2YBGA

Structure of lys120-acetylated p53 core domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
191
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTASVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acetylation of Lysine 120 of P53 Endows DNA- Binding Specificity at Effective Physiological Salt Concentration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 44
structure length 191
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ybgA00
3Q01A 4LO9A 4IBUA 4L0YA 4QO1B 3D09A 4MZIA 4LOEA 3ZMEA 4G82A 4IBZA 4IBQA 2VUKA 2BIOA 2IOOA 2RMNA 4XR8C 4GUQA 5G4MA 1UOLA 4IJTA 3KZ8A 1HJCA 3QYNA 3QYMA 4MZRA 5AOJA 2YBGA 2PCXA 4KVPA 3US0A 4AGPA 2ATAA 3D06A 3EXJA 2IOMA 5ECGA 4IBTA 5AOIA 4IBWA 2MEJB 4AGNA 4HJEA 5AOLA 3Q05A 5KBDA 4GUOA 2BIQA 5G4OA 2ADYA 1IO4C 2GEQA 1EANA 3WTWA 4IBVA 1EAOA 3WTXA 2X0UA 3VD0A 3D08A 1E50A 3WTSA 2XWCA 5A7BA 5LGYA 1H9DA 4AGMA 2WGXA 1TUPA 1GZHC 5BUAA 4AGLA 3IGKA 3WTUA 3WTYA 1TSRA 2P52A 3WTTA 2XWRA 3WTVA 3US1A 4AGOA 2J1WA 2J6WA 5AOKA 2AHIA 2H1LM 4LOFA 2J1YA 3EXLA 1HU8A 3Q06A 1CO1A 5AOMA 3WU1A 1LJMA 3VD1A 4IBYA 3TS8A 1GZHA 3VD2A 4L18A 1YCSA 2J20A 1KZYA 2J1XA 1HJBC 1CMOA 1EAQA 2IOIA 2BIMA 3IGLA 2X0WA 5AB9A 2AC0A 3D07A 2X0VA 3D0AA 2J1ZA 2FEJA 2BIPA 4AGQA 4G83A 5LAPA 4IBSA 1T4WA 5G4NA 5ABAA 3D05A 4A63A 2J21A 2BINA 4L0ZA 2OCJA 3KMDA
chains in the Genus database with same CATH superfamily
4TQ8A 2Y2TA 4JZNA 3BAEL 2A83B 5E9DE 4PIRF 5T5FL 4HWUA 3QRLA 5KS9E 4EZLA 4NFDA 3SKUD 1ZTXE 3F6JA 3LKQB 3H0TA 5GIRB 4JDVA 2ZWLT 3PJSA 2VZ3A 2ESVD 2XQYG 2XTSA 3ROOA 3LB6D 4KO5A 4XI5C 2G3ZA 4JFOA 1WAAF 2JKNA 1QW9A 2Y6SD 4HUUB 4O58L 2G3XA 4E41E 1J7VR 4ZAKB 4LLDA 4W9EC 4XNZC 3QQ3B 1I8MB 4XXWC 1SHWA 1MQ8A 2BCKB 3JV0A 4KI1A 2IFFH 3SDAD 2OBGA 4Q89A 5DGQA 4YXHH 3EGSA 4KU1A 1XH1A 2OKMA 4JFSA 3VXSD 4YDIL 2X4SA 3MGTA 1NCBH 4Z0BL 4FQ1L 3T3PF 2X4PA 2ZCZA 2WTOA 1OK8A 1K5NA 1E8XA 5GRZA 1KIRA 1A8ZA 5IBLC 1OGAE 3W3BA 4JPWL 3CFKA 3SBPA 4U33A 4BHUI 4PJHF 4P23B 2IDTA 4X5PA 4GG6F 1JNJA 3DKHA 3RVVD 1FAKT 2AXWA 3HAEA 3MFFA 3GM8A 2J6EH 1WD9A 2V17H 3L5XL 3AAZA 4LP8A 3PP3K 5D2NB 2K9FB 3RVTD 4IDJH 4V1DB 2Q86A 5T3XE 5IHUH 3FB6B 2ZUWA 3U9UB 1DFBL 1HI6A 4G9DA 3QRFM 1OCZB 1UACL 1WISA 1BQLH 3AB0B 4YHPA 5C0RH 1XGUB 1OP5H 3QFJB 3R0NA 2AV1A 3L1FA 3WE6A 4XVOA 2F15A 2N0KA 2YQGA 4LOUC 1AO7B 4U05A 4X83A 3C75A 2Y7MA 4FS0A 4ZFOB 5BOZG 2HT3D 3C6SA 4RWYL 2EUZA 1F45A 3O8XD 3W9DA 3OKLB 5IMLB 1MRFH 4E42A 4LK4A 2Y9RT 3WS6C 3AUWB 4EUPG 3OKNB 2DQTH 1ZJAA 4HWZA 4ORZC 4PJAF 5HY9A 1M6OB 3VRLF 2C3HA 4WCYL 2P4AB 3FZUC 3FK3A 2ITEA 3CCHB 3NCCB 4G2AA 3B2VH 2F7RA 1U30A 3PFQA 5ABAA 1IAIM 3AVEA 4KY1L 1QVOA 3DMMB 1L9SA 1O7SA 2NUPA 5I19H 4OKVB 1F97A 2E7CA 3HB3C 1MOEA 3SSGA 1JYWA 5TF0A 3X1FA 4WU7B 4JKWA 3PWLB 2BOCB 4JFDD 1D5ZB 8FABB 2JELH 2XFXA 3KBFA 1WBYA 3NQIA 4ETYA 2XG5B 3RZCA 4EI5A 2WXKA 5EDXA 4AVIA 3D5OF 2VQ1A 3K1KC 4LASH 4Y4HC 3GXUB 2VC2L 4WNQB 5F89B 3CZFB 3MSPA 3WAJA 2HH0H 4AYDC 5JOFB 1GYWA 2VDPB 2IQAB 3EOYG 1FNHA 2HT4D 1PEWA 3C6LB 2XA8L 2ZE0A 2CO4A 2A74B 1KLGB 1TR7A 4RVBA 3L7FB 4X8XA 3ZZ1A 5IHZA 5JW4N 3Q6GL 3KH4A 4WUUD 3WD5L 3OJDA 5IR1B 3QE5A 1U8OB 4YFEA 5CSZA 1A6ZB 4HKXB 2YSSB 5DGRA 5EH1A 1W72H 3BAJA 5KVGE 4G7QB 3BKCH 1IC5L 4JRXE 4YFDB 4YDJB 1KFGA 4OD1L 3ATEA 4FNUA 3BW9B 2VW7A 4M1DH 1U8MA 3D0LA 1VAHA 4ERSH 1I9RL 5D2NE 1S7UB 1RP9A 1BFOB 3UP6A 3HR5B 3T2QA 1BM3L 2R1YB 4XOEA 3A6OA 3L4WA 2V9TA 3EH3B 1JHKH 5DMIL 1NLBH 1RH8A 5BQ7B 4KITB 4FERA 1KTLA 1MJUL 1KJ2B 1MCFA 1PQZA 3HNVH 4MXQD 1AZRA 1R5WA 4A7QA 4ZX6A 2YLHA 3B8YA 4GJTB 5GPRA 5ILTL 4G7SB 4NNPH 5DYFA 3STLB 4P99A 4Z7VE 1OV8A 4ODHL 5F71A 3QA3A 5F7EL 1KIPA 3RQ3A 5FLVA 4DETA 4DF9A 4G8AC 1T0NA 4OCYH 4CSSA 3QDGA 1N7MH 3BZFA 2J71A 5DJ2B 4M56A 5DHVA 3DV6B 3MV8E 4O9HH 2ZUQC 3DXAB 2A1WH 2XETA 1N6QH 3EDKA 3D25A 1M56B 1LMKA 1UURA 3E6FB 2X0VA 3EOTH 3HUJF 3BD5A 3OD3A 1MPAL 5BCAA 1OZTG 4CGUB 3F7VA 2BIPA 4HOZA 1MCKA 1JPGB 2HN7A 4EN3D 5CN3A 4MDIA 3BVNA 3GLDA 3CNKA 5F9OL 3UTSE 3SKJH 3BT2H 4Q58C 2A77L 4J7RA 2CNZA 4L3ED 2OL3L 3ZY7A 4D9QD 3DHPA 3FKUS 4YE4H 1O6SA 4MVBD 4H8WC 2IPKA 2WZ0A 3I9GL 5I1CH 2G3MA 2FYYB 3Q48A 3GHPA 3P3YA 4L37A 2NY0C 3N3EA 4NGHH 5D93C 4M9PA 4XP9L 4KRNA 5E2WH 3JTBA 3OG4B 1DQLH 3ESPA 5DJ6A 4J39A 3H9SA 1XCTB 1U0QA 3BFQG 4MZ2A 2VT0A 2WBXA 5CKGA 1NEZB 4HGWB 3DRQB 4GFXA 3HI6L 3O3BB 1SN2A 1E9OA 3SE8L 5DS2A 4HOXA 1YJDC 2DY2A 3D25B 3W9EA 3K4AA 3O6MH 4ELMA 3NPSB 2GSGA 4X6BA 3QDMD 1IGMH 5D1QB 2VO8A 3FO0H 3BDBA 5HDWA 2DV6A 4NO5A 2XC8A 4U3HA 1WS8A 3TBTB 5G4OA 1YECH 4XNZB 1IVTA 4ODVL 2P8LB 4R4BB 25C8H 1RQ5A 1SOKA 3NK4A 1CE1H 1A5FL 2YWYA 1ZXKA 1NCUA 4CSTA 2FL5A 3WIFB 1LILA 1MJJB 2ZF9A 2X44D 1UD6A 4KOBA 1C5BL 4JCWA 4QRRD 3WENA 1TUPA 3ALXA 1AGDB 2YXFA 2NQ3A 2VMFA 3V5HA 5IB4B 4JFEB 4KI5E 3A4EA 1DQQA 4NDMB 5ERWA 5ADOL 4EBQH 1OCWH 2CCVA 2ARJA 1LP9E 4H20H 2F7IA 1NCWH 4PWHA 5E03A 3OF6D 1P4LB 4F3FB 4MMZA 4EZKA 3GBEA 3KYKL 1J0JA 1PMYA 3N42B 4MNQA 1HU8A 1NAMA 4J27A 3QAZB 1N3NB 4IGBB 7PAZA 5KJRH 1MY7A 4OJDH 2IFFL 5B3JF 2BOBA 1YEJH 4JDTH 3RWFA 4NLHA 2UXTA 2AJVL 3I6GA 4Z7NE 4FXLA 1YEEL 4PLKD 4NKMB 2P9RA 3N06B 2WLLB 2CALA 5E56A 2YN3A 1EZUA 2CDGB 3GSVA 3L5JA 4M6MH 1N4XH 1IEAA 2DMGA 2FBOJ 4O2CA 3ZTNL 3KLHD 5K9OB 4E42B 1NAKH 2OX5A 2LW3A 2QGCA 3MBEA 2OCFD 1S7XB 1I8IA 4GT0A 1RJYB 2AJ3A 2OYPA 1FNAA 2B4CL 1K4CB 4NCDA 5CP3H 4CU7A 1TZHB 1UKQA 3GC3A 4K7PH 2XSKA 1NGYB 2I60L 1CS6A 4ZYKB 3AG2B 2ICWB 1U58A 2X3CA 4ENEC 3S5YA 2IH8A 3FRUA 2B9AA 3CAFA 3QUKB 2BOCA 1O6TA 1WZMA 1YNLL 4ZO8A 5I6LA 2A9DA 4KMTH 1YJDH 3NJLA 1I31A 1WBYB 5I18H 2B16A 2PW2A 2VDRH 2YC1A 4EMZA 4MDRA 2NZIA 5AVVB 2RFXA 1HKLL 3GIVA 4HJUA 3VXRA 4P23A 3BP5B 1E8ZA 2O5XH 5E8EB 2B4CC 2BZDA 3QIBC 1NFDA 4RWYH 5GS0L 5AD0A 2GJPA 4FLHA 4F7EA 4OZIE 1N6VA 4B9FA 3VI3B 3VFPA 2OMWA 4HIHA 2ZAIA 3VSQA 2CBQA 1ZVHA 2EE0A 2DQTL 4F33A 4ZMZA 4KNUA 3TH2T 1INQA 1MRCL 5KVMC 3DHUA 2ZQKA 4PJXF 4MS8D 5LG6A 3SDDC 4ES8A 4YDKL 4QXVA 4I88A 4M62H 4MA1B 2JTYA 5DHVH 1LQSR 4ANUA 3INUH 1NMBL 5I9QB 2W0FB 4OFKA 4Z3JA 2PCYA 3GMRB 4LLUA 2GG1A 3EHBC 4XRCA 5FM4A 2OMZA 3SZ6A 3SZKC 3UCRA 3SPVB 3NK3A 4HX1B 2OXHA 3UJJL 3MRNB 3MBXL 1ETZA 4PRIA 1QLEH 1IC1A 4AQEA 2A74C 4F2MB 5BRZB 3QUKA 4PGDA 3IXTA 2FR4B 2NXZD 4TKWA 5JQ6L 3BP7A 2ICEA 1I3RB 1LO3L 2JKJA 4FNSA 2J12B 2GIMA 2HFTA 5FO8A 3DUHA 3CFDB 5EZLB 3LKSA 4YZFF 3VXRB 2OMXB 5GGSY 2W0KA 5AVTB 4H5SB 1N8ZB 2LVEA 3ASOB 4XAKD 1SN0A 5DZVA 3HI1A 4WEBH 2L8AA 4PMEA 3QZWG 4WVRA 4J8RA 3OJ2C 3TNNA 1BZEA 3TZVA 1FGVL 3BZFB 3FSVA 1X5ZA 3C5JA 1ORQB 5L2JA 2GC7C 1I3GL 3SE3C 3QEHB 4C54A 1P5UC 4OGYH 3BQVA 1XAKA 3GKWL 1JS4A 2H26B 4N9OB 4I1PA 1UGNA 1IC5H 3J27A 3D4CA 3DXAA 3ISRA 4FKKA 1CXIA 5IFHL 4YK4C 5ICUA 1MFUA 2Y2YA 3ZGIA 1MWAB 3U0PB 1JGDA 4PTTA 2XIBA 2XTJB 3KPRB 3A3YB 1LWRA 1QRNB 5GRXG 4F2MA 1QSFD 5E00A 4YBQC 5AWNL 5LDSA 2NT0A 1JPST 1ZT7A 4XX1G 4FQ1H 4LFHD 3RU8L 3FB5B 2A6DA 2FLRT 3CLEH 1VCAA 1V3MA 3FN3A 1N5AA 1YY9C 3LN9A 4ZOCA 1VKXA 1SDAB 1M71B 4AW4A 5MHSD 5CBAB 3EO0B 3MRCA 2Z0BA 4KROB 4N6RB 3H3PL 3NESA 4JVPA 5SV4A 1JRHI 4KQ4H 4LARH 2HA1A 1L7IL 2D9CA 3JT0A 2HCZX 1BD2E 2B1OA 4JO3L 5HJ3B 3CH1A 3SDYL 4GXVH 1T1XB 4JR9H 3ZLQC 5IHUL 5CLYA 1Q1JH 1PZSA 3U2SB 1VDGA 4LCUA 1KTKE 3KJ6H 1J12A 4GBXA 2VNCA 2HTLC 4ALAL 3ABGA 4MDJA 3QBTB 3A22A 1IU1A 3O3BA 4KRMB 2XG5A 4G8IA 4EI5B 5D1QA 2ZX5A 3OHXC 4LSDA 5IW1B 4X6DB 3WKYA 4XNAA 2K6ZA 3VQ1C 1KLFA 2WBKA 3APMA 1BQKA 4TNVF 3SKJL 3TBTA 2XQYA 5L0QB 2H1PL 3QNZA 5HHXL 3ZL2A 2R39A 4F8QA 4MQ7A 4OV5B 1HYSD 3PQYA 4DW2L 1S3KH 2ERJC 4WCYH 3GHEL 2F2HA 3KLSA 5IW3A 1HYSC 2SEBB 4EDWH 3BO8B 3T1FB 1TJXA 1UM5H 3N1MC 4YBHA 3R8BB 4OF8A 4OI7A 4NGHL 2G75B 2PABA 4HU2A 2F7OA 2ENQA 4JFEA 2D7PA 4PVBA 1BGXL 3MRKA 2CDFB 1OGTB 2GUYA 2FH8A 4RBPK 1GJWA 4IDLA 3EBIA 4NS0A 4KZ0A 1PFCA 4XC1L 5J1TC 8PAZA 2JJSA 3L9BA 2Q76A 5J7CC 5T1KD 3RDJA 3ZPDA 4PRPD 4L8SA 3ARDA 1P4BL 4G6KL 4QO1A 2DQFA 5EDSA 1XGPB 5T3ZD 1GYCA 2NQDA 3Q5YA 1YCSA 4PJBB 3TJHD 5D4IA 1H5BB 1QG3A 2AP2A 4JFZL 3NTCL 1DQDH 3PY9A 2HX9A 4XVTH 5KVGL 1S6NA 5LJYH 1QUNA 3WXVH 5A3ID 1XGUA 3APCA 4G7RB 1J5OL 4Y0GA 2BNRD 1HI6B 3ARDD 3UGUA 1WFOA 1TTUA 4ECNA 5JW4M 1KWGA 4F57L 4ODTL 1T0NB 4RRPA 1U6AL 2N1KA 1E2VA 3C12A 5CZVH 3EF4A 3B9VA 1ERNA 2ZOUA 4NKOA 4W81A 4XX1E 5HGGS 2D03H 5HYSA 4G7YH 3NCYP 1IX2A 3UMTA 4HFUH 3DJ9A 4OCXH 4DK6A 1FGNH 4A2LA 4OD1H 4NO5B 4GBXC 4HZLB 5I2IA 5C3IA 2AQ1A 1P7QD 3MRFA 5INCA 4ERSL 1XF2A 3IS1X 4LLWB 4LEBA 2AAAA 3MRQA 2W88A 3WNMA 1L9PA 2CO3A 1PTZA 2BWQA 1EEZB 2RACA 4ZMOA 4ELKA 1VGEH 3KD4A 4UCFA 5DLMH 2EC8A 4N6QA 5E99L 1ILUA 4PGBB 2VR7A 2NW3B 1QHPA 5MEQA 3IRCA 3BE1L 3BP4B 2QQNL 1YHPA 2DBJA 3BSZL 3MRPA 4NKDA 1LMIA 4RGNE 1N4XL 2FEEL 5AOJA 1SPDA 4OGAC 4DZ8A 1WUNT 2Y7SA 5D7LD 1AD9B 5KYUA 1T66D 4WJKB 5HGDA 1TCRA 3U7WH 1KGXA 1UD2A 4WNQA 3DETC 5F89A 2W60A 3V7AG 2C7UA 4R0LB 4NNYB 2ESVE 3TBYA 1FNLA 4Y19E 5CLWA 1KCVL 3ILEA 3QCTH 1N6QL 1IO4C 3TA4D 4ZUVB 5C08E 4OCMC 3RUGB 5HI4D 1M7IA 4ZO9A 3U7YL 1Q72H 1SRDA 2QADB 1YNLH 5KSAB 1TLKA 3FOMA 3U4AA 5EU6B 4HJSA 4P2RE 4MA1C 4P06A 4PBVC 5E2VL 2B3RA 3OWEA 1UADC 5DR5H 4PJCB 1EIBA 1LDPH 5DJXA 4BE6A 2WLKA 1D5BA 4RRPG 1KV7A 1YYCA 1KBGL 4L4TB 4F93B 3KBPA 5D1XC 4B9PA 3IFNL 1L9TA 1AKJA 3I9GH 3UO1H 3NZ8B 4WWKD 4H25B 4ZMAT 5D1XD 4UIMA 1FG9C 3FUIA 3DRTB 3E3QC 4G8GE 1S2EA 2G9HB 3FOLB 2NCEA 4N3TA 4WV1A 4EF3A 3MA7A 4UU9A 5HPMB 1J05B 3WMSA 3K6NA 3ECQA 1EFXB 1MJ8H 2HTKD 5HI3C 4H1LA 5DJ8B 4MMZB 5AW3B 1QFWM 2ENPA 3Q43A 3MROA 2HJFB 3TZVD 3ARPA 2IO5A 4GSXA 1JGDB 3UJJH 1WO2A 2VDKH 1QLEL 3LRSB 4UOW1 1S9YB 4QRQA 1F4YH 1JMZA 3LYRA 4U1HA 4G7VH 4ZQKA 2YPLE 3RWFB 2DMHA 2E74C 3U9WA 5GJSL 4ZZKA 2VZ1A 4WK2B 1F4WL 3AG3B 1DBML 3KWVA 2A6DB 4FQJH 2PP9A 3QHZH 4HJIA 5DFTA 2PN5A 3QDGB 5JA8B 1ZT7B 4UQ3B 1YYLH 3PV6B 4YL4A 1HEZB 2YEVB 1F2QA 3IU3A 1WC7B 5T8IA 3Q8AA 4FI6A 2XZZA 1M2VA 1PSKL 3P0YH 4JRXD 1MW3A 5C8JA 1K5NB 5JIKA 1WS7A 3RPIB 4G3YL 5F9AC 3OPZL 3TGXA 2X3BA 1SVZA 4TS6A 5FOBB 2NY1C 4NBYB 1FL5A 1IM9B 2XRAL 3LN5A 3NPSC 3E1F1 4HUCA 1I3GH 2PPFA 3BLKA 3QAQA 5I26A 2VB5A 4PRBB 1RZ7L 4KQ3L 3VSVA 5DD5H 4GFTB 5LBVA 5DMJB 3HJEA 1QFUH 1DVXA 2ITDB 1WCQA 2P24B 5SWQB 1AGBB 4OIAA 2W65B 3BH8B 1XIWA 4HCGA 3SKNB 5TFSL 1CFSA 1ZE3H 5IMOA 4CN4A 3P69A 2NPLX 1X5IA 3V6ZB 3NBNA 1DJYA 1N8ZA 1J88A 2BNUA 3BZEB 4KKLC 2PF6A 4IU2B 3FBKA 3JWOH 4GIOA 2FCBA 4JPSA 1BPVA 2UWEF 2WLZA 1KJMB 2G3NA 2LAAA 5AYUH 2IIJA 3F12B 5I1EH 1KELL 2ID5A 4OFIA 4WY7H 3VXRD 1YMHB 2BNQE 1TTAA 3W9EB 5F93C 1NAKL 1W91A 3TN0B 1IKNC 4QT5A 4L4TE 3MXWH 1YN7B 2NOYA 2OM5A 1Y1DA 4WW1B 4WUUE 2EYTB 3H3PH 3VGAB 2O5YH 4JRYA 2X4QB 2YMXL 2P46B 2Q7NA 1NBVH 4K3EH 5KTEH 2GHWB 3I9PA 1JZ7A 1TFPA 5IOKA 2KUTA 4NHCH 3WFCH 4QY8A 1MVUA 4MB5A 4YO0A 3EJZD 3RDTA 5H37H 2VR8A 3IF1A 5IUCA 2WINB 5DYOA 3VTAA 1E7VA 2J5LB 2XPZA 2CBMA 4KKNA 4M5TA 4JPKH 1G9HA 2VDRL 4FOMA 1SBSL 1WITA 2AJUH 2EDFA 2P42B 2VQ4A 3MRRA 3VM7A 5J13C 3CZSA 4N2GA 5EUKB 2NR6C 3MJ8B 5HVHB 1HHJB 2BIHA 3LTVA 2P1YA 5BW7A 2OMXA 1HQRB 4FQXD 4ZDHB 5GS0H 1G7QB 4XP4L 4MNHA 4XNYL 5KUKA 3D9AL 4IOFC 5E2UL 5ESAB 5FECA 1QUNB 1F42A 1XTLA 5F1KC 2CR3A 1MRCH 5E5MB 1CIDA 2ZCKL 1IAMA 2X9XA 4I4WB 5C08B 3RUGE 4PJDA 3TN0A 3BLPX 5JZ7C 1AR2A 1AI1L 2QV2A 1QQDB 4GSDH 5EBMB 4BIKA 2Z7ZA 1JD7A 3SDXA 4B9JA 4A2GA 2YXWA 4OD3H 2FT7A 3QWOA 1GTNA 1J9TA 1TQTA 3P30H 1K4CA 4HKXA 2DPKA 4EUPA 5ACZA 3C8KB 2EE9A 4G6KH 5FA3B 3WIIH 5J6GA 4I3SH 5JOEA 5JTWA 3MRLB 5I1KH 3CVIL 1S7UA 4NQCA 4Q0XH 3FF8A 2VAAA 1U3HD 1XCXA 4JHAH 3MCKB 5DJCA 1SGKA 2DWSA 4O02A 5BZDB 2XWTB 1I9JH 5EMYA 4OLWH 3UIZA 4XZUA 1VLXA 3ETTA 1ZHNA 1E6JH 3K0YA 3P11H 5JO5A 3BCDA 3GIVB 3K5RA 3U7AA 3NZSA 5IBTL 1SJVA 2AJZA 3VA2C 2L7JA 5IJVA 5IHLB 2YAEA 2X53A 1CI3M 1G43A 1XZ0B 3FQYA 2MH4A 4LSTL 4Y2LA 5GGUB 1OGAA 1NAMH 2R23A 4ZBJA 2QADD 5TDNA 4OCRH 3QNXB 5DJ0A 4DGYH 3B5TA 4PJ8D 3THMH 4GEIA 1IKFH 4OB5H 3S2AA 2WXJA 4MJ5A 1UH3A 3RWIB 3FT3B 1A7QL 4HWEL 3MO1B 4MD4B 4OLVL 1R17A 2ATPB 2X09A 5F97E 2I24N 1SLXA 1VZHA 1WZ1L 5ACZB 5JQHC 5BMFL 5E99H 3DVGB 1X5HA 3FHAA 3ZKXC 2XVKA 1SNRA 2P52A 3GBDA 4NZTH 1AP2A 4WO4D 3BGFB 5C0GA 3FFCA 3LIUA 4B9GA 1S7VB 2B08A 3DTXB 4ZXBD 4ODWA 2OZ4A 3VXPB 2XWTA 4DO5A 5HHQA 4D3CL 5FCSH 4QHMA 1B90A 1R3IH 4K7PX 4IOIA 3AADB 1J1PL 3PFUA 3QPQD 5C09E 35C8H 1EXUA 5GSRA 3S48A 4KGJA 3SDYH 1Z9SB 1EAQA 5FWQA 4NQVA 5F0PB 6FABL 1QX1A 4XVJH 3KPSA 1XGTB 2HTKC 4YHPB 1K4DB 2XLLA 2R0WL 2XNAB 4A67A 2FEJA 4CNIB 3V4PA 4KI5C 3LKQA 1QBAA 3AWFA 1HESA 3C5JB 5L2JB 1PIFA 2NT1A 4PJBA 3PHAA 2AJXH 2DBLH 2JKLA 3UL4A 2E56A 3O6LL 4NJ9H 3P77B 4HUMB 1C8PA 1A3RL 3P9WB 1YAZA 3PV6A 1OAQH 1OSPH 2BINA 2KLTA 1TYJA 5FFLA 4L0ZA 1H3PH 4P07A 5D7KD 3VDBA 3Q2NA 5HTSA 4U2ZA 2GJ6A 3UJTL 1M05B 3TBYB 4Z7QE 4UTBA 1S3KL 1CF1A 1JXFA 2ETWA 3D09A 4TUKL 3WNJA 3N1PC 4NZUL 3QJUB 5CWSA 2BC4A 4L5FH 1U8NA 2EXWD 4ODWB 1OW0A 4TQEL 3TCLB 4KZEH 4AIZA 4UQCA 3ZT5A 4Q4EA 3EGSB 1AVAA 5DTFB 4XB8A 5T1LD 4UTBH 2YOAA 1EXUB 2KDGA 5F3FA 1U3ZA 2DN7A 2F5BL 4KK6C 2PCXA 1H3VA 3MLZL 4MMZC 1Y6KR 3NSCA 4ZSOB 4KC3B 2IBBA 3FHEA 3C5XA 4J6RH 4JRYD 5A2LH 1RSYA 3S36L 4FLSA 1UCTA 4JY4A 3LMJL 1SHMA 3MLWL 5CGYD 1DBBH 1V7NH 3MZGB 1CXHA 1NC4A 4E9VA 5HYQA 2WUBL 3NTCH 3MLSL 4XVTL 4W4NA 4M7LL 1FAIH 2NR6A 3NN8B 4U31A 3NCJL 2V9RA 5LNEA 4GRMB 4TULL 3SB3A 1EEYA 1DQMH 3EG9A 4AG4H 1DHKA 4NN7C 4M3JA 3IGFA 3ZW3A 4MJID 1F4XH 3ME0B 3RAJL 1A4JA 3E7JA 1HHGA 3B2UC 2C1OA 5J6HB 2HLFC 2UUDK 4G7YL 2WBJA 3A4DA 3KLQA 5JMOC 2JWYA 2OCCB 3FQUA 4FQCL 1E0OB 1X3DA 1O7DC 2G4EA 2VDLH 5BRPA 3HS0B 1ZVYA 3UGEA 1VF5C 2L7UA 4R4ND 1MCIA 3EYVB 4HKBA 3SEPA 2ED6A 2V5TA 3IJ7A 5ECJE 2JLPA 3L9YA 4PBWD 2W92A 3TH4T 3KW7A 4K8RH 4QYOB 3LS4H 4EXKA 1OP9A 2EECA 2Y6SC 4NUJB 1EWHA 5CCJA 1VHPA 4OKVA 5LXGL 1JZHA 3SDDA 1CDJA 3BPOB 3TP4A 4CJ0A 5FK9B 3ARGA 1KN4L 5GJTH 5FUCE 3HBQA 2ENSA 5SV3A 1UD5A 2B9BA 3DOSB 3JZ7A 4KJPC 1W8NA 3LXBA 4P05A 5HI4C 2MTPA 3ZKSD 1XD1A 3DECA 3B2PA 3O3DB 3QUZD 4A7GF 2WKGA 3AWGA 5ICZA 5LVEA 2LU7A 3WNIA 1E5ZA 4JFHD 5HGBB 4ENED 5FEBA 4P23C 3AS3A 2DH2A 5E70A 2XVGA 1CT8A 2VDNB 1UM4L 5K1NA 1LK2A 1QQDA 3UC0H 5A43C 3VDCA 1BX2B 5A6MA 5M95B 2VXQH 5EOQL 3V0IA 1GVIA 4Q6IB 5D2LA 3N9GL 4XP5L 3LD8C 4X8JB 2EDYA 3HB3D 1KN2H 4BFIB 4XN4A 3HA0A 3X12A 1ND0B 3TBCA 2FB4H 1SBSH 2AJUL 3QFDB 3G6JA 1BMZA 1KEGH 2G4GA 3E2HB 3ARWA 4FG2A 4YX2H 2ZYIA 3HE7A 1IBZA 4GRWE 1AMYA 1IGFL 3MJ9A 2HG5B 3K2UH 5LAXA 5HVHC 3R0MA 4OGAD 4WWKA 2X4QA 1PL3A 2ICEB 3QC6X 2EDBA 1KBKA 4K5MA 3T0BA 4PCTA 1JHTB 1B0RA 2JJSC 2R4SH 2WO4A 3LNGA 1ADQA 3MFGB 4JDZA 2OMTB 3SDDD 4DKEL 2FJFA 2DI8A 3GSOB 4HG4K 1KIRB 1XSOA 4LSSH 5EFIB 2YN5A 2DQJH 2ZXBA 2ZKMX 3OLIA 2DWTA 2DLTA 5IJDC 3F7YA 2KQNA 3NAAH 1IZJA 1NUDA 3HG1A 4IOFD 3ZE2E 5I6PA 2F53A 3MFFB 2ZICA 4Y2DC 1TVBB 4JKMA 4NAMA 2GEQA 1CL7H 2WV3A 3KWXA 2VMEA 2UWEA 4WGKA 3V6ZA 1AQKL 4WGVB 2DLIA 4DZ8B 2DWXA 5AUMA 2AABH 4JFOB 4MJ5B 4UTAH 4O4YL 4M7KL 3BN3B 1S4IA 4A39A 3T5WA 5MENE 3U0PA 2IG2L 4PWGA 3MOBL 3ZHNA 2Q6WB 1JTOA 2Q3XA 1MFEH 1JVKA 2E9WA 3GIZL 4Y5XB 3UG5A 1A25A 1FJ1B 5H37G 1MFCH 1INDL 4DUXA 1NOAA 1IAKB 3WTTA 4N2LA 3M07A 4OLWL 3IJ8A 3CN2A 3DO3A 1SZNA 4Z7UF 3DV6A 1NFDF 4Y1AD 4NUPA 4MXQC 3BAWA 5IEHA 1NMCB 3QG7H 5IW6A 4AEIL 1NC4D 2OMNA 1H6TA 3N85L 3T3ME 2BPBA 4E68A 3DVFA 4IOSD 4A7SA 1XF3B 2VRQA 3B9EA 1IGYB 5DD5L 4Y9FA 3AT8A 3P3SA 4OM1H 3ZE1F 4I89A 4EI6B 2QSTA 2ZD0A 4OJFL 2FQDA 1GAFL 4J3OG 3S3JA 3VRJA 3H1ZA 3O4LE 2Y7QA 1BWMA 3AUVA 4KMLB 2CK2A 3H9SD 1DJSA 3EJJX 4E9LA 3HNSL 2OXGB 1OM3L 2C9SA 3WGVB 1IFRA 5T1DH 2NNXA 1T2JA 4XX5A 4X5WB 5T5FA 2LR4A 3L3HA 4QTFA 4R2GC 1CCZA 5F21B 4WY7L 4D94A 3MLXL 5IM7A 2OX5B 3KCPB 1UA6H 2W0FA 4YZWA 5LGHH 3OSVA 2WXFA 2JKSA 1FJ1A 3F7PC 2VZUA 1ODAA 1T5WA 5ADPL 3CZGA 3RL2B 4D8OA 3I02A 1JGUL 5IROD 1M57B 5DD3L 3O3UN 3KM2A 2BY0A 3SOBH 3SE3A 1AHWA 1TNMA 2WNXA 3L81A 3MO1A 2N7SA 4JG1H 5G4MA 1WK0A 1GL4B 1TJGH 2MTAA 4R8WL 5FGCB 4RGOH 4YXKL 3VRIA 1FH2A 3Q6FA 1CN4A 3B5GA 1OLLA 3PP4H 2YWZA 3TA3B 2RFXB 4XOAA 1X6LA 3HRZB 4WHDA 2OK0L 5D1XE 1AQMA 5BOJA 1QYGH 4XC3H 2UZIL 3BEVB 5C2BH 3MU3A 1A6PA 2Y7QB 4OCSL 3TTYA 1IJ9A 1RMFL 1OB0A 4R3SB 1DQQB 4GYBA 4NRZA 3WY3A 1GIGH 3O11B 4R96A 2IDQA 1H3PL 4HWNA 2EXYC 3QORD 1QO3A 4HA1A 5CD3B 1J8HE 1MWOA 2YGVA 3I3EA 3FFCD 1WWWX 4KTEH 1LE5A 4JQIL 4ZD3L 1OARH 2IV8A 3LVEA 2H26A 4ANVA 4NP4L 1CYWA 2L7EA 43CAB 2V8LA 1ZGLA 2VQ1B 3QZLA 4XE5B 3L3IB 2XZAL 3SGDH 3FUHA 2AJYH 2OMZB 4OLYH 1NINA 4IKKA 1NA8A 4MHHI 5AENA 1A4KA 1F3JB 1HWWA 1BAFH 4ILDA 1OPGL 2WBJB 5F7KC 3G5XA 4DFHA 4LKCB 4Z7VB 1JGIA 4M5SA 4DESA 4ZFFB 2XWZA 1IEBB 3DVNB 2NY1D 4IRSB 3VRIB 4HIEB 5HP5A 1NMAH 4WUUA 4J6RL 1MN4A 4M03A 2HT4C 1CGSL 1BDYA 1RHHA 4Y2NA 4OTXL 2HN7B 3LMJH 3MLWH 2EDEA 3N43B 3CDZB 3VJ6B 3S88H 2WUBH 2R2BB 3I50L 1D5IL 1E8WA 5D1QC 4AIZB 4ATWA 2F8OA 1FNGB 5IVZA 4A2EA 3MGOA 4JM2D 4WW2B 4AK2A 2D31B 4ORGA 3UPRB 1HE8A 4G8GB 5AOZA 1G0DA 1JF6A 1CBJA 2CBPA 2Y69B 2YSTA 4HVBA 2UXFA 4GQZA 3TV8A 3LNEA 4QLRA 4LSTH 3ZZQA 5EV7A 4PY8I 3NIDF 1G0YR 1I8UA 3DSNB 5B4MD 1P7HL 3D3VA 3DBSA 4BDVA 4JO2H 3SPJA 4CN1A 1MI5B 5D72L 1FH5L 2P3YA 3THML 1A8JH 2ICCA 4K7FB 3QA3B 4IQHA 5KVEH 1AS7A 4N2FA 2Q1EA 1RLBA 5L4JA 2OFQA 4OSUL 4LEEA 4ZXBC 4WQOA 3ZU8A 2W0PA 2XPYA 1P7QB 2ZKYA 1N10A 2AMUA 2QMJA 3K8KA 4QF1B 2Y72A 3X12B 4BZ2L 1V3JA 2H3KA 2VW6A 4WI9A 5CZXD 2IANA 3OGOE 3OKMB 4X6CE 3MV7D 4TL4A 3TWYA 3U6XA 5C9KA 5JR1H 5KZCB 1XL6A 5E6RB 3WNOA 5E8PB 5F1IB 3MRKB 4F7CA 4HX1A 4LVHB 2MOGA 4PRIB 5F72S 4CC0A 1KN4H 2WXQA 5GJTL 3GMRA 2XUWA 1SFDA 3EKCA 3IDNA 3WEXA 4WTXA 3FB7B 1IGTA 1ETZB 2BVEA 1MHPH 3P1VA 4JKNA 5EC2B 3ZL1A 2NY4B 5LN8A 3BP7B 2G2PA 1IFGA 1X7QA 3M46A 2MEJB 5AYTA 1UWGL 2UYLB 1PAMA 2WO2B 4UINH 1HE7A 1K3IA 2BIQA 4Z3FA 4OLXH 5IB4A 5DVMA 1UM4H 12E8H 5ISZE 3WO3B 2X9YA 2VDPH 5JDSA 2R1WB 4H88H 1TVBA 2QHRH 5AW1B 3NA4A 4JFWA 4TVSa 3GSUA 4UT6A 1OTTD 3MROB 5D4HA 5TQ2L 3AY2A 1UWXH 5B7EA 3CPLB 4GI8A 4TMPA 1EMTH 5LCVH 3AQZA 5CUSH 1FNFA 1NBQA 4NJ9L 1HK6A 4NN5C 5TDNB 3FU3A 4RFOH 1QR4A 3BKYH 3QNZB 1OGAB 3VE0B 3OC8A 2JIXB 1A1NA 2VLJA 1T3FB 3HNTL 2BNQB 3GMMB 2XY1A 2EXSA 4LCCC 3TPUA 5LBSH 2ADIA 4FQHB 1EO8H 5IMKA 1W0VB 1WYJA 2VMJA 3D4ZA 3F58L 3W82A 1JFQL 1MCJA 4K07A 5DVOA 1X5YA 2WP3O 3RPIA 2MCPH 4Y5YC 1JV5A 2XWBB 4NIKB 3QPXH 4EIGB 1ETB1 5DRZB 1NANH 1HSAA 4EIBA 3CBKB 1UYWL 4JO8A 4PRNB 3GS0A 1ZAGA 4X80H 5KSBB 1SUHA 1KG0B 5KG9A 2B1AH 1TXKA 1BG1A 4UIKL 4J3TA 3U1SL 3U0WH 3ZKND 1FDLH 1OTUC 1N59A 5E6YA 3SDAB 3TO4A 3S36H 3LQZA 3WJMA 4FC3E 3GBNL 4G83A 3OPUA 3CFNA 3NSFA 4HZAA 4QOKD 1IE5A 4HMEA 4UM9D 3BZ4B 4JRWA 4IRZA 4MNQB 4ZMTA 1GGBL 3NSDA 5F0MB 2BS71 1A6UH 5I8CA 3V79C 2VC2B 3RL2A 1HAUA 3DBXA 1FVDB 1Q9LA 4X7FC 1ZS8B 3O3DA 3W5NA 1R9FA 3EYSH 3QDGE 2GSIB 1M9SA 5FO9A 1UASA 3ISYA 4NT6A 5FGCE 3E6FA 3S3SA 5L8KB 3N85H 4TTDC 3UO8B 4AE1A 3BSZA 2I07B 3CDCA 1SY6H 3O2WH 1M05A 2FIRT 5C0BB 1TQBB 1W72B 4FQCH 3DDGA 2VDLL 4KV5F 1J9CT 3MRFB 5DEGA 4JANB 1ED3A 1FN4B 2CK0H 2VITB 1ZDQA 2OTPA 4OZGF 4XBGA 3QWRA 1E9QA 3BQUC 3QPQC 5JDJA 3LS4L 4MFHA 4DP9X 2HZHA 1KDJA 3L13A 4MJ2A 2CPUA 3HAEB 3DX4A 2NDGA 4PRHD 3B37A 1EVUA 1C5DA 2IAMC 4F8NA 2VZOA 4DGVL 4I77H 3CIQA 2WSDA 5E5UB 4Z7IA 4I2XE 2FO1A 4CW1A 4KX8A 3I2CL 4PB9L 5DMKA 4R2GB 1UA6L 1FC1A 3TFBA 1AFVL 3L7EB 3H2QA 2XYCA 3HUJB 1IAOB 1ZHBA 4Q97A 1FYTA 4JY5L 4XXCC 3SQOH 1NC4B 2IPTH 1PEZA 2Y36L 3BUDA 4HZ1A 4MB3A 2A99A 1NUGA 1NGWA 2EINB 1ROWA 2WGXA 4JY4B 4MX7B 4MLSA 2CAKA 3TNMB 2WGNB 4LKCA 3K4ZA 4C56B 3N0AA 2ZOKA 2WXRA 3KJ4C 5EO0B 1UJ3B 1UFUA 3FTUA 1Z5HA 3NYKA 3N44F 4YHKH 2FB4L 1DSFH 1PLGL 2ESVB 2J88L 5AYQA 2RD0A 1T1ZB 1WAEA 1QYGL 3D2UA 4XC3L 3U4BL 1AOHA 4OCSH 3K2UL 4EI5C 5T3XL 1I8KB 1T7XA 4X5LA 3QNFA 4YC2C 3UROR 4KJPD 3TJHC 3ESVF 4PPTA 4UM8B 5E4IA 2KZBA 4XO5A 4JLRB 4PJDF 4AUUA 4HF5L 2E46A 4GY4A 2MCG1 1T7WA 4GI9A 4HIPA 5I1HL 3W5MA 3LN4A 3UTZB 4NP4H 1MCRA 4MWFA 3E8UL 4NSKA 3HS8A 1RJZB 2YAOA 1MCHA 4HAKA 5F44A 2DM2A 2J56A 4QAMB 1AHWC 3T3MF 2AK4E 2PYED 1G9MC 1MREL 1EDYA 3BP6A 3J8F7 4NQEE 3CH1B 1TZOA 3LRSA 4MA7L 3RFZB 1MLCB 4Y4KD 2DQUL 3NJKA 3ETBF 5ICZB 4J3OF 5F2FA 4HQQL 2BW4A 4HC1H 4TRPL 2XY2A 4AJWA 5K9OA 4Y4HD 2QQKH 3Q2WA 1KCRL 2P48B 3CVDA 3FT3A 4MD4A 4PS8A 1BX2A 4CU6A 1UOLA 3S88L 3ERXA 1RZFH 3FMGH 3O2VH 3WXWH 3HLAB 2QTEA 3L3OC 1P6FA 1BZQK 2NLJA 3CBRA 1OP3H 2P26A 1GS6X 5A16B 2ROYA 3VI4B 3BVUA 3APDA 3FB7A 4MAYC 2QSCH 2YBGA 3SO3C 1RPQA 1AP2B 2MPAL 4XOCA 1TZGL 3SN6N 2XN0A 1TQSA 3MMEB 3VXNA 4YDJA 1XHHA 1HOCB 2BVQA 4TVPH 3VXPA 4Z7WE 2VXVH 4PJBE 2I9LB 4PJ8B 3STZA 2CXKA 3UTTD 5F7DB 3NJMA 5B1AB 4GW1A 4NYLA 4N9GA 5EEVA 1ZLEA 2BVYA 4UOJA 5HVGB 5T1KA 1HKFA 3FSZA 2QLVB 1JHTA 1ZEAH 1OT1A 1II4E 2ARJQ 2P24A 5DJXB 2APTA 4FGMA 4XXDB 2QHLA 3ARQA 4PR5A 4LL9A 5GZND 4J3UA 4QHKJ 1LQBC 3R19A 3VGGA 2WLIB 5E8EA 3DOHA 3SYOA 4U0RB 5D7JB 4ZPTB 4GMTH 1OM3H 5DWPA 4OSUH 1KNOA 3EJCA 1QSEA 3QP3A 4OJAA 3CHXA 4XO8A 1WRFA 4FN0A 3UBXA 3IKCA 4G42B 4NXSA 1VA9A 2JIXA 4X42A 4CGTA 3WFHB 5CKAA 2JXMB 4FQIL 4M7LT 3VFTA 2DDQH 3GSRB 2IBZY 4TTGA 4YIQA 3KYMA 4I0CC 4MJIB 1J1XH 3BUBA 3GRGA 3RKPA 3RWHA 4U6YA 5KEZA 1KB5B 1ULVA 1N2RB 1O7DE 3L9RB 3SOBL 1JNLH 1AXTL 5KYXA 3BAIA 2NW2A 4ZQKB 5TPWH 1KPUB 3MLYH 5I24A 5FA3A 1TJGL 2B1HL 3S0PA 3JWDH 3WJJC 5CD5D 4GW1B 4BD4A 1NSNH 3L17A 4C4UA 5AAWA 5B1KA 5DURD 2I69A 3ATDA 3NP4A 4MCYA 3BSGA 2DMBA 4HIIB 5INCB 1YEDA 3KPTA 1HHJA 4N2MA 2QTVA 2CHXA 1N18A 2EH8L 3SCMA 4TSAH 3PXLA 1LP9B 4XNBA 1RK0B 1H3GA 3G9AB 4D2NA 2UY7B 3BUPA 3AABA 1L6PA 4P48A 2NW3A 2AXHA 4ZD3H 4QOKB 3O8XA 1H6UA 2OXGA 2BSEA 4LQ1A 3QQDB 4JFYA 3SE9L 5DJAA 3WI9A 1JK9B 4ZX5A 3LKNA 1EO8L 1FC2D 1JHLL 5FYLD 2GSIA 2XV3A 4HV8B 4K8RC 4P5RA 5M94B 1C12A 3VFMB 3W56A 3WFEH 3IXAA 1XD0A 2A73A 2WUCH 1G5AA 1OPGH 2V7HB 2EE6A 1YNTF 1BJMA 1B6DA 5C6WH 3KLKA 4PCSA 2BM3A 3NEEA 4POZD 3F12A 1N5YH 3FQUB 4GP4B 5DHDA 3VQLA 4GLRI 3G5ZB 4GKNA 2VUOA 3ARGC 3EXJA 5DZLA 3G3LA 4IBTA 4IOSA 5IQLA 5KSVB 1GYUA 3CHQA 4R90L 5DJCB 1IGCL 5JXEC 1UB6B 3RZCC 2EIDA 5IK3B 3EYUL 2QKSA 3P4NA 4UI2A 3WNKA 1JV5B 2VO5A 4HS8H 4PRHB 4ZS6D 1RZJH 3HG5A 4PW9A 1W16A 2BCMA 3PE9A 2YFNA 3GK8H 1TEGA 4XPAH 3EYFB 4PJEF 4B41A 4I0PC 1QR1A 2NY3C 5E8NA 2AXJA 1NDTA 5CLXA 3QI9A 1A4BA 1RURH 4WWOA 3KH3A 4NHUB 4KK5C 3SDAA 3TO4B 3BC9A 3CH8A 4KKAC 5A2JH 4WV1B 1G6RH 5FA4A 5DQJB 3PYCA 1TITA 4F9LC 1O75A 3GLEA 4Y7OC 1IBDA 3UTSB 4AQAA 1ASOA 2A0LC 3KGSA 1MRDH 2RQEA 3OQRA 4X7DC 1A21A 3VD1A 1MCEA 2HWZL 2IANE 1MG3C 3DIDA 3EFDL 3RGVC 3LQAH 5F1OB 4O51B 2B0SL 4DGWC 4YBLB 1A14H 4ZYKA 3UADA 3QFDA 1IM3A 1C16B 5IV2A 1MUJA 1NPJA 2D2OA 1TZHA 2P5WE 3DX9A 2XIDA 3PXJA 4BA8A 5DVKA 3QJXA 2OQJA 4TSBL 5LG1A 3UAAA 4P2RA 3L1OL 2COVD 1T03L 3WUWB 1QP1A 3G5WA 4TUOB 3VYNA 3DO4A 3L4CA 4YMPA 4LIQE 2G5BA 1KPVA 4M8UA 4NWTL 1OO2A 1M7XA 4DCQB 5LXVA 3MCLL 1HQ4A 5ESVA 1OW0C 2BY2A 1YDPB 1WFMA 4H25A 3DMMA 1PNDA 3G7TA 4K3JH 3Q01A 2BIIA 5C9JB 4KWUA 3EOBA 1SEQL 1CTNA 1OTSC 1WUZA 3NRPA 4HJ0C 4RMQA 4XN2A 3UIYA 1M7UA 4YGVA 5EU3A 2J88H 3JVGC 4LCWD 3RWDB 5D7LE 5ANME 1HH6B 1MHHA 4OT1H 3PXHA 5L2KB 3GKZA 3JYBA 3IAQA 4J3SA 1B4JL 2CRMA 4XCFH 1QLFB 4JZOA 2YPLA 4HF5H 3GZPA 4KKPA 1MDTA 5I1HH 1COBA 2KPNA 3QEUB 5EBWA 4O2EB 2GTWA 3Q7JA 2GJ6D 1TJIH 1V27A 2FEDD 2X1PA 1JFQH 2DB8A 4P2RB 3V6OE 1I3RA 3L45A 3GB7A 5E6SB 4PB0L 4YHYB 3ARTA 5C0BA 3ILQC 4UB0L 4W9CC 3ROLB 2EYTA 4EUPH 4LLYA 3VFSA 1T1ZA 3D2UB 4G43A 4QRFA 5FHAL 3ZE1B 1I8KA 3EJYD 4LNRB 4RSVA 1WGVA 5T1MA 4G5ZH 1Q9WA 1HZHL 5I8KH 2XU9A 1B9KA 5E0FA 3G5YA 2FBJH 2J25A 2GFBB 3LNDA 4PJ8C 1DFBH 2XQYK 4F37F 2UYLA 2EICA 3CFCH 4GAGH 4KVCL 1QSVA 3EFFA 4GP5B 3WO4C 5CEZE 5IJKC 4F15B 4HH9B 1OWRM 2OL3A 4UV4L 1GGBH 5CCHE 2X2YA 3O2VL 1NL0H 1J9SA 4ABWA 3UCQA 3JYCA 5F7MC 1Y0LB 3QUMH 3N1GC 1HILB 4F7EB 4OCNC 2PWGA 1JXKA 3Q2LA 3PDOA 4MX7A 2ADJA 3ESMA 3FS9A 1KJMA 1V3LA 1MWAL 5C08A 2J1KA 4G1MB 5KYYA 1JZDC 3BWSA 2ZKWA 3QEQB 1JYVA 2DQIL 3V4UL 1HXYB 1QSED 2JB5H 1NDMB 3MV7E 5GGSB 2HG5A 3T04D 5B3JE 5LGJA 1U91A 4Q2ZA 2BIMA 2OYKA 3VFSB 3LQAC 5CU9A 2CK0L 3BN9D 2AC0A 5CWSB 2GJ6B 3LY6A 4UT9H 3QXWA 1USQA 4F9PA 4Q9QL 2EDJA 2EEDA 3F7QA 3FT1A 1CLCA 4IBSA 3MHZA 3CMOH 4PH8A 5E1HB 1OGAD 4P57A 4KRPC 4WFFE 4NJAH 2GIYA 3SY6A 1KGUA 4HP5A 1JZ6A 3QJHA 3UTTA 3G5VA 4XNQA 5ISZD 2WLNA 3O9WC 1LD9B 5C1MB 3MCKA 2G9KA 3FCSA 1JZ4A 4JFYB 3L9EA 3LX9A 4JPVL 3OSKA 1IC7L 1A2YB 1NCHA 2VC2H 3FH8A 4H8WH 2HH0L 3FCUB 3IDJB 1QO3B 4JY5H 1I9IH 5B21A 5DUBA 3IDXL 4ZZFA 5E2TL 1RULL 4N1EA 5JPNA 2X89A 4DGIH 5IQNA 1DO5A 5DMYA 5TPWL 4PUBH 1FRGL 2BVUA 2FJSA 4UF7C 5F1NB 3VFWA 4EQ3A 4Z5RB 2EUWA 5I0WA 1ZHKA 3VACA 4PJ7A 4PGEB 4HETA 1I1AB 3BQUD 2MCMA 5I8CB 4UQ2B 1GC1L 5JLZB 1V3KA 4OVVA 3VFTB 1L5GB 2HB0A 2XT1B 2CMRH 1ANUA 5T3XH 2FECI 4LZKA 2BW5A 3IJEA 2J55A 2PTUA 1DLFL 3QWNA 4JAMA 2CDFA 1J48A 1JWSA 1KB9K 5BUGA 4Z0BH 2OPCA 1IGYA 5GGVY 3P9MA 1VFBA 4LSUH 3V0FA 3LV3B 4D9RD 2F54A 1IAIL 1OP5K 3WL9A 1HAWA 1VFUA 2FTAA 4UAHA 4QYOA 3FCSB 1UJ3C 4R26H 4BKLA 1JZ3A 2J8UB 1I1CA 3EYVA 4NNPL 4RFNB 4NYLB 2LLGA 4X7CC 4AW7A 4EDXA 1S78D 4KFZC 4DZBB 2FHBA 5DD0L 2ARJB 3MGAA 4ZAKD 5EU7C 2NQCA 3IN2A 1RUML 1H3UA 2OP4H 3PAUA 4H0GA 2DI7A 2J6EL 3BUQA 4N0YL 1I7UA 5EU4A 2Z35A 3GJFK 4PTUB 4GIAA 1Z0NA 1YQVL 3EJUA 3MCG1 4ANXA 4DKAA 4HC1L 1UGKA 4BRVA 2V3DA 3TEUA 2FAUA 1FO0H 4N68A 3KWWA 4IRSD 3E8VA 3LRKA 4X4ZA 4Z78A 4OLEA 4RMUA 2QR0A 3BGAA 3BRFA 1LO2H 4HUXA 5I1JL 2OJEB 5EO0A 5CJXC 3T2NH 2QELA 1T21A 5F9OH 1RUAH 3UGXA 5ALBL 5C0EA 3BT2L 1KEML 1KB5A 2FD6L 4DP7X 4DKTA 1LK2B 2IWEA 4ONGL 4A6YA 3MLRL 3K2KA 2X4PB 5SX4I 3UEZA 1AGEA 4HSQA 4JZJB 3GK8L 4XPAL 3C9NB 1XF2B 3IDNB 4TNGA 2QSVA 3GSNL 4C4KO 1RZIB 2E75C 5TD4A 5HGHA 2Z7WA 3BP4A 4Y1TA 2G75A 1PKQA 4NZFA 2FYVA 3MODH 4LAJH 1H8NA 5IQ7L 5B8CA 1OZUA 1J1OH 4U1SA 4JM0A 4YDVA 4FQPA 4JMXA 4MNHB 1LE5B 2UVEA 4MMXC 3UX9B 3NPZB 3QRGL 2PWFA 2VJ8A 3LQAL 3GF8A 1U8CA 2I9TA 3QDJD 3O6ML 3O6FC 2DQFB 2P43B 4FL4B 3GMLA 3CXHK 4YBLC 4XWGH 1M7IB 1MHCB 5C0JA 1R47A 2CCLA 1A3ZA 2FHFA 5EOCH 1G4RA 3BPOC 1IGJB 5BZWA 4KROD 5E1AA 4GXUM 5LKNA 3NIFB 4YWGL 4F7MA 4NNXB 4PY7B 1FIGL 4HGKC 4UV7L 5F7YC 5EUOE 3IXAB 3SJVD 4G43B 5EOTA 3PPSA 2G60H 1YEFL 2P5WA 1GGCH 4GAJL 4WJG3 1RHHB 3VGFA 1RK1B 4JREC 2ZJSH 2AQ3A 4I7ZC 3OAZK 5HGHB 3QJQB 1E3FA 1PX3A 1HOCA 2Y23A 3EF7A 4P59H 4BXSV 4Y4HB 2Z1KA 3F65A 3EJYC 4IHOA 2YD4A 3SE4A 1G7JA 4P5TB 4LVOC 4B95C 1M2OA 1I9RH 3QO1A 5IQ9A 2EDTA 3UPRA 2DYSB 1A9EB 5KJRL 2MJWA 5EZJA 2FO4B 3C2AL 3I3BA 4OT1L 5DRWA 3RVUD 1KPVB 4X5RA 2YEQA 2EEBA 4U7MA 3QXAB 3COOA 2AJVH 2HRPL 4HH9A 2AFNA 1B4JH 5D7JA 1Z9LA 4ZPTA 3VXUE 3VXUB 1AC6A 4KO7A 5AOMA 3EOBB 2W5PA 3OMZA 2WCPA 3QDJE 5IJKA 4AQOA 3POHA 3PWUA 3NT0A 5GGRY 1QSEB 5I0YA 2LTQB 4NT6B 1KOAA 5J89A 1HJBC 5H35B 5F7WC 1MNUL 5DQDH 1M53A 1PGRB 3IDUA 4J3BA 4W9KC 1RFDL 4UTAA 1OTUD 4Y19A 4X2UA 2V37A 3WG7B 4YIQB 1A0QL 4Y2OB 1T2XA 2C1OB 2VCOA 2VXSL 2I7OA 1WC7A 4HJJH 4OAWB 2HKAA 1IUZA 1FFOB 2VITA 2QQLH 4TUUA 3N6YA 1IGCH 1BAGA 3WJLC 1MUJB 2OULB 3DX9B 3QG6B 1ZS2A 5JPMC 4MS6A 4X5QA 2XBZA 4UV4H 2K6WA 3BDYH 2NZ9D 4GT7A 3MGOB 3N5AA 3CVBA 4DVBA 1ZT4B 2F61A 2XVLA 5CILL 1NL0L 3CFEA 5I71B 1EDHA 1EX0A 4YE4L 1KTLB 2AEQH 1YG9A 3O9WD 5I1IH 4N6RA 5JDSB 4IBZA 2XICA 3M17B 3N50A 1XL4A 1X5MA 4L1TA 5DHEA 5D93B 4QGYA 7TAAA 2BIOA 4FG6D 5J1AA 2AITA 1G6RL 3FQWB 4R97C 4U1GC 3U4EB 2P7TA 4XP6H 5DO8A 1DQLL 2D9QB 2D7NA 1PVHA 1U92A 3HC2A 4L1BA 3IVKA 2MOVA 4KNTA 4UUJB 4PGJA 1KENH 5C92A 2OTWA 2VLLB 4MMYB 2YKKA 2VL5A 4G9DB 3PL6A 4TPRH 4XODA 1YEGL 4QXGL 4IMKC 1BP3B 1KY6A 2NY3B 3RVXD 1G9MH 4Y4KB 4ZNEA 1CURA 4GAYB 1T1YA 2QMKA 1JPGA 4ODSL 3V8CA 1ZANL 3VO0A 2D2CC 3QFGA 3TO4C 3MLVL 3ATFA 4NWUL 3CDYA 2IMNA 1K8IA 3WTWA 2NRDA 1ND0A 1CDYA 4IRJD 3SPIA 5EBWB 1DBAL 1OGPA 1WZKA 1Y18B 2BSED 4JFFD 1NFKA 1R1CA 1OAUH 4FFVD 4PBDA 1XSIA 4AXWA 5BZXA 1T89C 5IVNA 4L37B 1HS6A 4MVBC 2X40A 2V2XB 4QI3A 3CDGA 1FGVH 5DD6B 3MAWA 2VABA 3HS0C 4XAWH 4EBQL 1HX0A 4S0HA 1N9PA 4LLMA 5HHOA 1VEOA 2ADGA 2HKHH 4WUKL 3QI9B 5HPOA 2A9AA 5I5MA 3KYKH 1PY9A 3KS0J 4NQCE 2W59A 1Q9LB 3EYFA 2ISDA 2OA9A 3B6SB 3UZVB 1XIWB 4PG9B 4S1RH 5FYLE 4LPTA 4K3HA 5A2KH 4HMDA 1QKZL 4Z78B 3OAZH 3GM0A 4I0PA 1NGZB 4BINA 3QWOB 5KOMC 4MJ6B 3EHBD 2ZT9C 4JZJA 4F2ME 3RL1B 3QULA 4FZEH 2I32A 5CMAA 1ICTA 3CSBA 4GG6B 3QHFH 1I8MA 4YHML 4XBGB 4G70B 2EC9U 1E4WH 3U2JA 2NXZC 2CHWA 3FUKA 3JTTB 4K7PL 4ONFH 2D3VA 4F7CB 2ZOTA 2PPCA 2P8MA 1GS8A 3ZIYA 2PO6C 2EVFA 1CU4H 2R2EA 2WSKA 4LE8A 4K9EH 4JZJC 5IB1A 4E9QA 1BVLA 1J9QA 1FVEB 3T9WA 4QKTA 3BUYA 3T2OA 4KH9A 3KPNA 3KYOB 4CU8A 3QIWD 1MFAH 2E86A 3CFCL 2RBLA 4E9YA 2YAMA 5D7IA 1RZGB 1OEZW 1S7SA 1MF2L 1XZ0A 3CFKB 4AEEA 4FQLH 1BFOA 3BPNC 3MRRB 3ZRSA 2AJZB 4AYSA 3ATBA 4Q74A 4EDXB 3ARBD 2V7NB 4L4JA 1ACYL 4A68A 1KIUB 1YDPA 2R9HD 1ZS8A 4FXKC 1TQCC 3GXIA 4WI4A 4X4YB 3CPLA 4B9CA 3IU4L 4QXWA 3RWDA 3F5WB 4O2CB 5EN3A 5GISL 1V7MH 2ED8A 5JPNB 1U2HA 2I26N 2GY5A 3I6LD 1MWAH 3MBEB 1TTGA 3VI4E 3LIZA 2W1NA 4X8JA 5F1NA 3VFWB 3MX0B 1P5UA 3L3DA 3KWWB 1OAZH 3LH9A 5EOTB 5TQ0L 3INUL 1DZBA 3GEFA 3R1GH 1KPUA 3C6SB 4EVNB 3FTGB 5GRJH 2H45A 2HJLB 4ZNEE 1VPOH 4S1SL 2DQCL 1J1OL 4NI3A 4TLUA 5B38G 1KCUH 3WFDH 1QMUA 5IB5B 1GRWA 3FSAA 2VLJB 5BRQA 4AVKA 3WTSA 1ZVNA 1JYXA 3CK0H 1Z0MA 1OTTC 2ADIB 1AGEB 4FQHA 1FL6B 4M1CC 5CF3A 1NKGA 1BZ7B 2Q7YB 1OE1A 1I8LC 4WGWB 1M7DA 1IB5A 3U1PA 4X7EC 3T0EE 1S7SB 4C58B 4H13C 2XWBA 4R4FH 3WL9B 3EUUA 2YD9A 4LVOB 1ZV9A 3N91A 1J0YA 1GYVA 1LHZA 1K4DA 2D4FA 1KXTA 4N8PA 5FC9A 2NZ1A 4YDVB 5E2TH 4NPJA 4WEBL 2HG0A 4PRPE 4TNVK 2NX5A 2WB7A 1D5XB 1FZOA 2EILB 4NENB 2HJKA 3TO2A 1AOZA 4AQ1C 4MGXA 1A7PL 2GI0A 4KXAA 5DFVC 5CD3A 1NUFA 1XB6A 1L3WA 4GAJH 4RMBA 5CZVL 3CSFA 5GGUA 4P9HC 4JKLA 3QCUH 4UBDC 5JHBA 2N7BA 4EN3C 2BHFA 1EBPA 2GI7A 4LSQL 2BK8A 4P59L 2YMTA 1FGNL 2YUVA 4NQXB 5F7NC 2CMRL 2GHZA 4TLKA 5JPMA 3F7KA 5IB5A 3PDOB 4A2DA 5DCCA 4N85A 1DLFH 1BEYL 1JP5A 4G1MA 3VYOA 4ELMB 5KYYB 4D0CA 4H8QA 5E51A 4X9IA 4HWZB 4U0QB 4NZJA 4DTGL 3SDXE 4LSUL 1TMQA 4U1JB 4AUJA 4LDLB 4WUUB 1JSYA 4MSWB 2FIKA 1AZZC 3BSZH 4R26L 1V5JA 1WBXB 4FTVD 1P5VB 4LEXL 2L3BA 3MUHL 3TURA 3G5VB 4XNQB 3V0AC 1G7JB 1B0GB 4P5TA 3VWKD 4ACPA 1G4MA 3QUYB 1RIUL 4EOWL 3BP6B 3HE7D 4L9LB 4ZK8A 1KGIA 3Q1SL 4RMRA 1L9RA 1UQSA 3UTTB 4ISVA 1ORQA 4NAQA 1ZKAA 1Q0YH 4WK0B 4Z7WA 3II3A 1ACCA 2B59B 1KCVH 4I5BB 1UB5B 4PBXA 1BFVL 1XGTA 1AHKA 5KYNA 1BZ9B 5A2BA 2YPKA 4PJHB 3NJNA 1WSST 2O26U 3OXRB 4NLAA 5TE4L 5JXED 3QNYB 2XNAA 2OSLA 3CUPA 5KVFH 3V55A 2NY7L 3SDAC 3PL6B 4YZFE 1SXBA 1XGRB 5EEWA 1E5BA 3V4VA 4FNLL 4ZOBA 3T2NL 3BFWA 5DR5L 3MNDA 4HHWA 5D5MA 3T71A 5GRUH 3ZHFA 5GXBB 4AVJA 2CJSA 2CDGA 4P2RD 4DN4H 1KXQE 1N26A 1ZA6A 5FAAA 1U3YA 5AW2B 3ZGHA 1N5AB 4A37A 5JLZA 1U2CA 4ZW5A 2VSKB 3MV8B 4RGMB 4OIBA 1PX8A 4YEEA 1I3UA 3B9KC 2K3HA 3LRMA 4GS7B 2JKTM 4ZFQA 2VN6A 2QFRA 3IJYB 2AEIT 3UJIL 4F58L 1CFNB 3DTUB 4F27A 1E28B 2WCSA 2B2XL 3PGFL 4ZTEA 1HSAB 5F7BA 2IDFA 2AKRB 4YGAB 3NP3A 2F53D 2NY2D 5HHMD 3ZT6A 4PG9A 5C9JA 3SPHA 4N24A 3ULVD 4KVNH 1WA0X 3BH9A 5HDBF 4TPRL 2LQRA 4G7VL 2Z92B 4LVNB 2YC1B 5KSBE 4PQXA 3E3QE 1CMOA 4X6DA 4JRLA 5F9WC 1JGVH 2F7QA 3PNWB 5JIQA 1FORH 4YQXL 2KZWA 4P23D 2EAEA 4EIZC 3TT1L 2YPLB 4QUOA 2VRAA 1AR1D 4YXLL 4B9KC 5A6LA 1CLVA 1MHEB 2NLJB 3II1A 1HHGB 1DN0B 2OV0A 5JZ7D 3UTPD 1IBHA 2D03L 5DEFB 4GXFA 3QEQE 3GBLA 4OJCA 1CYGA 3A24A 4V11A 2C1PA 4O58H 1OK0A 1CFNA 3DV4B 3VXTB 2P8LA 3WN5C 1J86A 3EBAA 2OXHB 1BVNP 5CGTA 2I9LA 1DJHA 5D8JL 3K6IA 4BZ1H 3MMEA 3GMPA 3EBHA 3HC3L 3RNQA 1LVEA 4L9DA 4N9GB 3VXNB 5F96H 2Z31B 1J8KA 4BGLA 2MRYA 1DVTA 5J6GB 3GPSA 1NPUA 3E80A 5AZEH 5CEXA 2F53E 2VAJA 4U3SB 5EA0L 2Y06H 4PJIE 4G5AA 1SMAA 4EZJA 3MJ7A 5T3ZH 2WQ8A 3M1OA 2BVPB 4LAQH 4LESA 4N2CA 3H9SB 5E1GA 3MNZB 2A73B 3GTTA 1QACA 3MXWL 1AH1A 2WCGA 2J7LA 2OJZL 4LBEB 4R0LC 2VWEE 2Y5QA 4ABVA 2WKOF 1AMXA 4QF1A 4K2UH 1IGJA 2YA1A 1KC5H 3L08A 5EORH 5E8DH 3QEHA 4OGZA 4QGTA 4AQ8C 4FI8A 3OF6A 3H9YA 3G5ZA 3QNXA 1BLNB 1X9RA 2O72A 3VXRE 2ZG1A 5HI5C 1RCYA 5BZWB 1Q72L 4YSSA 2NNAB 3TWCH 4Q6IA 2XWCA 3OZ9H 4BUQA 4DO6A 1WH0A 4OZHF 2J8HA 1AS8A 5CINH 1S3RA 1UZ8A 4LHQB 4DUWA 3NIDE 1YPZB 3BWAA 4LLVB 3T6QC 4KAQL 5TDOA 4OBRA 4AT6A 3HBGA 1KJ2H 1B88A 4ZS7L 3U25A 4A55A 5FHBH 1U8QB 2J1WA 4NN6B 5L2KE 4NC1E 4PWEA 5TE6H 4MCYB 1E9PA 4TVUA 4NOFA 3FB8B 3JVFC 1G7PA 4NM8H 3NCEB 5ICXB 1UTDA 4XNYH 1EZLA 1TQCB 3IU4H 3ZE2B 3REWB 3VXOA 2GABA 1U93B 4JG9A 1KXVA 2DEXX 3SCMB 3K81A 4WO4A 1RK0A 2DZEA 5JPNC 4QRSB 3BPLB 4JDVB 1R33A 2ORBL 2R59A 2WIIA 2PPEA 4FQ2H 1LEGB 2GJJA 1FFNA 3HZVA 4LOVA 4W9GC 3V7AE 1XV8A 3V5KA 3TVMC 2CLZA 4HUWA 1N3NA 2IPUG 4NQXA 4G59C 1VPOL 4S1SH 4HK0B 4D0BB 2OMWB 4LLDB 4M7ZB 1CGUA 1AG0A 4HGMA 3C08L 3FBQA 4F33B 3HC0B 2QGEA 3P30L 1G9ML 2MOQA 2FATH 4D0CB 3ZDWA 1YVLA 3RVVC 3ZHDA 5G2NA 3WIIL 1EAPA 3UZQA 5I1LA 5DLLA 3LKOA 2RB8A 4XCYA 4LO9A 4ATTA 3IAPA 1IGIH 1Z5LA 1JVLA 2OJ1A 4W9HC 4MQ7B 3I6SA 4OV5A 3P73A 2YXMA 1L9OA 3WS3B 2ZX9A 1Q9KB 4IEFA 4X4MA 2DQMA 1T2QH 1F56A 5ABDE 4DP8X 1TLMA 5LQBH 3G5YB 4APQA 5I66A 4NRZB 2OSYA 3S35X 3VMOA 1RUQH 5ITBH 4YUEH 1AANA 1IBYA 3LB6C 4NFBA 2MKLC 4RAUA 1C5CH 2HKHL 4W9ZA 1SOQA 3IN0A 3OAUL 5FV2A 4AL8L 4PWKA 4JFPB 1E2ZA 3PF2A 4XOBA 2WLIA 2ZWNA 4MCMA 4NP9A 4NFCA 3WLBB 3WS6A 3FAXA 5JYMA 5TFSH 3SODB 4YLQT 1BYPA 2WHVA 4PV8A 3ZYOA 3SPGA 1Y07A 4HALA 2WZAA 4LPCA 4AV4A 2WANA 3DGGA 3JWOL 1UVQA 2J4WL 4UUJA 5I1GH 1QWNA 2BO0A 2DQHH 4OQ1A 4GH7B 4BK5C 4X4YA 5AYUL 3ZSSA 4ZMWA 2DM3A 1KTRL 4DTGH 3NABL 3F5WA 4XMLH 1R34A 5GRVK 3ULUL 3HNVL 3EO9L 5B1BB 5DVLA 3SQBA 5IM7B 3C60B 3NMEA 4JB9L 4XCCL 2VDRB 3LZOA 1OE3A 2P49B 2XQBL 2VQUA 4U6YB 4ZAKC 4AKOA 3MREA 2JB6A 4LEXH 2XTJC 4IMLA 3SGKA 2N0MA 3BIBX 4UZUA 1KXHA 4D3CH 1VEMA 2GCYB 4DQOL 1M42A 4ONFL 5FWRA 1JNNL 1R3IL 1QATA 2HFGH 4RAVA 4E9XA 4FABH 5CR1A 2Q0ZX 4K3EL 5E7BA 4APQB 5I66B 3UTTE 1P53A 5IV2B 1I7ZB 3KJ4B 3MKGA 6FABH 1WD8A 4GRLD 4JRYE 4QJ3B 4FULA 5J13B 1CGYA 4GS7C 4V2BA 1MF2H 2NUTA 3VFRB 4C56E 1JPSL 2W0LA 5T1KB 4N1HB 4LIQL 3JVGA 5FYKH 2EE3A 4DK5A 4AY0A 2N56A 3BEVA 1ACYH 3CN4A 1EHLH 1LP9A 5FW6A 3C8HA 2I9TB 4XP4H 2FJUB 5HHVL 2OL3H 4KUCF 4AEFA 4UNTA 5J4MA 4EO5A 1KYFA 5JIMA 4PJ7B 4PGEA 4IRJA 4DN4L 3TBVA 1TTCA 2ZOKB 4P2AA 3CXDH 3CFIC 4AV5A 2Z65C 5CJ5A 3KPRE 4MQXC 3WKPA 4IIQB 3SQBB 4I0PB 3GUTA 3AB0C 2PO6D 4L5FL 4YHNA 1BZ8A 2CNYA 3QJFB 4N8UA 4I18B 4KY1H 1PLAA 3ARRA 4F58H 1DJZA 3GO1L 5C0DA 3K71A 2W8CA 4NNYA 4GG6A 5H2BB 3KPRA 3GTVA 4KO9A 2X28A 3W9DB 1XIWD 4MHHG 2ZUSA 4HS6A 5MP6H 3RHWK 1FO0B 3CK0L 3SKMA 2IWFA 2IFGA 4J2QA 4ZFFA 1XCQA 3EFOA 3F7RA 1HH9B 3T0XA 3VU1A 4GKNB 2V0AA 2ADFH 2APWA 4JO4L 1JCKA 4WI5A 1PD0A 4I3SL 3BDXA 5J0BA 3BEWB 4NSKB 5HBBA 1IGML 5T1MB 3RX7A 2NY2C 4WF7A 2ZNWA 3S3PA 4QTHB 1X5FA 1BD2D 3CFBB 2R69L 2V5YA 3DMMC 2D0GA 4G6AD 1B0RB 3ML9A 2AXFA 5LLIC 1DQML 5MEPA 3AY4C 1XAUA 1CE1L 4U3CA 3UAJA 3ZDXE 5HJ3A 3HG1B 2BVPA 1A6AB 5JMRA 4S1QL 1YNTA 4Y8DC 3F7YB 4QOKA 3GMOB 1ACZA 3LS5L 3GQFA 2IH3A 4B53A 4P4RB 3UERA 5DJ2A 3DSNA 1AYRA 4OCRL 5CNHA 3O81A 1LL1A 4W6YB 2MIZA 1OL0A 4AM0B 5ELIA 3GMNB 3FPXA 1C12B 3VFMA 2FWSA 4PJXB 4X9FA 1AR1C 1UXWA 1LWJA 2X4NA 3D87B 3IB4A 2FX7H 3HPJB 4WHYG 2DD8H 3ARFA 1XX9C 1ID5I 4Y5XA 1NLDL 4PG2C 1BEYH 5T5FH 2DQDH 1SJMA 2K7QA 2WWNA 2W38A 4WAFA 1MCOL 1KT2A 4JDTL 3U4KA 3IMWA 5ITFB 4MAZA 3WFBL 2EDQA 2IGFL 2DL9A 3AREC 4UQAA 4LXFA 4FXKA 3Q06A 5JHLH 3RX5A 4PJAA 3CFEB 3ZTNH 1E5AA 1CICB 5CJQH 5I15H 4J3OH 1PLBA 3O4OB 3VFGL 3CVHB 1U8MB 1SEBA 3LQZB 3WJMB 3NJJA 5LDUA 3T0EA 2RJMA 2PYEB 2LU3A 4DCQA 2CLZB 4HUWB 3AY4A 2BERA 4J3OD 2I60H 3H8NA 3HEIB 1QTPA 3ZDZE 2A1WL 5DUMH 1T22B 2R0ZL 3IKCB 4G42A 2AAVA 1MVYA 5LNDA 4PI2A 4GRLB 3B7YA 3KLAA 4BUGA 1D5XA 3DIVA 4Z3EA 4XMTA 1MCPH 3DWTA 2CGRL 3OZ9L 2COQA 1D7DA 4KI5F 5FA4B 4HUXB 4QMEA 5IREA 1WBZA 1JERA 2HVKB 2C4FT 3LKOB 4QEGA 4P04A 5DS1A 5IHBA 2EO9A 4IKLA 2E5EA 3AU1A 4W9IC 1YYML 5IEKA 4H2AA 5FYKE 4UNVA 3FDWA 5J5EA 3FTWA 4FFZA 1UWFA 2XKUA 5DS8A 2VDLB 5IT2L 3VXMD 3H2PA 4GPVA 4OZHE 3WNNA 1S5HA 1K5WA 5GRYA 2OMUA 3IJEB 3DJZA 4KK9C 4FA8A 3H7LA 4QHMB 2F68X 3CX5J 3I6KA 1BQLL 2NNCA 3KHQA 1OSZB 1HEHC 2UZPA 1F4AA 5FFGA 5I82A 4XCEB 3A0OA 3T8MA 3PGFH 4C83A 2XWDA 3NAAL 3R8QA 4W68A 2QLYA 1QEWB 4XMPL 2IADA 1IC4L 3QIWB 1TQVA 5J6SA 2X1WL 5FGRA 3D52A 3P9MB 3MBXH 2FQEA 4PV8B 1G7PB 3L6FA 5ICXA 2EIBA 3I75B 4ONHB 2UV3A 5LCVA 4WENB 1DANT 1ONQA 3GHBH 2FATL 4O4YH 4UU9B 3MJ8A 2X4UB 3OZKA 4UT6H 4HV8A 4YDLB 3ULVL 3QXTA 1EFXA 1IL1B 1XR8B 3ZHLA 1AKJD 3L2MA 3NCJH 4LSPH 2NY3D 2H6UA 4F7MB 3D0VA 3U46A 1ZLVH 4IKNA 4JFXA 5K33A 5MEOA 3SBWA 3QFJA 3U9UA 5H4YA 2AV1B 3HRPA 1DVFC 3UDWC 1EVTC 2DH3A 3V52H 5CMAB 4MTMA 4HK3J 1L0XA 2J8UE 4HWBA 4WV1C 5D5MB 3C5ZC 5E9NA 3WE6B 1CYXA 2IJ0C 1T4KB 3VSTA 4WSJA 2CBTA 2O5NA 2Y07H 3V0EA 3K6SB 3NEOA 4HD5A 5ADOH 3IDYB 3UZQB 1BXXA 3OAUH 3EJSA 1HT6A 5GGQL 3QZBA 3GJEA 1RJZA 4JQVC 4MNGB 1FBIL 5JA9A 2P5ED 3HC3H 3QIWA 3BVTA 5D71L 5E5LA 5KSUA 4OFYA 1CQYA 3C9NA 1YN6B 1YSOA 3C8KA 1J8RA 1JXDA 1KZYA 4Z8FH 3AZUA 1VADA 1SJHA 5T1DL 1P6WA 1QHOA 2NX5D 3F01A 2VIRB 5HYQB 3S4SA 2ZXEB 2MPVA 3RU8H 3AMKA 4M6ML 4BJLA 4H44C 3VFPB 3EFFB 1XZWA 4KRLB 1K6QH 1P4LA 1EO5A 1W72L 2HLEB 1WPCA 3T2LA 1O9VA 3DGCR 5DJ8A 1JGUH 4LL1A 1JPEA 3Q13A 1AQDB 3M8OH 4J4PD 5EZOH 1P2CA 1JK8A 3FU7B 4FABL 5E24E 4FRWA 5B4MC 2J44A 3DYOA 2ZX7A 4FZ8L 4I0PD 5C71A 2KT6A 1QSEE 3K8LA 4JR9L 3WIAA 1FLRH 2XYBA 2JKWA 1Q1JL 3RJQB 5C97A 1AO7D 1OHQA 4KK5D 1TVHB 2H9GB 4YLBA 4DKFL 4OZIB 5CINL 5HHNA 3IJSB 2ZYSA 2GTZB 5I8EB 4NKQB 1WWAX 2AK4A 3Q2VA 3L7FA 4B27A 4RGNC 5FFOA 2WXPA 3MRMA 2ATPA 4NBZB 1E4KC 2WWKT 5F7EH 1OKEA 4ADGA 5AKRA 1WHOA 3NRFA 4PAZA 1IRAY 4NM8L 4YO0B 3RDTB 4NXKA 5E4OA 2FGZA 1LEIA 4HIQA 1XBRA 1VFBB 1FHNA 4IRSC 3LV3A 3QWQB 2OR8A 3RZWA 4UDTB 3S2CA 2AXFB 3VI4F 3CVHL 3LD8B 4EZMA 1KJ2A 1PQZB 2QBWA 1M3JA 4OF6A 3QXAA 4HDIB 4IOIB 2CU9A 5F8RC 1A6VH 1EFXD 1QA9B 5DRWB 2XV2A 3LPWA 3OZLA 5KBKA 2Z91B 5CEXB 5I30L 5DA4A 4KH2A 1S7TA 2X4RA 4IK6A 5T33L 2EIEA 4GB9A 4K5OA 1NBZA 3ES6B 3LSOA 5AQ0A 4XWOD 4Y9BA 1MLCA 1EEUA 2WXHA 1IQWH 4UT7L 1DUYB 4HPOL 3STLA 2X9WA 3U79A 4Z5RA 1R0AL 5CCKL 3QWRD 4PTTB 4UTAL 3SCMC 2WXIA 4PP1D 4FYRA 4L3EB 1QRNA 3A47A 1A4CA 4U6XA 4WTWA 2YLKA 5IVXF 3IRPX 4PP1C 2E9JA 3HHMA 3V0VA 5H35A 1GGTA 1L5GA 4KGLA 4P5SA 3ARVA 4AOFA 1GCFA 1JNHB 4HKJB 1L9QA 3S96B 5I9QC 1Z9PA 2GB2A 2OMVB 2HYMA 2XKSA 4WFHD 4GUPB 5IB1B 4Y2DB 3QC5X 4L18A 3F04A 3TX4A 4P9HL 1P84K 3ZZLA 3DX8A 2K0RA 1THAA 1JI1A 4Z7QF 1I1FB 2EEAA 2R51A 4GLRH 2QGBA 1SJEA 1NCDH 3ATAA 1LEKB 3OL2A 3K74B 3L48A 4P3DA 4YH6A 1MI5E 4HK3N 4OGYL 3QUYA 4PYHA 2VDOB 3FQXA 1WICA 4AL8H 4JREB 4HU8A 4YLCA 5G55A 1H0DA 3H9HA 4RESB 5JOPE 2N7AA 5IFHH 1T22A 4QHKI 3U2SA 3KDMA 3V5DA 1IFHH 2O5ZH 3QQDA 4KDVA 1HCYA 3QAZC 4IGBC 4ZSOA 3V9EA 5KVEE 4JW3A 3OXRA 4BZ2H 5EF0A 1W0WA 2AZAA 2FVNA 5I5RA 4AIEA 1QHQA 2FE0A 4LBAA 2J5WA 4IBUA 4QPEA 4EPSA 3FSOA 1Q8MA 3T1WA 3VTMA 3DRQA 2IGFH 2YPLD 4JB9H 4XCCH 4BQBA 1WQVT 3HVDA 4GRMA 2XQBH 1RY7B 1RV6X 3PQYB 5DRXA 2IAAC 1OCWL 4H20L 2H3NA 3MYJB 4LPUA 1CD8A 5I15L 5DA0B 3SIKA 3BIKB 1S9XB 1O5DT 4Q9BA 5D96B 5ID0A 5C0DB 1L7IH 4KXZI 4HH8A 1I7TA 2H0PA 4OZIF 1Z2KA 1WIOA 1YEJL 4QHUA 5IK3A 3PL6D 3MQIA 3VDAA 1ZLVK 5TK2A 4JHWL 4FADA 1Y18A 4BCYA 3QCTL 1YEEH 3IDMA 5E08H 4UYPA 1NCJA 1C5DB 3TC9A 2CGRH 2D7OA 2WVSA 1ZA3A 4QDGA 4AC4A 3DJSA 5LN4A 5IG7A 5L7XH 4FXTA 2V2XA 2ZF8A 1RIHH 3PDDA 4J3OC 5A1AA 4JN2A 5CUSL 1R46A 5LNGA 5TK4A 3A67L 4U1SB 1EHLL 3DDFA 3BRGC 1GR7A 2B4CH 1KGCD 1OALA 2X2UA 1LDPL 4AJVA 3NZUA 3U46B 4RFOL 1FIEA 3KLLA 5HHVH 2ZUQB 2CO1A 4PJBF 1UOWA 2J2ZA 3VXMA 4FNRA 5GGTH 4YBQD 4P2YA 3BPCB 2DS4A 1MNNA 2ZPKH 1J9RA 3QDME 1JK9A 1BJ8A 2Z8RA 4ZTPH 1NGWB 4AYBA 4Z9KB 1JGEB 1J10A 5E95B 5IWLC 2AJYL 3BIAX 1NC2A 2AF2A 3IFOA 2YPVL 2MCPL 4HYTB 1R3KB 2ATKA 2B3IA 5B39G 1MIEL 4U6VL 4PJ9D 1IC4H 2CLVA 5D2LB 1WCBA 3QZWA 3MJ9H 3II2A 3DX0A 2VDKL 1NCTA 5HHMB 3K72B 3FN0H 3HZYB 4PJ7F 3FFCB 2DYPB 5L2KD 3PV7A 1RAMA 4K94L 4LU5H 2GBAA 3ULVH 3QHZL 3MJGX 4ODBD 2VXQA 4JO5A 5DU7A 3U6RB 1VERA 2PO6A 3OLDA 3L5WA 3VD5A 2NXYC 1A6UL 3RVXC 3FB6A 4XHJC 3T08A 5D6CA 3IS0X 4JDZB 2VLJD 4XN1A 3OBAA 4F57H 3S34L 2NUTB 1A3LL 43CAA 4Y1AB 3SOTA 1NKOA 1SQMA 4FCHA 1KCBA 1OAYH 2O4EA 3WKNA 2FUTA 2HT2D 1U8LA 1NIBA 3JZYA 5IF0B 3BHBA 2IDCA 4L4VA 3ALPA 4Z7UE 4AMWA 4F24A 1DVSA 1KIUA 4V33A 3JUZA 5B1JC 2WOBA 3RPKA 5EU6E 4YHZL 4ZUVA 3RUGA 3EG9B 4AQAB 1WIUA 2VUKA 5I8EA 4NN7B 3E1ZA 5T1LA 3MACH 4M61A 1CLOL 2NNAA 3FUJA 3WCYA 3O6FB 4IBLT 1NM4A 2HAZA 1MCOH 1DQKA 5EULV 5J6HA 1EZVY 4WI8A 5FYJU 3VFVB 3WFBH 1FL3A 3Q3GA 2I25N 1X5LA 2WXNA 3TEXA 4KXBA 4M5YL 1AZVA 2BY1A 5A16A 4O2FB 4URTB 3FO1A 4FCAA 4Y89A 4X0NA 1B2WH 2HJLA 5CJQL 2JNZA 2ZSVA 3ZE2F 4FNPA 2AKRA 2DQEH 3CDFA 3MRHB 3V0GA 3B83A 5L4FA 3VFGH 1NDGB 2CDEA 1G7MA 2MNWA 1AFVH 1MHPL 4H4NA 5EUOF 4AKQA 4FYSA 2JCWA 2WQUA 4LCYB 3VW3L 4YVNA 3F6IA 5HI5D 2LV4A 5EIIB 5K1JA 2X4RB 1S7TB 1CXKA 3GRBA 1NBVL 5KTEL 2BP0B 4YHIA 4AENA 4OLXL 4NHCL 1YLBB 4NO0D 5AWNH 3WFCL 1FFNB 3HZVB 4Y88A 3TNNB 5B3SB 3KPRD 1T5KA 4YSTA 4A66A 4Z3TA 3CLEL 2E4FA 3IK2A 4YHKL 1EMTL 1C7TA 4DKDC 2IH3B 2BJMH 2J3SA 2PP7A 2G2NA 4OIFA 1YNTB 3WTVA 1LYQA 3F7VB 4KJQD 1YYMH 1AXSB 4N0UE 1MWAA 3FH5A 2Q8BH 3SBWC 3VMPA 2NTFB 5IT2H 1UXWB 4RETB 2QT6A 1VACB 1NCNA 2KL6A 2Y3AA 4ETQA 4HKZB 4JG0L 5IROA 4OM0H 2FNBA 2QPUA 1DCEA 2DLEA 2H9GA 2ZCKH 5AVZB 3F58H 3WS3A 3P9LB 1JGLL 2GTQA 3MRBA 1EXGA 4CILA 4KKBC 1XF4A 3T77A 5I30H 3LEYH 4XPFH 4RAHA 2G5UA 3SDCA 2QVTA 5EIIA 4PRPA 2GITA 4N2OA 4CC4A 4W4OC 3S37X 3L3KA 3WHE0 1IQWL 3LZFL 1FDLL 2WZ5A 5AW9B 5LAPA 1CICA 5LGKA 4M43H 3CC1A 3MTXA 3WJLA 3SDDB 2EDRA 3HG1E 3ZN6A 1C1EH 4NUMA 4EDWL 5M7QA 2ADGB 2VSCA 4LEOA 3UACA 3EJZC 2MKWA 2MQ3A 4K3DL 5E0QA 1N0XH 3IE9A 1YMHA 3W0WB 3RG1C 1SDDA 4MCZA 2VR9A 4LF3B 1S7QA 4G6ML 4G3YH 5AUMB 4KX9A 2KZKA 4BM7A 5IESL 2XRAH 4NUQA 2EIZA 1OAXH 5MERB 5L4IA</