1OE1A

Atomic resolution structure of the wildtype native nitrite reductase from alcaligenes xylosoxidans
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
336
structure length
336
Chain Sequence
EDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of Native Copper Nitrite Reductase from Alcaligenes Xylosoxidans and the Active Site Mutant Asp92Glu
pubmed doi rcsb
molecule tags Reductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 94
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe1A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe1A02
2BO0A 2FWLB 4K9JA 2MTAA 2QDWA 3TA4D 2AZUA 3FQ2A 1HAUA 2GC7C 1AG0A 3H4HA 1GYCA 1QNIA 3CVCA 3UAAA 2CJ3A 4F2FA 2OJ1A 3T6VA 1IKOP 1ET5A 3WIAA 2HX9A 1VLXA 5A7EA 2UXTA 3S3CB 1RZQA 3QJRB 1W6LA 6PCYA 4G71B 4FAAB 1OCOB 4M4RB 1HAWA 1L9PA 1AACA 4DPAX 1A3ZA 2H47C 3CZUB 1SFDA 2ZWNA 2YAOA 2FQGA 4HHWA 1JXGA 3OQRA 3FYIB 3G5WA 5D4HA 2JFCA 2CBPA 5B1JA 1QLEB 4G7SB 4N4YB 3WNJA 2DY2A 2FJSA 3FYEB 3S3BB 1NIEA 3WNIA 3T6XA 5B1BB 1BQKA 1ASPA 4HCGA 1BQ5A 2JKWA 2XU9A 3FSAA 2YXVA 1ADWA 3TBBA 1M56B 1PZCA 1KV7A 2YAQA 4KO5A 2CUAA 3NJJA 2IAAC 1DYZA 1JVOA 2WO3B 2GBAA 3X1EA 4BWTA 2Y1AA 3FU8A 1BYPA 2BZCA 1AANA 1N70A 2GSMB 1GS7A 5B1JC 3UAEA 2UXFA 2PPEA 4GP8B 4DPBX 3EHBB 3AW5A 3SQRA 3CDZB 5TK4A 1R1CA 3QPKA 4RH4A 3HB3B 1M57B 1PNDA 2EIKB 2Y69B 3V9EA 2YAPA 3WG7B 2VN3A 5AFAA 2FT6A 2XXGA 2UXGA 2VM3A 7PAZA 1CUOA 2XX1A 3BVDB 2IWEA 2XLLA 5AKRA 5E9NA 2FNWA 3X1NA 2H5UA 1QHQA 3EF4A 2HLEB 1WA1X 2UX6A 1TKWA 3MX0B 3FQ1A 1L9QA 4DP1X 1OE2A 5PCYA 1ZIBA 4BWUA 5I5JA 1WS7A 1KYAA 1SDDA 1ASOA 2P80A 2IH9A 1ILSA 4DP9X 2AZAA 2BWDA 1TEFA 2HX7A 4A2HA 1RCYA 1ID2A 2OV0A 2QPDB 2ZXWB 4Q89A 1N68A 1BEXA 1NPJA 1W8EA 3AY2A 3S3DB 2PPDA 4YSRA 3RYMA 4KOBA 3X2QB 3T9WA 2EINB 1PLCA 3IE9A 1B3IA 4E9RA 1CYWA 1AS8A 1KDIA 3OMNB 1A4BA 4W1TA 3ZBMA 2GHZA 3IN0A 1AS6A 4A68A 3T71A 2AVFA 1JERA 2Q5BA 3S8FB 2NRDA 5B1KA 2LLNA 4G70B 3NJIA 5I6PA 3X1BA 4AZUA 1AQ8A 3CVBA 1A8ZA 4PCYA 3CDZA 2VMJA 1NZRA 5ANHA 3FPYA 5B7MA 2EILB 3GXUB 3PCYA 1T5KA 3N2JA 3WKPA 1E5ZA 1XB6A 1E30A 2FTAA 4ENZA 2BP8B 3C75A 2QT6A 4AKPA 2ZONA 2IWFA 4PAZA 2CAKA 4L0PB 2X87A 4UAHA 4N8UA 4QLWA 2VSKB 1JOIA 4BDVB 4JHVA 1GR7A 4EF3A 1BXUA 1NIDA 2BW4A 3AG4B 4TXVB 3TASA 4AKOA 5TK2A 2FT8A 1BYOA 2QPEB 1ZPUA 2ZOOA 1OE1A 1V54B 1ZDQA 2E86A 2XX0A 2IDFA 2IDTA 4KO6A 4F7KA 5I5MA 3PAZA 4GXFA 2GI0A 4YSPA 5I6MA 4HCIA 2HX8A 4BK5C 1FA4A 1SJMA 3FPXA 1JXFA 1AZRA 2IDQA 3ZIYA 1KBWA 2GC4C 3NSDA 4HZ1A 5EHFA 1AZBA 1SHXA 4Q8BA 6PAZA 1DZ0A 2HRGA 7PCYA 5I26A 3ASOB 1SF3A 3IEAA 1ZDSA 3H56A 5B1AB 5FC9A 4E9XA 1JZJA 3QJQB 1GS6X 1J9QA 1KBVA 4KOCA 2XWZA 4E9TA 4E9QA 1PY0A 2A3TA 3ZX1A 2TSAA 3WI9A 4DP2X 3IN2A 1CYXA 1MG3C 1AR1B 3S8GB 3FT0A 3JT2A 2PLTA 2HRHA 1OV8A 2IDUA 2VSMB 4DP4X 2VW6A 3ABKB 4YVNA 4A2GA 5I5IA 4E9VA 2UXVA 5I6KA 3QJUB 3DKHA 3GYRA 3NJKA 4YSSA 9PCYA 1NWOA 4G7RB 3NJFA 3CG8A 3NSFA 1MDAA 1GS8A 4DP5X 3CVDA 2AANA 2YAEA 2FQEA 1AZUA 2PPAA 2IWKA 1NIFA 1RKRA 2P80D 2WSDA 4NB7A 1JVLA 4KNTA 3AG1B 1ETJA 2UX7A 2BZ7A 2YARA 2PCFA 4HHGA 1BAWA 1OCCB 3EH3B 4P5SA 3DTUB 1EHKB 5F7BA 4BXSV 4KNUA 4BDVA 1GY2A 1MG2C 1L9SA 1AOZA 1ET7A 2XV3A 1GW0A 1IUZA 2BP8A 1J5CA 1MZZA 2RACA 2DYSB 1XB8A 3NJGA 4DP7X 2XV2A 3FU7A 1XMEB 2PCYA 1JZFA 2I7OA 3NJHA 4YSOA 1KCBA 2YXWA 2IH8A 4GY4A 2IDSA 1IC0A 4KNSA 3IBOA 1BQRA 3SBQA 3UACA 1GY1A 4A67A 2VW7A 2XUWA 4YVUA 4DP6X 4YSTA 1ET8A 4HALA 1TEGA 2JXMA 1FFTB 5B3SB 4FA7B 4AKQA 4YSAA 2YAFA 1WA2X 4E9SA 1HFUA 4MFHA 1NPNA 1OCRB 3QQXA 4HAKA 1ZIAA 1A4AA 2YAHA 2I7SA 2DWSA 4HCFA 3X1GA 2DV6A 5PAZA 1MZYA 4E9YA 1ILUA 4F2EA 4G72B 4QKTA 1J9RA 1IBZA 3FU9A 1SFHA 3X1FA 3OD3A 1XB3A 5I6LA 2DYRB 4W9ZA 5I28A 3WKQA 3EH5B 4KO7A 4YL4A 5D4IA 1EZLA 1BXVA 1WA0X 1FWXA 4X4KA 2Q9OA 4NAJA 4BXVA 2BHFA 3KW7A 4GP4B 4AI7A 2R7EA 2CALA 3UADA 1AZCA 3FSWA 2OCCB 1UATA 2GIMA 3NP3A 4E9WA 1JZIA 3ABMB 1NDTA 1W6WA 3TU6A 2PP9A 3TBCA 1V55B 3FU7B 1SNRA 3DIVA 4M3HA 1ASQA 3NSYA 4GP5B 5B7EA 1TU2A 1WAEA 3FS9A 1J9TA 2EIJB 3ASNB 4WTQA 2QDVA 1NTDA 1NIBA 2N0MA 1V10A 4DP8X 1GSKA 4A2DA 1OF0A 4BWWA 3FSVA 3T6WA 2WO2B 2BP0A 4A66A 4YSUA 1L9TA 1AAJA 3PLYA 2B08A 2XVBA 4HIPA 3NYKA 2MRYA 1OE3A 1E5YA 2CCWA 3SBPA 4YSDA 5IY5B 1NWPA 2BWIA 1JXDA 2FQFA 3QJVB 4YSCA 3NSCA 2VM4A 3KW8A 4G7QB 3PPSA 1NIAA 1CC3A 5I6OA 1NINA 1ZV2A 2PPFA 1E65A 1PAZA 3NP4A 3NT0A 1PLBA 4GYBA 2DWTA 2R7EB 5LDUA 3AG2B 5AZUA 1KDJA 3PXLA 1AS7A 1J5DA 1SF5A 1SHWA 1L9RA 4WKXA 1URIA 1JZGA 3OMAB 1A4CA 3ERXA 3V9CA 1JZEA 3FQYA 1PF3A 2HXAA 3N55A 2J5WA 3MBWB 2PP8A 3AG3B 1OOWA 2XYBA 3L45A 5F7AA 1KCWA 1PZAA 2W8CA 4UF7C 1X9UA 3ABGA 2YQBA 1JZHA 2J57A 4AX3A 1L9OA 4P5RA 5D4JA 3AZUA 4JKNA 1WS8A 1PNCA 4ZK8A 2YAMA 4CSZA 2XXFA 2H3XC 3BQVA 2FQDA 2TSBA 2EIMB 3EH4B 3UGEA 1PMYA 4CSPA 3H4FA 2W88A 4DP0X 1YLBB 4YSQA 2XV0A 1F56A 1E67A 2X88A 5B7FA 3JTBA 1X9RA 4A2FA 3NJMA 4JHUA 2BP0B 2PPCA 2AFNA 1PZBA 3U25A 1CURA 3OM3B 2J56A 4KO9A 3QJSB 1J9SA 3UABA 2I85A 1IBYA 3ZDWA 4DPCX 2BW5A 1SDDB 3D12B 3T6ZA 3PAUA 2B3IA 4YSEA 1NICA 1AZNA 1RZPA 5I6NA 1KGYE 1OCZB 1AG6A 2HZHA 2VW4A 2J55A 3FSZA 2PP7A 4UANA 3OMIB 2GB2A 3HEIB 1M9WA 3SBRA 1I53A 3NJNA 3GDCA 3PAVA 4A2EA 3NJLA 4NERA 1AIZA 2FT7A 3QJTB 3ABLB 8PAZA 1PCSA 1A65A 1BXAA 1PLAA
chains in the Genus database with same CATH superfamily
2D4DA 2NY2C 3MUJA 4L0ZA 3DUSA 4HU8A 1PJWA 5T1JA 4PP1D 4UTAA 5IESH 3AUWB 3EO0A 1BREA 1KJ2H 3H4HA 3VFMA 2WSKA 4BBWA 3TBVB 2AEOA 4JFVA 1MDTA 3TIEB 5K59F 1KACB 1OSZA 1M05B 2CIKB 3RU8L 4L3EB 2AI0L 2OP4L 5EOQL 3VFNA 4NO0D 4ZAKD 5C07E 1W91A 4OD2A 5IJKC 2BLFA 2BOCA 3FFCE 2NXZB 4FLHA 4DZ8A 3TVMC 1W6LA 5FW7A 4G71B 1D5XB 4WTXA 2BNQB 4OJYA 3IMBA 4DGIL 1UOKA 4HIXH 1ZA6B 3F7RA 3G5WA 5F9JA 3ULVH 2AI0H 2OP4H 3ECVA 5EOQH 2HT3C 4BZ2A 3GSNB 4PGZA 2VMEA 4EI6B 2DL9A 5AAPA 4LXFA 4F7TB 5L2JB 2V2TB 3R7QA 1K72A 3DOSB 4YK4C 1UJ3A 4H1LB 5D93C 2Z7WA 5HGBA 3RZCA 1GAFL 1A22B 2DIAA 4K8RH 2BP3A 2PR4H 4EZJA 2FX8H 2BH0A 3GINA 1FH2A 1LHZA 3HTLX 4N24A 4BFKA 1MFDH 2K4WA 2X40A 2B1OA 3FFDB 1XSOA 4XB7A 3A22A 5IBUB 3TBBA 3WSQL 4BFOA 5IVXB 3P3TA 3VG9C 5GS0H 2BOBB 4ZUUA 1UWGH 4JLRB 5FV2A 4JO1L 1N7ML 4C83B 1AZVA 2VL4A 2IPKB 4JGUA 1AANA 2C9PA 3VFNB 1X6NA 2UXFA 4BGDA 1SBBA 4PJ5E 3SGDH 3ECWA 2J2ZA 3GNML 3QWRA 3CH8A 3ULSB 1K8DA 3IGAA 3KBFA 5E6SB 3VNZA 2AK4B 5I1AA 1CDBA 1YEGL 3LKPB 1O7DE 2ZUXA 4P3DA 5E2UL 3RUGA 5JOEA 1OP4A 5DVMA 1V05A 5AWNL 2JQMA 3W0WE 2GIXA 5C9KA 4G1MB 2FLRT 3C5XA 1EUTA 5D7JB 3IJ7A 1LVEA 1W0VB 2HH0H 4Y2OA 2H5UA 2L4OA 4MASA 2NT1A 1WYJA 1UA7A 1WUNT 1H8LA 3OPZL 4XCFL 3L1GA 5CZXD 1CLZH 4JY5L 3FT3B 3UYRH 1EFQA 1PD0A 2WK2A 3WJLA 4QRUA 4D9LL 4HPYH 4JY4A 3FQRA 1URZA 4R83A 2J1ZA 3V5DA 4JDEB 5G55A 3RJDA 4ZDHB 3U36B 4FQ2L 5KVFH 5CCGE 4FULA 5SWZD 2F58L 3ATBA 5C0EA 4EZLA 3HUJF 4HXAH 4MLIA 1GKEA 1KXQE 4NN7C 3QXAA 1F45A 5IUSA 4LCIL 3RNKB 2A9MH 3AY2A 5H4ZA 4RZKA 3GMPB 4ZS6D 4KOBA 3X2QB 3KPLA 4LASH 1ORQB 2YGQA 5D7LB 3U1PA 4ZXBA 4ETQB 5KSAC 1NUFA 3R0MA 1L4IA 5EA0H 1M1XA 2VC2H 4NZRL 3VH8B 5IMOA 3JYCA 4AV5A 3R06B 2E46A 2RFXB 3HHMA 4EN3B 3LKQA 1U3ZA 4Z0BL 4CVZB 2XY1A 3I3EA 4FTVD 1SLXA 4QXGL 4U1LB 1OQXA 5C0BA 2VMJA 1JGUH 1HHIA 5CO1A 1KENL 1U91B 2BSED 4EIGB 4YHLL 1PYWA 3IU3A 1OTTC 3FPYA 3V6FA 4CMMB 3GXUB 3R06A 2YS4A 2F58H 4MD4B 5EDSA 3FMGH 4HK0B 1U95A 1ZV9A 3WJJA 2YPVH 3H3PL 3TURA 2WUCH 5HYSG 2VUOA 1CT8A 4PJ5A 4YHNA 4MQ7A 4IOFD 5CEZH 5CLXA 3QQ9D 3ARRA 5D7LA 4HIEB 4MRCA 4ZXBB 3U1QA 4QLWA 5BUGA 1JOIA 2W9DH 4G42A 5CJ8A 2J8UF 2CZNA 1YNTA 2QV2A 3U9UB 5L88H 3B4NA 5C6TL 1C16A 1UOVA 1X4YA 4DGYH 5I71C 1FG9C 3MROB 3QA3A 3V6OC 4OGYL 3U9PL 1XH1A 4U1GB 2JB5H 1S9KC 2DBLH 4TPRL 4LDLB 1T22B 4UBDC 1YZZA 3GBMH 5C9JB 5L8KB 1FGNL 3F7PC 5EHFA 1DZ0A 2D4FA 4DETA 5GZOD 5KAQF 1HDMB 3PS6A 4OH2A 2Y6TE 4WI0A 4JFQA 4X7SH 3U0TB 1JZJA 5HI4C 4IMLA 4WI9A 4URKA 3L6FA 3TP4A 4ABWA 1XCQA 5F6HI 4KOCA 4M1GH 3WXWH 3KAAA 3WI9A 1ULVA 1SJEA 3CCHA 4Y7OC 4QHNB 4NKIH 5BJTB 3ARFD 5FUZH 2IDUA 2BY2A 4FEMA 5FW8A 3HLKA 5E8EB 1P7HL 2WXQA 3GEWB 4JM2C 4FQJL 1FNSL 1MFAL 5GS1B 2PETA 3B5HA 2WBJC 4M00A 5DTFA 1P7KA 1C8QA 2H0FA 4FNUA 1D2PA 4NN6C 4MJ6A 4XCNB 3ZE1F 1IL1A 3QORC 1UD2A 2NY5C 4IRSD 2J8UE 5H8DA 3T3MB 3QA3B 3R8BB 1OT2A 1KGWA 5CD3B 3BT0A 4NRXA 3ZKMC 3PHSA 2E7LC 4X98B 2WBKA 4GMTL 1T22A 3NK4A 5JXEA 4HHGA 5HYSB 4R3SA 4FNPA 4HGMA 5HYFA 3IFLH 2H4EA 4OKVA 5JIKA 1OW0A 5FECA 1YEEH 3MKGA 4NCC2 2YD5A 1GW0A 1IILE 2BP8A 3GIVB 3N40F 1BBDL 3PP4L 4WWKB 2RACA 2ADGA 5D1ZC 4M8QB 5GRVL 1FJ1A 3C6LA 2QGCA 1U58B 3QNYA 4PJ7F 2GW5A 5EBLA 1JPGB 3S37X 2MIZA 4XX5A 1SJEB 2Q2LA 3CCHB 5J1AB 3CC5B 2YPKB 4MA3A 3DSNB 4NJ9H 1JF5A 1ZGLB 1SOXA 4B41A 2LABA 2YLHA 2Q6WA 1HWHB 1OGAB 3AY4A 2R0WL 1I1RA 4A67A 1HXKA 2XUWA 4KPHL 1QLFB 5GJSL 5DUBB 2BOBA 1I82A 3MRQB 2JF1A 4E9SA 3W11D 4A2LA 3CFJA 1P7QA 5GHWH 3D39D 3H2WA 1CBVL 1HXYA 1T0PB 1SLWA 1AD9A 3B3BA 2ERJB 4GLRI 3H53A 2ZX6A 3LZFL 4NJ9L 1MCKA 2X4UA 1UWGL 4Y4FC 2ZOTA 2Y06H 5D70H 3SYOA 1CK0H 1F97A 3NBNA 2AJYH 4L8BB 1ZWIA 5GS0C 1CO1A 2AJVH 3VRIB 3U0WL 1KIPB 2DL2A 2WO4A 4ODXB 3UG5A 1CL7I 4PWGA 3TPUB 1XGQA 3OJVC 3E38A 4JFYA 1QSEB 2Y72A 1U8HA 4NLAA 5BOJA 2HFFA 4JW3A 4MJIA 5ERWA 3ZE0F 3GSWA 4G7VL 4G9FB 5E9DA 1EHLL 1Y0LA 3H9SA 4YO0B 4BQ9A 4PBVC 4R96A 3O6FB 1KJMB 4YDZA 3ULUL 3S2CA 2FGZA 3GM8A 1JZIA 1M3IA 5FKPB 3TU6A 3KJ4C 1T1WB 2XTSA 3RWJA 3SGKA 1SY6A 3OTTA 4M3HA 3NSYA 2OPCA 4I0PD 1A5FH 5ANMA 1KC5L 1I7TA 5DD6A 4DP8X 3FTYA 4P46B 3UO1H 5DMKB 4MJ4A 3ZPDA 3KLHD 1RK7A 1HCZA 3L3KA 5DEGA 5T5FL 3BT2L 1L9TA 3NH7L 3BVUA 3PABB 4J8QA 1WFOA 4GKZB 2H32B 1WWCA 2YRBA 1OE3A 2BIHA 5T1KA 3T1WA 4LLMB 4YXHH 2A6JB 5C09A 5LCVA 4C83A 1CICD 4YSDA 4M6MH 4NKDA 1MRDH 1E42A 4IEFA 2RBLA 4XN4A 3RY6A 4KFZC 5I18H 2UUDH 3V2AR 2K6YA 5FFLA 2D3VA 5D5ME 1KIQB 4UOJA 4JLRA 3Q7JA 4MA7H 3H9SD 5LDUA 5AZUA 3KPRA 1AS7A 4G7YH 3K71B 2VITB 1LWRA 1Q72L 3SKOB 2Y7LA 4UTBA 2DWDB 1ADQL 1XZWA 5ESAA 4B5EA 3RRQA 4MB1A 1CT8B 1E6JH 3V9CA 2CUIA 2XWDA 2OW6A 3MLTA 4KGJA 4N90E 4OD1H 3BSZH 3GSQB 3QJXA 4PJBB 5E4IA 2QSCL 1OSYA 1FNEB 3ZGIA 2YOCA 3CFEA 1ZLSL 4QJ5B 4I0KA 3TFKD 4M6ML 4Z7UF 4X9YA 5DO2C 4PRPE 35C8H 4BE6A 3O8XA 1B9KA 1NGXB 4WRLA 4XO5A 4I77L 1ZEAL 1OP9A 1RIHL 2ZYHA 3KLAA 4X0KB 5B4MC 3GKWH 2VQ1B 3MRGB 4R5TA 3GSVB 4CC4A 4UTAL 1F90L 3O3DB 3BEVA 3ZT5A 5IB3A 3EXLA 3FFOA 3HN3A 4DP0X 1L9NA 2ZCZA 4ZMOA 4G8AC 3VFMB 2XTJD 1MJUL 4N26A 3GXFA 3TJHC 1RK1B 3RI5K 1G6VK 3QWNA 2CHNA 1J1OL 4L4TB 3F6JA 4HX1B 4MMYB 2NY1B 3GUFA 1J9SA 1KGCD 3UEZA 1JWUB 1GGIH 4U4IA 2IPTH 2QHRL 1T5WB 1NEZB 1MCLA 3WIHA 3ZDWA 3AWFA 3P1VA 5KUKA 4G8IB 4ATTA 5E94A 3MV8A 2VR4A 1DBBH 1M1SA 5IFJA 3GSQA 4UQCA 2VRQA 3FO2B 4JRXA 2LT9A 1GHFL 2WUBH 3T0AA 5AYUH 3V10A 4Z3TA 2O6PA 2K3TA 3ISWA 4P23D 3VXOB 1LMIA 4WWKC 1IT9H 1AQMA 3RWDB 3SHSA 1P9MA 3K8KA 3D4CA 1A7QH 3NQKA 3A23A 3MPCA 3ETSA 4OIIL 3LN5B 4XCEB 5LGKA 2ORBH 3BUYB 1XBRA 1L0QA 1XIWD 1NEUA 4KZDL 1U8NA 1KG0B 2DEXX 2VQ1A 4G8FB 4RRPA 1X5MA 1Z9NA 4BK8A 3JXAA 4K71C 2QKSA 1N5AB 3US9A 1SVZA 1ETZB 4NI6A 4B9PA 5I1CH 5IQ9A 3BIAX 4Z7VA 3KS0H 2ZOKB 3QJRB 4GAYB 3H7BB 4TUUA 4JFQB 4TKWA 5CJBA 2ZCHH 1GOFA 1L9PA 5AZ2H 4DOHB 4YK4B 4PR5B 4JRWA 2QSTA 3AU1A 2WCPA 4OTXL 4PGCB 1EJ6A 1CLYL 3S88H 2AXFA 4M43H 4NO0A 4GAYA 4ZAKA 2APXA 1IBDA 2QPUA 3D4ZA 3FO0H 3GI8L 3WEBA 5CJ5A 5B1JA 4QPEA 2DKUA 1CGYA 5HDBB 2DI9A 3V4UH 4AEHL 3EJCA 4N9GA 4OLXL 4LCYA 1U3HC 3I2CH 3FBKA 4JVWA 4K2UL 3M1OA 5IFHL 2P8PA 4WO4C 3BO8A 3U83A 4NO0B 4ZAKB 1S7XB 3FCBA 1KB9J 4LAQH 4XN8A 3G6JF 3INOA 1PU0A 3LPOA 2DYPB 2PYEE 2EC9U 1KYDA 2DQJH 4PP2A 4G6KL 5AYQA 3BUTA 3K8MA 3AJ7A 5DEZA 4YPGA 2FX9H 2CLZB 4JO4H 1WEJH 1D5ZB 1HL9A 1Z9SB 4G59C 1I9EA 3IS1X 4PWFA 3WNKA 1S7RA 3QJOA 5I0DA 2DBJA 3H3BC 1WC7A 1HE8A 2E5EA 5BMFL 3T0EC 4KQ3L 3AW5A 5FM8A 4PJEE 3AXLB 1MIEL 4W9JC 4P5TC 1IAOB 5I8CB 1R3KA 5DVKA 2RTTA 2WLLB 4AXWA 4HXAL 3UJIL 4FDWA 4UV4H 4JPKH 5F9OL 3ULVL 2XX1A 3BVDB 1QABA 1YQVH 2IWEA 4FRWA 1IIIA 4L5FH 3NIFF 2Z65C 5DUML 2GG1A 1G4MA 4PRNB 3MFFA 1V5JA 2ZXDA 3DGCR 3QWRD 1ZHKA 1F4AA 2CLVA 1CFTB 3D0VB 4WUKH 5DO8A 4UM9A 5GRUL 5KG9B 3RA7L 2BSSB 1G7IA 1YEJL 3F01A 1YEFL 2J1XA 4LRNH 3QO0B 3RVUC 1H8NA 1XH3B 1FFPB 2ZUVA 4JFEB 4PJXB 4QT5A 4MCNA 4UOW1 4NP9A 5IBTL 3MYJB 5BS0D 1BAFL 5C7XH 3ESUF 4PM1A 5I8EB 32C2A 1MNUH 2P80A 3FONB 4O5LH 2AZAA 1PFOA 1TEFA 3HBQA 3OGCA 4A2HA 2YQGA 1X5HA 2ZG2A 4LBEA 2C9VA 1ID2A 1EEQA 1Z0MA 3LNHA 3G5VB 1G87A 4JY4B 1QRNA 3HNTL 2WINA 1OT4A 1Q9LB 4MDIB 2IGTA 1IGCH 3BEWB 3AROA 4KTDL 2YD9A 1PLCA 3MUY1 4L9LA 4MLSA 4CW1A 3O3BA 4DKTA 3OMNB 3UTPE 4P3CL 2VMFA 2DQTH 2A99A 3HZYB 4ZOBA 3VYNA 2O5YL 4NQEA 5DK2A 3LRSB 1MCNA 2AC0A 4ZSOE 5I18L 4FYSA 3VTAA 4DOHE 5ID0A 3UZVB 4MJ2A 3PWJA 2XDHA 4S2SB 2EDWA 3UH8A 1IGCL 1CXHA 3GMLA 3QB7C 4XPAH 4ERSH 1D2OA 1P4LA 4PJ8C 2OR9L 2BNQD 1U8JB 1YEDA 2ZD0A 4UQ2B 3ESNA 3B2VH 1NLBL 4ES9A 4O2FA 4TPRH 1BZ9B 5EU6D 5F7YC 3PCYA 2N56A 3D30A 3N2JA 4QXTB 4MJIB 3PWJB 1PG7L 4K55A 4Q0XH 3EJRA 1MW0A 3NUKA 3OSVA 3FTWA 1F4XL 4X6CA 1HOCB 3CFIC 3RFZC 3O3BB 2J21A 3UDWC 3OKOA 2OCFD 3MOAL 3QR2A 5IBUG 1D7DA 3ZHDA 4U7MA 2BVYA 4X4MA 4ELKB 4EF3A 4BCXA 1AR1B 4JPQA 4POZC 2QJDA 4O51B 1LP9E 2XTLA 2Q8AH 1XX9C 3C9NB 3WUWB 4A1RA 3U7YL 3GXMA 1E4XH 3ILDA 3L9RB 2NYZA 2RQEA 3FONA 3L5HA 2OULB 3MODH 5EORH 5I6MA 1JZ8A 3UBFA 2ADIB 4HCRA 4Q9QH 2E4FA 2LU4A 1OCWH 3MV9E 1IQWH 5C0BE 3W0WD 1K5NB 3VWJC 3ZTEA 4V1DB 3AT0A 3GSRB 3KM1A 1DDTA 1CJYA 3NTCL 3H54A 4YUEL 4YQXL 5D1QD 4P9HL 1RV6X 2A4ZA 2NUTB 4Q52A 3IEAA 1QASA 1AZZC 3ZTDC 5BVJA 1MCBA 3KNBA 5HHQA 2WZ0A 3FDWA 4NQCB 4PYHA 1SYSB 2HFGL 4JHAL 4C54A 5MENE 3REVB 5E6IA 4L3EA 4X99A 5EF0A 1SJHA 1JGVL 1A3LL 1XD1A 3BGFB 1FFRA 2HLAB 2VSMB 4XP6H 1YY9D 4N8VG 4YVNA 1QACA 1MEXH 1OTUC 1DQML 4GAFB 4ODWB 3REVA 4QRFA 4YWGH 1FL6A 3GYRA 1I8MB 2BY3A 5FA3A 3ES6B 4GXUM 4JPIA 4Q9QL 3CDGA 3NJFA 4J3BA 3VU1A 2VDML 4RFOH 4X4ZA 5DRNB 4OVVA 4S0SD 2VZ3A 5ITFB 3Q8CA 3L1OL 4YZFF 5DJDB 4ZYKB 2GEQA 3R7RA 3EF7A 4NZUL 4NT6B 2D0HA 1DCLA 4WUUD 4S1QH 4FL4B 1T4WA 4JPWH 3UZQA 2FZ3A 1J48A 4FFTA 4EPSA 3BVNB 3I6KA 3IJSA 5DD1L 1OP3H 2MH4A 1MWAB 3P2TA 1YUKB 1G0XA 4PJHA 4LQFH 4GRLD 2OL3A 5BO0D 4TNFA 4EUPA 3TXAA 5E5UB 3X17A 3F5WA 1KCKA 3BPCB 4KXZH 2F1BA 4P2OC 4WV1B 1HQ4A 3LQAC 1JZFA 3BFOA 1D9KB 3FT3A 2IFFL 4TVPE 1GZHC 1UWXH 3GK8L 4ZMXA 2IH8A 3EJYD 5IEKB 3TEYA 4BQCA 1UACH 2JJSC 3RAJL 3QDGE 4NQUA 4RGNE 5C09E 4DKFL 5BRQA 5BW7C 2JIXB 4OJFL 3AADB 3T77A 4FXGA 4AYFB 1UYWL 2WLIA 4QRQA 3EG9B 4TSCH 4X5WB 1JNNH 3NESA 4TLKA 5AB1A 4ODHH 1G9NC 1RK0A 1USQA 3CSGA 2G4EA 2V33A 3O3EA 2XJKA 5HDWA 4WHTB 4YSAA 1NPNA 2BCKA 4HJ0D 1MIMH 3BP6A 1SEQL 3IGKA 4OFKA 5CWSA 3HMXL 4XPFL 3DGDA 1BQHB 2A9NH 4XNZC 2MFNA 2APVA 1C1EL 4QTHB 2DM4A 4HCFA 5D1ZI 4IGBB 4HLEA 3JYBA 1T2QH 4IIQC 3W2DL 4FG6C 3WLBB 5FYLD 2BHYA 4Z7UA 1KTBA 1FN4B 3FU9A 5G4MA 2F53B 2DYRB 5DD3L 4YAQA 3N0PB 2BJML 4Z7IA 4QCIA 3U4EA 2IQ9L 3F8UB 4W9ZA 5IFHH 1EHAA 2B14A 2I07A 5E1AA 3WN6A 5HYJB 2H9GB 4JFOA 4ABVA 1OAYL 3MA9H 1MSPA 2HKFL 4I9WD 5DSCB 3RIAF 4BXVA 5JIHA 3VW3L 3DJZA 5JIPA 2AABL 1L6XA 3E2HC 2C3VB 2E7BA 1ONQA 3F12B 4FYTA 2FJFB 4JFYB 5DUMH 3VUAA 3CJJA 2AK4E 4NZTH 5KVDE 1XH3A 5CLZA 5D2LB 3RFRA 1TZIA 1DSFH 3AGVA 1VGKB 5E2VL 2ZAGA 2VJ0A 4L3ED 1KJMA 5DJ0B 2X0VA 5BMFH 2ODIA 3FQNB 1TJGH 2C3WA 4BD4A 1T4KA 2C4FU 3T6WA 3T2NH 2WB7A 3SQOL 1RK1A 1AAJA 5HI3C 3IT8D 4R8WH 3OAZK 3RPIA 3SN6N 1EAQA 1CFQB 3HS0B 4X80L 2VDOL 3PDOB 2KERA 5JMOC 2B77A 3N50A 2FBJH 1BX2B 2H6OA 2IIJA 2BC4A 1AHKA 1B9ZA 2FYVA 1T83C 1EGJL 3UTSE 1SLVA 5J5EA 4NO3A 4PJ5B 3VXRA 2W38A 4LSUL 4H2AA 2X1WL 4QTHA 3WDIA 2F68X 3TBSA 4W6XB 1OB1A 1NOAA 3WY3A 4NBYB 4PVLA 4LHJB 5C08D 3WTYA 4RX4A 3HRZB 2N1KA 1UXLA 3OBAA 2BWQA 4XVUC 2PYEB 4DTGL 3RWGA 4RZCB 4HOWA 5C2UB 3QQDB 2E56A 1PFCA 1OP5K 4K5NA 4C56D 1PSKL 1W0VA 4FJ6A 4WO4B 4XOEA 4KKZA 2W0FA 4P05A 1KBPA 3MBWB 3CZEA 3VFGL 1I9JL 5GGRY 3O2DH 5DK0A 1X9UA 2O72A 2BS71 3GJFH 4OF7A 3BSHA 1G6RA 4RMUA 2NLJB 4FKKA 5CEXB 1F4XH 2VH5H 5LAPA 3ZMEA 1WS8A 1EANA 4F2MB 1QEWA 5J13C 1J0ZA 1PSKH 2R56L 1FYTE 1R3LB 3LS5L 3QNFA 4IRSA 3QQ3B 1PX3A 4PJ8D 2TSBA 2EIMB 3BLBA 4BFEA 2NSQA 4F24A 2PYFB 5C0GB 3QXUA 3WN5A 3ARSA 3FTGB 2XV0A 2DWEA 3RPIB 3ZR5A 4ETQA 4PD4K 4NO5A 3TYFA 3WY4A 4FFVD 4LFHD 2EC9T 2IAMD 3QJSB 3S37H 2APBA 5I24A 3T2QA 1J88A 1CWVA 1TJIH 1SDDB 5LCVL 3RIFK 3KLKA 4OUUB 5KSAB 3CFDA 4OD1L 2IADA 3VSUA 3O9WA 1ZLWH 4XO4A 1ZMYA 3L7EA 4PWIA 3IU4H 3LIZL 5IK3B 4TNWK 1EEYB 2KUTA 3HEIB 4XZUA 4UQDA 1L3WA 3RVUD 4ONGH 5LO7A 3QUKA 3EJTA 1N8ZB 4GXVL 3SDDC 3TN0B 1RZGA 1T0NA 1KIUB 1KPVB 3MV8D 4G5ZH 4AQ1B 2D9CA 3SKMB 1R75A 4UQBA 5H37G 4OV5A 2FWLB 4NT6A 4PJ9D 4L8BA 5F44A 1I7UA 1MW2A 2OSWA 2J6EA 5IJVA 3VW3H 1WBYB 1CTOA 1IV8A 3BAIA 4FNTA 5C08A 2IANE 2CDEB 5INDA 2VERA 4PJEF 1AFVH 2X1QA 2X3BA 4NN5C 1ICTA 3N44F 3UAAA 3ENEA 1JGEA 4WW1B 4TUKL 2Y5EA 4K9EC 3LN4B 2PCPA 2HKHH 2XXMB 1DSFL 3C8KB 3VYPA 2HTLD 2WNXA 2R2HB 3MFGB 3T8XB 4KQ0A 2WTOA 3L8QA 1HXYB 2J1WA 1H9DA 1LO2H 1UEYA 4HS3A 4Y16D 5IQLA 3R18A 1KLFB 1T0OA 4M5TA 1CB4A 4AYFA 1HAWA 1SDYA 2VZSA 1NFDA 1F3JA 2ZWNA 3G6JE 4OJCA 2G5UA 2VDPB 4JO4L 2Z0BA 3SGEH 1PW3A 3I84A 2ZOLB 4PB9L 4AVHA 1AYRA 2LVCA 1KJ2L 3J7HA 2X9YA 2WWNA 1YNLL 4L1LA 1I85A 2KPNA 4AYMC 2CBPA 4FL4C 2G9HB 3CFDB 5EZPA 4TSCL 5IJCC 1DVQA 5F89A 1GGBH 3DVGB 4WO4D 2CBOA 1RPKA 1JGVH 1HYSC 4W9KC 3TBYA 4Z76B 3D18B 2PCPB 2WY3B 4GEJA 1J1PH 3KXFD 4P2RD 2X4OB 1KPRA 4LF3B 4MKMA 4R3SB 4BH8A 1UTDA 4B9KC 1L7IL 5KYWA 3VXSD 3NZ8A 4M5YH 2EYSB 4S10A 5C08B 1CFSA 2ICEC 2MEJB 1LYQA 1NJ9A 2BHZA 2N4IA 4XAWH 4D9RD 3FO0L 1VRSA 2CUAA 1YN7B 1PZSA 2R1WB 1DYZA 3D2TA 3BUDA 2IALA 2R4RH 3EYVA 1SUHA 4GIAA 1ESOA 3QNXB 3WMSA 4UT9A 3APMA 4L4VD 2N59A 3MV9A 4J39A 4GAJH 4NKMB 2OX5B 2ZX5A 2R59A 4MTMA 3IFLL 5I1KH 1FYTA 4J3OG 4OGQC 4Y4HB 4BRJA 4Z78B 1A9EA 1ZS8B 1S3KH 1MI5B 3S4SB 4AM0A 4LBAA 4XNZB 2ZOLA 1TCMA 4X4ME 1UB5A 3CE1A 4KJQC 2DQUH 5AKRA 2CO7A 4S2SA 4UM9D 2Z35A 4LMQE 3KPOA 1BLNB 2FEEI 3KJ6H 4AYSA 2YD2A 4U05A 3ULUE 1ZHNB 2GT9B 1H6TA 1TNMA 4N2MA 3STLA 4P2CG 3NACL 4TUOA 1MWAH 4LSRL 1DUZA 5C97A 2ED7A 1QYGL 1OE2A 4FMKA 4LCVA 3D33A 5JW4N 3UP6A 2HLFC 3ARTA 1KXQA 4GKSB 5HHXL 1LGVA 4EQ3A 5JHDE 2ADIA 1ZAGA 3ZQ9A 4X8JB 2VLRA 1SRDA 3DX9B 3WBDA 2DQHH 4JFXB 2GJ6E 1NCJA 4Z1PA 2ED9A 5MENA 1V7MH 1HKFA 4I5BA 4P5MA 3RZCB 1BAGA 5K9KA 4P9MH 2NX5D 3CSFA 1Q9OA 4PG2C 4YSRA 1CFSB 3ZL2A 4I9XA 4X5QA 1DDHB 2V2WA 4KRPB 4GG6F 1ITBB 1KDIA 1WQVT 2VCOA 4IJ3C 3IN0A 4OCLC 2DS4A 5K9KB 3FFCA 5EIVA 4ANXA 2Q2EB 4D9LH 4FZEL 4LSSL 5AKTA 1MWAL 2ZOWA 4LSRH 3TTSA 4PLKC 5IG7A 1MCDA 1HK6A 4F37F 4IBUA 1V3MA 1QP1A 1W72B 1YEWA 3HUJB 5F7KC 5F70A 3OPZH 4XCFH 4LRIA 5GGTA 2OSLA 1INQB 4KHXL 3QIBA 1IIKA 1TCRB 2FBJL 4PWKA 4AGNA 2QLVB 1N59B 3ELAT 3MX0A 4Q58C 5DQJB 5F0MB 1J1XL 4RBPH 1RU9L 5BRZD 4BGLA 5JNYA 3VFUB 1R5IB 1AQDA 3GMQA 2LFEA 3SCMB 1T5WA 2ZONA 3K72A 1TTCA 4HCRL 4OJEH 4MBRA 1JV5B 3GO1H 1J12A 2PO6D 4QHPA 4GS7C 5C0RH 4RCAA 2A4EA 1MCRA 4MNGE 5EULV 1P84K 4CNIA 2HRPH 3JV0A 4LEEA 5EIQA 2QPEB 3FQXA 3O4OC 3GXTA 5DZJA 2Q8BH 4EXKA 5E4EB 3H6AA 5D5MF 3IXAB 5DA4A 3UAJD 4KMTL 4KI1A 3QI9B 4BZYA 2VABB 4JDVA 4PJEA 3HBZA 2GI0A 4PJIE 4DVRL 2WXIA 1SY6H 3QDME 3LXAA 3AWGA 4H8UA 1QI4A 5BXFA 4YFLI 2WUCL 4TUJB 4IW4C 1X5JA 4ALAH 4LLYA 2AJUL 2Y5TA 3DI3B 1KB5H 5L4FA 1CGUA 2A6KA 2JCCE 3QJQB 5IM7B 2W0FB 4I2XE 3O2DA 3QUGA 1EIBA 5CCHE 1F1AA 4QOKA 1LEKA 5ID1B 2BRRL 3ZDZB 2H45A 2TSAA 1CXKA 4QXGH 1MG3C 1IKFL 4DSYA 3BESR 2VN7A 3BZFB 1YNTF 5LCVH 5AW0B 3G5YB 3LDBB 3WFCL 2VW6A 3IPBA 5F7DA 4H8PA 4DP4X 1IO4C 2ZOKA 1ACYH 3LPPA 4GIPD 1QFUL 3FNKA 3ZSTA 2ITDA 3K6IA 3RUGB 1FN4A 3VMOA 1O5PA 2WXLA 3ZO9A 3EIFA 1B4JL 1Q0EA 5ISZB 4YJZL 9PCYA 2BNRB 1NWOA 3NEXA 5EEUA 3QCUL 3VFOA 1GS8A 4QXUL 2G2RB 1DBJH 4EXPX 3FTGA 3GSOA 1OP5H 2EXSA 4OZIE 4DKFH 2YXFA 4JZJA 5H94A 4ZMVA 2EE2A 1CI5A 4GQ9L 4KDTC 1ETJA 4JRLA 5HYQB 1AXIB 2X4SA 1T0MA 1J86A 4OZFH 1X6LA 1ODUA 5CKAA 3FUEA 4OD3H 1WITA 4V2CB 3I75A 2MCPL 4LHUA 5AVXB 3QAZB 4OJDH 2GABA 3DPBB 2XWCA 1BG9A 4Y4FD 1MFBH 2AKRB 2B20A 4KKAD 1QWHA 2HH0L 5TGBB 4FYRA 4D0BA 1VFAA 4JZJC 1V7ML 3TV3L 2PW1A 4GY4A 1MAML 1W16A 3AT8A 4U3HA 4PJDF 3EGSA 1JK8A 4QYOB 3IBOA 1FLRL 4M61A 3W11C 1QAWA 2Y23A 4JZOB 3SBQA 4OLWH 4AMKL 2YPVL 3F3HA 2FX8L 1KCRH 1NFAA 2VTFA 3FH7A 1R5WA 2BC4B 4XPTH 4K5LA 3FTVA 1HILB 3LVEA 4HISA 1GTNA 1E50A 1WA2X 2X4PB 2P7TB 1RZFL 1QHOA 3VFOB 3T8VA 1AKJA 3B8SA 3MV8E 3BWAB 4MZ3A 5D71H 3BPOC 2KHAA 2RMNA 2Z1PA 2PO6A 5JHDB 1C8PA 4NKMA 2MCPH 4KHXH 5DJZA 2ZYIA 1PIGA 3E2HB 1SFHA 3X1FA 3C08H 3WTSA 3S7GA 3O2VL 3LQMA 5JIMA 5TDNA 3N06B 3OKMA 3PV6B 4CMHB 1EK3A 1OB0A 3BH4A 3SDYH 5I15L 3AAZB 2WXHA 1EPFA 2ZKHH 4EQ2A 2WVVB 5HHVL 5D4IA 4XC1L 1EZLA 5BOPA 3LJ3A 1RJCA 2MHAA 2CU9A 4LPVA 3B2PA 2DAVA 3KW7A 4OM0L 4P5KA 2ARWA 3QDHA 3SPJA 2K9FB 2R7EA 2V9UA 4OF8A 3RWFA 1AQKL 1FAKT 1DBMH 3QUZD 4A04A 1KCUH 3LKPA 1BPLB 1RZIB 1W6WA 4ZRGA 2YUVA 3FU7B 4NRZA 1UVQA 2YA2A 4B27A 3WUZA 1WAEA 1PZ2A 1FO0L 2YGVA 3ASNB 5DK0B 3FB7A 3E3QE 4JRYB 5D1QE 4JHWL 5EU7C 3RGBA 3N91A 5DHVB 5KSBF 2W65A 1JWMB 5F7UA 1CLYH 3S88L 1UZ8B 2A9NL 2WO2B 5HDLA 3WUWA 4IHOB 2EIDA 4OBRA 2ZQKA 1HQRA 1N4XH 3W0WB 2B08A 4GG6B 2DIJA 1I7RA 4FXKB 4MNGB 2C8NA 1DO5A 4MXVE 3VFWB 3QG6B 1S7QA 4LHUD 2R27A 1BZEA 3SBPA 4K2UH 1DJSA 4LRIC 3FUFA 4HT1L 1SMAA 1AI1L 2FEJA 4XWGL 3DROB 3WKML 3H0TB 3W0WA 5T3ZE 3BP4A 4PY8I 5FOBA 3FQTA 3A4EA 4G7QB 3D3VA 3KGUA 2XIBA 3S36H 4N1CA 3C60A 4X7TA 3GI9L 3DYMA 4UYPA 3V4VA 4GS7B 1FGVH 4WW2A 5ICYA 1U8JA 1P1ZB 3Q8BA 4ODBD 1P2CA 2FE0A 5HVHC 2I9TA 5BRZB 5CN2A 3GMOB 3UAJC 4NIYE 4X99B 3MJ8B 1SF5A 2Z8SA 2YC1A 3C5JB 1CFBA 4LCCB 4ADIA 4MJID 5D7SL 3P4OA 3U2SB 1E8WA 4FTDA 4BUQA 4QHUB 3Q5YA 4L5FL 2XYBA 4AM0Q 5BQ7B 1PD6A 1BYNA 1TZGH 3JWDL 4GMSL 4NRYB 3GSUA 3EYFB 2FR4A 3MXWL 2WOBA 1G43A 2ICEB 3QQDA 4UV4L 3CGTA 4WFGD 2B8OT 4JFDB 5ANME 2E6JA 4U1LA 4NNYB 1M2OA 4WW1A 3VD2A 1AKPA 4PJIA 4UI2A 1BF2A 5JW4R 1WZ1H 4W81A 3DTXA 1JDDA 3L4ZA 1TG8A 1J7VR 3TWYA 1A7QL 5J3HD 5FYKE 5IOKA 1NCWL 1KIRA 1MVUA 2CGRL 3W57A 3GO1L 4WTWA 2HVKB 2ENQA 4X9IA 2ZJSH 1H5BB 1XSIA 3GT6A 3I9PA 2IOMA 3W9EA 4P2RE 3PJSB 1X9RA 1I7RB 4FXKA 3NJMA 4MNGA 3RB7A 2BP0B 3DIFB 5AW8B 2X9ZA 5D2NB 3DOHA 3WGUB 1QNZL 1GTFA 2WLMA 3MRQA 2Q3ZA 5C0GA 5DTFB 4NQCA 3SYCA 4NN7B 5HJ3B 1FNAA 4ZS6C 3IE4A 3UAFA 4PTTA 1NCWH 4OIFA 5A6IA 4N2DA 4AYBA 4M93C 4N2BA 4YSEA 1ADQA 2WKOF 4JRFA 4OF0A 4JKWA 2FIKA 3O4OB 4TTDD 4ZUTB 3TO4A 5DD0H 4LCIH 5D6CA 1YYLH 1FAIL 1JRHH 1S7VA 1AGDB 2PMZA 1LO4H 4IRZH 4R7DB 3K4AA 3IMSA 4LASL 2P5WD 1KC5H 2A7BA 4WJ5A 3SDAB 1AGFA 2O6EA 3M1CA 3PGDB 3U7AA 1J5OH 1DJXA 5B39A 1EXUA 4B6ZA 2VDRL 5E1IA 1D5ZA 5A2KH 5AD0B 2CRYA 3MLTB 4IHBA 3X3GL 4GRLB 3UP1A 1CXLA 4OLZH 2EDMA 2H3NB 3I2CL 1ZLEA 2BO0A 2X4SB 1ERNA 1WTLA 4PV9B 3AACA 5KYWB 3FQ4A 1DFBL 1BHGA 2PWHA 2AZUA 1U3HD 3VXSA 4WUUB 1YG9A 5KJRL 2R1YB 3FT2A 3N44B 3CFUA 2OMTB 2VABA 2J2ZB 4JDVB 4PJEB 4U6TA 3PJLA 2X4UB 4X7EC 1YEEL 2CJ3A 3EYOA 3M17A 1WHPA 2NYKA 4LK4A 4PRHA 1H9VA 3DNKA 1T3FA 3MR9A 4MYPA 4LIQH 2XN0A 1BZDA 5F9AC 3CFJB 3WIAA 1FAIH 1A4KB 3UTZB 2FBOJ 1GGCH 1ETB1 4K3GA 2ZCLH 4HUXA 4LSTH 4JREC 4U6YB 3VD4A 1OCOB 2CHZA 5EEXA 4PJCF 2CPUA 4LB8A 5CINH 2X6MA 5HGGS 5ID1A 4M9OA 5FA3B 1UJ3B 1I8LA 1S7VB 4H1LA 4IRJC 2XN9B 5CGBA 3QIWB 2JQAA 3AT9A 2V3FA 3Q2VA 4H20L 3P9LA 1G84A 1DBBL 5A3ID 1FJ1B 3GHBL 3A6BH 2DQEL 4ELMB 2R0WH 3P0GB 4G8IA 1NM4A 5AOIA 2VXQH 4X6EB 1WBXA 4PJFB 3CXDL 1E9QB 4N4YB 4TV3A 1DTUA 4NHCL 5KVGE 1QVOA 2OTUB 3JTTB 4WEUD 1L7TH 3WFHA 3UZEA 2NW3A 3KWUA 1I7ZB 2XQYA 4B50A 1BX2A 4X6FA 4L9LB 1VAHA 4PJHB 1CZ8L 2ZUSA 2JKWA 4N22A 2F53D 3GZOA 1P5UA 5EBGA 5IBTH 3RILA 2ZPKH 3QUMB 3GSNL 4Q9CA 1KZQA 4HIHB 2WO3B 2WVVA 3KWTA 3VWKC 3WNOA 1IFGA 2BZCA 4I5BB 4Y2DB 3T04D 4ENEC 4TVUA 1TZGL 2A83A 2R1XB 5CJXA 2WXMA 5E5RB 3T3MF 3U0WH 1JYXA 3RVXC 2QKIC 4NZJA 1IC7H 3HG2A 4HQQH 1N12A 5AKVA 3P3UA 3S34H 4B3VA 4NAQA 1SBSL 3QPKA 1YPZB 1AGBB 1RERA 5JNYB 4LNVA 1M57B 3M1BB 4UNTA 3VTTA 2Y69B 4I8DA 4WGKA 4CMMA 5A2CA 4WCYL 5AFAA 2FT6A 2HJLA 2IH1B 2VIRB 2X89A 4DW2L 5I1HH 1JE6A 3SCMA 5KVGL 4M1DH 5E9NA 1N64H 3DYOA 5GGQL 3R0NA 4FQJH 1T04A 5LGHH 2Q20A 4IS6B 3B43A 2WLIB 2HLEB 4XPAL 1ZT4A 4POYA 4GIOA 1TKWA 2P8LB 3KS0J 5EF3A 2UZXA 3LEXA 3SDDD 1M7DB 2RCSL 3PWPB 6CGTA 1WWBX 1A3QA 5AALA 5HVHB 4OKDA 1L6ZA 5B4MD 1YMMA 3FXIC 1UM5H 2NY0C 3UTOA 5BZWA 3H6JA 1XQ4A 1JN6B 2HX7A 3G5ZB 4PJIF 5CSBA 4CDGC 2VKXA 2YA0A 3TFKC 3MUGB 2WN3A 1KMGA 5IHLB 2QPDB 3MRGA 5MEOB 1Q0XH 3GSXB 4Q89A 2KDYA 4WU7A 4XOCA 5L2KA 4TLUA 3GMMA 3MN8A 2P8PB 1BEXA 2IPKA 2HPOA 4G6KH 2K7QA 2WZPD 1HH9B 4QRPB 4FKHA 3BZ4A 1Z3GL 1WCBA 3I6GB 1OXYA 3U0PB 2IV9A 5FO9B 2DTML 4OLYL 3HS8A 5JW3H 2A9CA 3I3DA 1JD9A 3MLWL 2F2HA 5I16B 2Q5BA 3BW9A 3NK3A 5HHOE 5IVOA 5MEND 2NRDA 3KD4A 2X4QA 2H7WA 4XPGL 1IM3B 2DJ4A 5HYIA 1RJLB 3FCTA 2VE6A 3LZNA 5FO2A 4DCQA 4IOSA 3BKCL 5L9DH 3DUHA 1SOSA 1FVEA 5E99L 1M7DA 4MXQC 4DKAA 1DJYA 3CFBA 2D7TL 4HOXA 4XWOD 5HGAA 4ENZA 3VXMA 3EAKA 3RURA 2EEAA 3O2WL 1ZHLA 3HRPA 1DSYA 1FFOA 5JZ7D 3B1TA 4N25A 2ZUYA 1MEXL 5C0DB 4P0DA 5E9AA 1RZJH 5LBGA 3VFPB 5CD5D 4FJZA 5DS2A 3QJHB 1MHHB 3MTXA 2AJVL 2K78A 1HJBC 3MJ9A 3C8KA 1BYOA 4P2AA 3RNKA 5KSBB 1NFIA 2BSCA 1PKQA 1U8MA 3VGHA 4KO6A 3W1ZA 2FATL 1AE6H 5EU5B 4AQ8C 3L2NA 2F74A 3B9KA 4D0DA 4UDTB 1XVSA 4YSPA 3IJYA 1ZVYA 2PABA 3HS0C 2NY5H 2O5YH 3NSJA 4OFDA 2J5LC 3ZKND 2P48B 4EI6A 2NLJA 4PJCA 4L8CA 1RUQH 4U6VL 4K4KA 1DN0A 2A74B 3GXNA 2FATH 1J9QA 3ULUF 2GAZB 2BS9A 3HZVA 3QUMH 3GI8H 1KBVA 5CMAB 5FWQA 1S7UB 3S5LB 1OAKL 5GS0D 1UFGA 4Z3IA 4Y1TA 4MBOA 3DVNA 3JT2A 3L4WA 3BCDA 1K4DA 3ZGHA 1JTTA 1TZHA 4HSQA 4KUCF 3O2DL 4E9VA 3V79C 4O02L 2BSTB 2NW2A 5CEZD 3ARWA 1SEBB 2NNXA 1N0LA 2HRPL 3DKHA 3WIHL 1EGJA 4PWHA 4B7IA 4E5XB 4LNRA 1BXXA 4FXGC 3WHXA 5HYSA 5EFIA 2R4SH 1H5BA 1I8KB 2AEWA 3JWDC 3CXHK 3OQ3B 4KKNA 1P7BA 2JJSA 1LXMA 2F19L 2GK0B 4QKXB 2C9RA 1FP5A 1NOLA 3AG1B 4BCZA 1LWHA 4P2OA 1KJVB 2C26A 2ATAA 1QEXA 1ORSA 2AQ1A 2NR6A 1N67A 3H9YA 4JUTA 5AVWB 3WOVA 1CFNB 1CIDA 2EEBA 2OMVA 1ET7A 4YQXH 3VI3B 4F58H 5FB8B 1V27A 5KYYA 1JV2B 1U8NB 3MKKA 1PDKB 2CO7B 3UMNA 1FUNA 5KYXA 4C55A 2QADD 2FIKB 4I0CC 4N0CC 5EBMB 4RGOL 3HPLB 4YSOA 5ETUA 3GS0A 3H9HA 4KJPC 4PJGA 4MZRA 1F6AA 2CK2A 1U21A 2EDRA 2GUOB 4JE0A 5I19H 3HE7A 5E24E 5E1GA 4JGNA 2FLBT 4XAKE 2GJ6D 1HNGA 4U6HB 3UYPA 4GSQA 4YSTA 1JGLH 4E0RB 5GGUA 5B3SB 4FXLA 4AGPA 4AKQA 3MLWH 4DQOH 3T8XA 2NY4C 3PWNB 5E6ZA 2WBJD 2ZP9A 4MMZA 1ZWIB 1A9VA 1WWAX 4AYDC 3L3KB 4R5XA 5DEGB 3U6XA 3ROOA 5TH2B 3VXRD 2OYMA 4PBWD 3AXHA 1NCUA 1DQLL 4LARL 4XNMB 3BRGC 1R24B 2EP6A 2B2XL 2WHVA 4KXZI 4GRLC 4ORGA 5ACMA 3SE4A 1HSAB 2LU5A 1OEZW 2H2SD 1X5KA 4LHQB 4UDUB 3VO0A 5CGMA 5DYOB 3ZUCA 2N1TE 2CUHA 2C1OA 3VXUA 1SBSH 4KQ3H 3GLZA 5GS2H 4BZ2L 3STZA 5EU4B 4GRWE 5I6XC 5IB1A 2DTSA 3SGJC 1KGXA 5EEWA 1MXDA 4TQEL 1KGCE 2EO1A 3DXAB 1UH3A 2VMDA 5EOCH 1UATA 2HFEB 5L6YH 4J2XA 1R9FA 4FHJA 3TT1L 3CVIL 3DVFA 3Q44A 4I1RA 4ELMA 5DVOA 1R3IL 4ODTL 3HCVA 3TBCA 4UQ3B 4XC3H 1SNRA 3F62A 3TBYB 5IMKA 3RTQA 2L04A 4OIIH 2W0PA 3F5WB 4RMQA 2Y7MA 4KHTL 5JORA 1AD0A 2WXJA 2AV1A 2DMHA 3PY9A 4GFTB 4UT7H 1V3JA 5LB1A 3SDXF 4A66A 4I1PA 4FA6A 5ESAB 5EOCL 5IZ7A 5FGCB 3A6OA 2YEZA 4JFSA 4MXVF 1HZKA 4IGBD 2V2WB 5LXVA 3V0WL 5FO9A 4M7JL 5DC0A 2EH8L 1CQYA 4YHPA 1C5BH 5F96L 1XEDA 3WLWC 4LGSB 1Z9LA 1YEIL 5D1QC 1JF6A 4FHBD 4JFDE 4K15A 1IM9D 3TZVB 4EKJA 3BEVB 3QJVB 3UTTE 5AW9B 1RPUA 5JDSA 1TTRA 4HJJH 2DF3A 1H8OA 5GGRB 3S3PA 5SWSE 1A6AA 3CSYB 2VZOA 1NIAA 1KFAH 5JPNA 1K2DA 2NTSP 3CQQA 4P3WA 5HVGB 3ZHKA 4P46D 1VIWA 5GGVL 1IAMA 3BZFA 4HBQA 3QYMA 3D85A 2E7MA 5F1IB 4RFEA 1BD2B 5KSAD 1HHGA 4ODSH 1A4CA 3ERXA 4AQ1A 4N2FA 2FX9L 5CEYB 2NCEA 2JKLA 1MCEA 3RTQB 3OZ9L 4JKPH 5DD6B 3B2MA 2NSMA 3FB5B 2AS5M 1AGDA 4PWEA 4HFWB 1XAKA 1GC1C 2X3AA 5LKNA 1YN6A 4EI0A 1MCJA 2D73A 1HS6A 1D5IH 1YEGH 5I1GL 4MNQE 4U1SB 3GZKA 2Q8AL 4EMZA 3PXJA 4KVNL 3RGVA 1E40A 1T1XA 3L3HB 2CK0H 4Q4EA 5JW4Q 3B9KB 4D0DB 5HYQA 2XTJB 4N2GA 4PRBB 4XPGH 2Y6SC 4BZ1L 5ILTH 4YBQD 2MQCA 3KHQA 5K5YA 3Q06A 1FF5A 3HVNA 3N41B 1NGZA 3PIQA 1CD9B 2F5AL 4ISVA 3TF7C 4L8SB 2OMTA 4AIEA 3S96A 4TLTA 1G7JA 2XFXB 3JUYA 4P2YA 1U8LA 4R0LC 2IV8A 4FZ8L 3O3EB 2WLZA 2WB1A 4XNUH 1H3PL 3ES6A 4WK2B 2QELA 2YQ2A 2R0LL 1R5IA 3FO2A 3RHWK 1G7MB 4KAQL 4HFUH 5MERB 4WUUE 4WI7A 2BW5A 4AGOA 1BD2A 1E9QA 1VFBA 1P5UC 2EZ0D 1TCRA 5AVZB 3C5ZB 4RIRB 2G3XA 1P7QB 5J06A 3SPGA 3PRZA 1AVAA 3FQWB 3FSZA 3G6DL 4S11A 4UANA 4RVBA 1E27A 3WFEH 2WNWA 4RFEB 2GY5A 3N1PC 4JJ5B 4GRWF 1MFEH 2FGWH 2OTWB 1F86A 2YUZA 2VDQL 2I26N 8PAZA 1MHEB 4WV1A 4GLRH 2MPVA 1HOEA 1I8LC 4PGDB 2F61A 4X9BA 2ICWA 4KH9A 3ZDXE 1J1XH 3ZE1E 1Q1JH 2CXGA 5LHDA 1NCDL 1XR9B 3DX7B 1YPZF 4YHNB 1NMAH 3NZHL 3OF6A 4AEIL 3EFOA 3ULVF 4GQQA 4N9GB 3GC3A 1IRAY 5LDSA 2F18A 3ELQA 7CGTA 3ZLQC 3DMMA 4QNPE 1A66A 2BCKB 5LXGL 3BSZA 1VLXA 1U3YA 2B1HH 1CPUA 1Q9KA 1KLUA 3C6SB 5CSZA 2V5RA 3D87B 1BMGA 1TQWA 3DRTB 1CD8A 3SBWA 3TVMD 1BM7A 2I5YL 2RJMA 4R26L 3H3KA 2W5PA 4P46A 3EJZC 4W9LC 4XP9H 3OB8A 1YYML 3BH8A 3LH8A 3NA9H 2EYRB 1NGYA 2IGFL 3D0LB 1TQTA 4FOMA 5HDBE 5C0IA 4G7SB 5LG6A 1F1GA 4ELMF 3IB4A 1TZIB 3W9DB 3D7PA 1SM3L 3QEQB 4KXAA 4W4NA 4PP1C 3UJTL 3WNIA 4XPHL 2NY2D 1QYGH 3FRUB 2ZX7A 4CBPA 1C7TA 4Y1AE 2BNQE 5CJOL 3L3DA 1RZKH 3C87A 2VLRD 2ZNWA 1QTPA 2CBTA 2DQHL 1QUNB 3FU8A 1BYPA 3I6LE 2ETWA 4PRID 4M6NH 3SPHA 5T8IA 1IL1B 1PPIA 2FECI 2XNAA 2X6UA 3GHEL 3SPVA 4IHOA 3LKNB 4PJ7B 1J87A 5GS3A 1F5WA 4Z7UB 5BUAA 4QRRB 3HB3B 2FJHB 4L29A 3GSNH 4P23B 4Z7WF 2EIKB 2V7HB 3MTRA 3ARDD 3KR3L 5AW7B 3UBXG 4NRYA 1FFOB 3CZLA 3ARUA 4P9ML 1IC1A 2XLLA 4FNRA 3U30B 2G75A 1RUKL 1DQMH 3P4NB 1BG1A 3FSOA 4J6RL 4NHCH 3EDKA 4NDMA 5AW5B 3PGCB 3RZWA 3OF6D 1N2RB 2W1NA 5PCYA 3O8XC 3F83A 5BRZA 3IAPA 3BVWA 2IG2L 3KCPA 2JKRM 4HBCH 1MFDL 1OY3B 3CUPB 4FQHA 4PRDA 1QR1A 5SWSA 2AJSL 4WI8A 2ZXAA 2DLTA 4JO1H 4OCXH 2BZDA 1NAKL 5ALCL 4B53A 1X5XA 2H26B 3GD1C 4G43A 2Q87A 4YHML 4WW2C 2R39A 3ULUH 4XAWL 3B5TA 5KSBA 1LP9F 3O6LH 1TQSA 3QZPA 3BWUC 2XN1A 3PWNA 1FVDB 1W0YT 3F65A 2CHXA 2IDCA 3B9KD 4GO6B 4W93A 2IAND 2EXWD 3AMKA 3VRLE 1RJYA 3MLUH 5I30L 5EF1A 4OZIF 4J3XA 1SZNA 4GAJL 5B1CA 5DQDH 3HPJA 1O0VA 3SE9H 4Y5VB 3HVDA 5E95B 4R7DA 1DP0A 5T1LD 3MSPA 1MCOH 3QORB 4ZMQA 1AQ8A 3MOAH 4PRNA 1AO7B 1I8IA 4GQPH 2OYPA 3L9BA 4WI4A 4MNQB 2HN7A 2XWJA 1YEKL 2ZSWB 3V0VA 3B8YA 3QEQE 5ANHA 1S7UA 3S5LA 4PJFE 3HPJB 3NGBB 4XO9A 3PQYA 4M6AA 1LDPH 2Y36H 4NZFA 1JBJA 3EH1A 5I75C 1D5BB 5AUMB 3VD7A 1KGIA 2X10A 4HUWB 4XC3L 1NCTA 4W6YB 3KH4A 4CVWA 3HB3D 1TYJA 2CRMA 3ESVF 4FX5A 5JIIA 7FABH 1A14H 3U0TA 3EDDA 2J8UB 4N8UA 4KUCD 2B3RA 4Y5XA 5JW5A 4JHVA 1GVIA 1FBIL 1XTLA 4HK3N 1FNGA 2OMUB 3N41F 3I6SA 1KJ3L 4XP9L 1CGSH 5DJ8A 2V7NB 2VQUA 3REWA 5SWSB 5I6XB 5JOFA 4Z76A 1B2WL 1N0XL 1BOGB 3QJZA 1T21B 3ULUC 1KEGH 4MNHB 1H3WM 1A14L 3BP7A 4P2QE 1FNLA 1AZRA 1F18A 1UKTA 2IDQA 1X7QB 2O26U 4KKBD 4OF6A 3NSDA 4HZ1A 4XHJD 1LE9B 2HAZA 2YUWA 2EH7L 4F9PA 5E6YA 4HPHA 2BVQB 5HHNB 3V0FA 2ATKB 2HT4D 3BO8B 4UTBL 4TNVF 2YWZA 3FUKA 4PY8J 1BBJA 5DFVC 1UFUA 3HPLA 5D7HA 4DP2X 2XT1B 1UA3A 4WTZG 3S8GB 1CYXA 1QO3A 3BLPX 1KIPA 5DJ2A 2QVKA 1DVXA 5D7EA 4MA8L 2ATKA 3KLLA 4PRAB 1QFHA 1T83A 3ISRA 5I5IA 2R29A 4H7VA 2C5DC 3EYUL 3RL1B 1CTNA 1MHCB 2R0LH 4E42A 3K1DA 4M7KL 4HUVA 4IJTA 2DIBA 4ONFL 3VSVA 4X9HA 3RTQC 4XVSL 3UZQB 2J73A 2VLJA 3VACA 4LT7A 3WO4C 1MFCL 1A4KA 4N0UA 3UTZA 4EZMA 4MZIA 1JVLA 3G9VA 1O6SB 4GW1A 5DJ6A 4F7MB 2Z93B 4FMVA 1RAMA 2JI3A 5E8PA 1TOXA 1OGAE 3SOBH 2X9XA 1LQBC 3C08L 3LV3B 3OXSA 1HEZB 2HB0A 4AJWA 1OWWA 3EYSL 4BFIA 2G2PA 1A6UL 1AO7E 3DPDA 1YJDC 2VDRB 2E9GA 5JXEC 3SDCD 5AZEH 3WNLA 4XNDA 3K0YA 4GRLA 3SE4C 1QTSA 3ECUA 4OCMC 5EZOL 1IGYB 2CRIA 2QTEA 3EFDH 3RTLA 2C3HA 2NY4B 5HDQL 1M6OB 4FHKA 4CKVX 1NMAL 4N2KA 4HZLA 1MELA 1FO0B 3SKNB 1KCVH 4OGAD 3LB6D 1UM4H 4IYKA 4Y2OB 4IDLA 4K5MA 5ICZA 1RFDH 5I74C 4XBEL 3HJEA 4FADA 1JL8A 2Y22A 4XN7A 1F6AB 3U6XS 5D7KE 4QXVA 4CGTA 5DT1H 4S1SL 2MPAH 1OCRB 3MREA 1YNKL 4JO2L 4NO3B 4P49A 1PIFA 3HAEB 3DJSA 4LCWD 1K2DB 2DWSA 4OLEA 4WF7A 3PP4H 1LP9A 3TBVA 4C57C 4F2EA 1V7NH 5FFGA 1OGSA 3APFA 2VL5B 4JO5A 2B59A 5ICXA 1ECZA 3B34A 2VERN 3C12A 1YMMB 4FNLH 3HNVH 3ZKQD 1CFVL 2L7UA 1F13A 4LL1A 4EN2A 1DQKA 1WZMA 3ZKMD 1AGCA 1FHGA 2F7QA 3QS3A 5M95B 2NR6C 1AQDB 4ZUSB 4XBMA 4BM7A 3DHMA 4YDNA 3RPBA 3A6CL 1TJHL 2CNYA 3RTQD 3TCXA 1RUKH 4XN9A 2VDPL 2VZVA 2V2TA 3L4UA 1PEWA 1INQA 3NCMA 1M42A 4HV8B 3HMXH 5B7EA 1TU2A 4JMNA 3T0DA 4AM0B 3U9WA 4ZFFA 4KVCH 3P0VH 4WTQA 2QDVA 1WFTA 3QWOB 3TWCH 1C16B 4A2DA 1OF0A 3NIGB 3QIBC 2BDNL 4OAWB 4YR6B 1G7JB 2XFXA 4YSUA 4ZUVB 2DQCL 5DFVD 3O6MH 2YK1H 1FVDA 1RHHA 1F58H 4XWOC 2CO3A 3K6SB 1S9WB 4PI2A 2YD7A 5CKGA 5DRZA 4TRPL 4XHJC 3DHPA 3I9AA 3IRZA 4YLBA 4TQHA 3OKDB 5SWQB 2X4NA 5EBWB 1BMWA 3SGEI 2A6JA 5C09B 4P99A 1PGRB 5EG6C 4WKZA 5GISL 4XCCL 4CAGA 1F58L 2YPLD 1BVOA 1BZ7B 3K7UA 2O5XL 5TJWK 1QZNA 3LQZA 1U8KA 1EBPA 1P7QD 4XMVA 2VKWA 2AQSA 1Z66A 3SDCA 2J5WA 4RBPK 4EI5A 3RWDA 1FG2B 4G6FD 2FEEL 3BHBB 3L6FB 1PZAA 3LPGA 3MCG1 2Z0UA 1OD9A 4IOFC 3ABGA 2ITCB 4E5XG 5I0XA 5I1DB 3OWEA 2JKIS 1JGUL 2CKBA 2PYFA 4Y4KD 1U92A 1MIEH 1PNCA 1RP8A 3QEGL 4AL8L 2NY0D 4JQIH 1BCIA 4Z7NF 3NCFB 4PV8B 4EBQL 2CWRA 4NP4L 1E9PA 1JGDB 3O6FC 4XMPL 1FDLH 4PJXF 1B0RB 4YSQA 5F1NA 2WJ7A 1H3VA 2QPSA 1KCVL 1NFDF 1RHHB 1XR8B 3VFWA 4PV8A 4DVRH 4JANA 5JR1H 3MDJA 4G8GB 4KVNH 4DFIA 3ZU8A 3Q13A 1A1OB 5I1IH 5D2LE 4FFYA 4KO9A 3JV6A 5BRPA 4ABUA 4HC1L 3UERA 4J5VA 1HSBB 4R97B 5EFIB 5I8OH 3F64A 4EVNB 3RWGB 3LOWA 4A7UA 2ESVE 3VDAA 4JO8A 3TN0C 2V37A 1J18A 4WFED 2MOQA 2A9DA 3F04A 1WD9A 2XWJB 3V0VB 3OPUA 1KGYE 4FXTA 4AVIA 1TIUA 2JSFA 1WIOA 3GRWH 5B22A 2P5WB 1U58A 3QNYB 3TJPA 5HHXH 4YHKH 2EABA 3V4VB 3T4AB 3WEXA 3VI3A 3LQZB 5C09D 3DVIA 4U2ZA 2Q7AA 4Y89A 5H37H 2YKKA 4A2EA 5E08H 1I85C 4XBPA 1LTXA 4N0UB 5AOMA 2ZUQC 5JQHC 4Y4FB 4LCUA 4WSKA 5D71L 5IEHB 4L4VE 4HDIB 4X50A 1N9PA 2MTAA 1BM3H 5E99H 3TA4D 4D0CA 4LL4A 4TQ8A 3I6LD 3FQ2A 3EYUH 4OKVB 1IAIL 4YHZL 3ARBA 2WWMC 1NL0L 2HFGH 1E4HA 3KHOA 4JHAH 4PPTA 3AREA 1L9MA 3GM0A 3MXVH 1YJDH 2H0PA 2VXQL 3IWUA 3QZBA 2BPBA 5HXMA 1CLOH 4PJIB 1MJ7H 3VXSE 2DLFH 5D1XD 1SOKA 3DLQR 3T2OA 4Z7VF 1AJ7H 2DM7A 3V4LA 1VFOA 1K4DB 3OLIA 3ZDYE 1OVZA 4A39A 5JHLA 1IGIH 2HFEA 3V6OE 4FCHA 2F5BH 2LHAA 6PCYA 4E2OA 1OAZL 5DJAA 3WYRA 2QKIA 5KSUB 4YS4A 5JMRA 1OGAA 4WFGE 2CMRH 3MV7B 1RUPL 4L3CB 1AXSA 1VF5C 3CZUB 3CFTA 3MXVL 1GGTA 4JHBA 5CLTA 5D1XC 4LE8A 5F3BA 5AYUL 3LKOB 4JNXA 4QTIL 4RGNC 5B3NA 1JJUA 6FABL 2RA1A 5DURD 1QLRB 4KKQA 3SDDA 3HI1B 4O2EB 4JO3H 4PTTB 1WJ3A 3ALPA 4F27A 3OHXC 1CLZL 1LO4L 2CA4A 4IRZL 4JY5H 4KQ4H 5GIRB 2ZICA 5F8RC 3F7YA 3PP3K 1QA9B 5B1BB 3V0HA 3DURA 1U8QB 3P11L 4CA4A 3CC1A 3FSAA 1QRND 4NOBA 5FGBA 1H15B 3B7RL 4OT1L 4TNGA 4W9GC 3NIGE 3P73B 5IW1A 4QRAA 1XMWA 1S7QB 4IRJA 4BWTA 2P7TA 4U3XA 5INCA 4OSUH 1T7XA 1IB5A 5L7XH 4KNQA 1HHHA 5B1JC 1B88A 4LP8A 1TMCB 3QT2A 4IBTA 1Z0NA 4ZAKC 4HUNB 4X5PA 3ZN6A 2QTVA 1FFNA 5K9OB 2OA9A 3P3SA 1OGAD 1Z6JT 1KTDB 4RH4A 3AXIA 2ZXGA 2GSIA 2YRZA 1UM6L 4B0MB 1IBHA 4HK0A 3GSUB 2PN5A 2VSCA 2E0PA 4HV8A 3ILPA 5KS9E 3WG7B 1UH2A 4JKLA 1QD0A 4KTEH 3RVVC 2ZX8A 4GAGL 1F8TH 2BNRE 1WEJL 3MGAA 4Y9FA 1NCAL 4LLQA 5AAWC 3BDYL 3VVVA 3SE3C 5JORB 4J8RA 2J6EH 3LZPA 3B7TA 4WK4B 5CLYA 4P5KB 2DIEA 2ZXBA 4NXSA 3VXMD 4CU6A 3UPAA 1NFDE 1MPAH 2LFGA 3MX0B 2QGDA 4QXTA 4XP5H 3V52L 5D5MA 3CVHH 5CIPH 2GTZB 3I02B 5LNDA 3IDNB 2KPWA 5C0FA 1BGXL 3JV5A 3IDJA 3R19A 5DEFA 5MENB 4WZ9A 3L1FA 5DJXA 3ESMA 3BFQG 1N4XL 4CBZA 4R2GD 1EO7A 2Y7SA 4IEFB 3S5YA 2D7OA 5C0ND 4JPSA 2OV0A 3L17A 4LVOC 2XKNA 3UTPD 2NDGA 5I1KL 1QR4A 5TQ0L 3MRCA 5FFOA 3QFJE 5KSVA 3TO4C 1TQBB 2YRLA 1AY1H 3VH8G 4APQD 1A6TA 5BO1L 4P04A 3MJWA 5T3XD 3K8LA 4K23L 3P77A 5H35B 1X4ZA 2B2XH 1QFWH 2WBXA 3DGGB 1RULL 3QS2A 1AS6A 4BSWB 4K3EH 3SJVA 2YFOA 3CQFA 3EBAA 4MDIA 2ZG1A 4PS3A 2D7QA 1LEKB 1IC7L 3RLSA 1EWHA 1HC1A 1KIRB 1W80A 1LEGA 1X5LA 2LLNA 3MRKB 4TN9A 5C6TH 1GIGL 1GSMA 4BINA 3BJLA 4O2CB 5F7DB 1SUJA 5TPWL 4YZWA 5J89A 1FQ9C 1DQQA 4HKZA 4H20H 5BV7B 3CFMA 4HLZH 2H1LM 2ENJA 2YBGA 3STLB 4Y1SA 3MRKA 3HZKB 1CLOL 1V3LA 2AJYL 4G7VH 2YMTA 1G7MA 3K0WA 4ZPVA 5FUZL 1T80A 1Z32X 2RB8A 3QFJB 4EIZC 4EUPB 3L81A 2IWFA 3GEFA 4ONHA 1WAAE 2EDOA 3P77B 5BVJB 2MQGA 2UZPA 1UUSA 3TWCL 5SWZA 2Y5QA 1G0DA 4N68A 2ZWLT 4P3DB 2ZE0A 1VJSA 4Z7OB 3NH7H 3E6HB 2N01B 2A6IB 3E1ZA 1W8NA 1PDKA 5AOJA 2ZKHL 2DOCA 5DJDA 4BHUI 3ARGD 4YHOH 4WEEA 4RMWA 5CBAB 3HFMH 3OKDA 1HT6A 1QW8A 3WENA 5BZWB 4PRHB 4HCIA 2KL6A 3QQ4A 4AMXA 4LOVA 2PCFB 3FPXA 1JXFA 2A77L 4H8QA 4P06A 2VAAA 4B0MM 2PUQT 4AGMA 4GKNA 2HRGA 2CUMA 1WT5C 4Y8AA 1NKGA 3K6FA 1QPXA 2P26A 2FJUB 3V8CA 5DZ9A 1N19A 2OTPA 3TEXA 4HC1H 4F8QA 3VQ2C 2IEPA 3RX7A 2NNFA 1IGYA 3B7UX 2A3TA 3RY5A 3M8OH 4YLQT 1QSFD 1E90A 2NTFA 3UYRL 3VXQB 5T3XH 3KPLB 3Q5TA 4P9HH 1R4XA 2OSYA 3OAUH 2RIKA 5BW7A 2K6ZA 1S9YB 3D9AL 2B5IB 5EEZA 1RLBA 1GZHA 2G4GA 2ENYA 1T0MB 2NMSA 3LH2L 2NXYB 1U8OB 1MDAA 2QSCH 4DP5X 1CBVH 1U93B 3IPFA 5KAQG 3OKEB 1KYOJ 3HKFA 3QAZC 1DJZA 1NQBA 1RJZB 4UTAH 1XR8A 1FVCB 3VFSA 1WIUA 1FZJB 5FO8A 2PCFA 2ITEA 4DUXA 1IQDA 3Q01A 5DZOA 1I7ZA 1LJMA 1MXGA 4C4KO 2C9AA 5KW9L 2XV3A 1JGDA 2XA3A 3UX9B 1GGCL 5JXED 3ARDA 3LNDA 1NFIB 3MOQA 1GXEA 3HI1A 1N6QL 2I25N 4FFZA 3MV8B 2XV2A 1NUNB 1ZLUK 4GMSH 1I9RL 3GJEB 3KYNA 4X42A 1B4JH 1SMOA 2NY3B 1E9OB 4XNUL 3F12A 3UC2A 4WFHE 1F90H 2G30A 1G1KA 3CHSA 2KYIA 2YMOA 3UACA 2Z1KA 4KJYA 1TTFA 2FH6A 5HHMD 3MHZA 3WFEL 1QKZL 1D6EA 2AEPH 4BZ2H 4P23A 3O9WB 3ARGA 1T66C 5HI5C 4MFHA 5IR1B 1U8OA 4ODVH 1ES0B 3JUZA 1WO2A 4NM8H 3ZE1B 4M4PA 2M2DA 4KJPD 1GIGH 4LSQH 3FRPG 2I7SA 3B2VL 4E41B 2LQRA 2W60B 4UAOB 4WY7L 3X1GA 1PL3A 1XGRB 3BW9B 1T1YA 1IQDB 2FSEA 3MNDA 3G5VA 1KYFA 4H26A 5E8OB 1AIFB 2AQ2A 5T5NG 4M3JA 4BQBA 1A7OL 4XMXA 4NHUB 1WBZA 5GXBB 2VB5A 2YZ1A 2PTTA 3G5XB 4DH2A 1KN4L 5CAYB 2JWYA 1A3RL 4JHWH 1UYWH 3GSXA 5FYKU 2D3LA 3MGTA 4HIIB 4XMLL 5CF3A 1BQLL 2QQLL 2IH3B 1KTKE 3QULB 2OXHA 2WCSA 3BDYH 3AFLA 1OW0C 4E9WA 2EYRA 4AENA 4U1JA 1UADC 2B1HL 1NCNA 5GGQH 3JBG7 1UD6A 3TBSB 1HZLA 1CGTA 4RMVA 4DCQB 1MF2L 1X5ZA 1ASQA 1IARB 1MN4A 2TRHA 2X9WA 4RAVB 3FS9A 2ICWJ 2YSSA 3VDCA 5GGTL 3DHJA 4JL1A 3ILEA 4BRVA 2P5WE 5GISH 2J6EL 4FQCL 1DQIA 4C47A 1VA9A 4OZFA 3LSOB 2PWGA 2E7HA 3LPFA 4Y1AB 2X53A 43CAB 1X44A 2OXGB 2J6WA 2FIRT 4OIAA 4P4RA 1CD1A 1II4E 2WBJA 3FB6B 4HWUA 2MRYA 1CK0L 4M4RA 1TTAA 4ZTPH 4CW1B 3SIKA 1NA8A 3DK0A 1QW9A 4U31A 4XX1G 1EDQA 2EVGA 5D7JC 1BZQK 1JXDA 2DH2A 4NN6B 2XVKA 3NZ8B 4JFWA 43CAA 3ZR6A 1C08A 4QIRA 2YGNA 1R3IH 1ZLUH 1YEHL 3VFVB 1BFVH 1SEBA 1H6UA 2E8YA 3FOMA 3V0JA 4M7LT 1BP3B 5HHME 2ZSWA 1MHHA 1PLBA 3M7OA 1ZTMA 2P8MB 3T0BA 4KFMA 3HAEH 1NCCL 3G08B 3A6BL 4U1JB 3ZT7A 3A3YB 1HWGB 2GTWB 5FO7A 2C1OB 2CLVB 1JZEA 4PJAB 3I9IA 5FYJL 3IFPA 1P6FA 3NRQA 3UG4A 2ILLA 3R4RA 4UF7C 4M5ZL 5JUEH 3BP5B 3P4MA 4HKJA 4RZCA 2JELL 3QO1B 2PW2A 3DO7A 3GIVA 4K5PA 2APFA 3AM8A 2ENPA 2D2OA 4CILA 1IT9L 3VFVA 3MLVL 3EUDA 2OZNA 1KGJA 2IFFH 5I1JH 3O8XD 3VXNB 5I76A 4UQEA 2GBVA 3PWVB 4GOSA 5D5MB 3LKRA 1G1YA 3PU7A 4AV4A 1DBKH 1F56A 1TZOA 4YXLL 3RZCD 3HG1B 2R1YA 2OXGA 1N8OE 2I32A 2YUXA 1QLFA 1UWYA 3L3OA 3UGUA 2AFNA 4F20A 1PZBA 3OZ9H 3GRBA 4JJOA 5B39G 3U25A 4ORZC 1O7SA 3D2UD 4N5UA 1XGTB 3L16A 1TUPA 1PAMA 5I0YA 1VKXB 5SX5H 1RULH 5DZVA 3KPRD 4I85A 5K9JH 2YC1B 3Q1SL 3MNVA 4YE4L 4TQEH 3N1QC 4AW4A 3C2AL 3RWIA 5DHXB 1AGFB 3MRJA 3NCCB 4R4FH 4M5YL 1YEDB 2EDDA 1YPZE 1TVHB 4N0YL 1SXCA 2QZQA 4JCMA 5AD0A 2EXTA 2GKIA 2VJ8A 2EDBA 3DO7B 3E6FB 5ELIA 3PAVA 3M45A 5I8OL 2UWEA 4ABQA 2IXQA 2VLKE 3QXDB 4AG4H 4FEIA 5ADPH 3IFPB 1WFMA 4CN1A 2P5WA 1EFXA 5CR8A 4ZQKA 2HUHA 4Q97A 3ABZA 4I2XB 1I3RA 5H4YA 3WJMB 1LNUA 4K9JA 5LBSA 1D6VL 4I18C 1QNZH 1Z3GH 4Q6KA 3APDA 2NY6C 2QQQA 4F7EB 5ICXB 3MLSL 2GC7C 1T2JA 5KANG 3PJSA 4QRRA 2J72A 2MWCA 3LQAL 4DKDC 3BWUF 4XP6L 4ELME 3DOIA 4U3SA 5DZNA 3D25A 3EJZD 3OG4B 5C0CA 5C0JA 4WW2F 1E2WA 2HTKD 3EXJA 2VXUH 4JRYD 1XF4A 1R33A 3KNBB 1EJOL 3S5LG 5IQ7H 2IXQB 2MMXA 4AYGA 1Z5YD 1ZT4B 3FF8A 3LH2H 4QRQB 2FLMA 3IMTA 3NN8A 3I9GH 2FX7L 1MWOA 4HUMB 3EGDA 3OR7B 4YHYB 4M5SA 1E4KA 5CHNA 4AYID 3IAGC 5D4HA 1XWVA 4XVJH 2ZPKL 4N2EA 4LIQE 2KC0A 4K0OA 5FF6B 4ZMAT 5KS9F 3IXTA 3NIDB 5IBLD 5IP4A 4R4BA 1YPZA 1NDGB 4TL4A 3QZLA 2XZCH 4G43B 1CGXA 3FYEB 3QDGB 4EDWH 3ULVE 5D8JH 3BAEL 1G9ML 1YMHB 2LOEA 3KH3A 5E9DB 5LBSL 2OZ4A 2J1YA 4HX1A 3II3A 3K4ZA 2OYLA 1WRFA 5K9QI 5AW1B 3GMNA 5DRWB 2PXYA 5FKAB 3GWJA 4YAQB 2P5EA 4BK4A 4MCZB 1G7HA 3FUNA 3JWNE 5T3ZL 4EZKA 2BRRH 1I3RB 1A1NA 2C7UA 4UUJA 1LMKA 1MHEA 2J5LB 4PJ5D 4RLDA 4OCXL 4X5XB 4JO2H 3SYPA 4DN3H 5CJQL 1Q9OB 3H2QA 2OMZA 5I0VA 3X14A 4S1DD 3UL4A 1U8IB 2GQHA 4K7PX 3IFOB 4PW3A 5TK4A 3QUML 3EFOB 3O6KH 1QUPA 3DX9A 1VCAA 4B97A 4F8OA 3QIBB 1XXDC 2DQEH 5IEKA 4QMEA 1D9KA 2H41A 2YAPA 3K4DA 4P59H 4MQSB 2AHIA 3PFUA 1DJGA 5F9JB 5IFAL 5BV7H 3QIWA 4NWUH 1EHXA 2WANA 2C9XA 3DX8A 3X1NA 4JPVH 2BNQA 4W9FC 4BKSC 3T3PB 3NA4A 1ZOXA 4Z0XA 4Y4KA 4PGBB 1A0QH 4YBQC 5EU7E 3MCLL 5J9PA 5KZCB 3Q9PA 4OD3L 2XVGA 3GMMB 4N90D 1BF8A 1MH5B 4Z7VE 2XG5B 2VRKA 1UOWA 3ZTCC 3NEEA 2E76C 3B9EA 4B7LA 4NQQA 2C7UB 3CN3A 3HFFA 4Y16A 1NPJA 2J8HA 4JGMA 4V1DE 1W8EA 3Q05A 3C5SA 3O9WC 3E7JA 5F7EL 1PG7H 2PXYB 2VZTA 5FKAA 1H0DA 2QGBA 2H0JA 1R46A 1B3IA 1EV2E 2BVPB 4S1SH 1ACCA 1AS8A 5GGVY 3F7KA 2R51A 4AJVA 4B9ZA 3HI5L 3BUBA 2AGJL 4OB5L 1GCYA 1TJXA 2GHZA 3MRFA 3RVTC 4ESKA 3AUVA 1QFUH 3CHRA 2ARJB 5DJZB 2IBZX 5IMLA 2RAMA 1RIUH 2CCLA 1EUUA 3SDAA 2GEEA 3CPLA 3OLEA 3QIWD 4PLOB 5DFWH 3RU8H 5KZCD 1JZDC 3BGMA 2HKFH 3CFBB 1CXEA 3IJ9A 1A7PL 4J6RH 5J3HC 2EE3A 5HHMB 2COQA 4Y9GA 5FUCE 5F88A 2IQ9H 1YYMH 3F6IA 4ZPTA 1OAQH 3VCLB 3PAYA 3DMMB 4XP5L 4BUHA 4R4ND 5CMAA 4WI6A 3FK3A 3WKPA 4FNQA 4LSUH 3V4UL 1WK0A 4X4YB 3L2LA 4F8PA 4HIIA 3CN2A 3TEUA 4OFYD 4L8CB 5C6PB 1Q9WA 1ZLDA 3QUXA 4GW1B