1X5IA

The solution structure of the fourth fibronectin type iii domain of human neogenin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
126
structure length
126
Chain Sequence
GSSGSSGPATDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Neogenin
publication title The solution structure of the fourth fibronectin type III domain of human Neogenin
rcsb
source organism Homo sapiens
total genus 8
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1x5iA01
2QR0B 4HXBH 4WY7L 3SE4C 2R1YB 5F1IA 4LPWA 2Z9TA 5MHSD 5KBNC 2NY6B 1VFAB 5C0DA 2I25N 4YXKH 5EORL 4NHCH 1AC0A 3BYYA 2HN7A 5DD0L 5GS3A 5IKCA 4P4KD 2XZAL 2R23A 3MRMA 5IB3A 3RHWF 2E8ZA 4G8FA 4MXWH 3B2VH 3B5GA 1G9EA 2HG5B 3MV11 4GSDL 3RIFK 1FVEB 2EXYC 4A6YA 2DBJA 4D9RE 5DJ8B 1N2RB 1OB1A 5D2NB 5GISL 3TN0B 1DBKL 3H9HB 1BZ9A 3EYOB 1JPTL 4U2YA 4OZIF 5D1XB 4FZEH 5TH2A 3FT2A 4ZPVA 3WLBA 1D5XB 1T7XA 1URLA 2YR3A 3V52L 1W72H 3VFRA 4D9LH 4X7SL 1SY6L 5IEHB 2EDTA 4OZIB 3VMOA 3QA3A 5CKAA 2WP3O 4U3XA 1UJTA 5CJ5A 4LCCB 1IAIL 1QFWI 4M4RA 3WJJC 3N1QC 1FZKB 2VIRB 3FO9A 3CXDH 1EHXA 3I85A 1KCSL 3SDXE 3C60C 4WI9A 1ZT7A 3V6ZA 2W9EL 4NO2A 2ATPB 3HAEG 1J1PL 3OV6A 4NNPH 4N5ED 3QXDB 1BWWA 2XTJC 3S88H 4KQ4L 5BZDB 4HUXA 4X6DA 4WI7A 4YX2L 2X4QB 1DBBL 2B1HH 2ZPKH 4JEGB 3KXFD 4KKLC 2IMMA 1JHKL 3ULUF 1KENH 5C0CD 4IDJH 5FO8B 3QJHB 1S7TA 4QOKA 1T22A 1TVBA 2YSSB 1L6XA 2BVUA 5T33H 1T7VA 4OD3L 2R8SL 4OF8A 3FQNB 2IF7A 4WHYH 4OT1L 1ORSA 2BERA 1CE1H 1K3IA 5D72H 1XCQB 3MLYH 5D5ME 5ILTH 4X6BB 2CKBB 3CSBA 3ARQA 2AW2A 3OJVC 3CZFA 3FMGL 3WDHA 4CVZB 1A7OH 4NO3A 4RGND 4G6FD 3PJSA 4JN2A 3V5KA 4WU5A 4JM2D 4HMDA 2GYSA 5E6YA 4OIIL 1ZWIA 1INDL 1A7QL 5D70H 1HXYA 2PTVA 4GRMB 4NRYA 3CCHA 4U1IB 1P69B 2R39A 3FB7B 5CFHA 5I74C 2BHUA 1EBAA 3PGFL 2R2EA 3AROA 3DNKA 4LIQE 3SY0A 2NY1D 1W0WA 3BO8A 4XPTL 5FYJE 3U4BH 2HVKB 3FZUC 4FQ1L 2GSGB 3AS1A 1SHMA 2IADB 1I8KB 3E3QC 4MMXC 2ZUYA 2N1KA 2FH6A 4LVOB 1MI5A 5IVXF 2CO6B 1DANU 3ARGB 5LQBL 3MJ9L 3TBTB 3Q6FB 4P2RE 5DFVC 4X5XB 1KJ3H 1MCHA 3GSQB 5IVXB 1UZ6F 4G8GE 2NW2B 1NKOA 1BGXH 2D31B 2WWKT 1CFVL 4R2GD 2E6PA 3LRHA 1MCFA 5GHWH 4F57H 3LKNB 5BMFH 4XPHL 2P5EA 2G60H 3TJHD 2OL3L 4Y2DA 5DJYA 2ZUWA 3RU8L 4YBLB 1NGWB 3IXAA 1V05A 3HPLB 2FL5A 1OGTA 3ZMRA 1UACL 5IG7B 1HHGB 1Q72H 3D3VA 1AP2B 3ULVE 4AEHH 4HKBA 4K7PL 4JE4B 1RUML 2AEQH 3QCTL 2NXZB 2ADIB 1CD0A 1A3LH 3B9KA 3HAEB 5GRZA 2Y5TA 4P4RA 3SQBA 4GAJH 4FHBD 2YWYA 3ZDZE 2BSED 4JZJA 1P5UA 3S7GA 4X4XB 3GBMH 1RAMA 5A2KH 4J3VA 2PCPA 5KJRL 3SDDA 4BFEA 4ODTH 2P7TB 4ODUB 3TPKA 4CU8A 1FO0A 2NYYD 1NC2B 4XMLH 1DLFL 2XFXA 2J4WL 2FSEB 5C9JB 3VD3A 1EERB 4P3WA 3VG0L 1XH3A 3IF1B 2HLAA 3IFPA 3MXWH 3SDYL 1K4DB 1E6JH 1SBSH 3ARED 4BZ2L 4EN3C 5HGGS 4OI9A 2MCG1 3DYMA 3LQAC 4HIEB 5DMKA 5I66A 4NSKB 5C0AB 2JELL 2UWEA 5CWSB 4ZQKB 5D7LD 3V4UH 3KWWA 3K0WA 4KZDH 3BKMH 3Q48A 4KTDH 5GRJL 4ZNCD 1XF2B 3OSKA 3OZ9L 2HJKA 4OCXH 3WHE0 4KGJA 2C26A 3UZEA 3QUYD 4X8JA 1CS6A 3WFZA 1Z6JT 3B3IB 5FA4B 5ESAA 1F4HA 4MLIA 3IFNL 4XCFL 1A4KB 4RMSA 5HYQA 5FGRA 4MB4A 3Q3GB 1CWVA 4HIIA 5C0IA 3BPNC 5M95B 1QA9B 4JKLA 1X3DA 1ZXQA 3GMRA 5I1GL 2OS7A 1IZJA 3MRNB 5I1IL 1J1OH 2GIYA 2VDQH 1NUFA 3MLXL 2FATH 4OGAD 5EBMA 3NN8B 3MUJA 5F21B 1RK0A 3MBED 4YHNB 2ICWI 2XKNA 5F9WB 3I84A 4RA3A 2I5YL 4KRPD 5C8JB 4LLYB 5IHZB 2JCCF 1EA9C 2R0ZH 1R3IH 3L3JB 4RAVB 1ADQH 5I15L 4I9WD 3PWPA 1U42A 1C5DB 4H88H 1Q94A 4UOW1 1RU9L 3EYUH 4ONHB 4MA1C 1FG9C 2JCCB 1HKFA 2GK0A 1QO3B 5DHYA 3RWIA 5JQHC 3LQAL 4FQJH 2NY0D 4S11A 2H6PB 4I13B 5KVFL 2A6DB 2FEEL 1CK0L 1UENA 4PD4K 4WI6A 4XNYH 1GOGA 4EDXA 4F37F 1ITBB 1KTDA 1QOKA 1MWAL 5HGDA 5F9OH 1JGEA 4URTB 1HYSC 1RK1B 2G2RA 2VDRL 2OZ4H 3ARUA 4FMFA 2EE3A 3Q6GL 4LF3B 3VGDA 1EDQA 1EV2E 3FL7A 3M17B 2ENSA 4Y4HA 3RTQD 3U30C 3W9EB 1NBQA 2E7MA 2G75A 3GMOB 1OHQA 4LCIH 1JF5A 5SWQA 4MA3A 3L7FA 3T0EE 1X5LA 1LD9A 3OJDB 2C9AA 5TFSL 4UV7L 2F5BH 12E8L 1OM3H 1X5IA 1IAKA 5IMKB 1CDYA 3DSFH 5L2JB 2CK2A 4HGWA 3IDMB 4GW1B 3VFGL 3D5OF 1PG7L 3KHQA 4PRPD 2YPLA 4HCRL 2VQTA 4IRJC 3WKNA 2BDNL 1XIWA 5DC9B 3PQYE 3O3EA 1GOHA 2MJWA 1V7NH 4Y4KA 4N5EC 1MIEL 5KN5A 3W11D 5DRXA 1QR1A 1A14L 1NAKH 5E9DD 3PUCA 4M03A 1RMFH 2GAZA 5ICZB 1R5WA 4LQFL 4LSVH 4RX4A 5E00B 5HHQA 5EO1B 2DMKA 1IGTA 5E8NB 4L8SC 4LFHD 1F00I 5J3HD 2NLJA 3GM0A 1TDQA 1YNLL 5D1ZA 5IBUG 2V5TA 4I3GA 1IAOA 1KG0B 4FNLL 1MF2H 5HDBE 3GM8A 1V3MA 1X6LA 3BDXA 2P4AB 3NIGF 3C5SB 1YUHB 4HPOH 1Z5LA 1L9NA 5GGVH 5F7DB 3TO2B 1MHHB 3HNSH 4Q6IC 5CLWA 4M9OA 5CCKH 3LCYA 3MNVA 4KU1A 3CLEH 2M8XA 1NCUA 1TZHB 4WTZG 1NCWH 2CGRL 5L9DL 4I3RL 2YHGA 4WWKA 4FQXD 5DC0A 3GSNL 1NC4A 5BS0B 1QHOA 4YE4L 5AYQA 4Z0XA 4UT9H 3IETB 3UZQA 2X70B 2W60A 4W4NA 4JREC 2OLDA 4MA8H 5KSVA 3EOTH 1GGTA 3MSPA 4L9LA 3N85L 4WW1B 4NKMA 4ORGB 4DGVH 3QWOA 1OOAA 3EOBB 3O6KH 4P2QE 4YDJB 1S7VB 3MGTA 4KKAD 2APTA 3P4LA 4XNZB 5DXWA 4NQSA 3L5XL 5DLML 3WXVL 1GC1C 5E2VL 5K9OA 1KPRA 3ZKXC 1J87A 2X1QA 4Z7OE 4XP4H 1L7IH 1X5YA 3DRQB 4JFED 1MREH 4ELKA 3WXWH 1AXSA 4AQOA 5GGRY 1P2CA 1S8DA 1UM4H 1OSPL 1J05A 5I6XB 1HH6A 2BNRE 3IFOB 3ARFB 4PJDF 2CLRA 4TVPE 3QUMA 1FNGB 5LGHH 2OP4L 4XBEH 2Y6SD 3ME0A 1OLLA 3RIAK 1WK0A 5DVMA 3REVB 2F9BT 4PJDB 2AJSL 4YWGH 5IIEA 1DQML 1FAIL 4NZRL 4WRLA 4QRTA 4PY7B 5HDQL 1PX3A 1VFOA 2Q86B 4WW2C 4HC1H 3VI3F 1L9MA 2EDNA 3RWDB 2NX5E 2R0LH 3ZTJG 2IGFH 1IEAA 1FSKC 3VXRE 1NBZA 1G7HA 1Y6MR 4I2XA 4A2LA 3MV01 2I26N 5DD5H 2HRPH 1PQZB 3VWJD 2G9HB 4IMKC 4R0LA 4GW5B 1JGVH 3DHMA 3I6LE 2D0FA 2BC4B 3EO0A 3BZDA 1NDMA 4D0DB 3UDWA 1N6QL 4PJ8A 3J7HA 5LBSH 2AEPL 4Y89A 1KCLA 3QXUA 4QKXB 2FJFB 3G5ZA 4NZTH 4DFHA 1V7MH 2HAZA 1GC1L 4PB0L 2XZCL 4L3EB 3MFFA 3L9RB 4DGYH 3EJYC 1YMMA 4NQUA 2VERN 4XHQA 1PLGH 5EBWB 3RWGB 5I1AA 5F7FA 1AKJD 2ARWA 2AK4D 1A02N 2MTPA 3LEXB 2FJGB 3AREC 4NN6B 5JUEL 5BXFB 3F58L 3WIIH 2DKSA 4WENB 3TIDB 5T3XL 1QRKA 1U8IB 2O61B 1LNUA 3PV6A 3QIUA 4NCC2 3QIBC 1B2WL 2PYED 4PGBB 1MCLA 1YEDB 5C0BB 3BKYH 4Q2ZA 4TNVF 1B90A 3O2VH 1U8QA 3GSUA 3U1SL 3IDYB 4TUOB 1MFCL 4AEFA 3TNMA 2AABL 2FHCA 2VAAA 3UP1A 2R1XB 1WAAF 1F6LL 4JZNB 3A6BL 4OSUH 3P4NB 3QEHB 3HR5B 2A38A 4ZFOA 5C07B 3WN5C 4YHPA 1R5VA 3RVUD 3MBXL 4JO1L 4QRSB 4YC2B 2D7TL 2VWEC 3I3DA 1EAJA 1INQB 1ZGLM 3MO1B 1QRNA 3M1BA 1QFPA 1RVFH 2ICEB 2NNAA 4OTXL 3WCYA 4DKAA 2QL1A 4KRPC 1L7TH 1R3LB 4LLVB 5C2UB 2AJVL 5DDHA 2K1MA 4NQDB 4UQ3B 4YNYA 4M7LH 2OSLB 4PGCB 5FYKL 4OGXH 5EIIA 2XACC 3IKKA 1WISA 1E28A 3JSSA 1HK6A 2X9XA 4CDHA 4X98A 3RZCA 3NCMA 3LD8C 4P3CH 3I6KB 3O6ML 4P5TD 4PUBL 1G6RB 4OCNC 1EPFA 5TE6H 1G7MB 1JNNL 3V0VA 2NY0C 3PWLB 4P46A 1FGVL 2X1PA 4OCMC 3LEVL 5ANMA 4P2YA 1EEYB 1W0VB 1TJHH 5F7HA 35C8H 1FP5A 5ADOH 3GI8H 2EYSA 4LLDA 5D7LE 1AGDB 3TZVC 2DQUL 1JYVA 3FO1A 4PV9B 4JFFB 2A74A 2EEBA 2XZZA 5EUOF 3RTQC 3U9UA 4R96A 1J1XH 3V2AR 3QEQA 4ZFZB 3JV6A 1T2QL 4K23L 5L2KB 5D96B 3U48A 1BVKB 4N8CH 5EUOB 4JQIH 4XCYB 3EKCA 3SGJA 1XF3A 3ZL4L 1IBGL 1AI1L 2AJXL 3DI3B 2Z31A 4HDIA 5LGJA 4OF7A 1CT8B 3B43A 4WV1B 1JL8A 4GS7B 3C8KB 3F5WA 5KW9L 3HMXA 4UMGA 2DM2A 4GBXA 4LRIA 4P23B 3FB5A 4KK6C 5L8JB 3N1FC 2UZIH 4S2SB 3CNKA 5JW5B 2H32A 4OFYD 1JF6A 4UNVA 2CIIB 3W11C 1J88A 1JK8A 2KDGA 1K2DA 1B4JH 1OAUL 2BOCB 5DJ2A 4BH8A 1NLBH 4I0PD 3GRWL 4L8DB 4MZ3A 8CGTA 3GSRB 4NCC1 3QJFB 5EZOL 4N0YL 5F1OB 4P9MH 2GW5A 4X0KA 1WBZA 4LDLB 4Y4FB 4NNYA 4M9PA 3PDOB 3C2AH 4NWUH 1EK3A 1GH7A 4QXTB 4B50A 1RJLB 2EXWD 5J3HC 3TNNA 3N0PB 4JKPH 4XBGB 4YPGB 3I9GL 2CIKB 4MMZC 3ARZA 4LCUA 3D39D 3OR6B 4N9GA 2P5WB 4MNQE 4OCLC 4P2OC 5F3BA 1Y6KR 1OCWH 5I1EL 5TQ0H 1G7IB 4KI5C 2OYPA 3VXUB 4HXBL 4OD2B 3Q1SH 2FX9H 1IKFH 4PJCF 2ID5A 4OLXH 3GBNH 3BZFA 1NCTA 4Y5YC 1TJGH 1OP9A 2DIAA 2IEPA 4UBDC 5F3HA 4YXKL 4PJCB 4NHCL 4OI8A 4AIZA 4CMHB 4KI1A 3EDDA 4AJ0A 4G43B 3ZDXF 1T3FB 4NGHL 3HHRB 1YPZF 1U3JA 2YK1H 3PF2A 5D7IE 2NZ9D 3GJFK 4P57A 3L6FB 2PW2A 5E6ID 5EO9A 4S1DD 2F74B 3PWUB 4F58H 4N8VB 1WZMA 4MXWL 3B2VL 3O4OB 5F9AC 3VXMA 1XF5B 2VISA 4H1LA 3O9WA 3MOBH 1CFQB 4PJFF 2VL4A 1YPZB 1KCVH 1CXLA 4M93C 4NRZB 4RGMB 4D2NA 4LKXA 1T0MA 3UPCA 3MV8E 3GSXA 4KKAC 3MV7B 4GMSH 4LSRH 1II4E 4PJFB 5B39B 4KKCC 4FZEL 3FCTB 1CE6B 1MFNA 5IW1A 2ZSWB 4TSBL 2PO6D 3AMLA 4D9LL 4NQCB 2XRAL 3EYSH 1M71B 2JJVA 3PHSA 2VDOL 5HYJA 2DB8A 1FZJA 5EPMA 3G9VA 2DLHA 3GSOB 3V6OC 2GCYA 3MLUH 3HUJF 2ZSVA 2ZWLT 3QULA 3QDJA 2XYCA 3C5ZC 4LLMA 3HUJB 5DEFA 2PF6A 2Y6SC 4Y5VC 4HKZB 4U6XB 5C0FB 2W0LA 1A6TA 5HHOB 5DHVA 5DMYA 1DEEA 4UUJB 4HGKC 3S88L 4LNRA 3G04B 3T2QA 3EHBD 1FNFA 5FYLH 4NQDE 2B1HL 2ZPKL 1U3HC 4TQEH 3UBXG 2ITCB 3PL6A 4M1CC 3W9DA 1QEWA 1U3ZA 3BP5B 4QLRA 1KENL 4IDJL 5DUPL 4OZGE 4MAUL 1DZBA 5C7XH 3LKPB 4YHOH 4NSKA 4U1KB 5JXEC 3VWJC 3DJ9A 5T33L 3GDBA 5ENWB 1K8IA 2X4SA 3SPVB 8FABB 2VZ3A 1FHGA 2Q7YB 3S97C 4Z78A 1HSBB 4WNQB 5KTEL 5D72L 5MENE 4M48H 5GGRA 3I50H 5ILTL 2ATKA 4Q9RL 3ABZA 4O2EA 2P1YA 4NDMB 5F72S 3K2UH 5I71C 1NEZA 4I0CC 1ODAA 2AJZB 2IQ9H 1CXFA 1DN2A 1A7OL 3QIWA 5ITFA 5I1DB 3PHOB 2CXGA 3KDMB 5E08H 2HKFH 2EEAA 3MRLB 2YD6A 4GW4B 4R6UA 4R7DA 2DWEA 3D85A 1A6UH 4PIRF 4ALAH 1HQ4A 1QA9A 3VI4E 5D70L 1EX0A 4LLQA 5AG8A 3RWCB 5ECJE 1L0YA 4QTIH 1DUYB 2X7LA 5BVPL 3RWJA 2X1OA 2WUCH 5I73C 3U4BL 4K8RD 1MY5A 2VLJB 2QV2A 4WFFD 1MHPL 3QHZH 3OHXB 3BUYA 3FOMB 1EGJA 4BFIB 1MCWM 2YBRB 1A1NA 3TBYB 1KJ3L 5LAXA 1RUAH 5IW3A 1LILA 4Y2OA 1GL4B 3H3KA 5H35B 1BGXL 4X99B 4H8WH 1PVHA 4M8QA 5FFLA 3CLFL 2EDWA 4QOKD 4HS6B 3DX8B 3BWUC 5K93A 1NAMB 3RVUC 5DO2D 5GHWL 1U8OA 2ZOLA 4F57L 3I75B 3IDGB 2VABA 2X05A 5FO7A 5BMFL 2DD8L 4CADA 1GVIA 4K94H 2G60L 1MVFA 1FN4B 2C1OB 2DF3A 3OPZH 4FXLA 4JFYA 4XB7A 1LMKA 5F7MC 1BFTA 5FF6A 1CD8A 3V5HB 4EJ1C 1CFSA 1Q72L 3QZWA 5BJTB 4BK4A 4XXDA 1ZHKB 3BN9C 4AEHL 1YQVH 4LK4A 2AEQL 4P5TC 4WHTB 2X9WA 5SWSB 1A3LL 3OAZH 4PGEA 4GAJL 3LN4A 2DYPA 1OVZA 4PTUA 3H6JA 5TDNA 3T1FA 4JR9H 3UTOA 3ILQD 3QUMH 4R4BB 4F9PA 5C3LD 5GS0H 1RJCA 1MCOL 3D2UA 4JZOA 5HVWA 2HLFD 4ODTL 1HEZA 2OMNA 2XA3A 4XMLL 3QEUB 2YD9A 5ID1A 3DX9B 4JG0H 4QHKJ 5A2LH 4MDJB 2Q87A 4N1HB 2HJFB 4XRCA 4GXVL 3TPUA 2AJYH 1MI5D 3MXWL 3RDTA 3RVWD 4ODSL 3ZKSD 5HJ3B 4OLWH 1KTRL 3MLSH 32C2A 2HT3D 2QHLA 4X6CA 1AY1H 3UPAA 5E8PB 4G9FB 5B8CB 1C7TA 2H8PB 3QXTA 2GY5A 4QWWD 2DQDH 3C60B 4QRRB 3V4UL 3CVHB 1UH2A 4KZDL 4DUVA 3KYNB 4EUPA 3BKML 5GS2D 3EZJB 4KTDL 4LLAA 1G84A 3CU1A 4H26A 4PP2A 3B8YA 1X6NA 2P5ED 4ONOA 1KPVB 3FAXA 4Y2DD 3F7YB 2WBJA 3CK0H 3FN3A 3N1MC 4XNMB 3NIDE 5T1LB 1A22B 5IJKC 5EA0L 4ETYA 5HYSG 4QRPB 2D9CA 3W82A 1KXQE 4LSUH 2FB4L 3IVKA 3UAJD 5FECB 1M4KA 4O51B 5CEYB 5IW6A 4JGUA 3WSQH 2EXWC 3C09C 3CMOL 1I9IH 1MHEA 5C0GA 3B9KD 1PAMA 1BMGA 2F54B 4YDJA 3H9SE 2SEBB 4Z7WA 5HHXL 3X13B 5KVEL 1JMXA 4JO3H 4XTRD 3TH4T 4XPGH 4KKNA 4Z7VE 3D25A 1XR8B 2IQAA 3SDDD 1HDMA 1R3IL 1BIIB 1ADQL 3KYMA 2VLME 2IH3B 1KXVC 2OJEA 2R1WA 4U1HB 4G5ZH 4QRUA 3TVMC 1JZ3A 1M7IB 1P4LA 3EYFA 3EYUL 4Z7NE 4KHTL 5KOVC 3FFDA 3O11B 5DJDB 3QNYA 4LHQB 4FQJL 1OGAA 2CQVA 3KPQB 2HKHH 4PJ5E 5CD3A 1SEBB 3VGEA 5I74B 2H9GA 4HKJA 5E6IC 4S1DC 3BIKA 4MHHG 3RNQB 1NBVL 3TC9A 1N8ZA 1CZ8H 2BVPA 4N0UE 5F9OL 1C8PA 1WCBA 4JRXE 3MCLL 2OZ4L 1D9KC 2EE6A 4QHMB 3STLA 2N7AA 1H8OA 5T1KB 3WS6C 5FM4A 4XZUA 1GGCH 2PO6C 3Q2CA 4PRAA 3GHBH 3IFLH 3P2TA 4M62H 4LCIL 2P43B 1LE5A 5CZVH 3BP6B 4RFOL 2IC2A 1FZMA 3ZKMC 5JMOC 4PRBB 4U05A 1N7MH 1IE5A 4PRDB 2OX5A 1OM3L 1T6WA 7FABL 1BD2B 5B38A 1BOGA 3DSFL 1FYHB 4YK4B 3EDEA 5C0NC 1H5BC 3N1PC 5FGCE 1CICC 3G6JF 4TUKH 3MA9L 5CJQH 4QY8A 1OP3K 5HVFB 1F6FB 2D7MA 3K8MA 4M3JA 1NBYA 2KZWA 1IARB 1JGLL 1EEZB 4WDIB 3G6JB 1V7NL 1JN6A 3BISA 4LP5A 5CIPA 4LRNH 3ELAT 1GZQA 4YZFF 3L9RA 4ZAKB 2F19H 3ZDYE 2IWGA 2W9DH 1NAKL 3RL2A 1F42A 3O2WH 3KAAA 3PWPD 4HUNB 1IC5L 4ZNEA 1WT5A 4TUJA 2OTWA 1QFHA 2NY3D 5DWUH 5BZWB 3MUGB 3TFKC 3OXSA 5DJXA 1SYVA 2HH0H 1KJ2A 3OR7B 3O6LH 1MCJA 4RZCB 4K9EH 2XXMB 3HS0A 1MF2L 3SBWA 1DQDH 3OAUH 1U8JA 4UDUB 3ULUH 2XN9A 5IFJA 5JQ6L 1I85A 4PJEF 2C3GA 4AH2A 4HPOL 3IJYA 4Y1AA 3GIVA 3I6GB 3MODH 3P4MA 1CG9A 4E9LA 3HNSL 2CKBH 1W0YT 4J8RB 3DXAA 1YN7A 3QUZB 5DJ6B 4PJEB 3CLEL 3PIQA 4GLRI 1NCWL 2BVOA 2ITDB 3CFBB 4HT1L 1CU4H 3IDIB 3LKOA 4Y4HD 4EN3B 2CDEB 3ETBF 2OI9C 1G1YA 4O58H 3T8XA 4LVHC 4UT9L 1AGCA 1NH6A 4J6RH 4PY8J 3KPPA 1BFOB 2BY2A 4MA8L 3EOTL 3AVEA 4MJ5A 4PGZA 4L3AA 1U6AL 1KIPB 3FFCB 1OAKL 4OKDA 5B3JE 4IOFC 1ZGLP 3SGDI 2VDKH 4DGVL 3VFMB 3O6KL 1UZ8B 5I8OL 2YPLD 1LQSR 4M6NH 4PJAF 5EFIB 3NFNB 4P9HH 1XIWD 4O2FA 3GMQB 5HYFA 2XTJE 5MERB 3P77B 4LSTH 4PGCA 4Y4KD 5DUMH 4GAYB 4LSQH 4NQEB 4XP4L 4BJLA 1HWHB 4PJAB 5GRYA 3UTTE 1MREL 5ERWA 3KPRB 5IK3B 3WXWL 4OZ4A 5J11C 1UM4L 4DQOH 3P9MB 3UEZA 4HAGA 1PJ9A 3IJHA 4RX4D 4V1DE 1MCRA 3S35X 3ZKND 1AXIB 3KPNB 4ZG1A 5C09A 1FFPA 1J8HA 1J18A 2VQUA 3AB0C 1XGQA 4MWFB 5D1ZD 4CJ0A 2D7OA 2H1PH 4XBEL 3SGEI 2BNUB 5IB5A 3H7BB 3QCUL 3BIBX 5TF0A 3L5WB 2ZOKA 4YWGL 1ZAGA 2OJZH 1NFDF 3ORJA 2J5LC 3VFTA 4HC1L 3LSOA 1N6VA 2GKIA 3ROLA 3BDYH 2R0LL 3T2PA 2A73B 4MJIA 1FFQA 1NFDB 4P4KB 2VUYA 1KLUA 4NQXA 2WK2A 3V7MA 1KB9K 1RIVL 3ALPA 3MRPB 4WWKD 1Q9OA 5DD5L 4XNQB 1D6EA 1NC4D 2VZ1A 3C2SA 1H3VA 1NGYA 2HRPL 2Z4QA 4XPFL 4NPYA 1JGVL 2NW3B 3CX5K 2QKIB 5IF0B 4P49A 3BPOC 5E6ZA 3F7RA 4F7CB 1CT8A 4F2MA 4M61B 4NOFA 4JB9H 4QCIA 4H25B 1MHCB 3VGGA 1W8OA 1OARH 2HLFC 3E3QE 4EVNA 1F6AB 4F15C 2R2BB 3U30B 2AAVA 4FQPA 4JQVC 2WV3A 3DBXB 3MJ8A 4DGYL 3HZKB 5T3ZD 5D7KD 4H0GA 1PLGL 4NN7B 4DK3A 3N9GH 5F8RC 2EO9A 4GMTL 5ALBH 1BF8A 4FFVC 1KGCE 1A7RH 2A6IA 4L8CB 5EU6E 4QXTA 2V7NA 3RPIA 2HT3C 1U41A 2CRMA 1FPTH 2CKNA 5EC1A 3VFNB 4Z77B 5AG9A 2YD2A 3GKWL 5FDWA 4L1HA 4JPWH 5CP7B 5F7LB 5DEGA 3LB6D 5FV1L 2C3VB 3EUUA 2JB5H 2X44D 2V2XB 1XGPB 1A9BB 1EO8L 4R8WH 4Z7UE 3O2VL 5IQ7H 1RV6X 4D8PB 3DV6A 1CDJA 1JGUH 2P8PB 3KXFB 1RZ8A 3BESR 3ROOA 1KELH 5K59E 4GG8A 5JW4R 1WZ1H 4YO0B 5C0CB 4L8SB 4PJ7A 1EO5A 4OSUL 4PRNB 1GOFA 1QBMH 3UAJC 4GRLC 4Z6AT 1ZHNB 4TTGA 3LZFH 4JN1H 4UU9A 3QCVL 1LK3H 1IVLA 3QDME 5KSUA 1X7QA 4OV6F 1DJSA 1P9MA 2GUOA 2VO5A 5DUBB 1RVFL 3RI5F 1I9JH 4WI2A 1ZGLA 4JM2F 1E4XI 3PG2A 1XGRA 4PJ8D 5I75B 1RHFA 2NY7H 1JZ7A 3OGCB 4XTRC 1L7TL 5I8EB 4E41A 4RGNB 1G0DA 4G6FB 3LH2H 1TLKA 1RURH 4D0CB 1X5HA 5BQ7B 4BQBA 2W65B 4HJGB 4YAQA 4PJ9A 5TDPB 1YMMD 4WGWB 4JREB 3X12A 4HUMB 4P3CL 3WIFB 2VNCA 3BP7B 1XGTB 5TE6L 4C56E 5JHDA 2GEEA 3MNWA 5FHBH 1JWSB 2C1PA 3JTTA 4JDZA 1UB6B 1BQLH 2NY1B 1PZ5A 4ELME 5DQJA 3BQUD 1F58H 3P9LB 5ISZA 35C8L 3HLAB 4OI7A 1YA5A 1ULVA 1S7WB 3BD5A 3GI8L 4MDIB 5ADOL 3MCG1 1C16B 3QIUD 1WWCA 5I1CH 1F13A 1ZHBA 5DA0B 3R06A 3GB7A 4YHIB 3TJEH 2Y25A 4RRPG 5T5NG 1Q38A 3BN3B 1AIFA 3ILPA 1GIGH 4JDVB 3TWCH 1J1XL 5F89A 5A3ID 2BNQA 4FXGB 4IDLA 4R2GB 4R4ND 1UKQA 4GKNA 1BZQK 4WUUE 4JQIL 3VCLA 1UXWA 1O5DT 3CFKB 4WW2F 5A16B 2Z93A 3IYLW 5EZLB 5GGQH 4DWHA 3PWJA 3CDCA 3OB0K 4L4JA 3W39A 1QRND 5EC2A 1YEKH 5HHVH 1P6AB 4XC3H 4WW2B 1QSEB 5DJCA 1CLOH 5IT2H 1HHIA 1FSKB 1I1FA 1B4JL 4HZAA 3SQOH 1PZUB 1X5AA 1D5MB 5GSVB 4HWUA 3L3OA 3QBTB 1Q9LA 4LARL 4MNGE 4P9ML 1DDHA 3K7UA 2NY3C 3MOAH 3C2AL 2C4FU 3RZCD 6FABH 1WIUA 3GBLA 4JKPL 2XNAB 3T4AA 1FNEB 4PRIE 4P46D 4HWEH 1UWGH 3FQRA 4S0SD 1OCWL 5TQ0L 2V9QA 3Q1SL 2FX9L 1IKFL 5LJYH 2EH8H 5FB8B 1F11A 5SX5H 4F80A 4OLXL 3GBNL 1TJGL 3ALXA 5JTWA 3UJJH 4L3CB 5ACZB 1UG9A 4Z9KB 3AREB 3B6SA 2DS4A 5F7WC 3QEQD 3HC3L 4P5MB 3S5LB 1D5BB 3SDXA 4QO1A 3VXTB 4NWTL 2YK1L 1RZGB 3L5IA 5ID0A 1FLTX 4QHUA 3CSGA 3N50A 4AYFA 2FWOA 4F7EA 4F58L 5IEKB 3DO7B 3QIBB 3MOBL 4W6XB 5I1LA 3SJVE 1I8LA 1JP5A 2NCMA 4UTBH 2Z31D 4NRXA 5ADPL 4HS3A 5IBLC 4X80H 4GMSL 5FM5O 3QUYB 4LSRL 2PTTA 4GBXD 1XIWC 5FCSH 5J6GA 5L6YH 3CPLB 2XPGB 4Y4KC 3BJLA 3EYSL 1RZIA 3LN5B 1CD9B 1YNTA 2BRQA 3SCMA 3WN5B 1MH5A 1ONQA 3GMNA 2IJ0C 3AUVA 4QXGH 3SE3A 1CL7H 5D5MA 3MLUL 5CEXA 5JO5A 5DS8A 3ZKNC 2QSCH 2GY7B 2IALA 1ZA3A 3FQUA 1K4CA 1NPUA 3MBEB 3LN9A 5HGBB 3HRZA 2VZUA 3RWFA 3EOAB 1F2XK 2DQGH 5D1ZC 1HH9B 4UZGA 4ORZC 1T89A 4KRPB 2VE6A 2UUDK 2X4UA 4PJXE 1A0QH 3EGSB 4WHYG 2EIDA 4ESKA 4YDVA 3TBSB 3P4OB 5SX4H 3BW9B 5CBAA 4PGJA 5FYLL 4C57C 2EZ0D 3WHE1 4XCNA 4TQEL 3TO4A 2FLBT 3MV9E 1XEDA 1NGPH 2NY0B 3VXPA 3CFDA 4WWKC 3MACL 4NC0B 4XXCA 2HP4A 3HMWH 4CGTA 5C7XL 4H8WC 4YHOL 4LCYA 1KPUB 4PB9H 4WO4C 4O2CB 1NFKA 1CFNB 3S96A 3VGAC 2XQBH 4XMPH 3DX6B 5K9JL 4M48L 3VXMD 2B1AH 3GEWB 4P2RA 1JF1B 4K94C 4LCWB 3MXVH 3K2UL 1Y0LB 4G8GA 3RTQB 2IQ9L 3RWHB 3RWEB 1LWRA 3BKCH 4F3FB 4IS6B 4S1RL 1I1RA 5E08L 3NZ8A 4NUGH 2HKFL 5GIRB 4NQTA 4ODWB 4HH9A 3O6FA 4XWGH 4ALAL 5HYJD 2VLLA 1A6UL 3GO1H 1J0JA 3TIEB 2NXYD 3U0PA 4XT1C 4GG6F 1QUNA 3ULSB 2AXFB 1XGUA 1IL1A 4QNPF 5FKAB 4PRPB 5T5FH 4Z7QE 1LO2L 1M05A 1A1OB 3CC5B 4QTIL 1Y6NR 3QDJD 5T3XE 1KJ2H 1LVEA 3JV0A 4Z8FH 2WUCL 2WQ8A 4GG6B 2P42B 3KPOB 3UXFA 2CJUL 5E9DB 3NIFF 4NZDA 3EFFB 3VFSA 3QHZL 1QSEE 3G6AA 1W72B 1I7UA 3BEVA 3OKEA 4CDGC 5DURD 1HILA 4U1LA 2J8UE 1RJZA 1B0GA 3BE1H 1EFXA 2EIZA 4MCZA 3UPRB 3VFOA 3QHFH 1MFAH 3B9VA 4U6VH 3PL6D 2GTZB 1IM3A 4ZYKB 3MNZA 3VGHA 3S36X 4MB5A 5DK0B 4Y19B 3E6HB 1P84K 1T66C 4RAUA 5JW3L 1E6OH 4R0LC 3ZE2F 5A2JH 1J5OL 3OWEA 1GCFA 4JFQA 1KNOB 2W91A 1HSAB 4X5WA 1AR2A 4K94L 3RGVC 4PJ8C 4EEEA 3OPZL 1P1ZA 2JJTC 3FQXB 2WUBL 3QI9A 5E8EA 3FOLB 1W8NA 3VXQB 2UZXB 1FBIH 5FYKE 4LLUB 4FQXB 1EO7A 3P0YH 3QIWD 5HGHB 2D7QA 1GHFH 5HPMB 4HZLB 4POZD 4WFEE 1UEMA 3Q5OA 4BA8A 1CD1A 2PW1A 3D85D 4JPIA 3U6RB 3VRLF 1MJUH 2I9LB 5D2LF 1LEIA 4U6YA 1LE9B 2P47B 4XP6H 1E27A 2XKSA 4JR9L 3CFJA 1G6VK 4DEPC 5GS0L 1JHLH 3D9AH 3FRPG 4YFDB 2V2TA 4H0HB 5D2LB 3PE9A 4DZBA 1UXSB 4OD1H 4PJHF 1ES0A 3KYAA 1BBDH 5JW4M 4DW2H 4L4TE 4JFEB 5MEOB 3GKZA 2AJYL 4JJ5A 1FL5A 3U0TB 4PJHB 3WNLA 4MD4A 2HVJA 4OLWL 5C71A 1OAXH 4G6MH 5H2BA 3MLSL 3F12B 4R4NC 1AY1L 3MRQA 2XWBA 1NGZB 1E4WH 2E9IA 5FYKU 4ZTPH 1UWXH 2DQDL 2VWEE 1JGDB 3QUKA 4M4PA 1U8HA 4NJ9H 4Y5VB 1AO7E 3QNXA 1DBJH 1T04A 3S37X 2CRYA 4JFOB 3TN0C 1H15B 4M7ZC 3UTPD 4RA0C 3CK0L 4P2CG 2R4RH 4G42B 5E1AB 4OQTL 1TIUA 2B2XH 1IGYA 5SWZE 3BEWB 1N59A 3T0XA 4G8IB 3QNZB 5I8KH 1NCCH 3JTSA 3O8XA 1H0DB 3VD7A 4LSUL 4KFZC 5D6CA 1VADB 4YFLI 3VWJB 2FO1A 3IXTA 2IH1A 3RZCC 4HIHA 1DN0B 3JV4A 3WSQL 2NTSP 2BSRB 1BWMA 1QSZA 1I9IL 4LCCC 2D4FA 1ZA6A 1M6OA 2Y06H 1NMAL 4I18A 3S34H 5KS9F 3MMEB 1G1CA 4RBPH 3WD5H 1GGYA 3MGOA 5I71B 2DYPD 5E95B 3T0EA 1AD9B 4XPGL 3D2UD 1IAIM 1I1YB 5JA8B 1IQDB 5KS9B 5DQ9A 3RZWA 1AKJB 4G5ZL 2AK4B 4QHNA 2A1WH 1MNUH 4KJYA 4LVNC 2Q8AH 3VRJA 2AJ3B 1UVQB 1AXTH 3RDTD 4NOBA 3RFZC 1B6UA 3WO3B 3TEUA 1A6ZB 1KC5H 2HKHL 3PQYA 2QEJA 3KPSE 4BKLB 3DMMA 5IESH 1GGBH 4NJAH 2XXCB 1ZOXA 3CH1A 4OLZL 4I3SH 5F96H 4ZUVB 1S9KC 5BVJA 4W81A 4TULH 4ETQA 1CIDA 4NUJB 5I73B 3H7LA 4K9EC 2IPKB 3DPBA 2PYEB 3GGWA 5IOPA 1HXMB 3ZYIA 3ULUC 3HE7A 1CZ8L 2Z31C 1JV5A 3B83A 4QXWA 4X7TB 2DL2A 2A83A 5TDOB 5CBEA 1HHJA 1EIBA 4GBXC 2J8OA 3HNTH 5AZEH 4PJIF 4PJBF 1N0XL 5KAQG 1GGCL 2NQCA 2B4CH 2WBJD 4PY8I 3ARDA 1FVCB 3GHBL 3IFLL 3K74B 4M62L 4CMMB 4XP9H 3MLTA 3DVNB 3SKJH 5CZVL 5C3TA 4PJIB 3JVGA 4PJBB 4JJHA 2X41A 2CDGA 4U1JA 1TZIA 4OZHE 5EH1A 1QQDB 4G8EA 1QZ1A 5T1MA 4AT6A 3OGOE 3KG5A 1NSNH 4Y19E 5CJQL 1D5ZB 1MEXH 1MRCH 2GJ6E 3B5HA 1Q8MA 4H25A 3WV0A 5KSAA 4MQXD 2ZUQC 5J1AB 5I0ZA 3H3PH 4D9QE 1S9WA 1QFWM 2DKUA 2DLIA 2DQEH 5EU4B 3P0VL 5FDYA 5ICYA 5L0QB 4LRNL 1QNZL 2F19L 1SYSB 5D9SB 3O2WL 2VMFA 1ZEAH 2EZ0C 4ZFFA 1JPFA 4XCCH 1A7NH 2LTQC 3NPSC 4P5TB 1AGFB 4P2QA 5IFHH 5DWUL 5ITBH 5HY9A 3LY6A 3EO1B 4ZOEA 2HH0L 4OB5H 3GMLA 1OGAD 3WUWB 1QKZL 4K9EL 1F3RB 3O4LE 1OD9A 5HHPA 1DQDL 4YDKH 4C59B 3OAUL 2F58L 3L3HA 4JY6A 2DM4A 3ULUL 5DHXB 3O9WC 1PKQB 4MSWA 1CFTB 3MODL 4X6EA 2JKXA 1I3UA 3DUUA 4I5BB 3MRJA 2CKBL 2VXQH 5TF1H 5I76B 4JDTH 1IFHH 3IDNA 2FJHA 1CDIA 1FIGH 2BNRA 2C3WA 5D1QA 1CU4L 4EI5A 1P7QD 3KLHD 4KRNA 3UJTH 1I8MB 5HHNA 1R3KB 3L3GA 3VMPA 2NXYC 3LS4H 4J6RL 1FFOA 1OAZL 2NXZC 5EO0B 2YUZA 2JJSC 3X11B 4MX7A 1ZLUH 4YHYB 2VXTH 1U8MA 2NX5A 2EE9A 1WTLA 1DBMH 2A0LD 3VXRA 1UWEH 5C6WH 4M6NL 3TT1L 3QG6B 2CUMA 4P9HL 4KJQD 1ACZA 4I0PB 1FL3A 5FUZH 3HZYA 1N3NB 4EI6B 3MQIA 4LSTL 5DUML 3ZKQD 4Q7DA 3D87B 4JM2A 1FG2B 1BM3H 1A5FH 5TDPA 2DLTA 2MQCA 2KQMA 5EIQA 4GKOA 3RNKA 3C09B 1ZS8A 5IR1A 3PL6C 3FB8B 3LRGA 4FQQA 3DUSB 3D39B 5ICXB 4R7NA 1TCRA 2CLVB 1WBXA 1NAMH 1TNNA 5ETUB 2H1PL 5F9JA 4P5KB 4BUGA 3LDBC 2OJZL 2XN9D 4MQ7A 1Q9WA 4PLJC 4Y1AD 2GK2A 2V5MA 3E0GA 4GO6B 4HKXA 3EDKA 3CUPB 3QFDA 3H0TA 4F7PA 3GJEB 3DXAD 4YDIL 5I2IB 1IGJA 4TYUA 3V5DB 2YC1A 4ENEC 2GFBB 5GGUB 3FO0L 4NBXB 4O5LH 5J06A 3QDAA 5E6IB 2BY1A 1IJ9A 1CGTA 5CILH 1JPGA 4HX1B 2OCFD 5FO9A 3NFSL 1A6AA 4NQVB 3BH9A 3GMMB 3WFEL 4JB9L 3CXHJ 3RAJH 4JANB 4HEME 3QQ4A 4N68A 2Z92A 4H5SA 3BOVA 5CGMA 1OARL 3G08B 2IMNA 4HK0B 2AKRB 2PO6B 1BZ7A 3D6GA 5CHNB 2P8LA 2VLKD 3R1GH 5EU5A 4FABL 5DZNA 3ZT7A 3P30H 2E6JA 3T4YB 5ALBL 1R3HB 2ADJB 1A7RL 2FBJH 5HHMD 3OKMA 4LEXH 4XNXH 1FPTL 2EDQA 3G5VB 2IFFH 3LKSB 4UINL 4XVTL 3CDYA 4KQ3H 1QPPA 3DROA 4JPWL 5D4QA 5C70A 5C09D 3RY4A 5EOCH 5A43C 1J8HD 4DOHE 3CVHH 1T1YA 4KTEH 4ZMAT 1A4JA 1MCPH 2JB5L 4AEIH 1JNLH 1G7LA 4MCYA 1SMAA 4TSAH 1H3WM 4ZSOE 5F1IB 2VXSH 4R8WL 5IQ7L 5C6TH 4C55A 3LEYH 1JGUL 2AV7A 3TV3L 5EOCJ 3D69A 5DMGD 1KELL 4AK1A 5C0DB 1OTUC 1QD0A 2HN7B 1B9ZA 3X3FH 4MJID 5IKCB 1FC2D 1QBML 2R23B 3MRMB 5IB3B 3WFHA 5D7LA 3LZFL 4LVEA 4G8FB 3EFDL 2R29H 3PNWA 2OR8A 5F1NA 4U6TA 2ZCLH 2UY6A 4MGXA 4A6YB 1KEGL 1I9JL 4CU6A 1OB1B 3SKNA 2IAND 3QUYA 2NY7L 1BZ9B 4F9PC 1KT2A 2J8HA 4G3YH 5TH2B 3FT2B 4ZPVB 3WLBB 1RURL 2MCPH 3VFRB 1BQHG 2LU4A 4KRMB 4FQCH 2FBOJ 3QRGH 3DIFA 3MR9A 4UOJA 1IILE 3QA3B 1NFIA 4TVSa 5FHBL 5M94B 4LQ1A 1JYNA 1CXIA 5A40E 1BQLL 4LPYA 3FO9B 1F58L 3DRTA 3BGFB 5CEZD 4MJ2A 1AJ7H 1NLDH 3FT3A 4X6DF 4IOIA 1ZT7B 3V6ZB 4NO2B 1KF9B 4M7JH 5I1CL 2HMID 1AHWA 5IVZA 4FQ2L 1BREA 3ZE1E 1JRHI 1QSFE 4RSVA 3TJEL 4WCYL 5EZJA 3UTSE 1JHTA 3BZ4A 4HUXB 4X6DB 2WBJC 3TWCL 1RIHL 1CDUA 4OM1L 4MNQA 3DGCR 1PBYA 5BW7A 1TTFA 3DYOA 2KBGA 4PRHE 1O7VA 2VR5A 3VGFA 1S7TB 4GRWF 1T22B 4QOKB 1S9XA 3GNMH 4WI4A 1TVBB 3WHXA 1G7PA 3AB0B 1J12A 1HCFX 2R2CA 2X4PA 1ORSB 3PWNB 1MJ7H 4GRWB 2FIKA 2X09A 2F53E 3OKNA 4MXVF 3IRZA 3W0WE 1YEKL 2J5LB 5HHVL 4XC3L 2FECI 3C87A 3HG1E 2KUTA 1RZJC 4BQ6A 1UT9A 1CLOL 5D7IA 1E4KA 3CZFB 1H3UA 3OKYA 1D6VH 1N5YL 3A6CL 1VACA 4NO3B 3SQOL 4E41D 4OCRH 4JG1H 3V8CA 3PJSB 4JN2B 3V5KB 2EC8A 4CBPA 4WU5B 3WIHA 4BUHA 3MOAL 4PJ9D 1ZWIB 4PFEA 3CGTA 3K8KA 6FABL 1NKRA 3ULSA 1HXYB 3MV8A 4WTZA 4NRYB 3CCHB 5I6XC 2ZUXA 3BPOB 1CL7I 5JHDD 2VXUH 1FH5H 4TRPH 5C9KA 2QHRH 3D1MC 1QYGH 2R2EB 1UWGL 3SGKC 3SY0B 1W0WB 5D7SH 3BO8B 1UM5H 2Z35A 3QUXA 3KPLA 4F15B 1JRHL 5TGBA 2DJ4A 2V5SA 1KACB 3STBA 4G6JH 1ZTXL 4HGMA 1VHPA 1W2KT 4IRSA 2IAMA 4EXPX 1MI5B 2VZVA 3UJJL 4N0CD 2LE9A 1A1MA 3CSPA 1KIQA 3KLHC 2BNQD 1KOAA 1P4IL 1SJHA 5CJOH 2HFGH 3TCXA 4IIQA 1CLZH 3ARRA 2DMCA 2GITA 4CU7A 4UILH 1ZLVH 2FECL 2P48B 2P5EB 2VLRE 1WCQA 4Y2DB 1CGSL 4KWUA 4X80L 5DJYB 5CZKA 2YRZA 4FFYH 4YEFA 1K9TA 1T2XA 3NPZB 4HUVA 3IXAB 4I4WA 2FL5B 4OZGA 1OGTB 1KTLA 3OBAA 1G7QA 2Q76A 4GT7A 2HFFA 4U31A 4HKBB 4PV8A 5MENA 4KK8D 1BX2A 4QXGL 3MJ7A 1CL7L 2X9YA 3VFUA 4GXUN 4Q74A 3B9KB 4NN6C 4D9RD 1RQ5A 2Y5TB 4P4RB 5GZOC 1INEL 3C6SA 4JZJB 2DQGL 1UGNA 3SBWC 1TZGH 4KVCH 2PCPB 3SDDB 3RUGE 2NY2D 1DFBH 3BHBA 1FO0B 5MEQA 2XFXB 2J6EL 4YH6A 1HZHL 1XH3B 4MB3A 2HLAB 3IFPB 2VDLH 2VB5A 4ZD3H 2QADD 1NGPL 2UWEF 2MFNA 3QO0A 5J9PA 1JWMA 1GAFH 4P59H 3PXHA 1E4JA 3HMWL 4K7PY 1D7FA 5DMKB 4HBCH 1J0ZA 5I66B 5KSBE 3G6DH 4PB9L 2UWEB 2XQBL 4XMPL 3KWWB 5FHAL 4GKSA 2B1AL 4CN4A 1NL0H 2ZUVA 5C0JA 3U36A 4N0FA 4OFDA 2HJKB 3VE0A 3FO2A 4JO4H 4G42A 4X8JB 5FKPA 2IPTH 5ESAB 2ZNXA 5F6HI 1T7ZA 4NUGL 3R8QA 5HYQB 1CF8H 4HIIB 4NKIH 3SCMD 5C0IB 4AY0A 1D5IH 4KY1H 4QHLA 5D6DA 3TBVA 3GMRB 4BSVA 4X4ZA 2H2SD 4Y8AA 1FVDA 2B8OT 1YYLL 1C5BH 1T4KA 2XWTA 5EBMB 5IMOA 5IVOA 1RK0B 1C08A 4WI5A 3F6IA 4PS4H 2RAMA 2XKNB 5E2TH 2ZCHH 1DQJA 1FORH 4HWBA 3S9DB 4B53A 3CFIC 1ZE3C 4RDQF 4LHUG 3IAPA 3U2SA 3PWPB 1Q94B 4JO2H 1QHPA 3ZSTA 2NY3B 3GK8H 3BE1L 2GK0B 2DQCH 5DHYB 1I8IB 3RWIB 3QT2A 4LL9A 3TO4D 1MFAL 4U6VL 5HD8C 1P53A 1UB5A 3SO3B 2HJLA 5FYJD 1IEBA 1RFDH 1ZLSH 3B9AA 4LSSH 2V9TA 4Q58C 3R0MA 1P7HL 2PYEA 4X5LA 1E6OL 4EDXB 1TJIH 5DMJB 3QXAA 3M8OH 1KTDB 3KLSA 5HGDB 4WV1C 3NFPA 4P2RD 1JGEB 1CDCA 2G2RB 2V2WA 2O5XL 3C9NA 1T1ZA 5I18H 2NR6C 4L4VE 4Y4HB 4G8GD 1LDPH 4XPAH 1AGEA 2G75B 3P0YL 4CVXA 5SWQB 2A77H 2AGJH 4MA3B 4QGTA 1GHFL 3L7FB 1Z0NA 1LD9B 5IROA 4KPHH 5IGXH 4Y4FC 3K4AA 3RVTC 4EQ3A 4BH7A 1G6RL 4QXUH 4EDWL 2ENYA 2N4IA 1IAKB 1MJUL 2Y7QA 1AQDA 4HGWB 4MJ6A 5HVHC 3A6OA 1U3YA 2YPLB 3CZJA 3JUZA 5AZ2H 1JHLL 3D9AL 5DD1H 1BOYA 1XIWB 1SEQH 2IG2H 3O3EB 3DETD 3ULVD 4Y4KB 1U93A 4OD1L 1BBDL 1FYTE 2A9NH 5I16A 5KN5B 5DRXB 1QR1B 1KB5A 4DW2L 4XMKH 1C1EH 3GJFA 2GAZB 1R5WB 1S7QA 3D3VE 3H9SA 5HHQB 1OAXL 1U8NA 3M07A 1QFUH 4BFBD 1IGTB 4C4KO 3FONA 2JJWA 3QAZB 1IC7H 4F7MA 2NLJB 4TPRH 4Z7VA 4U7MA 3PGDA 5D1ZB 4R3SA 2FGWH 1IAOB 2OR7A 2ADGA 2FR4A 2BP3A 4NJ9L 1C5CH 1I9RH 5IBTH 1SJEA 1DBJL 4F7TA 3HFMH 1Z5LB 1P9MC 2QTEA 4DKFH 4RGMC 5E2JA 2ZP0T 4JFDE 5FIEA 3NH7L 4ZOBA 5CJ8A 1F90H 2R4RL 3MNVB 2B2XL 1ROWA 3QI9D 4FQLH 1N26A 1I1AA 4UTAH 1DQTA 5I8KL 1NCCL 4WWKB 1NC4B 1Z9LA 1IKNA 4JFPA 4Z0XB 1N4XH 3ISWA 2W60B 3O3BA 1EMTH 5KSVB 4N0UA 3VGAB 2K3TA 4JRXA 1MY7A 5FA3A 2DQJL 3VU2A 4L9LB 1VFBA 4NKMB 5BO1H 2EDOA 3CVIL 3QWOB 2Y06L 4H20L 3DURA 3S34L 2OK0H 3MGTB 4FG6C 4CJ1A 3WD5L 3WFCH 1SY6A 5JORA 3B2UC 4NQSB 4XHJD 5K9OB 2NY4D 5C08E 1KPRB 2QQKH 2X4NA 4LMQE 5F9DC 4G7VH 2ZUUA 4UIKL 3V8OA 2A1WL 2Q8AL 1R6VA 1MCWW 4ELKB 3MJGX 1AXSB 1AXTL 1P2CB 1S8DB 1V3LA 4LLWA 3WJLC 4X4YA 4M7KH 4X9IA 4MD0A 1J05B 4J7RA 3W5MA 1KC5L 1HH6B 1NUNB 4S1QH 4ZUTA 3EDFA 1MRFH 3IGAA 1GGBL 4GQPH 4NJAL 5F96L 4I3SL 2CLRB 4TULL 2BSTA 3QUMB 3GZKA 3BPCA 5GGTH 3MLZH 5IIEB 1MPAH 2BOBA 4QRTB 5AZEL 3SO5A 4OUUB 2B4CL 5DYOA 1IEAB 4L8BA 2FDBP 1NBZB 1G7HB 4XP9L 4I2XB 1RUPH 1WEJL 4KHXH 3SKJL 2VH5H 3UC0L 2WZPD 4JY4A 4PG9A 3O8XD 4R0LB 3UBXA 4RFNC 1DQLH 1OSZA 4L29A 1F4WH 3CU7A 3EO0B 1NANH 1VKXB 1NDMB 4G6KH 3RHWK 4PJ8B 4KKBC 2HTKD 2YD1A 3H3PL 2Y36H 3G5ZB 2DQEL 2PNDA 3CFCL 4OFVA 2NY2C 5DRWA 5D8JH 2NTFA 3T0ED 4K71B 4NKQB 3PABA 3MFFB 1CBVL 3ZE0E 5FYLE 1YMMB 5I1AB 3ZT6A 3T3ME 4XCCL 1A7NL 3U0WH 2QADC 2XQYG 4YR6A 1EXUA 3IU3A 2L7UA 2OMBA 43CAA 5IFHL 5ITBL 4BELD 2OM5A 2EYRA 3MRRA 4OB5L 3T77A 1IAII 3PQYD 3DMMD 1FNSH 1Z9SA 4DEPB 2OQJA 4YDKL 1LNUB 3PV6B 3MJ9A 1X5XA 4DVBA 1DUZA 3UTTA 3QIUB 1I8LC 4JRYE 2VRAA 1T7YA 3HE7D 4Q2ZB 2EKSA 1S7XB 5TF1L 3B8SA 1CGWA 1U8QB 4V1DA 1N0LA 3GSUB 2D0HA 1FIGL 3DTXA 4YXHL 4HXAL 3TNMB 2CR6A 1UJ3A 2VAAB 4K3HA 2YKLH 3ARDD 4MS8D 3UJTL 4QGYA 1FC1A 1AFVH 2W07A 2CUIA 3F8UB 4L5FL 4R97C 3HZMA 3SCMC 3WIHH 4OF3A 5DVNA 4ZFOB 3LS4L 4YHPB 2OL3A 1BJ1H 1R5VB 1VDGA 1S7UA 2H2SC 2MQ0A 4LSPH 3HKFA 3NA9H 2VXTL 5I1HH 2E7BA 1DSFH 1QRNB 3M1BB 1X4YA 1S5IH 2NNAB 1DBML 1RZ7L 2ZUTA 4D3CH 4WTXA 4M7ZB 4DK6A 1EVUA 2XQYK 5KSAD 3WL9A 3VW3L 1T89C 4KK9D 5KVDH 1BJ1J 5DDHB 3VFVA 5ESVA 5FUZL 4PJGE 3SDCA 3UBXI 1WZKA 4YNYB 3VXNA 3VXSE 5EIIB 5EDXA 1E28B 1BM3L 1A5FL 1HCVA 3HPJA 4X98B 3U4EA 3RZCB 2EDBA 2AS5M 1P4BH 3S98A 3V0VB 3S35H 4P2QD 5L7XH 2FIRT 4P46B 2Y1VA 4Y5XA 5ANMB 3EJZD 1WTGT 4U1SA 4XXCC 5JPMA 3L3KA 5B8CC 4HUWA 1NAML 1MFDL 1CDHA 2RCSL 4KV5F 5I8CA 4BSWA 1R0AH 2EYSB 4LLDB 3MX0A 3OAYH 3FO1B 1YEEH 1BQSA 2RGSA 3K2MC 2A74B 3INUL 4LVNB 4PR5A 3U9UB 4R96B 2BNRD 3QEQB 3JV6B 5D1QD 3TBWA 5F7YC 5JZ7D 4TVPD 3VG9C 4O5LL 4S0TD 4EI5D 2WBKA 3ECBA 5CILL 3O6FC 4FTVE 1BAFH 3DX7A 4Z7UA 5E8OA 5ALCL 1XF3B 1GGIH 3PWNA 2VL5A 2Z31B 4HDIB 5LGJB 3RAJL 4NNXA 2ZNWA 4DKDC 3KYKH 2NX5D 3F5WB 3P73A 4GBXB 1MAMH 3QDGE 3FB5B 1FCGA 4R90H 3DETC 3VXRD 2GT9A 2H32B 1T20A 2GQHA 1JK8B 4NO5A 1K2DB 2WIMA 4BH8B 1RZKC 3QFJE 5DJ2B 2PN5A 4LEOA 5DJZA 1VGKA 3QDMA 4U3CA 1Y18A 1ZHLA 3S6CA 3P30L 2G5BA 1G9NH 4X0KB 1WBZB 3I6LD 4NKDA 1X4ZA 1UCBH 4NNYB 3T1WA 4X9GA 4LEXL 4OV5A 4XNXL 4U1NA 3TNNB 5HYSA 3NTCH 3DGGA 4XAKE 4KQ3L 4LCUB 4N9GB 5BRZE 3ZHLA 4LDEB 2ZUQB 4XAWH 5EOCL 3AMKA 3CVHL 3LQMA 5F3BB 3KR3H 4AEIL 1JNLL 3MA7A 2QSTA 2ORBL 3SKMA 4OIBA 3BZFB 4C56A 4ZOAA 1L4IA 5C6TL 3LEYL 2MPAH 3RA7L 3NPSB 2LTQB 4IOSD 5DD3H 5F3HB 1HHHA 4ELMA 4AIZB 3O2DH 3X3FL 1M7DA 3HC4H 4ODVL 2JE8A 1A47A 1LP9E 2ESVE 1EAPA 4P57B 3BRGC 1MWAA 2PW2B 2YZ8A 5EO9B 2V7HA 3C08H 2R29L 4YFEA 2X4OA 3VXMB 4BSJA 2VISB 2ZCLL 3O9WB 4H1LB 3X17A 4YK4C 4E0RA 1AE6H 2EDDA 3O3UN 1ZT4A 2O5ZL 4LKXB 1T0MB 3GSXB 3S4SA 1XF4A 4NM8H 4XHJC 4G3YL 2NY4C 5K9KA 2ARJQ 3DI2B 4HWBH 3MPCA 4OAWA 5IW1B 3ZO0A 2UVEA 1ED3A 2VDPH 4ZAKC 4ZUWA 3ZSSA 3H42L 4W4OC 5HYJB 4EBQH 2ICWA 1FZJB 5EPMB 4HCRA 2NXYB 2YXFA 3V0AC 2GCYB 2ZSVB 1J0KA 1JTPA 2BHYA 2FH8A 3D18A 2VITA 3QDJB 3QULB 2DMBA 1FQ9C 3QZWG 4LLMB 2PTUA 1AR1C 5DEFB 1YY9D 1AJ7L 2WIIA 1NLDL 1V8HA 4MNGA 1P7KA 1A6TB 5D2NE 2DI8A 5DHVB 4FMKA 4LPXA 4PTTA 4O02H 2FEDC 5F93C 1DEEB 5DEZA 1EHAA 5DURB 2QLVB 1BBJA 4LNRB 2HA1A 4MYWB 1C12A 1LO3H 3QUZC 2K7PA 2LU7A 3WS3A 2FD6H 4PRIA 3T0BA 5BS0D 2Y5EA 3SEPA 1SJXA 3PL6B 4NKOB 3W9DB 1QEWB 5FM5M 3LMJH 4JCLA 4OZIE 3HB3D 3O8XC 3EZ8A 1F4XH 4I77H 2H3NA 4PP1D 2H2PC 3CSYA 1K8IB 2X4SB 2FEEI 4Z78B 4FFWC 3LDBB 4HIJA 5GGRB 1IC4H 2HTKC 3FTGA 3OL2A 5E7FA 2ATKB 4O2EB 4I18C 3GSNA 5DFWH 5FV2A 3B4NA 2VOTA 2R2HA 1NEZB 4F37K 1T5WA 3QIWB 4WIQA 4JG1L 1F4YH 5ITFB 1KB5H 3VD9A 2R9HC 5GZND 2M2DA 1T5XA 3GJFH 4XH2A 3SJVA 4MHHI 4IRJA 4R7DB 3D85B 3FRUA 1MQKL 2DWEB 1HQ4B 1ACYH 4LLQB 5HYEA 1HI6A 4ONGL 2FX8L 2VXUL 1FH5L 4TRPL 2QHRL 1IMHC 1NJ9A 1QYGL 5B4MD 3SKOA 2X7LB 3RBGA 3SE9H 3MRGA 4BQ8A 3RWJB 4C58B 5D7SL 1UM5L 3ULUE 3STZB 4HEPG 2AK1H 3AS2A 4XC1L 2UY7A 1QLFA 4G6JL 4X9BA 4XVUD 1CLYL 2CSPA 3KLAA 2F8XC 5FGBC 4OFPA 3BUYB 1VEPA 3EYVA 3P11H 2NPLX 4APQA 1A1NB 4Q0XH 3MJ6A 5LAXB 1I8IA 5E94A 3ARDC 4LDOB 2BY0A 4MNQD 4P4KC 4LGRB 5CJOL 1FE8L 1UYWL 2HFGL 2ZG2A 4M8QB 4PJXA 4POYA 3JVGC 1K6QH 3L7EA 4Q6IA 1CGVA 1CLZL 1DBKH 5E2WH 1JI2A 1U8OB 2OBGA 2ZOLB 3DECA 3MYJA 1ZT1A 3LVEA 2VABB 4UILL 4YHKH 5FO7B 1KLGA 4CADB 3MV9A 4FFYL 4JFYB 2FO4A 2DAVA 4CVWA 5FF6B 1FV1A 2MKWA 4EQ2A 4HPYL 1CFSB 1T1XA 3QZWB 2W9LA 4XXDB 5EOTA 3D48R 4NN7C 4AENA 3DO3A 3QYCA 4AQ1B 5IVXE 4PGEB 3EJZC 3MV8D 5BOZG 3LN4B 2DYPB 3T1FB 4PTUB 5AYUH 5TDNB 5C0EA 2D3VA 1UZ6E 1TZGL 4KVCL 3D2UB 4YX2H 4JZOB 1DBBH 4YQXL 1DFBL 3QUXD 1HEZB 3F7PC 2Z91A 3FJTA 1NMBH 2HRLA 5ID1B 1JHKH 4IRSD 4X6CF 3TPUB 4XRCB 2IAMD 3RDTB 3D0LA 3GSVA 3KJ4C 5KZCD 4JKMA 4UIMA 4K3DL 3LIZH 4QT5A 1HN1A 32C2B 4OT1H 4X6CB 1GAFL 3BPLB 1PYWA 4P59L 1XR9A 4DAGH 4HBCL 5CAYB 1IT9H 2EYTA 2J7LA 1KCUH 4U0RC 2PETA 4EUPB 3FMGH 3OJ2C 1K8DA 1NL0L 5LXGL 2J8UA 4PP2B 4H26B 4HQQH 4NQDD 3SN6N 2E7LC 5I75C 15C8H 1GRWA 2WBJB 4JO4L 4RGNC 2BSSA 4IMKA 1QFWH 1U91A 1EEUA 4U1MA 1JFQH 1Z2KA 3BH8A 4JM2C 3X14A 1WWBX 1CF8L 3IVKB 4NKIL 1D5IL 5MEND 4KY1L 4XPTH 4Z7WF 5IW6B 5JIPA 1PW3A 1VFMA 5JNYA 1MHEB 4LAQH 5C0GB 1C5BL 5C0AE 3F6LA 3H2WA 2NY1C 4IJ3B 5F1KC 4Z7WB 4PS4L 4P3DA 5LQBH 4KGLA 2ZCHL 1FORL 3U79A 3UYRH 3E6FA 1KJVA 1AGBA 2IQAB 3D25B 1HDMB 4RWYH 3KYMB 4PBWD 1F5WA 2OJEB 2R1WB 4G6AD 1CFVH 4JO2L 4QRUB 2YD4A 3QHTC 1P4LB 3EYFB 3GK8L 3DVGA 2DJSA 5E5UB 2W1NA 4C83A 3FFDB 3BD3A 5HYIA 3QNYB 1OGAB 3WFDL 4ACPA 5E1HB 3S36H 4OKVA 5CD3B 4R2GC 5F7NC 2H9GB 3G5XA 4HKJB 1RFDL 3BIKB 3TA3D 4LSSL 4HLZH 4L4TA 3ESVF 1N8ZB 3BRDA 1VEOA 3QO1A 4ODHL 4A6YH 4Q9QH 3TJHC 1NCAL 2BVPB 5I17A 1WCBB 3V4PH 2CK0L 2DTSA 5KOMC 1HE7A 3TT3H 3STLB 1SM3H 3R8BB 1RJYA 4OUUA 2WSKA 4XZUB 1FNLA 4NC2B 4OM0H 4PRAB 2MOVA 4OLYH 2EE2A 4TNVK 2A77L 4X4ME 3IDUA 1LE5B 4HMCA 3QR2A 1AO7A 2JCCE 4KPHL 1JJUA 1FZMB 4WJ5A 4QXUL 4IMLA 1WZLA 4OFKA 5B38B 1BOGB 2YS4A 5F8QC 1VKXA 1TENA 2LU3A 4QY8B 5DTFA 1X9QA 2OXHA 3GRWA 3HI6L 3S3PA 1PY4A 3BIAX 4K8RH 5SWZA 5AZ2L 1NBYB 1DEDA 4DJMA 1GZPA 5KVGH 2NYYC 4KDTA 1JN6B 1BJ8A 2YZ1A 1IGIH 4G80A 5CIPB 2VZSA 2A9NL 1GZQB 4WUKH 1VA9A 4BZ2H 1YY8A 4Q97A 3RL2B 4XMKL 4NC1C 1CXKA 2P8MA 2XI9A 4TUJB 4HUUA 2OTWB 3CDFA 4MVBD 2AV1A 3W2DH 2UYLA 3OXSB 3QB7C 5DJXB 4JRWA 5EWIH 3HB3C 5TPWH 1SYVB 3TZVA 4Y8DC 1IC7L 5I30H 3BQUA 4TPRL 1KJ2B 2FGWL 1DANT 4OF5A 5DRNA 3HS0B 3UO1H 1U8JB 3U7AA 1C5CL 1I9RL 5IBTL 4XP5H 2XN9B 5IFJB 4ZS6D 3S37H 4GRWH 1KJMA 3HFML 4TNWF 4AH2B 3IJYB 4Y1AB 3GIVB 4DKFL 3P4MB 1CG9B 1S7XA 3IFNH 3DXAB 1YN7B 1A8JH 3QUYC 3WMSA 3KPSA 1F45A 1F90L 1TVDA 2ERJC 1JBJA 1Q9KA 3PIQB 3T0VA 4FQLL 3VWKA 1X4XA 2BVOB 2EEDA 4UTAL 5GZNC 5L8LB 2R56H 3LKOB 5I1GH 2L4OA 5F70A 5IV2A 1HNFA 3MLXH 3T8XB 1JYXA 1GPOH 1N4XL 1AGCB 3MRDA 4KROD 3KPPB 1EMTL 1UWXK 4MJ5B 2GTWA 2YPKA 1FRGH 1NCBH 1NCNA 3GSWA 3IDJA 4OGAC 4QYOA 1A9EA 1F3JA 5BO1L 4G9DA 3MBEC 3HI1A 5FK9A 3WFCL 1U58A 4N8VG 5I19H 4O2FB 1QVOA 2QQKL 4NT6A 5GGVY 3V4VH 4G7VL 5JPNA 3NIGE 5ERWB 1TXKA 4P2OA 5HHMB 2GJ6A 4OZ4B 1CK0H 3BWAA 4M7KL 5B39G 3IJHB 2H45A 5DD6A 5IB2A 4X6FA 5BS0E 3H9SD 3OKLA 4S1QL 5C09B 1FFPB 1MWAH 5D93C 1J8HB 4Y5YA 2ZCKH 1MRDH 4B41A 5CUSH 3REWA 1XGQB 4RBPK 1AQKL 1LO4H 1MLBA 5GS2H 3Q6GH 1Q0YH 5GGSY 5IB5B 2EH7H 4CL7A 1CCZA 2VLMD 4MQSB 2CMRL 2ZOKB 3MLZL 5GGTL 2C3HA 1MPAL 1G7JA 1OQXA 1UQSA 3VFTB 3L95A 5M7QA 3LSOB 1L0XA 3MLRH 5BV7B 3ROLB 5TFSH 4J3OC 4X7DC 1E4KC 3HZVA 4PJ5D 4MJIB 3O4LA 1S5HA 1J10A 2MNUA 4WFHE 3VJ6A 1RUPL 1KLUB 4KHXL 4NQXB 1I1AD 3VFGH 4MD5A 3NZHL 4Z5RA 1Q9OB 1D6EB 5HPOA 3THMH 2Z4QB 1NGYB 2EC9T 4NPYB 4M6OH 2JTDA 3NOIA 4JRXD 4UQ2A 3CMGA 4F2MB 5IHUL 4G6KL 4TOYH 1A14H 1CQYA 2I07B 3U7YH 1YMHA 2OR9H 4QCIB 5I1KL 2YWZA 2UZYB 2Y36L 2D2OA 3QUXC 2L7JA 4PJDE 4EVNB 4J3UA 2BZDA 5D8JL 1FO0H 1S78D 3MJ8B 4IRSC 4LGSB 3C5ZA 5LCVH 2IAMC 4JPVL 3U0WL 3MRKA 3MRHA 3O3DA 4RMWA 3PXJA 2A6IB 4FNLH 3RPIB 2V7NB 4NYLA 5CSZA 3VI3E 5L8KB 5EC1B 4F33A 5HVHB 5FDWB 3JBG7 1B6DA 3NA4A 3A67H 2BCKA 3BXNA 5DEGB 2R0KH 1OWWA 3RX7A 3T3PF 5DVLA 1Q1JH 4YGVA 2EECA 3MREA 4O4YH 2CGRH 5AAWA 4I3RH 5FUCE 5J89A 3AC0A 3DV6B 4PJ7F 4Y88A 1EH9A 4OUOA 4XBPA 1JNHA 2PYFB 4M6AA 2YN5A 4L3EE 4CUCA 1RZ8B 4NIKB 3QRFM 3Q5YA 3ROOB 4GG8B 4RISH 2CXKA 3GMPA 1S7RB 4PGDA 4YIQA 4FQXC 2YKLL 3BAEH 4HSQA 3JUYA 4PJ7B 4CNIA 1AFVL 4CW1A 1XZ0A 4HG4J 3RL1A 4BZ1H 2FYYA 5MEPA 2KH2B 4UU9B 5KANG 5KSUB 1X7QB 1CR9H 4NO0A 3NA9L 2Q3ZA 1F02I 5E2VH 1X5GA 1DSFL 2GUOB 1S5IL 2D0GA 3ALWA 1ZGLB 4BZYA 1XGRB 3PHQA 4OQ1A 4CN1A 3T0DA 5KVDL 3PP3H 4E41B 2E9JA 5C0BE 4EIGB 4QTHA 4PREA 2W0FA 1W72L 4NZUH 4UT6H 5D7JA 4F9LA 4YAQB 4PJ9B 2BK8A 1I4FA 1G9NC 3HI5H 1WFTA 3MCKA 3X12B 1JUFA 5C6PB 3OKOA 2EO1A 2RHEA 1LK2A 3S35L 5JHDB 3MNWB 2C1PB 3JTTB 4JDZB 3E1F1 5C07E 4Z76A 3BJ91 4OBRA 3CXDL 2AJSH 1PZ5B 5DQJB 4NFBA 1WAAE 2XTJD 5ISZB 4DCQA 2NY5H 2EICA 4AG4H 2DOCA 4NNPL 3UTTD 1MJJA 3NABH 4KKLD 1ZHBB 3R06B 3RY6C 3GB7B 1YEEL 4PPTA 1FDLH 1AIFB 4V1DD 3ILPB 1OAYH 2V5RA 2GJZA 5F89B 2BNQB 2RFXA 4NKOA 4AL8H 4U33A 3C5JA 3BKJH 5J7CC 4GKNB 3VXOB 3T08A 4ZSOA 5HI4D 3VCLB 2AEPH 1U8PA 1BAFL 1UXWB 2DWDA 4HF5H 5D6DC 1GGIL 2Z93B 1SBBA 1CE1L 3PWJB 3MC0A 1OP5K 3OKDA 5EN2A 1RY7B 5INCA 3MLYL 3KYKL 3W39B 1MAML 3O0RH 5EC2B 4KUCD 4R90L 3FT4A 4LP4A 3BMWA 5DJCB 4XX1G 1HHIB 1I1FB 1TETH 3AU1A 2DIJA 3SDCD 3CXHK 4JFFE 1G9NL 3L3OB 1Q9LB 1DDHB 1UCBL 1GXEA 4ERSH 1WBYA 4MVBC 3FAWA 5L2KE 4RFNB 3DUHA 2PUQT 1MUJA 43C9A 5EUOE 1ETZA 3NTCL 1B2WH 3FZUD 3T4AB 1U95A 5K9QG 5C1MB 1ADQA 4XAWL 3FQRB 2NY2B 3STZA 3KR3L 4RNRA 1H3PH 3WDIA 3LPFA 1F11B 1UH4A 1KGCD 3SDXF 5I9QC 5EU6D 3QPQD 5DD3L 2QADB 3DV4A 4J1UA 3BZEA 3WNMA 2YEZA 1B0RA 3B6SB 4IM8A 3O2DL 3HC4L 2VJXA 4HK3J 5GRWA 3SDXB 1UA6H 1H8SA 4KROC 5ID0B 1NMCC 4HJJH 3LKRA 4QHUB 4F7EB 2FWOB 3C08L 2OZ4A 1QSFA 3UX9B 3UTSA 2AJVH 4UDTA 1AE6L 5I1LB 1U92A 1XCTA 4P0DA 2P5WE 1IRAY 4LNVA 5F97E 5IJKA 1B4RA 3HTLX 4NRXB 3G5YA 4HS3B 5DZLA 1IC1A 3VXUE 4PRHA 4NM8L 2X89A 2PTTB 2YMXH 5J6GB 5L0QC 1IM9A 3O6MH 5T3ZH 1HOCA 5D5MF 2VDPL 3BRFA 1T03H 3CDGB 1I3RA 2YUVA 1RZIB 1YNTB 4EBQL 4R97B 2YA1A 3SCMB 5JHLH 4PJCE 3QDMD 1FNHA 2I9TA 1MH5B 1ONQB 2EDHA 1F4AA 2F53A 3GMNB 5D5MB 5DJ0A 5CEXB 5JO5B 3W0WA 5DI8A 5DS8B 2VUOA 3VDCA 2XWJA 3ZYJA 4DVRH 4E42A 3HG1A 2IALB 4EIZC 1ZA3B 3FQUB 1RZFH 3OB0H 1K4CB 5JA9A 1ZVHA 3HRZB 3RWFB 4D0BA 4WFGE 1TTUA 1CGXA 3GBML 3ZDXE 4XGZA 4JCMA 3TVMA 1YPZE 2VE6B 2X4UB 2DLEA 4KH2A 3V0WH 4AM0A 3RRQA 4FXKA 3MV7E 1T2QH 4K23H 4O02L 5KG9A 3HC0A 1FL6A 4YDVB 2HFEA 4PJFE 5CBAB 4J3WA 4C56D 5JLZA 3QWRA 2FD6L 4AMKH 2JIXA 3V95A 1E6JL 2CO7B 4XCNB 1SBSL 4NQCE 3K4ZA 3TO4B 3L3IA 3NCFB 1I1AC 1T21A 3LMJL 3VXPB 3CFDB 1ZK9A 1IBGH 4XI5D 4S1SH 2FRGP 1IKNC 4I77L 4LCYB 4HV8A 4IRZH 1D9KA 4RMRA 3S96B 1YEGH 3WS6A 1A21A 2RJMA 4MNHA 5E99H 3MOQA 4ZUSA 2JB6A 4YHYC 2VSCA 3P3YA 4P2RB 1IC4L 3HUJE 5AUMA 3GUTA 1WIPA 4OCXL 5H94A 2V6HA 4O00A 3FB6A 4G8GB 4FQIH 5HHOE 4DZ8A 4I0PC 1F4YL 1EBPA 1DVFA 1H5BA 1CICA 1ZVSA 3SE8H 3VG9B 5GGSA 4WUUD 1BVLA 3NZ8B 1E0OB 2K9UA 4HH9B 3O6FB 2VN4A 5MI0B 2VLLB 3KNBA 1ACYL 2VLRA 3U0PB 2KL6A 5E4EB 1XGUB 1IL1B 3ULVF 1OTSD 3C6LA 5I1EH 1J1OL 2VDQL 1M05B 4LOUD 2FATL 2DDQH 1DBAH 1KYOJ 4K3JH 2H26A 2XT1B 4U1GB 3SE9L 2RBLA 3PWVA 2AK1L 2R0ZL 3AAZA 4JHAH 3ZDZF 3VFSB 2MHAA 3G6AB 2DQFA 1I7UB 3BEVB 4NGHH 3OKEB 4H88L 3P11L 4BQ9A 1HILB 1WLHA 4U1LB 4Q0XL 1QPXA 4OJFH 5IJVA 1RJZB 1B0GB 1EFXB 4YHLH 1CVRA 2EIZB 4MCZB 4PRID 2P44B 3VFOB 4YGAB 2NZ9C 3NCJH 1IM3B 3MNZB 3RUGA 1K6QL 1YNKH 2AXGA 4RAUB 1M1SA 4YFLF 5E2WL 1U8LA 4XNYL 1HYSD 2UUDH 3DLQR 4HC1A 3OKKA 4JFQB 2YPVH 1KBGH 4YHKL 4TSBH 4X5WB 5EBLA 3U7WH 4YDLB 2DQHH 1WWWX 1CYGA 1FLRH 2XOTA 4KJPD 2XRAH 4X7FC 1P1ZB 2HFTA 4ZUUA 2VLJE 5IMLA 2VDOH 3R0NA 3RX5A 3QI9B 5E8EB 4X7CC 4MAYA 1P7QA 1RI8A 1NGQH 1ZLWH 5KSBA 1PGRB 2JK5A 1PG7W 1JI1A 1EUTA 2DL9A 3MRFA 3B9DA 2YRLA 5IWLA 4N1EA 2F5BL 3VH8A 5IB1A 3SJVD 4CVUA 1CD1B 1RSFA 4IRJD 2PW1B 3VFWA 3L5HA 1WQVT 4JPIB 1BP3B 1LEKA 1LEIB 4U6YB 1ZLVK 1ITCA 3QEGH 1E27B 5AYUL 4Y16A 3CFJB 3V6FA 1I7TB 2NY4B 1FIEA 2C5DC 2V2TB 3AXLA 1XF1A 3BGMA 4DZBB 4K7FA 1ES0B 4HHAA 1KIRA 4QF1A 1MCDA 4CN6A 1NMBL 3EHBC 2VDMH 1ORQA 1T0NA 1RMFL 5DUPH 5HGAA 4JJ5B 4MAUH 1FL5B 3RIFF 4J3SA 3FN9A 4GUPA 4LSVL 2ED8A 5F7EH 2GJJA 2WLZA 2IBZY 3LIZL 5DK2A 1KSRA 4MD4B 2HVJB 4APQD 5H2BB 1UJ3C 5HXMA 2VKWA 5KTEH 3MRQB 2WNGA 2XWBB 4DAGL 1EVTC 5HI4C 5SWSE 1UCTA 4Q9RH 3QH3A 1RHHA 1IT9L 2R0WH 1KCUL 1U8KA 5GS1A 3QUKB 1U8HB 3Q5TA 5SV3A 1H8NA 3HRPA 3QNXB 1T04B 1DLHA 2XKUA 5GGVL 4HQQL 1TPXC 3HMXH 1NGXA 15C8L 3K1KC 5EUKA 3MV9D 3WUZA 5CCKL 2H32H 1OW0A 4BFGA 4RFEA 1QFWL 3SDCC 1IGYB 4UI2A 1N59B 3PGCA 1JFQL 4OGYH 3JTSB 2Q1EA 3O8XB 1WFUA 5D6CB 5CSGA 3IXTB 2IH1B 5BVPH 4HIHB 2DQTH 3L3DA 1S9YA 5ACMA 1MFEH 2VXVH 3JV4B 4IHOA 3TLRA 4LAQL 3SOBH 4G9FE 4JQVA 1ZA6B 4FQHA 4Y5XC 2CDFA 4L4VA 1M6OB 4QRRE 1MHPH 4XX1E 4I18B 3S8WA 4K8RC 1FCCA 1YN6A 3BGFC 1XT5A 1P84J 2A6JA 3MGOB 3Q0HA 2GSIA 1PY9A 5DSCA 3T0EB 2QJDA 3UROR 3UYRL 1MCQA 2VLKA 1LO5A 2OTUA 1QG3A 4UT7H 3VFPA 4RWYL 2Q6WA 5DQ9B 3WE6A 3UYPA 4LU5H 1L7IL 3QPQC 4RIRA 5JIIA 4QHNB 4KJYB 3VRJB 3CLFH 1WUNT 2RR3A 2VN7A 2MQ3A 1R5IA 2WP3T 4QRPE 5T3XD 1MJ8H 5ACLA 3ARBA 3PQYB 3S36L 1BQHA 3DMMB 2DD8H 2V5YA 5IM7A 3CH1B 1FYTA 5DO2C 4ETQB 5BVJB 1LGVA 5DGRA 5LGHL 3BDBA 4I48A 5DK3A 2VDNH 4H1LH 3GGWB 5IOPB 1QSED 3LV3A 4NM4H 2QQLH 3HE7B 4J2XA 2F54E 4A6YL 4Q9QL 3OX8A 1JV5B 1MAKA 2A83B 5DZOA 3V4PL 1OD7A 3R4DA 5FYJU 1HHJB 5HDBF 5CBEB 3TT3L 4GRLA 1SM3L 3DVFA 1ZANH 4KMLB 3WO4B 2IGFL 1T83A 4OM0L 3ARDB 4OLYL 5DRZB 3MROA 3U46A 5C2BH 3MLTB 5IB4A 3IKCA 4U1JB 2CDGB 1TZIB 5TE7H 1X44A 1R3JA 5J1TC 2FNBA 1BLNA 1MCOH 4G8EB 3RJDA 1A2YA 4JFDA 1SVCP 5T1MB 4AT6B 2J1KA 3HCVA 4PG2A 2IANA 2I07A 5LGKA 3UTZA 3ILQC 4K8RL 5LBSL 4HFWA 5KSAB 2LAGB 2WWMD 5FYKD 4NZTL 4GXVH 3EJYD 1V7ML 1S9WB 5KVGL 3BI9X 1CDBA 5JOFA 5ICYB 1IGIL 4ODSH 4WUKL 3RI5K 3P40A 5DHVH 1WFNA 4WFED 2GHWB 2P24A 1S9VA 3RVWC 4ZFFB 3O45A 5FXCH 1JPFB 4V2CB 3VDBA 5JOPE 4MZ2A 4P2QB 4Z7OF 1BECA 4Y7MA 3W2DL 5EWIL 5HY9B 4HUKB 4XI5C 3WIIL 1VCAA 5TPWL 1T2JA 3QIBD 5I30L 3GMLB 3I02A 5C08A 1BD2E 1YJDH 4QWWC 1T1WA 5FOBA 5HHPB 3UO1L 3IDXH 2EC9U 3L3HB 4JY6B 4XP5L 3NACH 4L4TD 3S37L 5SV4A 3AS0A 2DQIH 3TM6A 4MSWB 4XNUH 3BKYL 1G0YR 4X6EB 5EA0H 3DUUB 2X4RA 3MRJB 4Y2DC 2Y4SA 3G6JE 5CMAA 2PYFA 3IDNB 2FJHB 3KJ4B 4QRQA 2BNRB 2FB4H 4ZS7H 1LEGA 5ESQA 5D1QB 2HT2D 1QLRA 1S7RA 3SDAA 2R56L 4EI5B 3CMOH 2VQ1A 3MRCA 1NDGA 5HHNB 1GPOL 4OBSA 4YZFE 3L3GB 5J1SC 1AO7D 1JWUA 1FFOB 5HHXH 3MZTA 3CFEA 1OTSC 5IQ9A 1FRGL 1NCBL 4JLRA 4U0RB 5KVEH 3B9KC 4RMUA 4LOUC 4MX7B 4NBZB 4JAMA 2WANA 1U8MB 2NX5B 3S5LG 4B0MM 4U2ZA 4BK5A 4JZJC 3LOWA 1EJ6A 5CKGA 5DA4A 3VXRB 2F8OA 3EYQD 3WKMH 5SWZD 4OZFA 1K5NA 5I19L 3SDDC 1FL3B 3HZYB 3HR6A 4M7LL 4KHTH 4OGXL 3V4VL 1VEMA 4JM2B 1UFUA 4PJEE 4MLSA 1N5AA 3BP4A 1EGJH 2PXYA 1RUKH 1NBVH 2XG4A 4HJ0D 3RNKB 4M02A 1ZS8B 5IR1B 5DJAA 4FQQB 3L1OH 4GOSA 5F88A 4R7NB 1TJHL 3TZVD 1TCRB 2ZCKL 3FFCE 3MRIA 1MRDL 1LDSA 5CUSL 1WBXB 3CIQA 3MCLH 1FFNA 4Q6YA 1LO4L 4U7KA 4LCWD 1C7SA 5F9JB 1Q0YL 3WNKA 2EH7L 1ZSDA 3H8NA 4ISVA 3T65A 5CJXA 4KJPC 4MQ7B 4LKCA 1TQCC 5JXAH 1Q9WB 1KCKA 4U7SA 4KDVA 4HKXB 5IMMA 4RFOH 3MLRL 3H0TB 3QFDB 4F7PB 5E5MA 5CS7A 4LMQI 1ND0A 2IBGA 1DE4A 3KPSD 5HI3D 4NQEE 1IGJB 7FABH 2FCBA 2YC1B 4PJAE 3VWKD 1QFOA 3O3AA 5INDA 3T0AA 4Q9BA 4JFHE 3KPRE 1PFCA 3MA9H 4N8CL 2DLGA 3VXOA 4XWOD 4JRYA 3THML 1JPGB 1JGLH 4M6OL 5FO9B 1HQRA 4KK6D 1A6AB 3BH9B 2J88H 4TOYL 3U7YL 2AQ3A 2OR9L 4KTYA 3QQ4B 2Z92B 1MLCA 4H5SB 4OLUH 2UZIL 4OCSH 5GQBA 3LRSA 1IC5H 5MHSE 1H3GA 1FO0L 1BZ7B 1DQQA 4WU7A 2APWA 1NLBL 4HIXH 2P8LB 5LCVL 5EU5B 4MQTB 2D7PA 3JZ7A 4ZDHA 1NFDE 5EU3A 4APQC 4NWUL 1A6VH 4P2OD 4Y19D 2GJ6D 3IT8D 3OKMB 3N1GC 3ESUF 4HAFA 5JQ6H 1KN4H 3QQ3A 4KI5D 4U6HA 1YDPA 3SO3C 4D9QD 4PJGA 3DROB 1Z3GH 3A67L 3VRIA 4NHUA 5E8DH 2R0KL 3VXSA 3QISA 2CLZA 1Q1JL 1T1YB 4EUPH 1A4JB 2DTMH 1G7LB 4MCYB 4UBDD 4ZPTA 3WEXA 2NY5C 4K55A 4O4YL 1B88A 4HT1H 5A2FA 1R24A 2E8YA 1BQUA 1S7SA 2AEWA 2AV7B 1JPST 3D69B 3DHJA 4OFIA 4RISL 4WO4A 4JFXA