1OE1A

Atomic resolution structure of the wildtype native nitrite reductase from alcaligenes xylosoxidans
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
336
structure length
336
Chain Sequence
EDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Native Copper Nitrite Reductase from Alcaligenes Xylosoxidans and the Active Site Mutant Asp92Glu
pubmed doi rcsb
molecule tags Reductase
total genus 94
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe1A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe1A02
3BVDB 2Q9OA 3TU6A 4KO5A 3FSAA 1CC3A 3T71A 1NDTA 4YSCA 3PCYA 3IBOA 4P5SA 3QJVB 4BDVB 4HHGA 1BQRA 4JHVA 2UXGA 1X9RA 3GYRA 3NJFA 3QJUB 2J56A 3S3CB 5AKRA 5PCYA 4JHUA 3T9WA 3WG7B 2VW6A 3D12B 1IUZA 3FU7A 3NJKA 4A66A 2UXFA 4DP4X 4GY4A 1MZYA 3FQ1A 3ASNB 1ZPUA 2AANA 1NTDA 3ABKB 2XV2A 3FYIB 4KO9A 2HX8A 1NINA 2XX0A 1OCRB 5B1JA 2XXFA 3PAUA 4BXSV 5E9NA 1TEFA 4W1TA 3N55A 2VMJA 3TA4D 2IAAC 4N4YB 5D4HA 2HRGA 3PLYA 3AG3B 4K9JA 2BP0B 1A3ZA 2IWFA 9PCYA 1NWPA 2YAOA 5I6PA 5I6MA 4YSOA 4A67A 2DYRB 2P80A 3HB3B 1OOWA 3ASOB 2NRDA 1JZJA 3TBCA 4WTQA 1RZPA 2XUWA 3FPXA 2CAKA 1RKRA 1SF5A 1WA1X 2YQBA 4DPBX 2EILB 4DP7X 1SJMA 1AZNA 4GP4B 1KCBA 3FSVA 1AZBA 1GS7A 1ET5A 3BQVA 3UABA 2N0MA 2AVFA 2IH8A 1JZFA 2IWKA 2DY2A 4AZUA 3NSFA 2BZCA 1L9OA 3AG4B 1M9WA 4NAJA 5ANHA 1EZLA 1AG6A 4HAKA 4AKOA 2EIJB 2XXGA 4BXVA 2VM4A 1IC0A 1AS6A 1M56B 1NWOA 1GY2A 1NIDA 2J55A 3SBPA 2MTAA 1J5DA 3N2JA 2Y69B 2B08A 3QJSB 1X9UA 4QLWA 2XU9A 4L0PB 3AG1B 1E30A 3NP4A 5B1JC 3TBBA 4BWWA 2YARA 1E67A 4YSSA 3IE9A 1XB3A 2FQFA 3JTBA 1JVLA 3T6XA 4F2EA 3QQXA 1HFUA 3X1NA 1AOZA 1L9TA 4YSPA 2GI0A 5I5MA 3AG2B 1SNRA 2BP8A 2HZHA 3CG8A 7PCYA 3X1FA 4E9WA 3IEAA 4YVNA 2MRYA 4RH4A 1GSKA 3T6WA 4G7SB 1DYZA 1MG3C 1AG0A 2BW4A 1ASPA 1V10A 2WO2B 2GC4C 3IN0A 2GBAA 2Y1AA 2UX6A 2YAEA 4BWTA 3WIAA 1TKWA 1GR7A 2XVBA 2FT7A 3WKPA 3EH4B 2CCWA 6PCYA 1L9RA 4DPAX 1OE1A 4A2DA 4N8UA 2PPEA 2QPEB 3X2QB 4Q89A 5F7BA 1JXDA 3FS9A 1FWXA 1YLBB 3V9EA 2PPAA 1BQKA 5B1BB 4HALA 1AAJA 3WKQA 4E9VA 1PY0A 3DTUB 4G70B 4GXFA 1L9QA 3ERXA 1UATA 2YXVA 3PXLA 2DYSB 5I6NA 3SBQA 2GC7C 1L9SA 3ABMB 4YL4A 3FT0A 2AZUA 2PP8A 1AR1B 1T5KA 1NIAA 1WAEA 1KCWA 1QLEB 2FT8A 2EINB 2HX9A 3NJNA 2HXAA 2YAFA 2IDSA 1KBVA 4PAZA 2BWIA 2WSDA 1FFTB 3RYMA 4GP8B 1ET8A 1ILSA 3GDCA 1E5ZA 1E5YA 3UAEA 2PP7A 1L9PA 4DP6X 8PAZA 5I6LA 4F2FA 1JXGA 3H4FA 3KW7A 3CDZB 1XB8A 1KDIA 1MZZA 1SHXA 1SFDA 2OV0A 3OD3A 1JVOA 2AZAA 1ET7A 2BP0A 5D4JA 4E9YA 2XV3A 4KNTA 1AANA 1GY1A 2P80D 1SF3A 3EH3B 3FQ2A 5IY5B 1W6LA 1SHWA 2BZ7A 3FYEB 1IKOP 3AY2A 2VW7A 4TXVB 4A2FA 2ZOOA 3U25A 2R7EB 1NPJA 2WO3B 4E9XA 1OCOB 4GP5B 3AZUA 4HCGA 2I7OA 3QJRB 4KO6A 4E9SA 1SDDB 2H5UA 5EHFA 6PAZA 1F56A 2PPCA 3NYKA 4UAHA 1ASOA 2YAPA 3H56A 2YAMA 1PLAA 2CBPA 2PCFA 1URIA 1EHKB 3NJHA 3FU8A 3NJLA 2I85A 1RZQA 2CJ3A 1WA2X 1PLBA 3G5WA 1AIZA 1PAZA 1CYWA 3X1GA 5B7FA 3FPYA 3FSWA 3NJMA 4FA7B 3S3DB 1KBWA 2IDTA 3NSCA 4BWUA 1GYCA 1ADWA 2GSMB 3NSYA 3DKHA 2DWSA 1OCCB 4CSPA 2E86A 1IBZA 1FA4A 2HX7A 5I28A 4DP5X 4M4RB 3UACA 4DP2X 1PF3A 2HLEB 2FWLB 4BK5C 1ID2A 1NIFA 1JZIA 1N70A 3S3BB 5D4IA 3ZBMA 4G72B 2UXVA 1JOIA 2XWZA 2H3XC 5B7MA 4HIPA 1RCYA 3OMAB 2Q5BA 1BAWA 5FC9A 2XYBA 1GS6X 1W8EA 3NJIA 1MDAA 5I26A 5LDUA 2XV0A 2ZONA 4DP1X 4DP0X 1A4BA 3NJJA 2VM3A 2BHFA 1NIEA 2IDUA 5I5JA 2BO0A 2XX1A 5I6KA 3EH5B 1A4AA 1CUOA 4KOCA 5TK2A 1AACA 4W9ZA 4Q8BA 4AKQA 1ILUA 1PNDA 4FAAB 4NERA 1ZDSA 4KNSA 1AZRA 4AX3A 3KW8A 1V54B 1R1CA 5I5IA 1PCSA 4KO7A 1E65A 1PMYA 4DP9X 4YSUA 1PZAA 3OMIB 1KYAA 4P5RA 4YSEA 3CVCA 5B1KA 1BXUA 1V55B 4F7KA 3HEIB 4YSAA 3ZX1A 4ZK8A 2AFNA 2DWTA 1PZCA 4BDVA 3S8GB 5AFAA 4A2EA 2XLLA 1WS7A 1JERA 4KNUA 1TU2A 1BQ5A 1AS7A 3JT2A 1JZEA 2GB2A 4UF7C 5A7EA 1JZGA 2FQGA 3IN2A 3NJGA 3CZUB 2VSMB 3QPKA 1J9RA 1J5CA 2FTAA 2FNWA 4A2GA 3C75A 1KDJA 3ABLB 1BYPA 1WS8A 2IDQA 3OM3B 3FSZA 1VLXA 1HAUA 2TSBA 1OCZB 3FU7B 4MFHA 4DP8X 2OCCB 2VN3A 3S8FB 2JKWA 2ZXWB 4HCFA 3DIVA 3EF4A 3PPSA 1JXFA 3CDZA 4G7QB 2QPDB 1W6WA 2JFCA 3QJQB 2A3TA 5I6OA 2PP9A 4YSQA 4YSRA 4E9TA 2J5WA 2IDFA 2X88A 3X1EA 3SBRA 4HZ1A 4JKNA 4AKPA 1IBYA 1M57B 4CSZA 4G71B 1I53A 4M3HA 4E9RA 2JXMA 2VSKB 3WNIA 2EIKB 2R7EA 4YVUA 5TK4A 2CALA 2PCYA 2VW4A 4WKXA 3ZIYA 1ZIBA 1J9QA 2CUAA 2HRHA 3ABGA 3PAVA 1SDDA 3SQRA 3OQRA 2EIMB 2PPFA 4AI7A 2BWDA 4EF3A 2W88A 1NIBA 1SFHA 4YSDA 1AZUA 4X4KA 1ASQA 2B3IA 2H47C 4GYBA 1J9SA 1PLCA 1ZDQA 2I7SA 7PAZA 4YSTA 1GS8A 1HAWA 2YXWA 4UANA 1AS8A 4HCIA 4PCYA 2J57A 2IH9A 2PLTA 2OJ1A 2UXTA 3WNJA 1JZHA 1ZV2A 1OV8A 1NICA 1B3IA 2QDWA 3NP3A 2YAQA 1NZRA 1KV7A 3MX0B 3OMNB 1OE2A 1OF0A 2FT6A 1PNCA 1ZIAA 3FQYA 3CVBA 4A2HA 1NPNA 3QJTB 1AZCA 1J9TA 2FJSA 1ETJA 3WI9A 3UGEA 3ZDWA 2QT6A 1BXAA 1BEXA 3PAZA 2RACA 4A68A 3FU9A 4DPCX 5PAZA 4KOBA 2W8CA 1OE3A 3T6ZA 1BXVA 1DZ0A 1A65A 2IWEA 1WA0X 2X87A 3V9CA 1BYOA 1QNIA 3L45A 3UADA 2BW5A 2LLNA 3T6VA 1XMEB 2UX7A 5F7AA 2GIMA 2GHZA 4E9QA 3H4HA 4NB7A 2ZWNA 4HHWA 3NSDA 1A8ZA 2BP8B 3NT0A 1A4CA 4ENZA 2FQEA 2FQDA 1QHQA 1PZBA 5AZUA 5B7EA 2PPDA 5B1AB 2QDVA 2YAHA 1AQ8A 3EHBB 2TSAA 4QKTA 1GW0A 1TEGA 1KGYE 3MBWB 3X1BA 3GXUB 1CYXA 3UAAA 4G7RB 3AW5A 1MG2C 2DV6A 3TASA 3CVDA 1CURA 5B3SB 1XB6A 1N68A
chains in the Genus database with same CATH superfamily
3RE0A 4JDEA 1G87A 3QYCA 4S1DC 3D25B 1KYOJ 2P5WD 3L4XA 4N3TA 4A7GA 2F19L 3L4WA 4Y5YB 5GRUL 1OTSD 2ALWA 1BGXH 3KPLB 4IGBA 5D7JA 1MCRA 3FB7A 2CD0A 3ZY7A 5TF1L 4P5SA 1F8TH 3B9KB 1HHHB 4YC2B 1ORQB 4ZUTA 4HHGA 4KHTH 4MA7H 1R5IB 3BWAB 1LEKB 5PCYA 3QQ4A 3D30A 4X83A 5ESQB 2V33A 3CZEA 4UQIM 4IBZA 4DP4X 5CD3A 2WJ7A 4PLJC 3PQYD 2CCVA 3WO4B 4GW5B 1WGOA 3SJVE 2EEFA 4H4NA 1ZPUA 3PGDB 1NTDA 3T0XA 4G1MB 4FQ1H 5CEZD 3BSHA 5GRWA 3RWDA 4OLVL 5B8CA 2GKIA 4RMSA 5I0VA 5D2NB 2CCLA 3UDWC 2F8VA 2HYMA 1RP8A 4W1TA 5GS1C 3D4CA 3HNSH 4XNUH 4ONOA 2DOCA 4Y2OA 4WI4A 3KZ8A 2WV3A 1KC5H 1NWPA 3GJFB 2Y7LA 4KTYA 4N1CA 5F8RC 3TPUA 5I74B 1QRNE 2ADGA 2HT3D 5DYOA 2XFXB 3SQOH 3STLA 2P42B 3TBCA 2NXZB 2NR6D 4HIEB 1P1ZB 3WNPA 3AADB 3A6CH 4JKKA 5EOQL 1WA1X 1CICD 3NIGE 3RIAK 3RNKB 2XIDA 1YN6A 3MBXH 1RP9A 4JM2D 4MXVF 4GRLC 4F91B 3SY0B 2CIKA 3GINA 4QGTA 4Y5YC 3U30C 1RJCA 1CFQA 1B0RA 4QR7A 3B43A 1BZOA 3B9KC 4JY4B 3F7KA 1JZFA 2VN4A 1LNUA 5CFHA 5HHPA 2NCMA 4QHMA 3MX0A 1BBJB 4XMKL 4GUPA 5DR5L 1DBJL 2F58L 4O00A 4OUUA 4P2RD 4NO0A 5SWSB 5L8KB 1FE8H 2VITA 1MW0A 2EQDA 3QZWG 4XMZA 5EOTB 4PRNB 1FCGA 1YMME 5ISZB 1IC0A 1NWOA 3PWPA 3WO4C 2ZXQA 5JXAL 3KCWA 1J5DA 1MRFL 4UI2A 4D0CA 4R2GC 3RI5F 4UIKH 3HN5A 3TBBA 3TPKA 2VLKB 4QWWC 1JGLH 2MTPA 4CC1A 4F58L 2DQGL 2Z8VC 4WFEE 1RFDH 1GGIH 3S5LG 4N2FA 3HOGA 3FB5B 1HZKA 5SV4A 4PW9A 3LIZH 2QFRA 3NQKA 1MQKL 2J88L 3QYMA 5I74C 2XCMC 2MJWA 3AAZA 2KERA 3WD5L 3T0EE 1EFXB 3PHQB 4ZD3L 5LQBH 3NK4A 1BSIA 5D9SA 2HAZA 3WGVB 4TF4A 5CUSH 4Y16B 1UWGL 4PCKA 4J4PD 4A2MA 2JB6A 2GC4C 2KQNA 5GGTH 1CFNB 4D9QE 1UOWA 5EF3A 2X09A 4B9YA 2H1LM 5ITFB 5F21B 1B4TA 3VFRA 2W65B 2WKOA 1FYTB 3Q3GB 2DYPA 5EBLA 5EBWB 3II3A 1UOVA 2WUBH 3DMMD 4KROB 2J44A 4U0RC 4Y4HA 3TO4B 1YYMH 4ORGA 4PJHE 3GJEB 3WNLA 3D0VB 2NY6B 5HHOA 4U0QB 4N0FB 4GW1B 2X3AA 4N5ED 1D5MB 1UM4L 3I6GB 1T22A 4HFUH 4HKXB 1RIUH 3QIWD 3WLWD 4FFYA 2A74B 5JUEH 4QTHA 5I30H 4TQHA 1A1NA 3B7SA 1WP6A 2VDPH 4FHBD 3U82B 4F5CE 1TZIA 4PP2B 1RJYB 1OALA 3H3PH 1FAIL 2AQ2A 4ZPTA 5HHVL 3VXUD 2FX7L 5JDJA 1U8LA 3FMGH 2BOCA 3WFEH 2CO3A 2NY4D 1KB5H 1F6AB 5DMJB 5KZCB 1OTUD 3GMMB 1JXGA 2X2HA 4P2AA 5FPIA 3KBPA 1DSYA 4GXUN 3ISWA 4E42B 3C9NB 4U6VL 5ES4B 4P2OA 2IQAA 3QWRA 3S34H 1JPFB 4AM0A 3IJ7A 3A47A 5LBGA 1K85A 2XI9A 1E2WA 3QO1B 1DVYA 4Y16C 3RY4A 1GYUA 2ZTBA 5F88B 3IMBA 4PJAB 4YHLH 1HCVA 3OAUL 4TXVB 3SPHA 4HZLA 5CS7A 4B9CA 3FTYA 4ES9A 5EF1A 3LZLA 3JWNC 4H1LA 1M6OA 1HX0A 2I26N 3WJJC 1A9EB 2J71A 1XT5A 5JOFB 1Q9WA 3ZYIA 1DP0A 4N6QA 3SE8H 5EHFA 2BIQA 3FN9A 4YQXH 1F1DA 3L08A 1ACYH 1FNGA 1WTGT 2OMZA 3OKKB 3TO4C 3WIFB 1T7WA 4JRXA 3Q44A 5EU6B 4JFHE 1IMHC 4LGSB 2WXRA 2GUOB 2IAMC 3MUZ1 4P04A 4U6YA 5AZ2L 3QUKA 3NJHA 4YLBA 4PGDA 3MLZL 2B3RA 4KI5D 5IIEA 3EGXA 3G5WA 4KBPA 4M93B 4Q6IA 3L1GA 3LOWA 4UIMA 4X6CF 1SLVA 4GBXA 1TTFA 3IJ8A 1G43A 4AMWA 2ZWZA 3SD5A 3NJMA 4FA7B 3LDBB 4BWUA 4LLUA 5H37H 5DMGD 3U4AA 4R26H 1S7RA 1RUML 4O2EA 1SJHA 2DKMA 1QSVA 1EHLH 4LOVA 5JIPA 1UGKA 3Q6FA 1NDGA 4MKTA 2V9TA 1SUJA 3MROA 2RHEA 2ZZUT 4O58L 4RGMB 4QNPE 1U8PA 5SWZD 1JZ2A 4JFVA 1M2VA 2Z64C 3K6IA 2WYZA 5FWQA 5ADPH 1W9XA 4FERA 3MLWH 3BPLB 1KCSH 3EF7A 1LP9A 1RCYA 2AXFA 1S2EA 1G6RH 3TV3H 2OMTB 4WHYG 3REWB 4AYDC 1GMEA 1MDAA 1A14H 1D7FA 1QBLH 4QCIA 4OV5A 2BVOB 2V7NB 4V1DD 3D3VD 4LEOA 1NIEA 2IDUA 4PG9B 3SYCA 4CJ0A 1S46A 3GS4A 4M7ZB 4R3SB 3N0PB 4BFIA 1ILUA 1DQQB 4HIXH 3RPIA 5JZ7C 2D3NA 2YUZA 3EGDB 3KW8A 2G2RB 2FLRT 2FO4A 2OXGB 4UQBA 2VN5A 4IK7A 1IEAB 5IGXH 3T4AA 3BGAA 1G9NH 2R59A 4YSEA 2CDGB 3CVCA 1BXUA 5I1CH 2DLTA 1FZOB 4QHNA 1FCCA 3UMTA 2ZYRA 4M93C 2EH8L 2KDGA 3I9IA 1L7TL 3QWQB 3T09A 3TN0A 1OQXA 3R0MA 5LXVA 5ELIA 3DXAE 4E0RB 1BBDH 2L3BA 1YEGL 2VB5A 4WW1A 2CPUA 3CFIC 5GSRB 2E6PA 4P4KC 5JXEA 1RIVL 3G08B 2GB2A 3O3UN 1VEMA 2KZBA 4C56A 3RDTD 2BFVH 1J1PL 1YN7A 4K23H 5IB2A 2BNQE 1M7IA 2B2XL 1VPOH 2OL3L 3FU7B 1ZGLP 1DQLH 4N3UA 3WN5C 1NBZA 1L6PA 2Y7NA 2BCMA 4JY6A 1WYJA 4JVWA 3A67L 3PQYB 4E36A 2DL2A 5FM4A 1TFPA 5J56B 3AREA 5EN2B 2QPDB 4DH2A 2Q3ZA 5E4AA 3QEUB 4GLRI 3MRHA 3IU3A 5CGTA 2BHYA 1BOGA 5ICUA 3H9SD 3SE4C 1N8OE 3QEQE 4AKPA 2G9HA 2P8MB 5AAPA 4M3HA 1TZOA 1KTDB 5J11C 4OLUH 2WMPA 4NT6B 2FYYB 2JF1A 4A7GF 1E3FA 3OR6B 4W9EC 3NH7L 3ARDD 1EIBA 1ZIBA 3MVSA 4IMKC 3L7FB 3VXTA 3B37A 1S7SB 4JDZB 4YFLF 4G11A 4ZUSB 5AOMA 5LCVL 2ICEB 3JUZA 1X5HA 3AQDA 4IDLA 4A38A 1CD1A 2BWDA 1ZHLB 5F0JB 4F7EB 2ZWSA 4Y1AD 3OJDA 4DK3A 4KK6C 5I0WA 2OM5A 4O02L 4I4WA 1OT4A 3T5WA 3CPLA 1I7ZB 4ODHH 3UTSA 4XNDA 4OLYL 1ZTXE 3K4DA 4R6UA 3WJMA 1CICB 1CLVA 7PAZA 1KTBA 1S7QA 4ODXA 3W81A 4PCYA 2C3WA 1WBYB 4L8CA 2PLTA 1LJMA 5JQ6H 4PR5A 1OTSC 3WN6A 3IDGA 4NN5B 4M5SA 2FGWH 1B3IA 4B3VA 1BMZA 3WEXB 3MO1B 3V7AE 4HS6B 4I77L 2FT6A 4NQVB 4BYHA 2H3NB 1ZVSB 3IDMB 4P2RB 4X80H 2C1PA 2EXTA 4DO4A 3WXVH 3MRJA 1SHMA 1BEXA 1K4CB 1GL4B 1FV1B 3BAJA 3N06B 2Z8WC 3QDJA 5HDOA 5PAZA 2JVUA 3RVWD 1GRWA 3B4NA 4WI5A 4UTAA 3AU0A 1WUZA 3PWJA 4OZGA 4HVBA 3RU8H 5MEQA 2C7FA 1BD2A 2BS8A 5E95B 2CXKA 5IBLD 5DTFB 4Z7AA 5F7AA 1ETA1 3ZU8A 5HSFA 3ZTJG 1QLFB 4MHHI 4NB7A 3VG9C 5JNYB 5LHDA 3DRQB 5ERWB 5EU3B 4EJ1C 4PI2A 3QG7H 1U2HA 4RAHA 1A1OB 1BVNP 4WI6A 5BZZA 2BX5A 4MSWB 1JXKA 4X5WB 4YXKH 2X1OA 1X5XA 1U0QA 4YO0A 3HBZA 2FHCA 3B9VA 1MJ7L 2X7LA 5IFJB 1CYXA 3MC0A 1DDTA 3UGXA 4Q9QH 1FVDB 4LSUH 2NR6C 3HFML 3NJXA 1U8NA 1G0DA 3D51A 1Z3GH 4WUUA 4YNYB 1M71A 2Z93A 3A21A 4WU5A 3TM6A 1HHGA 2E7BA 2P5EE 1VFUA 1DJYA 3KPOA 3MV7D 2GTWA 1S7VA 1O7VA 4JM2C 4H88H 3SN6N 5ID1A 2YEZB 3MMEB 1RZJL 4Q74A 1ZLSL 4M61B 4N8PA 3LPOA 2GJ6E 1NCWL 2FAUA 4P3CL 5CCKH 5G55A 2BSCA 5T8IA 5KYWA 1UYWH 3EYQD 1S9VB 1K72A 4LQFH 3GF8A 4XVJL 1I7RB 5L4MA 5E2VH 2XWCA 3OZ9L 4FG4A 1QACA 3EOAB 1DE4B 4WTXA 1Z7JA 3D1MC 4JPKL 4BIKA 1BZ7B 4P2QA 3ZW3A 4WHYH 1HWGB 1WICA 4YDLC 3PWPE 3VGHA 4JREB 3US0A 2WM0A 2F74A 5D7KD 1Q9OA 2X12A 4TQPA 3KBHE 4XPAH 5E2TH 5JW4N 3ARYA 5GS2H 3FYIB 3PG2A 1C1EL 4KXZH 2FBRA 5GGRY 1OQOA 2AV7B 2VZSA 3VXUB 1SEBB 2WKOF 4YXHL 1SM3H 2VZ1A 4N2OA 3FB6B 2D03L 2XA3A 2NY4B 5C0CA 3T1WA 4N4YB 5D4HA 1TJXA 3GMLB 3QI9A 4H1LG 3DHPA 1DQML 2BP0B 5CZXC 1IE4A 3O6KH 3T0BA 4ZZFA 3RWHA 1RK1B 1CD9B 4S10A 3IFLH 4Z78A 4HK0A 3DJRA 4U1HA 5CCGE 1DBML 2P80A 2B1AH 3OF6A 5F89A 4OZIB 4LPWA 4MCMA 2H6PB 3KCPA 3CHQA 5MI0B 3LRMA 4FZ8L 2JTYA 5D1ZA 3L81A 4JFOB 3ZRCC 4W6XB 2DTSA 3AMLA 4DOHB 3ALWA 4AH2A 3GIVA 4R0LA 1HNGA 3KLAB 3DMMC 4GRWB 4KKQA 2P24A 4NSKA 1PZ3A 2WO4A 3ESNA 3BIKB 4B9JA 3QRBA 4NUGH 2XZQL 4QY8A 4UILH 4N5EC 3AG4B 5DJ0B 2NY2C 4L0ZA 2X2JA 1TVBA 4HAKA 4ESKA 1NC4D 3P0VH 3QIWC 3WLWC 4AVIA 2Z4QB 3AGVA 2QV4A 5JMRA 1L6XA 1JNNH 1ULVA 3MRDB 4LHUA 2PCPB 1BEYL 3HG3A 3ARWA 1RLBA 1AKJD 1E9OA 1X6NA 4H7VA 2VDRL 1E30A 3DV6B 3NP4A 4XHJD 4B95C 4PGBB 3L4ZA 2A9AA 4NZDA 1QW8A 2YBRB 4K3GA 3GS7A 4UB0H 1E40A 5DDHA 4TOYL 1HT6A 1DQDH 3UEZA 2NY4C 2VZTA 3QXDA 4Z7NB 2DAVA 3SE9L 4LSVL 1CG9A 2EC8A 1OTUC 5IW3A 4CSSA 1J8HD 3WMQA 1EVUA 1WZ1L 4GH7B 2BY2A 2UY7B 4Y2DA 4N2MA 5ICZB 3GBNH 1GZQA 3L4YA 2MRYA 4F7PB 2CDFB 1D5RA 4OB5L 4A1RA 5FA4B 3ESOA 3MFFA 4GW4A 3WIIL 1VKXA 2ZWKA 4BE5A 3P2DA 5MI0C 4DN3L 1CLOH 4MD5A 1U95B 1F3DH 3LQZA 4N2EA 4U1LA 1R34A 4ES8A 3IN0A 3MV11 3L3OB 3V5KB 4NN6B 1YY8B 1Y18B 1EMTL 4OSUH 1ZHNA 4PV8A 1G1KA 1B9ZA 3K2UL 2XNAA 1BVLB 1DANU 1JPTL 2Y36L 3CLEH 4W9DC 4ZS6D 3TS8A 1YO4A 5KBNC 3ULVC 3HHMA 3S9DB 1ZK9A 5DLML 1MHPL 3SDAA 3QDHA 2ZUQB 1FFPB 4J7RA 3DGCR 4ODTH 3EO1A 4U3CA 3VXMA 4NXSA 1J0KA 2A6DB 2BVPA 3PNWB 5FW8A 5HGDA 4K7FB 3OKMB 1PG7H 1A7NL 3W9DB 1KTCA 4G1EA 4JE0A 3RFZC 1J88A 2C7UA 4KI5C 4KUZH 3O3BA 2ZPKH 2VWEE 2YQ3A 3BXNB 1LP9F 2OSWA 1LO2L 3SBQA 2GC7C 3BMWA 1E9QA 4NZRH 5FK9B 3LXAA 4L37A 1NCGA 3FFCA 2NOYA 3L9BA 4GUOA 1QPKA 2Y1VA 4G8GA 3RDTB 3N42B 4FXTA 4PH8A 3ZTJH 2FSDA 3O3EB 4LO9A 4A37A 4XVTL 2ICCA 1YEEL 4JJOA 4PJ9A 3F84A 4MASA 4L3CB 4AY0A 4AEEA 3OG6B 3H42H 1L9PA 4PY7B 2CHWA 5D71H 4F2FA 2X0WA 1MCKA 1JVOA 3MHZA 1W8NA 4Y5XA 2K78A 1LP9E 4XBEL 3IGKA 5DWUH 1I1AB 1AD0A 4O2CB 1Z6JT 2VXQA 2CHDA 4JO5A 5KS9E 1FZJB 3FYEB 3MOAH 4A6YL 3KAAA 2YMOA 3HUJA 1MWAL 3CLFL 3KYNB 2FJGB 3FTXA 1HYRC 3L3OC 3VFTA 2LU7A 4EO5A 3V79C 1INEL 1OAQL 3U25A 3P30L 2KZKA 4TVUA 1LL1A 1YYLH 5HXMA 1IO4C 1NPJA 5C0RL 4K3EH 5HHMD 5EEUA 4FFYH 2A9CA 4FYQA 4MMZB 4E9SA 3ARDB 3DVFA 1MFDL 2H5UA 2FHFA 1AGEB 3LYRA 5JTWA 4A04A 2ZYHA 1Q9LB 4J6IA 3RUGB 5IMLB 5E5MB 4BE6A 4WTZA 3LZQA 3ZKMD 4KQ3H 4Y1AB 4E41A 3BP7A 1TTCA 1T5XB 1JS4A 1NBVL 3FCUB 2WXJA 1AYOA 4OKVB 3N1MC 4AYMC 2W81C 1XIWD 3MKKA 3SHSA 4FRWA 3S98A 4Z3IA 1A22B 4G7VL 3VH8A 3QQ3B 5EIIB 4KKBD 5DVMA 3T4YB 1WH0A 1A6WH 5IBTL 2B0SL 3WEAA 4QHPA 1G7LA 2QKIA 3RVVD 4XMPL 3U4EB 3RDTC 5K9QI 3N43F 4XO8A 4C56E 2YD5A 3IWVA 3UACA 2DPKA 1Q0XH 3IDYB 3L9EA 5KW9H 2WNGA 4H1LH 1AHWA 3ATAA 3POHA 1YAZA 4FHKA 2I07B 5E6SB 3WAKA 1JZIA 1XF4A 3O3DB 3UC0L 1IE5A 1T1WB 5A1AA 2XTJE 1JOIA 4GAYA 4XBGB 1U41A 1X9LA 1RK0A 1CI3M 3MNZA 3EHBD 4WO4D 5FC9A 4AJ0A 1SPDA 4GQZA 1HK6A 1IM9A 3KEDA 4DZBA 5I24A 2ZP9A 4N22A 4DP0X 3T2NL 3HI5L 3WKNA 5GS0L 3F01A 3G5VA 3CFDB 4G8FA 2BO0A 5I6KA 3EH5B 2HRPL 1MEXH 2XN2A 5FGSA 5CCHE 1ZLWK 4DW2H 3IKCA 3QXVA 3ZE2B 1ZDSA 3ARDC 4AX3A 4F8QA 3GNML 1KGCE 3SKNA 1Z9SB 5DLLA 1JN6A 5DSCB 3K6FA 1R33A 2NQ3A 4OAWA 3ORJA 4RIRA 4XP9L 5HPMB 4JR9H 5CWSA 3ELAT 2AK1L 2VC2B 3D7PA 4LQ1A 3TJPA 2AEQL 1YAIA 1CFVH 5CLTA 5KVFE 5LGYA 1YNLL 3NA4A 4ZMWA 2AKRB 1W91A 2V5YA 5DZOA 4TL5A 4KKAD 1NJ9A 2ALAA 3KGSA 3SGEI 2XVKA 1P9MA 4DKDC 3S2CA 3UTSE 3X11B 3FRPA 3TJHC 4Z3TA 4XP4L 1HINH 2JKSA 4OZGF 1G7HB 4JKPH 1F58H 4MD0B 4ZO9A 5EIQA 1DVXA 1IEBA 5F0MB 2R69L 3IWUA 3ULVE 4HKBA 1CE1L 1W0WB 1A3RH 2HP4A 2G60L 2WTPA 2GT9B 5I18H 4P4RB 3VXRA 3ZO9A 5IF0A 5L6YH 1B4LA 1UM6L 3LN4B 4YBHA 1OCZB 3KPRA 3MA7A 3Q48A 4WQOA 2VN3A 1KCLA 3PWUA 3L5WB 1ODAA 2PYEE 4QO1A 2ZXWB 4X6DA 4HCFA 1QOKA 4F9LA 4M1GL 4K5OA 5I1DB 1BVZA 4F57L 3LKNA 2J6EA 3IJYB 1I3RB 5HGHB 2B77A 4WW2C 3HS0A 5FFLA 4YSRA 2QEJA 1ECZA 1DZBA 3KHOA 4CSZA 4HSAC 2UZIH 1JK8B 2NNXA 2VSKB 4U7SA 5FECB 1GHFH 1T21B 4NKDA 1OW0C 5IHZA 1GTFA 2PCYA 4WKXA 4DFIA 2H8PA 4DQOL 4KJYA 2K3TA 3ABGA 4BV1A 2JCCB 5GZOC 3ZDYE 5B3JF 2YUXA 4AGLA 3N5AA 1ERNA 4N20A 1MCIA 3MRFB 2VE6B 3GWJA 1R3IL 1NGQH 1J9SA 2I9LA 4EIZC 1PLCA 3SDCB 3IGLA 1C16B 1ZDQA 2DQEH 5IG7B 1KIPA 1JDDA 3KWTA 2NNAA 1S5HA 3KJ6H 4J23A 2AV1A 2C9AA 2WXNA 4NNPL 1U8CB 2Y5TB 2RALA 1D5BB 3KPSA 4LHUG 3LS5L 3QP3A 2A6JA 1BF8A 3VD3A 1HXYB 1VFAA 1OE2A 5F71A 1BW8A 1CO1A 5H94A 1AY1L 2QHRL 4R7DA 1HH9A 1RZIA 5B3JE 3VA2C 1NC4B 2QT6A 3OKNB 3AM8A 3IU4H 5KVEE 3ZQXA 4GRMB 5D7IA 4RQQB 1UXMA 3SYOA 5I1GH 3S4SB 1UZ8B 4JFFB 1PZ5B 2WB7A 2EDTA 4ICXA 2OSLB 4PJ5E 3F7PC 4Y9BA 1V5JA 3FO9B 4I13B 3UGUA 3UADA 2HMID 1IGJA 2G9KA 5I8KH 2BW5A 3CDCA 2J1WA 3L3IB 3NIDE 4E9QA 3MLUL 2ZWNA 1MNUH 3O8XC 1UWEH 4U1NB 1RL1A 4WAFA 1J8HB 3C5JA 1RZGA 5T1KD 1FN4B 3C6LA 3FU5A 4M29A 2E7CA 4JPVL 5AZEL 4MZIA 2ITEA 4YX2L 1EV2E 2GY5A 1GOGA 3SGDI 4WI0B 3QGVA 2JJUA 2DLIA 2YHGA 3OLDA 1JZ6A 4IRZA 3V7MA 3DC0A 2E56A 3JT0A 3MBWB 3TCLA 5IW1B 3MUY1 4PJ6A 3G6JB 2LOEA 3MTRA 4X4XB 4XPFL 2CO4A 3H9HA 3CVHB 3IPEA 4RSVA 5SX5H 5EO1B 3C8KA 4PVLA 2DJ4A 2DLEA 3AGWA 4JE4B 3KWWA 3US1A 4FTVD 4WHTB 5BPPA 2YMXL 1P6FA 3CFJB 5JIMA 2HH0L 1FIEA 2BY1A 3MACH 1MN4A 4UTAH 4HXBH 4HUKB 3TZVB 2OMVB 3VB8A 1PPIA 3MREA 1SGKA 3WDIA 2AK4B 4KKNA 3WNOA 4IOSA 1TCRA 4ODWA 4BQBA 4YLQT 2IFFH 4DGVH 3KL0A 1R3HA 2X42A 4JHUA 5FV1L 1UM5L 2WTOA 3SZ6A 2LU3A 4A66A 1JPEA 1NOFA 2HLFD 2QV2A 3CH1A 5IHBA 3HZVA 3FTZA 2VLRA 4MZ3A 5C9JA 4XHJC 3OHMB 1IC7H 2UZYA 3DYMA 2CO1A 3VI3B 5IOPA 2XV2A 4RZKA 3HBPA 2XXCB 3HC0B 4JJ5A 3T8VA 2COVD 3K7UA 1NINA 5CO1A 1PKQE 4L4VA 4EI5D 4B7IA 2NY3D 2ZX9A 3KYOB 3N55A 1A9BB 2CLZA 4J28A 3TA4D 2IAAC 1JVKA 4PRIA 4IEFA 3RY6C 4K4KA 2WP3T 2LT9A 3K1DA 2APWA 4UNUA 3DO4A 4ANUA 3CFUA 3KXFA 1OF2B 4H26A 3EO9H 3Q1SL 4ZFOB 5FW6A 2WKLA 4M48L 4WTZG 4I5BA 2CLVA 3UPRB 5IROA 2CAKA 5KVEH 3BIBX 3AUWB 4ZFZA 1UWXK 1O5DT 3EDEA 1QFWL 3NEOA 4ZS6C 3V0VA 4DPBX 2EXWD 1E4XH 2GBTA 1EJOH 1W72L 3BT2L 4U1SB 3VH8G 2VXTH 1FG2B 1QABA 1S3KL 4N0UE 2IH3B 4PW3A 3U1SL 4TNGA 1DVUA 3F00A 3FUEA 3HNTH 1PLGL 4TULL 2WN2A 5DUMH 3EYFB 4HIJB 2X2YA 4XBPA 2J5LC 4ATWA 3WOVA 2C4FU 4MA1B 3BDYH 2CLRA 3BAXA 5ANHA 1JWSB 1XIWB 3RRQA 1H5BC 2DQJH 1ZJAA 2HFFB 1OP5K 4UTBA 3KPPB 4U1KB 4QHLA 5HGBB 3QK0A 1OSYA 3E6FA 3N2JA 4KZCA 3FFCE 2B08A 1L0XA 1X9UA 3HUJF 1DFBH 4L0PB 5AOLA 1YEJH 5B1JC 2YLKA 5ACZA 2JLLA 2RCSL 3HPLB 1QNZL 2AP2A 4LF3B 4HULB 4IIQB 2E46A 3QAZB 3W2DL 2CNZA 5AALA 3DVNB 3ZMRA 1FH2A 4ODSH 4OCYH 3PWNA 2Z31A 4TQ8A 3ME0B 3RWFA 1SNRA 1JPGB 5GGRA 2IPKB 3BZ5A 3EOYG 5GS1A 4JO8A 3ZKQD 2WLKA 3P9LA 4WO4B 1DN0B 4TSCL 4BH8A 1DYZA 1YDPA 3ULAB 2M1KA 3R06B 5E2UH 2J8HA 2ISDA 4C83A 4QYOA 1V10A 3VRJB 5HYQB 1HXMA 3S5YA 2NDGA 1YJDH 3I3DA 3QUXB 5A2AA 3ETBJ 3PWLA 5BVPL 2GBAA 3CLWA 6FABL 2B1HH 2FUTA 4JHAH 4JFQA 3BW9A 4LCCA 4APXB 4Q14A 3GXNA 1GGBL 1NQBA 1JWMB 2H45A 4G2AA 3LV3B 5D7SL 3TEXA 3V0IA 1MVYA 3FRPG 4NFBA 3IGFA 4IS6B 4ODBD 3C60D 4OLWH 3RNQB 3D25A 5EPMB 2VM9A 2AJ3B 3JVFC 3ZKMC 3MRRB 4BKSC 4B27A 4C4UA 4Y5YA 3H6AA 4KVCH 3KPLA 3P02A 4FFZA 3O2WL 2ZAGA 2DM7A 3WKQA 4E41E 3ULUF 4OVVA 1NCBL 3B9KA 4PB0H 1HHHA 4XI5C 1ORQA 3U9UB 2AEOA 1UJ3B 3MDJA 5FFOA 3HC4H 1R5IA 4FQHB 4LLAA 4R9HA 2AXJA 2C4FT 3BWAA 3ERXA 4KKBC 4OF0A 1LEKA 3UBXB 4F8TA 1TU2B 1CE6B 5ESQA 4AV4A 1NLBL 5EBMB 2JMRA 1HCFX 3RVVC 4N28A 1O6VA 5GHWH 5AW3B 2Z91B 3BH9B 3QRGL 1CF8H 2OW6A 4GW5A 4UZGA 1R9FA 3C5ZD 1XD1A 2XIIA 3PGDA 3FO0H 4G1MA 1NBCA 3TEYA 2BVEA 4FXKB 4R97B 4WFGD 1R0AL 4UM9D 1WCQA 4HWZB 1ET8A 4FHJA 3WENA 5D2NA 1CVSC 2IH1B 3UYRL 3UAEA 3QCVH 1KWKA 2OMYB 3V5DB 5JORB 4LLWB 3EHBC 4WO4C 3QFDB 3X12A 4X9HA 4Y9FA 1I75A 1OVZA 5IQOA 4S1QL 4QRRD 1XZ0B 5F9AC 3GJFA 5ANMB 2NZIA 1SHWA 2NDFA 3G7TA 2DS4A 1MCOL 2XFXA 3IRPX 3QUYD 2ZOOA 1VACB 2I25N 3AWGA 4NKMB 1ACXA 3QUZB 4HIEA 2VDQB 1P1ZA 1W0VB 1RUKH 4JQIA 4ADJA 2Q8BH 2ICES 1QTSA 3D2UD 4GIOA 5ACMA 2WVTA 2ROYA 4QAMB 4HCGA 3QJRB 5DEJA 1KCKA 4LPUA 1OGTB 4RGNE 3RNKA 2QSCH 2FLMA 4K8RH 4PUBL 6PAZA 4K5MA 3AMKA 5DT1L 1PZDA 3SY0A 4FQ2L 4K3JH 3PF2A 1KCVL 3UJTL 2XVGA 1I7UB 4J27A 5T3ZD 4XCFH 2CBQA 5EU7E 5E5UB 1NCCL 3ZUNC 5DMKB 3GBMH 5HDQL 5I0DA 4JY4A 3L2NA 4HUNB 2IOIA 5DMIH 1BBJA 2CUMA 4OCWH 3NJLA 4X7TB 4JFDB 5SWSA 3EIFA 3LPGA 3MXVH 4X6DF 5EOTA 3Q05A 4PRNA 3WFDL 3GLAA 4PJXE 4TRPL 2ZJSL 1LK3H 2ORBL 1IGCH 2KL6A 3HE6B 5ISZA 2O5XL 2DKSA 4Q7DA 3C2AL 1D5IL 2Y06L 2VXQH 1WHPA 4AUYA 1I8UA 2BFGA 4XVSL 1WT5C 4L3EE 4HJ0C 2VLKA 3HE7D 1KT2B 3D4YA 3LN5B 4L4TB 3RX9A 4S0TD 4KUCF 2A6KB 1UFUA 1ID2A 3MLRL 3U7WH 1DJIA 5HHXL 4PJGB 4XPHL 1ETZB 3FHEA 4BFOA 2NLJB 3HZKB 4I3SL 1CBVH 3IB4A 1Y6KR 2BRRL 3ZN6A 1NKRA 4TN9A 4I0PD 2COQA 1EFXA 3PHQA 3M17B 3FHQA 4G9FA 3ABZA 4AYBA 1MRDL 3O9WB 2X6MA 3B9AA 2R2EB 1EHXA 1CU4H 4YHYC 4Y16A 5CZRA 4R4ND 4EXKA 4WVRA 4KTGA 5IESL 2GJPA 4DTGH 5DD1L 1CFNA 1QFWI 3SDDD 4RMTA 4RFNC 3CFKB 2ZCHH 5DRNB 1U4EA 5ITFA 1IEHA 2W65A 1KLFB 1FYTA 2FUQA 2ZCKL 3Q3GA 2VDKH 3QWNA 2OAAA 4YMPA 2MIZA 5EBWA 4GQQA 3VGGA 2IANE 3NBNA 3OMIB 5F7HA 2BPBA 4HBCL 5DVNA 4P59H 4HCRA 2AAVA 4PRAA 1P2CB 1TLMA 5GPRA 1BAFL 3TO4A 4FS0A 3CVHL 3GJEA 1C5BH 1B0IA 3D0VA 3QFJD 3ULUH 3IE4A 4N0FA 4PN6A 5D7IF 3ARTA 4GW1A 3VUAA 1L3WA 3GEFA 3CXDL 2MQ3A 3WJLC 1D5MA 4WNSA 3I6GA 4AEFA 1YY9D 1XH3B 4HKXA 1WEJH 3HRPA 4FTVB 3UG3A 2EUXA 1NCUA 4XAKD 1NUDA 2A74A 2JB5L 2XWBB 1J1OH 4UF7C 3KPSE 2X28A 2FQGA 2BSBA 2QPFA 4LCWE 2Y07L 4MJ6B 5TQ0L 1NUGA 5I73C 2FNWA 4PP2A 2WD0A 4DERA 1RJYA 5BQ7B 2EE2A 1SOSA 1JHKL 3OM3B 4LLVB 2Z35B 3O6FB 4GXUM 4H25B 3S37L 5CJOL 5EH1A 2FECL 3OX8A 4WJG3 3WCYA 1F6AA 1U3NA 3UTOA 4L8SB 5C07D 2K70A 3GMMA 4E42A 3C9NA 2UZPA 5DJ8B 4BRVA 2JFCA 5L7XH 5E9DD 1JPFA 5CILH 4DKEL 3P4OB 5H35B 3QO1A 3MUHL 1TCMA 2DQMA 2CO6A 4QGYA 3CDYA 3ARFB 3BX7C 5F88A 4PJAA 3T0VA 2ZE0A 4ZT1A 3EJJX 4YHKL 2GBUA 3T6QC 3AS0A 1N9PA 1I7TB 4M7KH 1KIUB 5TK4A 2X70B 2WLLB 5DQDL 3ZIYA 1A9EA 1KFGA 2X2IA 4KZEL 1I3VA 5JOFA 1URLA 3O6MH 3N1QC 3IGAB 5E6ID 2XZAH 2B4CL 3QXTA 1H0DB 3OKKA 1EANA 1G7PA 4Z7OE 4GKZB 3WIFA 4MNHB 4ZFOL 1UZ6F 5EU6A 4HJJL 4M8RA 4YDMA 2GUOA 5K39B 5G5DB 1U3YA 1IGMH 3EZJB 3NGBC 4X5XB 1TLKA 4PJEB 4M6OH 1A8JH 1WV7T 2J6EH 3HG2A 3LZOA 3HCVB 4PIBA 3BQUC 2J21A 3WNJA 1UXWB 3LRHA 2D9CA 2WQVA 5T33L 4JX0A 1XF1A 1I9IL 3FT9A 5HYJD 4X8GA 5AYUL 1EO8H 1A4JB 1HDMA 2QPSA 5DEFB 3QS3A 3VRIB 5JIIA 4P5KB 1LEIB 5BRPA 4C58B 1EH9A 2HLFC 2L7EA 4L8SC 2DQTL 1YHPA 2HJKB 3DTDA 4K73A 5FCSH 1JNLH 2H32B 1IBGL 1NLDH 4W9IC 1Y7VA 3FU9A 4BUQA 1OAYL 1BZQK 2DQFB 3LN9A 3QO0B 4OCSL 5I1AB 3ZT7A 5CLYA 4DCQB 4DN4H 1JDCA 2IWEA 4JS7A 2G3ZA 2OMTA 4L3FA 3BAKA 3REWA 4EI5C 2BVOA 2V7NA 3RVXD 2NY3C 3FO2B 5INDA 3DX6B 4MJIE 2AI0H 2PTVA 4WCYH 3CK0H 3N1FC 3VD2A 2DWYA 4ONGL 3BE1H 4R3SA 4XCYB 5DJDB 4OBSA 3LHPL 5ITBH 4HWNA 1LHZA 4F9PC 2ESVE 4PRIE 1DQQA 5B7EA 1B4JH 2WPGA 1FGNH 3EGDA 2G2RA 2YAHA 5E70A 3Q8CA 2OXGA 5AVTB 2AW2A 2FX9H 3UAJA 2VMDA 3PHAA 2W0FB 3L1OH 4JRFA 4LU5L 1IEAA 5E0QA 5JR1L 3UAAA 5DD3H 3SKOB 5LXGH 5C0ND 3VXOB 3QCUH 2CDGA 2OSYA 1NEZB 3LPWA 1FZOA 1U8JB 1E5BA 1KG0B 1MFUA 3NMEA 2EXWC 1M7UA 3SKJL 3THML 3GXTA 3BPCB 4CU6A 4M9OA 2VDOB 1NCOA 1MPAL 4E0RA 2IBGA 1VCAA 3C60B 3DUUB 2J88H 1JRHL 4JZNB 3V0JA 5GSRA 2MCPL 5GRJL 3KEHA 3BRFA 4ZQKB 1A0QL 3G08A 4GLRH 1IKFH 3GFUA 4YSCA 4OZ4B 3PCYA 4WIQA 5CJBA 2WNXA 4F7MB 1SVCP 3QEGH 3KLHD 2NY5H 1TQCC 2UXGA 3ETSA 4LDLB 4P9HC 1IAIM 4KTDH 1E28B 2ARJB 4PEEA 1T3FB 4O4YL 1OT2A 4JUSA 3FU7A 4AUUA 1X9QA 3F6LA 4G80B 4YDVB 5EZIH 4OFVA 2VSDA 3BVNB 1MXGA 1JHLH 5F1NB 2ZUTA 4FMFA 3PQYA 1N67A 4IRZH 4YBLB 5C2UB 5EN2A 5JDSB 4MQXD 1WPCA 4EDWH 1K6QL 4ZMQA 2CO7B 4HPYL 3C5ZB 3QEUA 4KVNL 4XMXA 3T2QA 3KLKA 12E8L 1A6ZB 3CD4A 4UM9B 2CIIB 4LASH 3S3SA 2RB8A 2KHAA 2P8MA 2OW7A 5K9OB 4FQLL 4M7LL 1KTDA 3RBSA 4AYGA 1OARH 5F6HI 5AVXB 4NT6A 4FYRA 2FYYA 1RZJC 1ZT1B 3NFNB 3OR6A 5DGQA 3L3DB 3L7FA 4JDZA 1S7SA 2LLLA 3QORD 2WHVA 3IF1B 4LCVA 4QRRB 4U7MA 5DD5H 4LZKA 1WIUA 2ICEA 5DEGB 1KUMA 1UA3A 2E7DA 4JZJC 3ASOB 1ZHLA 3IETB 1K4DB 3QUYB 4F7EA 2F18A 2RIKA 5EEYA 3PJSB 4CL7A 4WI7A 2NR6A 2VDQL 4WF7A 3DX9B 1OP3K 1I7ZA 2B14A 3GM0A 3D2UB 1T6WA 3MRBA 1CICA 3BUTA 4D9RE 3C60C 3ZYOA 5J7CC 1OTTC 1M53A 1PS3A 1WBYA 1WZKA 2HB0A 1H6UA 2QBWA 1Y1UA 4CC4A 4OD1L 2O6DA 2J1ZA 4ZAKD 5DZVA 3UPAA 1V05A 3WEXA 3MO1A 5ETUB 1ICTA 4D9LL 4HS6A 1MAKA 4NQVA 2H3NA 1IILE 3GUFA 1ZVSA 3IDMA 4P2RA 1KN2H 4L8BB 1BQLH 5CNHA 2FECI 1SZNA 1PD6A 4DKTA 1K4CA 1X5LA 2D7TL 1FV1A 3DO3A 4LP5A 1IX2A 2Y69B 2MNJB 3LQAL 4ACPA 3UL4A 5FS5A 1INDL 4WWNA 3OLEA 2IGFL 2X4TB 4CN1A 2XN9E 1RZ7L 2KQMA 5JPMC 5FUOH 2QADD 4JHWL 5DTFA 3TNNA 2FH8A 5D8JH 1QLFA 2BDNH 1TQTA 3E6HB 4QT5B 3S3JA 2AEPL 3DRQA 5D2NE 5ERWA 5EU3A 5FHAL 5JNYA 5J13C 4G82A 1A1OA 1JFQL 4ZSOB 3OSVA 4MSWA 4X5WA 4I1PA 4I0PB 1O75A 1EWHA 1RUMH 3OQ3B 2BW4A 3S96B 2A2QT 2JCWA 5IFJA 1IC4H 1FVDA 2D7QA 2VXVL 3AQZA 4Y5VC 4OLXL 5DD0H 4ZMYA 2YAEA 3SYPA 1AQKH 4J4PA 1RUPL 4YNYA 2WYIA 4UTBH 5IBUG 4HQQH 1E6JH 3LEVH 4TL4A 3ZGIA 1LYQA 4KAQH 3P3TA 1ANUA 3U2IA 2NX5E 5FGRA 3LZRA 2CR6A 2GY7B 2YEZA 3L6FB 3QZBA 1CXFA 4AGMA 2QPEB 3MMEA 3LH2H 4Z7UE 3KPQB 4PRDB 5CJ8A 1D3CA 4M61A 4JUTA 1SBSL 5EUKB 1KJMB 1EZUA 5B1BB 2EDJA 3FCTB 4E9VA 1S9VA 1VGEH 2P28B 1GCYA 1WF5A 1I7RA 1F90H 5SWSE 2Z6FA 3EOAA 1DE4A 1WBXB 3I6LE 2FRGP 3MV8E 1BZ7A 5EO0B 1M4KA 5ISZE 3QIWA 1XF2B 1JTTA 25C8L 4PBVC 1QLEB 4UAOB 5KN5B 4ISVB 3C5SB 5MENE 5HI5D 5F7LB 1QSFD 2WXFA 1ZVYA 3HE7C 2AJYL 4HC1A 5L2KD 3H55A 2D0GA 2V5SA 2OTPA 2VLKE 4HXAL 2AV7A 4OJDH 3JWOL 3Q1EA 4RMUA 4UV7L 3UTZB 3VXUA 1SEBA 1MELA 1L7TH 5D7LE 3FB6A 1U3HD 2F5AH 1QYGH 4ZNEE 4FP8L 1JF5A 3GMLA 1XB8A 5L8LB 5AVRB 3FULA 4Q0XH 2BP0A 4NLAA 5D4JA 5E6YA 5ESVB 1TYRA 4MA8H 1GY1A 5E9DB 1MCCA 3EH3B 4HP5A 1RK1A 1JV2B 5HJ3B 4O2FB 4FFZH 2VJXA 3UO1L 3QIBB 2K4WA 5AL8A 3FO1B 4R4NC 4G83A 3T08A 3F7VB 1XBRA 5TQ2L 2DQCH 4OZIA 1J1PH 2H6PA 1KIRB 2VW7A 1A3QA 2NY7L 2YWYA 3K8MA 3SDDC 1O9WA 4ELMB 5L9DH 3MLTB 4MQ7B 4JFOA 3P3YA 5D1QE 4GP5B 3T1FB 5TDPB 2P3YA 2WB1A 3A4FA 1QUNB 2R9HC 4GMSH 2P8PB 1FYTE 2F8OA 3KLAA 2IDCA 3TJEH 1DVTA 1HZHL 1JRHI 3MUGB 4PG2C 3GM8A 5E4EC 5E6IB 5BO0D 4ZMAT 2RA1A 5EZPA 4HU8A 3BIKA 1Z5YD 3FBQA 1F1GA 1PLAA 1TDQA 4FLHA 2XA8L 4I7ZC 3ZTNH 1Z9PA 5CHNB 2F5BH 2CJ3A 5DJ0A 1WA2X 1YY9C 5FEBA 3UBXI 2XWTB 5HDLA 1AJ7H 2Z4QA 1SY6L 3L5XL 3P69A 4X5PA 2DLFH 1ZLVH 3T3PB 1KELL 2IDTA 3GJFH 2PCPA 1I4FB 3MRDA 4PRHD 5C86A 3DX0A 4PJAF 2DH2A 2CH8A 3DV6A 4EIBA 5JHDD 2EDFA 2MQCA 3QE5A 1FA4A 1CIDA 5CCJA 3D69B 5HYJB 5DO2D 2R0ZL 3BH4A 4HUVA 2YBRA 1PF3A 1U33A 4LARL 1SHSA 3UZVB 4JQIH 4OJAA 5KANI 3HKFA 1N70A 5J9PB 5FUZH 2FJHB 5BOPA 2ZOLB 3LCYA 3O11B 2WZPD 3LY6A 3TBWB 4FLRA 1MSPA 5ICZA 3EFOB 4LHJB 2HPTA 5CFAA 1AQDB 4F7PA 2CDFA 2FSEB 1G7IB 2F54D 3ZR6A 3QDGD 3MQIA 5FA4A 3WFCL 1MFEL 2XV0A 3ES6B 1GYWA 4PU2A 3NJJA 5F7DB 5TE6L 3BEWB 2XX1A 1U95A 4GAJH 4M62H 4PJAE 4Q4IA 4Z95H 3L3OA 1J10A 3T04D 3UP6A 3V5KA 1YY8A 1Y18A 2MPAH 4JRYE 5E8OB 1BVLA 2OJZL 2HFGH 1Q0YH 4JQXC 1HH6B 5AG8A 4N85A 1A7PL 1E65A 4HGWB 2O26U 1FFPA 3DLQR 4PV9B 1OAXH 1OM9A 2GK0B 2A6DA 4PJDE 5B1KA 3PNWA 4I3RL 1NANI 1KIQB 5T3XL 4K7FA 3OKMA 1VHPA 5EU6E 3K8LA 3W9DA 3BEVB 3F62A 1N8ZB 3RIAF 3II1A 4XN7A 3BXNA 4YAQB 5FKPB 1AQHA 1T2QL 4K7PY 4MAUL 2MCG1 1V27A 5FK9A 4LSSL 1KBGL 3EXJA 3O2DA 1YQVH 2KMWA 3FN0L 3Q43A 4QKXB 3RDTA 3V9FA 3HR6A 2WBXA 3O3EA 1AZZC 5J4MA 1F00I 3QW9A 4JFEE 5FYLH 4UT6L 3BH8B 3AY4C 4L3CA 2YRBA 3S8FB 2YD7A 1D5XB 3CN4A 4U1IA 1RZKL 2DQHH 1A3LH 2XETA 3DIVA 3LKQB 4FI8A 3HTLX 3S37X 5BS0D 2WVVB 2GABA 5E1GA 3GPEA 1I1AA 1ZT4B 4H20L 4HCRH 4O2CA 1NCWH 2ETWA 2J5WA 2DMBA 1Q1JH 4YDKL 5DF0A 1KBBA 2DI8A 5J6HB 1FZJA 3H9SA 3KYNA 1CGWA 2FJGA 1RHFA 1OAZL 4M8UA 2G0LA 1P7QB 1KCRL 2AJXH 2LABA 4PB9L 3CN1A 5FAAA 2Q87A 4JCWA 4BELD 4AL8L 4MMZA 3ARDA 1YPZB 2JJSC 3PWVB 1BM3H 3N1PC 1AGEA 1QMUA 5C0NC 3AT8A 3AWEA 1Q9LA 1C1EH 1LO4L 1SFHA 3RUGA 3ZMEA 1CLZL 5IMLA 2IPUK 5I6XB 3DJSA 2XWEA 3R18A 4Y1AA 3AABA 1FBIL 2Z0BA 1LTXA 1T5XA 4M02A 3RJOA 2CRYA 1IC1A 3G5XB 4OKVA 2CK0L 3WDJA 4MXQC 4PJCB 5F72S 4Z77B 1EJFA 4OUOA 4AE0A 2X05A 3QQ3A 3I50L 3D50A 5F9WB 3T4YA 2ADFL 1CTOA 2OR9L 3APCA 3T65B 3U4EA 3NP3A 5FCUL 4N24A 4UDTB 4D8PB 4PMFA 4XPGL 3WTVA 3KLHC 3OAZK 4KRPD 1TO5A 1WAAE 2Z7WA 2F7PA 3MODL 3D39D 2I60L 2VXUL 4PJ7E 2CMRL 2NYYC 3UGEA 3P4NB 3MNVA 1G9EA 3II2A 4PJBB 2I07A 1HCZA 3ZXAC 4PBXA 3CXFA 4BZYA 1KXTA 3ARGC 1AYRA 3O3DA 4K94H 8CGTA 1T1WA 4ZOBA 1GZHC 3Q6GH 4XBGA 1E2ZA 4W6YB 2JJVA 5JO5B 2M83A 4BWWA 3QDMD 4G5ZL 3ZQ9A 3QZWB 2V4LA 4PWEA 5C2BL 4YGVB 1UD3A 4WW2A 4LOFA 4LT7A 2QADB 5DHXB 3P0YL 3R1GH 1MOEA 3H4HA 3CFDA 5F7EH 4WFFD 2HJLB 2DTML 5IR1B 1IAOB 5C0GA 2ZXEB 1IGYA 3QORC 1OW0A 3E7JA 3QJZA 4J3OD 1Z9SA 5I75B 1GW0A 1BGXL 5DSCA 2WK2A 3V0HA 5I6XC 1BVNT 5HPMA 1F8TL 1SMDA 3S5LB 2CM6A 3BJ91 2DV6A 6TAAA 4KHTL 1E4JA 3BN9D 4MA7L 3KJ4B 4I9WD 2AKRA 1WZLA 1GA2A 5A7BA 3BYYA 4O5LH 3X11A 3RBGA 1UEYA 5F9WC 4L9LB 3UG4A 4EZMA 5D55A 8FABB 1BLNB 1QSED 4OB5H 2VDMB 1G7HA 2QQNH 3T71A 4ZAKC 4MD0A 4RBPK 5KYUB 2AQPA 1U8HB 4KNQA 5DK2B 3NCYP 4L4JA 1W0WA 3UYOD 4Z7VE 1NCHA 1CDHA 2VAJA 1BQRA 2GT9A 2Y2WA 5AW4B 2J56A 4P4RA 4CDHA 1UKQA 3B3BA 1OGAD 3EJTA 2VW6A 3B9EA 3HNSL 1DDHB 3LN4A 3HZ3A 3DUHA 4X7CC 5EZOH 1XAUA 3D06A 3EJPA 1KC5L 1T1YB 4HOWA 2VRKA 3VD9A 3HRZC 1DVFD 1I3RA 1MCEA 3IJYA 3QXWA 5HGHA 3SQOL 1IKNA 3HMXA 4WNQB 3ZSTA 1SJXA 3UJIH 1MY5A 2XX0A 5CIPB 1EXHA 3A6CL 2EKSB 3BI9X 1MHEB 4I88A 4K71C 4MCNA 4MAYC 1JK8A 3QAQA 3MBXL 5FECA 1T20B 1T21A 3WSQH 4AV5A 1BFVH 1UH2A 1ZV5A 1U2CA 2ZKXA 1J5OH 1QQDB 2JCCA 1TSHA 4QRPE 2VABB 3KJ4C 1U30A 4XO3A 3I9PA 1VFMA 4MNQD 1FE8L 3FPXA 3MRFA 2VE6A 1SF5A 4F1ZA 2D0HA 2AXGB 3SDCA 1C16A 2A9NH 5IJKA 4L9LC 1VEOA 3MJ6A 3DVGB 3W38A 1J8KA 3C09C 3Q2LA 1U8CA 2Y5TA 5IQ9B 1YSOA 4UIKL 4L48A 3WIHA 1D5BA 4UM8B 3G5ZB 2WBJB 4RCAA 5CEZH 3U4KA 1HXYA 4QTIH 4WU7A 2Z8RA 5L88H 1RFDL 1GGIL 4HOZA 1OAQH 1V3JA 1M7DB 1ZE3C 1MHCB 1NC4A 3LIZL 43CAB 3OKNA 1TPXC 4ZXBC 2JJTA 1XD0A 2H0EA 5DFVD 4LKXB 4GRMA 1HE7A 5KSVB 2PO6B 2H41A 1N59B 4RQQA 3S4SA 5HI5C 1UZ8A 2N01B 1PZ5A 2VR4A 4JFFA 4PRHB 5JHAA 3CV5A 5LQBL 4OZIF 1AKJA 2OSLA 3LQMA 4GT7A 5CUSL 4JBSA 3FO9A 1RZFH 5GGTL 1JFHA 3FQTB 3L3IA 4HH8A 4N2NA 4WHDA 1SOQA 1U3HC 4N8CH 4K7PX 5E56A 1L9TA 2HTKD 2RQ8A 4GRWF 4I2XB 4U1NA 4PMEA 1J8HA 4ZW8A 1FN4A 7PCYA 4L1BA 2WUBL 3NPSC 4D0DB 3U1PA 1HEJC 3MZGB 4N2LA 2F54B 4G7SB 4WI0A 4XMPH 5E8EB 1GOHA 4FXGC 1YYML 3MBWA 5DJ2B 4XN8A 5IW1A 2AJVH 4KI5F 4X4XA 2G5BB 2ZUYA 4BWTA 4MKMA 3HLKA 2VR6A 5FUCE 4HFUL 4ZQTA 3HBQA 5EO1A 2Y9RT 1RIUL 3IJ9A 2FIKB 5JUEL 3GI8H 3KWXA 3APDA 4HPHA 5I30L 1T4KB 1QG3A 5IB5B 3SGKA 4F37K 3ENEA 3L4UA 4WHTA 4UNIA 4H5SB 3CFJA 5A16B 3VAEA 2VDPL 4GRWE 5DHVB 3TZVA 2OK0L 2OMVA 3S88H 3V0WH 3H3PL 3L4TA 5DD6B 1JYXA 2XRAH 3LX9A 5E8PB 4Z7NF 3W39B 4JO2H 3HS9A 4XMLH 2AK4A 3WFEL 3B5GA 3GXFA 4MS8D 1KB5L 4QUOA 2MNWA 4OIIH 2AMUA 1RJLB 2CJSA 4MZ2A 4PRPD 4DHLA 5I6NA 1A6PA 5IJVB 2I69A 3S34L 1T5KA 4N90E 1AFVH 1ML0A 3ZL4H 4GIPD 4IKJA 4ENEC 2Z4TA 3GSNB 1IB5A 3V0GA 5C0AE 3VI3A 4YHLL 5DO2C 1GZPB 4IJTA 3K72B 1JZ7A 4F1SA 3HC0A 2QHLA 1BF5A 1FFTB 3NZSA 4ZMTA 1QWNA 2AQ1A 2NT1A 3B7RL 3KYOA 3VWJD 4Z7NE 5I6LA 4OI8A 4NJ9H 4P5TD 4M5YH 4Q6KA 1SHXA 3SE8L 4YQXL 4KQ4H 3KH3A 1ACYL 2XV3A 5BS0B 4KNTA 3TWCH 3GMQB 3DRTB 1CE1H 4XTRD 2V37A 1OF2A 3L4VA 1P84K 2HN7B 3BKJH 2V9QA 4ZFOA 1Z9OA 5E9AA 4A7SA 1UM6H 3X3FH 3UPRA 5IHWA 32C2B 1Q1PA 1FH5H 4ZW5A 5DJXB 3VD4A 1TQBB 5IQ7H 3CQQA 4QRAA 4U1SA 1SDDB 3UYRH 4R26L 2ADGB 1CK0H 1FG2A 3N42F 2IH3A 3KYMB 2WCPA 1EHLL 3K2MC 4M6NH 3O45B 5CBAB 1EBAA 1URIA 4PI0A 4OR1A 3S0PA 3EYFA 1ZOXA 4HIJA 1ZVHA 5DC9B 5ADPL 1P1VA 3MCLH 2IGLA 1JWSA 1XIWA 3MLWL 1KCSL 1CYWA 2HFFA 4IM8A 2A9MH 4J2QA 2ZUUA 3KPPA 4NRXB 4U1KA 5HGBA 4WK0B 1G6RL 2ZG3A 4LPCA 1N2RB 5C08D 5J12B 2V5RA 1GYCA 5IVZB 3O81A 1A14L 1QBLL 1KB3A 5AW5B 4OUUB 4UQ9A 3LVEA 3EG9B 5CJXC 3TVMD 1AI1H 1AP2B 3D39B 3CSBA 3HPLA 3PRZA 2EYTA 5HD8D 3UMNA 4LF3A 4L1TA 5E1IA 3Q2CA 4IIQA 2A6IB 1K3IA 5DRXB 2H3KA 4PLOB 3QNXB 3AQYA 5KBDA 3ME0A 3O4LB 2YPLE 4GRWH 4HWUA 2IPKA 4IU2B 3RUGF 3VFOA 5IGXL 2X38A 3NPZB 5FF6B 1AO7B 2R0KH 1G9NL 4WO4A 2YD8A 1DN0A 5I1CL 3QDMB 3U46B 5HYSG 1YECH 3R06A 4QXGH 4X4ZA 1TYEB 4J6RH 1I8AA 5HYQA 3VRJA 4PWKA 3ARVA 1AY1H 3QUXA 3KLSA 1KJVB 1T03H 2D7NA 4NCC2 2OMNA 3IMSA 3QC5X 1BBDL 4XOBA 2J8UE 1WFJA 1IZJA 3OBAA 4APXA 3M07A 1JWMA 4GB9A 2Q3XA 4JVUA 2PXYD 3LHAA 4BEIA 4IS6A 3WBDA 4AGOA 4Y89A 2JIXB 5T1DH 2LGNA 3VGAB 4G6JH 5EPMA 3OPUA 2AJ3A 1IAIH 2DJSA 2BFVL 3US9A 3MRRA 5F7KC 1INQA 4K23L 2KDYA 1DCEA 4R7LA 3IMRA 1HHJB 1PZCA 1VPOL 1XSKA 2HUEA 3GC3A 5F9DC 1DQLL 4S0SD 1UJ3A 4XPBH 3U9UA 4Q9CA 4FQHA 4P8QA 1WS7A 4Y4FB 5J12C 1SBBA 1TU2A 1CE6A 4N5UA 1TNNA 1BQ5A 5KWYC 4YX2H 2ILLA 4BA8A 2CUHA 3SSGA 4WW2F 3MRLB 5CLZA 3SKMB 4F20A 2Z91A 3BH9A 4KRPC 4DEPB 4QXWA 5FYJE 4BRJA 3VRLE 2ZXCA 2F7OA 4ZUSA 3K6NA 1KDJA 1XH2A 1KMGA 4J8QA 2BY3A 3FT2B 4FXKA 1WT5A 4OLUL 3ZE2F 2VR3A 4HWZA 4N1EA 4XCNB 4Z6AT 3NFSH 1U3JA 2IH1A 2YSTA 4QTHB 2A5UA 5I1HL 3PPEA 2OMYA 3V5DA 4RSYA 3PPSA 5JORA 2H0FA 4LLWA 1JL8A 5F0PB 3ARUA 3VDBA 4NBZB 5JMOC 3QJFB 4NRYB 1DVFB 1KN4H 1HSBB 1XZ0A 5FYKE 4ALAL 4E9TA 5ANMA 4ZPTB 2IDFA 2ZYSA 2X88A 3GKZA 3MV01 4KKRA 4ZO7A 5AOKA 3NOIA 4HH9B 1UB5B 1RQ5A 5FO9B 4QLRA 1AQMA 1IBYA 1QX1A 4ODHL 4FQJH 1VACA 2VQUA 4NKMA 3QUZA 1KV3A 1TJIH 1W0VA 4YVUA 5L0QB 2VW4A 2EDHA 2ZX5A 5JQ6L 5AEAA 1TUPA 1OGTA 5TFSH 2FGWL 4F80A 1RSFA 3O2DH 4NQED 2OYMA 2EIMB 3NRPA 1NIBA 2D7MA 1I7UA 4GT0A 5GZND 5CAYB 1DEDA 3W57A 4OZHB 5DMKA 4X80L 3V4VB 1ASQA 4MNQB 3WXVL 2ENJA 4X7TA 2YA1A 3CIAA 1DFXA 4JFDA 2D3VA 4MQTB 3A6OA 4Z7WE 5E03A 4N1HB 4H8UA 4YPGB 1L4IA 4W6WB 3HE6A 1ZAGA 3WJLA 4EEEA 1HQRB 4WV1C 4DGUA 3RU8L 3S4SG 4LOUD 3AXLB 2DEWX 1FF5A 4PJIE 2JV6A 4NCC1 5IIEB 4KMLB 5I17B 4U1GC 1KT2A 2WTRB 3LN5A 4L4TA 2AEWA 1CDYA 3QG7L 4HUUB 3ZDWA 2A6KA 3OJMB 3FU3A 4KDTC 4PJGA 1ETZA 2NLJA 3SPIA 2V9UA 3HZKA 2JCCF 3M7OA 4LLUB 3EFFB 2VXSL 3U1SH 1T7XA 3TX4A 3V9CA 4Q9QL 2R27A 4LSUL 5DJYB 3PHOA 5BRZD 1PLGH 2LLNA 5KAQG 1GJWA 1Z3GL 2VLJE 3M17A 4TVPD 3T6VA 3KMDA 2WUCH 3O9WA 4N2HA 2R2EA 4LVHB 4OF7A 4Y4KC 2GHZA 5C92A 4BGDA 2YUWA 2Y6SD 2QQLH 4RMWA 4J1UB 2X0UA 1KOAA 5A2IH 1CFTB 4H88L 2W9DH 4APQC 4ZI8A 5L0QC 3UH8A 3LB6D 1S78D 5DUBB 2K8MA 2GCYB 5KBMA 5T1KA 2HKHH 2PPDA 3CFKA 3P0GB 5DRNA 2QSVA 4B9GA 2QDVA 1KLFA 5D1XD 2TSAA 1MUJB 4B97A 5FYJH 4OV5B 5CCKL 3CHOA 5D7HA 3P1VA 4I18C 2XKSA 1E6OH 4LEOB 3JTTB 4OD2B 2RCSH 5E2VL 2EUZA 1P2CA 4A55A 2E8ZA 1UT9A 4KK8D 5AUMB 2B9BA 3TL5A 1U9KA 3FUIA 1K2DA 2V17H 1UUNA 1R19A 4ZS7H 1XH3A 4WSJA 4NAQA 4FTVA 1CDCA 5E2TL 5FYKH 1PTZA 1IIIA 2WLIB 3FSAA 2QGCA 3EUUA 3OHXB 4JFZH 4XPAL 2KYIA 3UP1A 4JGNA 2XWBA 2J8OA 2ZSWB 1U21A 5KG9B 5JW4R 5CR1A 3HI6H 2WYTA 2WQWA 5BQ7A 2WXGA 3BVXA 5BVPH 1SM3L 2QELA 3BCFA 4OF8A 2YGQA 1KGJA 2FZ3B 4LLVA 3B8YA 1CN4A 2Z35A 3DK2A 3O6FA 4H25A 3CC1A 3NJKA 4PRPB 3A6BL 5A40E 5DFVC 2J4WH 2OXHB 1MZYA 3O6KL 5DZNA 1MF2H 5KAQF 3BAYA 4NX0A 4L8SA 3RKDD 5BV7C 3IFLL 1SVBA 2OTUB 5LKNA 5DJ8A 4JFFE 2Y1YA 2VC2H 2XQYK 4LVHC 4KO9A 3P4OA 5H35A 4AE1A 2HX8A 4S0HA 3BP4B 2YGOA 5IREA 4XP6H 3RTLA 3ARFA 1FNEB 2AEIT 3OKOB 2HTKC 5BVJA 2HKAA 3A23A 3VWJB 2FO8A 3J27A 3LVTA 5ECJE 3PLYA 2XJLA 2M26A 1I7TA 3E3QC 3HFFA 2OX5B 2EVGA 2X70A 1D7CA 2WLLA 4DVRH 3TEZA 4FCHA 1ZT7B 2P4AB 3INUL 4F9PA 1DR9A 5BUGA 1H3XA 2BOBB 4QTFA 4NUGL 5IWLC 3IGAA 2ADYA 1RPQA 2A9BA 3HAEB 4UILL 1H0DA 2W59A 2BK8A 3CN3A 1T7ZA 4MNHA 2PN5A 3G6JE 1R0AH 3IMWA 4OLZH 4TQIA 3P0VL 2OPCA 4G8AC 5K39A 5CD5C 5G5DA 4CILA 2OMUA 4X4MA 4XXWC 4X5XA 1JNNL 4ECNA 3E8UL 4KKCC 4DESA 5INCB 4PJEA 1WO2A 3VI3F 2XN1A 5C3IA 3VFNB 2BNRD 2F2HA 3HCVA 3HMXH 4NO5B 1UXWA 2PCFB 3ZKXB 4CUCA 4UB0L 4QF1B 3O0LA 1DQDL 4MS8C 1M9WA 1OANA 2AK4E 3TFKC 1A4JA 4MJJA 5DEFA 3VRIA 4K3DH 4P5KA 1LEIA 1DQVA 3GBNL 4DEWA 2HJKA 3VD7A 4PR5B 2W38A 2H32A 4I48B 4EBQH 4AW7A 2X4NB 3QO0A 5I1AA 2ODHA 4DCQA 4RFEB 3PP4H 1CLOL 2H26B 4G59C 4NGHH 4CN6A 3VI3E 2CQVA 2FQFA 1ZVNA 3TVMB 4OSUL 3FO2A 3T6XA 3DX6A 3I2CH 3B1TA 1HFUA 4WJKB 1WD9A 3CLEL 4P5TC 5J1TC 1OO2A 5DJDA 4XCYA 4E9WA 1TTRA 4ABVA 4ODTL 2O5XH 3WIHH 3SO3C 3LRLA 3SGJC 2OZNA 1MG3C 2VDLH 5C0EB 5MEQB 2E0PA 1PG7L 1UGNA 1QFHA 5FGBA 5E8NB 3SKOA 2VLME 4WWID 4KUZL 3VXOA 3EFDH 5I1EL 2ZPKL 1CQYA 1NEZA 1U8JA 1KG0A 2A1WH 3WKPA 1A2YB 4OCXH 5HHXH 5HDBB 3BPCA 3M46A 2XN0A 4HU2A 4NZRL 4WZ9A 1JGEB 4I3SH 3LQAC 2BRRH 2B7DT 3D34A 4GEJA 3IFOB 3OAYK 4BBWA 3DUUA 1N64H 3C60A 1FO0B 4JZNA 1XH0A 1AR2A 1TYJA 4LB8A 4I89A 5F3HB 4ZQKA 5FA3B 2PUQT 2N1KA 5BW7C 2VERN 3JZYA 1M71B 4XXDB 2B39A 4OZ4A 3RJQB 1IARB 4F7MA 2V3EA 2FWSA 3DTUB 3QHTC 3OWRA 1JDAA 1L9QA 1MFBH 2BSDA 3H42L 5C09D 1P4UA 5D71L 1E28A 1LWHA 1U91B 2A77H 3SE3C 3TC9A 1T3FA 4G80A 2P9RA 3CXHK 3D2TA 4YDVA 2KZWA 2KUTA 5DWUL 4P23D 1KLUB 3BVNA 4W9FC 3MCYA 2WAQA 2X10A 4FLQA 5F1NA 1A7OL 3RWJB 4GQRA 4KDVA 3VTMA 3MOAL 5AYTA 3VE0B 5JDSA 4EMZA 4DF9A 2CO7A 4R5VA 3C5ZA 2AJUH 1XEUA 3DUSB 3OLIA 1YYLL 4XC3H 1JUFB 1A6ZA 4K3EL 4UM9A 2EDBA 5JPMA 2JK5B 2QLYA 3WUWA 2CIIA 1LM8V 4FFYL 3L16A 1NGWB 5K9OA 4G43A 4FLOA 5AVWB 3KW7A 4LNRB 5EDXA 5IMOA 1BAGA 4YHZH 4E9YA 1X4ZA 1ZT1A 3KPNB 3NFNA 2NNFA 2YO3A 3HIZA 3W0WD 3L3DA 3FBKA 5IY5B 4QRRA 3IF1A 4KQ3L 5DEGA 2ZD0A 3JV4B 3FTGB 4JVPA 5C0DB 3KL5A 2PW1B 5FR3A 5A2BA 4NQSB 3VXSD 2QVIA 3IETA 1K4DA 3QUYA 1UURA 1JHKH 2YSSB 2ITFA 3PJSA 1J0YA 3N91A 3DX9A 1VAHA 5AVYB 3D2UA 2PXYC 1A6WL 3NCJH 1KJ3H 2R4RH 4UYPA 4Z78B 4P48A 2PPCA 2X1PA 1U92B 4N2IA 4NQEB 1QFPA 5F89B 4HUMB 4JL1A 3NVQA 4KXZI 3BDBA 4HGKC 5LBSL 2KI6A 1Q0XL 3JWOC 3VFPB 5ETUA 5D2LB 3SEPA 3WL9B 5F6IC 1U42A 3ESVF 5KBLA 2CDEB 3SDXB 5D6DA 4IJ3B 4L8BA 5TPWH 4ONHA 3SJVD 3X1GA 3H7BB 3DDGA 3N50A 5DQDH 3FSWA 4MTMA 3P4LA 1A5FH 2QMKA 2I5YH 5FYJU 4GAGH 4M5ZH 4YFLI 1KENL 3U48A 4Z3HA 4JQVC 5GRVL 1ND0B 2X4TA 3VU2A 5GJTH 1MEXL 2HLEB 3HE7A 4BK5C 3TYGH 1X4XA 4L0YA 5DWPA 4DW2L 5A6LA 3RWIB 5LN4A 1J7VR 3O4OB 3E6HA 4QT5A 1QRND 2IBBA 3PU7A 1PAMA 3HG1E 3OMAB 5DS8B 3FRUB 1ZJBA 4AQ8A 3DETD 1C5DB 4ZSOA 1KY6A 4JR9L 3BUDA 3FZUD 2Y7QB 4I0PA 3X13B 1EEZB 1CFVL 2R39A 3S96A 1NOAA 2PWDA 1W0YT 2X6AA 3ARRA 3UAFA 2IMNA 4OT1L 4J8RB 4BGLA 4NERA 4KNSA 2RGSA 5EZJA 1HINL 4QRUB 4JKPL 1IC5H 1F58L 3L6FA 3T77B 5CBEB 1TMCB 1XGYH 1A3RL 4QHKJ 2HUHA 1GOFA 3KPQA 4PRDA 2LU4A 3DBXB 4N68A 2ZXGA 4GQ9L 4H44C 4QJ3B 1B9KA 3RB7A 5I18L 4OFYD 5L6YL 5EUKA 4NLHA 1KJMA 2AFNA 4R4FL 4ZK8A 1YMMD 1IQDB 4PJGF 3FCTA 3S8GB 5B21A 3BUPA 1UWYA 1SMAA 5F1OB 4AEHL 3HNVH 4JFDE 2AXWA 1JERA 3EDJA 4RRPM 1WBXA 5TF0A 1BYNA 4RMRA 2HKFH 5EO0A 3M45A 1XF2A 1MREL 2APXA 1LK2B 4ZUWB 4IDJH 5K59F 5KN5A 3RPKA 4U2YA 4ISVA 2FTAA 3C5SA 4WFED 1C7TA 2L7JA 3AB0C 3K0YA 3PDDA 2DB8A 2IDQA 5C0JB 2UZIL 1URZA 3HMWH 3LXBA 3UTZA 4CN4A 3O4OC 3PUCA 3SKJH 4L4TE 2OR7A 5SV3A 3THMH 1DQJA 5J1SC 5CF3A 3N85H 3CX5K 3T0ED 5FKAB 3H6JA 4OCRH 5LB1A 4PTUB 1MPAH 1OT1A 1IFRA 1QFOA 3FQWB 3F83A 3MBEB 4G5AA 5ESVA 4AQEB 4WWKD 2JI3A 5E9DA 1JMXA 2C3GA 5BCAA 1JV2A 5CZVL 4D9QD 5HJ3A 2GTZB 2AMGA 2X6UA 2Y6SC 3QIBA 3T2PA 3FO1A 1NGQL 3F7VA 1G7QB 2ZF8A 1KIRA 5K59E 5IKCB 5I9QC 4DAGL 3RL1A 3KJ6L 2EIKB 4H8PA 3CN0A 3MLTA 4MQ7A 4AK1A 1DJXA 2HRLA 1KCUH 1EDQA 1A9VA 4TTGA 4HS8H 5D1XC 3T1FA 5TDPA 3RX5A 4OIAA 1AD0B 1QUNA 5AAMA 1LD9B 1JYNA 3PAVA 1NFAA 4YS4A 1EVTC 2P8PA 3MUGA 5F8QC 5C3LD 4I0CC 5E6IA 3RWEB 2J73A 1DJHA 3QSKB 4KVNH 2DL9A 2ENSA 3QUMB 4KK8C 1D9KB 3X3GL 2H47C 1WVZA 12E8H 4XNXH 1XCWA 3L2MA 3IU4L 5CHNA 2NY1B 4K9EC 4G6FD 4GO9A 5EULV 1P7BA 1RZKC 2NNRA 3ARBD 2EDEA 1G5GA 5I1GL 5IT2H 2XWTA 1LE5B 3GHEH 1TETH 4S1DD 1EZSA 1ZV2A 3RB5A 1OM3H 2D7OA 4PJFB 1I4FA 1X5YA 2QDWA 2VISB 1NZRA 1XL4A 4Y7OC 2OI9C 1H3GA 4XRCB 4Y9CA 4JRLA 3BCDA 3D69A 1SQMA 1MNUL 1RVFH 5HYJA 1UWEL 3EBIA 4JHZA 2DI7A 3VQLA 1B2WH 2VDQH 3IS0X 3UZVA 1PQZB 2QQKH 2Y6TE 4W70A 5J9PA 2FJHA 2Z7ZA 4H0GA 2ZOLA 5E00B 3AY4A 3O11A 3RKDC 3RIKA 1QFWM 1OE3A 2PYFB 2VH5H 2W07B 3TBWA 3EFOA 3OR7B 1BA9A 4JEGB 1AQDA 1G7IA 2FSEA 1B6UA 1NAMB 3ES6A 1OD7A 1XMEB 2VR5A 4JANB 4XB3A 5F7DA 4Y19E 4XXCA 3BEWA 1BM7A 5KSBB 1B0GA 3DX2A 1A8ZA 1NEZG 4PJEF 2FQEA 5E2WH 3QQDB 4R83A 5F9JB 5AZUA 5E8OA 3MACL 4UTAL 2I27N 4HXBL 2Q8AH 5DVLA 1HH6A 1RH8A 4JFHD 1M7XA 1NFDA 1BF2A 4FMVA 4HGWA 4LSQH 4OFPA 1CWVA 4PV9A 4K7PH 3G5VB 2JJSA 1MG2C 2GK0A 3MRGB 3OPZH 4NC0B 4ZTPH 2IFFL 4DGVL 2P43B 4JHWH 4ODUB 4YOKA 1UWXH 3VX0A 2NTFB 1N68A 3BEVA 4N0YL 1A7QH 1N8ZA 3F7YB 3OLGA 4HSQA 1RERA 1ZEAH 4M7JH 5FHAH 3QUGA 4YAQA 5FKPA 3Q13A 3FC8A 4IBUA 1CDBA 2R23B 2QKSA 1IC7L 3GSUB 3B2DC 1A6UH 1HOEA 2ERJC 3IBOA 5EFIB 4U7KA 1BVKB 4XX1E 5FV2A 1FGVH 4WEEA 4CVXB 2K3HA 3WY3A 5B22A 1FC1A 4R8WH 1GSMA 3B83A 2V2TB 3BH8A 1OP5H 5HHQB 5F6HJ 3WUWG 1WUNT 1PZSA 1Y6NR 1X3DA 3K3QA 1D5XA 4N9GA 4P23B 4OJCA 4ZFGH 3LKQA 4XZUA 3ASNB 3NZ8B 4BFRA 1R3KB 1GZHA 2KLRA 2WVVA 3QIUC 3EO9L 4Q2ZB 4NKQB 1ZT4A 2EO9A 1OCRB 2WN3A 1OAJA 3IDJB 5KVEL 5J6HA 1CGUA 4BH7B 1UD4A 4BXSV 3K6DA 1E4XL 1EJOL 1P7QA 5D96C 4ZDHB 2VXTL 1HIMH 1CTMA 3LKNB 3M8OH 2R1XB 1F45A 3HNTL 3W0WB 5D93B 3VFGH 1YPZA 3PWVA 3HB3B 2XV6B 3IYLW 5DUML 4ZX4A 4LVOC 3VXSB 2BVUA 1RZPA 2CHXA 3BDYL 4XCCH 3Q5YA 4WENB 4YZFF 5T3XE 1JZ5A 3DXAD 2IPTH 2DQJL 4P5MB 1H8SA 1Z2KA 3ILDA 3IXAB 1FVEB 3WY1A 2AJSH 4PJCA 4NM8L 3UTTE 2FD6H 2MPVA 4UU9B 3IXTB 3LPPA 5T1LD 5BO1H 1YEJL 5DQ9B 3TA3B 3F05A 3MLSH 2BNQD 3T65A 4YK4C 5JIHA 1O6SB 1PIFA 2OMXB 4UDTA 4D8PA 4P05A 43C9B 5TQ2H 5A6MA 3WEBA 2BZCA 2E7LC 3GKWH 2PWGA 4ODSL 4OCYL 5AAWC 4RRPA 3MLPA 2BP3A 1QBMH 3P4NA 3WFZA 4PJBA 3IAQA 1AS6A 4P23C 3SJVB 2OP4H 2NZ1A 4Z9KB 3LS4H 4GS7C 5E2UL 3C2SA 2MKWA 2VN7A 3QEQD 1VCBC 5HP5A 1U8IB 5JO5A 2YXMA 1YJDL 5H94B 3QZWA 3HRZA 4YGVA 3C8HA 1SUHA 2B1HL 5C6TH 1QZNA 4JHAL 2FGZA 3DECA 4XNQB 4R7NB 2VUYA 1CDJA 5DA0B 4IRSC 2HJLA 3CG8A 3GI9H 3MV9B 2WLHA 4OLWL 5IMMB 3LH9A 5D93C 1GSKA 5KVDL 3V6OC 1BJ1J 4FFTA 1P4LB 2OKMA 4NUPA 1AG0A 3ZO0A 4KVCL 1DL7H 4ADIA 2R0WH 2IMMA 2WZAA 2X41A 4AIXA 2WZ5A 2WO2B 2YKLH 3RGVD 3S5LA 4PB0L 2JLPA 5GGVY 5CGBA 4D3CL 1WQVT 2GPZA 3HC4L 4QOKE 4QI3A 4TUOB 1TKWA 3WIAA 5CU9A 1PG7X 1VRSA 1GR7A 4P9HH 5FO2A 4Y1TA 2ZCLH 3M1OA 1L9RA 5KJRH 3VVVA 1A1MB 2H32H 2LAGB 4KK9D 2F8IA 5F1IB 1U36A 5FGCB 3SY6A 5GHWL 4A2DA 4N8UA 4L9LA 4I87A 3ZSSA 1SEQL 4KTEH 4DEUA 1CF8L 5D7JD 1BLNA 4M4PA 3VTTA 3CMGA 5KYUA 1PY9A 1U8HA 5DK2A 3SOBH 2B15A 2JKXA 1U8OB 1P84J 3L95B 1YMMB 1OPGH 2IAMD 1B0WA 2FLBT 3G9VA 1U4FA 2BC4B 3TH3T 1TNMA 2LFEA 2QVMA 2WNWA 4TQEH 1DDHA 4HJIA 4URKA 3NIFB 4QHUB 2K6YA 2GSGB 2BVQB 5D4QA