1OE1A

Atomic resolution structure of the wildtype native nitrite reductase from alcaligenes xylosoxidans
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
336
structure length
336
Chain Sequence
EDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Reductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Native Copper Nitrite Reductase from Alcaligenes Xylosoxidans and the Active Site Mutant Asp92Glu
pubmed doi rcsb
total genus 94
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe1A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe1A02
2HLEB 3TASA 1E65A 2EILB 1J9SA 1I53A 5LDUA 4BXSV 3S8FB 1GW0A 5B7EA 4K9JA 2AZAA 3CZUB 3EH5B 1AACA 2GB2A 2BZ7A 4MFHA 1HAWA 1NZRA 5TK4A 3BQVA 2BWIA 3OD3A 4E9VA 9PCYA 1NTDA 4AKQA 4DP8X 3EH3B 5I6KA 4P5SA 4P5RA 1MDAA 3QJRB 4DP5X 3NSFA 3T6VA 2TSAA 1OOWA 2VW4A 4G7RB 2CALA 1ET7A 3SQRA 1TKWA 2PLTA 4NAJA 3NSDA 3NSCA 3AW5A 5B1JA 4BWTA 4BDVA 4Q8BA 3ZIYA 3QJTB 1SJMA 1WS7A 4UANA 1AZBA 2IWFA 2Y1AA 2B08A 3JT2A 1IKOP 3SBRA 3BVDB 1X9UA 3FPXA 2PCFA 2NRDA 4HAKA 1A3ZA 1OV8A 2J56A 2BO0A 3ZX1A 1NIDA 2YAFA 4GY4A 4BDVB 1MZYA 4A66A 4KO7A 3OMAB 1J5DA 2QPEB 4DP0X 3UGEA 1QHQA 2IDTA 2EIMB 3G5WA 3S3CB 3EHBB 1PY0A 4YSRA 4YSQA 1SNRA 1QNIA 1JXGA 2HX8A 2H3XC 1AAJA 2YAQA 4HCFA 1PMYA 1VLXA 3AZUA 4DPBX 2E86A 3PAVA 2BW4A 4GXFA 4DP1X 4DP6X 2AVFA 4Q89A 2R7EA 1AZCA 2HZHA 3HEIB 1BXUA 4W1TA 5EHFA 3X1BA 2B3IA 1CYXA 1IBZA 2PPEA 2Q5BA 1OE2A 2VW6A 3QJSB 2I7SA 1A65A 4YSAA 2HRGA 2XX0A 2XV2A 3D12B 3RYMA 4G72B 1PF3A 2PPCA 2R7EB 5B7FA 3AY2A 5B1BB 4YSSA 2FWLB 1NIAA 1V54B 1PLBA 4KO5A 2GC4C 2I85A 2HX9A 3IBOA 4A2GA 1MG3C 1E5ZA 3V9CA 2H47C 5PAZA 2YAOA 2VM3A 1CC3A 4UF7C 1CYWA 5AFAA 3PAUA 8PAZA 1J5CA 2N0MA 2ZONA 4E9XA 4A2DA 5E9NA 4E9QA 1ZV2A 2UXFA 3NJMA 4M3HA 2GBAA 4JHVA 4M4RB 4F2FA 2VSKB 4KO6A 4F2EA 1N68A 1PZCA 1SF5A 4YSTA 2Q9OA 4A68A 1ZIBA 1KBVA 3NJFA 4KNSA 3GYRA 4JKNA 2GIMA 4HHWA 5F7AA 1NPNA 1EHKB 3ABLB 1AZNA 4KOBA 2CBPA 2J55A 2EIJB 1BXVA 1BQRA 3X1FA 2CJ3A 2DWSA 4PCYA 1QLEB 1SHWA 2IDQA 3T6XA 4YL4A 3ZBMA 6PCYA 3UADA 3T6WA 1M57B 3NP3A 4DPAX 4A2HA 1JXDA 1NDTA 3X1EA 1JZJA 1W6WA 1IBYA 4BWWA 2FQDA 2PPFA 3CG8A 1WA2X 1OCCB 2EINB 1L9RA 4YSCA 4YSUA 2HX7A 4HCGA 1OCZB 3AG4B 5I5MA 3CVDA 4EF3A 3FU8A 2PCYA 3WKPA 1GY1A 5B1AB 4AKOA 1CURA 3OMNB 1XB8A 4W9ZA 3U25A 2FTAA 3FYIB 3QJQB 3MX0B 1PLCA 4G7QB 3NJGA 3TBBA 3JTBA 4BK5C 1B3IA 1M56B 1SF3A 1ZPUA 4N4YB 4TXVB 4GP4B 2X87A 4YSPA 5I6LA 2BW5A 1JZIA 2BP0A 3FS9A 4GP8B 2FT6A 1A4AA 2XX1A 3N55A 1ILUA 3S8GB 3ASNB 2GHZA 1NIFA 1E30A 7PAZA 4DP9X 2YXWA 2XUWA 5D4HA 3C75A 2P80A 3PLYA 3UAEA 3NJLA 2YAPA 3IN2A 1M9WA 3FT0A 4G70B 5I6MA 3AG2B 1A4CA 2XLLA 1KDIA 5D4IA 4YVNA 1PLAA 3NYKA 1WA0X 2AZUA 2EIKB 3OMIB 4QKTA 1KCWA 4AX3A 2IH8A 1JZEA 1RKRA 2DYSB 1FWXA 3QJUB 4HIPA 2YQBA 1PCSA 3PAZA 1RCYA 2OJ1A 5A7EA 2XVBA 1SFHA 3ABMB 4FAAB 1JVOA 3GXUB 2BP8A 1OCRB 1KV7A 1MZZA 4E9YA 1GR7A 2FQFA 3UABA 2XV3A 1AG6A 1AZUA 2FJSA 1JZFA 3OM3B 3DKHA 1TEGA 4AI7A 2MRYA 1HAUA 1JOIA 1AOZA 3WKQA 5I6PA 1V55B 4BXVA 4CSPA 1X9RA 7PCYA 2BP8B 1NINA 1XB6A 1BAWA 2XV0A 2DYRB 1OE1A 3ABKB 3AG3B 5TK2A 3FSVA 1E5YA 1T5KA 1PNDA 4YSDA 2JKWA 1E67A 2P80D 2ZWNA 2RACA 1JERA 1SDDA 2IDSA 3TA4D 4DP2X 2WO2B 2PPDA 5ANHA 1BYPA 5B1JC 5D4JA 4YSEA 4FA7B 3FQ2A 2AANA 4GP5B 1JXFA 1GS7A 1ET5A 2IWKA 2MTAA 3NJKA 2VMJA 2BWDA 2VN3A 3ERXA 3OQRA 1SDDB 2FQGA 1RZPA 1WS8A 2FQEA 4JHUA 2DV6A 3TBCA 1NIEA 2LLNA 2VW7A 2QDWA 2ZOOA 2WSDA 3IE9A 4AKPA 1KGYE 1YLBB 2I7OA 2FT7A 1AZRA 3CVBA 4A67A 1PNCA 1DZ0A 2QPDB 4KO9A 2WO3B 3CDZA 2OCCB 1J9QA 1J9TA 2ZXWB 1XB3A 2XYBA 1GYCA 3FPYA 1ID2A 3ABGA 1ETJA 2PP7A 1ILSA 5I5JA 4E9RA 1JZHA 1AS6A 3NSYA 4YVUA 4WKXA 2TSBA 1NICA 2FNWA 1KYAA 4RH4A 3CDZB 2GI0A 2YAMA 3ASOB 3SBPA 3X1GA 4G71B 1GS8A 3FYEB 4UAHA 3HB3B 5I5IA 1FA4A 2J57A 1ASOA 1ET8A 3SBQA 1MG2C 1TU2A 2UXTA 1TEFA 2QT6A 2UX6A 3TU6A 3KW7A 2YAHA 3IN0A 4F7KA 2IAAC 1SFDA 2OV0A 1WAEA 3MBWB 2CUAA 1NWOA 1V10A 2YXVA 4N8UA 2XXGA 5IY5B 3L45A 1AG0A 3H4FA 3S3BB 1JZGA 2DY2A 1XMEB 3NJHA 4ENZA 2XU9A 2GC7C 2VM4A 3FSWA 2BP0B 2W88A 4NB7A 1URIA 3UACA 4CSZA 3FU9A 3FU7A 1L9TA 1AQ8A 1SHXA 2IH9A 3WI9A 1ADWA 1A4BA 3NJJA 5I28A 5F7BA 3KW8A 1BQKA 4NERA 2CCWA 5FC9A 2FT8A 3H56A 4PAZA 2JXMA 2JFCA 5AKRA 3H4HA 5AZUA 4HHGA 1AIZA 1BYOA 1AR1B 3NJNA 2IDFA 1PZBA 1ASQA 1J9RA 3T6ZA 2YARA 1L9PA 3AG1B 3FU7B 3WNJA 3T71A 2H5UA 4KOCA 4A2EA 1AS8A 1ZDSA 1OF0A 2UXGA 3QPKA 1HFUA 3NJIA 1L9QA 1AANA 2UXVA 2HXAA 3T9WA 4DP7X 1W8EA 3X2QB 5B7MA 1GY2A 3EH4B 2UX7A 3PPSA 4X4KA 4DP4X 1IC0A 4HCIA 2IDUA 1PAZA 3FQYA 4E9SA 1IUZA 1NIBA 2XXFA 5B1KA 3QQXA 4YSOA 4ZK8A 2CAKA 5B3SB 1WA1X 6PAZA 1KDJA 4DPCX 4HZ1A 3IEAA 3WIAA 3CVCA 3N2JA 1NWPA 2DWTA 4A2FA 1W6LA 1BQ5A 2YAEA 1EZLA 1GS6X 3DTUB 4KNTA 1F56A 4G7SB 3FSZA 1AS7A 3FSAA 3QJVB 4AZUA 3S3DB 4KNUA 2J5WA 3NT0A 4WTQA 2X88A 2VSMB 2PP8A 1KCBA 5PCYA 2PP9A 1L9OA 3UAAA 5I26A 1FFTB 4GYBA 2QDVA 3PXLA 4BWUA 1KBWA 4HALA 1BXAA 2XWZA 2BZCA 1UATA 3ZDWA 2HRHA 3EF4A 3WNIA 1N70A 1RZQA 5I6OA 1JVLA 4E9TA 4E9WA 1A8ZA 3FQ1A 1OCOB 1ZIAA 3WG7B 1CUOA 1DYZA 5I6NA 2Y69B 1OE3A 1ZDQA 2AFNA 1ASPA 1R1CA 2GSMB 2BHFA 1PZAA 2A3TA 2PPAA 1GSKA 2W8CA 3DIVA 3PCYA 1L9SA 3X1NA 3V9EA 1BEXA 3NP4A 4L0PB 3GDCA 4QLWA 1NPJA 2IWEA
chains in the Genus database with same CATH superfamily
3B2DC 1DLHB 2HRPH 4XNQB 5LDUA 5EF3A 4BXSV 2YKLL 1GW0A 3NFNA 4K9JA 1FAKT 3ZKXC 1HH6A 1FCCA 3BCFA 4N8VA 2CR0A 5FK9A 2AABH 2YUZA 1DN2A 5A7BA 1DQIA 5J1TC 1LP9F 4MA3B 4Q9QH 3DVIA 3ARBA 3FFDB 4P4KB 1VGEH 4E41A 1MDAA 1S3KH 5F1NA 5DZAA 1JL8A 5EUOF 2GJ6B 2F8VA 4M61A 3L3OC 2VW4A 2MCG1 4JRWA 4NZFA 4OGYH 1G94A 4DZBB 1IZKA 5JHAA 1DEEB 3KLDA 4NPKA 5T1KD 4GG6A 3OAYH 5FX3A 4BWTA 2DQGH 5IB2B 4XBPB 5JIMA 1WS7A 32C2A 2OAAA 4KQ4L 5KSUA 1A64A 5JNYB 4WW2A 1MCFA 5G55A 3X3FH 2AK1H 5CGMA 2BC4B 4WO4D 1HHGB 2IGFL 4RBPH 4JRXB 3ZT5A 1TZGH 5F3FA 3CBJB 4P5TA 3M45A 3UTSA 3VD3A 1QBMH 4K3EH 4QD2E 3EFDL 4GMTH 3QE5A 4S2SA 5KAQG 3QG7L 1JPGB 4GKLA 1I1CA 5EPMA 2IPTH 3QEUB 2BH0A 3VI3E 3S5ZA 3QUXC 1CDBA 2F5BL 4P2QE 1CLOL 2RIKA 4M8VA 2V9UA 1B0GA 1JZ7A 3PE9A 4G5ZL 5DF0A 1N7ML 4S0SD 1DVSA 2ICCA 4QEGA 2F7RA 3L5XH 4MJIE 1BD2A 5I1HH 2PPEA 1MH5A 2F54A 1KTKE 3BLBA 4PRNA 3SEPA 3IJ7A 4WJ5A 4LOFA 2BVOA 3GTNA 4G1MA 4WTXA 3H53A 5LNEA 1ZA3B 3F3HA 4F9PA 2V5MA 5FYKL 2DBJA 3GSNH 1RURL 4FTVD 3QULA 1I1AD 4QT5A 1RZIB 4ELDA 4E2OA 3IJEA 3O2VL 1AO7D 4WVRA 1TJHL 4A2GA 3WHE1 1CFVL 1CR9L 2C1OA 4KTEH 2BCKA 4X98A 1KCUL 2V2WB 1H3GA 4PD4J 5EN2A 4NGHL 1BP3B 5AFAA 3WGUB 3PAUA 1E2WA 5J13B 5K9OB 1BBDL 2A2QT 3BVVA 2N0MA 3HRZA 4ZQKA 4XB7A 3T65B 5L9DH 1HX0A 2WHVA 1T4KA 3AGVA 1PW3A 5EZOL 1NFDF 1YEDA 4XT1C 1AE6H 2F15A 3PDOA 2AGJH 2HVKA 2Q3XA 2NLJA 2GYSA 3BAJA 1RZ8B 5TQ0H 2R1YA 4RMRA 3PL6B 4XN5A 1JF1A 1XL6A 2EP6A 3AREA 4GSDL 5IMOA 4YAQB 2CBPA 4UBDC 1L0XA 1XR9A 3IVKB 3FN0L 3QEQD 4NQDE 1KFAH 1U33A 2CJ3A 3PWLB 1S7SB 1OQOA 2R2EA 3T6XA 5JOEA 5CJQL 3EJTA 3RRQA 1A7QL 1RMFH 4PB9H 5AVWB 4JX0A 2EQDA 4EVNB 2AJSL 2G2PA 5LJYH 3D18B 1W6WA 3VFSB 2D0FA 5HPMB 2RQEA 2KZKA 1FZOA 4U6XB 2Z65C 1YMMD 1GGBL 2VLKE 4MRCA 5ERWA 3T0WA 1ZANH 1X6LA 2YD7A 1NMBH 1OCZB 2X6MA 1N8ZA 2R2BA 5I73C 1C08A 3FAXA 3WKPA 3I3BA 1GY1A 2AJYH 4AKOA 4AITA 2KMWA 4G8GD 4Y8AA 5CJXA 2ZNXA 3BAXA 2B3RA 1FORH 3WS6C 3H9HB 2X89A 4D0BB 2GEQA 2Y5TB 1CQYA 3L5IA 2OSYA 1KB5H 3FU5A 3JTBA 4QOKD 4KKRA 4P2AA 5TDOB 3WFEH 4PGEB 1M56B 4B7IA 1U95A 1X3DA 2GEEA 4R5XA 5AW3B 3VQ2C 5L2KB 1X5MA 2JCCA 4NKMA 3ZPDA 5LBSA 1JK9A 5LBVA 1A4AA 2XX1A 3MV8D 5HDLA 3IBEA 3ZK0A 2YGPA 4TTDC 4FXGC 5TDNA 2BNRD 2ZUXA 5FW6A 3TBWA 3INOA 12E8H 4WRLA 3ZZQA 3F12A 1AFVL 1KLFA 5E1AA 4FEMA 1CYGA 2VLJA 4HBQA 4X7FC 4Z7NE 1U3JA 4LLDA 4XPAL 4Y7OC 4HJ0C 4EDWL 4XMKH 4ETQB 2QHLA 3ZLQC 3OKLA 4CVXA 3GLEA 1EAOA 2V3EA 5DSCB 1TTBA 4JZNB 3UXFA 3MV9B 1H6TA 5D2NE 5IBTH 5C2BL 3GJFH 4K3HA 5IJVB 4OZHA 1T03L 1TTCA 1IJNA 2WK2A 2AI0H 3DX2A 1O7VA 4DEPC 3K6OA 4KROC 1SEQL 3ZKNC 5A7EA 4LVNB 4R0LC 2DM3A 3FRPA 1DBAH 3P9LA 4NO0A 4RMUA 4AQZA 1JVOA 4HUXA 3KVDD 5EZIH 4AGOA 3BJLA 2XZCH 3VG9C 2PYFB 3EOAB 3GIVA 5J3HC 2F8IA 5JYLA 5GGSY 2YPLE 5IVZA 1D7FA 3I9PA 3GI9H 2Z34A 3MUY1 4LRIA 4NM8H 4YL9A 3KDMA 1T21A 1MWAA 1EGJA 1W0VA 2ICEA 2XPGB 1X9RA 1O9WA 2QV2A 3MZTA 4FNTA 4RRPG 4YWGL 2VLLA 4HIHA 1QVOB 1EFXD 2WGXA 4EJ1C 4KV5F 2WBWB 4PVBA 2X10A 4XO3A 2ZWLT 1YYLH 2J88H 3G5VB 4A2MA 4PJ7B 3JWOH 3CNKA 5D2LA 4WUUE 5DEFB 3N1QC 3NZUA 4Y4KB 4XP1H 2GPZA 4OGZA 1BZOA 1K72A 2Y22A 1X7QA 2BNUA 2PPDA 3ZL1A 2F5AL 5G5DB 3P9MB 4GW4A 4QCIA 4IKLA 5BJTA 3LXAA 1CFTA 2K8QA 4AVJA 4OIBA 4FQ2L 3DJ9A 1NBZB 1IEBB 2JELL 4DGVH 3RTQC 1A25A 3IETB 3I6LE 4GXUN 3E3QE 3R1GH 1CTNA 1OO2A 2H6PA 3FULA 4PP2A 4F7TA 3BPCB 5IM7B 1TFPA 3AS0A 4MB1A 3DX9B 2A6DA 3FUEA 2I7OA 2ICWJ 4YPGA 5G4NA 5DUBA 2X6CA 3CDZA 3U36A 3CV5A 3SDAD 3QR2A 3RWEB 2WYHA 1S2EA 1T20A 3WE6A 2X4RB 3R8QA 3K2MC 5FUZL 4I5BA 3RBSA 1JD7A 4OCWH 1NC4A 3BXNB 2BS8A 3ATFA 1MVFA 3V4LA 3JTSB 4W4OC 1XCQA 1ZLVK 3WIIL 3L1OH 4PTTB 4N9GA 2O61B 3U4KA 1SEBB 5ILTL 2K8MA 4NC0B 1H5BA 1X5GA 3GXPA 5JDSA 3FUNA 3TL5A 1BQLL 4NQSB 2B9AA 4FFYH 2VLRB 2VABA 5E9DB 2J4WH 3ZN6A 2Q8BL 3KLLA 3BISA 4JDVA 5ISZB 4MAYB 4MA8L 1T7WA 1ASOA 3SBQA 2A83B 4WI4A 5E7BA 2DQHH 2X1WL 2K6YA 4BH7A 4H8UA 1F02I 1U2YA 3D9AH 5HHPB 3HC4H 2G9HB 3OR7B 4D9RE 2VM9A 2WO4A 1Q94A 3EO0A 4LVHC 1A5FH 4PFEA 4AW7A 4BK8A 4UTBA 3SHSA 5IY5B 5LCVL 4WU7B 2V37A 3IFOA 3EUDA 3VXUD 2B4CC 1IE5A 5C09D 3QZMA 4MJ4A 1I8KB 2J1XA 1IMHC 1CDJA 1HL5A 2I32A 1OGAD 5L4MA 3KYOA 4PJCF 3TYGL 3WI9A 1A4BA 1LO4L 3TV3H 1E28B 1P4IH 4YC2B 5FC9A 5EZPA 4RX4A 1AXTL 3GS0A 3RFRA 4B0MB 1AY1L 4IOSD 2JFCA 4RFEA 1R3JB 1F90L 5DJ2B 4AENA 1AC6A 2CZNA 5J1AB 2CUMA 4PJ8A 5JORA 3PUCA 2WGNB 1KN2H 4MD4B 5FYJH 1A0QH 4OCXL 1X9QA 2Z4QA 3ILPA 2HMID 4BE5A 3AY4C 5LUMA 2WINB 2CSPA 2ZNWA 4IKJA 4NN5C 2DQIH 5CJOL 1T0PB 4PJHB 1UENA 4YR6A 4ZOAA 2I9LB 3VFVA 2BNQB 1RAMA 4M3JA 4U4IA 3VG0L 3ZE0B 3TVMA 5T3XE 3VFNA 1A6TA 5A43C 4FFZL 4LPCA 3QYCA 3NZSA 1YQVL 1KCRH 4XNUL 2D03H 2X4QA 1EZSA 1LD9A 3MSPA 3UPRA 5E2UH 2R1XB 3V0DA 3TEZA 2BY1A 4PJAE 2Q87A 4GQRA 2YAEA 3BAYA 3QHZL 4TUOA 1BECA 2ZXBA 1AS7A 4M5ZH 3HG1B 4XBEH 3F58L 3LN5A 3KGUA 4ORGB 4WCYH 5CILH 2QVTA 1S7RB 1S7UB 1VEPA 1CGTA 2HUEA 4WI8A 3T8XA 3Q43A 4HETA 5D1QB 3IM1A 2P52A 4XAWL 4IBTA 5FO9B 5IT2H 4Z0BH 4HWEL 4YFEA 4ILDA 1KBBA 1L9OA 3FOLB 3T2QA 4WU5B 3ZKMD 3LNFA 3BKCH 3MTXA 2CO3A 2OK0H 1IC7H 3IFNH 3VI3A 1QR1B 2EIBA 1UXWB 1OZTG 4P2QA 2CG9X 4I89A 3DXAE 5I1AB 4I0PC 5LG6A 4KZDH 2CJUH 2EKSA 3AT0A 5GGVY 3ZSTA 5FW8A 3OB0K 3ZGIA 1SVBA 4FJYA 2GW5A 4JN1H 3SDCC 1O7DE 3CDYA 2GSGA 4W4NA 1A8ZA 3SY6A 1BQHB 4HJIA 3D87B 5DMKA 2E6QA 4AE1A 2Y2YA 5IB4A 4B41A 1WEJL 4MJIA 3T2NH 4PRHD 4PMFA 3NK4A 4RZCA 3HE6C 2X70B 4QTFA 2DW5A 5BO0D 2IAND 2G2RB 3H2WA 1F8TL 3PWPE 4IEFA 1AJ7L 1NJ9B 2WXIA 1AQDA 3K4DA 5EC1A 4WIQA 1Y0LA 3S4SG 1RXLA 2VXTL 3TCLA 2A4EA 2IWEA 1ZWIA 3N42F 2RQ8A 3CLFL 1E50A 1ZTXH 2EIZA 2NXZC 3GXIA 3CZUB 2AW2A 4PW9A 2GB2A 3NDZE 4ETYA 2WYIA 4WFHD 5DVOA 1HAWA 4JO4H 5I30H 5LQBH 1KPRA 9PCYA 3IDXL 1T83C 2YUWA 2ITCB 4WV1A 2E3VA 1EBPA 3F7VB 5K39A 4PJDB 2Z35B 4ZSOE 4DP5X 4XNDA 5F21B 1FFNA 4Y19E 1GGIL 4FQXD 4G7RB 1JRHH 1JZ6A 2JJVA 1T89A 1HSBA 3T0EB 3QORA 5EF0A 3MRDA 3U1SH 5EU4B 2J6EL 2YGOA 4HW6A 4GUOA 2D3LA 5DO2D 3MRMB 3TJEH 3QP3A 4J12A 3SGDH 4EQ3A 3L1FA 1AZBA 3K80A 2W9LA 1N0XL 3BT2L 4NQDA 5F1OB 4L5FL 1URZA 2LFEA 5FGSA 3CD4A 3VFTA 1QFHA 4RAUB 4BUHA 4Z23A 4ADIA 4K3DH 4NRXB 3LKSB 3ZX1A 3POCA 4OF3A 3WU1A 2OTWA 2IAMC 1N19A 2FGWL 1MW2A 4WHTA 1KTLB 3CCHA 4JHWH 2VLKA 2VN6A 1NCCL 1OGTA 5F8QC 1JJUA 2VOTA 2W9DL 5JOFB 1QHQA 2CK2A 2OX5A 2N4IA 2F18A 1KB9K 3D0VA 1D5ZA 3G5WA 4P23D 1TENA 4JFZH 1MCOH 4M5TA 3C60D 3UGXA 1QNIA 1AAJA 4U6HB 1R3LA 5E6RB 2YEQA 3UO8B 2YSSB 1NGQL 1JGDB 2ZKWA 4I77H 4P2YA 3HI5H 2IO5A 1TZOA 2AK4B 3IS1X 1ITBB 4O4YL 4OLZH 4XCYA 4UTCA 2VDOL 1BXUA 1AGDB 2PXYB 5F7LB 5GRXG 1IBZA 4PJEA 1L4IA 1G7JB 3G6JB 4OIIH 3V8CA 3KWWA 5FFOA 3IS0X 1ED3B 4K71B 1KLUB 2P44B 4K94L 4QF1B 5FGBA 3EO1B 4NC2B 5A6MA 5MP6H 4U1GB 2GTQA 2YD0A 3TO4C 1HCFX 3IF1A 4J3BA 2NY4D 2VDKH 3QS3A 2M1KA 1JI2A 4CUCA 3MRLB 4YBLB 4Q2ZA 3FQXB 5F7DA 2W9EL 3P0YL 5AAPA 2YAOA 4FYRA 4XNYH 5DHEA 5IQLA 2YPVH 4HD5A 4N8VG 5I9QB 2NNFA 3BW9B 1YEGH 1A7NH 4P5TD 5D2NA 1TVBB 1UEMA 2WVSA 4G7VH 4EN3B 3K1KC 1QYGH 2EEFA 2DWEA 4X7CC 2GBAA 1YNTA 2PUQT 2CMRH 4PV9A 1S7TB 4GRWB 4WNQB 5C8JB 3EZJB 2VERA 4C56D 4X4ME 1UH4A 2Q9OA 4TL4A 1WTLA 4ZTPL 1NANI 3WXVH 1YNKL 4HGKC 4ZO6A 2GIMA 1WCBA 2MCPH 3KPSB 1MFUA 2KI6A 3GSQB 2P43B 1A6AB 4OUOA 2K0RA 4JFXB 3ABLB 4KOBA 5F7KC 4HOWA 1KPUB 4KKNA 2YPLA 3GD1C 4ONGH 3BP5B 5GZOA 4MYWB 3I3DA 1BD2D 5E6IC 4PCYA 2F54D 2NY1B 3ZBMA 4YL4A 2CH8A 4XNBA 5DTFB 2ZTBA 4IQHA 5GISL 2ZUTA 4CC1A 2UZYA 1O0VA 2G3ZA 5E2VL 4R2GB 4PMEA 2FJGA 1D6EB 4EEEA 3NIGB 1Q0YH 4KVNH 1G9NH 4U1JB 2W92A 2X9YA 1U8MA 2EINB 2QGBA 3GIZL 2AQPA 2HX7A 3BE1H 4HPOH 1M2OA 4F57H 4WUUA 5B3JF 1CBVL 3CSPA 3BZ4A 2D0GA 2L04A 1BJ1H 1IEAB 2VTFA 5SWSB 3HZYA 5EU6E 1OP5K 3C09C 5J11C 3PHQA 4Y5XC 3U25A 3CXHK 2WLNA 4UAOB 5HJDA 3GZQA 2B20A 3TBYA 2YQ3A 4UB0H 2CGRL 1WRFA 1S7VA 2HJKA 3DPBB 4RIRB 3VX0A 1G7PB 4JL2A 2WVVB 2E9BA 5DFVC 1PSKH 3GLZA 4NZRH 4MCZA 2X4SA 4ZS6D 3DMMC 3QH3B 1OTTC 5F3BB 4OD2A 4PP1C 2JV6A 2EJ1A 2GHZA 2E9GA 3U7YH 3WEBA 3SOBH 2H32B 2LTQC 3JVGA 1JHKL 2QGCA 5IBLD 2YAPA 3NN8B 4ZOCA 1P2CB 4R5TA 1WT5A 1DVQA 4RGOH 5MENB 4PG9A 1EJ8A 3Q0HA 4QIRA 1DL7L 2VYRE 1ZE3C 2ADJA 1K4DA 1ZPLA 4ZPVA 5ITBL 1MF2L 4HMEA 3DC0A 1ZMYA 2BCMA 3ARRA 2WXMA 3TOPA 4K0OA 1ODAA 4IJ3B 4PJGB 3UTSB 2DQUH 1ND0B 3BESR 4JZJB 5DJCB 2C26A 4OCRL 4O02A 2IADA 3STLA 2EE3A 3ZTEA 5IW3A 3N85L 5EPMB 4WY7L 4CMHB 5F0PB 2Q86A 3CFCL 4AG4L 2JJSA 1NGPL 5CEZD 4OFPA 1MLCB 4JPIB 4KXDA 1GR7A 2NY7L 4YDMA 3ILDA 3MFFB 1WUNT 4M93B 1EBAA 1BM3L 1S4IA 2EIDA 5F88B 4G42A 1TCMA 1GL4B 2W07A 2L7UA 3GHBL 1NCDH 1I1FA 4X9YA 3N91A 5ID1B 2BS9A 1GC1L 4OZFH 1MY7A 2DKSA 1IC5H 1OE1A 3GI8L 3RJDA 1F42A 1ZEAH 5TK2A 3HCVB 2AJXL 4D9LL 1IAIH 3SDDD 1JPFB 4NZJA 5HHOB 1MJJB 4QTIH 1E67A 3QIWB 3PHAA 4GAAA 4RNRB 4BGLA 1XFPA 2ADIB 2XICA 2C1OB 3D25B 2BCKB 3APNA 2P28B 1K4CB 3UG5A 4D0DB 2BSSA 3MNZA 3QI9A 3RNKB 1M1SA 1A6WH 4NZTL 3LCYA 1ET5A 5B4MD 4KRLB 1IC4L 4WI5A 5HHVL 4AK1A 3HI1B 3LS5H 1T1WA 1QABA 4PRPB 4QAMB 3VXRE 3MUJA 2V2TA 1BWMA 4F33A 5KS9E 2VMDA 2WNXA 3FHEA 2GFBB 3F7RA 5F9WB 2FWOB 3D39E 4F8QA 3KEHA 1A7OH 2AF2A 1HZKA 1A9EB 1OQXA 4LSUL 2ZOOA 5IEKA 2OTUA 3DUUA 4HSQA 4RAVA 4XCCL 5LBSL 4CGTA 1U2HA 3RTLA 3E2HB 2R2HB 4U1NB 3CU7A 5JPMB 1UM5L 3ULUE 4TVPD 1FV1B 5D7EA 1TLKA 4ZAKB 3QQ3A 2VO5A 3ESUF 3H42H 5AZEL 4H4NA 3BUTA 1JSYA 1FN4B 4PJIB 4UTAA 1ID2A 1XV8A 2X1XR 5MI0B 3ZKMC 1RULL 5AWNH 5E1HB 4NOFA 4BFBD 5T1JA 2WQ8A 4WKXA 1NICA 3DX7A 5DRXA 4CADA 1HL9A 1WBZB 3NACL 5GZNA 3FRPG 3PWJA 1AGEB 2RA1A 4PJ7F 3S3PA 4GG8A 1YPZF 3QRBA 5MEQB 3FYEB 4X9HA 1N8ZB 4MS8D 4YDVA 5FPIA 1C08B 2OR8A 4MXQD 3TH2T 3SCMC 1YAZA 3MLWL 3BJ91 4DVRH 3NIDB 3A24A 4J8RA 5CCKL 4XMLL 3FO0H 3IN0A 2IAAC 3MYZA 3DXAA 4QHLA 1HH9A 1BV8A 4B9GA 1IBGL 2A74C 3DV6A 1NFAA 4DW2H 2NT0A 3BGFB 2GITA 3I6KB 3MHZA 1R0AL 3L45A 4QY8A 3H4FA 5BV7C 4HS3B 5ESVA 4JNXA 4Q0XL 3SKNA 2BZDA 4ZJ9A 4AM0A 4OV5A 1I7ZB 1NCHA 1OT4A 1TU2B 1XMEB 3L2MA 2ATAA 2VM4A 4OSUL 4Z7WB 1MWAL 1EGJL 2BHUA 3SE9L 4S1RH 5K93A 2YMXH 5IROD 3CSBA 1HEZA 3QIUA 1HYRC 1DDHB 2G75A 3QQ4B 2G5UA 3PWPA 1LM8V 3KW8A 4NERA 2JB5H 2OXGA 4GQPH 1HYSC 3BRDA 4W6YB 2A73B 3U6RB 1XMWA 3IPFA 1FLTX 4LSSH 5EC2A 1KWGA 2FHCA 4LIQE 4OFQA 4XWGH 4XVOA 4EI5C 1MCNA 1UJ3C 2P24A 3HS0B 2EEDA 1J9RA 4KMTH 4C4UA 3KM1A 4KFZC 1ZSDA 4FQXC 3MROA 1MCPH 2R1WB 3LNIA 4HBCL 3KJ4B 3LH9A 4EDXB 4G9DB 5DO2C 2VDRB 4GEJA 3VFOA 4EUPH 5B22A 2HXAA 4J3OC 3EFOB 4N1HB 3BAEL 3TPKA 2B1OA 3L48A 4DP4X 4F7EA 4HU8A 3POHA 4ZSOA 5FV1L 4HCIA 4H0IA 4NUQA 5A3ID 4Y19A 2C3VA 1DVZA 5T33L 3B5GA 3WTUA 3UYPA 1I9JL 1G6RB 3CFQA 3J8F7 3U2IA 4FTDA 4MZ3A 4CU6A 5C08E 3DTXA 4EMZA 3KM2A 1KC5L 2P48B 1SDYA 4M7KL 1UVQA 1OCWL 4BGDA 2V17L 3JUYA 2FUQA 3TBSA 1T21B 1MWAB 3SO3C 4Z5RB 1V5JA 2WANA 4AZUA 4KMLB 4NI6A 2IQ9H 3TT3H 4HZAA 2UUDH 4AEHL 2WXLA 4F1SA 5E94A 2ALAA 4NJAH 4WDIA 4H5SA 2P5EB 4JPWH 4RX4D 5C0GB 5I1KH 5CFAA 1QFWI 3PGDB 4UQ3A 4QRSA 1XAKA 5GIRA 4A6YB 1AIFB 3L3IA 4QXTA 1JGVL 5IMKB 4AYBA 2BOLA 4JY5L 1UG9A 4PJ8D 3OHXC 2BRQA 2YRZA 2HRHA 1X4YA 4LK4A 2DTMH 4LKCB 3VGFA 5BJTB 5BMFH 1EDYA 1OSYA 2PW1B 3LNEA 2HT3C 3LMJL 1I8AA 2OSLB 5EORH 4UNVA 1J0JA 2AQNA 3VAEA 2K7PA 4DO4A 1IVLA 3ROOA 5JHDD 5AG8A 4PJHF 4L4VB 4UTBL 3HC2A 3N50A 2H6PB 2WNKA 3QAZB 2A3TA 3DSFH 4DAGH 3ZE0F 5HI5C 3TPUA 2PR9A 2M8XA 5FUCC 3X1NA 5DZLA 5HVHC 1FE8H 3N04A 4XX5A 4Z7UE 2Y7MA 3MOAH 3TN0D 5DS1A 3TF7C 2FO4A 3THMH 1VZHA 2OMZB 1M3JA 5DJ0B 4AQ1C 2AKRA 2YEZA 3BQUD 3SGEI 3H6JA 3X13B 2BY3A 4I5BB 4KJWD 2NY5H 4PREA 1AQKH 2FGZA 2V2XB 4WJKB 4Q4IA 1L0PA 2C9VA 4MDIA 2V7HA 4GW5A 4DQOH 1U4EA 2H1XA 3QWQB 1NTDA 6FABL 1GZQA 1G7HB 2A9ML 2OYLA 2A0LD 4HJSA 4P5SA 1TTUA 4AMXA 3LZRA 3CK0H 3NZHH 1GYUA 2IGTA 5C9KA 3PJSA 1MREH 2LVEA 4NP4L 2Z93B 4PS3A 4X4MA 3UAJA 4E0RB 1JNLL 4P2QD 5HGDA 3AGWA 2V9QA 1FNGA 2H1LM 2XQBH 4NDMB 2G2NA 4HS8H 4WFEE 2XZAL 1PG7L 3QDME 1J7VR 5GRVL 3EGSB 2Y1AA 4C4BA 4YQXL 3LQZA 4OIAA 5F1IA 3N40F 1WZAA 1DSFL 1JIBA 3CLEL 4L1SA 3FU6A 4N8CL 2IH3A 2UWEF 3QAQA 4KGJA 2MOQA 5K1NA 4AGPA 4P06A 1GGUA 3V79C 1P9MC 4FE9A 1NBCA 4DT2A 4TNEA 5CZVH 1KMGA 4QLRA 1IU1A 1C7SA 2XWCA 5DU7A 3EHBB 1UA6L 4LASL 3KPTA 4YJZL 1Z32X 3NZ8A 5J1SC 2JJTC 3U1PA 1G1CA 2YAQA 3BIKA 5EU6A 3W9DB 1RZFL 1C5BL 4Y5YA 1JAEA 3FQTB 4WSJA 1XCTB 2GKIA 1DBJL 2VCOA 4P5KB 5EHFA 3CH1B 1TO4A 2JTDA 1T7YA 3ZVVA 2MPVA 3PGFH 4ONFH 4QRQB 2HH0L 4G8IB 5I1LA 2IALB 4QRTB 4XI5C 4CN1A 4PJDF 4GAJH 1XGQB 4B60A 3MUGB 5IBLC 3MBXH 4EOWL 3ZRFC 1CXEA 2BERA 4A7QA 3QG7H 4F8PA 1E4KA 2DMBA 4J8QA 1N6QH 1VF5C 5F7HA 1EAJA 2H45A 5B1BB 4X4XA 3LKNB 3NH7H 5CIPB 3UGUA 1MUJA 3VRJB 3ZT7A 2PNDA 1LD9B 1MG3C 4FLHA 4R4BB 2FX8H 4Y4FA 3VU1A 4K9EL 3RWCB 3BUDA 1KXVA 5I8CA 2NXYB 1Q4NX 1OM3L 3VJ6A 1CYWA 2MQ3A 4XX1E 4YBQD 4Q6KA 2VR3A 2IOIA 3BDYH 4TVSa 2KC0A 4P57A 4HPHA 1A3RH 1WC7B 2PTVA 5EF2A 3ZR5A 1XX9C 4BD4A 2R4RH 1IGIH 5FYKH 3DOHA 1AHWA 2PW2A 1UASA 3RL2B 1UOWA 3O2VH 1MCCA 4ZUTA 1B9KA 3S7GA 4RGNE 3K2KA 1CFVH 4M7LT 1EHKB 4YDZA 3BKML 4ZXBA 3S35X 4MVBD 3H9SE 2WBJD 2EIJB 1BXVA 6TAAA 5FKAA 4GQ9L 4N0CD 4UT9H 4B0MM 1TZAA 1UZ8B 3QG6A 1F86A 1BBDH 2LU3A 3Q8EA 1RY7B 3KPRE 4TLTA 4CJ1A 5EZOH 4OKDA 4WK2B 1KELL 4G7YH 3QZBA 3IRZA 2WKGA 1G7MB 2WXPA 1OCCB 2CGZA 1S7XB 3E1ZA 3FHQA 3G5YB 4N0RA 4RISH 4I4WA 5FOBB 3M1CA 4JFQB 4BFJA 5B4MC 5JTWA 1MNNA 2A6KA 3EZ8A 3APMA 3C2SA 4WWPA 1QW8A 4OJDH 3INUL 2NW3A 1H3PL 1LO0L 1DVFB 1NOAA 1YMHA 2E9WA 5DJXB 1NC2A 3HZKA 4MHHI 4MDJA 3MXWH 1PS3A 3DARA 1JMXA 1IO4C 5IW1A 5CJQH 4ANVA 1W0WA 3D34A 1RZ7H 3VGEA 4DVBB 2H3KA 3M46A 1MHHB 1MCLA 1KPRB 1QPXA 2AJSH 1B3IA 1FH5L 1UM4L 5EBWB 3VXRA 5JW4Q 3L95B 5KS9A 3GSRB 4OI9A 5JIKA 4GRWF 1J0KA 1GGBH 1S9YB 2OCJA 3D39A 2CLRA 4AIZB 1PVHA 1YJDL 3KBPA 2N01B 1J8SA 3PJLA 2VDPB 2YPLD 3AMLA 3OAWA 4W9HC 2WWNA 1COBA 3ZHLA 3SKOA 2R69H 2C3GA 4HWBH 1XIWC 2P80A 3HTLX 2E9JA 4CC4A 1N59B 2YUVA 3X12A 2O6CA 4FKKA 4P4KD 3GSOB 1FZMB 3UZVA 2OP4L 2C9AA 43CAA 4GAYB 2D8KA 3LPWA 5JOPE 5I8KH 3DYPA 1VFAB 1Z9OA 3NIGF 3BYYA 3B9KC 2VQ1A 4ZRGA 1PCSA 3CN1A 2APTA 4WUUD 2YBGA 2OJ1A 5IJKC 3T08A 3LV3B 1SFHA 4JY4B 5E8EA 4AUJA 1F58L 4U1HA 3G04B 5EG6C 3VXNA 1MAML 4AQAB 1KV7A 1MZZA 4XPAH 4NI3A 5HGHA 1WZ1L 2ESVE 3KXFB 4NENB 3DUHA 3EH1A 4OFIA 2VC2L 2FJSA 4N1EA 1EEYB 3CZFA 4R4NC 2QVMA 5JPNB 3W37A 2DMKA 3I6LD 3W0WB 3MJ9A 4GRMB 3ZQ9A 4PJEB 5LXVA 5T1MA 5IBUG 3OGCA 3LDBB 1ZT1A 4G3YL 4XP5L 2P1YA 2ZP8A 3T0DA 1ADQA 1OB0A 1MEXL 3FB7A 4G6FB 3HNSL 2WLHA 3IF1B 4IRSB 4PBVC 4BQ9A 1TZ8A 2DICA 4QHMB 5IMMA 1SYSB 1IFHH 1XF2A 2JMRA 2YA2A 2FL5B 2H2SD 3I9AA 2O5XH 1AD0A 4AIEA 1Q9OA 3WLBB 3QYMA 1KACB 3GBMH 1ZOXA 4WW2F 3BKYL 1O6SA 1QI5A 3QCVL 4MMXB 3UBXA 1PIFA 4UUJA 3EADA 4NKDA 4GKZA 4FXLA 5GS1A 2WLMA 2GJZA 1THAA 4NWTH 1EJ6A 2DWEB 4ZUSA 1FL3B 3W11C 3SD2A 4K7FA 2IJ0C 4O9HH 3E9UA 1CBJA 4W70A 1NIEA 2VW7A 3BP7A 1AXSA 2BSEA 1CGSH 1IRAY 5KSVB 2CKBA 4K5NA 1A14L 5CJ8A 4WI9A 4A1RA 4Z7OE 2EXSA 1KPVB 1WAPA 1MSPA 4UT6A 1UXSB 5C08A 4TPRH 3W5MA 1YUKB 5JXAL 4PJXB 4RMTA 3RY4A 1ACZA 5IFJA 4AXWB 2ORBL 4FMVA 2CLZA 4FQ2H 3P54A 2XYBA 1A4JB 4MAZA 1CICA 4JFSA 4N28A 3M7OA 4ALAL 2E7DA 4ODWA 4M7JH 4GS7C 5LGKA 3MLSH 4FQ1H 3FFOA 3GLDA 4HS6B 2WIMA 4KKCC 3BZ5A 3HUJB 4JR9L 2NSQA 4NKQB 5DQJA 5ETUA 4TULL 5I8EB 4XODA 4PBXA 1D7CA 3RDTA 4O02L 2JE8A 3V0VB 5ABDE 2DPKA 4KKQA 3GSWB 4YEFA 3U4BL 1J1OH 3FZUC 3L4VA 5D1ZI 5DHYA 3D07A 4OLYL 5BVPH 1BREA 4KY1L 3K8MA 5FUZH 1OY3B 3HA0A 4OT1H 2XXGA 3OKOA 4AY0A 4Y4HC 2EXTA 3WNLA 3HNVL 2FO1A 4U2YA 4YK4C 5ILTH 1JTOA 3TN0C 4XP4L 2V7NB 5I1EH 3KBEA 5T3XD 1MCJA 1KCKA 2H3NB 3BQUC 2OI9B 3FU7A 4LZKA 1RSFA 3ML8A 1TVDA 3HZVA 1QRNB 2QELA 1MFAL 4KX9A 1MQKL 5DJDA 2EEBA 5FM5M 5L8JB 4ZOEA 1XGUB 4P2RB 4Z7UA 3VXTA 3IMWA 5AZUA 2DAVA 3M1BA 3RU8L 4NNXB 4IOIB 5AW2B 1XQ4A 3II2A 1FG9C 5IESH 3LH2L 3MA9L 1A2YA 5L2KD 3W39A 1JPTL 4NNYA 2CJTA 3QUZA 4WZ9A 2A6JA 2W81C 1FIGH 2VISA 2ENSA 5GZND 1XR8A 4MNHB 2A1WL 3FB8A 3VRIA 4OZ4B 1T66D 5C0BE 1NGYA 1S7WB 4F58L 3RGVD 4R4FL 4WWKB 3DVGB 1PAZA 1ZRUA 1T2QL 3WJJC 3BEWB 5CEXB 3S36L 1AXTH 1E4XI 1TVHB 3ARGA 3H8NA 4P3CL 2FD6H 4I48A 4X8JB 5B3SB 5GS0L 4A7GA 4NUGL 4IJTA 2BOBB 3O2WH 5EOCH 3QDMA 5EB9A 4IBUA 3BDBA 4ZMTA 2YD8A 1NFIA 3F85A 2H0EA 2DWTA 5HJGA 4KFMA 4GAFB 1FYHB 1QLEH 3CZGA 2GBUA 2NY6C 3QUMB 3FSAA 3OAZK 5DA4A 1R34A 4CSSA 3E38A 4PCSA 4PY8J 2JCCF 2UYLB 4UTAL 3TIEA 3L7FA 1GIGL 1KLGA 2P9RA 3GBNL 1YYML 3APCA 3RPIB 3VFWA 1IAKB 1YHPA 2QFPA 4E42A 4ZFGH 1PY9A 3UYRH 3BHBA 5ENWB 4JB9H 5I75B 1VSCA 4DHLA 3JSSA 4XNUH 4NQEE 3PXLA 1KYUA 3FMGH 2OJZL 2B2XH 1MKFA 3LB6D 2EC9U 1B6DA 4D9QE 1UB5B 5H4ZA 3GZPA 3AITA 1B0IA 3QHZH 4XHJD 1Z9MA 4HOZA 2HT2D 1CUOA 2Y7LA 2YFOA 3OVUB 5HGAA 1XGRA 4U0RB 1HSAB 1CZ8L 3MCKA 3ALPA 4JLRA 5E4IA 1ZDQA 3SBWA 4Y4KD 4M1DH 1IFGA 1NCUA 3NPZB 3MN8A 4M6NL 4D8PA 4DUXA 1V8HA 5KYWA 3BI9X 5J7CC 5GJSL 5EDSA 1FNSL 3CVIL 3GM0A 2Y5QA 3DUUB 4WWNA 4TSBL 2UV3A 4GBXC 1JZ2A 3TNNA 4H20L 2NYKA 2BPBA 4JG0L 4ODUA 5L6YL 3LKPA 3U7AA 2E6JA 5AOKA 2JTYA 3QYNA 2LQRA 3U4EA 2EDBA 4X6BA 5C0NC 1YEKH 5EU3A 3VXME 2WQRA 3RKDD 2X1PA 1NZRA 4OKVA 5FA3B 4Z6AT 1BIHA 4L8SC 4Q6IC 5DMIH 1T5XA 4PLKC 3OLDA 1I9RH 5HDRA 4UILL 4MVBC 2WBJC 4YE4H 1B6UA 1TQUA 1JNNH 2N0KA 2JKRM 4PJ5E 4PRIE 2B8OT 2XRAH 2ZP9A 1C12B 1U8KA 5J6HA 5DVKA 1AJ7H 1D5XA 1ZAGA 1OK0A 2A9NH 3IGUA 2XWEA 4YXHL 1MW0A 1TKWA 5D7JC 1BX2A 3DV4A 1QWHA 2VXTH 2WUCL 4LDOB 4J8RB 1ZHLB 5AB1A 2NY3B 4Q8BA 4NP9A 1ETB1 3OZ9L 3HE7A 3E8UH 3H9SA 3QZWA 4LCVA 4N2BA 1I7TB 2Y24A 4L3CA 4UV7L 1KXTB 3JWNE 4GXVH 2XPZA 3BVDB 4DN3L 2DQFB 2VWEE 1OPGL 3NGBC 3KPRA 3Q5TA 4P46C 2VQ4A 2NUTA 2R0WL 5ISZD 2H0PA 1AKPA 4MAYD 1S5IL 3LPPA 1VESA 3BD3A 2AJVH 4GW1A 4JHBA 3MRGB 2G75B 3PV6A 4HMCA 2J6EH 2F74B 3FRUA 4M5SA 4NNPL 5DD3H 5MERA 1ES0B 3I02A 2ADFH 4FZ8L 4GH7B 3VWKB 1HN1A 1RVFH 5AOIA 3L9EA 1XDTT 3D69A 3O6MH 5F89B 1G0XA 3BPOB 5AOMA 1DQLH 3PS6A 4P99A 4HCFA 4HFWB 3AZUA 4MD0A 1S5HB 1U3HA 1NBYA 3NAAH 4XR8C 3LKOB 4CAGA 3P77A 2DLFL 1TDQA 3X1BA 3MRCA 2ZCKH 3DRTA 4CKQA 4J1UA 2H26B 3CTTA 4PB0H 1KCVL 5ID0A 25C8H 2Z31C 4QI3A 1QSFE 4W9EC 1X5YA 5EH1A 1NBVH 1KNOB 5D1XC 4KDVA 4V11A 2ENYA 3C08L 2Q7YB 5J57B 1Q9LA 3ZKQD 3T4YB 2WLZA 5IG7A 4XH2A 3MNMA 4Q97A 3D52A 2QQNH 3I9GL 4PTUA 4HHAB 1WITA 1ZHNA 4Y16A 3IDGA 4A04A 3V0IA 4YS4A 1HKLH 3IDMA 1NGQH 2VDQL 4XBGA 5EA0L 3CN3A 3CX2A 4UDUB 3P4OA 5IB1A 1VRSA 3BZFA 2VDLL 1MJ8H 3C6SA 3ZY7A 5DMJB 2ZAGA 2BNQD 2CLVA 3VWJB 5HHQA 2OYMA 3F7LA 4NAMA 2JWYA 2YN5A 3REVB 4EAEA 3FOMA 5DR5H 1PZCA 3ZJAA 4KNSA 1U8LA 2NUPB 2R15A 3O6FA 4ES9A 5EU6D 4CVZA 3JZYA 3RPBA 2NR6A 3TCTA 1U8NA 4URTB 3GQFA 3P0GB 3P0YH 2VO8A 3WN5A 3UPAA 3HG1D 2ESVA 2OA9A 1FQ9C 1CMOA 1SHWA 2H1PL 3ARDC 3T6WA 4KXBA 3WEAA 3TNMB 4PI0A 1B4LA 1CGYA 1YC7A 4HK3N 4P4RB 3NDYE 4X99B 4U3CA 4CSTA 1GCFA 2O6FA 3QQDA 4ZTPH 1JZ8A 1E9OB 1J5OL 3OX8A 3QWOA 2HG5A 3WD5L 3OKMB 4DGYL 1F4WH 1ZVNA 3MKKA 2W60B 1UD6A 5ACZB 4XPHL 2FO4B 3IXTB 4YHKH 1OTSD 1DQJB 5TD4A 4YXLH 3EJYD 3WEXB 1G1OA 3BH4A 5KYXB 2YWZA 4BIKA 1TIUA 4D3CL 1PLCA 1WQVT 2GTZA 3IJYA 4G7QB 4R5VA 4UOQA 5HHNA 2ZWYA 2ED8A 3UIZA 3EYOB 5I1JL 4B9PA 4MDIB 5DJAB 5IUSA 4BK5C 3IDJB 2ZSVB 4GAGL 4N3UA 1SF3A 4GFXA 4HUWB 5I0DA 1EAPA 3ZTJH 1KB3A 1WISA 2OM5A 4QNPE 2Q76B 5BQDA 2E7CA 1F41A 3PJSB 2K7QA 5FYJE 3V95A 5CLWA 3V0FA 4OLWH 5EZLA 5HGDB 1YEJL 3ASNB 3VI3F 5CBEB 1QMUA 3GMOA 3PL6C 4XAKE 5BVJA 5FF6A 3EYQD 4NQQA 2IH1A 2QQKL 3IN2A 4KUZL 3D2UA 5LDSA 4G70B 5HGBA 2AXJA 4F9LA 5DURB 3ILQD 3DNKA 2E27H 4KK5D 4IOFD 3ZYIA 1EIBA 4U6VL 3RZCD 3ZE2B 3LKQB 1RHHB 3C5XA 3T0ED 1NCNA 4LEEA 4WKZB 2DYSB 1QSEB 3GXTA 4DUWA 3HAEB 1TJXA 2RCSL 5BRZB 1ZT4A 4F24A 1MJUH 3UH8A 4M1GL 1NC2D 3ABMB 3PJNA 5CM1A 4FNUA 3NZ8B 4AZ8B 5HSFA 4XMPH 4U3HA 1CIUA 3QR0A 1PLGH 3U9PL 3QXDA 3BIKB 4KH9A 3KWTA 2FQFA 4RCAA 1HKFA 2XOTA 2N1TE 2XTJB 2XV3A 3F8UB 3LNDA 3TZVA 2WXKA 1P1ZA 1I82A 1N9PA 3AS3A 4HJEA 4JK0D 5ITBH 3MI6A 5DQDL 2YD3A 2MRYA 1E4HA 3C5ZA 1U42A 3C5SA 3LQAH 5CZXD 1AOZA 3VA6A 3D3VE 3GMMA 3N5AA 2APBA 2X3CA 3SD5A 2FEJA 1NL0H 4OCRH 5DRWA 2UY7B 3QA3A 4TUUA 5DLML 3LKRB 3ZKXB 2Q8AH 4UZUA 4U4BA 4UM9A 2C9PA 4RQQB 4AG4H 3CFCH 2WYTA 2AS5M 2P80D 5D7KD 4GINA 2AK4D 5FWRA 1QQDA 2NY7H 2APXA 4HX1A 5DVNA 2HFGL 5AVTB 2WQWA 1FIEA 4P3DB 1NGXA 2PXYD 4KK8D 3B3BA 3VXSB 3EYSH 2AANA 2WLIA 5I8CB 4QHUA 2NTFB 5KW9H 3DWTA 4FZEH 2K6WA 3TC9A 3MLRL 2ZIDA 3VFPA 4DGIH 4O2CB 2VE6B 3L7EA 3FL7A 1F4XH 1HIML 2P42B 1ZLSL 3JTTA 1ZTXE 4ZFFA 5C0BA 3T4AA 4URKA 1QFWL 1NGWA 4X7TB 3VCLA 4JHUA 3RB5A 3TFKC 5TF1L 3MLYH 1YEHL 4L4TB 2Y2TA 1FGVL 4ODXB 1NAMB 2NYYC 4YXKL 43C9B 5DQ9A 4LVNC 2JKJA 4U6YA 2C4FT 4HISA 2YPKA 1PZ3A 4WFFD 3IKCB 3L3GA 3BH8A 5CXPA 3LTVA 1KYOK 4BELD 2WO3B 5JW3L 5K59E 2KL6A 2J2ZB 5CINH 2ZOKA 4WSGA 4EN3D 1IC4H 5HHVH 3ALXA 1P5VA 3M8OH 3ABGA 2B7DT 4TQIA 4PJEF 4AUUA 5CEZH 4OB5H 3VI4B 3ULUL 3QBTB 5DUPL 1AS6A 1BVKA 3QUXB 1NDGA 2AITA 4YVUA 3JV5A 5D71L 5FGRA 1VEOA 4ABVA 2FIKA 2CXKA 1OSZA 5F7NC 4HUCA 2G0KA 1B4JL 3EGXA 4N5ED 4UQ2A 1Z5LB 3CSFA 4PGDA 1JFQL 2ZYRA 3HB3B 3WTTA 1JV2A 1AGCB 1U91B 1KJMB 2EKJA 3SPGA 3AS1A 7FABH 1WAAE 1SM3H 4NQEA 3WXWL 5EOQH 1OLZA 3KW7A 4Y4KC 3G6AB 2FWSA 3II1A 5AZEH 3L5WB 5KVFE 2YZ1A 2L3BA 5FW7A 3MUUA 1RULH 3FAWA 1ULVA 4AJWA 4GIOA 4JM2A 1XXFC 2CKNA 3HHSB 1BFTA 4MB5A 3ML9A 1T7XA 3NUKA 1WFMA 1GVIA 3VXRB 5CFHA 3O3DA 1YNTF 4XO4A 2GC7C 2BSED 1CE1H 3MJ9L 3PXJA 4CA4A 4JEGB 2ATPB 4CSZA 1DCLA 5SWSD 5GS3A 3V4VB 3CFJA 1DQDH 1ETZA 1WWCA 4N2HA 4N85A 4TRPL 4RFOH 4UU9A 3RKDC 5C08D 1NUGA 1ADWA 1KB5A 2DYPA 3GKWL 1ADQL 3MLWH 1DQQA 2CCWA 1YG9A 3H56A 4XMLH 1P5UC 1R3IH 3QCTL 3ZMRA 1KJ3L 4MJ5B 4N1CA 4PJXF 2XVLA 1OIOA 3ZHNA 4F7MB 3ZE1B 1I3GL 3UBXG 2IDCA 1R0AH 4PJFB 2YARA 4TNVF 1G5AA 3VXMA 2ILLA 1P6AB 4Q0XH 4LIQL 3QPKA 1HFUA 1NLBL 4AH2B 2ZT9C 2UXVA 4M8RA 1TYRA 1EGJH 4KK6C 4TVPH 5KSAD 1VKXA 2JXMB 4R7NA 1TQWA 4LSVL 1SUHA 1G9ML 3VRLE 3EH4B 4OU3A 3GINA 3S3JA 1E40A 4HUVA 3IDYB 3D0LA 4N0YL 4HCRA 4PJ5A 4PRIA 4FNPA 3RDTD 3WJLA 1WFTA 2MCMA 4JFYB 1OSPH 3AQDA 3V6FB 3QJXA 3GJFA 2VXUL 2QKIC 3CSTA 5F70A 1NAKL 1FO0A 4MAYC 2NZ9D 1LQSR 2EECA 2YS4A 5FECB 2CKBL 4WHYG 3QW9A 1ORQB 2HRLA 5L8KB 2PKDA 4UT6L 3K6SA 3O6LL 1HHKB 1GGCH 3L6FA 4XNZB 1UD8A 3J2PA 1UCBH 2NDFA 5I73B 5F7MC 1CLZL 3BAEH 4JRYB 4Y2DB 1CFQA 1A6VL 1GZPA 2CDGB 4ZNEE 1YUHB 2F9BT 3B4NA 2O5ZH 3I6GB 3P73A 4KTDL 4H8QA 4BFIB 4Z76A 5DJ6A 1U3YA 1TZHB 4KXCA 4NFCA 1QP1A 3PWUA 4MX7A 1O6TA 3CFEA 4XXWC 3W38A 3L54A 3NTCH 3N44F 4XGZB 4YC2C 1CT8A 2ZCHL 3QUZD 1OCWH 2H2PC 3MV7E 3N3EA 3OLIA 2WKLA 3NFPA 4FNSA 3GMRB 4LCUA 3QSKB 3STZB 4MXVE 1R19A 4LF3A 3CVHA 1CXIA 2XV6B 4TUJB 1RU9H 3WFBH 4ZZKA 5AVVB 1JRHI 1QSFA 1YN7B 4FJ6A 4XE5B 5LVEA 2RALA 4B5EA 4P04A 2X9ZA 1GPOH 3HNTH 1JGVH 2J71A 2W8CA 1HILB 4WFED 2VZ3A 5IOPB 5L8LB 3SGDI 5KVDH 1LE5B 3V9EA 2WPGA 3ES6B 1XAUA 3RGHA 3P30L 3O9WC 5MEPB 4PRPD 4WUKL 3FCBA 3LMJH 3UJIL 1FL6A 1I53A 2NSMA 3TONA 4KXAA 1VJSA 2MWCA 4M7LH 4YDNA 5E5MB 1BZQK 4DFIA 3FH8A 3BQVA 3VG9B 2DIEA 1T1XA 2EZ0C 3MV01 1E7UA 5C07E 5ALCL 1Y6KR 3NPSC 3KE0A 1FFOA 1MRFH 1N2RB 4APQD 1FJ1B 2VNCA 4MHHG 5DYOA 3PNWA 4LCCC 5GRJL 5D1QC 2EYTA 4ZAKD 4JFEB 1U9KA 5DUJA 1FDLL 1EXGA 2BHYA 4TOYL 4WI3A 3RX5A 4M29A 4XNXH 3ZIYA 1JK8B 2IPKB 3CC5B 4A7UA 2IWFA 5DJYB 4HKXB 3P3YA 3KCPA 3IMRA 3JYCA 4FFYA 4P5MA 3IJ8A 2D7QA 1V3MA 3U7WL 2O93L 4YHML 1JXKA 1QG3A 1U8CA 3IGAA 3LZNA 4FFWC 4M8UA 4S10A 5ESQA 3V4UH 4OI8A 3WHXB 1VFOA 3PGCB 4HAKA 1ZVSA 5KN5B 3NBNA 2DN7A 1PDKA 4HIEB 3TBVB 4BDVB 4G82A 4H1LB 5KOMC 1JNLH 1J87A 3EG9A 3UJTH 3SPVB 2AJ3B 1YRKA 3RWGB 5DJDB 3LD8C 3LN4B 2XZAH 1XGTB 1IGTA 1PG7H 1J0HA 3QRGH 5L4IA 2Z3FA 3MNVB 4QGTA 5BNXD 5CSZA 2X6UA 2E86A 1TJGL 4CU7A 3PAVA 1JWMB 2AVFA 1JNJA 1SOQA 1NCJA 3CLEH 4XMWA 2FJHB 1AMYA 1HC1A 2VRAA 2VISB 2GT9A 4OAWB 3WKYA 2D31B 1THCA 1N0LB 1T22A 2C4XA 3VVVA 1KUMA 2XG5B 5E8PA 2XV2A 2CE6A 4G6KL 5EFIA 3SGJC 2XG4B 4JANA 4WO0A 2ENJA 4ICXA 4PRAA 4RGND 4ODTL 5JA9A 1UWGH 3FQUB 3ILQC 4K2UL 1NCAH 5B38A 4HLZG 4H7VA 3HE7D 3H9SD 3O8XC 5E99H 1W2KT 2C3WA 3U46B 3T0EC 4M4RA 4NX0A 1J8HE 1E27B 1QASA 4XVUC 1BF5A 2YJLA 1NFIB 2MNWA 5J6GB 3QUKB 5JZ7D 3OJVC 3P0VL 3WMPA 1AC0A 2CRIA 4HJJL 4ZMWA 1GYVA 4BA0A 5IVXE 1DUZA 4JG1L 3T1FA 5ALBL 1CF1A 1K8DB 2OZ4H 4E9XA 1EEQA 5KSBE 2KDGA 3WO3B 1OB1B 1L5GB 1KLGB 3ZQWA 5M7QA 1QWNA 4FNLH 4TSAL 5E8OA 5KYYB 3LS4L 4KI5F 2Z64C 1BGXL 2LAAA 3AM8C 4A68A 4HMDA 3NJFA 4WWID 2X0VA 3MGOA 5B3NA 4FX5A 4ATTA 3V4PB 3FTGB 3MA7B 3QUYB 3PWNB 1EMTH 3QZWG 1EO7A 1CFNA 4I1PA 4L1LA 5KG9B 1XH0A 2EH7L 4LRNL 3KPQA 1JPSL 2VZVA 4Y5VB 6PCYA 3OB8A 4AEIL 4XOEA 4QRPE 1JXDA 2XN9E 3D3VA 4G8FB 1T1ZB 1KB9J 1MFDL 1JPEA 2XHNA 5FDWB 5AUMB 4MZ2A 4AT6A 1I3UA 4Y16D 5T1DH 1SLVA 4X0KA 4XN7A 5TTRA 5GJTL 3S96B 2CR3A 5C0AE 3O4LB 4NSKB 4WHDA 5DMGC 4EF3A 3BKMH 2MKWA 3OSVA 1R5VA 3CXDL 4NAQA 4R97B 2FIRT 2HKHL 4IRJA 4ONHB 5AKVA 3U4EB 4YBLC 2AQ3A 4OD1L 4L4VD 3WIHH 4HKBA 1FNEB 4QHKI 2QPUA 1NKRA 2WXJA 1MFEL 2RFXA 4JZOA 4XO9A 5I9QC 2Z8WC 1SOSA 5CKGA 5JXED 2VR5A 5AAMC 4GP4B 4NQVB 4P59L 1Q1PA 5AW1B 5J6HB 5AOJA 1PX3A 2YSTA 2ZCLL 4HV8A 4JFDE 5ICYA 1FFPA 3CFIC 5F72S 1MJ7L 4NT6B 3O11B 4HVBA 1PJ9A 2ESVD 5DS8B 4ELMB 3MJ7A 4PUBH 4BKSC 2YXWA 4U49A 2C8NA 2XUWA 4HSCX 5DEGB 4W6XB 4L3CB 1M9WA 3MBEA 4NO3B 2H8PB 2E74C 2JNZA 1MCRA 1UM4H 3JV4A 4XC3H 3WO4B 1U58A 2NY1C 3NYKA 4NN7B 3DVNB 3MO1B 2FDBP 1YEIH 1EXUA 3ZL2A 1XTMA 1IAII 4JPVL 5E8NA 1RKRA 2EH8L 4Z9KB 2ZP0T 1FWXA 4HOMA 4N2MA 1RPQA 1I9IL 2YQBA 4R2GC 2D0HA 3N1MC 1UA3A 4Q9RL 1DDTA 2I69A 1PKQE 1J1PL 1J0YA 2QSCL 3O2DL 2OULB 3J07A 1X5HA 3KR3H 3PABB 3T2OA 3FTYA 2Y7QA 5FCUL 4LHUA 5LAXA 2BSTA 3NK3A 5JLZB 1WAAA 1II4E 1OAQL 3HE6B 3CFKA 4OTXH 2ZJSH 4K8RD 2DD8H 3H1ZA 1PTZA 2YZ8A 3P77B 1TEGA 5D8JL 2PETA 5M94B 4UAOC 1DJWA 2CIIB 4KZEH 4KQ3L 2F8OA 1KIUA 1UM6L 4GO8A 2QVIA 1Z2KA 5TFSL 2DYRB 3ARBC 3B6SA 3ABKB 5EO1A 1YECL 4UT7H 4A7TA 1WO2A 5D1ZB 1LNUA 3GRGA 4GIAA 1TTFA 3QCUL 5C0CB 3GB7A 3CXHJ 3N9GL 2HFTA 3MRQA 3GUTA 4AM0Q 1OK8A 4MWFA 5I71B 2D7TH 3KLAA 4CC0A 4HGWB 4HJGA 2WSPA 3D2UD 3BVWA 3FFCD 2NNCA 1TFHA 2CO6B 3ZQXA 5C97A 4XVJH 1HHHA 3Q6FB 1SJVA 1NMAL 3GMPB 1GHFL 5EO0B 4WW2C 2GUOA 2VDNB 2GAZB 4PRBB 5FKPA 3MV11 2K78A 1E4WL 3GT6A 3ZE2F 3EO9L 3A67H 1QEWB 3OZLA 4HGMA 4K8RL 2FQEA 2DV6A 2YPVA 3RNQA 1RP9A 4JZJC 3NIFB 2AP2A 2HRPL 1TLMA 4ERSL 1R24A 3B56A 1LWJA 3TZVD 4O51A 1JPST 4BQCA 2W1NA 4NKIL 4A67A 4X6CE 1H8LA 2ENQA 4X5XB 5CEYB 2AABL 2IAMB 4TYUA 3L13A 5E4OA 3UZQA 4R8WH 4Q9QL 5BZXA 2KPWA 2EDFA 3AU1A 5I74B 1S3KL 1TNMA 1MFMA 2WLLB 1QFPA 2X3AA 1VACB 3L3HB 3NSYA 3TBTA 4OGYL 5BOJA 3B2MA 1LEKB 3PU7A 1FFRA 1VCAA 5FA4B 1DJIA 3QZOA 3FCSA 4ZNEA 3DO7B 2WZ0A 4YFDB 4LNRA 2DQGL 5FDYA 5GGVH 4OCYH 3E80A 4NQCB 4F9PC 4BA8A 4MCYB 3A4AA 1Q9WA 8FABA 3X3FL 2AK1L 5JXAH 3VUAA 1R46A 3QIWC 3GNML 2XXCB 2GJRA 3DHPA 3VYOA 1WAEA 3MV7A 4F2MB 4NUJA 4LEOA 1TZGL 3E6HB 4FCHA 2WIIA 1SOKA 4X50A 3QJHA 2P8LB 2C9RA 2NYZA 1QBML 2LR4A 5C0BD 5I17B 4K3EL 1M7DB 4GMTL 1WZLA 3QQNA 4CNIA 1ZA6B 3NJHA 4DGUA 5E1GA 1WD9A 1H8OA 4ADGA 4B9FA 1CI3M 2Y3AA 5E70A 1UD2A 1EDQA 4N6RA 4GKOA 1U92B 3LXCA 5F9WC 2YIHA 1LK3H 1KGCE 2BFVH 3OLEA 5FB8A 4EI6A 3I3EA 1F6AB 1WBXA 2XWBA 3VDAA 5F9JB 1OAXL 3MLPA 5FF6B 3L5XL 3AREC 5HPOA 2NCEA 2WQXA 5I1HL 3N41F 3E2HC 3ISRA 3RA7H 5JPMC 4DPBX 1R3HB 1ZDSA 3VI4F 4ZAKC 5CBAA 1XF1A 3F64A 2HJLA 1GC1C 3BUIA 1FVCB 3LVTA 2UXGA 4MMZB 1CFSA 2EE0A 3B8SA 5DDHB 4E36A 1YEWA 1PY4A 4GKNA 4DP7X 3GSNL 3HBZA 4EZKA 5C07A 1AGBA 4OLVH 1F11B 3AAZA 4MB4A 1RH8A 3NCEB 2AEQH 3QDGE 4LT7A 1U8QB 4NQED 3KHOA 3MR9A 5MHSE 3QWRD 4MS6A 4Q4EA 4X9GA 1SJEB 2WZPD 5IR1B 1M6OA 1WA1X 4D9QD 4Z78A 2N59A 1U8JB 5TH2B 3L3OA 4JM2D 4FJZA 4CSPA 4DPCX 3IEAA 5IQ9A 5L9DL 4FS0A 3QWNA 1NM4A 1A1MA 4L9LB 5EN3A 1D9KA 2ITDB 4OY9A 3PFUA 2AGJL 3QPQD 5KS9F 3QJVB 3NCYP 5TQ0L 3BGFC 3EJSA 4KNUA 2FEDC 3EJJX 4X5QA 3C09B 5J11B 4DO5A 1DO6A 5JO5A 5KJRH 5DHVB 2X88A 1IM3A 1LK2A 4B6ZA 4JY6A 3PHOA 1TCRA 4NJ9L 3KXFD 1HXYA 1KFAL 4X4ZA 1QQDB 3HPJB 1XH3B 1M05A 1VPOH 1DLFH 2OLDA 2VSDA 2X4UA 3MYJA 4NUGH 3SO5A 4BWUA 1INQB 1J05A 5T3XH 1BXAA 4JVPA 4O5LH 3ZE1F 3ULUF 3VD0A 4PB9L 4KRMB 2WCGA 1OAYH 4OGAD 1CGUA 1U8OB 4PJFF 1BLNA 5ICZA 3GSNB 4F92B 1SZNA 4G6FD 1FBIH 4K7PX 1U8IA 4IRSD 3DHJA 3NJXA 4AEFA 4B9YA 5I6NA 1B0RB 5C0JB 3FF8A 3KJ4C 3GBNH 1D2OA 1NMBL 3FT3A 1BBJB 1FNLA 4WJG3 4HUUA 3T3PE 4FTVE 5JZ7C 1PZAA 2AJYL 3LQMA 5IW6B 4RESB 2J5LB 2M2DA 1HQ4A 2L7QA 4KK9D 5EU7C 1IBBA 3DOIA 2WLKA 3GDCA 4FHBD 1T3FB 4GJTB 1WG3A 4W9CC 1KB5L 3EGDB 4HZLA 2FO8A 3WFEL 1J8HA 5ELIA 4POYA 2EILB 1HU8A 5DLLA 4E5XA 3LN9A 1LO2H 1IIKA 1RIHH 3VFMA 5IVXA 4LRIC 1BVKB 3CHRA 4Z0XA 2E8ZA 2AJZB 5FCSH 3AWEA 2ICEC 5KSBA 2FIKB 5GGRB 3KVQA 4PGCA 12E8L 1B4RA 4JMNA 4NRYB 1OOWA 5T5NG 4MKMA 4K5LA 4PSPA 4XMKL 4K23H 4N2OA 1P7QA 3QEQE 2F53B 3WFHA 4OFYA 5L6YH 4GSQA 3ET9F 3QXWA 2KPNA 4F7CA 1DJHA 5JDJA 2N3JA 1Z66A 4BYHA 2HPOA 5AW5B 3AXIA 3H0TA 5F96H 1FO0L 2AI0L 4FI7A 3JWNG 1Z9PA 4PG2A 4PJ9D 3SBRA 5L2JA 1XBRA 2EC8A 2EDJA 2Y1VA 4C8XA 4KRNA 1YMME 2BSRB 4QRPA 4Z3EA 3PAYA 3V5DB 2UZIL 4P3WA 2XN9A 1NIDA 2C9SA 3SE3C 2YAFA 5AENA 1BVZA 4K7PY 1VGKB 3VXQA 2G3XA 4KO7A 1ETZB 4P9HC 3L9RB 3QNXB 3RWHA 4YXHH 1FVEA 4WEUD 3X17A 2AXHA 2IQAA 2WUCH 1NMCC 3QAZC 4G6ML 1ZSHA 1SJHA 4G8GE 4OLEA 3CBKB 5C0AA 3S5LB 4DK3A 1FI8C 5E03A 2VN7A 4P05A 1RK1A 1A9VA 4ICWA 2MPAH 3RDJA 3Q1EA 4GXFA 4V33A 4QOKE 3K6IA 5AD0B 2A5UA 1BFOA 4XB3A 1WWAX 4MAUL 3WYRA 5EEWA 1ZGLB 1S5IH 4V1DB 1YYLL 2J88L 1QRND 2QBWA 3WNPA 3MV8E 3BP4A 3JWOL 1A65A 3WS6A 4HUVB 2BNRE 4HDIB 4XP1L 4OV6F 5EBLA 4LSPH 3T77A 4ZMYA 4FLOA 5HYJB 1ODUA 3E0GA 3RUGE 3S37H 1C5CH 3ZTCC 4M02A 4DOHB 4XN8A 2BWQA 1IIIA 4EUPA 1NIAA 1T4WA 4LARH 4YDLB 3C2AL 2GC4C 3IMUA 4TKWA 2XSKA 3MOQA 5DK0A 4PR5B 4N26A 4DGVL 3NVQA 4RZKA 1BPVA 1KT2B 4KX8A 3M17B 1JCKA 2FLRT 2LE9A 1U36A 2ZE0A 3R1GL 1UT1A 2OMVB 4UF7C 3ULVF 3CFNA 1YY9D 3LEXA 3QO0B 3IU4H 3SDXE 3SCMB 3OWRA 3I75B 3MLTA 4P2OB 5I76B 2HN7B 2K9FB 3GEWB 4L9DA 4X4YA 1H19A 4M00A 1QFWM 1V7NH 1QLFA 1FSKB 1G0DA 1CDUA 2VSKB 1KBKA 2X4TA 3C08H 5JIPA 3X11A 4C57C 3BWAA 3GXNA 4Z7VB 1A47A 3RILA 5EIIB 1OXYA 2JK5A 3PWUB 4ISVA 2AV7A 5GS2D 1PKQA 4DK6A 4Z7UF 1KXQE 4ZMNA 4UIKH 1Z3GH 2VDQH 3NCCB 1BFVH 4OCWL 4P2CG 1U93B 3PPEA 3L2LA 1EO5A 3EHBC 1XZ0B 4R0LA 5IWLA 3WTYA 3L1OL 4HK0A 3FB5A 3K0YA 5C86A 1OL0A 5E2TH 4RGMC 3L4YA 1RK0B 2NNRA 4YHIB 4UIMB 4FFYL 2OMYA 3QVAA 2J4WL 4J3VA 4WQOA 4BJLA 4QR7A 4EI5B 1DE4A 4N0UE 1UJ3B 4I8DA 4JN2B 2WOBA 2Y06L 2DQHL 2BOCB 4YDIH 4BFNA 3OKEB 3D9AL 4XAKD 1ZHBB 2N7BA 3HC4L 2AERT 4A7GF 4HCGA 1Q38A 3FO2B 1A5FL 3IKKA 2AV1A 3OJ2C 1HINH 1A7PH 2VZ1A 1BOGA 2OMTB 3OV6A 4M6OH 1FYTB 4LLYA 4GKSA 3HN3A 2UY6B 4QJ4B 2VSCA 3Q2WA 3WEMA 4BZ2A 3T6QC 2NXYC 5C9JB 4PGZA 3TV3L 1P4IL 2AXGB 2DLIA 4YN3A 4OZIB 2IXQA 3F7KA 4LP5A 1UTDA 2BP0A 2JLLA 3CQFA 2CHWA 3UTQA 4G9FB 5DHMC 3MREA 1S9VA 3N55A 3RTQA 4DGYH 3H2PA 1GW6A 1RL1A 1UEYA 3VA2C 1N3NA 1NKGA 1KN2L 4G8EA 3HJEA 4ENED 5FYJL 5C7XH 3WTVA 2JJUA 4X6CA 2EXYD 5IB5A 1ONQA 3FNKA 3S97C 5CP7A 5EBGA 4U3SB 1Y1UA 4Z8FL 2DRUA 2OW6A 3E6FA 4ZPTA 2HFEB 4P5MB 3O81A 3OKNA 3ZL4H 3AG2B 1A4CA 5F3HB 1KDIA 2Y07H 1PLAA 3HKFA 4LSRL 1J12A 4C59B 3ULSB 4NZUL 3KCWA 1TITA 1PDKB 4X5WB 4FA8A 2XWJA 4S1DD 1QHOA 4DSYA 4ZW5A 5LBGA 3SPHA 1QO3A 1ML0A 2NY3D 5DO8A 5T1LA 3WOVA 2D03L 2NX5E 4W4OA 4R84A 1K8IA 5E6YA 5E2UL 3TYFA 3U1QA 3WIFB 1ZHKA 4LCIH 4K9EC 4UM8B 3UABA 1KENL 4KUZH 1DQKA 3IGLA 4XBEL 1DVFC 2ZSWB 2VUOA 5F2FA 4WCYL 3MRRB 5CILL 5CLTA 4NFBA 3VXUE 3MRNA 4XOCA 2DTSA 4FFVC 5E1QA 5HVHB 5IT2L 4CW1A 1OGAE 3EYVB 1NUNB 3ZDZE 1KIPB 3ARFB 3NRPA 3VWKD 1HEHC 1X5XA 3BKCL 5BUPA 2OK0L 1LLAA 3BZDA 4WV1C 4F3FA 4N8PA 1T5KA 4M1GH 4EZLA 3N1PC 4KZDL 2CJUL 2ZOUA 3NCJH 4EBQL 1RZGA 4WI6A 5H35B 4ELMF 3U9PH 1Y18A 3RVVC 4JN1L 3QORC 4UOJA 1NBQA 1MHCB 3CC1A 3AACA 4TQHA 3DX3A 3KLHC 1EXHA 4P9ML 5FWQA 3T2NL 4KJPD 5DQDH 5ICUA 5A2FA 3V6BR 5ABZA 4ZD3H 3NJKA 1WZKA 3KYMB 1HHIA 2VMJA 3X3GH 2HFFA 3H3PH 3Q8BA 4PVMA 1AGFA 2X6VA 3B83A 2G30A 3OQRA 4HUMB 1SDDB 2FQGA 5HBBA 2BINA 3DBXA 3IU3A 1T6VN 3SJVE 4L8BB 3ARQA 4MSWA 3C6LB 3QDGA 5DI8B 4I13B 3AY4A 3MAWA 4FMFA 2WSDA 1ZTXL 1IL1B 1UWYA 3PV7A 3FUFA 1YLBB 1AH1A 2B59A 1JGEA 2FT7A 2OFQA 3WS3B 3REWB 1A6UH 1DZ0A 5I30L 4JO4L 3DGGA 1CFNB 3VWJD 1N6VA 2Q6WA 2GY5A 5CGYD 1L0YA 4PPTA 2BM3A 1R33A 2H0FA 2VR7A 2X2JA 5ECJE 3HMWL 1H3UA 1ETJA 1E90A 2PP7A 3W9EA 4RSVA 5JPNC 3WNKA 4R3SA 2WZ5A 1JRHL 2FSEA 3U1SL 3BFQG 4OGAC 3LDBC 1YJDC 3MXVH 4UT9A 3DBSA 4ZOBA 1ORSB 3ASOB 3PWVA 1YEHH 4U1SB 3TJEL 5I19H 4N86A 3ROLA 4X0KB 1MNUL 3EUUA 4QRRE 4P0DA 2B1HH 3PREA 4LHUG 4NO2B 3A21A 1Q1JH 3N0AA 2YK1H 2UXTA 1N6UA 2L7EA 3UCRA 3EKCA 1VZIA 1JUFB 2P3YA 1IGYB 2OMUA 2ZZUT 3TU6A 2YAHA 3RVTC 4IRJB 1BIIA 1MFBH 4X6DE 3CIAA 1CXFA 5SWQA 4JJOA 2FLBT 5EO9A 4K3DL 4PRHE 3LPOA 1V10A 2J8UE 4MMXC 1SXCA 4JHWL 2MOVA 4I0PA 3RWJA 3SPJA 1QEXA 2MJWA 4NCC2 3S3SA 2IANE 4J7RA 2WTRA 3SDCA 1B4JH 4JFZL 1MCOL 1URIA 1OHQA 4L29A 4F7PA 5KBNC 2UZXB 3RL1B 4FTVA 5F9AC 3FCTA 1FFPB 3NIFF 4WEEA 1JFQH 1S9XA 3GRBA 3QIBD 3DGCR 5DJ8A 1ZLEA 1H15A 4PGJA 2B5IC 2IG2H 3Q06A 1DQVA 4I77L 1HWGB 3HI5L 1Q72L 2FT8A 4ZUUB 5TGBB 4OLZL 2K45A 1CD1B 3BUPA 4PAZA 2FECL 5BZZA 1XEUA 2WM0A 3BVXA 1FFQA 4NKOA 3VQ1C 3B7TA 4OIIL 5JUEH 5BZWB 1SOXA 4ZMZA 5GZOC 3BPNB 2GSIA 3UCQA 3QZPA 3G5ZB 2ZUYA 1X6NA 2V8MA 3QQ9D 4HWBA 1U3ZA 3ZDXB 2VDKL 3FO1B 2B77A 4YDKH 3SKMB 1JWUA 4TRPH 4ZFZB 3WLWD 3HR5A 5C0IA 4N2CA 4JFFE 2WB1A 1IUZA 1T83A 4K3JH 4Y1AE 3DI2B 3K72B 2R8SL 2ED7A 4LHUB 5LAXB 2CAKA 1TOXA 2BSTB 4IHOA 4XNYL 2YPVL 5MEOB 3QEQA 6PAZA 3MNDA 5KVEE 2FYYB 1YEGL 1A7NL 3GMLB 1I3GH 5GGRY 4W9LC 3OXRA 1ZLWH 3AUVA 1S9WA 4DFHA 5T3ZE 3CFBA 1VFBB 3FTXA 4G7VL 4WNJA 1QYGL 1IJ9A 1QSED 4LIQH 4XMUA 3B9DA 1KYDA 1NLBH 3QNZA 5E2WH 1M7IB 3FXIC 5D7SH 1YMMA 3WXVL 4F20A 3RHWF 3L4CA 4ACPA 2ZXAA 3SE8H 4Z3GA 3R0NA 4PLJD 4M7ZC 5H94B 1SYVA 3S6CA 2LGNA 3GUTB 1AYRA 2AJUH 2XTJD 4ONGL 4B7LA 5KWYC 2OI9C 2VXUH 4Z7OF 1JGLH 1T1YA 4G8GA 5SX4H 2FHBA 2DI9A 1W0YT 2ATKA 4HALA 2CKBH 3KHQA 3CN4A 2VRKA 2XWZA 5L0QB 5BO1L 3EYUH 4OM1H 3P4NB 4GI9A 3WNIA 1T0OA 4J23A 4QOKA 1BVNP 1DJXA 3ABZA 2XFXA 3KPMA 1JVLA 2JQAA 2LAGB 3ETBF 4ALAC 1Q0YL 4WHYH 4ODBD 3S8WA 4AJ0A 1G9NL 1A6VH 2OPCA 4B3EA 3PNRB 4MGXA 2ZUQB 2FJFA 3BE1L 3MV8A 4HPOL 4F57L 3TX4A 2BNRA 2ZXGA 3FHAA 3HC0B 5GRVK 2CGYA 4H0LC 1E4JA 4MASA 4HWZA 3RUGA 3VXSD 1UZ6F 4QPEA 1R24B 3VACA 3DYMA 4JREC 4WWKC 3IMTA 2G0LA 2XPYA 1RJCA 4LKXA 3BEVA 1DN0A 1BEXA 3GSXA 2EVJA 2H32H 3AQYA 4UB0L 3B9KB 2JJSC 5FUCE 3TO4A 1HEJC 4L37B 4FQPA 5HY9A 2OMXB 3UJJL 1KIQA 1FGNL 3EH5B 5AAWC 4DGWC 4MFHA 1I7UA 3SDXA 1A7RL 1FG2A 3WNOA 1QI3A 4L4TD 5INDB 4C56E 1BVNT 4U1KA 5EBMA 3U7YL 3QJFA 1OM9A 2BIIA 4MJ6B 3RX8A 1WFIA 1PYWB 5JQ6H 5CWSB 2TSAA 3TLRA 1UURA 3WUWB 4G1EB 2FZ3A 5BQ7A 3AQZA 4QWWD 3V7AE 5DVMA 1I8LC 2X4PA 4RGOL 4UYPA 1AD9B 3P30H 1A21A 1LP9E 1KXQA 3QNYA 3TA3B 4A38A 3JV6B 1GXEA 4WUKH 4S1SL 2DEXX 3FT2A 5D5ME 5E51A 3S88H 3QUXD 3UJIH 4NLAA 3BC9A 3QJTB 1NGZB 5B8CA 1IQDA 3N43F 4FQLH 5EUOE 2JCWA 2DQUL 4H8HA 1E8XA 1WBYA 1HL4A 2PCFA 1WV7T 3UTZB 3OJDB 5ALCH 4DEWA 1A6ZB 2N56A 2ZKHH 5E6IA 4LOEA 4C54A 1HT6A 3CUPA 3HB3D 3VD2A 1A4KA 4KVCH 2FH8A 4GY4A 4U0RC 3RVWC 1MZYA 2ARWA 4N0UA 1XT5A 1SLXA 2VQUA 5F9DC 3VFUB 3QPXH 1L9NA 4QO1A 5GS0C 1BEYH 1C16B 4NYLA 2VKXA 4R26H 1J8HD 3IPBA 1QZNA 4UCFA 3JT0A 1NCDL 2DQTH 1JXGA 1NCWH 1WWBX 3DIFA 4JUTA 1KTDA 2BW4A 4UMSA 4ODSH 4AGQA 1NDMB 3C8KA 3U7WH 2ETWA 1U2CA 1IC5L 1P4BH 1UOKA 2Z4TA 4RLDA 1KEMH 1ZEAL 2X7LB 3S48A 5DZPA 4B9CA 4YPJA 4YHZH 2W0KA 4OCMC 3V7MA 2PO6B 1CYXA 4Y5XA 3TCXA 1SDAB 4QTIL 3QJSB 3UPCA 3D12B 3LZLA 1EVTC 1WZMA 2OW7A 5D7LE 3SKJH 4ADJA 3MCYA 3IMVA 5B7FA 2H9GB 3RWFA 3O3EB 4AV5A 3O3UN 3O6KH 1XGPB 1A6WL 4X8CA 3S35H 2CDEA 1CPUA 1M71A 2BVQB 4HH9B 4L1BA 1TJGH 4NS0A 1QA9A 4QTHA 5CHNB 4CILA 3DMMA 2FATH 5KBDA 4QXUH 4MNGB 3V9CA 4NPYA 2OMNA 4UBDD 4HF5H 2NY3C 3Q8FA 4E5XG 5TQ2H 4X6EB 5PAZA 3F62A 2ZYSA 1N10A 2XN9D 4M6AA 1A02N 8PAZA 1A7OL 4YDJB 1VADB 4AYID 2ZONA 4BBWA 3PQYD 5E9NA 1TJMA 3PF2A 5CS7A 4G6KH 2UXFA 2CRMA 3U83A 3B2PA 2R23A 3DSNA 1B90A 5LNDA 3VH8A 1U8PA 3MACH 4K2UH 4OBSA 5LN4A 4UINH 5CEZE 1F0LA 4G83A 2NX5A 3QIUC 2EADA 1G6VK 4KI5C 2DL2A 3BKJH 3H42L 4I87A 4IS6A 4OZFB 5D9SA 1CG9A 2QQLL 5AWNL 3VWKC 3TGXA 4HLZH 1RJZA 1NFDE 4JRYD 4Y2DD 4HJJH 4R9HA 3BPOC 1BQRA 3KVPA 3L4XA 3OHMB 5TDPB 4RDBA 5ALBH 5BUAA 4ZUVB 1BVLA 3VXUA 1U8IB 5C0DA 3ZR6A 3GEFA 2IMNA 1OGAA 3KL5A 3EFFB 1JZJA 3UG3A 4HUUB 2ZUVA 1EA9C 3K8LA 4JFDD 4GXUM 5DJZA 1JYXA 1FNFA 4N2LA 1XSIA 4DVRL 2DWDB 4CDHA 4BQ8A 1UOLA 4IOSA 4GI6A 4AQOA 2EDL