2YBGA

Structure of lys120-acetylated p53 core domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
191
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTASVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Acetylation of Lysine 120 of P53 Endows DNA- Binding Specificity at Effective Physiological Salt Concentration.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 191
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ybgA00
1HJCA 4IBVA 3D07A 4L0YA 1UOLA 3WTWA 2J6WA 3KMDA 3D06A 2OCJA 2H1LM 2X0UA 2PCXA 4LO9A 5ABAA 4IBUA 2YBGA 4XR8C 4AGNA 5LAPA 2WGXA 3EXLA 2IOMA 4A63A 2X0VA 1EAQA 3IGLA 4AGOA 2J1ZA 1IO4C 5AB9A 3WTTA 3US0A 4GUOA 2BIPA 4IBQA 1T4WA 4MZRA 2BINA 2BIOA 2BIMA 4AGQA 2XWCA 2J1WA 3VD1A 4IBYA 3WU1A 4G82A 2XWRA 3EXJA 2IOIA 2ATAA 2MEJB 2AHIA 4HJEA 4L18A 3IGKA 1HU8A 3D0AA 3WTXA 3WTSA 4G83A 1CO1A 1TSRA 4KVPA 3VD0A 4AGPA 3WTUA 1E50A 3QYMA 5A7BA 1EAOA 3WTVA 2X0WA 5G4NA 2BIQA 1HJBC 4IBTA 1LJMA 1CMOA 3WTYA 3QYNA 3Q01A 5G4OA 2VUKA 2RMNA 4MZIA 5G4MA 5AOKA 1H9DA 2FEJA 2J20A 2AC0A 4IJTA 2ADYA 5BUAA 5AOMA 4LOEA 1EANA 3VD2A 3KZ8A 4IBSA 4IBWA 4IBZA 1KZYA 3ZMEA 3Q06A 5LGYA 4QO1B 1TUPA 5AOJA 3US1A 2J1XA 4L0ZA 4AGMA 3D09A 4AGLA 5AOLA 2IOOA 3Q05A 2J1YA 2J21A 4LOFA 5AOIA 3D08A 5ECGA 5KBDA 4GUQA 1YCSA 2P52A 3TS8A 1GZHA 2GEQA 1GZHC 3D05A
chains in the Genus database with same CATH superfamily
2RH0A 4U1LA 3MRFB 1NCNA 2VL5B 1E28B 2CR6A 2DLIA 2VDKB 1SDDB 4GKSA 1L9TA 1KEGH 4NUJB 4YVUA 3SOTA 2ZYIA 3BPCB 4RQQA 3AREC 3U46B 5I18H 1H3TA 1UADC 2KERA 4P0DA 4KY2A 3I85A 1O5PA 4KWUA 2HKHL 4X4XB 3P0YH 1SVCP 4GPVA 1GY1A 2X1OA 3P3SA 4O2CB 5C0DA 4AMWA 1W6LA 1UASA 3NJNA 2WLLA 4HUWB 1CGYA 5K1JA 5ILTL 1NANH 5HHXL 2KQMA 1GOGA 1TNNA 3RB5A 6FABH 1EZVX 6TAAA 3WTTA 2IMMA 2YQ3A 5B3JF 5ITBL 4NOFA 2OJZH 4Q9BA 3A6CL 1HL9A 5DJAA 4XGZB 3QCUH 4KY1H 4PUBL 3WS6A 1F8TH 4LVOC 4JPWH 3D0LB 3T2QA 2DWEA 2QQLL 4XP5H 2ZXBA 1Z0NA 4HJEA 3MRMA 3IMWA 3L8QA 1QFWL 5AWNL 1F56A 4YSCA 4UIKL 3T3PF 4M5YL 2BSRA 3RKDC 4LDLB 3E8VA 4PJFB 1QHOA 1WFIA 5SWZE 5DTFB 3E2HB 1TXKA 3L81A 3WNPA 4F8OA 4Z77B 3KL5A 3HC0B 3CH1B 4Z76B 1UM5H 2WWNA 1LEKA 25C8L 3QFJE 2ADIB 2JCCA 3ROOA 1BZEA 3VSQA 3M8OH 1KB9K 1UB5B 1RZFL 1HHGB 2F54A 2YRZA 3UGUA 4HIHB 1A7QH 3Q0HA 2FEJA 2NY3D 2ENQA 1Q9OA 1G5GA 1T66D 2HKAA 3MCLL 1W0WB 4IHOA 4R7NA 2WZ6A 4XZUB 4ZUWB 5JDSB 1GGCH 2BWDA 3AQYA 2Z92B 1HZHH 3EFDH 3IKCB 4OFYD 1UXSA 3VXNB 1SY6A 3ASNB 3LRSB 3VD9A 2MSPA 1HOCA 3MLVH 4QKXB 5TQ2H 3QQDB 4IBWA 4J4PD 1KJ2L 3HHSB 4UQCA 5EN2A 4AL8C 5D9SA 2DIJA 3NJJA 3MX0A 1C16B 2ROXA 3KGTA 3MXVL 5D96B 4OLXL 5FUOH 5GS3A 5B7FA 5IQ9B 1P6WA 3CN2A 4E41D 3GSUB 4ZFZB 1QUNB 5GZOA 1T3FB 4OW6A 1K3ZA 4OJYA 4YJZL 4EOWL 2FEDC 3BH8B 2XJKA 3H7BA 4CU8A 1TOXA 4M93C 2LVEA 3O6LH 5JMOC 4G9DB 5I28A 3VXSB 3F7YB 2RAMA 4Q97A 5HYSG 2CCWA 4BEIA 4QRTA 2VXTH 2NTSP 4OD3L 5BUPA 1OZTG 2RALA 5AVYB 1AI1L 1J0ZA 1HWWA 1MFUA 5IVXA 2OR7A 3TZVC 4TSAH 2DQDH 2YO3A 5HHNB 3T4YB 4A68A 4MZ3A 1BVKB 3F05A 1I75A 2LU4A 3MRIB 2JI1A 5F88A 3BSZL 3CN4A 3O41B 4EAEA 1S78C 1FWXA 3UADA 2E6PA 1SXSA 3FB6A 4PS4H 2K3TA 3L2NA 4D8PB 3DLQR 3WEOA 3E38A 4DGUA 2YXFA 5D7IF 3MI6A 3NJGA 5F96H 3EOBB 4JFXA 4A2MA 5ESAA 3RE0A 2O93L 3PWJB 1ANUA 4YHIB 1NEZB 4RFOL 2EDNA 2G30A 1AFVL 5JDJA 2VLKE 5HHME 1BQLH 3G04B 3JTSB 5DHEA 1NIEA 3HLKA 5TE4H 3SDYL 5ISZB 2NY1B 4PJ5D 1R0AL 4PJGB 4PQXA 1Y1UA 1FLRL 1EA9C 1U6AH 2Y36H 3TA3D 4NWUL 3EHBD 3VTMA 1JVKA 2LE9A 4FJ6A 1SYVA 3BPOC 2EXWC 5MEQB 3QXWA 2XFXB 5EU6E 3T65A 5FHBH 2WTPA 3ZHLA 3RIFF 1A6ZA 4ELKB 3EYVA 2R23A 1WJ3A 1T03L 5E1HB 3QCVL 2K45A 1A8ZA 5DD0L 4TRPH 3V0IA 1M7UA 1RIVH 1VF5C 3UEZA 2GUYA 2CKBA 4ANKA 3ENEA 1R19A 2XXMB 3HNVL 5JIHA 1S9WA 4NN5C 3HG1B 5I1GH 4LOUC 1J5OL 1XIWA 3OD3A 1BFOA 4XHJD 2MJWA 2Z31B 5FV2A 2UWEE 4L4TD 2B1AH 2MHAA 2C9QA 3FTGA 2WBJB 4B9FA 1RU9L 4PJAA 4H88L 4YFLF 4FZEL 2ZOOA 3IJ9A 4J3UA 5TFSL 3RL2A 3AMKA 4DVRH 1FZMA 4JFYB 4PD4K 1RK1A 2OR9L 4R2GC 5FCUH 3IM1A 4KHTH 4U6XB 3EBIA 3KWXA 4U7MA 3FXIC 4YO0B 1AO7E 4OZHB 3FO9A 4PV1C 2ZOWA 1P84J 3VA2C 2QMJA 1PZ3A 3E6FA 4N0CC 1FF5A 3ECBB 2ITCB 3VFRB 1VGEL 4QHLA 3QJOA 1ET5A 4ZZKA 1SEQH 3JYBA 5F89B 2WZ0A 3CXHJ 4PJ8C 3T0AA 3EUDA 3NZ8A 3CFBA 2X4NA 1FRGL 1F6FB 1ZPLA 2VOTA 3PAYA 4XTRD 2ESVA 4B9PA 1I8LC 1NFAA 3RWIB 3VI4E 3BGAA 3B9VA 3OQRA 4I3SL 3OR6A 5TDPB 5CKAA 1JTTA 1SOKA 4J3WA 4WUUB 3HAEA 2E7MA 3FTWA 3SYOA 5E9NA 1LWRA 2DJUA 2PCXA 1EDHA 3FUEA 1URIA 3STLA 4F7TA 5AW3B 3CSPA 2GT9B 2IADB 5EF3A 3BKYH 3B6SA 1ZLWK 5SX4H 3GS0A 4DQAA 3NP4A 5IF0A 4N0UA 3B9DA 1RL1A 2X0VA 2IAAC 3NABL 3HOGA 3GSWB 2ZWLT 4BH7A 1EVUA 4HS3A 3TF4A 4OUOA 1RIHL 1I8LA 3ARFB 1Z5YD 5F1NB 4WV1C 2D4DA 2P43B 4XNAA 5F6HI 2ZF9A 3COOA 3DTXA 1QSED 2H1PH 3V7AE 2I69A 3PL6B 2UYLA 2Z7UA 3ZDXB 1HE7A 1L9NA 2XWEA 3CVBA 4M6NL 5DRNB 3JT2A 2QGCA 5FECB 3NCYS 4GBXA 1Z9NA 1HHHB 1KC5H 1EXUB 1LMIA 2CK2A 3JT0A 4PJDE 4AMXA 4M8RA 3WFZA 2EYRA 2Z4QB 4WU7A 5KS9B 4L18A 3GI9L 4NCC1 5C0CB 5EUOF 3IS1X 5D7LE 5A3ID 1S7RA 2FB4H 3QR2A 3O4LD 5I8CA 5JR1L 4MA3A 5D2NA 4K23H 4JAMA 1J12A 2DF3A 2I07B 4KZDH 3PDOA 3SPIA 1U93B 2IWGA 1MVUB 3IAPA 3HC3L 3LNEA 3WLBA 3ULUD 2DBJA 1OAQH 4HGWB 3RPBA 3FH8A 4K9EH 4NT6B 5DT1H 4TOYH 1MW1A 3AQDA 3VA6A 3MLUH 1ZT4A 5I2IB 1F2QA 2YAEA 35C8L 4PV8A 4OIFA 1DTUA 5DQJA 3ZIMA 5E1IA 2ZP0T 4XT1C 3PPEA 4LCWB 4D0BB 4PMEA 3QEHA 1TZGH 1XWVA 4K3JH 4NQXA 1OW0C 1FL6A 2C9VA 3MV01 3QT2A 3T0EA 4GO9A 1KFGA 4P5MB 2DH2A 3V5HB 3OAYH 4CC4A 2VWEE 2NY3C 4MGXA 4Z7NE 5DD1L 1QZ1A 5T1MB 4GI6A 5DEFB 2YR3A 1QFWM 2CR3A 2XWBA 2AAAA 1A7NH 2UZYA 4JFSA 2WCGA 4LEEA 4KI1A 5J11B 2HT4D 4MB5A 3BISA 1NFDB 2NY0B 3GPEA 4LIQH 4RGOL 5C3IA 1HIML 2HVJB 4XX1G 3KVQA 3RDJA 4MXVF 4M7ZB 4ZXBB 4R5VA 4LRNH 1J1OL 3NTCL 2HXAA 1MREH 4S0SD 2AMGA 3DYOA 3FQTA 5A40E 2FD6H 4YHKH 4PGEA 1CFNA 1RSYA 1FG9C 4CSSA 4DGIH 1SMDA 1R3LB 1XZ0A 4ZOBA 1WBYB 1H6UA 1DDTA 5E5UB 3SDDC 3GBEA 5FF6B 4PW3A 4OFYA 1CXLA 3TBSB 4UQ3A 5DMIL 2UXVA 1AD9B 3P9WB 1M7XA 4HXAL 1TTGA 2X4UB 1ZT7A 3QFDB 1HEJC 5D72L 3FFDB 1H6TA 4J4PA 3BAKA 3CCHA 5AZUA 5HGAA 1P53A 2AQ3A 4JUTA 3SGDI 4EI5D 5I1EL 3ZO0A 1EFXD 3U0PB 1TETH 4X9IA 3I9GH 2DLFH 4JPIB 2XJLA 3MPCA 2ZCKL 4KKAD 1NCHA 5DJ2A 1NGZA 4M61B 1FNEA 3OG6B 5ACZA 2UUDK 3S34L 4AC4A 4AYBA 4JVWA 2MQCA 1NCBL 1NL0H 1XR9A 5D93C 3EYOB 3EYSL 4KTGA 4P2OA 4BZ1L 3ZDZF 2Z34A 3OLGA 3TPUB 5AW0B 5FGBC 3RGHA 2V9RA 2ED9A 2KYIA 1HH9A 3TN0B 2P5EB 5CEZE 5J1SC 2F19H 2FLMA 2B59A 2QR0A 2PYEE 4UAHA 1JE6A 4JY4A 3BP4A 4N2BA 2E4FA 1BIHA 1G7JA 3FUMA 1B90A 5DZVA 4JEGB 5LCVL 5SWZD 3VXMB 4EDWL 3SGEH 4Y2DA 2BVPA 3ZGIA 3EHBC 3HPLA 3V8CA 3KH4A 3NJFA 5I8KL 5INCA 2J5LC 2A74A 1QBLH 1J5CA 5GRJL 4OJFL 3QFJD 5FAAA 3NIGE 4JDVA 1U8PA 4LQ1A 3QEQE 3AW5A 2IH3B 3AGWA 2R29A 2Q20A 2VXUH 4KKQA 3ELAT 4FQLH 4E9TA 4RAVB 5IIEA 1G7LA 5ICZA 1U30A 2KZ1B 4PJ5A 1R6VA 3F65A 1WISA 4OGAD 3IAQA 4XHJC 4HKBB 2BY0A 1EJOH 3HZKB 3TA3A 1FPTH 3ZMEA 1GXEA 1OAYH 2X1QA 3HE6D 1Y18B 1FJ1B 1YEEH 4KX7A 4OGZA 1XXFC 5GGRY 3U2IA 1KCRL 4C59B 1BZ9B 3GSRA 4GRMB 3BHBB 5SX4I 3E6HB 5EG6C 1CFVH 3QHZH 1P4LB 4BWWA 2YGPA 2VABB 1IGTA 3D0VA 2WSKA 1UACL 1N12A 2NXYD 3HBZA 4N8VA 5EORH 4PLNC 1C5CL 5EU3A 3IDJB 2A9CA 2YGNA 5EC1A 4HSQA 1KBGH 2YQGA 4PRAB 1JMXA 5I66B 3AXIA 2FECL 1W2KT 1QTYT 3IFPA 5I19H 4BZ2H 4W9JC 1NCOA 3OXSB 2LAGB 1HCYA 1AGDB 4L4TA 3WMQA 5IFJA 2XWZA 1K2DB 1OSPL 2UXTA 2ROYA 4AX3A 3V4VL 1MWAH 5H2BB 3HUJB 3IRCA 2WWKT 4Y8DC 4ENZA 5TQ0L 2Y3AA 3OMNB 5M95B 3FCTA 5F7EH 1N2RB 1OK0A 2F68X 3LNHA 4OZIE 5D6CB 4HUUB 1UFUA 4OLYH 4NO5B 2RCSH 1BFSA 1Q9WB 4APQD 1MEXL 5FYLE 1DL7L 1MWAB 4JBSA 4XOAA 4JHAH 4M5ZL 3SJVB 3N55A 2LFEA 4H1LA 5SV3A 2WSDA 3QXUA 3D9AL 4HAFA 3WO4C 2N4IA 2HKFH 2D3LA 4JO2L 4ODUA 5I5RA 5I6NA 2X4TA 5ID0B 1QR1B 5I17A 4EN2A 1ADQL 2VLKD 2Y1ZA 2WKOF 3WN5A 5HHMD 2ZCHL 2VDKL 5CCJA 4CVXB 3DIFA 1Q0YL 3WIHL 4RZCB 4F33A 1PTZA 2P7TB 2XN2A 5IVNA 5IMOA 4GW4B 1AGEB 4OCSH 5JPMB 1CURA 4PLOB 1YC7A 3DRTA 3GD1C 4S2SA 3OHMB 4JCLA 1EFQA 2JKNA 4P2RB 2E7LC 2WMPA 1M6UA 5EU6D 3B2DC 1KEGL 2DI9A 4OZFG 1BM3H 5I18L 4GO6B 5I9QB 2AQ1A 1U3ZA 2ZG3A 5EU5B 5EO9B 3ULUC 3MNVA 4I1NB 3NCJL 1R34A 3P0YL 4HFUH 4ZW6A 3MYJA 4ES9A 3KYOB 1HEHC 2QQNH 1OLLA 4JZJA 1R3JB 1L6XA 2XXCB 1TYRA 1X6LA 2BP8B 1DR9A 5CLWA 3U25A 1QSFB 3HE7C 4X2UA 6FABL 3E1F1 2E86A 3BVNB 4E5XA 3HFMH 3RNQA 4HUVA 3US1A 3HI1A 2J57A 1AO7D 1BOGA 2B77A 1BD2B 1TKWA 2OJZL 3EH3B 3LN5B 1CCZA 5F71A 4AYDC 3QCUL 4KY1L 2Z8RA 1F8TL 3ZRFC 2AKRA 5KYUB 3V6ZB 1C5BH 3AGVA 5GSRB 4XP5L 1NDTA 4DP5X 2R1WB 4TYUA 2I7SA 4F8NA 1EPFA 4MNQB 4ZMZA 3S35H 1P1ZB 1SEBB 2HT4C 1WBXA 2QDVA 4ABUA 1ZXKA 1NMBH 3DA0A 4G8GB 4MA8H 5TJWK 2MNWA 3RPIA 5JHMA 3W57A 4KKZA 1NAKH 2PN5A 1PG7H 5IBTH 3D85B 2X4OB 3SCMB 1OKEA 5I6PA 1OCZB 2HLAB 5DD6B 4KK5C 1UM5L 5IVZB 3D3VB 4UDUA 2Z0UA 3D2UD 4KRPD 4X5XA 4UUJB 3M8OL 3L1GA 3MBEB 3NA4A 5GGVY 1IB5A 2ETWA 3GXPA 1A7QL 2AV7A 5I15L 4LLWB 1ZJAA 5TPWH 5ADOH 1IO4C 1GGCL 3EFDL 1HZHL 5FO7B 3WNOA 2G60H 4K71C 4E36A 4U3XA 2QHLA 2B3IA 5ANHA 5A7EA 3CFMA 4Q2ZA 3MLVL 2AVGA 5TQ2L 4EI5C 1XCXA 1G9NC 2X89A 2NZ9C 5FYJU 1CTOA 1JGLH 2OMYB 4U1MB 1M9WA 2QV4A 3FSOA 3FFOA 3P02A 4ELMA 4GOSA 4M7JH 1CD1B 3MRHA 4KH9A 5FUOL 5I1AB 1W72H 1WCBA 1YNTB 3D0AA 3APNA 3ESNA 4HUKB 2QFRA 2HYMA 4HA1A 3JV4B 4QRPE 4A37A 4Z6AT 3U9PH 2I9TB 4GNKB 1MRFH 1DE4B 1M1XA 3ZIYA 1I1FA 1MQKH 3OZ9H 3DVGA 2SEBA 3QJQB 5D7LD 3TO2A 1JWSA 2FJFB 3O6LL 3OR7B 5CGTA 1YYCA 2XN9B 4APXB 1KIQB 1NIBA 1QQDA 2F9BT 4HETA 5HGDA 2H1XA 1BBJB 1YC8A 4EI5A 3FFCE 5DGQA 3VFNB 2ZSWA 5DVMA 4R3SB 2VXTL 4U6TA 4M1GH 4GRLD 5IW1B 5DRXA 1BWMA 3P2TA 3EOTH 5KVDH 1E90A 3RUGB 2DQDL 3F01A 2V4LA 3BX7C 4H0LC 4R7LA 1KPUB 2NLJB 3DXAB 4YBQD 2NSXA 4A2GA 4M6AA 3VDBA 2W0KA 3BLPX 4OFKA 2JB6B 5EZLB 2EDFA 3CFTA 3S37H 3MJ8A 4AJYV 4PS4L 5IV2A 1UZ6E 3UBHA 2NUTA 4IEFA 3MGTA 1JIBA 1XD0A 3QNXB 2OKMA 1MFCH 5F96L 1ASPA 5C0AB 4FEMA 3C6SB 1G7PA 2ODIA 1R1CA 1S2EA 3VMPA 3CU7A 1BQLL 4QHNB 3B3IA 2GBVA 4ZUTB 3P4NB 5CJBA 2J21A 5TE4L 4JL1A 2ZOTA 5EZPA 3AACA 3P30H 3QH3A 1IEBB 1WWBX 3PAZA 5TTRA 2JK5B 3KJ4C 4DGVH 3QO1B 2G0LA 2YXVA 3MV8E 4WWID 3HE6C 1U6AL 2Y36L 3IFOA 5BVPH 2BOCA 1LO0H 2XQYG 3FCUB 4I3RH 4NFCA 5CCGE 3H6JA 1RJZA 5DMKA 4RNRB 3G6JF 3KPMA 5L8JB 1PU0A 2W59A 3GTVA 4Y7OC 2FX9H 5F44A 4RFNB 4KO5A 5FHBL 2NXYC 2R69H 1VGKA 3ULAB 2C9SA 4K94C 4OIBA 2R9HC 1MRCH 4NENB 1N8OE 1EHLH 4TRPL 1RIVL 4AQ1C 2AGJH 2NXZB 1DQLH 2P4AB 2XSKA 4PWIA 2JJWA 5I1GL 3V4LA 1VEPA 1UWXH 3WS3B 2CM5A 2Y7QA 4MA1C 5ACMA 2B1AL 2AXWA 1V8HA 3KJ6H 4RA0C 5C3LD 4JZOB 1OTTC 1KY6A 1A7RH 4FQQB 4DVRL 3NDZE 1J8SA 1T4WA 4DAGH 4L29A 4P9HC 3P9LA 5FCUL 4KHTL 3E9TA 4EDXA 5EIVA 5LAXB 3K0YA 4APQC 3C60A 1E43A 1QO3A 2J4WH 3JV0A 4OF0A 5DHVH 2BSDA 4BXVA 4OBSA 4WI4A 4LCIH 2EDQA 2FO4B 2VR3A 1VIWA 3PABB 4WWOA 1E9QB 4PM1A 4YSOA 3GMMA 3IDUA 4QJ3B 3S48A 2IMNA 2L8AA 1C9SA 1SRDA 2I7OA 3QWNA 1SEQL 4FG4A 3RWGB 5KBKA 2Y22A 5FM5M 2VIRB 3JV5A 3EGSB 1CTMA 5KVFH 1X7TA 4Y16A 5DHVB 2WZAA 1T5WB 3OKKA 1QFHA 2Z6FA 1A6AB 3VFUA 4ZSOE 3WNMA 5CEZD 1KLUA 3O2DA 4W9EC 5E8NA 4Y19B 2PYED 3JV6B 4J3XA 3D39E 4APQA 2H3NA 5EBLA 5TK4A 4QRAA 3MROA 5AD0B 1ZGLA 2R39A 3UZVA 1YVLA 2BH0A 2QGBA 5DRZA 3P4MA 1L9PA 1BZDA 3PQYB 1RSFA 3K80A 1FVDB 2J2ZA 5JORA 2B15A 1ND0B 2A4CA 4HV8B 3BKYL 3BQUC 1PZDA 4FQXC 3NIDB 1AMXA 1TSHA 3QEQD 3T9WA 4W6YB 4PJ7E 4PJXB 5KSAD 2VLKA 2IH8A 3H4FA 4PJEF 2HPOA 3ARPA 4QMEA 1QKZH 2ZONA 5IFHH 4P5TC 2H1PL 1FCCA 2NY5H 3CFJB 4U6YA 3VGAB 1MJ7H 4NQEE 1XEDA 3GTTA 4PGJA 3FYIB 3ABGA 5HY9A 1LL1A 2XWDA 1KC5L 3TBVB 1MZYA 5DC0A 4UZGA 4IS6A 4NQUA 5EU6A 4YSRA 2DKUA 3C12A 4ZOAA 5AENA 1EAPA 2FB4L 2YJLA 2AXFA 5BMFH 3GJFH 4F7MA 3NJXA 5KW9L 3BVVA 4K23L 2LQRA 4KZDL 5B22A 2YK1L 4WHYH 3T2NH 4J28A 1UWFA 5CAYB 4J3OF 4TVUA 1J8RA 2IANB 4HBQA 5LGJA 1OAQL 4K9EL 4MJIB 3EJUA 4BUQA 2UWEA 3GXTA 5DT1L 4TOYL 5FDWB 4FNUA 3GJFB 3MLUL 1DVXA 4NRYB 1JV2B 3ROLA 3D5OF 2IBBA 3ZU8A 1UH2A 1P2CA 3ALWA 4HUNB 2B7DT 3FQXB 4AIEA 3MRRA 4CILA 4F2ME 4G80B 1AO7A 1TZGL 3H54A 5F0LB 3NN8A 4K3JL 3ARDB 4EN3C 4N2DA 1JGDB 4KRPC 2DMCA 1E67A 2ZYHA 5FYLD 3B8SA 3MRPB 1X5GA 5ECJE 4F5CE 5HDLA 3G6AA 5DMYA 3W0WE 2WW8A 2EEBA 2W9LA 1WAAE 1TMCB 2XYCA 3LS4H 4IK6A 3L3HA 4ZAKB 4OCLC 3BGMA 5DFTA 2VQ4A 4OGYH 3ZE2E 4AENB 2G75A 3ESVF 4A04A 1A7NL 4L3EA 1QVOA 1YG9A 2CIIA 3QIWA 5DGRA 1CN4A 5AVSB 4Z18A 1HXYA 3VI4A 4BGLA 2A77H 1F3JA 1AZZC 2FQDA 3AG4B 2BNQA 1MLCA 2FX7H 4LIQL 5F72S 1U42A 1E2ZA 3AWFA 5KSUA 3BN9D 1IJNA 4KKBD 4LRNL 4M03A 3EJJX 2Q76B 1MREL 5C0ND 2R83A 4C54A 2FD6L 4YHKL 4I48A 1IGJB 5K9KB 4DGIL 4O2FB 5EULV 2ZWZA 4XRCB 3X1EA 5HHOB 2XG4B 4IGBB 3HB3B 1T6BX 2MCAA 4WJG3 5F3HB 2BHUA 2Y69B 2Z7WA 3Q2NA 2ATKA 1KV7A 1XGQB 4QHMB 3CDGA 1LE9B 3DO7A 1X4XA 4IRSB 3QJFB 1N3NB 4YAQA 2C4FT 3ULVE 2NW3B 2YC1B 4O9HH 4ZOCA 3BXNA 4LPTA 1TETL 4GRLC 4X5PA 1NDMA 3SZ6A 4ONHA 5IUCA 2H6OA 3I9GL 2DLFL 2C26A 4WGVB 4YBQC 4AIZB 4X6DB 3FF7A 4CJ1A 2J1XA 3GMNB 3IWUA 2QVKA 3CFDB 3ME0B 1NL0L 4UTBH 5D7LA 5FOBB 4LHUG 2AXGB 5IB5A 1P7QB 4XB3A 4LOFA 3SKOA 2CJ3A 3PWVA 5L2KB 2MIZA 4J12A 3UAEA 2EYSB 4CVZB 4P46B 1HYRC 2ZAHA 3FUHA 2DIAA 2F19L 3B56A 1XF4A 2K78A 1A3ZA 5ACLA 3S8WA 1W91A 1S7SB 2I25N 1BXXA 5T1KB 3TBTA 1A9BB 3BZ4A 1YSOA 1UJTA 5DVPA 5ABAA 1DVSA 4NS0A 4XXWC 4HOZA 1PS3A 1J1PH 2CXGA 4RMUA 5HD8D 1I8IA 1JV5B 4FQHA 1QBLL 5B7MA 1KGJA 1ZRUA 1WYJA 3O9WD 1BAWA 3QEUA 3QIUD 5LO7A 2J1KA 3BDBA 3UTOA 3A5VA 3AUWB 2VXUL 3QUZA 4FKEA 4FQLL 1I3RA 4K07A 3MBXH 3X11A 1YQ2A 3I74A 1K5NB 4NJAH 2XBTA 3MREB 4WEMB 1T83A 2C7UA 4ETQA 3NEEA 3AQZA 4RAUB 4P57A 1EJOL 1LEIB 1FPTL 1FZJB 1OV8A 1OAYL 3HPJB 4FQJH 3UTPE 3I9IA 1DZBA 2WWOA 2ZPKH 1YEEL 3HG2A 4BE6A 1DBJL 3EJCA 2UY7A 4Z7QF 5DK2A 5DURD 1CFVL 3IJEA 3QHZL 1KYAA 1NGPL 1YJDC 5EORL 3HJEA 2BVUA 2PO6B 1OGTB 2NR6C 2VLRB 3V0VA 4U1LB 4N6RA 4NHCH 1U58A 1KBGL 3OKOB 4QRPD 4O4YH 3RWEA 3TJHD 4GKSB 1JXFA 5I19L 4BZ2L 3WE6A 2B1HH 1G7IA 2F7RA 4RQQB 1DVTA 3ZMRA 3E0GA 2WXNA 5GSVA 2TSAA 2RBLA 3L3OC 4XN9A 1ZSDA 3FCSA 1MWAL 1JYXA 4FNRA 3SQBA 3TT3H 1BYOA 1FL3A 3FFCD 1FSKB 3ZE1E 4F8TA 2Q1EA 2E7HA 5F7EL 1BSIA 1KGUA 5AOMA 1PIGA 2QVTA 1NLDH 2C7FA 4OLYL 2ITEA 1AQ8A 3PE9A 3PS6A 4UTCA 2RCSL 3WGVB 5T3XH 1MNUH 2ZKMX 4OZGB 4JHAL 2IG2H 4OLVH 2IGFH 4W9ZA 1IZJA 2G2RA 4ICXA 4KX8A 5DJAB 3AG3B 4CNIA 5INDA 3ARUA 2BDNH 3QQ3A 4I13B 2XRAH 4PH8A 4FNLH 2HKFL 4XVJH 3LJ3A 2DWEB 4HGMA 5IQNA 1U8IA 3MRCA 2OSWA 2X9WA 2BVQA 5KZCB 5E4AA 2Y6SC 2O6CA 2W88A 3RYMA 1XF5A 2HLFD 2BSRB 1P9MA 2AMUA 3K1DA 1TMQA 3MV8D 5A6MA 2APXA 1I8KB 1WFJA 4KI5F 4XBGA 3KCPA 3H2WA 4OCSL 2XNAA 1LEKB 1ED3A 1SY6H 2JCCB 4OI7A 3ROOB 1HXMA 3CVIH 3QEQA 3CHOA 3F62A 2YARA 3I75A 3KEDA 1BXUA 2F54B 2VDLH 3ML9A 5KSAA 4G1MB 2ZNXA 1BM3L 1O9VA 1OTSC 2HPTA 1WEJH 5F9WB 4R7NB 1Q9OB 1GZPA 4F58H 4IHOB 3MJ7A 4JHWL 3V2AR 5J7CC 4AQEA 1UXSB 5GS2D 4HFUL 1HOCB 2QQNL 3BVDB 1HVXA 2VDLB 3HFFA 2V9QA 3N0PB 2GITA 3ILQD 5EN2B 2OSYA 5D9SB 2CHZA 1MCDA 4ZK8A 3MX0B 4N2EA 1A9VA 1FNHA 5E4EB 3OF6A 1IFRA 1AHKA 3IF1A 2Z35A 3HFML 4NHUA 3TEZA 1XFPA 3C5ZD 3QUGA 4LVNC 4N87A 2C9AA 5SWSE 1R4XA 2QADB 1LNUB 2WB7A 1INDH 4Y7MA 3H7BB 2CHDA 1UD5A 1XB8A 1C5BL 1DLHA 4ZFQA 1AH1A 5E2TH 4A2LA 4QXGH 3ZKXC 2Z91A 2CBPA 5HHPA 1XBRA 2FVNA 3S6CA 4BFJA 3S35L 4P99A 1E6JH 5EF0A 4IBTA 1NMBL 4QRTB 4MA8L 3BZEA 1MCRA 1PG7W 1NAKL 1PG7L 5IVXB 1PX8A 1C5DA 1BQSA 1FNFA 2DQGH 3ILPA 3D39D 4KKBC 2ALAA 1SLUA 4BIKA 4EZMA 5J13C 4GG6F 3FCGA 1JN6B 4FDWA 3DV4A 3FB6B 1WDAA 3BIKA 1J9TA 3D2TA 5ADOL 5TPWL 4IBZA 2OYPA 1LO2H 2Q2EB 1UA3A 4JFXB 4OLEA 2OJEA 5ESAB 3VQ2C 2G60L 2W1NA 1J5HA 4KPHH 1O7DE 4EIGB 5I1HH 1NIFA 3KBFA 2B9AA 4LPCA 3RPKA 3CHQA 2ZUWA 5LWYH 1AG6A 1OPOA 1H3VA 5HJGA 1U2CA 2JJSA 5JQ6H 1CLYL 4LNRA 1JGLL 2Y3NA 4BA8A 1YEHH 3CPLA 5DS2A 3IDYC 4M7JL 3MOQA 4HKXB 2XXGA 4NQED 1V7MH 1TJIH 1W72L 4I0PD 3RVXD 2CKBH 1JHTA 3SE4A 3OKMA 4XXCC 1FFPB 4M8QA 4BQCA 3T65B 1U8JA 2GFBA 4LEOA 1CT8A 4Q6IB 3U9PL 4L0YA 1A6ZB 1C12A 1NKOA 1R3HA 2D73A 2ICWA 2JWYA 1MQKL 3EYVB 1O75A 2YEZA 3OZ9L 3QAZC 4O00A 3ZE0F 3OC5A 1AZNA 4KK8C 3PWLA 3Q9QA 2CKBB 4PRHE 1YEFH 3T71A 4OF7A 5CZXC 1S9WB 2IDTA 2XN1A 5I82A 3X14A 3OMAB 4N0YH 4AYID 1XIWB 4M1GL 4XMZA 1LLAA 1BFOB 1FN4A 1WAEA 4FXTA 3FTGB 5KVDL 4IOFD 4Z3FA 1YPZE 4PJAB 4EXKA 3CIQA 1BW8A 3RL2B 1M05A 1T04A 1P6AB 2W8CA 1A64A 1XDTT 5I8OL 1RK1B 3V0FA 5HD8C 2ZCZA 3L6FA 3EFFA 3MXWH 5TF1H 3S37L 5E5LA 3QIUC 1EZSA 3O9WC 1S5HA 2MTAA 1CGSH 1MFCL 3E6FB 3NEOA 1TQUA 5GPRA 1G6RA 4DT2A 3B5TA 2BC4A 3W0WD 1KELH 3ATBA 4XNZC 1BQUA 2APSA 3HAEH 4YLBA 3X13A 5LXVA 3L5JA 1C7SA 5IFAH 4FCAA 3P30L 4NNXA 3CFBB 2X4NB 4DGVL 4PJBE 2EKJA 2ESVB 4QOKA 3SBWA 5KVGE 4Z3HA 3WTUA 3TGXA 5BVPL 4HISA 1EAOA 1IGIH 1LO0L 1VACA 3M88A 2X0WA 1K8DA 2C9XA 1JXDA 3OR6B 4I3RL 4PRIE 4OI9A 2DYRB 1XH0A 1I82A 1XH3A 4K15A 3HAEB 4D7BA 1MAMH 2FX9L 3C8HA 4OIIH 3WDHA 4QHUA 4LVEA 2R69L 1F11A 3BZFA 1O7SA 5JHDB 3STLB 1CDCA 1MRCL 2FH6A 2YBRA 1EHLL 3B6SB 2WM0A 1NFKA 4ZX5A 2IFGA 3RNKA 1JNJA 1NA8A 5IF0B 2AGJL 1DQLL 4N0UB 3RG1C 4BH7B 2HG5A 4HS3B 1DYZA 2WLKA 3ZHFA 3DTXB 4ONOA 3KJ6L 3W3BA 5AW7B 2UYLB 2Q86A 3ULVD 1L0XA 4RDQG 3D18A 3NCXA 1A7RL 1DVFC 2MQ0A 2MTPA 4GBXB 4JQVC 1D7DA 2YOAA 4CRPA 1BMZA 3CFQA 4DAGL 1ACZA 2J4WL 3RZCA 2EYRB 4WU7B 3P3RA 4LCIL 4WVRA 5E8DH 1L5GA 1S3RA 1S7RB 5I8CB 3CE1A 4MA3B 3RY5A 4NX0A 1AD0A 4WK4B 5D2NB 2MCG1 3OJDA 4JAMB 1FYTE 1UXLA 4LZKA 2CG9X 1MXDA 3HA0A 2WY3B 4E9VA 3G6JA 5KVFL 4BDVB 4NBYB 5F3BA 1U36A 2PUQT 2YD0A 5F1KC 2WYIA 5CR8A 4AITA 3T3MB 2HLFC 4ALAC 1PAMA 3S3BB 2XY2A 1ZT4B 2DBLH 2MOGA 2IO5A 4XR8C 2YPVA 4PV8B 1T22A 1NGXA 5JPNC 3K4ZA 4V2CB 1OWRM 2Z9TA 4RMQA 4FMVA 4KO6A 5FS5A 1CLVA 3QEHB 5HJ3A 2XLLA 4I8DA 4NQXB 3WJLA 1FL6B 3T0EB 3NZUA 5E56A 4LGRB 12E8H 1Q9KA 4IBQA 2CM6A 4GKZA 4UOQA 2FHBA 2JQMA 2RD0A 4JDZA 4LSRH 1UVQA 4UT6H 5HVFB 1ERNA 4D2NA 5D7IE 2KI6A 1GIGH 5IFHL 2XWBB 2FQEA 4Y4HC 2NY5L 5I73B 2UZYB 3DX7A 1USZA 1MJ7L 5JPNA 3MV8A 5FX3A 1I8AA 1Q1PA 3ILQC 3CDFA 4NO2A 3QWOA 3UTPD 5F6IB 3TBCA 2EIEA 1SXZA 3C5ZC 1H5BC 1NCGA 1M53A 5E1QA 4ZQTA 2CO4A 3FQTB 1PQZA 1CGWA 4JRWA 5DMJB 5LLIC 1CFNB 2BIQA 4KROD 1XZ0B 5C86A 4RWYH 4WU5A 3T2NL 4UQ3B 4UM8A 2EE9A 3KLAA 4JRLA 5G4MA 3RDTB 4DN4H 5JHBA 4MA7H 1ZT7B 4CN6A 3FTSA 4JJ5A 4E0RA 2N59A 1H8SA 3CCHB 5HGAB 4HSAC 3N5AA 4KZEH 2ZF8A 4YZWA 2XIBA 5AAPA 5KYWA 1MVFA 1SYSA 5I1JH 1K4CA 2BS9A 3VFPA 1TR7A 1GS7A 5G2NA 3KDMA 3L7EA 5AALA 5DJ2B 1NGZB 3O3AA 3HS0B 4K5OA 1FNEB 2CR0A 3RJOA 5ACZB 2D0HA 5B1AB 1OP3K 1XR9B 5DZOA 3GS4A 4HOMA 3OMZA 4I9XA 3UZQB 4P2OB 4RSVA 3MLSH 3LS4L 2CPCA 4L3AA 5AZEH 1RZJC 4OGYL 3D08A 3FUIA 3WMPA 2DY2A 1OSEA 2P52A 4GS7B 1IBDA 1MJJA 5CP7A 1HH9B 3O11B 1T80A 5ADPH 1Q94A 4G7YH 1O9ZA 2A77L 4ZSOA 2B59B 2W9DH 2FX7L 2BSCA 4JY4B 1B9ZA 3BP4B 4FNPA 1G7JB 2R29H 4BCYA 4WHCA 2OLDA 4Y2DB 2BVPB 1KLFA 3RVXC 2VRKA 2P8PB 3HPLB 4Z7UF 1M9SA 2BWIA 1PZAA 5INCB 3Q3GB 2A74B 1ML0A 2EDHA 4N2OA 4N2KA 1JZEA 3SIKA 3QJZA 5BOZG 1WIUA 3APDA 1V3LA 4WJ5A 4XMXA 4QAMB 4X83A 2WGNB 1CGUA 2DI8A 2VO5A 3KD4A 4X9HA 5IIEB 1G7LB 5ICZB 1KGWA 1TQBB 1I53A 4PJ5B 2EH7H 4QO1A 4O9HL 4NQEA 4UF7C 1CXHA 3TA3B 4I0PA 4IOFC 3TH2T 4N5UA 4HCIA 3TP4A 3EHBB 4E2OA 4HLEA 4G82A 3DMMD 1OOWA 4FLHA 3GSRB 4X7SH 4UTBL 1DQDH 1IGTB 3D0VB 3ZZLA 2BNRE 4N8VB 3Q44A 5EU3B 5FKPA 5SWSD 2ZX6A 5EC1B 3VQMA 4WW1A 3NFSH 4UINH 3U2JA 3PGCA 3IFPB 1WZMA 2WWMD 2JKXA 1WUZA 2X3CA 3C6EA 1TTCA 3VJ6B 5ICUA 4L4TB 4G59C 5IFJB 1CMOA 1LJMA 4EVNA 2Q3ZA 7TAAA 2WTOA 5D5MF 4H20H 4H1LH 4M4RA 1JZHA 5F7LB 2EKSA 1DVUA 2IAMD 4QXUH 4F2MA 1J1PL 2NQCA 3F6IA 1CF8H 3QUYD 3HZVA 3O0LA 4ESKA 5A2FA 4H1LB 4LBAA 3CVDA 2VKXA 1DBKH 3U79A 4KU1A 2NY2D 3MBXL 5DQ9B 3MLRH 5GGTH 4NJAL 1IM3D 2WD0A 1I3UA 1E4XH 1M3IA 4ODUB 1JAEA 5CJ5A 2X4TB 1DQTA 5IBUB 1FVCA 4RIRA 5I17B 2UXGA 3CK0H 2ZUUA 3BKJH 3WN5B 4FQJL 2ZPKL 1E4WH 1KWGA 1NTDA 3ULVC 1KBPA 3DIFB 3LPOA 4R4NC 4WWNA 5AW9B 4F33B 3A47A 1MCIA 5IMOB 2LTQB 4L1SA 5L4MA 4W93A 1SLWA 2NYKA 3DRTB 2MNUA 4H44C 4S2SB 2J73A 4KNUA 4QRRA 4BHUI 2Q8AH 1KNOA 3MRKA 4ZD3H 4NHCL 5C08E 1MCCA 4GAYA 1P84K 3MLYH 2B1HL 2DTMH 1LEGA 1HILA 3UTZA 1EZUA 3L3IA 2Z8VC 4G42A 3WV0A 4U0RB 4LQFH 1OAUH 4P23A 4WO4B 4PRHD 1VB9A 2NX5E 3CXHK 2YWYA 3TT3L 4ANVA 3IJYA 1VZHA 4K55A 3RJQB 2B14A 3MYJB 1PW3A 2XI9A 4B9CA 2KC0A 4JZJB 4P8QA 4PW4A 3PWUA 4AKPA 5KEZA 1NLDL 4R0LB 5TH2A 3L1OH 1KXQE 4YNYA 1AQKH 3TCLA 2DOCA 4PJ9D 5T3XL 5I1KH 1MNUL 5IROD 1NKGA 4ELDA 3HG5A 2IG2L 4S0HA 2HRLA 4E5XB 4OLVL 1ID2A 2IGFL 3RNQB 2M1KA 4HUVB 1HT6A 3HI1B 4XPTH 5LGKA 1GCFA 1BOGB 2ICES 1E3FA 2G3MA 3IGKA 3QIBD 3KWUA 2BDNL 5G5DA 4MHHI 2XRAL 2V8LA 4FNLL 1YEJH 4P05A 4LCCC 4XVJL 3KR3H 2VLME 4TL5A 1OB1A 5FO2A 3UJIH 1T7YA 3KVDD 5L0QC 1G9EA 1E4KC 1KUMA 4X6CE 2H47C 2EXYD 2F8IA 3RPIB 3WTYA 2GTZA 1N9PA 3N04A 1T21B 1I1AD 4PRID 3HJ0A 5F0JB 1M6OB 3MUJA 3TWCH 1SY6L 2VW7A 1I85A 4UDUB 1IU1A 3B83A 3CVIL 4PJFF 1AKJA 1L7TH 4XE5B 1MCBA 4NAQA 3WFCH 3U0WH 2VDLL 5PCYA 2B16A 4KROC 1LXMA 2I27N 3WKPA 2K6ZA 1D2PA 1K8IA 1WEJL 2AV7B 2WKLA 1SLVA 4OY9A 4XX1E 1W16A 4TL4A 4F58L 2AEQH 1NEZG 1II4E 3D1MC 2JF1A 4WAFA 2OYLA 4CUCA 3EO9H 2EC8A 3DI3B 4Q2ZB 4CDHA 2LU5A 1XF3A 4RAHA 3QZOA 4ENEC 3CWGA 4FXKA 4FE9A 3JBG7 4F9LC 2DM2A 3UTSE 4YLQT 5AKSA 4ELMB 1WCBB 1Z3GH 3U7WH 1ZS2A 4G8IA 4KNSA 3V8OA 3RI5F 2XX1A 3MOAH 3Q6GH 1INDL 4M02A 1J87A 4M29A 4K3DH 1M1XB 1I1FB 5FR3A 4NWTH 2SEBB 3TO2B 3RVUD 1UOLA 3LQAC 1JWSB 5E2TL 4QXGL 3UXFA 1FYTD 1QQDB 1AYOA 2DKMA 5DWUH 5HGDB 4KMTH 4EI5B 4LF3A 4F9LA 3WFHA 2FUQA 1E6JL 2ZSWB 4YDKH 3SDAD 1NBCA 2FLBT 5DRXB 5DZJA 2BVYA 1IC5H 1BDYA 2DQGL 2X4RB 4GEIA 3T8XA 4P06A 4UILH 1FZKA 4UYQA 3A6BH 1CICA 2DEXX 2YXMA 3CNKA 4W81A 2ORBH 3SYQA 4MZ2A 3TVMD 3HKFA 1HCZA 3MJ8B 3AT8A 3QBTB 4AVIA 5A2BA 5IV2B 5FO8A 2NUTB 4IEFB 3MGTB 2WXMA 1KY7A 3MRBA 5JXEA 1LO2L 1H15B 3ISRA 1SHWA 4KPHL 5I1HL 2EIKB 2K6YA 1GOHA 4XBMA 3RVTD 3TO4D 2XPGA 4Y5VC 5LWYL 2MOQA 3B3IB 4TNWF 4YBLC 3B4NA 2Q9OA 1DQJA 2D8KA 2VMEA 3QH3B 1R3IH 1YEHL 3VVVA 3W38A 4U1HA 3AB0B 1D5RA 1V7ML 1TJIL 3GSNH 2QGEA 4XH2B 2BOCB 1MCKA 2GVYA 3DMMC 3ET9F 1ZLVK 3M1BA 2XZCH 2ZE0A 3V0GA 2CKBL 3LPGA 1RJZB 4A7UA 5A7BA 1CBVH 5DMKB 4E9XA 4PI0A 4S1DD 1CQYA 1U3JA 2H7WA 3KPMB 3PHOB 1IE4A 4O4YL 4CAGA 4PJGF 5EOQH 5IUSA 1UFGA 3NAAH 2PTVA 3GSNB 5AOKA 1Y6KR 4P07A 4K8RH 4Y5VA 4K7FA 2WWMC 5AW5B 4KDTC 1YEFL 1S7VA 2B0SH 4N0YL 4JL2A 4IOIA 2Y7QB 3UYOD 4QYOA 3N3EA 4LLAA 1MELA 2HJKA 2AJZA 4M6OH 4AJ0A 4X5RA 4L29B 2WAHA 3BD3A 1HKLH 1HX0A 3BUPA 3P9LB 3QUYC 4LFHG 1KWKA 1URLA 3C60B 3MXWL 1QO3B 5TF1L 5FW8A 3VRIB 4GSUA 1CGSL 1KN4H 2V2WA 3VW3H 3GO1H 3QAQA 4KDTA 3GMMB 3O2DH 4A6YA 2Y7NA 5J56B 1F5WA 3LIZA 4FLOA 1P7HL 1KELL 4TVPE 4HIIA 4CN1A 4OZHF 3TA4D 2TSBA 1GC1H 3RY6C 4NUGH 1O7DC 5IFAL 1DBBH 1MI5E 5GZNC 4Y16B 1AHWA 2IAMA 3JUZA 1EO5A 1HWGB 3OKKB 1HDMA 1EEZA 5B1CA 3VFUB 1KLUB 1KZQA 3EOAA 3Q8EA 1NDGA 5E00A 5E8NB 3MJ9A 5AB1A 4APQB 4MRBA 2H3NB 4UBDD 1KG0A 3IU3A 3MROB 1MAML 3L2MA 1ZGLB 4OIIL 3UZVB 3EXLA 1RULH 5DRZB 3P4MB 4F92B 3NUKA 5LQBH 5TF0A 1CDYA 2ZXEB 1UD4A 5JORB 2J2ZB 1J48A 4ZW8A 1IM3A 1DEEA 1KV3A 1QHQA 2YZ1A 1OF2B 1XH1A 3VWJC 1GS8A 2VLKB 1BX2A 3WHE0 3VFGH 4UQBA 4U6YB 2H2SC 3LH2H 4OM1H 4W4OC 5F0PB 3GRBA 2DM7A 3HEIB 4H8QA 3L4CA 5HY9B 2X2IA 3RGBA 4HMEA 4JDEA 4N3TA 4IS6B 5IROC 1YYMH 2AAVA 4KJWC 4MNGA 5EU6B 5C0BA 5E8DL 3ZDXF 1EAPB 3VD0A 4WSKA 2AXFB 4FKHA 1S9VA 2H6PA 4HVBA 4MASA 2BNRD 1IV8A 4F7MB 5F9JA 3LD8B 2XV2A 3TFKD 2WVVA 1G7MA 3JWNE 4DO6A 4YX2H 1DJHA 2GIXA 3MV7A 1AZRA 4QLWA 5LGJB 3FQUA 2UWEB 3RTQC 1E8WA 5ANMA 2ENJA 3GT6A 2HVKA 2DBLL 3ROLB 3ECVA 4PJ9A 1P2CB 2ARJA 1SJHA 1I1AC 2HWZH 4E9SA 1OP9A 5TE6H 2DTSA 3MRRB 1VFAA 2V8MA 1AO7B 5D4QA 2CGRH 3CZNA 1OSZA 3NN8B 2XZZA 3QIBA 5EZOH 1TTAA 1FC2D 12E8L 3EJTA 1YEIH 3FRPA 5HI3D 2D4FA 3G6AB 3V5KB 4N20A 4LSRL 3BUYA 4UT6L 4JRYE 3HG4A 3L3HB 3N1PC 5BS0A 3BGMB 1GIGL 2X4QB 3KEHA 3AT9A 3VXPA 4KKCD 2G75B 3BAIA 3UTQA 1UOKA 4L3EB 1QVOB 2CIIB 3QIWB 2CQVA 4PJBA 4YGVA 1HXYB 3JWDH 3W81A 1F3JB 4PRIA 2BNQB 1MLCB 4QXTA 4DH2A 4RRPA 2GJ6A 5HJBA 5KSUB 1S9KC 3A4DA 3VU1A 1E8YA 1OE3A 2F7PA 3BDXA 2H9GA 4WW2F 1RH8A 4EQ2A 1NFDF 2XT1B 4I48B 3DV6B 4B7IA 2YUXA 1QTSA 2D9QB 3O3UN 5K1NA 1IC4H 2N7SA 5C08D 4RWYL 3RVUC 1IAIH 5I0VA 1IRAY 1MY5A 1GOFA 1NCJA 3AM8A 3MCKA 3MV9E 4DN4L 2ATKB 1KMGA 1RUPH 5FFOA 3CDGB 3DO7B 4GP4B 3FUNA 1OWWA 3S7GA 4YAQB 1ECYA 5SX5K 5MENA 4KZEL 3U30B 2CH8A 4LXFA 1S9YA 4GUCA 2NX5D 3KS0H 5I1JL 1NDMB 1MCSA 2O5XH 4OD1H 4ONHB 2AABL 4DP9X 1P7BA 1G9MC 2BIMA 1MZZA 3G5ZA 1NQBA 2A5UA 2H3XC 3OKLA 3OKDA 3LV3A 4HU8A 2W80C 3NSYA 1T7WA 1OANA 3VG0H 4Q52A 5D7LB 2WXQA 5EPMA 3TVMC 5IB5B 3PU7A 1T5XA 4KK9D 3ZTDC 2A1WH 3BRDA 3MLSL 3AUVA 3SKOB 4A7TA 4G9FB 5AZEL 1R75A 1TTBA 2VXSH 2XXFA 3SDAA 1XAUA 3RVTC 5G4NA 2VLMD 4G7YL 5ADPL 1XVSA 4JS7A 2W9DL 2O30A 1XF4B 1QLRA 3VI3E 5I6LA 2KZBA 5E7BA 3TBTB 4XPGH 2R29L 4OCRH 4LEXL 3QZBA 5D55A 1IAOA 3QPQD 2X1XR 4F57H 3KGRA 2V33A 4YN3A 1I8IB 2XWXA 4FQHB 1KULA 2J8UF 5TDNA 5J89A 4X7EC 5I0YA 5C8JA 3QEUB 3U1QA 1PJWA 5IW6A 2K7PA 3LRGA 1WT5A 5I24A 3TO4A 3QUZB 1I3RB 1OP5K 4Z7NB 4UDTA 1NZRA 3X11B 3T04D 4YFLI 4OLUH 4KMLB 4H0GA 2C7UB 4ETQB 1FHGA 2EH7L 1CE6A 2ICEA 2Y23A 3DTDA 5ID1A 4BKTC 2DIBA 3OVUB 5DC4B 2V7HA 3O3BA 1NICA 4UMGA 3II1A 1JG9A 2UY7B 2R59A 5DK2B 3UTSD 1WGOA 5AL8A 1KBKA 4X7SL 5IMLA 3IJEB 1BVOA 3NYKA 1DQDL 2V3EA 2PP7A 1JCVA 2JKTM 3V0VB 3QRGH 4N6RB 1U58B 3RWEB 3UMNA 3NFSL 4UINL 1U9KA 1KACB 3WE6B 4U49A 1G7IB 3ORJA 3NQKA 1T0PB 1ZSDB 3SHSA 3DX8A 4H20L 3O45A 3STBA 3SQBB 5DYOB 1FL3B 3FQ2A 2YFOA 5C2UB 1M56B 2CBMA 4QXUL 3AROA 5F6HJ 2FK9A 2AQSA 1CF8L 1JPST 3HUJF 3JVGC 1TFHA 4HDIA 2J55A 3ZL2A 3BPNC 4J5VA 2G2RB 1D5ZA 3ETSA 1DBKL 2IOIA 1OK8A 3MLRL 5GGTL 5INDB 3QQ3B 3G5YA 5ITFA 1E4XL 4B9GA 5BCAA 1CGTA 1U4EA 3MRCB 1AMYA 3NSXA 3PP3K 2FE0A 3CK0L 3BKJL 1QPKA 2BVQB 5F7KC 5C97A 3ARGB 1T7ZA 1E4WL 1XF5B 1NH6A 2CNYA 2HTKC 4Y4FD 3Q43A 2AV1A 2ZTBA 4WO0A 2EE2A 1ZKAA 3EYFA 4XBGB 4F37K 3KCPB 1H8NA 4MAYA 4CC1A 1NCUA 5B1JC 2Q8AL 3SE3C 1ED3B 3L5HA 4ZD3L 3NIGB 3EYQD 1HXMB 3MA9H 2YPKA 3MLYL 3QEQB 4QY8A 3I75B 3KYKH 5E9DA 1SM3H 3UAJD 5KSAB 2DTML 1Q4NX 1FGNH 2YN3A 4KMQA 3WMSA 4F15B 3TFKC 4IRZA 2FGWH 4LQFL 1GZPB 2XWTA 1T5KA 1OAUL 3MJ7B 4WWKD 5DQDH 4AQEB 1BZ7A 5I6KA 2L0DA 4G72B 4R4BA 3BW9A 1JPGA 3N9GH 4WTQA 1Z9MA 2VUOA 1HHKA 2HMID 3L1OL 3NJKA 5B1JA 1AQKL 4OJAA 3SE3A 5I1KL 3IF1B 2Z35B 1YMME 3FTUA 2N7AA 3TWYA 4M8VA 4UM9B 1XV8A 4NHUB 1AXIB 2BNRA 3P2BA 4XPTL 2X6AA 1DUYA 5D4IA 1DJSA 3ZT7A 1SVZA 1YEJL 1IBHA 2AFNA 5L4FA 4XVSH 2G5UA 5C07B 1J7VR 1DLHB 1PIFA 1KXVA 3KR3L 4ZOEA 1HS6A 3UX9B 1ZS8A 3A4FA 3UERA 4TVPD 1KB5A 4JO1H 4KKCC 5FYLH 2Z91B 5HHPB 3UJJH 3VXTA 3LRMA 5CWSA 1WFOA 4PS3A 2FRGP 3D06A 5CD3A 3UJIL 1TIUA 1X9RA 2JTYA 3F5WB 2FJUB 4WI5A 3GHEH 1MI5D 1NLBH 2F15A 2IJ0C 4HHAA 3BZEB 3IRZA 4MXWH 1EGJA 2XCMC 1IIKA 1ZIAA 1C5DB 5C09E 3ILPB 2DYPD 5AUMA 4FMFA 1VKXA 3MKKA 2DWYA 2DQCH 3TWCL 4PJIE 1TU2A 2NSMA 2FQFA 4LRIA 3VXRA 4N0RA 1L7TL 3ES6A 4XNMA 3QS3A 3U0WL 3WFCL 3HC2A 4OFIA 1OP4A 3IAGC 3QARA 4NN7C 1BJ8A 1FORH 3IDXH 2A9BA 1VEOA 1OALA 2AEQL 5HGBB 2OJEB 3AC0A 5E03A 3EO9L 1HOEA 4JY5L 4NEHB 3VG9B 4F8QA 1FNLA 1D5BA 2CXKA 5E0FA 2WIMA 4DPRA 4GT0A 4LNRB 5E99H 5HGHA 1EJ8A 3BVUA 3CPLB 4XP6L 4URTB 3TYGH 1PZCA 4I89A 4W9DC 1Z3GL 3U7WL 3MODH 1JHTB 3OKMB 1UH3A 3GC3A 3MOAL 3Q6GL 5C08A 1P5UA 4M8QB 1E3ZA 1U8JB 2GFBB 4LEOB 4KK9C 1C12B 2H4EA 4K3DL 5FPIA 4NWTL 2YEZB 4N8UA 4JGNA 1NMAH 2QTEA 5F97E 2KUTA 1P6FA 4NZRH 5IQOA 2VUKA 5AVZB 3UG3A 5JOEA 2XN0A 4U1JA 5DWUL 4LLQA 3PWLB 3D4GA 4KMTL 3X14B 4JR9H 4YDKL 4ZFOA 1S8DA 2H0EA 4ODVH 3UBXA 1FN4B 4X4ME 3DJTA 3MTRA 4TQHA 1EUTA 1IC5L 1KXQA 1TVHA 4UILL 3QDJE 4XCNA 5BV7C 2XU9A 1M05B 1T04B 1N4XH 1GGUA 1X9QA 5KSBE 2ORBL 4AUYA 1FFTB 2IPUK 3ZN6A 3EFFB 1JRHH 3RL1A 1DUZA 2V5MA 1I31A 1S5HB 1SHSA 3ATEA 4DFHA 2A9MH 3ZDWA 4AGLA 3QUXD 4C56E 2BC4B 1K4DA 4JY6A 4JRYD 2IH1A 4HWBA 2JNZA 5CO1A 5E8OA 3NMEA 2D7MA 4NNXB 4U6HA 1R3IL 3S3JA 2WCSA 2PW1A 3PHQA 3BESR 4QOKB 5ETUB 3HCVA 1RKRA 1WFNA 3GSNL 3UYRH 1KJMA 2HFFA 1K8DB 2XZCL 1CBVL 5I71C 1CTNA 1XH3B 4GH7B 4C4KT 4FYRA 2XTLA 2EDYA 1UB6A 1S7WA 3Q8CA 4QHUB 1BVLA 2JB5H 3K6OA 1CI5A 1H6FA 2CDFA 3BZFB 1JFQH 4X7DC 5EOQL 2BX5A 4G43A 3NAAL 3KPRA 2LW3A 2X42A 2ZYSA 1FE8H 4ODBD 2YBRB 4K8RL 3UTTE 2FSDA 4AGOA 4FP8H 4LVHC 2B0SL 3FDWA 2HG5B 4U1KA 3MV9D 4D0CA 5C0IB 4F7KA 4TLSA 3OG4B 4KXDA 3VCLA 4B9JA 2GABA 1QI4A 3UTSA 5DURB 3U1SH 2DYSB 5MHSE 2Y6TE 4M6OL 3L3JA 3REVA 1HKLL 2AW2A 1MFEH 3QQ4A 2WP3T 3H3PH 1Z2KA 3RZCB 3SO5A 4P4KB 4X8XA 4OD2A 5AAWC 1KN4L 1VADB 3CSFA 3NCMA 1U8MA 1L5GB 3VW3L 3GO1L 3O2DL 2WLMA 3FS9A 3X1FA 1PDKA 3NT0A 4ZO7A 1DJYA 2ZP8A 4NQDE 1AD0B 4XXDA 3DETD 3OJDB 2AF2A 3KWWA 2XQ0A 5IB2A 1GC1L 3G6JB 3Q5TA 4MMZA 4NUGL 1QBMH 4DUVA 2QEJA 5F3BB 2DV6A 4FCHA 3LKOA 2VAAA 2VZSA 3U4BH 1GGIH 4B97A 4Y4FC 4JHZA 4LPUA 5DDHA 3ARTA 3DECA 1T22B 4WHYG 3X3FH 4AJVA 2GI7A 5ALBH 3AS0A 1RULL 3S88H 5LQBL 5HJ3B 1KTRL 1FFOA 5GRUH 4GG6E 3EYQC 3I84A 4Z95H 3UAJC 1CC3A 4FEIA 2Y4SA 4GKZB 4JDZB 1P7KA 5JIKA 1UVQB 1JDCA 4PMFA 5GISH 3W37A 1A3RH 3N40F 4PYGA 4DZ8A 3VFGL 2OI9B 4L3CA 2ZKXA 4D9QE 3OLEA 3LH2L 1O7VA 4OM1L 3DGGA 3DX7B 4LOVA 3MRGA 4PJCE 1ZXQA 3MV8B 4AYGA 3V0EA 2H32H 1BQRA 4NO2B 2ENYA 3QWOB 3KCWA 2KMWA 4MS8D 1YYML 1MCWM 3DX9A 5JW4N 3IDGA 2MCMA 3JZ7A 4YL9A 5FW7A 3UAJA 3K71A 2DQFA 3I9AA 4M3HA 1PQZB 2OR8A 2P1YA 2R27A 2Y07H 4A55A 3RKPA 4WWKA 2H32B 2QPSA 4OGXH 2FDBP 4WU5B 4YX2L 3ZE0E 3FW6A 4UM8B 3KLAB 3W9EA 4B3EA 2CCLA 4JJ5B 4YR6A 4E0RB 1ZVYA 3C2SA 1XSOA 2VUYA 2BOBA 3BO8A 5KYWB 1SYSB 2PXYA 4NCC2 2HWZL 2HUEA 3H4HA 5TE6L 2YUZA 1NFIA 1J1XH 1VZGA 3KDMB 3L7EB 2CGRL 2CRZA 3O3AB 2WN3A 7FABH 4BK8A 1U8KA 4ZMLA 5EZOL 1N64H 1KGCE 5DO8A 1YEIL 2EDXA 3DSFH 4I2XE 4Y1AE 5BRZE 5J4MA 1PFCA 5FGSA 3WTXA 3JXAA 4Z7OB 5JOPE 4DEPB 1H3UA 4U1NB 4JFFE 4J3OH 5I6MA 2WYTA 1XZWA 5CHNB 1D6VH 2VXQH 4HZLA 1MJJB 2IV8A 1Q94B 2E9JA 3JWDL 3KYNA 3WXWH 2J7LA 4ZSOB 2JQZA 2DYPA 3HZMA 3LTVA 2WSPA 3GMPA 4P59H 3K91A 2FT8A 4KRMB 2JTDA 2Z1KA 4WNJA 1KLFB 1SJEB 2QPUA 1A6UH 5ICXA 1KEMH 4EZJA 1D7CA 5PAZA 3V9CA 3ZTCC 2EVGA 1QRNE 2E9IA 1IC4L 3MCG1 1IAIL 3UJTH 4WJ5B 1HC1A 3ARBD 1RUPL 1BWWA 1LDPH 1GRWA 4ZX4A 3O3DB 1MFDH 2C1PA 3MKGA 3O4OB 1WFTA 5A1AA 1D9KC 5AAMC 3VD7A 4QO1B 3VRLE 4X98A 4GI8A 1JXJA 4TQEH 4NQEB 1Y6NR 2O5XL 4OD1L 5IWLC 4I0PB 3D09A 1OAJA 2NNAA 2YRLA 2ZZUT 3P3UA 5B8CA 1T0MA 4PYHA 3FN3A 3BPLC 2J5WA 3AXLA 1WVZA 1KLGB 1UWGH 1HH6A 1YMMD 4Q89A 3WGUB 3ALPA 3GXMA 2A1WL 3IBEA 4DVBA 3QC6X 4A2FA 5FKPB 2DQ6A 2XVKA 1FNGA 3QUXC 1F3RB 4WW1B 3ZL1A 4X6DF 2VXSL 1RV6X 5E6UB 3DRQA 1OP3H 4L3FA 4MVBC 1S7QA 3UFIA 4EVNB 3WJJC 4ZTEA 4BQ6A 3F2LA 1B6DA 2BFVH 2XZQH 3OHXC 4K5MA 4PB0H 4M4RB 4XPGL 4AK1A 4OCRL 2WXPA 2EKSB 3P4LA 1NC2A 1KN2H 1G0YR 2WIIA 4L9LC 4F57L 4OCMC 4ZMAT 2D7PA 1NM4A 5C09D 2A6DA 3HZVB 4CGUB 4H25A 1MG3C 1R9FA 3BUTA 1WS7A 3B1TA 3SQRA 4MNHA 4N86A 2HP4A 3H42H 2IV9A 4M9OA 4L8SC 1CJYA 4YC2C 4PY7A 3RJDA 4JRYA 5LDSA 1H8OA 5E94A 1Z1WA 4HCFA 4OLUL 5E51A 2DMBA 1XCWA 5BZZA 3FB5B 1AKPA 2K9FB 4Y5XC 4Y88A 2VZ3A 1PLGH 1FVCB 1L9MA 3K6IA 3BYTA 4FXGA 1NINA 3BWUF 5GGRA 3WENA 5IP4A 1OOAA 1ZLSH 3IPFA 2XYBA 3NZSA 4MS6A 5BW7C 1E5CA 3GJEB 3W5MA 1AC0A 2PYFA 4DQOL 2QV2A 2ZUTA 2JJVA 3LNGA 2J71A 2JKJA 3FTZA 8PAZA 2VR9A 4QRRB 3QRGL 1KNOB 3KLDA 1F0LA 3MRKB 3QP3A 4HXBH 1SJVA 3RWHA 3UG4A 4GAYB 4JE4B 1NSNH 3MV9A 1HSBA 1LEGB 3DETC 1HILB 1UG9A 3CU1A 1NGQH 3L3IB 5E8EA 2JKRM 4G42B 4OCXH 1F4YH 2XVGA 2RGSA 5GJTH 4P23B 3ZKSD 4GXVH 1HK6A 4BQ8A 4NNPH 3U7YH 3IJYB 4LHUD 4IRJD 3IXAA 3PWUB 1A6TA 2WC7A 5JXAH 2O6EA 5TH2B 2BZCA 3ZYJA 3GLEA 1IGCH 4I0CC 4QDGA 1WLHA 4YNYB 2L04A 3TCLB 3QDJD 1NMCB 1J0KA 1UZ8A 5MEPA 4W9KC 4WNSA 2NY4D 4XNQB 2ID5A 3ZVVA 4ZTOH 5BXFA 3I3BA 4JKWA 1XEUA 2AK4A 5G5DB 2OULB 2ZWYA 3WSQH 4ZYKA 4LT7A 1ZGLM 2NDGA 1THAA 4LASH 3D6GA 2PPCA 4C56D 5ESQA 4KTDH 5KJ7E 4ZNEE 3W11D 4H40A 1OB1B 1NM9A 3VI3A 4AE1A 3L17A 5DA4A 1BAFH 3QDGA 4MYPA 4FGMA 4OU3A 4Z7VF 4OBRA 3H9HA 2GTZB 4JKKA 3VXUE 4MS8C 5SWQB 1BA9A 1P1VA 2CSPA 1WS8A 2Q7AA 3PP4H 2IOMA 1VCAA 3N43B 5E5MA 1AKJB 3MA9L 4P3WA 3KYKL 5FCSH 1SM3L 2WXFA 4UOJA 1FGNL 1TJXA 3FL7A 4GQQA 5DZ9A 1K8IB 4AUUA 1NUGA 2FGWL 2D0FA 1E2VA 1RZ7H 5A2IH 3UTTD 5DQDL 2JCCF 3GKWH 3QXVA 4H0HB 5L0QB 3EBAA 4XNDA 4KDVA 4GW1B 1AG0A 5MERA 1XF3B 3NSJA 1E7VA 3MO1A 3N9GL 5A2CA 3ZKMD 4FXKB 2CGZA 2YAHA 4L4VE 2A6IA 4L8CB 3EYUH 1CD8A 4PCSA 3QA3A 4DEWA 4PGCA 3PUCA 4RISH 5MHSD 2ODHA 4QRQA 3VWKA 2R2HA 1IVTA 4XB8A 2A73A 5B1BB 1ZANL 1KGIA 4G8IB 3V4PH 4OFQA 5K9QG 3BRFA 2ZAIA 4RGNC 3PAVA 2Y1VA 5CGYD 3U7AA 4DP2X 4MJ5A 1USQA 1XX9C 4XVSL 3PAUA 4POUB 3LRLA 3DDFA 3EO1B 4YSPA 5EU7E 4TULH 2GAZA 4PCTA 5A2KH 4NQDD 5LHDA 3MQIA 4JO1L 3CQFA 5FYLL 4IBLT 3UJJL 4GSDH 3V4PB 3FO2B 3WFHB 3N85H 3GHEL 5IHLB 1NLBL 4N26A 4BSWA 3ZE1B 4MXWL 4LLYA 4R7XA 5D5ME 3SEPA 2JIXA 1ZA6A 3T8XB 1IIIA 1TT6A 1WG3A 1FZKB 2DQCL 5HP5A 1OQXA 2V0AA 2PTTA 2HJFA 1CICB 4F7PA 3LKPA 3K6SA 4HUXA 2CO2A 2O6FA 1K72A 2FEEI 5IVXF 5JW4M 1P4IH 2IDSA 3FUKA 1FORL 1ONQA 5FO8B 3IDXL 1BXAA 2GHWB 1QFOA 3LRHA 3MRBB 4XCEA 2WQXA 3ARBC 4M1CD 3T6ZA 4GSXA 4AG4H 4ZFGH 2ITDA 4Z5RA 3DX4A 1GMEA 2XPGB 1L4IA 3AAZA 5E8PA 1K6QH 2Q3XA 1IMHC 5E99L 3CX2A 1DQJB 5DUBA 4D9QD 2O1AA 4U1HB 1HNYA 2LFGA 3AS1A 3BT0A 3DJ9A 5DF0A 5KWYC 4OV5A 3NGBB 1CI3M 3C09C 5D7JB 3TYGL 3CSTA 3L3GB 3M1BB 3SD5A 3MODL 3HAEG 2BK8A 2O72A 3EH4B 3KPSE 3DHMA 1UD2A 3HG3A 5EO0A 1J9RA 2APVA 2KLTA 5T5FA 4JW3A 1IAIM 1U91A 3ARBA 2YA1A 5AG8A 4HJ1A 3HS9A 4XCYA 4Z78A 1NMAL 4TQ8A 4ZJ9A 1OD9A 3GNMH 4NZRL 2XUWA 3D69A 5I5JA 4R5XA 1BYPA 2CDGA 4Y5VB 4K7FB 4I4WA 4ZTPH 5J6GA 2QKIA 1F1DA 4JR9L 1MG2C 4UV7H 3ZQ9A 1G1KA 3CSGA 2XVLA 1R47A 2D7OA 4IOIB 4ODVL 1J5IA 3ZQWA 4Q6KA 1UJ3B 4QYOB 4JM2D 1F4WH 5MEOA 5FHAH 4A6YH 3HRZA 4OZ4A 1CBJA 3LIZH 4H7VA 1IGYA 2HJKB 2AJZB 3TNNA 1N4XL 4LHQB 3CC5A 4H8WC 1ZD6A 5B21A 2MQGA 2XBDA 4KJPD 3RFZC 3HN8A 4QRUA 1EQWA 1JRHL 2XQBH 1N67A 2B39A 4PJAF 2GUOA 3FJTA 3X3GL 1J0YA 5EOCJ 2A9ML 2OXGA 3DK0A 4MCMA 1KGCD 4PY8J 4YVNA 1HYSC 4A6YB 4Y1AD 3MJ9H 5D1ZA 5BRZD 2H45A 4PS7A 2GJPA 2PCFB 4HIIB 5LUMA 3J8F7 4HJGA 5JOPD 4JFFD 4KKNA 1D5MA 1MFNA 2JJTC 3LDBC 1Q9LA 3K2MC 2WZPD 1AHWB 2IAMB 4OSUH 5HPMB 3FAXA 5FWRA 1HDMB 2A3TA 1EEZB 1KPRA 2CJSA 4WTXA 3UYRL 5C09A 3RFZA 3EOAB 5E00B 1NDGB 3O8XD 3CVHA 3SDCD 2QQKH 2OW7A 1KG0B 3IU3B 5ICYA 4PJIA 4F24A 4IIQA 3IDMA 2CIKA 1ZTXE 4DWHA 7PAZA 4I77H 2JB5L 5HHVH 3RFRA 1JFQL 2X38A 2NY2B 4YSUA 1W80A 3F8UB 1HXKA 1FE8L 4PJFE 1RY7B 5AVUB 1DEEB 1ZLVH 1QRND 3M7FB 1M1SA 1HN1A 2WINA 4JVPA 4FP8L 3GSQA 4JRXA 1MIEH 3OB0K 1AJ7H 4JJOA 5GS1C 1JZJA 2CA3A 1BX2B 5AOJA 3BYYA 4XNYH 3NEXA 4KNQA 4Y1TA 4GUPA 1EIBA 5J12C 3CN0A 3IEAA 4IRJC 3INOA 1D7FA 1F90H 1FUNA 3U1SL 3INUH 2N7BA 2VE6A 2LVCA 2HFEA 4LSVH 3SYPA 1MFEL 4U4IA 1DQVA 3VYPA 3ULSA 3H3PL 2OTUA 4JDEB 3BLBA 5FWQA 2UVEA 4MNGB 3ZKNC 5IB3A 1CXIA 3U1PA 5C0BB 1JCKA 1AOZA 1OHZA 1S9VB 2Z4TA 4P48A 2H6PB 4NZDA 4Y4KD 3KM2A 4C56B 4QYAA 1WZAA 4JE0A 1AC6A 1G7MB 1WIOA 1EJFA 4W9HC 3OGOE 1QBML 3WXVL 3MV7B 4LHUA 4LP4A 3WEAA 3W39A 3QRLA 3W11C 3FQUB 3WY1A 4X4MA 1S5IH 4A63A 5ANMB 3U4BL 1GGIL 2DJMA 4GAJH 2HVKB 4ZG1A 4URKA 1X6NA 1KJVA 2Q8BH 1JBJA 1O6VA 2NW2A 4PJ9B 3X3FL 1ETZA 2BSBA 4FNTA 3TTYA 5ALBL 3UOAB 3ZHDA 2ARJB 1SJHB 1L3NA 5KSBA 3VXSE 3G7TA 3H9SA 1VFAB 3S88L 5MI0C 1UM6H 3T3MF 3QORD 1OSZB 1WTGT 4CADA 3QIBB 3AU1A 1RZGA 5D70H 1QFWI 3MLWH 4Z95L 1VLXA 4LSTH 4DP4X 3FRPB 4C56A 2X9ZA 5F7UA 3BUYB 5GISL 2WQVA 4OF6A 1A3RL 1G0DA 1E4HA 5I75C 5BS0B 4P2QA 3W9DB 2X6VA 3VXPB 3CJJA 3UTQB 4DKEH 3FQYA 3GM8A 4PJBB 4YGVB 2OL3A 2WQRA 1OCWH 2EEDA 1BF2A 1CDUA 1GW6A 3D12B 3ZKMC 3NK3A 4PRBA 4XNXH 3ZRCC 1U3HC 3EJZD 4PRIB 2EIJB 4QXTB 4BK5A 4JMXA 3VGFA 2GJ6B 2P47B 1SN5A 4TNVK 4N2GA 4XB7A 1EX0A 2FJHA 2OMZA 1YMHA 4QIRA 3FONA 4IKIA 2Y7OA 2H9GB 5CINH 2ICWJ 3Q5YA 5F7AA 2Y07L 5T1DH 1PSKH 2F53E 4JJHA 1SF3A 4PJGE 3UTTA 3ZBMA 4CKQA 4OGXL 4S11A 1KGYE 3MCKB 4IMKC 1E65A 1BLNB 3QULA 4X9BA 2EE3A 5FYKE 5HYFA 1YY9D 4L8BA 3WKMH 4RMVA 2EQDA 1TPXB 3TJEH 2ITFA 3H53A 3QDHA 5MENB 4N3UA 2K1MA 1S9YB 5LGYA 4OI8A 3V5DB 2F8OA 4PVMA 5I30H 1J1XL 3G5ZB 3T1FA 3AY4A 4X5LA 3VXQA 4I1RA 2P45B 3FQNA 2C1OA 1UKSA 3HG1E 3LV3B 3OKLB 3OKDB 7FABL 3ML8A 1N64L 3ABMB 5EPMB 3FSWA 4N8VG 3DSFL 4Y9BA 1T5XB 4N9GA 3GINA 4NQDA 1VRSA 3C87A 1OGPA 3LNDA 2NY7H 3B7RL 1E5UI 1MJ8H 1D6VL 2VXQL 1A47A 3RP1A 3SDAB 5CBAA 4G3YH 2KH2B 4JO8A 2EIBA 2X09A 4DKDC 2H26A 4HW6A 3WXWL 4BSJA 1EEUA 1QLRB 1HI6A 5FA4A 1B4TA 4Y2NA 5EWIH 1MCPH 1GL4B 4WWPA 2XWJB 3RBSA 4P59L 2CHNA 1AR2A 1IAOB 3TXAA 1OGAA 4Q74A 5F9AC 1EAQA 3V6OA 1A6UL 1CFBA 3VXUD 1KEML 4G6FD 5TDNB 3MBWB 4L4JA 5FDYA 5C8JB 3FN0H 3LB6C 4H1LG 4YHYC 3IJHB 2VW4A 5IT2H 3UJTL 3MRDB 5IW6B 3B9KA 4QEGA 3MUY1 3TO4B 1LDPL 4WUUE 5JOFB 1MCEA 4AEEA 1IFHH 1MFDL 4LL1A 1LQSR 4NQVA 2E74C 3DUHA 5IBUG 4I18B 1CE6B 3WNLA 4TQEL 4PJCA 2ICEB 1AIFA 3C9NA 5ID1B 4JM2C 1JYNA 3QUKB 3O3BB 3C8KA 4JFEA 4FADA 4L4VD 1A14H 3Q8AA 1QAWA 2L4OA 2Z7ZA 5IMLB 1J0HA 1XSKA 4KJPC 1QA9B 1UWGL 2WHVA 1FO0A 2ERJB 2ZUQC 3MDJA 3TF7C 3IETA 4A38A 5G4OA 4A2EA 1HINL 1A4AA 2K7QA 2Y5QA 4TQPA 2E3VA 3EO0A 4Z7UB 5CGBA 2Z8WC 3HRPA 4R97C 5KS9E 3KLQA 3QUMA 5C0CE 4X9FA 3DX8B 1J0IA 5T1LA 2BFVL 4PB0L 2XZQL 3ESOA 3ZR5A 3P11H 3K6NA 2EILB 3ZMNA 5LNDA 1MDTA 1KN2L 5HSFA 4QRSA 3O8XC 3SDCC 4EF3A 4J8RA 1AS8A 3S96A 3K8KA 3LPPA 4TLUA 2WTRA 4AXWA 4AQ8A 3FO1A 4QGTA 2WXHA 4NKQB 4E5XG 1UXWA 3K4AA 3H42L 1A3LH 4S1SH 4HDIB 5JNYA 3G9VA 4I2XA 4L0ZA 1QLEH 4UMSA 1BEYH 1A1OB 2WXGA 5CILH 1D5ZB 2ZWKA 3UBFA 3TEYA 3IFLH 4JKLA 5GGSB 3ZYOA 2WZPA 4L37A 4Z0BL 1PLGL 2NCMA 1NUFA 3L5XH 1XO8A 1ZLSL 1QLEB 3I6SA 3O8XA 4PWFA 4G6JH 2QSCH 1MNNA 2FO1A 4F2FA 2AV1B 1YAIA 5C2BH 4EUPA 3QGVA 2QVIA 3ECUA 1UTDA 3EYFB 4AVKA 3U6RA 2YBGA 4MAYB 5B39A 1J9QA 4UNUA 2G5BB 2WK2A 4HXBL 3MACH 1BG9A 3KPSD 3MYZA 2XETA 2UZPA 2ZKYA 3S0PA 4QY8B 2YPKB 1NSNL 2DICA 5E9DB 1JI1A 4Y4KC 4KO7A 3Q2WA 1NGQL 5F21B 3ZXAC 4OCXL 1F4YL 3BGFC 4P5KA 4FJZA 3GUTA 2HJLA 5GJTL 1WHPA 2X1PA 4NO0D 4GXVL 3LZLA 5A43C 4GINA 3RY4A 4NNPL 3U7YL 1BZ7B 4R4BB 3BW9B 4J3VA 2C3VB 2GSIA 1JPGB 4CC0A 3DJSA 3OZLA 5JXAL 5JQIB 1HHKB 5HYJA 2F18A 4MYWB 5GGUA 1IGCL 1T2XA 1ZVSA 2P24A 3SPCA 4WFEE 2UX7A 1DVZA 1KB5H 2AJSH 1YDPA 3HN5A 3NQIA 1BZQK 2BNRB 4N0CD 4ZTOL 1TSRA 3S35X 5DJ8A 4NZFA 4GKOA 4BE5A 1F6LL 1DUYB 3U4AA 4CSZA 3WSQL 2C9UA 3PNWA 3MRLA 3N44B 1EGJH 2RR3A 3KPLA 3TFBA 1VAHA 4DUWA 3O6FA 4LASL 1PG7X 4X0NA 5HVHB 5E2VH 3ZDYB 1ZS8B 1JD7A 4X80H 4NN6C 1KB5B 1JZ4A 4KTDL 1FV1A 3VXTB 3PV6A 5CWSB 4DCQA 5CD3B 3OJ2C 2QHRH 3H1ZA 1BAFL 1X5XA 1BZOA 4HC1A 4HHAB 5GIRA 1IKNC 3EJZC 3QPXH 5AB2A 1TF4A 2XIDA 3MN8A 4AYFB 1DSFH 5E1GA 3QORA 4NP4H 5E6ZA 1JPSH 3PIQA 3WL9A 3PP3H 5AUMB 3PP4L 3FB8A 1VKXB 1SXNA 4Y0GA 2OPCA 4ORZC 4JB9H 1TU2B 2YN5A 3NIFF 3VXRB 3N40P 4XNMB 2WXIA 3MGOA 3GZKA 1JPFA 1UURA 2WP3O 1A7BA 4OR1A 1K85A 3J7HA 4WK2B 4OJCA 1JPTH 1Z9PA 2BNUA 4N28A 5E2JA 5E6ID 3VXME 2D03H 3ELQA 1EV2E 1RZ7L 3PV7A 1KCLA 3GKWL 1J88A 4LEBA 4E9YA 5IEHA 4UANA 5ABZA 1KCKA 1YY9C 3PRZA 1D5BB 1QHPA 4FC3E 3QC5X 5DJXB 1KT2A 1KYDA 1SDAB 5D1XB 3FT3A 2F7OA 2N3JA 1MHPH 3EYUL 1AR1B 4DEUA 5HGHB 2DWSA 4RISL 3S36H 1UHVA 4CU6A 4XPHH 3IFNH 4ES8A 1TQCB 3RVWD 5K39A 2EEAA 1DFBH 1ZLUK 3V4PL 4YSAA 3AREA 1QATA 3CHSA 4PJHE 4GMSH 5C08B 1P5UB 4XMWA 5TD4A 4ELMF 3GS7A 2NQDA 4Z7VA 2QGDA 4DJMA 2DM4A 3BJLA 4KO9A 4UV4H 4TULL 1AZCA 4N2CA 4U1JB 4LLQB 1SPDA 3LH9A 4GSDL 3GXFA 5E6SB 1B6UA 3N85L 3T8VA 4ZFOB 3L3KA 1S8DB 2J1ZA 3UBXB 3S37X 1PX4A 5KOMC 1ORSA 2PWDA 3EJSA 4FA6A 1Z66A 1OAZH 4C58B 1TVHB 4XCNB 2WOYA 4GEJA 1KDIA 3DC0A 4PHXA 2XKNA 4KUCD 5KG9B 4JO5A 4HWBH 5CU9A 3VXSD 2CDEA 2XWRA 4NKDA 3RL1B 1P4IL 3D33A 3OM3B 1T20A 1QBAA 3FT4A 2YRPA 4P5RA 4GAGH 1LGVA 1F1GA 1K4DB 4JY6B 4AG4L 4ZFGL 1OLZA 1F18A 5GJSH 3HG0A 1K6QL 3QR0A 5DJYA 4HAGA 3N6YA 4GFTB 5E8OB 3SJVE 4EIBA 4M7LH 1TEYA 4U6HB 3WTVA 1WD9A 1MH5A 2W92A 3PHQB 2PW1B 4A7GA 4YHOH 1M7DA 3HCVB 1P4BH 1U2YA 2JH2A 3VXUA 1KJMB 4XBEH 1XF1A 2HFFB 3DYPA 3AFLA 3IMVA 3WUZA 5C1MB 4V33A 4HWNA 2V3DA 3QRFM 1C8QA 1U8OB 1UB6B 3SDDD 1PNDA 3BT2H 1BVLB 3DGCR 2CDFB 4FQCH 4G43B 3KPRB 4Q4IA 3CZLA 4ONGH 2PR9A 3GNML 4RFEA 1N5AA 2F53D 5E1AA 5HDBE 3WHE1 1BREA 1QD0A 4BYHA 3CBJB 3ZJAA 2FNBA 4ZTPL 2X12A 2B5IB 1IM9D 5EU7C 4X8CA 4U1KB 4UV7L 4D0CB 4XP9L 5TDOA 5FYKD 3D52A 3VCLB 2GK0A 3V9FA 1F4WL 3UTSB 5FHAL 4A6YL 3VD3A 3LIZL 4DUXA 1GCYA 3VB9A 3TOPA 4LLDA 3ATDA 2FECI 3L3JB 3REVB 4KDWA 4F3FA 3FT2A 3QQ4B 1A4JA 4GUQA 1G6VK 2VRQA 1G1YA 2XQBL 4NERA 3HG1D 5GS0H 1CFQA 4OD2B 2OTPA 1F1AA 1U8MB 2Z31D 3NSCA 3L7FA 4B6ZA 1PDKB 3MJ9L 3T2OA 5CP3A 4XXDB 5HJDA 1ETJA 2OW6A 3KWWB 1KYUA 3K2KA 5IB2B 2AK1H 3TZVA 4MMZB 5AYUH 2P8LA 3STZA 5IQMA 2Z64C 1ECZA 4OSUL 4WGWB 3N2JA 1ITBB 3LKOB 5IM7A 2VAAB 1ZDSA 2DQEH 3QDMA 1CWVA 4JREB 1DO6A 4YHNA 5DDHB 2EVFA 2QQKL 5DRWA 1RJLA 3WKYA 2ZX9A 3REWA 3EG9A 4RX4D 2VLJB 1QG3A 1WZ1H 3MJ6A 4I77L 3T4AC 5HHVL 4XO8A 4D9LH 1FFOB 2W94A 3IU4H 2LAAA 4TSCH 3RWJA 1MIEL 2WBWB 2WYZA 1AJ7L 1P7KB 1F58H 5FFLA 2FATH 5KSVA 2X3AA 2GTWA 1VSCA 1W8EA 1QR4A 3EFOA 4WUUD 4XNYL 3V4VA 4DZ8B 4L3CB 3TONA 4V11A 1CYXA 3JTTA 3DGGB 2NMSA 4YGAB 1F90L 3MRGB 2P5WE 1WHOA 3INUL 4XWGH 3F12A 4U1IA 5JW4Q 4LSVL 4EE2A 3KPSA 3DX9B 2YXWA 3VSUA 3IDGB 4JPKH 4XO5A 3QJSB 3WY3A 3K71B 3ILEA 2DQFB 4HFWA 3U36B 2VW6A 2O4EA 1HQ4A 3BAWA 4QLRA 2GSGB 4WWKB 2YD1A 4YWGH 3TU6A 5I0WA 1NANI 4H4NA 3N0AA 2VO8A 3CPUA 3W9EB 4EZKA 3U4EA 4LFHD 1ETB1 1S5IL 4ZS6C 4YR6B 2E47A 1UATA 4GAJL 5C0CD 4WFGE 3I6KA 2Q8BL 1J0JA 5L6YH 3BO8B 5L7XH 2BOBB 3W2DH 2PXYB 3ZLQC 2IDUA 4AW7A 2XN9E 4JM0A 1PVHA 3CFKA 1NFIB 2YD8A 2W5PA 3K81A 3VFVA 2UWEF 4AZUA 1UM6L 1ACCA 1GVIA 2X87A 4NI6A 3THMH 3JWOH 3F85A 5D70L 1RLWA 3K46A 1U8KB 3ZTEA 3MLWL 5AOZA 3B9AA 3SGKC 4LSTL