2YBGA

Structure of lys120-acetylated p53 core domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
191
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTASVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Acetylation of Lysine 120 of P53 Endows DNA- Binding Specificity at Effective Physiological Salt Concentration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 44
structure length 191
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ybgA00
2BIQA 4A63A 4AGMA 1GZHA 1GZHC 3D05A 1EANA 5LGYA 3QYMA 2XWCA 2AHIA 2GEQA 4HJEA 4IBWA 4AGQA 4IBUA 3EXJA 5AB9A 3VD1A 5ABAA 2MEJB 2OCJA 3KZ8A 4XR8C 2VUKA 3D09A 4AGNA 5G4NA 2BIOA 3D06A 1CO1A 4MZRA 1IO4C 3D08A 2RMNA 1EAQA 4IBQA 1TUPA 2ATAA 3WU1A 1CMOA 2ADYA 3WTYA 2J20A 5AOMA 5G4OA 3WTWA 4MZIA 2IOMA 3WTVA 3Q05A 4L18A 4LOFA 1T4WA 2J1XA 3D0AA 2YBGA 2J6WA 2IOIA 3IGKA 1LJMA 2BINA 4IBSA 4IJTA 3WTSA 1HU8A 3US1A 2AC0A 4LO9A 2X0WA 4IBVA 4AGOA 4G83A 5AOJA 2BIMA 1EAOA 3IGLA 4GUQA 4IBYA 4AGLA 1KZYA 4GUOA 2J21A 4LOEA 5ECGA 5BUAA 2IOOA 2X0UA 5AOKA 2XWRA 3Q01A 3QYNA 3TS8A 4QO1B 3US0A 4G82A 1HJBC 2FEJA 1TSRA 2J1WA 2WGXA 4IBZA 3WTUA 3WTXA 2X0VA 1YCSA 5AOIA 5A7BA 3D07A 3ZMEA 4L0YA 3EXLA 1UOLA 4L0ZA 4KVPA 3KMDA 4IBTA 3Q06A 5KBDA 5AOLA 2J1ZA 4AGPA 2H1LM 1E50A 2PCXA 5LAPA 1H9DA 3VD2A 1HJCA 2J1YA 3WTTA 3VD0A 5G4MA 2P52A 2BIPA
chains in the Genus database with same CATH superfamily
4BFIB 1N4XH 4NQDE 1JWMB 4WWKD 4GQPH 4GXVL 4R4BA 5D8JL 5HHOD 2H0PA 2ZX6A 5B7EA 1TETL 2VZVA 3RDJA 3HE7B 3OGCA 4EI0A 2R0LH 4TULL 1MZZA 4EOWL 3ZR5A 1BFSA 3L3OB 4JJ5B 1KTLB 2VZOA 1CU4L 3D25B 3WFDL 4K23L 3DHUA 1F4XH 4A2GA 3CQPA 3DI2B 2VWEC 1DSFL 2VDKB 1MLCA 1BAFL 3PPEA 5D4IA 2ATKB 1ZS2A 1UJ3B 2ZIDA 1OE1A 1CYWA 1ZHLA 3AQYA 3VXUD 4F2ME 4U1HB 4G5ZH 3JV4A 5FKAB 5I18L 2A0LC 2PO6D 2F7PA 4JRLA 2E75C 3GYRA 2NUTB 1OLZA 1YEHH 4OKVA 3RB7A 1FLRH 5TDPB 2YPKB 2D2OA 5HJBA 5ALCL 2PYFB 5GS0L 1YEDB 2WZPA 3S3SA 4WTZA 2VDOB 5DFTA 3BHBB 5T1KA 4TS6A 4LHUG 3ZDYE 3ZT6A 4APQD 5GS0C 1P69B 1OXYA 5LAXB 1ZMYA 1FFPA 3VXTB 4IBSA 3QR2A 1S5HB 2D9CA 4XMUA 3M6DA 4M5YH 2AEPH 4EIBA 3ESMA 3CHRA 1QLFA 3JV0A 3A67H 3VI3E 5I8KL 3QR0A 4JFDB 1UGKA 2O5ZL 5H2BB 5ACMA 4WWKB 2FIKA 5JPNB 2QBWA 5HHOB 4Y4HA 1YEKH 2BNQE 2E4FA 5DT1H 1AFVL 4DUWA 1I1RA 1VB9A 4HJSA 3ZTJG 4NZTH 4D9LL 2XXCB 1BSIA 4CSZA 2XVLA 3QXWA 4H8PA 5FM5O 2AQTA 3K6SA 3BAIA 2Y07H 2VH5L 1U8PA 4Z7VF 4K2UH 2ZTBA 2V5TA 1MRFL 2PW1A 3IFNH 5DK3A 1ACYH 4D3CL 3Q2VA 4GT0A 1LILA 5JXAH 3IMVA 1L7IL 3ZTEA 3N2JA 3QFJA 1A4JA 1UB6A 1EXHA 1HQ4B 1MXGA 4AQAA 4NN6B 4NXKA 5AOZA 2VWEE 5ACZB 5T3XH 5GJSH 2BCKA 5GGUA 1XH1A 3C5SA 1ZGLM 1UXSA 4PRHD 3C08L 3LV3B 3H9SB 1WZLA 2WXFA 2H9GB 2BY0A 3VSUA 4W70A 3H53A 3P73A 3DURB 3TCXA 4M4RA 5IR1A 3PWJB 2CLRB 1EEZB 3ZTDC 3U7YH 1MWAB 2J1ZA 1HH6B 4AM0A 2UUDK 3VXOA 2Y22A 3MNWA 3CPUA 2AJVL 1E50A 4IRJB 3DO7A 4N1CA 1J1PH 3OLEA 5A16A 4X7SL 2CMRL 3L13A 4Q6IC 1N68A 3KJ6H 2OXGB 4YEEA 4IRSA 2BJML 5JW4R 1LE5B 2UXFA 4N3TA 4YXHH 4GFTB 4QHMA 3R7QA 3RZCC 1OW0A 2FWLB 4AG4L 4MD0A 3DPBA 4PJFE 5I76A 4U1MA 4P5RA 1U4FA 4HXAL 4JX0A 3ZYIA 1FIGH 2EKSA 1XBRA 1R46A 3BH9B 5CLZA 1G9NL 1SHSA 2Y0SA 4BXVA 1MF2L 3GBEA 5D2LA 1S7WA 5TDOA 2YR3A 4Q9QH 1F3RB 3DHPA 5IQ9B 1MCIA 3PAUA 1N59A 2BRRL 2D7MA 4JQIH 3VG9C 4ELME 4S1SH 3TYFA 4LSRL 4DKTA 5DMGD 2H1PH 4BKTC 3G9VA 4ZUVB 2ZUWA 5JYMA 1A8ZA 4NC1E 4OM0H 1BMWA 4HEME 4RWHA 4BDVA 1RZKL 3H3BC 2YARA 3FUIA 1SJHA 4XVSL 3KPTA 2Q20A 3FUKA 3RL1A 5C7XH 3MNVB 1Q1PA 3FT2A 1W0YT 3C6LA 3IDMB 3LIZH 2QMKA 4FYQA 3CPLB 5AZ2H 4ZW5A 3APFA 4FYRA 5I19H 1A7NL 1ORSA 1J1XL 1JF1B 4J8RB 4G6AD 3FB6B 4J3OG 1A1OA 1A3QA 3KYMB 3NUKA 4JM2B 4KGJA 3W81A 4HA1A 2B8OT 1JI1A 4R97C 4A6YH 3ZBMA 1R3IH 2YBRA 3QUMH 2CUHA 2MNJB 5A3ID 2GHZA 3KR3H 3VH8A 4CRPA 4CADA 3PQYE 4JQXC 5T1LB 2XN9A 1U95A 3R19A 1LK3H 1F11A 2BERA 5ECGA 1A5FL 5JHLH 5BUAA 3OXRA 2PCYA 4FAAB 5IY5B 2HJLA 2Z8SA 5AZUA 3EBHA 4O02A 4ZI8A 1UZ8A 3TBYB 3HUJA 3FT0A 5C8JA 3S37L 3MUZ1 4QTIH 2X4SB 4LSUL 2WC7A 1SM3L 1XF5B 3KPRB 1KULA 5FM4A 4FQIH 4LPVA 3L95B 3IDXH 3HKZA 1SF3A 5IQ7H 5AB1A 2D3JA 3KBHE 4LLWB 1JPST 5HHME 5C6TH 3ES6B 3HC4H 3LZQA 2CHNA 2YD1A 2ITDA 2Z93B 1O9ZA 1PLGL 4FQQB 1E4WL 4Y8AA 3OF6A 3UZVB 1GC1C 5CSZA 5KYUB 4WU7B 3GLZA 1KJVA 5IF0A 2JXMA 3MKKA 2DM2A 2OMUA 4RX4A 3SYPA 2WQSA 1FCGA 5DEFB 3ZL4L 4MS8D 5IB1B 4AEFA 2NXZD 3EOAB 3LKQB 5GIRB 1OM3L 2ZJSL 3V0EA 3W82A 2VERA 2BWIA 1MAJA 3MJWA 2P46B 1U3HD 3PHQA 3TJHD 5MHSE 4JFOB 4HIXH 1AXSA 3KM2A 4W4NA 3IXAB 1MNUH 5EOQL 4I3SH 4LLYA 3P0VH 5HYJA 3KPMB 3OR6A 3U4BH 1DVQA 1JRHI 5BS0B 1FO0L 1OP4A 4YH6A 2FNWA 4R7DA 1KEGH 3U9UA 4EUPB 2VERN 2WP3T 5EZOL 4GG6F 5D7JC 4JPIB 2HRPL 2D0FA 1MCPL 4P2RA 3WUZA 1H6EA 1PZ2A 4YPGA 3ZZQA 1FC2D 3L16A 3I3EA 4DTGL 2YD6A 3NJVA 4Y5VB 1HYSC 1UACH 4OZGE 5GS1C 3SDYH 4Q2ZB 3FU0A 4L1HA 2YSSA 1NFKA 4CKVX 1PVHA 1TZIA 3F84A 4PJDE 3NABH 2Z8VC 4XBEH 2UY7B 4X7EC 4PP1D 3T6ZA 4KZDH 1MVUB 1Z9SB 4HJJH 4OJAA 4JZNA 3KDPB 4YHYB 2P1YA 2NY3D 5AVVB 7CGTA 4AQEA 4IS6B 4Z7NE 2NXZB 1IGJA 5KYWA 2V2XA 5TK4A 4F7TB 1LHZA 2BVEA 4G42A 3GB7A 5LXVA 4DVRL 2QZ5A 4AK2A 3QJZA 5KSVA 4XNXH 4BZ2H 4ZNCD 1DVFC 1OAQL 4LRNL 1J5OL 5GRWA 3LKNB 1SBBA 1TCRA 4RZCB 1YNLH 2BP5M 3ILEA 3O4LB 2QHRL 2QADD 4NN5B 1IQWL 2Y7SA 3OMNB 3CDFA 1X6NA 4Y19D 4R2GD 4FXLA 3KPQA 3UH8A 2NNXA 1ZVSB 5IFJB 4U2ZA 4ZO6A 1S3RA 3NIFB 3QHFH 3WTUA 3GQFA 3QS3A 2B5IC 1U36A 3PGDA 5INCA 1BQHG 4HSCX 3VXSB 1GTFA 2WJ5A 1N6VA 2Y2TA 3U30C 3ZZSA 1T7WA 5DUMH 1FVDA 2J72A 4G8GE 4OT1H 5IW3A 3VU2A 2WPGA 4EJ1C 3PWNB 5HVFB 5L88H 1INQB 1ZPLA 4U7MA 2NQ3A 4Z76A 3BP7B 4M48H 4WK0B 5IP4A 4YSUA 3ZYJA 4NP4H 5HHPA 3QEQD 5FCUH 3MRHA 5DZAA 1FJ1B 5D71H 3RWFB 3T3MB 4H2CA 3AWFA 4HZLB 3GRWH 1KYDA 3CGTA 3QVAA 1WYJA 1QSED 3MXVL 4G43A 2YMXH 4G7YL 3BGMA 4R96B 3CK0H 4RAHA 3KYKH 3EYQC 4P5KB 5I30H 4ONOA 4OCSH 5CD5C 3IB4A 2FH6A 2VT0A 1EXUA 2DDQL 4FFZA 3F3HA 3L48A 4KVCH 2QADB 1LP9E 5E8EB 1NGYA 4WJKB 4F9LC 1JYVA 3BEWA 7PAZA 1A9BB 3GJEB 4IKNA 4WW2F 1Q94A 2ZP0T 4KI5E 4Y19B 4HUVA 4R2GB 2YUXA 4ZUSA 2EDLA 4C56D 3LKRA 1TKWA 3UERA 1HIML 4MD4A 4B7IA 5BVJB 5LG6A 5CKAA 4YHZH 1Z9NA 2R2HA 4J3XA 5GRJH 3N1PC 1GYVA 4N9GB 5IJCC 3LEYL 4F7PB 4PRDB 5K39B 3S35X 4AZ8A 4FTVD 1PJWA 1UKSA 2FJHA 4O4YL 5I23A 2DKUA 2EVFA 3L4CA 3ARDB 1OPGL 4L0PB 5CZRA 5IVXF 1L0YA 4ENED 1M7IB 2ZZUT 3JUYA 4U6YB 2GKIA 1JNNL 5D7IB 3ULUF 5D55A 1HI6B 3QDGA 2XBZA 1UYWH 3O11A 2MTPA 3BGFB 5F6IB 1TZAA 3ARGA 2ODHA 2VC2L 3QQDA 1UOVA 3F7LA 3G5YA 3RY6A 1CURA 1M53A 1LO5A 3BZ4B 3DYOA 2XQYA 4YSTA 3EUUA 2BY1A 1D5MA 1QATA 1RU9L 4NP9A 2EH8L 3DJTA 2Y72A 2OMWB 4JO4L 4ZUUA 5AVUB 2DPKA 3NSCA 4JN2B 5FUZH 3UBXA 3IJSB 3FN0L 1DJYA 3EYVA 3NG5A 4PRIA 4POZD 1RZ8B 4PJ8C 4TYUA 1UC6A 4XZUA 4PWEA 1D7DA 1NEUA 3AAZB 3MGTB 4P3CL 1BXVA 4JFQB 1KCLA 3ZZ1A 2F5BH 2WQVA 5FLVA 1SVZA 5L2KD 3BZEB 3HJ0A 1LTXA 4RSVA 1TU2B 5D2NA 4DNLA 1E4KC 1ROWA 3BKCL 5IVOA 2WBJB 5MEOB 2IQAA 4HDIB 4K8RD 1CBVL 3P1VA 2QLYA 4XI5D 5DVOA 1KFAH 4FTVB 1MCOL 1WITA 5BNXD 3DIDA 3QPQD 5DC9B 4GXVH 3V2AR 4EI5D 5D8JH 4JO3L 1QLEB 3TVMC 2OMZB 4KVPA 1C16A 4IBTA 3EHBC 1CXIA 2IPKB 4G8IA 1F3DJ 1HNFA 4MA8L 4TULH 4EOWH 1DJSA 2F54D 5AL8A 2OMNA 2G5BB 3B2MA 3UTSA 5F6HI 1TQUA 1TZOA 2J1YA 1CU4H 3WFDH 5HVHC 3MX0B 4KNUA 4D7PA 1RSYA 4MVBC 4PGCA 1H5BB 4RA0C 3TT1L 2O72A 1EWHA 3O8XA 2AF2A 5AVQB 1DSFH 2AK1L 5BZZA 2YA1A 4NI3A 3QUYB 1BCIA 1I1YB 3K72A 3BC9A 4DP1X 1S7SA 1FPTL 4HJ1A 3K6NA 4IBWA 4O58L 1KC5L 2X70B 4Y1AD 5FW6A 4C54A 3A6BL 5ALCH 5GS0H 2FEDD 3FYIB 1VFAA 2LR4A 4JFYB 4DK5A 5J13C 4NRZB 2PLTA 2Z92A 4HJUA 1A7RL 4XOEA 3HB3D 4Y8DC 5ICZA 1T5WA 3QORD 5L8LB 1AKJA 1YQ2A 2E0PA 4PJHA 4EZLA 5L2KB 3BE1L 3MLPA 5E4EC 3OJ2C 1S5IL 1O7VA 4GJTB 4YBHA 4ZFOA 1AO7D 4M43L 3EGSB 3SBWA 2L7UA 5I8KH 3BP6A 3HCVB 3LN5A 1ZV2A 1XIWB 3FUJA 5TJWK 1NCBL 5JXEA 3DO3A 2EICA 3FRPG 3B3BA 3L3IA 1AFVH 3VDCA 3K4AA 5E7FA 4Y4KA 3WBDA 3K8KA 5LO7A 4BFIA 4ILDA 2F54B 4I3GA 3BMWA 3FOMA 1MJUL 1AZUA 2VH5H 2EDMA 4Q6KA 5FUOL 3PRZA 2H32B 3QCUL 3QFDB 4WFHD 1MRFH 4M7LT 5HI5D 1M3IA 2NY4B 4D3CH 3HNVH 1G7LB 3L3OA 4JJ5A 1KTLA 1ZLWK 5DRNB 1L7IH 1NWPA 3D25A 5ICXB 3D3VB 3S5ZA 1F6FB 3A24A 2C9PA 2NX5D 1UJ3A 1MFAH 1Z0NA 3C08H 4X6BB 5FKAA 4QT5B 1MJ8L 2H8PB 2P7TB 2F1AA 3MCG1 4WSGA 2FUQA 2NUTA 3RPBA 5TDPA 1MEXH 2DWYA 2GI7A 2MOVA 3LH2L 4XO9A 3WIAA 4FJZA 1SPDA 3QQ9D 3RVTC 3BHBA 2AJVH 4J2QA 3KD4A 2W94A 1F6LL 4WHCA 5LAXA 4YC2C 4X7SH 2CMRH 1VHPA 3VXTA 5GRVK 1PLCA 2AQPA 2ZF9A 1PZUB 1K72A 3DBSA 5FX3A 2BJMH 3ARSA 1VADB 2UY6A 5I0XA 3ILPB 4ZFGL 1XGZA 1I4FB 2D73A 4JFFE 4LXFA 4X7CC 1J0HA 2QT6A 3MRQA 1NANH 4WWKA 4AG4H 5JPNA 3WEOA 2ZX5A 1JPEA 1SMDA 5HHOA 5DYFA 4WGVB 2RQ8A 5JW3L 4HXAH 2YA0A 5D4JA 3BSZA 4KJWC 1KIUB 3KLAB 1EGJL 4GO6B 2W8CA 2R51A 4N8VG 2XX0A 2HRHA 1GYCA 1B2YA 1PG7W 4K5PA 2BOCB 3WKPA 5ANMA 3QUKB 2BRRH 5L4JA 1MWOA 3UG3A 1OGTA 2QSVA 4R26L 3OXSA 5DK0B 3MV11 4I1RA 1TYRA 2E7LA 1HQ4A 3FPXA 3L9YA 4P57B 3H7LA 4RRPG 4Y5XA 4Z77B 5T5FL 4IIQC 3FB7B 3GIZL 2EO7A 5E4IA 2NDFA 2YOAA 4E41B 2GITB 3L54A 4XVSH 3H9SA 4PMFA 3FUNA 5CEZD 2IDFA 2H9GA 3LZNA 3WO3B 4IK6A 1S4IA 3DURA 4N26A 1WV7T 1ZHNA 3PWJA 1EEZA 1A7NH 3MRIB 1QKZL 3IDYB 1J1XH 1EAQA 2AVGA 1SFHA 1JMZA 1HH6A 3DROA 3P3RA 2XWDA 4HPHA 4ZT1A 5E6SB 3TFKC 2BSCA 2FWUA 3B6SA 4U4BA 4G8AC 1U58A 1L9MA 1QUNA 1CD8A 1NICA 5EBMB 1ZT1A 2K4WA 4P2OC 3PWUB 5CEYB 2D03H 4OLUL 5GGVY 4ZX6A 2ESVB 3CFQA 2AABL 4UM9B 2X4TA 4IMKC 1RJYB 3K5SA 2X1XR 1U8HA 1QX1A 4WUUE 1R24A 1QTYT 1A5FH 3EIFA 1C8PA 2CLVB 3N5AA 3MOBL 5C0JB 2V9UA 5KANG 3AZUA 3TP4A 4XO4A 2F5AL 1KJ2A 1OP5H 3WNLA 1F13A 2IQ9L 4GY4A 4G6ML 4N2HA 3BD5A 3S37H 1D6EA 2O5NA 2ADIB 4Z7UE 1SM3H 2YLHA 1KIRB 3DX1A 5IQ9A 4L4JA 1HWHB 2IH1B 3DSFL 3CNKA 1WBZB 3W0WE 4PRHA 3QZLA 4LVOC 3VFTB 4WY7L 4MRBA 3EH1A 4HWNA 1CI5A 3BP4A 3ULSA 4FXKC 3WEAA 1OGSA 1WD9A 1GC1H 2M8XA 2VLMD 1PLGH 5I16B 1E4WH 1PGRB 3ESNA 4ZO9A 4YIQB 5EV7A 4QRSB 1UHVA 1VEMA 2IV9A 3WUWG 2VLJB 3CPLA 1NCHA 5BOJA 3HR5B 1QNZH 3ZL4H 1VRSA 4B0MM 4NNYB 1JF1A 1OM3H 1CTOA 2ZJSH 5IMLB 1GXEA 2DLFL 1DQQB 3KYMA 4JM2A 1Q9OB 5F0JB 3V6FB 2WSPA 4X5WB 2HKHH 1LDPL 4RA3A 5L4IA 4OFPA 4GRWF 2LLNA 4N2CA 4IU2A 3NJMA 1Q90A 1MCKA 5T1LA 3W39B 2EE6A 1FL6B 2IV8A 5EOQH 4PV8A 1JPGB 1P2CA 3NRFA 3UC0H 1WP6A 2DQMA 1V10A 2BIPA 3D39B 2MCAA 5I1KL 4AGMA 4PBDA 2NZ9C 3GD1C 1J12A 1FO0H 1N6UA 4PJIA 3NIFF 3TEYA 4NT6B 1YYCA 3W9EB 4HMDA 3TBYA 4CN4A 2WBXA 4G70B 4I18C 3RGHA 4ESKA 5C0EB 3SGDI 1MCPH 4XXWA 5HVGB 2AEQL 3INUL 5IJVA 2XX1A 4DTGH 4K9EL 1XF5A 2Y7NA 1CYXA 2AJYL 4MB4A 1AH1A 3QC6X 3PNWB 5JHDE 4D8PB 3NFNB 5DD6B 5KUKA 2PPFA 3QIUD 1NFIB 3SDCB 3BFQG 2WB1A 4K9EC 3M86A 3OKDA 2PP9A 5HYFA 4KC3B 2XIIA 1JFQL 3D7PA 1OSZA 2R83A 3RTQB 5FB8B 3P11L 3OHMB 4LLWA 1KTKE 5GZOC 3X13B 1WHPA 2Z93A 3TO4C 1QEWB 4ANXA 5KYUA 5BQ7A 1KF9B 4AIXA 4DVRH 3BRGC 2CJ3A 5BOZG 3T6WA 4KKNA 5DEFA 3KGRA 1X44A 2DD8L 4PG9A 2W60A 1F58H 2UXGA 2X2YA 3EOAA 3HNSL 4L3ED 4LRNH 3K6DA 2APBA 2XXGA 2EE3A 3LQAL 4X5QA 4X99A 1KUMA 5DWUL 4O51B 4ODSH 3FMGL 2PP7A 3B1TA 3TNMB 2QHRH 5J3HC 3VB8A 3L5XL 4Z3HA 1IQWH 4J3OC 5EU7E 2CUMA 4F8QA 4JFOA 5CJXA 3U4EB 2K8MA 3EJYC 3IXAA 5DC4B 1QFWH 4C55A 3WEXA 1P4BL 3MV7E 2VR6A 2YJQA 1WFOA 3JVFC 5LNGA 1XGUB 2O5YL 3AQXA 1NGXB 4HCRL 3T0ED 5EEZA 4OAWB 2NZ1A 4XO5A 2OL3A 1KB5B 2ORBL 2VYRE 3FFCE 1EH9A 4H8WL 4DW2L 5T33L 5E9DB 4KUCD 2Z35B 1UZGA 4UNVA 3FFOA 4M1CD 4H8WC 1RURL 4MYWB 2ZOWA 4ADJA 4ZOEA 4JEGB 3FT1A 1F00I 3CXDL 3QULB 4AZUA 2EXYD 2VSCA 3PDDA 4OUOA 1TDQA 1Z9SA 3MXVH 1HHIA 3F6LA 4W9ZA 5LHDA 2P43B 2DIBA 3MBEB 1WAAF 2BRQA 4YFLI 4IS6A 2G30A 1E4XI 1P4LB 3GSWB 4N2EA 1MG3C 1K6QL 4F7TA 4R8WH 2DDQH 2UVFA 2R59A 3JV6A 1U3HA 4UQ3B 1MG2C 1EHKB 4LNRA 5BRQA 4XVJL 3UZQB 3VM7A 4LOVA 4RZCA 5D4QA 2OR8A 1FI8C 1JXDA 2Z91B 3GXNA 5L9DH 5E94B 3WY2A 1ADQA 3U7AA 2AQSA 2GEQA 2J57A 4M8QA 5IFJA 1ZVSA 2EEDA 2OMBA 3DA0A 1KACB 2X53A 3LEYH 2E59A 2QQQA 1XB8A 1CFVL 1NIFA 2EVIA 1DDTA 1YDPB 4G1MB 1OB1B 3K3QA 4XPTL 3CFIC 1OPGH 1KYFA 3WJLC 1C7TA 3ABGA 4PJXB 4ZO7A 3MUGB 1FFOB 1Z5LB 4EPSA 4Z0BL 1F6AB 1JNNH 2MMXA 4XPFH 3BP7A 4HC1L 4XP1L 4KRMB 1YHPA 1G7MB 2BS71 1W8OA 5EU6D 1OGAE 4PRNA 3RUGB 3RWFA 3T0AA 1N19A 2Y7LA 4HZLA 2ICWI 1RU9H 2EH8H 4E2OA 3GIVB 4JO4H 1MHEB 5DJ0A 4IJTA 4QHNB 4RDQF 3FN0H 4KXCA 3QDHA 3OD3A 5D7KD 1ZXKA 4Y5YA 4YDVB 3CH1B 4GINA 4LCYA 4NGHL 4P3CH 3AU0A 4P23B 3ZSSA 4G8FB 2Y5TB 4IBVA 1BQLL 1KBGL 1P1ZA 4JRYB 2X4RB 1KBPA 4AQOA 3GJEA 4Y19A 3KVPA 1ZSHA 2WV3A 1MELA 2CZNA 5DD1H 5CSBA 2Z0BA 3BKCH 4OF3A 1Y0LB 3S36H 3QDMD 2EDFA 2Z31B 5ID0A 4JGJA 1YY9C 4PI0A 2AXGB 1CXFA 4XHJC 5D7LD 3VCLB 1MCOH 4KTEH 5BVJA 4PB0L 5CBAA 4DP8X 4JO3H 4KV5F 4YFLF 4AQ8A 3AUVA 1K8IB 3C12A 1N9PA 4MA8H 3WIIL 4KJPD 1TO5A 4WEMB 5KSBE 3A47A 1D5ZB 1T7XA 4PYGA 3ARDA 4NM4L 2GABA 2FECI 1SMAA 1YPZA 1JUFB 3QEQA 1M7IA 2QQLL 3V4UL 3VNZA 2C3VB 1WCBB 2EJ1A 5D7IA 5E23A 1HI6A 1Y1UA 4QXTB 1FPTH 1MJ7H 1QSEA 1U3ZA 5JLZB 3MNZA 5T1JA 4XNYL 5E8OB 2CLZA 1UQSB 4YHKL 3I50L 4O58H 1KC5H 5T3XD 4CC4A 5HYQA 3ZE2E 3BZ4A 3WN5B 2G0LA 2I7SA 3KPSE 5F0PB 3SE3C 5CFAA 1NGWB 4UMSA 1A7RH 1AD9B 2K4AA 3CN1A 1BW8A 3MYZA 4LLVB 4QYOA 1W6WA 2JJSC 4JN2A 4Y9FA 5EZJB 5L6YL 4FXGA 4HH9B 3D69A 1OAXL 4UAOB 3BE1H 1S5IH 2VDRL 3AAZA 3MGTA 4M43H 4JFQA 4C56A 2EVGA 3QDMB 2DLTA 2RFXB 5DD0L 2IMMA 4HAKA 4ZS6D 5D7LB 4H0GA 4GKNB 4YDZA 2M83A 2P5EB 5GISH 3S4SG 5GSVB 1NCBH 4Y2DC 3CFDB 4CN1A 3BZEA 5I1LB 3D87B 2YWYA 1WLHA 3LRGA 1TTFA 3DUSB 2R0ZL 3WFZA 4H4NA 4BQ9A 2IH8A 3C60C 4JCWA 4FTVA 1L6ZA 3FTWA 4YSQA 2GQHA 4IW4C 1MJUH 2VDMH 5C07B 4N6RB 2A6JB 2O6DA 2OMZA 3HAEH 5J6GB 1EMTL 3QCUH 2IPKA 4OIIL 2Q6WA 4EIGB 3WELA 1O7DE 3S2CA 2DMKA 3UP1A 4YQXL 1A22B 4XODA 3MXWL 3PHOB 3PWPB 4H0LC 4O00A 3SHSA 2FGZA 3G6JF 3MX0A 4ZAKB 3SE9H 2WIMA 3GMMA 1A0QL 1H5BA 1MFCL 4LFHD 4D0CB 2ZT9C 1VEPA 4KGLA 4KUZL 1CFNA 1X5HA 4LF3B 5F0LB 2W0FA 1I1YA 1WGVA 4YO0A 3TTSA 1T1YB 1UVQA 2PXYC 2WZ0A 2DJSA 3IM1A 1MSPA 1T1WA 1AGCA 3LH2H 1PY4A 1R5VB 2GTWA 3KWWB 1IEHA 2LHAA 1NJ9B 4U1LB 4NRZA 1QRKA 1NMBH 2WAHA 5FK9A 4YBLC 4BD4A 5ESVB 4G7VH 4MJJA 5L2KA 2LTQC 1KBKA 1FSKC 1B0WA 4PV1C 2PUQT 1UFGA 4OCLC 1GYAA 4POUB 4ZXBC 1KGWA 3SGJC 3EGSA 4ZFGH 4P4RA 3IU3B 1TPXB 5C0AD 2J6EL 3IRCA 1FNAA 3U1QA 2KPWA 5EG6C 4EI5A 1FVEA 4PJ5B 3US0A 3W38A 2YXMA 2IAND 3TNNB 3EZJB 4FCAA 4F1ZA 2HUEA 4FI8A 4A04A 2F54A 3BVWA 1EGJH 1KENL 2BSRB 2YC1B 2ZAGA 4HFUL 1I1AC 2H32A 3D07A 3QFDA 4D9RD 5SWSB 1UD5A 4EKJA 1IARB 5KYXB 2YFNA 4JR9H 4R26H 1G7LA 4MQ7B 2UZIH 2VO8A 3K8LA 1EFQA 3LS4L 5ICXA 3FQNA 3UZEA 1A3LL 4EN3C 4Q0XL 5T5FH 2R7EA 3GIZH 1T89A 5F9WB 3M88A 4Y1AA 1RV6X 5B38A 4TVPL 3HRZC 4X6BA 2HLAB 1J8HD 1I7UB 3B2XA 1WAEA 4QJ4B 3VW3L 4EVNB 3GJFK 4G5AA 5J0BA 4KRPC 2ALAA 4ZMZA 1ZJAA 1QKZH 4JFSA 1PBYA 5GZND 4KK5D 1CXLA 1OKEA 5D9SB 2WWKT 3JVGA 1AO7A 3QNXB 3D18A 4XBMA 5FGSA 4PH8A 2B20A 2NNFA 3UX9B 3S6CA 1UCTA 4A6YB 3QUMB 4PLOB 3CUPB 4BFKA 2XG4A 5C0AB 4OLUH 4Z7AA 4L3CA 2AK4D 2AABH 4BWWA 4X4XB 1HESA 1VADA 3QEUB 1X6LA 2WTPA 4I3RL 2A9AA 3ILPA 3Q43A 3PV6B 3MOQA 3EO0B 2WQRA 4UQ2A 1DFBL 2VN5A 5HYIA 3JZYA 3DOSB 2GC4C 4UTAL 2F5AH 3ZTJH 1OGPA 2FLRT 4G6MH 1KIUA 2X4QB 3KLAA 4P5MB 4YR6B 4KKBC 3REVB 1BZ7A 2PTTA 3SKJH 1UZ6F 5CN1A 4DGWC 5C7ZA 1Z0MA 3S97C 3QUKA 1OB0A 4B6ZA 3OZ9L 1CXHA 3HFFA 2ICEC 3DSFH 1R1CA 1YMMD 4ZJ9A 3LHAA 1Z9LA 2RD0A 5ENWB 4M9OA 5J9PA 3TFBA 1J8HB 1UG9A 5IOKA 1F86A 3CHPA 2C9SA 2EC9U 2PWEA 4WRLA 1EAOA 4OLYL 4X6DE 4WU5A 4E41A 5LB1A 3IWVA 4IRZA 3DUUA 3TH3T 3IAQA 4JUTA 2HB0A 2FZ3B 3MA9L 4WK4B 5D93B 5KAQG 4TVPE 1B90A 1XH3B 2FRGP 3AM8C 1IKOP 3DX0A 4Y16C 4NLHA 1SZNA 3MRIA 4PSPA 5I0DA 3CFNA 2AK4B 2ZWYA 2DLFH 4M93C 4TPRL 5F7NC 1LDPH 5EBMA 4XXDB 3A22A 2LU5A 3PWUA 1CICB 1JZFA 2FEJA 5TPWL 1G7PA 4A1RA 4GLRI 4UM9A 4DZ8A 1JDAA 2OXHB 3HKFA 1K3IA 5ITBL 1OAKH 4U05A 1UH3A 2H4EA 2EABA 3OMIB 4MMXA 2X2IA 2CLVA 3ARFB 5I1KH 4P99A 1SYSB 5C0JA 1A21A 4QNPF 5F6HJ 1N67A 2D31B 4RSYA 5DF0A 3B9VA 1ZCRA 2JB5L 4QRFA 2WNGA 1YMMB 1DJXA 2AEQH 3INUH 4K9EH 3FUHA 1JBJA 3PYCA 3IFPB 4CA4A 4URTB 5GGSY 3WTTA 3SOBL 2IH1A 1WBZA 4OCMC 3VFTA 1JFQH 4KKZA 3NVQA 4DUVA 4X9GA 3Q6GL 4PGEA 5KJ4A 3P11H 1A4KA 4XWGL 2F1BA 3FO2A 4QYAA 1ND0B 5I16A 5JA8B 1GGTA 4YIQA 3LJ3A 3EADA 3WKNA 1P6WA 1WD8A 3HR5A 3SYQA 3P4OB 3D09A 1U8OB 2UXVA 4NNYA 4P46B 5C0GB 5D1XD 5F9JA 5HDBF 1DQQA 2C34A 4J3OH 1Q9OA 3DTXB 4DP9X 5DWUH 2YMOA 3V6FA 3FMGH 4X5WA 3EO9H 2NUPB 1BIHA 3F00A 3L5XH 4PJCB 3MCKB 1MREL 4PRBA 3G5VB 3ZXAC 3QPKA 2VZ3A 3WTWA 3NCYP 2CBMA 2FEEI 3PGCA 1OLLA 4XAWH 2IG2L 2HCZX 1JPGA 4I77L 4LBEB 2H3XC 1RAMA 2AV7A 4ZQTA 2EE9A 3D0VA 2O5YH 1U93A 2CO2A 2OX5B 4HCRH 1N5YL 4K73A 3BMVA 2VM3A 1K5WA 4U3CA 3QXDA 2XIBA 1PTZA 4RBPK 3KLDA 4H8WH 2V17L 4DW2H 2CRMA 1QNIA 2FAUA 2UUDH 3FTSA 5FS5A 4G83A 3DX8B 4PJXF 4OFYD 4P2QE 4JDTL 5IVZB 3B9KB 3PNWA 4AVHA 1MIEL 2ZSWB 5DD6A 3BPOB 1D9KB 1RURH 5K33A 1NFIA 3MTXA 5T1DL 4BXSV 5GRVL 1A6TB 1BQSA 1BXXA 2BS9A 3CXDH 3P0GB 3PNRB 2A83A 2CIIB 5FB8A 3B8YA 1CDUA 5AW6B 1F90L 2X4PB 1GOGA 2WXRA 2B14A 4KXDA 2ZYSA 3DNKA 1S7UA 3IJ7A 4WFGE 1F4WH 5D1XB 4B27A 1K6QH 3F62A 4LKXA 2DYPB 4YHNB 5DO2C 2ZOKB 3CBJB 1KXQA 3HZKB 3DMMD 3KM1A 4X4MA 5D1QB 1P7KB 1ZLVK 1MFBL 4Q58C 4WO4D 3WTXA 1OK0A 3VYNA 4KHXL 3VMOA 1MAKA 4GRMB 2F61A 2XBDA 5EUKB 2N1KA 1I9RL 4NQDB 5ANHA 3K2IA 4R0LB 3TNMA 4D9QD 1MIML 2BNQD 3FH5A 1NLBL 3N40F 5E03A 4U3SB 3U4EA 3OAWA 5E6UB 4PJEE 3DETC 1J0ZA 3GZPA 1H3PL 3P4NA 4LL4A 4P05A 2GK0B 1CFVH 3CHQA 4N90D 2XA3A 3SGKA 1XGUA 2KT6A 3FXIC 4LSDA 5DEJA 1T5KA 3N43B 2BIQA 3ARXA 4U0RB 5HVWA 3QIUA 3K0WA 1KB5A 4F2MB 3T04D 1JAEA 3SO3B 4OCWL 5KVMC 1VA9A 5FF6B 4Z0BH 4HCFA 2Z35A 2YXFA 2VR7A 1AMXA 4G6FD 4XP1H 4LLUB 3TBTB 1J0YA 3OAYK 5DJZA 5F21B 1DE4B 3P3UA 3W5NA 1OOAA 5BZDA 5J11B 4RMVA 3OHXA 1S7QB 4FL4C 1TQTA 5EA0L 3ZDYB 5IW6B 2QEJA 1J86A 1AS7A 4DIXA 2E47A 1SOXA 4OZIF 3RVVC 2VDNL 2VITB 4P07A 3BPNC 5GS0D 1DLHA 3RNQB 2P5WD 4IDJL 4NGHH 3MGOB 3MRKA 2J20A 5AOMA 4BQ6A 1BQLH 4UQ3A 5E9NA 3CC5B 1KBGH 1ID2A 3WV0A 3PDOB 3Q6FB 2BNQB 3A5VA 4LQFL 4BINA 1IGYB 1XF4A 4EIZC 3UZQA 3QS2A 4OB5L 3S98A 4ZPVA 3SB3A 1GCFA 5A2KH 5F7MC 2IF7A 3LZLA 2Z91A 4GAJL 4QXVA 1X5ZA 1S7VA 1TOXA 1LWRA 1R3HA 5E94A 1U8MB 4PB0H 2KMWA 1QZNA 4UAHA 1AY1H 4Q14A 3WSQH 3UTTD 4QI3A 4PJAF 2VLKE 1YDPA 4G1MA 2WN2A 1OB1A 4WGKA 1IC4L 5ID1A 4HYTB 4JFUA 2R9HC 1MNNA 4NM4H 1ETB1 4JFHD 2JKLA 3QPXH 4Y9CA 1OWRM 5EBWB 3A4DA 2AANA 1Z5LA 3Q8AA 5C0BE 3V4UH 1UB5A 5ISZD 1NBZB 2EZ0C 3QHZH 1F6AA 4PLNC 3IGAB 1EFXB 1WAPA 4PWFA 4YL9A 1JZEA 1AE6L 2XFXB 4XNYH 4YHKH 1G7MA 2GSIA 4N22A 4IGBD 3I50H 4NQEE 2UWEE 4ZBJA 2FSEA 3OC5A 5DQJA 4KTDL 4GQ9H 4LDEB 3QO1B 2B0SH 2AKRB 5HDLA 3GIVA 5F7KC 1MHEA 3HR6A 4RMUA 6CGTA 5L6YH 1PG7L 1OAXH 5DHMC 4PS3A 1JPFA 2APFA 5EFIA 4DKAA 1RCYA 3SKOB 3T4AC 2XWTB 3CH1A 4QGTA 2ZWZA 4P23A 4TVSa 2Y5TA 5DD0H 4BH8B 2D4DA 3GBMH 4PJFB 5IG7B 5HPMB 1V8HA 2IDQA 4KRLB 2X4RA 4HBQA 3BO8B 4TNEA 2P80D 2JSFA 3ROLA 4GSDL 3RZCD 2O6CA 5EDSA 1Y0LA 1YUKB 2Z31A 4UUJB 2R0ZH 4UQCA 3VTAA 1FCCA 3S2AA 1V3LA 2FATL 2MNUA 2ENQA 2IDTA 2AXGA 4MLIA 3S37X 3VCLA 1HSBB 1ML0A 4BFEA 5IBUG 2IALA 4U3XA 2F8OA 1K8IA 1NDGB 1W72H 1BEXA 3ECUA 3H8NA 4OIIH 1GMEA 2WOBA 5EUOE 2CK0L 3ZKNC 4RIRA 4Y2NA 2ZPKH 3U83A 4YQXH 2X6VA 3BQVA 2QELA 5B8CB 5J12C 4WI4A 4ELKB 2WXKA 1A0QH 1MFCH 1TCMA 2SEBB 2Y2YA 2YQBA 4JFXA 4Y4FB 1VFMA 4KUZH 2WD0A 1NCNA 5EU6A 4BM7A 3NCXA 4G11A 2DICA 3D06A 4QXTA 1DQTA 2A6IB 2YN5A 3D2UB 4YK4C 2BHYA 2JCWA 1RZQA 1DJIA 1HVXA 2OV0A 5IQLA 2JE8A 1EK3A 4GKLA 3WN5A 2CXGA 2CDFB 4LT7A 3UTOA 1GSKA 4MMZB 3FT4A 1KN4L 1NGWA 1AD9A 4LLVA 4ZFQA 5A2AA 4UV4L 4GP8B 5EZJA 3QB7C 3PQYB 4HH9A 3G3LA 3B2VL 1I3VA 2P47B 4I13B 1BMGA 4JFPB 2Y1ZA 3ZE0E 5JPMB 3QDMA 4D2NA 2RFXA 4U31A 2C9RA 1EAJA 2L7JA 5D7LA 4GKNA 1P7QD 1Q72H 2J6EH 4FCHA 1Z32X 4L8SC 3MRDB 2VUYA 3DV4B 5I1LA 4XTRC 1VGKA 1QPKA 3DUSA 2XWBB 1OCCB 2K9FB 4LGSB 1U0QA 1KENH 1GR7A 4Z95H 5C07A 3BWUF 3IE9A 2A6JA 2EDHA 2WVUA 3VG9B 4HFUH 4EUPG 5DQ9B 1ILSA 1U3NA 3D33A 4MA1C 4LSTL 1G0XA 2DQHH 4CU7A 3EYFA 4OIFA 1V7NH 3TLRA 2Y5EA 3QYNA 3WIFB 4GEIA 3PHOA 1TQWA 3LS4H 4NSKB 5HHMB 1T03H 3T0XA 3IVKA 5HGAB 1A3LH 3GI8L 1WDAA 4Q0XH 1FA4A 3ARVA 4NFBA 1YEIH 3IU4H 2CHZA 4AIZA 1PW3A 4LF3A 3ECBB 5DUPL 3LEVL 1C1EL 4XX1E 3V0WL 4EDXB 1T1YA 5I9QC 3EGDA 3R4DA 3VW3H 1GKEA 4M7JH 1ASPA 2ZXEB 1ZA6B 3OB0K 2DQEH 2X9XA 4R97B 3HG4A 1T7YA 1KGJA 1NJ9A 3VFNB 1G87A 3BLPX 1ZTXL 2DH3A 3H1ZA 3D9AL 5ESVA 3C5XA 4AQ1B 3OAUL 1P7QB 2DWXA 3AU1A 3AREC 3GWJA 1KXVA 1KPRA 2N7BA 2ZCZA 3F6IA 3NSXA 3LTVA 2G3NA 3KHOA 4Z7OE 4AYFB 1NCDL 4I3RH 4O2CB 4RCAA 4APXB 3IU3A 1H6TA 4FKEA 3T1FB 1DFBH 4HOWA 3HC2A 4HU8A 1Z1WA 5GGRB 2DLEA 3GS7A 4UTAH 2PP8A 4N0UE 4AGQA 3ZMNA 3TNNA 4P3WA 4R7XA 4KKCC 4OF5A 1YAZA 5D7JD 1NMCB 4QHUB 5K1VA 3VG0H 5C2UB 2YC1A 4OZGB 3UTPE 4G8GD 3D0LA 4PGJA 4LEOB 2QPEB 4LVNB 4OIBA 4PJDB 2Z34A 1A25A 3OZ9H 3IKCA 4JQIA 5KYXA 4PWKA 1HYSD 4MZRA 4I85A 4DFIA 2BVOB 1EBAA 2ICWJ 4KJQD 4Z7VE 4Z7NB 15C8L 1N5AB 3WMQA 5TGBB 3VYPA 4FFYL 2EDTA 3X11A 4DZBB 4OLYH 3K4DA 1IBGL 2HLAA 2TRHA 2YK1L 3MA9H 4OV5B 1J11A 2D4FA 3VDAA 1I7UA 2WINA 2DM4A 3PFUA 2R4SH 3WOVA 3LIZA 4WI6A 1KPVB 2BW5A 1DDHB 3NK3A 3DRQB 5AAWC 4JLRB 4NBZB 5D9SA 1DVFD 3QNXA 4TPRH 2BVYA 3PXHA 4A6YA 1L9OA 3VMPA 4ABVA 3QUMA 2MTAA 1GMIA 5IFAL 5IM7B 5B3NA 1E6OL 4R4NC 5C0AA 1ZTXE 4GXUM 1U91A 2CRZA 4L9LC 5TPWH 4UZSA 4PJCF 2JQAA 1OTTC 4X4XA 2CKBH 4I88A 5B39A 3QEUA 2IMNA 2XYBA 4DKEL 5ITBH 1YY8B 2IANA 3GTNA 5JHLA 3EO0A 5DD3L 3WAKA 3DOSA 3Q3GA 2YAMA 4G8GB 5IESL 4UU9B 4ZMTA 1B4RA 4OCRH 1AKPA 3QP3A 3REVA 2X4QA 4P5MA 4YR6A 4HUUB 3FU8A 5E6YA 4X5XB 3GMRB 3OV6A 3U79A 3W37A 3NSFA 2MH4A 2DIEA 3SOBH 3N6YA 3NACL 5JDSA 4BRJA 2VQ4A 5HDWA 1T66C 2J1KA 4Z7QF 5E8NB 3FHQA 5ENWA 2J8OA 3EYOA 1PU0A 3Q6GH 1UFUA 1J8HA 3AS2A 4Z7WE 3E0GA 5E99L 2CO1A 5GZNA 4FFVC 2FZ3A 3THML 1ET7A 3DJSA 1QSFE 5IHZB 3TPKA 3EYQD 4MAYC 2NOYA 5I1DB 2CR0A 4FZ8L 4KKAC 3KG5A 1MW0A 3LKSA 5CD5D 4F7MB 1I7RA 5CD3B 2LAAA 4IM8A 2AK4A 2DH2A 2O1AA 2XIDA 4MJ2A 5DUJA 3BD4A 2E86A 1M7UA 2HN7B 3SDDB 1OOWA 1Q38A 4UQAA 4ETQB 4YE4L 1ZLWH 2EIZA 8PAZA 1PAMA 2YQ2A 4F5CE 2PN5A 2OXHA 4XCYB 5INDB 2B5IB 1SN2A 3LPWA 2IG2H 4I77H 4OQTL 2VW4A 3V5DB 2VISA 2IFGA 1ZS8A 4KWUA 4QRRE 1OSPL 5C3LD 1MW1A 4XC3L 1N5YH 4DOHE 1FL5A 1WWBX 3UMTA 4L2LA 4N2DA 1WSST 4JKPH 2X44D 3MA7B 1YMMA 2EYTB 2V17H 2R69L 1P9MC 2IOMA 1K3ZA 4JDTH 3UAJC 1SDDB 1MIEH 3T2PA 5HD8D 5T1DH 4A2HA 1CQKA 2ENJA 2J1XA 3EJRA 5KW9L 2Q10A 4WWNA 5B1JC 4I0KA 3LB6C 1YN6B 5CFHA 1F90H 1JYNA 2EUXA 1OWWA 1ND0A 3OKLB 1C5CL 3R18A 4KDVA 2Q3AA 5DD5L 1IM3B 4H20L 4RDQG 2RJMA 4PIBA 1DQJA 2GIYA 5E56A 5B1CA 1CDYA 1S8DA 4PJ8D 3VI3F 3L1OL 3P4OA 4PY7B 2R29H 1H3GA 1MFBH 4BZ2A 1N6QL 2BMKB 4P46A 4U1GC 3UDWC 4KHXH 4ORGB 3VWJC 3PGFH 4MQTB 3IDIB 2OTWA 3ZLQC 4NCDA 3E6FB 1MIMH 1NIBA 1KDIA 2NSMA 3MCKA 3G5VA 5F1OB 2PWFA 4TLKA 1NLBH 3T2OA 4PP2B 3GS4A 4FNPA 4F9PC 5BW7C 4X42A 1KLUA 2G2NA 3K80A 2W07A 3RL2B 1R34A 3ZU8A 4YFEA 4LBEA 4M29A 3TVMD 4LVHC 2EH7L 2D3VA 3EHBD 4OR1A 1R3LB 1NM4A 4NKOA 4PWJA 4MNHB 1SVBA 3BCDA 4BCYA 3TA3C 4ZW7A 3VFVB 1JOIA 2I9TB 3GC3A 1QTPA 2FBOJ 1PKQE 4IOSA 5DO8A 4E0RB 3NCBB 4MVBD 2AQNA 4NQVA 3MJ8A 3DX8A 3S3BB 2FBJL 4KNSA 2B4CC 2ZSWA 1UD2A 2VL5B 4U1JB 4GG6E 2FO1A 2WKLA 5EEVA 2VC2B 4JW3A 4KZEL 4KKLC 2CDGB 5EA0H 3QDJE 2WM0A 2CIIA 2Z1KA 3GRWA 4UT6L 3O6FC 4FMKA 3SIKA 4R5XA 1IC5L 4ZPTA 2V4LA 5JIQA 5DK2B 5A2JH 2DL2A 2VDNH 5F9DC 5B4MC 3LXUX 1QVOB 1XGQB 4Z18A 1JRHL 3QJFB 5D1XA 1Q9LA 5BRZE 1OF2A 5KS9F 3MI6A 4IDJH 4YHNA 3JT2A 2ZOKA 4FNSA 4L05A 1P7KA 2C4FU 4LQFH 3MRNA 2BNUB 4OB5H 4Q56A 4K94C 2A1WH 5EUKA 2V5MA 4XR8C 5PAZA 5E5RB 2FO4A 4R0LA 1J1OL 3V79C 3L3HB 4U4IA 5T3ZL 1NCWL 4L8BB 4W9JC 1PEWA 4WW2C 4Y0GA 4ZUTA 2GK0A 4ELMF 1QZ1A 1JV2B 4Q52A 4NQQA 2CNYA 5I6OA 5LN4A 4OCXH 2DWEB 5I17A 2Y36L 4LAQL 2V2WB 4HK3N 4F2MA 1E2ZA 2ZYRA 2C8NA 1FYTE 3C5ZB 5FF6A 3MBXL 4L8DA 1U8LA 3GXIA 4RQQB 1AVAA 3WI9A 3T1WA 3HE7C 2NNRA 2VN3A 2PMZA 1A6AB 4B9PA 1AE6H 2HPTA 3TBTA 3I02B 4XPBH 3T5WA 5J13B 1DE4A 1TFHA 3LEXB 3ULUL 2C5DC 4ISVB 4OD1H 1CDIA 4KTDH 1S7QA 5DHEA 5IW6A 1KLGA 2YEZB 3HPLB 4QD2E 4WKZB 5JHAA 4QR7A 1M2VB 3CFMA 3RVTD 3RZWA 1PG7H 4NO5A 1IKFL 4WO4A 3RRQA 3BFWA 4I1PA 3RNQA 4JFFB 4QTHB 2MFNA 3QISA 1BF8A 2VXUH 1OE3A 4GKSB 1I1CA 1PX8A 3Q6FA 1GGCL 2BNQA 4WUUD 1WBXA 3ASNB 1NGPL 1T1XB 2WGXA 1M3JA 3DIVA 4GSDH 2AS5M 3WO4B 3OKEB 4X4YB 1S6NA 1WFTA 2VMJA 1GPOL 5JHBA 1QI5A 1WZ1L 5EOTB 5T3ZE 1ASQA 3EJZD 3NA4A 4KJWD 4CMHC 3HAEB 2QKIC 1T6WA 1WC7B 4LKCA 1MLBA 2GTZA 4F8LA 4F27A 3Q06A 1N18A 2CK0H 3QRLA 2XKSA 1S3KH 2F8IA 2G4GA 4DETA 3O2DL 3A4FA 2OCCB 5D72L 2FJSA 1E28B 1I8KA 2EDEA 3W0WD 5DMJB 3ZE1E 4A7GA 2GT9B 4ZX5A 3OPZH 1U92B 3QR1A 1NBZA 1R5WB 2QZQA 2ATPB 3PG2A 3LRMA 3IGAA 1EFXA 1D7BA 4G2AA 4OGYL 3TJEL 2XFXA 4Z7IA 2V5YA 3U0PB 5KZCB 4NO2B 4GEJA 4Q7DA 5IVXE 2E7LC 3FCGA 1LEIB 3QO1A 3SBQA 2P5WA 1N8ZB 4HJGA 3ULUE 1F18A 3NFSL 3DX7B 4UV4H 3TFKD 4RETB 3MZGB 3B2VH 4P9HL 1CTNA 1V54B 5E8DL 2X05A 1FNEA 5ICYB 4WUUB 4E36A 4P2OD 3SKOA 5I1IL 1JE6A 4P9HC 1R47A 3ECQA 5HPMA 3SKUD 4LHUD 4PJFA 1Q9KB 4UNIA 5DZOA 3RVUC 3PS6A 2C9AA 3HZMB 1ZT4A 3BO8A 5AG8A 4IRJC 4YSRA 1D5BB 4D94A 2ZNXA 3H7BB 3BXNB 3H6JA 4NYLB 2MPVA 4GSQA 4UUJA 4X8XA 1JWSB 4Z7UB 2A5UA 3OVUB 4BK5C 1HSBA 1L0QA 1M6OB 2N0MA 5IIEB 3VJ6B 3FK3A 2I26N 2W9EL 5C0CD 3CDGA 5CZVL 2X9WA 1RZFL 2DQDL 3D5OF 3FB8B 4LSTH 3W0WB 4OZGF 4AYID 5E24E 5ISZA 4A2MA 4IIQB 1E9PA 1W80A 2J8UB 3K91A 5DLML 2HFFA 1XGTB 4ZX3A 3H3KA 1ANUA 4ELKA 3GI8H 4AYMC 3TBVB 2SEBA 1X9LA 3P30L 3FSZA 3A3YB 3VGBA 4XXCC 5DUPH 3LEVH 3V0WH 1KEML 4TQHA 5EIIA 4NCC1 2WVSA 4XT1C 3HMXH 3LRSB 1ZGLB 2CDFA 4P2OB 2X28A 1OCWL 4IOIB 2MIZA 2VAAB 4Q6IA 1ZTXH 2EEFA 4OVUA 3KL3A 4LHUB 1X5FA 3D9AH 3OAUH 4JFPA 5F7FA 2P80A 1FNFA 3RZCA 5GRYA 2VUOA 2EC9T 2HJFB 4L0YA 1NCDH 3ULAB 4C4KT 1KCBA 3TN0D 2QPUA 3T8XA 4LGRB 3KXFD 5BCAA 1D5XB 3II2A 2JKSA 3DV4A 2Y6SC 4UMGA 3B2UC 1J5IA 4OJYA 1BFTA 2XWBA 3EH3B 1K4CA 5I1CL 4JY5L 4IU3A 4TUOB 1AP2A 5JHDB 3SQBB 3NOIA 3VMNA 2L3BA 5F7EL 2HT4C 1WVZA 5AAMC 4LVOB 4F2EA 5EPMA 5KYYB 3P9WB 1BZ9B 4LSPL 3BJLA 2PYED 2XG5B 1RL1A 3MFFB 1HCVA 4P49A 4ZUWB 4FXKB 3WIFA 2F68X 5KEZA 3AROA 1AQDB 4PIRF 4WIQA 2OSYA 2VXQL 5FO7B 5B3JF 5M95B 2J56A 4HEPG 5CJOL 15C8H 3CVIL 2PF6A 3SSGA 5IMMA 5KTEL 1GJUA 4FFYH 3ZGIA 4A37A 5EZLA 1IBGH 5HTSA 3D4GA 1I53A 2OI9C 4CL7A 2YK1H 5TK2A 1Z5HA 5DRWA 3F6JA 3TO4D 2C1PA 2ZXBA 3P3YA 3X1NA 4BUHA 1XF2B 3KEHA 1LP9F 3RB5A 1U2CA 2TSBA 1YPZF 1RHHB 4XO3A 2WYZA 25C8L 3VFNA 5C0NC 2CR3A 1B0GB 4EBQL 3HZVA 2NSQA 2DTML 2XV0A 2YUWA 4JQXA 3RWIA 3TASA 2A9CA 5IFAH 2I85A 3KXFB 4M7KL 1E6OH 1P7QA 7TAAA 4I9WD 3CCHB 1L0PA 2D3NA 1H3WM 5J3HD 2ERJB 3MV7B 2E9WA 2Y06L 3Q5OA 1SYVB 2ZAHA 4DKEH 4AYFA 2DAVA 3DGCR 5IMKB 1XEDA 3EJYD 2K3HA 3RWDB 1T83C 4KMLB 2VO5A 4L4TD 4I18B 2B59B 4M6NL 4UBDC 4J4PC 2V8MA 3FFCB 5IESH 3ZHLA 3QXVA 4FMVA 4MNGE 4UTBL 4FA6A 2PYEB 2ZX9A 2B16A 5AOJA 3M17B 4GAAA 4N2GA 3T8VA 1E65A 1E8XA 1IMHC 1WCQA 3ZR6A 1X5YA 3O45B 5BPPA 4LEOA 3RWHB 4PJDA 3NACH 1P5VB 3N44B 2VR9A 3D4YA 4OF7A 4JKWA 4K3DL 3I9GL 3IDNB 2D0GA 1DVXA 3O41B 4AKQA 4DN4L 3FRUB 2XWRA 4R7NB 2VDLL 3MRMB 1N5AA 1OGAD 5TGBA 1J9TA 5CZXC 5E99H 4DZBA 4ZYKB 3K74B 1KCKA 1M1XB 2QV2A 4Y5VC 1KB3A 3THMH 2PPAA 4OV5A 4H88L 1G9HA 2OAAA 4FLSA 4FZ8H 3GMLA 5D6CB 2H3NB 3MRFB 1DDHA 3QZWA 4QRTB 4PS7A 4JLRA 1K8DB 3P40A 3KDMA 3CFUA 4YHYC 2Q2LA 1ZA3B 3G04B 1DBAL 2ZXCA 4LP5A 4YE4H 2A9NL 4PRPD 1TTBA 5CLYA 3IVKB 4K7PH 3QCTH 4DVBA 5DDHB 1YC8A 1YY8A 1KTDB 1JGVL 3EYSL 5D7JA 1O6SA 1OSPH 1FO0A 3IXTB 4XC3H 5CGTA 4G8GA 4NN5C 5E2TH 3VFWA 1X9UA 1HSAA 1DZ0A 3IPEA 4HUUA 3QQ4B 1WG3A 2APTA 1I85C 2R69H 4N0FB 1OP3K 4BA0A 1YNKH 5GS1A 3GMRA 2NNAB 2QJDA 3QJSB 2FHFA 4J5VA 1OGAB 5I1JL 4C8XA 5E1AB 2YPVL 3OJMB 2HVJB 5E8NA 2XV3A 2LU4A 5KW9H 3MV8D 4KROB 3CLEL 3PFQA 1BOYA 2VLRE 4JKNA 1F2QA 5CLTA 2RBLA 2RMNA 3U25A 4XVUD 4AE1A 1C5CH 1DN2A 3O3DB 2PPDA 2UZXB 4FG0A 2VXTL 2Z9TA 3BUTA 1HZHH 4MXVF 3G6AB 1DVFA 5DD5H 4CNIB 4H20H 2WLIB 2QSCH 2XTJE 4XE0A 5I1DA 4UF7C 5FOBB 5CJ5A 3L1OH 4K7PY 4HLEA 3GGWA 5CD3A 1RJZB 1CL7I 1QWNA 3CZKA 3EFFB 4QKXB 1H3VA 3TEZA 4HOZA 1ECYA 4PRPB 5DRXA 1N6QH 2OTUB 1BA9A 4Y2OB 3BT2L 2R0WL 3IK2A 2FNBA 1FE8L 3MMEB 4H1LG 4ETQA 1ZE3C 5I8CA 2FQDA 5IUCA 4OQ1A 3GSRA 1YY9D 5A1AA 2QR0B 2UZYB 4XHJD 3SJVE 1T22A 2KUTA 3SPVB 3ALPA 4ZSOE 1QO3B 1N3NA 5KSBB 2EH7H 2IH9A 4GRWE 1A9EB 4HKJB 3L9RB 3EDFA 3KPPB 8FABA 2JMRA 4GUOA 2F74B 4HQQL 1G7IB 4PG2C 4JPWL 2WIIB 4D8OA 3GJFH 2CO6B 4NERA 4QCIA 2WCSA 1YLBB 4HUWB 2AZAA 1OARL 2B4CH 2EYTA 1ZSDB 5C0DA 5LGHL 1DEEB 1NAKL 3GF8A 4NQCD 4NI6A 3TS8A 1N12A 3MLVL 1SDDA 2K6WA 1LEKB 4NEHB 3LHPL 3ZE2B 1VENA 3KPSB 1BGXL 2H0EA 1T4KA 2YPLE 3FQTB 4QPEA 5FHBL 3H54A 4KZEH 3ARDC 1TITA 4UT6H 5SWZE 4FI7A 1YN6A 1TMQA 1AZBA 1IC5H 2IXQB 4HK0B 1JD9A 1X4ZA 1JMXA 3MLXH 2IDCA 4FRWA 3BUBA 4F9LA 3CX2A 3GT6A 3BGFC 5F6IC 2FHCA 4TUKL 2BK8A 4V1DD 4K94H 5BVPL 4PY7A 3DJZA 5G2NA 5LAPA 1LE9B 3GXDA 2UVEA 3IRPX 1J1OH 3PY9A 3E6FA 1NCWH 2I27N 5EF0A 4PP2A 4IYKA 5IV2B 3EFOA 3C60D 3WKML 2BP3A 2FLMA 5BOPA 3T0DA 1ZIAA 1AJ7L 4RVBA 1U8JB 3VA6A 1MY7A 4KO9A 3UJJL 2H6UA 2AJZB 2WXOA 2CJUL 3BW9B 2WBJC 1HOEA 2HLFC 2K3TA 4PWIA 3BAEL 5DUBA 2CWRA 5DJ8B 2Y36H 4LAQH 4GNKB 1KTRL 1QQDB 1T0OA 2Z4TA 2LT9A 1REIA 3KW8A 3QDAA 5TF1L 3QG6B 1I7TA 4YNYB 3MBXH 5DXWA 4IHOA 3IT8D 3BP5A 1FL3B 5CIPB 2GJ6D 2ZXQA 1C08B 3LZOA 2AMGA 1P53A 2F7OA 3GLAA 4QXGL 4MDRA 1SNRA 5JIKA 3AXHA 4HT1L 5I1GL 1A6WL 1PLBA 1UA6L 2PXYD 3X1BA 4GAFB 5FYJU 5EF3A 5C6WH 1YSOA 1XX9C 4AJYV 4PJ8A 3LSOB 5DK2A 3BIAX 4I1NB 3QUYC 1IKFH 3RILA 1QVOA 4Z8FL 4P3DB 3QJFA 3V6ZB 1WO2A 4FQPA 4LDOB 3V6BR 2VDRB 3BVDB 3BAWA 4I48A 4Y2DB 4ODBD 2X3AA 4NPYA 1E4KA 4ZMXA 1DVYA 1GGCH 1WAAE 1O9VA 4ZXBD 1QASA 2BNUA 3P2TA 1H15B 4CDHA 1DCEA 3BH4A 2J3SA 5EC2A 4OZHE 2W59A 4HWZA 3L3HA 1U21A 3PUUA 3TVMA 4L8BA 2NT0A 2YD4A 1GPOH 1YUHB 4OF8A 3F2LA 2FB4L 4FA7B 1WZ1H 2QGBA 1MFNA 2H0JA 5E1QA 3ABLB 1XIWC 3SQRA 1D7FA 1WF5A 1I1AD 2QGCA 5ESQB 3KYOB 1JV2A 4FD0A 4ZFZB 3ZQXA 1E4XL 3FSWA 5JORB 3U6RB 2YD9A 3DIFB 2XJLA 3O2DH 2DWEA 3H0TB 4JO2L 5D72H 3P4MA 5DZPA 3EJUA 2CUIA 3SPCA 3LPGA 3ZRCC 1BWWA 2PXYB 2GJJA 5E08L 5HI3C 4JVWA 1TZGH 3OL2A 1MDTA 4OGYH 1T20A 2XQBH 3TJEH 4G80B 4J39A 4LCCB 2NY4C 5CEXA 4XE5B 4U1KB 5KBDA 3MJ7A 4JKKA 4YBLB 2NTFA 4HD9A 3STLB 4KRPD 3HPLA 3WFCL 4H5SB 1FVCB 1SEQL 2M1KA 3LOWA 3HZ3A 4WKZA 1BQRA 5AVSB 4O2EB 1FSKB 3B9AA 1CK0L 5DSCB 1ETZB 4P9HH 5E8DH 3FT3B 4ZXBB 4UANA 5MEND 1MWAH 5HGHA 4JHAH 5I1IH 4KFZC 2XETA 4QTHA 4NOFA 4RBPH 2ROXA 3MOAH 4MCMA 1NCCL 4BELD 4O9HL 1NBYB 4N8CH 1VAHA 3UJIL 3DTDA 1RMFL 2FE0A 1HHKB 3DTUB 3KEDA 1KY7A 3OKEA 4S1RL 5EMYA 4X4YA 2KH2B 1I1AB 1TFPA 2BPBA 2WW8A 3MV9D 2MNWA 4U6VL 4JKLA 5EOTA 4AEHL 3HLAA 1RY7B 4J3BA 3KPLB 4DKFH 1FUNA 3HAEA 2B2XL 2W9EH 4KKBD 1WC7A 5DQDL 5AZEL 5CZVH 3VXRE 4WJ5B 4OI8A 1RZFH 2DLIA 2DQDH 1IO4C 2APSA 3QWQB 2Y4SA 4PJGA 4R3SB 4EN3B 3S48A 4XPHL 2EDYA 4RFEA 3DHJA 5DLMH 3WTYA 1PX3A 1Y6KR 2A74B 4M8UA 1Q0EA 3KLSA 4KV5E 1E28A 4X6DB 4NFCA 1ZLVH 3P30H 2GT9A 3WLBB 4KKRA 1U92A 3ET9F 1BEYL 3MLRL 4TNVF 2BNRE 4KRPB 3LXCA 4NN7C 1KEMH 3N85L 4L1TA 1QABA 4PGDB 5K69A 3U0PA 1CLOH 2ZF8A 3GMPB 3HBQA 2WTRB 1LEIA 3IETB 2Q7AA 4Y16D 5ESAA 4G6KL 3N9GL 5I1HH 3OQRA 2E74C 3DX7A 4YZWA 3R06B 2NW2A 2COQA 5AKRA 3U2SB 5ICYA 2XOTA 2K9UA 3M7FB 1E8YA 4WUUA 1WBYA 4G59C 3NK4A 4E42A 4HIIA 4E9YA 3IDYC 2FECL 1TVBB 5AB0A 1AGFB 4I2XE 3HS8A 3LN9A 1OALA 4HMEA 1E0OB 3RAJL 3H7BA 3BXNA 3FRPB 4NYLA 3V9FA 4XMWA 3OAYH 1DYZA 5HI4C 1DBJH 4LZKA 4Z7UA 2J4WL 5I1CH 1JTPA 4JY5H 2HTKC 5EU3B 4XCCL 3ISWA 1MCDA 1EGJA 5IIEA 3J27A 3IMBA 2VSDA 5IEKB 3NSDA 5A2IH 2YGVA 3FU6A 3FB8A 2VKWA 3MU3A 3W0WA 4AL8L 4LSPH 1UT2A 4P2QD 3HHSA 5DRZB 3OKMB 4IIQA 2J8UA 1K5NA 4N86A 1WICA 3N44F 1XGTA 2VRAA 1QW8A 5CJOH 5KVFH 3CVIH 3OJDB 3DYMA 1HS6A 4OJDH 5T5FA 5KTEH 4OGZA 2DIAA 4UYQA 3QG7L 4TSAL 4P9ML 3LPPA 2X6BA 4A38A 3BYYA 4Y16B 5CKGA 4KUCF 1KN2H 2YD7A 1EHAA 3G6JE 1XGRB 3E1F1 4FG6C 2XJKA 1ZGLA 25C8H 4P2OA 2ILLA 4TTDC 4RMQA 1AZCA 1T1ZA 2VAAA 4EBQH 1M9SA 2DTMH 4LHUA 1XTMA 4IMKA 4M7KH 1JGDB 1I9IL 4YLCA 1SJXA 5DR5L 5EC1B 5LDSA 3OR7A 2WVVB 1J9QA 3QA3A 5BJTB 2Y06H 4TUJA 2CHDA 1X7TA 2ZD0A 4LLDB 2EO1A 1UWXK 2VR3A 2W9LA 4M6NH 1JZHA 3NH7L 4YXLL 1CZ8L 2OZ4L 1QRNE 1R3JB 4IOFC 4YHIA 5C0CA 1G0YR 3O2VL 4DAGL 1YVLA 2JIXB 4AC2A 1TR7A 2DMHA 4K3JL 4JY6B 4TUOA 4UTBH 4P2QB 1HL4A 3SQBA 1E5BA 4LCIH 3T0WA 4Z3EA 2HYMA 3ISYA 4HUNB 1JIBA 5ITFB 4X98B 4N8VB 3BDXA 5J1SC 4EUPH 5KYYA 1F42A 5AALA 3I74A 1JHLL 1JV5B 2VQUA 3NJJA 3UYOD 3MFFA 4LU5L 2OP4L 4FXKA 5DC0A 3RY5A 1UOKA 3I9GH 4K3DH 1AQDA 1JWUB 4DN4H 3WE6B 4B53A 1IJ9A 2GIXA 4BHUA 4LO9A 2LOEA 1DVTA 1HILB 2VMEA 5EIQA 3NCJL 3GPSA 2K6YA 4H88H 3SDCC 1II4E 1AHWC 3QJHB 1LWHA 2AP2A 1XF2A 3PL6D 3RIAF 3AG4B 4JM0A 3BVXA 2ADFL 5DO2D 1RHHA 2DMCA 1YA5A 3RTQC 1V3MA 1DUYA 2C9VA 3N42B 4PLJC 1ES0B 4HX1B 3PWLA 2XPGA 4FNLH 3F12B 2A4EA 5JNYB 3KXFA 2NYKA 1IM9B 1DANT 3FS9A 4PJEB 4I0PC 3CCHA 2A9NH 3ZQ9A 4OUUB 4B0MB 1SXSA 4GRWH 3GZQA 5AW8B 1SYVA 4K4KA 5HDQH 3B3IA 3OAZK 5DFAA 5IMKA 5HHXL 2ZSVB 5I66B 3DETD 3EYSH 3F7VA 2ARJB 3VE0B 4I18A 5I6XC 5FEBA 5FECB 3ZGHA 5C09E 3FFCA 3ESPA 5DFVC 1E3ZA 1NFDB 4NXSA 3CFTA 2ZOOA 1U2HA 1AR1B 1R9FA 1JYXA 2PYEA 2FT8A 3M17A 1JK9A 3MRBB 3AB0C 1XSJA 4KXAA 3O45A 4AYEC 3DX2A 2ZUVA 1I7ZB 1PY0A 1BIIA 4XN8A 1P5VA 2CCLA 2W0LA 1BF5A 1IZJA 2YPVH 4ANUA 4N5UA 4NNXB 2J5LB 1WFJA 5GZOA 5AVXB 3RGVC 4R7NA 3MZTA 5JIHA 1UZ6E 4PM1A 4E9QA 3MRMA 2G4EA 2R2BA 3L9BA 5LGYA 1PG7X 2CRYA 4X4KA 3APDA 4FQHB 1WE5A 3MRLA 1M1XA 3SQOH 3GDCA 2J73A 3RVVD 2H6PA 3M45A 3VXME 3DRTB 1YRKA 2UXTA 3Q8FA 1EHXA 5CGMA 1RPQA 1DBBL 3WUWB 3E3QC 1GJIA 4JRFA 4MZ3A 2L8AA 3HRPA 1ZE3H 1K8DA 1AQ8A 3QZBA 3BT2H 2F8XC 3MBEC 2R0WH 1ZA3A 2YGOA 1FE8H 4FERA 4UI2A 3CSYA 2Q7NA 3TA4D 4LPYA 4L4TA 3QXTA 3GKZA 3L6FB 4MAZA 4NQTA 4LASL 2VLKB 2X89D 1CGWA 3I85A 3UIZA 3IJYB 3CDYA 3ETSA 4W9HC 3JBG7 3GSNL 5LBSL 2V0AA 3I2CL 4GS7B 5F3BA 4HCRA 4HQQH 5CMAB 4JPWH 4IEFA 5C0BB 2IWKA 2JKNA 3OB0H 4FQ1H 2Y24A 4PHZA 2C4FT 1NCUA 1OARH 4AV4A 4W9EC 5LGHH 3HG1D 4BE5A 1NAKH 5GHWL 2EAEA 3BESR 1EIBA 2NNAA 5CU5A 5F8RC 2X0WA 2UWEB 4NQEB 3MLVH 4QNPE 2EIMB 1G6RL 2EZ0D 1OGAA 3LHPH 4FL4B 3V8CA 5E1AA 4ERSH 1BGXH 2LLLA 4JDVB 5FHBH 3MUJA 3L17A 1CLYL 3BPNB 3MREB 2VDPL 3PP3K 2I5YL 3FB5B 3QFJD 4H8VA 2IGTA 4DGIL 2VDNB 2BSSB 3VRIB 1I3GL 1OQOA 2UZXA 3O3BB 4OM1L 1DVSA 4CNIA 5C0IA 35C8L 2WLIA 1OV8A 4TUKH 1KFGA 5FOBA 2VZTA 5I1EL 3E3QE 1QP1A 3T3PF 1RJZA 3SGDH 5EH1A 4LPWA 1NGQL 4PRPA 1JXFA 1WFNA 3VNYA 4HUXB 3MMEA 3QI9B 4RDBA 4JFED 1XF3B 3X1EA 4TM9A 3MRGA 5LXGH 1VFOA 3FQWA 1Y07A 3JYCA 5EUOB 2QR0A 3SPVA 5HDBE 2WWNA 3WKMH 1AJ7H 1HEZA 5F1KC 3TV8A 1QO3A 5KSBA 3RDTB 1AS8A 1D5RA 4HKJA 3CQFA 2DZEA 4RESB 2CJUH 3KPPA 2CIKA 4GRLC 3WJLA 2F1EA 3BAEH 1GCYA 4LPUA 2WIIA 3ERXA 2GC7C 1L6XA 4HUWA 2NXYD 4R5VA 3OLIA 5TF1H 1ZSDA 4W9FC 4WI0B 2CCWA 4FQXB 3RJQB 5EU5B 1SQMA 5ABZA 2NYZA 4QXGH 4NB7A 1P0SE 4M6ML 3SYAA 1P1VA 1NEZB 4HT1H 3KPSA 4HXBL 1BPVA 1UA6H 3B5TA 5AB9A 1S7TB 5I28A 2YMTA 2DN7A 2OMVB 4NQUA 3ZL2A 1WA1X 2FEEL 4HFWA 4KRNA 4W9KC 1O6VA 4NKMB 4GQRA 1ACZA 5MEQB 3ZE0B 3VU1A 3T4AB 4OD2A 1W8NA 3BJ91 3VVVA 1E9QA 2E7HA 3B4NA 3L4WA 2BP0B 5D2LE 3NJKA 5IHHA 3N0PB 2CJTA 2P44B 4ODHL 5LDUA 4F8TA 4DERA 2WQ8A 3VGEA 2P8MA 1XMEB 1D3CA 4KOBA 3ZKMC 1PYWB 2H41A 3NJXA 4E9SA 5CAYB 1FFRA 2J25A 4LOUC 1JP5A 4MAUH 3IFLL 3LQMA 4RGNC 2ZYIA 4AV0A 3PCYA 3NEEA 4GXUN 4LCUB 4XAKE 4DPAX 1AGDB 2AJZA 1VJSA 4XNMB 3NJIA 4WVRA 3UTPD 3X3FL 4IIZA 3I6LE 4TQIA 2YKLL 1E4XH 5FR3A 2N7AA 4NQCA 3GO1L 1BQHA 4TLTA 2PR4L 4JO2H 3WXVL 5DJ8A 1QQDA 4LRIC 4LK4A 2EILB 5DU7A 4TUUA 4N1HB 5HHQA 4YK4B 3VXPB 4GQZA 1ORQB 2AAAA 1C08A 3SCMC 4YEFA 3Q8BA 3WS6C 3U36A 1T21B 1N0XL 3SE3A 2RH0A 3QH3B 3TBSB 2YD0A 3VI4F 4ZAKC 2WWMC 3TX4A 1HXMB 3UCQA 5FYKL 1F1AA 1RIHL 3DJRA 4V1DA 2M2DA 3LSOA 3J7HA 4Z1PA 4K15A 1CK0H 2HFGL 4Z7OB 3V6ZA 4PD4J 1D7CA 1KCUL 2ZCKL 4ZNEA 4F33B 4QRPE 3ARED 4ZOAA 2FD6L 3TPUB 1HZKA 1NC2D 4Y2DA 3LVEA 4L8SB 3MUUA 1NCCH 4OZIE 2XBTA 4X0KB 3UJIH 4N0UB 4XVOA 3UO1L 3GSQB 1PJ9A 2NW3B 2WSDA 3C60A 1RMFH 4G9DB 2OJEB 2HUHA 4L2YA 3H9HB 3VD2A 3UBGA 1XFPA 4H0HB 4S1RH 4OVVA 4MA1B 1M56B 4U6VH 1BFOB 1BP3B 1I9JL 4AEHH 4KKCD 5E6IB 2B2XH 5AZEH 1W72A 4X7DC 2JVUA 5DQDH 4NWUL 3HW7A 3SODB 1FFNB 2B1HL 3RX9A 5HYJD 1QFOA 1WS8A 4XPHH 1IAOB 4Z7VB 3U6RA 3DIFA 1G7JB 3EJTA 1B0IA 1NH6A 2GJ6A 3H0TA 1PDKB 5T8IA 1F4HA 4PJAE 1BVZA 2MEJB 2PXYA 5I9QB 4P2RD 3S34L 3T2NL 3EOYG 2OSLB 1BEYH 3MLRH 1IAII 3BI9X 1BFVH 3N85H 1SY6L 3IBOA 3VD3A 2JTYA 3ESUF 5AYUL 3QQ3B 4UINL 3CFKB 4YLBA 1MJJA 3D08A 3ETBF 1MCCA 3CFBA 4U1KA 4HOMA 4IBQA 1VCAA 5GGTL 3WYRA 3L1GA 2EYSA 3GLEA 4ZMPA 4H5SA 1FVCA 4G6KH 3AREB 3N9GH 5F9WC 5F88A 2XZCL 1R0AL 2GVYA 5FYKE 4ZXBA 1IC0A 5A43C 4CSTA 2IOIA 2OMTA 2GCYA 4R4ND 1F4AA 5FO9B 5DURB 2VJXA 3FO9A 1OTTD 1TYJA 2OKMA 2J6EA 1FZJB 4HWBL 4AJ0A 4XVTL 3S4SB 2ZKHL 1HHKA 4IJ3C 3Q9QA 2AZUA 3EJSA 1IJNA 1I1AA 2J4WH 3RJOA 4YSEA 4XCCH 1H8OA 4JCMA 3KPLA 3QIWB 2JCCF 2JKIS 4U0QB 5D70L 3UAEA 1QWUA 5IB2B 1LNUB 1ZHKB 3NAAL 3LIUA 4L37B 2CGZA 4ABQA 1AQHA 4EN3A 5CCGE 1H0DA 3ZRFC 1JDDA 1U42A 4F58L 1T66D 4X6DA 2ARWA 1NSNH 3AADB 3BWUC 3HRZA 3KJ4B 1MCSA 5IBLC 2ZUSA 1O0VA 1QSFB 1CE6B 3QG7H 4TSAH 4P9MH 3UCRA 3BVTA 5E5MB 2HPOA 1ZWIA 2E3VA 4JMNA 1I8IB 4PGDA 3GMPA 4MAYD 3D2TA 3KH4A 2YO3A 5F7WC 2CE6A 5MENA 4KKAD 1CLVA 2WJ7A 4P4KB 1Q8MA 1GAFL 5LGJA 3KH3A 1NKOA 2UX6A 1U8KA 2J44A 3R06A 2H1LM 3U2SA 3QUZB 1JYWA 5DR5H 2AXHA 4JB9L 1SRDA 3GSOA 4L29B 4PD4K 4Z7QB 3IMUA 3MRCB 4LP4A 1ZJBA 5AUMB 1DCLA 3SDXF 2NR6C 1AGFA 4XWOC 2Q0ZX 3MV9A 4PJBA 1VKXA 4DOHB 3PUCA 2QMJA 2YOCA 3IN2A 3NH7H 4YXLH 1CZ8H 1CT8B 2OZ4H 3FRPA 4U1IA 5GRXG 3O2VH 1CICC 4DAGH 1B4JL 1LL1A 3I6KB 4RAVB 5AVTB 2BX5A 1NUGA 4K3JH 1JG9A 3JWNG 2BVUA 3GMNB 1KIPB 4BFNA 2ICEA 5IEKA 2I07B 4A39A 2FT7A 2GJRA 3IMTA 5BO1L 3ARFC 1GW6A 2WY3B 1JHLH 3DI3B 3UAJD 5G4NA 4LU5H 2OP4H 5DRZA 3OKMA 1JGLH 5E0QA 2MPAH 4FKKA 3DYPA 3WCYA 3BVNB 2GAZB 3OJDA 2P8PA 4MX7A 2AV1B 2Z6FA 3LB6D 2B1OA 1A7QH 1GW0A 1PD0A 3AM8A 4Y16A 3MDJA 5TH2B 4G3YL 5F97E 4CVZB 1U8QB 1XGRA 4B9FA 4AW7A 1J5HA 2PCFB 1XEUA 1F56A 3FPYA 3Q9PA 4YDLB 4F7KA 5JIIA 2FLBT 1AIFB 3BKYH 5FYJL 2W38A 1KCRL 4C83B 3VWJD 2JB6A 1PQZB 4Q4EA 4NX0A 3OMAB 2WVVA 2FCBA 3DGDA 1GSMA 1ZDQA 1CFMA 2CKBA 4QOKE 1CVRA 3ARTA 1EAPA 1LEGA 5HHXH 4GW4A 4WI2A 1DN0B 5EU4B 5FC9A 4JQVC 5LG1A 1CYGA 1OAUL 1PKQB 4MXQC 4EEEA 2R23A 3FQYA 3VTTA 3PAYA 5GS2H 2FL5B 4OFVA 5IROC 1KPUA 4P2QA 1BVLB 3TA3D 3V10A 3GSUA 3RIKA 1DZBA 1IC7L 1RK1B 4GG6B 1ZVNA 3CZNA 4ZFOL 4X98A 1CDCA 4N8VA 3BIKB 2J2ZB 4PVBA 4L8CA 4LIQH 2NY1C 1ZY9A 3QDJB 5G5DB 2UWEF 5L4MA 1CB4A 4Z3JA 4AI7A 4PJ7F 2C9QA 2O4EA 2FWOB 3U6XA 4KKLD 4RRPA 5D2NE 5BRZB 5K9QG 4AYBA 3V5KB 3O6FD 4MJ6B 1HILA 3L7FA 5KN5A 3S7GA 3O0LA 1NUNB 3B9KC 1CD1B 2AGJL 3BAJA 1D9KC 1DEDA 3BPOC 3NN8A 5JHMA 4LCWD 4N5EC 4U1GB 3N04A 1FQ9C 1SDAB 1DBBH 2KS0A 5EBGA 5K1NA 3WXWL 2DQFB 3M8OL 4J27A 1RD6A 4GO9A 4YLQT 5CP7B 5H94B 4HX1A 3W3BA 2RACA 3MROB 1BJ1J 4K3GA 1N10A 4YVUA 2HT3C 3F12A 4PGZA 3SE4C 2XWCA 1IE4A 3FW6A 1VACA 4FS0A 5CILL 5JNYA 4PJEA 1AKJD 4ZW6A 2O6FA 1P84J 1XT5A 5FYJE 4RWYL 3EKCA 1Y6NR 1LVEA 5D1QC 3MODL 2XC8A 4WO0A 2WLLB 5I66A 3GSNH 2DLGA 5TQ2L 2ARJA 5LBSH 4YHOL 1FNGB 3I2CH 3ZQWA 5GRUH 1L4IA 4LLQB 3DDGA 1NFDA 2G5RA 4R0LC 1FYTB 4W9CC 5JXED 2HT2C 3JSSA 1XZWA 3GJFB 3RURA 4KPHH 4CMMB 4ZMAT 1A14L 1TQBB 3HN3A 5GHWH 1CMOA 1Y18A 2DQIL 3OLDA 5ACLA 2GB2A 4PJHE 1I7ZA 3UO8B 1PZBA 4OGXL 1G6RH 3U2IA 4Z5RB 4FNTA 3HE7D 1MW3A 3JTSA 5F9AC 1KYAA 2KPNA 3ZHNA 4AH2B 4AYDC 4U0RC 2IO5A 1FG2B 1Z5YD 1CLYH 2OK0H 2I5YH 3BSZL 1SN0A 4FQHA 5TDNB 1I3GH 5E2WL 4Q97A 3MLYL 4OM1H 35C8H 1AI1L 3RX7A 2PTUA 4MA3B 2PW2B 2YAHA 2FYYA 3N06B 3HI1B 3WUWA 5I1EH 5J11C 2R29A 3IRZA 1BLNB 1AR2A 1NGQH 4R4FL 4GAYA 1LO0L 4HUMB 1FGVL 3GMQB 5IWLC 4RMWA 1RZ7L 1CXKA 3ZDWA 3JV5A 4WW2B 3WFHB 2PO6C 5HYSB 3MN8A 1YZZA 3L6FA 4Y7MA 1G6VK 2VLKA 2CCVA 1QUPA 5C0RL 2HVKA 3IJYA 4X80H 1BBJB 4F24A 4NRXB 4DH2A 4JFDD 3AWGA 2WO3B 1XZ0B 1G84A 5TE7L 1JF5A 2WUCL 2CR6A 3GUFA 1UEYA 2DOCA 4NO3A 1E5YA 4X6CF 5I8EA 4HPYL 3QXAB 4NQEA 4YHPB 1GZPB 5DVMA 1HHJB 3GEFA 4M6MH 5IVXB 4ZG1A 2L04A 4HXBH 1A7PH 4M6OH 1HCFX 1G0DA 1EZUA 4JDVA 3NA9L 5SV3A 5BUPA 4KITB 3VGHA 4ICXA 4C4BA 5LQBL 3TT3L 1KJ2L 2FDBP 4EZJA 3FB5A 1HX0A 3ULVF 1GZHA 4W9IC 3VRIA 2XWJA 4R7VA 3O3BA 1HCYA 4QRQA 4O2FB 3H9SD 3V4PL 2V7HB 1VZGA 1OY3B 4Z7OF 1HN1A 3AACA 1CWVA 5ANME 1GY1A 3UG4A 4NLAA 5L0QB 2CAKA 3G5XA 5SX5K 43CAB 2YGPA 2X89A 1QFWI 1NBQA 2R56H 1XCTB 3D8MA 3RVUD 1BVKB 4HIEA 3T2QA 1E7UA 4HUXA 3VXUE 3QI9A 3W1ZA 4F7EB 3BWZA 2IWEA 4IRJD 4H1LH 1KOAA 2QKIB 5FA3A 3CLWA 4A2LA 4CMHB 1H8LA 1GTNA 4QY8B 1BJ8A 1T04B 2DQCL 5EUOA 1P84K 3WJMB 1VCBC 5E2JA 1Z66A 4AITA 3X3FH 4ODXB 5CBEB 1KZQA 1U6AL 3HG1A 3A6CL 1XWVA 1BG9A 2WNWA 1BQ5A 2YKLH 4XOAA 3WKQA 3GO1H 3W2DL 3II3A 3K7UA 3RWEB 3WXVH 4NRYB 5SWQB 3QO0B 2B3RA 2R1WB 4XN4A 3IGKA 4XBPA 3MO1B 4HGKC 4WI0A 4Q89A 5J1TC 4M5TA 3PWVB 1JPSL 1T2JA 1RUQL 3F5WA 4FDWA 1N0XH 4MD5B 3ZKQD 2VLLA 3CX5J 4NC1C 5B8CC 4W81A 1RUKH 1S7TA 2HVBA 2BIMA 2OMVA 3MACL 4N9OB 4OBRA 2GJZB 4Y4FC 3CHSA 5FYKH 1RIHH 2EINB 2Q7YB 5MEQA 5C92A 1X3DA 3T4AA 2HFGH 3QAZC 3OTTA 2ZCKH 2VXSL 3CIQA 3LZPA 4XP9L 4CJ0A 3S3PA 2FD6H 5IQOA 3AFLA 4KXZH 2L7QA 1NINA 4JFEA 2WQUA 1OP3H 4MMZC 3AWEA 3UO1H 4F1SA 2BDNL 4MSWB 4N0YL 1N0LB 4OLXL 4PRHE 5KS9E 4JM2D 2V2TB 4FGMA 4N2OA 2Y6SD 3X14B 5JPMC 1RZJL 3CVHL 2E6JA 4XO8A 1I9JH 3GBLA 5DCCA 2BP8B 2LLGA 1BM3L 3SO5A 5T1LD 4LCUA 3RIAK 1JGIA 1RZJC 3NIDF 2YAPA 1J0JA 2PKDA 4YJZL 1ET5A 2GFBB 2WMPB 1EJ6A 4NZJA 4Z7WF 1ZK9A 5JTWA 4R84A 3G08B 1RK0A 4MJ5A 4AK1A 1G9NC 1OHQA 4A7SA 3L4ZA 1ILUA 1IIKA