1OE1A

Atomic resolution structure of the wildtype native nitrite reductase from alcaligenes xylosoxidans
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
336
structure length
336
Chain Sequence
EDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of Native Copper Nitrite Reductase from Alcaligenes Xylosoxidans and the Active Site Mutant Asp92Glu
pubmed doi rcsb
molecule tags Reductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 94
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe1A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe1A02
1X9UA 2DV6A 2IWKA 3KW8A 2VW6A 1JXGA 1A4AA 3FQ2A 3V9CA 3OMAB 1RZPA 4HCIA 1PLCA 2X88A 3C75A 3FSWA 1IC0A 1NIDA 3FU7A 2YAHA 1URIA 4BK5C 2J57A 4YSPA 1NIAA 1SDDA 5I6LA 1KBWA 2IDSA 4WKXA 5ANHA 1MG2C 4HAKA 4DP5X 2H5UA 5TK2A 2J55A 4BWWA 1A4BA 4PCYA 1CYWA 4BWUA 1M56B 1N70A 1PLBA 1GY1A 6PAZA 5I6PA 3TA4D 2YAMA 3UGEA 4EF3A 1J5CA 4N8UA 2HRHA 1SHWA 2MTAA 1CC3A 2FT7A 4YSDA 4YVNA 2VM4A 4E9TA 3DKHA 3FU7B 1IUZA 5I5IA 1AACA 4E9WA 2W8CA 3GDCA 1NIEA 4YSSA 2BP0A 1FFTB 4W1TA 2JXMA 4DP4X 4YSUA 2FQGA 1AIZA 1SF3A 3X1FA 2XV0A 5B1KA 1RCYA 1OE1A 4BXVA 1OE2A 3S8FB 3N2JA 3H56A 3PAVA 1RZQA 1NINA 3WI9A 4E9VA 1RKRA 2HXAA 1NWOA 5AKRA 1JOIA 1ET8A 4UANA 3FQ1A 1OCCB 2EIKB 3NJGA 1A3ZA 1PCSA 3IBOA 3OM3B 3DIVA 1XB6A 2J56A 1T5KA 1M9WA 3T6VA 3X1BA 3ERXA 4E9SA 4YSRA 2R7EA 3WNJA 2XX0A 3FS9A 2EINB 2CCWA 4HALA 1CURA 4NAJA 4A2FA 2Y1AA 1E5YA 1QNIA 1TEGA 3NJHA 1NIFA 2BO0A 1AAJA 2XXFA 5B1JC 1OCZB 1GW0A 1J9RA 2OV0A 5B1BB 4DP1X 1GYCA 1TEFA 1AS8A 1V54B 4G7QB 1EZLA 2PPCA 1BXAA 5B7MA 4DPBX 2BP8A 1PMYA 1AZCA 2QDVA 3FU9A 3IN0A 1E30A 4QLWA 1M57B 5D4HA 1ID2A 2GBAA 4E9QA 3HEIB 2NRDA 1WA1X 4YSTA 4DP6X 4KNTA 9PCYA 2GC4C 4KO6A 5I5JA 5B3SB 3NJFA 2DWSA 1BQ5A 1AOZA 2EILB 2CAKA 2YAEA 1HAWA 3H4HA 3NSFA 3JTBA 2ZOOA 2FTAA 1AZNA 3ZX1A 2TSBA 2A3TA 2VN3A 3QJVB 2FJSA 4KNUA 1JXFA 2VSKB 4BWTA 4AI7A 3FYEB 1PAZA 2UXGA 3SBRA 4HIPA 2FT8A 2DYRB 3UAEA 2B08A 1NDTA 4KO7A 1WS8A 2VW4A 2UXFA 3PXLA 4YSCA 3CVBA 1PF3A 4ENZA 4AKPA 4HCFA 3CDZA 1GS8A 2YAOA 1A8ZA 2HLEB 4E9RA 4QKTA 4A2HA 1AS7A 3FSZA 4W9ZA 2XXGA 3T71A 1JERA 1ILUA 3SBQA 1L9TA 1J9TA 1TU2A 2PCYA 1IBYA 1OV8A 3AG1B 1AG0A 2FT6A 3N55A 3HB3B 3ZBMA 1A4CA 3ASOB 3UADA 2YARA 4A2EA 4A67A 2ZWNA 2XU9A 3NYKA 1E65A 3PLYA 1A65A 3OQRA 1ZDSA 1GS7A 1ASQA 3NSDA 2CJ3A 4YSOA 4A2GA 4TXVB 4Q89A 1JZFA 2GC7C 3ZDWA 2MRYA 4UF7C 1V10A 3TBBA 4YVUA 3PCYA 2HX7A 3GXUB 3QJQB 3T9WA 2GB2A 1J5DA 1SFHA 1PZAA 1SJMA 1SHXA 3NJKA 3PAUA 1KBVA 1FWXA 3EH3B 2CALA 2UXTA 1R1CA 2PP9A 5PCYA 2XLLA 3EHBB 1ILSA 1JVLA 2IH8A 2Y69B 3EH5B 2YAFA 1ASPA 2H3XC 7PAZA 1AZUA 1OCOB 2WO2B 2PP8A 4PAZA 2CBPA 3BVDB 1L9QA 1HFUA 2R7EB 1IKOP 2FNWA 3AG4B 2AVFA 4M3HA 4G71B 3PAZA 4KOCA 4JHUA 5D4JA 1PZCA 1BAWA 2OCCB 3FYIB 3BQVA 2IWFA 2ZONA 1ZIBA 1L9SA 3S8GB 3AY2A 3QJUB 5B1AB 3MX0B 2VMJA 4AX3A 1JZIA 1OE3A 4Q8BA 4YSAA 4FA7B 1YLBB 4RH4A 1BYPA 2PPDA 2DY2A 1CYXA 1W6LA 1ETJA 1L9OA 3WNIA 4HHWA 4YL4A 1QLEB 2BP0B 4DPCX 1J9SA 4DP0X 4ZK8A 1MG3C 2B3IA 2GI0A 2XV2A 3NSCA 4HHGA 2BZCA 2P80A 3SQRA 5B1JA 5EHFA 3X1GA 2Q5BA 4KO5A 3FQYA 3EF4A 4MFHA 1NTDA 1DYZA 2H47C 2BHFA 4F2EA 3QJRB 1SF5A 1AZBA 4E9XA 3T6ZA 1L9RA 3SBPA 1AZRA 5I6NA 4N4YB 3OD3A 4X4KA 2AFNA 2RACA 3TBCA 2GSMB 2UX7A 3UABA 2QT6A 1L9PA 3NP3A 1XMEB 3NP4A 1ZV2A 1MZZA 1KYAA 3NJLA 1KCBA 2FQFA 3WG7B 5TK4A 1ASOA 4HZ1A 3TU6A 3X1EA 3MBWB 2HZHA 2ZXWB 1PLAA 1BXUA 3S3DB 3X1NA 4DP9X 2JFCA 1BYOA 4GXFA 5F7AA 3S3CB 1NWPA 1OOWA 1B3IA 4A68A 5I6MA 3FSAA 3CDZB 5F7BA 2PPAA 2GHZA 2UX6A 4DPAX 4AKQA 8PAZA 1SDDB 3NJNA 2YAPA 4AKOA 4DP7X 1BQRA 2EIMB 2BW5A 1HAUA 2AANA 5I6OA 4HCGA 1OCRB 3V9EA 1KV7A 2XVBA 5I28A 2YAQA 3KW7A 3NJMA 1KDJA 2IDUA 5PAZA 1SFDA 4GP8B 4JKNA 2WO3B 1NZRA 2PLTA 2YXVA 2AZUA 2HRGA 3CVDA 3QQXA 2I7SA 2J5WA 1W8EA 3ABMB 4P5SA 3NSYA 3S3BB 4A2DA 4G7SB 2BWDA 4GYBA 1NICA 4F7KA 1W6WA 3L45A 1KCWA 1XB8A 1E5ZA 2IH9A 5B7EA 2XX1A 1WA2X 3NT0A 3AG3B 3FPXA 4DP2X 3WKQA 3QPKA 1PY0A 3FT0A 2VSMB 4L0PB 5I6KA 3U25A 2XV3A 6PCYA 5A7EA 2CUAA 1AR1B 3OMIB 3X2QB 3WIAA 2IDTA 3GYRA 1PNCA 1ZIAA 2I7OA 1MDAA 3CZUB 2DYSB 5B7FA 3G5WA 3AG2B 3H4FA 7PCYA 1NPNA 1JZHA 2HX8A 2FWLB 3FU8A 2BW4A 2EIJB 3QJTB 4CSZA 1SNRA 5D4IA 1KDIA 1F56A 1ET5A 1GS6X 2N0MA 4F2FA 1XB3A 5LDUA 2UXVA 2QPEB 2LLNA 1KGYE 2DWTA 3CVCA 2HX9A 2YQBA 2I85A 4A66A 1UATA 3AW5A 3CG8A 4BDVA 2VM3A 1ET7A 1JVOA 2XUWA 2PCFA 3QJSB 2W88A 1BEXA 3UACA 2BZ7A 1WA0X 4JHVA 5AZUA 2XWZA 3FPYA 4G72B 2IAAC 4CSPA 5FC9A 2BP8B 2QDWA 4GP4B 2PPFA 4P5RA 1I53A 3EH4B 3ZIYA 1ZDQA 4KO9A 3T6WA 1OF0A 2QPDB 1IBZA 1X9RA 3PPSA 1TKWA 1AS6A 4UAHA 1PNDA 1GY2A 1GR7A 3NJJA 4KNSA 1QHQA 2IDFA 3ABGA 5IY5B 4G7RB 1AQ8A 1N68A 1NPJA 1WS7A 3IEAA 4GY4A 1V55B 3WKPA 2AZAA 3IE9A 4K9JA 3ABLB 3ABKB 1WAEA 1DZ0A 1NIBA 3RYMA 3T6XA 4E9YA 3UAAA 2BWIA 2X87A 4FAAB 3IN2A 1VLXA 3ASNB 1JZEA 2JKWA 1GSKA 4BXSV 2IWEA 2FQDA 1J9QA 3AZUA 2OJ1A 4AZUA 1ADWA 1AANA 2P80D 3JT2A 2FQEA 1MZYA 1CUOA 4DP8X 4M4RB 5I5MA 2GIMA 4YSEA 2VW7A 4YSQA 4NERA 4WTQA 3DTUB 1JXDA 2TSAA 1E67A 3TASA 5AFAA 1FA4A 4G70B 2YXWA 1BQKA 1BXVA 1JZJA 2E86A 2Q9OA 5E9NA 1EHKB 1JZGA 2IDQA 3NJIA 2PPEA 2WSDA 5I26A 3D12B 1AG6A 4KOBA 4GP5B 1PZBA 4NB7A 2XYBA 3OMNB 2PP7A 4BDVB 3FSVA 1ZPUA
chains in the Genus database with same CATH superfamily
3NCXA 1P6AB 3LRMA 2FLRT 1RUMH 5LGYA 2YGPA 1W2KT 3K72A 3V9CA 2BOBB 2HT2D 2VDNH 1RZPA 1PZ5B 2ITCB 1P7HL 2EEFA 4M7JL 2Q2LA 3HE6D 2R83A 2D7QA 1URIA 2EE3A 5BS0D 1ORQA 4MKTA 1BM3L 3U82B 1S5HB 2YA0A 1OAXL 3F7QA 2V17L 1J0IA 2H5UA 4RGND 2A9AA 4Q0XH 5C0BD 5BO1H 3Q3GA 3LPGA 3B8YA 1XZ0A 2J1ZA 2H1PH 1ZLSH 3P9MA 4K94C 4PFEA 4Y2DC 4OZFB 1TZOA 1MY5A 4C8XA 4L4VE 1RURH 1U2CA 2DIBA 2VM4A 2VQ4A 3GT6A 3VM5A 4WI9A 3U9UB 5I5IA 2WXGA 2OSXA 3MOBL 1OO2A 4K3GA 3SSGA 3R0MA 5I15H 3CBJB 2ICCA 5DRNA 1ED3A 5CD5D 1T66C 2PYED 2JXMB 1JHTB 3PREA 1ZRUA 4WDIB 3WTVA 4XHQA 5L88L 3E6FA 2WN3A 4KHXH 5GSRA 1KJVA 4X6CA 1EHXA 4P9ML 1JGLL 4NHCL 4ZMYA 1H8NA 4FFVD 2F7IA 1J8HD 1CICB 2H8PA 1IGTB 2BNRE 1JNLL 1J8HE 3LKRA 2V7NA 1SUJA 4NC1E 4JEGB 3GMMB 4EDXA 3DXAE 1QD0A 3QXDB 3MTRA 5BV7C 1SOSA 4IS6A 3C8KB 3NJGA 2AITA 2QQLL 4WNQA 1PCSA 2NYKA 3UZVB 2LW3A 1FG2B 2WQAA 1CD0A 1I9JL 2Z93A 1XB6A 4YK4C 4XMVA 5CEZD 1F3DJ 2FEEI 1FZJB 4FEMA 2XVGA 2P5EB 4LLVB 2GTWB 2UY7B 2FJGA 1W9XA 3JTSB 4MCYB 3N6YA 1RK0A 3QAZB 1RP8A 3KWXA 4B7IA 1QR1B 2VDKH 3F8UB 4HD9A 2N3JA 3EHBC 5I9QC 2H0EA 1KXVC 2H26B 3PL6B 5GRZA 2PWGA 3TH2T 5BUAA 1UUSA 3MCYA 4YHLL 4DQOH 2GAZA 2G5BA 2WZ0A 4XO3A 1TQWA 2OV0A 4IDJH 4XXCA 1GYCA 3DXAA 2ZOTA 3O3BB 4G7QB 5IOPB 4RDQF 2CCVA 4O4YH 1A3LH 4TVPL 4XNXH 1C12B 2VLKB 3D3VB 2R23A 4KGLA 2J43A 1VKXA 5HYEA 3TEZA 3V4VA 4YSTA 2HFFB 5A3IC 1N6VA 4TPRL 2CLVA 3LZRA 3OKLB 3FTYA 2KLSA 3EYSH 3QI9B 2DLFH 3BVNA 4GI6A 4DEPB 3JTTB 3KLQA 3IDYC 3WO4C 4BYHA 5IMOB 5J6GA 3C2AH 4UT9L 1WZ1H 2IQAA 2Q7NA 4W68A 4WUKH 4A7GA 5FHBH 1PGRB 2EUXA 5BUPA 1JPGB 4E41D 4HX1B 2DD8L 4UMSA 4WFFE 3B2VL 3BRFA 2CRIA 4JG5A 1RJZA 4KY2A 3EXLA 4X6BB 1LK3H 2GABA 2A9NL 1DQML 4HEPG 4MBRA 5ITFA 4G9FA 5IJVA 2BFVH 2MNJB 2KI6A 5H94B 4Z95H 5SX4I 2VERA 3UP1A 3VRLF 4EI6A 1ANUA 1U95B 5FGSA 4ES9A 4B9KC 4AXWA 3NK4A 3NIGB 3FB8B 4GINA 3BZ4B 5AW1B 2YAOA 5DURD 2EO1A 4GPVA 5M95B 1NMBL 1UVQA 2W0FA 3OXRB 2TRYA 5ALBH 1EXGA 3BWUF 4LIQL 1GCYA 2A4ZA 4P23B 2DH2A 4ZRGA 3T71A 5HGAB 4NOBA 1OPGL 4X5WB 1R0AL 3PP3H 3DSNB 3LXCA 1LTXA 3BEVB 1WG3A 3GWJA 4YHPB 4J3SA 4UQ9A 5EIVA 3LEYH 5IQ7L 4TVPD 5E1AB 1CG9B 4GMSL 2EDQA 2JJTC 4A67A 5FW6A 1J87A 3NYKA 3PLYA 1E65A 1VSCA 2OMWB 3OHXB 2XVLA 4Q9BA 3ZDYE 1JYXA 4TL4A 3HMWH 2NY0C 1KTLB 5DUPH 4HMCA 5DK2A 2X2UA 2NDGA 5DGQA 2VAJA 5AWNL 4A2GA 3PV7A 5KUMA 3RNKB 1S7XA 3EBGA 4KTYA 5DI8B 1ONQB 1L7TH 1MFAL 3EGDB 3LS5H 1JV2B 5F1NA 4R84A 5HHNA 4I18C 5DZ9A 3I9GL 4F7PA 1FZOA 5I1AB 2K8QA 1ZHBB 2JH2A 2NTFA 4Q56A 1OPOA 4ERSL 2EECA 4KJPD 5EF3A 4IEFA 5KBPA 3VGBA 2AEPH 4LCVA 2EE0A 2H1XA 3VD0A 1UHVA 5AEAA 5A2FA 1NGPL 4A6YB 4ZFZB 1JVLA 2Y69B 2H3XC 3U2JA 5I19L 1OLLA 4QRPE 1U9KA 1GGUA 2OX5B 3T3MF 3F7YA 2NY3D 4HXBL 3CX2A 4U4IA 3S97C 2FB4L 4M3HA 1DQQA 3FUHA 1NFIA 4MD4B 4B9ZA 2BNUA 1J8KA 1IGFH 2WCPA 5D4JA 1R24A 4XWGH 5BZWB 5GS1C 3AB0C 3TPUB 2XN2A 4PJ7B 2F15A 5ESQA 4Y16A 3QHFL 2NSXA 3QJUB 4P4RB 2OMVB 3OSKA 3WS3B 3KLAA 4YDKL 4WSGA 2WKGA 4I3RL 1BZEA 1XT5A 3X3FL 3C60B 5CJOL 3Q1EA 2YIHA 3IDNA 4L05A 1QQDB 1DVTA 1ZY9A 1R33A 4PV8B 2GBTA 2V5SA 3MV9A 5EO0B 5LO7A 1CXFA 2JKTM 3VAEA 2DQTH 2YQ3A 3ISWA 5H2BB 1IBFA 5C86A 4RGMC 4HHGA 2P80A 1RY7B 3PHQA 3CZNA 4IU3A 5D1ZD 3CLFL 2AXJA 4TUJB 4NJ9L 2TRHA 1GGIL 3MHZA 4PMFA 4MB4A 3W57A 4HJUA 4UDUA 1MAJA 3Q05A 1AZBA 2Y0SA 3SKMA 4WEBL 43C9B 5EN3A 3MSPA 1WTGT 4L1SA 2HH0L 2AHIA 1K8DA 3OD3A 3SDDD 3QDGA 5EEZA 5AW0B 2RACA 4CJ0A 4Y4KB 3SOBL 2R4SH 2X44D 4JG1H 2CXKA 1D5XB 2QT6A 4MZ3A 4GQ9L 4BZ2L 2ZX6A 3LZQA 1WV7T 2P8LB 1Z9PA 1XSJA 3EH2A 1MRDH 3I85A 3PDDA 2CK2A 3TPKA 1U41A 5BW7A 2NY7L 1MAML 1XIWB 4S10A 5INDA 3X1EA 5F1NB 1MJ8L 1FYTD 3FF7A 1A3RL 1NWPA 1OOWA 3PQYB 3RX7A 3TN0B 2LABA 1GA2A 2JB5L 5TDPB 4EZLA 2DWXA 3DVNA 5KVGL 1XVSA 3L54A 3HJ0A 3EO9H 1Z0MA 1D7CA 4MJJA 3B2VH 1WPCA 4ONHB 1MVYA 3P4NA 5DFTA 2J4WH 2VXVL 4J6RH 1BZOA 4TSCL 4PWJA 2FECI 2FB4H 3IRCA 1OCRB 3N43F 2I69A 3C2AL 4G6AD 5FYJD 1A4KA 1U8CA 2X89A 2XXCB 1X9QA 4OFQA 4WY7L 3KW7A 2V7HA 4XP4L 4YL9A 2V8MA 3DO4A 4WEMB 4DGIH 4ZW5A 5C0FA 1JYNA 3NZHH 5BRZB 2FX7L 2AJZA 3VA2C 3TYFA 4ADJA 5EZPA 3ZYJA 4A2DA 3NSYA 3VQLA 2DQJH 1JGUL 5JHDD 1IFRA 1E5ZA 3CK0L 3GIVA 5J9PA 1S6NA 3N40F 3WFDH 4QI3A 3E6HA 4ZFGL 1HILA 1YEKH 1UZ8A 2X0UA 1JJUA 4IRZL 3U25A 2KBGA 3NSXA 4BZYA 5TPWL 1UWYA 1NCDL 2CUAA 3LRLA 4I13B 5IQLA 4LRIA 4L8SB 1MCKA 1NMCC 1ETZA 4HBCL 2AEQH 4IRJD 3TBVB 3BAKA 5EOQL 1K4CB 2DH3A 4K5LA 4FS0A 1R5WA 3BW9B 4UOQA 5LVEA 2I24N 3IFOB 2R29H 2HX8A 2Q7YB 2WD0A 2CGRL 1G87A 1KACB 5TE4H 1SXZA 1XGQB 5LCVA 4F2FA 5I8CA 4D8OA 4K94L 3RKDC 9CGTA 3FQ4A 3N43B 2X3CA 3PGFH 2PYEB 1RZJL 3Q6GH 4HT1L 2A6IB 2XXMB 3SDXB 1HCYA 2DLHA 4JN2A 5GSVB 1BQUA 1IBGH 5CINL 3U6XS 3DXAB 5GRUL 3RFRA 3ULUE 2IANB 1CE6A 3RVVD 1PPIA 2OMUA 4WGVB 2BXYA 2H6OA 4X4ME 4LVNC 4OTXH 2WBKA 3MCKB 5L6YL 5DSCA 1KEML 3J27A 4LQFL 1YEJL 4BFGA 4G8GE 3IK2A 4M29A 4ERSH 3GI9H 5GZOC 5FA4B 4N86A 1FF5A 1HXYB 4FXGA 1NC2D 1A1MB 4K23L 4YO0B 2EDDA 4MBOA 2UY7A 3BH9B 1CDIA 1XBDA 3EFFB 3LXAA 4M9OA 5EA0H 4DGIL 1CL7I 1FL6A 3QEHB 2BNUB 4KNSA 1Q94B 3DMMD 3ABGA 4GXVL 1FDLH 2MKLC 32C2A 4P2QD 1LE5A 5GQBA 4FKKA 4JHWL 3TA3A 4TSAL 1DZ0A 1G7IB 3PQYA 3AT9A 2HN7A 4HMEA 1EQWA 3KR3L 3KH3A 4AIOA 2Y23A 1WEJH 2HWZL 4X6BA 4AG4L 2XZQH 2WSKA 3ARFC 1W72L 2ERJB 2RFXA 3JVFC 4Y2DD 4BFIB 4EDWL 4HPYH 3BUDA 4R7XA 4ZZKA 1KIUA 3T1FA 2OTUB 2CKBA 3IKCA 4Z3EA 4C56A 5F6IB 4FYSA 5DFVD 3D2UD 4PEEA 4WJ5B 1KCRL 3U6XA 4L3ED 4Z77B 4IRSC 4MQTB 5KSBA 1FSKC 1S7VB 4GG6E 1FUNA 3EDEA 1PYWB 1F58H 1MCNA 4AC2A 4NKDA 2A73B 4WFHD 1F18A 4G9FD 4C56D 3BSHA 3OTTA 4MXVF 1XGYL 1BF5A 4PJEB 5JO5A 4L1BA 4ZUUB 2V9RA 3VRJA 1MI5A 1OK8A 3KLDA 4PLNC 4P23D 4QT5A 1KXHA 1ZE3C 4N0YH 4LP5A 1PVHA 4FTVE 4YHPA 4EBQH 1EZVY 3HC0A 5EF2A 2NSMA 3PJNA 4V33A 1GOGA 2YSTA 3EADA 4APQD 5DWUL 1D9KA 2NXYC 1G0XA 1KJ3L 3UCRA 4RAUB 3BUBA 1ETZB 1BREA 1WLHA 3BUPA 3E38A 1ZANH 3MRHB 4PGJA 4ZNCD 5ERWA 5F89B 4P2YA 4XVOA 4NM8L 4PJEF 5EU3A 3I84A 1J1PH 3CSYB 3JWDH 3MBXL 3UJJH 1RVFL 3T3PF 3UO1L 2EXWC 4WZ9A 5HYSA 2AK1H 4XWOC 1TUPA 5CU5A 3NN8A 4MX7A 4JDTH 2IJ0C 2Q76B 5C7XH 1HXYA 4CW1B 3L3GB 1B90A 3GMOA 3GS7A 1NFDA 2XFGB 4DZBB 3TA4D 2AV1B 2X09A 3GTTA 2N01B 1AHMA 4I88A 5A2BA 4B7LA 3GXTA 1F4WL 1AMXA 3TCLA 3GBDA 4U1IB 4MNQD 1QBAA 1AACA 1FYTB 3TIDA 4E9WA 2Y7QB 2EDYA 3QEGL 3G9VA 1Y18B 2BSED 4XI5D 4EKXA 4DAGL 4HUNB 3T0XA 3MJ9H 3OR7B 3D6GA 1SBBA 3ZDZB 2FQGA 5B3JE 5IQ9B 5B1KA 2R0WL 2DIAA 2YFNA 3BIBX 3LVEA 2GVYA 3DJSA 3BDBA 4ZS6D 1SMOA 1V7MH 2C9XA 3NJVA 3PAVA 4YFLI 3LEXA 1HU8A 4AGMA 1JV5A 3KS0H 3PWUA 4QNPE 2GT9B 1MFDH 4KROB 2D03H 1QSZA 4KI5D 1JAEA 1S2EA 2X4UB 4MNHA 3P0YL 4UANA 4MXWH 1NCIA 4FDWA 1L5GB 4A7QA 1S9YB 4PTUB 5ADOH 5EOQH 1TJIH 2AABL 2YD3A 3OM3B 1PZ2A 3DJTA 3W3BA 4N0YL 2O4EA 4KGJA 3A6BL 1Q4NX 4OLWL 3DGCR 4X4YB 1KENL 1BBJB 1ZA6B 2V2XB 3TIEA 5JHLH 2H32H 2DIJA 3GSVA 4GXUN 4A2FA 3SPCA 4JZNA 3ETBF 1I1AA 4PJGF 4GW5B 3SKOA 4GNKB 4QRAA 3CNKA 4JN1H 1BMWA 4M5YL 5D8JL 4N9GA 5DD1H 2BNRA 4F3FB 3RA7H 1WBYA 4Z9KB 3STLB 4LLQB 4BZ1A 3EUUA 3LKSA 3II3A 4Q6IC 1HCFX 1F90H 5HGDA 3A3YB 4PWGA 1BXAA 1AE6H 4M9PA 5CWSA 3AVEA 4RMVA 3WS6C 5JHDB 1LDSA 1C5CH 2IDCA 4GS7C 4AYMC 4CMHC 2GC4C 1XGRA 5JIKA 5GS0C 4KH9A 3NJFA 3O3AA 3BDXA 4TSAH 2QZQA 2JJUA 2B20A 5AW8B 1G7HA 3JTBA 2ZOOA 4HK0A 3S4SA 1AZNA 1FYTA 2VXQH 4N0UA 4NQQA 4K7PL 1SPDA 3HFMH 2FJSA 3NCMA 4N2GA 5FA3A 4IOIB 4XNYH 1D5XA 4GMSH 3QUXA 5JW3H 4YHLH 2CWRA 4HIPA 5AB1A 5JLZA 1X9LA 3HE6B 3QXVA 2YMXL 3ECBB 3P2DA 2BOCA 2BSSA 3GMOB 3HN8A 3ZVVA 3BEWB 4X8JB 5HJ3A 4Z7UE 4TUOA 3DUHA 2G5BB 3QJXA 3TFKC 3MLUL 4LOVA 1AD9A 5LKNA 1TITA 4P2OA 5E5MB 5DRZB 1AR1C 3REVB 3UJTL 1LDPH 1N3NA 3BVUA 5DD3L 4BUQA 5KUKA 4DPRA 1VFMA 4GBXA 1XH0A 4TQ8A 2DL2A 3UZQA 3VB8A 1K3ZA 3JVGC 1TZIB 4FFYA 4JAMA 2JKXA 1K85A 2C5DC 3BUTA 1U8CB 1USQA 2KC0A 4U31A 5B22A 3UAJC 3VM7A 2UWEE 4EI5B 5CJ5A 3KGRA 4FYTA 1NOAA 1SBSL 4P57B 2BIMA 4NKIL 1NKRA 4XMLL 1MXDA 5F9WB 4Z7QB 2DMCA 1P9MA 2CIIB 4FX5A 3WTSA 3GTVA 4PRDB 2AV7B 3D8MA 5IFHL 1RK1A 4HAGA 4GG6B 2I27N 2A6IA 1BZDA 1V10A 4K7FA 3KYMB 2ZZUT 5CS7A 3MACL 1UEYA 3CC1A 3U0PB 4AQ1C 2MCMA 3AU1A 2ESVD 1KYDA 3PHAA 4A38A 3KXFA 4A2MA 1SFHA 1N5AA 1QRNA 1N8ZA 4GKLA 2HFGL 2HJLA 4RDBA 3VXSA 3BW9A 3RG1C 5ABDE 3K71B 3HUJA 4FHBD 4X4ZA 1IGYA 2IOOA 3VJ6A 4X8XA 3QEGH 2Y7NA 3WDHA 4AOFA 4JPVL 1FBIL 1DJIA 1IRAY 5F7LB 4Z7NF 2OLDA 2ZUQB 3FB5B 4XBMA 5EFIA 4H8WL 3RTQC 2J1XA 7PAZA 2MQ0A 2GY5A 3EHBD 3BKYH 4F3FA 3FBKA 5GGTL 1DN0B 4G9DA 3U1SH 4C83A 2NUTA 2WLNA 2F8IA 3C87A 5FYKD 2X6CA 3D3VD 2OXHA 2XPZA 4R4FL 4JHUA 5E56A 2OQJA 3FT4B 1D9KD 2D03L 4DF9A 4EIBA 3G5XA 3RI5F 4R8WH 4LFHD 1ZV5A 4JE4B 2YEVB 3NZ8A 2ARWA 4FQ2H 5JIQA 4HIJB 3GBNH 4WWKD 4QKXB 1CFTB 5HYQB 3SDAA 2CLZA 5A6LA 5JOFA 1BVOA 1YLBB 1MAKA 3AAZB 3MV7D 5TF1H 1U21A 2DJMA 3LQAC 2XHNA 2P5ED 4BHUI 5FPIA 2DY2A 2GK0A 1P9MC 4JFVA 5DJXA 1YMHA 1WIPA 3ALPA 3R4RA 4GRMA 4ZK8A 2XWEA 2GI0A 1Q94A 2XICA 3UTQB 2CBQA 2A0LC 3S8FB 3G5VB 3LN4B 5DO2D 1E9QA 3IJEB 5C0IA 3BYTA 1F41A 1KGWA 1SVBA 3CFBB 1QA9A 5FFOA 1IQDA 2HLFC 4G6FD 3PJSA 1J8HB 3D5OF 1F2XK 1AZRA 3MLTB 2BSEA 3DHMA 4MDIA 4PBWD 3DV6B 5ILTL 1XCTB 1RJZB 5TQ0L 5D7JB 3R18A 3WTTA 4MAYD 1KCBA 3TEUA 2FQFA 3U1PA 4AH2B 2QHRH 3U2SB 1ASOA 2VLLA 3PGDA 2Q8AL 3SGJC 1CQKA 3GSOB 4MA3B 3QJHB 3FOLB 4H0GA 3CFEB 3H42H 4YDVB 3OF6D 4DK6A 3POCA 3QPQC 3V4LA 3ZT6A 3FKUS 4L4TA 3PJSB 1YPZB 1ZSDB 4DUWA 5F7BA 2VDOL 3FQNB 1ZS8A 3VI4F 1G9NH 3T65A 5CBAB 2WYIA 4GFXA 5I75B 5JZ7D 2CIKB 2MHAB 2IG2L 2FSEB 4LAJH 1S9WA 4HA1A 4LDCA 4M43H 4L2LA 2QZ5A 4FABL 4HOWA 4DTGL 1G1YA 2VN4A 5F21B 4FG6D 3ECVA 3RGHA 3RTQB 2ZIDA 2G5UA 3MV7B 4FRWA 2VQUA 3GS4A 3TO2B 5GJSL 3P9MB 4UTBH 1T4WA 1MEXH 4PYHA 4M5SA 4S0SD 1RZGB 1ZS8B 5IOKA 3KYNB 2DI7A 1QX1A 1ZTXH 4FQJL 1I82A 4XC1L 2CDFB 3CLEL 5EOCL 4I0CC 5FO8B 3SYPA 1ZKAA 2E56A 4Z3GA 2PCPB 3ZZSA 3H3PH 2J5LB 4NWTL 2LGNA 3LS4L 4HD5A 4O2CB 1B4JH 4MMYB 4N5EC 2IPUK 4ODVL 4FLOA 4KJQD 2RJMA 4MCYA 3UEQA 4NO5B 3GRGA 4JO4H 5A7EA 4C58B 1A47A 3WXVL 2X4PA 5I2IB 1ZE3H 4POUB 5DJCA 4I77L 4NPKA 1FZOB 5IT2L 4EAEA 5FK9A 1I1AC 1N0XL 2DTMH 2VAAA 2VERN 1PX4A 1X5KA 4HU8A 2RBLA 3EBIA 1EDHA 2OMXA 2NW2B 3BWAA 3N5AA 2EIJB 4J8RB 5DEZA 4CVZB 1G7MB 2EP6A 4AE1A 3RIFK 3COOA 5IZ7A 1QFWH 4DKFL 3PHOB 4OGQC 3RUGF 4S1DC 4D3CL 2I9TB 1TO4A 2CO4A 2JKNA 4I89A 2DZEA 4PRIE 1KYUA 1NM4A 1RLBA 1U91A 3DBXB 2GFBB 3D4YA 4JVWA 2I85A 3QUXD 4LPXA 3TO4A 3S36H 3CG8A 4I48B 1TTRA 1IV8A 4W9JC 2OCJA 2PCFA 3EJYC 2Y2YA 4PS4L 1QP1A 3QJSB 5GZNA 4DGVL 1QWHA 3FO0L 4Q9QL 1WA0X 1J05A 4N85A 1N0LB 5KSUB 5EORH 4NO0D 2YD7A 1T22B 2EUWA 3E1ZA 3HZVB 1XGZA 4K3DH 4EI5D 5E6ID 1XF5A 4GH7B 1EAPA 4NQUA 1RQ5A 3P0VL 2O6CA 5EEVA 4KI1A 5F9JB 2R69A 3KVQA 4I9WE 3L3IB 1YEIH 2EDOA 3QZWG 1HINH 5MERB 4I9WD 4KROC 3WUWG 1GY2A 5I0ZA 2NY5C 2PWDA 1G6RL 3APMA 5HYJE 1OSPL 2F54E 1EMTH 2IDFA 1XGYH 5A2CA 3SPGA 1BCIA 3MC0A 1LEIA 5HVHC 4WFEE 1NGZA 3QORA 1BJ1J 3K8MA 1V55B 3TJEL 4U6VL 5A1AA 1FSKB 1SYSB 3GUTA 3BT2L 4I5BA 1OOAA 3VXSB 1BYNA 3CX5J 3GMMA 1OP3H 1UWXH 3PGFL 4KZCA 1IQWL 4Q2ZB 5TF1L 4YC2C 3VGFA 3E3QC 5B8CB 2V9TA 1QACA 3GB7A 2VR8A 2G60H 4OF0A 1JG9A 3W0WD 5CAYB 1QLRA 2YN5A 5EU6E 1SOXA 4F7CA 1ADWA 1JRHI 3QDME 3QR2A 5KYNA 1CGTA 5D96C 5I73B 3KXFB 2YGQA 5L9DL 3G6JA 3ZXAC 1RPKA 1LWRA 4HEME 3MMEA 3S37L 2WGXA 1MRCH 1WBZA 5C0CA 3OZLA 1HXMA 4K7PY 3QPQD 1T6BX 1BFOA 4CN1A 1FGVL 4UV7L 5CO1A 3LKNB 1U8KB 2ENPA 4N8VA 1MCPH 2E7CA 4AQ8A 2NTFB 3GSNL 3CH8A 2PWHA 3VH8B 5BRZA 2YKKA 4DPCX 1FO0B 1BWMA 3VFPA 4H0IA 3QEUB 3ZKSD 5EU4A 4L1DA 5SWZD 1SN5A 1JXGA 3WTXA 2KZ1B 2YRBA 2BOBA 5F7NC 2NY4B 3DOHA 4Y5VC 3MRKB 3X3FH 1E9PB 2JQZA 1IC0A 2E9JA 5CZKA 3L5WB 4POZD 2WUBH 4L48A 5E00B 3EZ8A 4JM4H 1G9NL 3BZEB 2JKLA 1SUHA 2UY6B 4O51A 4L8BA 5I6PA 3BMWA 1XZWA 1I9IL 3MLZL 4PRHA 5GISH 2ICES 1FRGH 3TO4B 3CUPA 2D2CC 3K5SA 3EYOA 3EO1A 5I0XA 1G1KA 4PJ9B 1XGTB 3DKHA 5J13C 2AP2A 1MFEH 4NWTH 1A14L 3BIAX 4IJTA 1IILE 4UB0L 3KBHE 4TRPL 5CMAA 1FC1A 2DBJA 1BM7A 3QZNA 3M8OH 4OFYD 1F3JB 1MCLA 5AALA 5KBKA 2AMGA 4F37K 4XO9A 1ACYH 4DO6A 2K7QA 4J8QA 2C3XA 3RKPA 1RV6X 5CLWA 2A77H 1ETB1 1E5AA 2ADGB 2B5IC 5C09E 5HDLA 3WI9A 4LVEA 3L3OA 3ILQC 3HZKA 1P4IH 4Y19A 4BQ8A 1XGTA 4PJFA 4WFHE 1FGNH 3QJOA 2R69H 4O02B 4Z7AA 2CRZA 2VDLB 1EV2E 4O9HH 3QDGB 4P06A 1DE4A 4NAQA 4FXLA 2QKSA 4JM2D 3HE7B 1YNTB 4F92B 3D06A 5GPRA 1SJHB 1TLKA 1DQLH 5T3XD 5DA0B 1TPXC 3VDAA 5FGBA 5C92A 3QDJE 2QMJA 3BQUB 1T20B 4XB8A 4AVHA 4S1QH 3BHBB 5AAMC 3SY0A 4PS4H 4IBZA 4M4PA 5H8DA 1J5OH 4RA0C 1YEGL 4X9HA 3ZKND 2Y5QA 4H8WC 1MCJA 2XXFA 3SGKA 3H85A 3OJ2C 4U1NA 4XVSH 5DJZA 3B6SB 1BGXL 4CDGC 4TTDD 1XX9C 2YD9A 1K4DA 3WHXA 1IBBA 1REIA 1U8QB 3OKOB 1ZHLB 3GK8H 4PMEA 3I6LE 2D4FA 3V6ZA 2MCPL 1C16A 3L5IA 4AIEA 4I4WB 3QDMB 2WCGA 4RMBA 5H37A 3SDDB 4MXWL 3SDXA 2HJKA 3LOWA 5LGKA 3PWUB 4F7TB 5ADOL 3FQNA 1D6VH 2EILB 2JK5A 2VDNB 4JFXA 4YIQB 4JDVB 4GKNA 1I8IB 2WKOA 5GS0H 1UYWH 4ONGH 4FG0A 2Z34A 1ERNA 4MCNA 3N1FC 1YMMD 4JW3A 3SZKC 5CP7B 1HE7A 3OAYH 3T4AA 1T1YB 1A6PA 4FNPA 2VE6A 4QF1A 4QRBA 3STBA 3HZMB 3MBEC 4D9LL 2VSKB 1XF5B 3V7AG 4NPJA 4OM0H 4RZCA 4U6VH 4GQ9H 4BZ2H 1KLUA 4JVPA 1CLZL 2GTZB 4JRFA 3IMTA 1I8KB 2B08A 2Y36H 1NDTA 2QTVA 3D18B 5DUJA 3EYVB 4U1KA 1RH8A 3BX7C 3RL1B 4FFYL 4N0RA 4B9CA 4HCFA 1B6UA 5DUMH 1LEIB 1GS8A 1CDGA 3CIQA 4YE4H 2EQDA 5GRJH 4Z1PA 1C5CL 1WHOA 2QGEA 2OFQA 5EC1B 1MCPL 5L2KA 3FSZA 2HFGH 5DFAA 5KANG 1PL3A 3MBEB 3LYRA 3AREA 1DQJA 1T6VN 5I71B 2PCYA 1IBYA 3AFLA 4NXKA 5KW9L 1G5AA 1AG0A 4ZMLA 1BP3B 3ASOB 3QCTH 2Q2EB 4NPYA 5EN2A 5DSCB 1N9PA 1G7HB 3NTCH 1OXYA 4LPYA 5I82A 5C08A 2IAMA 3PU7A 1YEDB 1UACH 4K8RC 4MHHG 3ARGA 4NBXB 4ANXA 1A65A 2XZCH 5JW3L 4L9LA 1KJMA 2WLZA 3F2LA 1GS7A 3N1GC 5IBTH 3VRJB 1JK8B 4MMYA 4S1RL 1Q38A 5C0CB 2ICWA 4ELMA 5CEYA 3HI5L 1GC1H 3W0WA 4QHPA 3CU1A 5IVXA 4KV5F 1SDYA 3JV5A 4P5TA 5E8OA 3S2CA 1OGAA 2V0AA 3WYRA 3OKLA 3T0EE 5EEYA 1I8LC 3EYOB 4UB0H 5FYKH 1XR9B 2ZWKA 1WJ3A 3KPNB 1ASPA 2ADFH 1Z9SA 3ZHFA 3SGEH 2QV4A 3ARDC 5I1HL 4M6MH 1GTFA 5J9PB 4EOWH 2VR7A 3C6LC 3QO0A 3S0PA 4N24A 3VFOA 2GJ6E 4UINH 4UQBA 2Y36L 5DYFA 2YOCA 3Q6GL 4HT1H 5K1VA 4FQLH 2AQTA 4KOCA 4YHML 2OCCB 5J1TC 3CXHJ 4YUEH 2Y2WA 1TT6A 4AT6A 4UQ2B 1L9SA 3QAZC 4IBYA 4LPUA 3JUYA 1AKJB 1DFXA 1FL5A 5MEPA 5B21A 2ZYIA 2PR4H 1KGCD 1N10A 2HTKD 2VABA 3IJ9A 2XN1A 4GQQA 3O4LA 1E4JA 2DQ6A 1MFMA 5CILL 4K23H 3MUHL 3WNIA 5IHBA 5GGQL 3EBHA 3GBML 4NUPA 5EZLA 4ZI8A 2R2EB 2F7OA 3QZBA 1ZLWK 4QHLA 4CC4C 1NFIB 3NQKA 1HH6A 3ZKNC 1FDLL 2NNCA 1LEKB 4Q52A 3X1GA 4LSVH 4QWWD 1F4WH 3TN0D 1Y0LB 1ZHKA 1Z6JT 2O5ZL 4S2SB 2Q7AA 3P11H 4FJZA 3SBPA 4S1RH 1DEEB 2JJSA 4JQXC 3UDWA 1DEDA 2DLTA 4OZHA 3SE3C 5E1QA 4X42A 2ENJA 4XZ4A 3UABA 5LBVA 2X5PA 1QLRB 3QUZB 3W0WB 4MJ6B 1MFAH 4WY7H 2ENSA 3NUKA 1ZD6A 5HHNB 4R26L 4ZPVB 2J2ZA 3SB3A 3K7UA 2VUOA 3P9WB 3IPBA 3OLGA 1RZ8B 4J3UA 4S1DD 2EAEA 4D9LH 1UASA 1FIEA 4JO1H 5H4ZA 2IAMB 3AMKA 1FIGL 3GSQB 4JG0H 4F27A 3EG9A 2ZUYA 3FTSA 3ULVC 4MJIE 1CGVA 4HUCA 4UBDD 5IJBC 3KBPA 5HYFA 5C6TH 1ZJBA 4HAFA 4J5VA 3H9HB 4Y9FA 3QIUB 4UUJA 3HC2A 5BOZG 4ZO9A 3N42F 3V6BR 4NFBA 4AT6B 1FLRH 1CL7L 3GJFA 4DOHB 1KCWA 1XB8A 2FWOA 3CFQA 1L9MA 2WBWB 3WS3A 1S7VA 1BOGA 5E2JA 1NCUA 1SMDA 3S35X 5J1SC 1GYAA 3WKQA 2B9AA 4NCDA 1X5IA 4UNVA 5C3IA 5J0BA 3FT0A 3LZFH 4ZFZA 2NY1D 3TF7C 5FB8A 2CU9A 1AR1B 3S6CA 2ZP9A 3N04A 1BAFH 2GJJA 4LCYB 4HULB 4O00A 4XXCC 2I7OA 3MRBA 4KTDH 2W9EH 1I9RH 4CGTA 1YEFL 3UTOA 4B97A 4F57L 4IS6B 5DJ6B 1S9VA 2GYSA 3H4FA 5DZOA 2X4UA 4PJCF 4OI7A 1SEQH 4MMZB 5TGBB 1W16A 4WU5A 5HD8D 1A22B 3W39B 1JDDA 2LLNA 1D7BA 4L0ZA 3U9PH 3MRRB 4B96A 3FUJA 3ML9A 5IV2A 5E4EB 4K7PX 1J1OH 2DKUA 4XAWL 1G1OA 3FTGB 1KJ2B 1B4JL 3MRLB 3L9YA 3NCJH 5L7XL 2XWZA 1T0MB 1CE6B 4HS6A 1N2RB 3SGJA 1T7WA 5JW5B 4XN9A 5F8RC 2PPFA 3CHXA 1ODAA 2MJWA 2NR6C 1A7PH 3EZJB 1FIGH 1QSFA 4KX9A 3H9SD 4PVMA 5F2FA 2AABH 3RVWC 1KN4L 3ZE2B 1O9VA 1A6TA 2W0LA 5T1DH 4JQIA 2V37A 5IKCA 3GMQA 3MV8E 3FO1A 2W9LA 3TV3L 1C9SA 2ADFL 1HWHB 4J28A 4PV9B 4YWGL 3EOBA 1S7TA 3RL2A 1N68A 3LZLA 4NUMA 1SLVA 3AT8A 3HUJB 1ZTXE 5C08B 3AREC 4F5CE 4E9YA 3DPBA 2K7PA 3LNEA 1CU4H 1RZKC 3BGFC 2LE9A 4GSDL 1AE6L 1QRND 4PJEA 1P6FA 2G3ZA 3BD5A 1JZEA 5D7JA 5FM5O 3MKGA 4WRLA 3RNKA 1T89A 5TPWH 5E6YA 1EDYA 2YUXA 4BFRA 5D2NE 1I9RL 3O11B 3H54A 4PY7A 2XYCA 5HYJD 1G43A 3LQZB 3CQPA 1FNGA 2FQEA 3GZQA 1NBZA 2DEYX 4FFZA 1MVUB 2EYRB 4X99A 1GKEA 4K15A 1J0YA 4KU1A 1E67A 1RIHL 4XGZB 3UXFA 5L6YH 2HJFA 1F6LL 1U8JB 3UO1H 1D3CA 1BQKA 1TPXB 2NXZD 3BESR 3FTZA 3LN5B 4OVVA 4KKPA 2NZ9D 3H1ZA 3VFUA 1MCFA 5E9NA 5T5FH 1DBKH 2G4EA 4E68A 3VO0A 5ICYA 2VDML 4YK4B 1IC4L 1KLUB 2EO9A 3HE7C 25C8L 1LO4L 3BT2H 2C4FU 1QSVA 1IGCL 2J6EA 2XACC 1PX3A 3RDTD 1DVXA 2E7DA 4DOHE 5I0DA 4WK0B 5FM4A 5C07A 4LP4A 3PFUA 5D1QA 3DGDA 2H1PL 1L3NA 1UXSA 1YYLH 3EO0B 4Z8FH 2EEAA 4Z7UF 3Q44A 5FM5M 5CNHA 4KC3B 4BK5A 2ZOUA 1I4FA 3ZQXA 3B7YA 3VI4E 4X4XA 3L2MA 4BWWA 3P30L 1A1NB 4BWUA 1PLBA 2AJUH 5D7IA 3ILEA 2ENQA 1YMMB 4QJ4B 5D93C 2ZPKH 3GKWL 5E4AA 3KPOB 5JXED 1OSZB 1IGYB 2FT7A 4YSDA 5D7LB 3ZE0E 2F7QA 5IEKB 3UAJA 1I3VA 1T7XA 4P9HL 1GZQA 5E6RB 4KKRA 3M07A 4HV8B 4NQDA 1MIMH 2P43B 3PIQB 4FZ8L 1VIWA 1NGYB 4OY9A 4LCUA 4LARL 1AIZA 2FX8H 4PWIA 1E4XI 1RU9L 5HGBA 3ZKXC 1OE2A 5DRXB 3T6QC 2P46B 3MLPA 5HGHB 1FVCA 2BNQD 2HXAA 3FO1B 4XAKE 3L3OC 4UAOC 2NLJB 4NQSA 3VXTB 3RRQA 4MJIB 4Y5YB 4KQ4H 3P40A 3Q2VA 4JFDD 1I7ZB 4NIYE 1A3ZA 1F6AB 1H3GA 3VE0B 2W9EL 3UJJL 3KCPB 4IGBB 4M7LT 4E9SA 1OK0A 1X6NA 2PXYC 2R7EA 3MJWA 3C9NB 1OTTD 4I3GA 3OGOE 3AS2A 3H2PA 3OVUB 5DK0A 1X4YA 3MRNA 3HUJE 1NJ9A 3EDDA 5LQBH 3O2DA 1W0VA 1MCIA 3KH4A 4YHIA 3D50A 2DQIL 3E8UL 1J9RA 1XH2A 3KWVA 4LDLB 4OM0L 4PJ9A 2Q8BL 2XG4A 4GSUA 4KQ3H 2BJMH 1R4XA 2YC1A 3GKZA 5HDBB 3MLTA 3LS4H 2YPLA 1KCVL 2WXPA 3ZMRA 5TGBA 1FV1B 2AQNA 3DVGB 5F7KC 3R06A 2C1OB 3MUUA 4L4VB 2GITA 1DFBH 4MJ2A 4U7MA 2GFBA 1OGPA 2IXQB 3JWOC 4UBDC 2WLIB 4HJGA 5TDOA 4YLCA 5CGTA 1NGPH 3FFDB 4DP6X 4IBSA 4F20A 4I48A 1Z5LA 2DQMA 2NW3B 3TBWA 2J88L 4PBDA 3WHE1 5F7HA 3HZYB 4M6NH 3ME0A 1TEYA 2DWSA 3C5JA 5AOJA 3VB9A 2PO6A 1AOZA 4Z3HA 1BM3H 4M4RA 1H9DA 3NSFA 2DB8A 2YS4A 5C9KA 4EZMA 3IDGA 4HIHA 5I76B 3V10A 1MCOH 1H3WM 1YJDL 1F8TH 2WNXA 4LSSL 2FTAA 5DCCA 1UZ6F 5EZIL 1FO0H 3QE5A 4OVUA 2BINA 5JPMC 1SY6H 4L8CA 2GJZB 2IADA 1WFTA 2F1EA 2I07B 3MA7B 1JXFA 5FYKE 3U30B 2DM3A 2E4TA 4KI5C 5HGAA 5JPMA 3E2HB 1TFPA 1N7ML 1V27A 3TS8A 1GGYA 3CXDL 5CGMA 4U1LB 5E8EA 4MAUL 3KZ8A 4YLQT 3REWB 4IKJA 5I15L 4QRPB 5CN2A 3NPZB 4XPGL 4Z7OB 2AXWA 2IIJA 2B5IB 3NCWA 1RIHH 4LHJB 4XI5C 3JWNG 4M5YH 5DD1L 3MUGA 4PJBF 4QTHB 2WW8A 4RDQG 4URTB 1BVZA 2IG2H 3N44F 2NY6B 4NQCE 5GIRB 4W9FC 4IMLA 3O4OB 1F11A 1EUUA 2BM3A 4U1LA 3O6ML 4PJ6A 5E8EB 3FT9A 4A37A 2DQGL 1J9TA 4OLWH 2HFEA 5IMLB 4J3TA 4LKCA 4EIUA 4XCNB 1F3RB 5BMFL 4LSTH 1TCMA 1N0LA 3BGAA 5KSUA 1P84K 4HCRA 1QO3A 8FABA 3MRPA 4Y4HB 4YPGA 2OI9C 2RMNA 3DOSB 4OZGF 1SJEA 3ZHLA 3I2CL 4J3XA 4HJEA 1P7BA 1QSED 2VDKL 2XPGB 2PXYA 1UXSB 1J0JA 2NYZA 2L7EA 5AVWB 3MNZA 1XF2B 4JDEB 5DVPA 4TM9A 2MTPA 3ZDWA 1GPOH 4LGRB 4GEIA 1WFJA 4QRRA 3HS0A 1I3GH 3T9WA 3C6LD 1WCQA 2ZPKL 1B2YA 3GKWH 5IHZA 2V9UA 2B1AH 1XSIA 3TOPA 4WJ5A 2ZD0A 1NCWH 1U8HA 2DTML 1VPOH 4R8WL 35C8L 4PW9A 5D6DA 2MKWA 2HT3D 4PM1A 5IW6A 3QWNA 4XXDB 4QXVA 4FQXB 1DR9A 4WHTB 2UXTA 1LP9E 1R1CA 1W0VB 4KRPD 3UPCA 3QQDB 4JFOB 5HYSG 4NQVA 1ILSA 5J6HB 4WUUE 2D0HA 3AS0A 4XPFL 3ZYZA 2MOGA 4XOBA 3RVTD 3QXWA 2VXQL 2N1TE 2DEXX 3QA3A 4QRRB 3PQYE 2W65A 3VACA 4NRYB 1QEXA 4XC3H 3P73B 4LHUG 4MDRA 3S5YA 4HFWB 4QRFA 5TTRA 3BUYB 4CUCA 4X83A 1DJXA 3FONB 5KS9A 2PO6C 2ZUVA 4Q14A 2WOYA 4KDVA 4P2RD 4WI5A 2WOBA 3OV6A 5FOJA 4D94A 1PKQE 4NO2B 4RIRA 2NLJA 2Y22A 4NQSB 3VXTA 3X11B 3MX0B 3E3QE 4O58L 5AG8A 3B9AA 3VVWA 2GCYB 1OE3A 1EO5A 3MTXA 4WI2A 4CU8A 3IJYB 3F6LA 3FFCD 3LZNA 1LXMA 4ORZC 5FHAH 5FLUA 3IAQA 3UYRL 3MYJB 4AVJA 4PU2A 3MXVL 3F05A 2DTSA 4NC2B 4WI6A 4C83B 4HS3B 4G8EA 2DYPA 1XD0A 4CKVX 5CR1A 1O75A 3MLZH 5GISL 2CA4A 1MIEL 2VZ3A 4L3FA 4KDTA 3DVIA 1CT8B 1BVKA 5GS1B 1HYSC 5J57B 3HNSH 3CFEA 4YDVA 3UTSD 2F19L 1OP9A 1VERA 2CG9X 3TNNA 1MHPL 3HE7A 3EDKA 2G3NA 2Z8SA 5FO9A 1O6TA 2WSPA 4Q9RH 4L2YA 4LDOB 1AGFA 4A6YL 1P7QB 4JO8A 4OTXL 3LMJH 1WIUA 3WG7B 1JZ7A 3VW3H 2JLPA 2XZQL 1V7NH 3S37X 4DUXA 4X6DF 3SPVB 1FC2D 1OARH 4HZAA 2X1OA 3CDZB 2EKSA 3VSTA 4GSQA 2YXFA 1FAIH 2E9IA 5E0QA 4AKOA 1T89C 4DP7X 3RNQA 1HILB 3JXAA 2BW5A 2VXQA 4R97C 4TNVK 2WM0A 1NCHA 1HNGA 1U58A 2YD4A 3QFJA 1VFBB 4A2LA 3ARPA 1FV1A 3DVGA 1EEZA 3U0WL 2BHZA 3AT0A 4ZAKB 3KR3H 4ESKA 4TNEA 3WEAA 2YXVA 3QQXA 3ZKXB 2FD6H 2YWYA 2X7LB 1FFQA 5TDPA 3S3JA 2DF3A 3FO9A 2YQGA 1QG3A 5E6SB 2AGJH 1E9OA 4G3YL 5GGVL 1AC0A 5E4EC 1XCWA 1EK3A 5D5ME 4PVLA 4EO5A 4LGSB 3WEXA 1MREH 2R59A 2XKSA 3EJQA 3SDAC 1E5UI 1DLHB 3CFDA 2HFEB 2VLJA 3CZUB 1CFSA 4DIXA 3TH3T 3L95B 5BRPA 1BQHG 4LVOB 3C5ZD 4JDTL 2ISDA 4OH2A 1S46A 1Z3RA 4WQOA 4AENA 3EJYD 1GYUA 1LD9A 3U7WL 3WAKA 4ZS7L 5A2JH 1JI2A 1AGCA 3W56A 4N22A 4XVJL 4KVCL 5L2JB 1QUPA 2N0MA 3RURA 3HFFA 3ILQD 2Y07L 1QBBA 3BH8B 1NBCA 3BISA 2EEXA 3I9AA 5JPNB 4PSRA 4LCUB 4HDIA 2WZ5A 1WFMA 3R1GH 1GMIA 2R1XB 4IMLB 1FH2A 4UZSA 4XTRC 1KY7A 3Q9QA 1A6WH 3UYPA 1ES0A 1ET7A 2HH0H 3QIBB 1M7UA 1MEXL 1HOCB 1KIRA 1WBYB 2EDEA 3STLA 4PRPB 5AL8A 4G72B 4XNZB 2X1PA 1TSRA 1UTDA 4GP4B 4BSWB 5BW7C 1UH2A 1X5LA 2WXFA 3G6DH 5KTEL 2XBTA 5D7JC 2N7BA 5IW1A 5K9JL 3V8CA 2BVQB 1OP5K 4LLDB 4F80A 3WJLA 1WUNT 5I30L 3N3EA 4U3SB 1X9RA 5DS8B 4NRYA 4JHWH 2APTA 1AS6A 4P3DB 1MFUA 1NQBA 4LFHG 4ZTOH 1WWWX 3TEXA 3U0TB 1BIIB 4L3AA 1P53A 4JRXD 1U3JA 2UZIH 4G7RB 3AWGA 1UC6A 4JRXE 4O2EA 3UCQA 4HZLA 3HA0A 5JQIB 2DBLH 2Y3NA 1WZAA 3QUZD 1F4XH 1IB5A 1UJTA 3ABKB 3RWJB 2C34A 4U3HA 2I9TA 4WK2B 5IB3B 3N41F 4J27A 5EUOB 4Q6KA 2YC1B 4LMQE 3NCEB 1IZJA 3UAAA 1QFWL 3T4AB 4DFHA 2P24A 1OGAD 3NFSH 3C8KA 4OF8A 5FHAL 2FEJA 3ILDA 4KFZC 1FCCA 4JKPH 2GITB 2NR6A 1H6UA 3BC9A 4PJIB 5GGTA 4HOZA 1URLA 4ELKB 5LUMA 4HJTA 2W9DL 4OZHF 4UI2A 1CFQB 3CZKA 5E1GA 4Z78B 5A40E 5IBLD 4P2OB 5DEGA 2NY3C 5LBSL 1JZ4A 1G9MH 5CHNA 5IQOA 2ARJA 1JF6A 2V9QA 3SE6A 4BKLA 4LNVA 3GI8H 4ACTA 1TMCB 3EJZD 1NCNA 3O81A 3IXAB 3T2PA 3L2LA 3QRGL 3SE3A 2IANE 1NLBL 4WLCA 5D1XD 4YEFA 1AG6A 3DLQR 3L6FA 4KOBA 2JNZA 4JM4L 2Z4QA 1E27B 3UTTB 3APDA 1ZHLA 5F70A 4P59L 1ZPUA 4YZFF 4G7VH 5ESVA 1PW3A 2DV6A 4R5TA 5DXWA 2CDGB 1A9EB 4K94H 2D8KA 1IM9D 1TZAA 2CDEA 2FNBA 2X4TA 4FC3E 4Y5XC 5CR8A 3PP4H 5AYQA 4DWHA 4M7JH 1QI5A 3CVHB 3WS6A 5D7KD 3ZL2A 3QCVH 4QCIB 2ZT9C 1NIDA 4AIZA 1Z2KA 5JHLA 1UM5L 1T0NB 5I0VA 2IDSA 3RHWK 5IB2A 4HAKA 5IFJB 4OBSA 3M45A 4LSUL 5FOBB 3QQ3B 2F5AH 3LRKA 3CZFB 1FNFA 2X12A 5LXGL 2QPFA 4MNQA 2CR6A 3BPLC 1XR8A 4NBZB 4OGYL 5MI0B 4Y5XA 1TYJA 5CM1A 1YN7A 1SJXA 2YPKB 2CH8A 2MTAA 1CC3A 4EI5C 3DRQA 2Q20A 4M5ZL 3HAEB 3WCYA 2ZKWA 1YYMH 4G8FB 4OCLC 3BWUC 4HSAC 2APFA 4A63A 3EOTL 5HHOA 4JJHA 2P5EE 3HHMA 2HUEA 5HI5C 4JJOA 1KULA 2JXMA 4IBQA 2KDYA 3ZTJG 3C5SA 4HF5H 1HH6B 5TDNB 2XWTA 3SCMB 1ZLSL 1W8OA 1I8LA 3L5XH 5T5NF 1R5IA 3NACL 1EEZB 4OQTL 1I7RA 2Y1ZA 1JOIA 1ET8A 3BGMA 1AKJA 1M3IA 3DO3A 2FEDC 1WO2A 4OZFA 4I87A 2WVVA 3RX8A 3ELQA 4P5TC 3QK0A 5BXFB 5LCVH 1QEWA 2ZE0A 4TUUA 1Q9KB 1UEMA 3IBOA 2VISA 4N3UA 1MLCB 2WVTA 3BDYH 4F9PC 4B5EA 5BS0A 3BLPX 2BIOA 3ES6A 4G43A 4NXSA 5DT1L 5GGRB 4BQ9A 2P5EA 4LLVA 4PD4J 1BPVA 1R0AH 1JXJA 3SJVD 3B7UX 4YPJA 3L4VA 3ARGC 5F7DA 3FCSB 1MCOL 2EINB 4OR1A 2L7JA 2ORBH 1QNIA 1HDMB 3RWGB 3HHSA 1JF1A 2BO0A 4WCYH 3ZGHA 4FZ8H 4Y1AE 1T0PB 4G6ML 3GRWA 3MRGB 3LKRB 4EI6B 2DOCA 3CN2A 4HGKC 1AY1L 1ZAGA 1FYHB 1EZLA 1T1XA 3EJUA 1GL4B 4NQEA 4R9HA 3GMLA 3ARRA 4S1SH 5GSRB 5GRVK 4GO6B 5ENWA 4Q6YA 4QLWA 1RZ7H 1G0YR 1XEUA 2X4QA 4QOKA 3JWDC 3WE6A 2WNKA 4HKXB 1FYTE 2V7NB 4IIQC 1ZXQA 4JFZL 4K71C 3MV8D 3D09A 4P2RE 1Z32X 3CVHH 4GAYB 4XBPB 2VDKB 5HGHA 1TLMA 4FQQB 4PB0L 4PJ8B 4R0LA 1Y07A 3AABA 3ZMEA 4AM0Q 4LSRL 1OLZA 3B7SA 4AEHH 1N12A 3GMPA 4RAVA 4L3CB 1SEQL 2WXRA 4WO0A 1EERB 2RR3A 1DQKA 2R2BB 4GQRA 2ZCHL 4NSKB 2IPKA 3C6LA 2HPOA 3GTNA 2K6YA 4N6RB 1OSYA 1URZA 3UAFA 3OKNA 3CVIL 4U1JA 1AQDB 4ELDA 4BCXA 4FOMA 2JIXB 2Y6SD 3AUVA 3MRMB 1ETA1 5HHQB 3QVAA 4CVUA 5JHDA 2UXGA 4ETQA 3NK3A 3PXHA 4W9GC 1A7QH 1RZGA 3BAJA 2MCG1 3VH8G 5C0JB 2JKSA 5KW9H 1OTUC 1UM4L 1WFIA 1OAKL 1WSST 1SYSA 1HOCA 3PXLA 4IRSA 1BLNA 1WVZA 1Z0NA 2YGOA 4W6YB 4B95C 2VDPL 1DQVA 1A6VL 4XPAL 5CIPB 2X89D 5H37G 1KGCE 5D9SB 3E9TA 3LAFA 3CDZA 3W39A 5K39A 2OZ4L 4YEEA 4RVBA 3OJDB 3D0VB 3V4PH 3OKYA 3GLAA 3N1MC 2YEQA 2EYSA 4L9DA 1NPUA 4ODHH 3TEWA 1KC5L 5A6MA 1JMZA 1KLGA 1NCWL 2KH2B 3FQWB 4FQ1L 3P0YH 1INQB 2LV4A 2OXGB 4AQAA 4NFDA 5MERA 1ZHBA 2WLLA 2NCMA 4AENB 5CJQH 3OR6B 3O9WD 2W07B 3SGKC 3CQFA 4XNAA 5J1AA 2D3LA 2NZIA 3RWHA 4F24A 1X5GA 4WKZA 4Z76A 4ZUSA 3DYOA 4U4BA 4AJVA 5JOEA 3HZMA 3CXDH 2VIRB 4JFPB 3GLDA 5GZOA 1BHGA 1YECH 2VOTA 1GGTA 3ARBB 4NZUL 4OGXL 1SEBA 2O61A 2Z7WA 1S9KC 4I3SH 3ZL1A 5J1AB 5F88B 4MHHI 3O9WB 2BOCB 4H8WH 3VSUA 2HJKB 3UBXB 4H13C 3BP5A 4X5WA 3K8KA 1EVUA 2Y5EA 4XH2B 2Y1YA 4U1SB 1D5IL 2A9DA 4M8QA 3NA4A 4J2XA 1SVCP 2BVQA 4IK6A 3UG5A 5EC2A 4CN6A 1HXMB 1U92A 3SKMB 1N4XL 1TYEB 3ETSA 3T4AC 3W1ZA 4Z7UB 5LN8A 2R7EB 3KPQB 1CTMA 2LVEA 3GBMH 1MY7A 3PGCA 4ZUWA 3PAZA 4U1HB 4NDMA 3SY6A 3UYPB 4JPQA 1ADQH 2G30A 2IWFA 3LEVL 4KK8D 4Y7MA 3V5KA 1DUZA 3KL5A 1WWBX 3P77A 4N8VG 4PJCA 1H6TA 2X4TB 5D72H 4JR9H 4HLZH 1GHFL 3U9WA 1JZIA 4A1RA 15C8L 1JNNL 1M71A 2ICEB 3IGAB 4LL9A 3RWEA 3C60A 2XWJA 5HPMB 3P3SA 1F97A 4J3OG 5C0DB 2LR4A 3VXUE 4RWYL 3ZE2E 3K1DA 3IE4A 3KDPB 4QHUB 3FRPG 2PPDA 4ODTH 4MNGB 5IB4B 2O30A 4JO3H 3HB3D 2B7DT 5BJTA 1TMQA 3MV8B 1MG3C 3SHSA 3QJHA 2B59B 3FHEA 1NCAH 4PG2C 3RWDA 1DQQB 1QR4A 4DVRL 3RUGE 4A6YA 1GYWA 3VFWB 4TVSa 3I3EA 1TVBB 4G8AC 3MA9H 1CDYA 3KG5A 2FECL 1NGXB 2F53E 3W82A 1YVLA 2BP5M 3WGUB 4E9XA 1F86A 4ALAL 4AQ8C 1EHAA 4N4YB 1FZMA 5K69A 2LTQB 2RB8A 3MRDA 2OSLA 1PDKA 3SOBH 1NCJA 5EMYA 3R7QA 3NBNA 3KPPA 2WJ5A 3X12B 2JVUA 2O6DA 1L9PA 2BVYA 3P4OA 1UENA 2H26A 1GZPB 2H45A 3PL6C 1QHPA 5DC4B 4ABWA 4HZ1A 3IFLH 4UQ2A 4AEFA 3ATBA 3MLSH 1EEUA 2AGJL 3OG4B 5JQHC 4LESA 5F7AA 4BE5A 3GRBA 5D6DC 5INCA 6TAAA 2BLFA 1BG1A 4IIQA 4JCWA 4R96B 5F3FA 3IAGC 4ICWA 3CFBA 1UG9A 4D0CB 3HS0C 4HWNA 2PYFB 2QQLH 4JM2A 5ISZA 4U1MB 4AYEC 3D0LB 3LCYA 3KEHA 4HCGA 5AKVA 1SYVB 4LCWE 1T03L 2XTLA 3NRQA 5DJXB 4PJAB 1SZNA 2X2HA 4XNUL 5JA8B 5KS9F 4XCFH 1D5RA 4HWEH 3O6LH 3H9HA 4JY5H 4OI8A 1F5WA 1IEAB 2YRPA 1HCVA 4GEJA 3L45A 3FQUB 5C2BH 1WCBA 5E95B 1FNGB 5IEHA 3WAJA 3UGXA 4DP2X 1HTYA 2C9AA 3L7EB 3MKKA 4BGLA 5BOJA 1BWWA 3FT2A 5I18L 1W72H 1L0QA 1BVLB 4HFUL 4F9PA 5JHMA 2VSMB 2AKRA 4OLVH 3WFZA 4H8QA 3PWJB 5FO7A 4FQ2L 4Y9EA 4PJBE 3Q2WA 5FYLL 3ATEA 3P30H 5H35B 1IEAA 5E2TH 2J2ZB 2HVJA 3V6OC 3G6DL 3EYSL 2WUBL 1BQLL 1TJHL 3OF6A 3FQUA 3I6GB 4Y16C 3RVVC 1KBGH 2KQNA 3G5WA 1PEZA 1UKSA 3I6KB 1QBMH 4NUGH 5FS5A 3UBHA 4EN2A 5L7XH 2Q7YA 5TE4L 2QLYA 5D7KE 2DWEA 5L8JB 4L4JA 2LAGB 4CSZA 1SNRA 5L2KB 2Q0ZX 4EJ1C 1U3HD 5EEXA 5K59E 2WLYA 3N0PB 3FRUB 2J8OA 2XNAB 2JV6A 3TJPA 4MMXB 3CVCA 4TL5A 1MJ7H 3F7VB 3QG6A 3BUYA 4AJYV 4BDVA 1OM3L 2AI0L 3VWKD 4EI5A 1N64H 2YA2A 2Z8VC 4PJ7E 1M6OA 4HIQA 2OTUA 5FDWA 1AC6A 4ZJ9A 2XV6B 3PWLA 5AZUA 5INCB 1KYFA 4MB5A 5TQ0H 4N2AA 1FLTX 2YBRA 4JKPL 4ATTA 3ZIYA 1U93A 4LCYA 3U4BH 3OKKB 1DJZA 2ZXAA 3ZDZF 2OSLB 1TKWA 4YHZH 5HHME 3R4DA 5DZNA 1JPTH 5IHZB 1NDGA 4DNLA 4PJ9C 2EXWD 1AQ8A 2P47B 3BN3B 1XR9A 3HLKA 2X6VA 3QUKA 3WKPA 3EFDH 3FQXB 3V52H 1WAEA 1J5OL 5HJ3B 2HTKC 1M2VB 1G6RA 3MCLH 4R5XA 1NC4B 4X7SH 2R56H 1L4IA 5BQDA 4G42B 4OZ4B 3RPBA 1U8KA 1IE4A 5J89A 5KYXB 5EU6D 1XF4A 3RVXD 4BXSV 3I9PA 3EG9B 5EO9A 4XX5A 5EOCH 1KBKA 1BQLH 1TJHH 2LFGA 2J88H 3O3EA 4PIRF 4N1EA 1VPOL 3MRJB 1E8YA 1YEFH 1CUOA 2LFEA 4F57H 4CJ1A 4JO4L 3VYOA 2GIMA 2Q87A 4CRPA 4ALAH 5ICZB 4Q4EA 2R8SH 2M8XA 1MCDA 3BVVA 3MRQA 3HTLX 4B9PA 1YYLL 1RUQL 3WOVA 1Z3GH 1SXAA 4N0FB 4OFPA 4DVRH 2BIHA 3NCYS 5H2BA 3TYGL 3A6OA 3ZTNL 4KZEH 2FWUA 4FFZL 1T4KB 3AM8C 3HNTL 1UKTA 2Z91B 4YX2L 5FR3A 3V0VA 4TS6A 5CWSB 3FH7A 1D9KB 4GAJL 2MPVA 2O26U 4FHJA 4ZPTA 4XNZC 3FFCA 4KJQC 4LVHB 4HK3J 3T0VA 1OSEA 1VF5C 4FG2A 3UYOD 4W70A 4Z77A 1UA7A 3DK0A 4M93C 2QV2A 3C75A 4I3RH 2HRPL 3S36L 1CDHA 2XY2A 3FU7A 2ZCKL 4BK5C 5BUGA 5DC0A 5IBUG 1L5GA 5G4OA 4YHZL 3LHPL 2P5PA 2ZF8A 3FU0A 2NY5L 4GRWB 3H9ZA 1YZZA 2CE6A 2ESVE 3IS1X 3VXRE 4CSSA 2F1BA 4UAOB 2G2PA 1N70A 2J8HA 3L95A 1NBYB 4MA3A 3PWNA 4X7FC 2N59A 3OR6A 5DDHA 4BELD 4NWUL 2I60H 3QARA 4DK3A 5DTFA 3T8XA 3CLFH 2HRHA 3DTXB 3OMZA 1ACYL 3IJHA 2D7PA 3FU7B 2H6PB 2CO7A 1GAFH 2OJEB 4PIBA 1H0DA 3P3UA 2W8CA 3GIZL 1G6RB 1MI5E 3FUEA 1NIEA 3BH9A 4NQDD 1YAIA 1MI5D 1E6OL 1UB5A 5C7XL 1QLEH 2PYEE 1U93B 3QHZL 3QO1B 4X7DC 4H8HA 3VXOB 3QIUA 3ARTA 4BXVA 1A6TB 2RHEA 2DMBA 5HTSA 4AUYA 3HN3A 3EGSB 5TE6H 3K0WA 3QEUA 2H2PC 4JDZB 4KMTH 4Z7IA 4F9LA 1RK7A 4BSVB 2AV1A 5A16B 3VFGH 4AQ1A 2X4OB 1MF2H 3O3BA 5HYSB 2Q3AA 1UJ3A 1P1ZA 4S11A 1KEGH 3L3GA 5AOMA 5HHPB 5DVNA 4LP8A 5HHMB 2NQ3A 5IF0B 2DEWX 3O8XB 4RLDA 4ZO6A 4PTTA 3CC5A 5D5MB 1EHNA 4NDMB 4MJ5B 4P46D 1EA9C 4PRHD 1A6ZB 2XFXB 5AOLA 5DWPA 3O11A 4WU5B 3CTTA 3MLVL 5ICUA 1PBYA 3MRJA 3R0NA 4NQDB 2P8MA 3B1UA 4K9EH 4WNQB 5L2JA 1LL1A 2ALAA 1YNTA 5I1EL 1CDBA 1OAKH 3DYMA 2AF2A 3Q0HA 4KX7A 3KYKL 2O5YL 4AUJA 1SN0A 2XFXA 2OAAA 5L2KE 1T04B 3VRIB 4JM2F 4UM9B 4G6FB 1BA9A 1S7RB 3MREB 3BP7A 4NNYB 5AW2B 2DQUL 5DEGB 3V52L 4JO5A 4ECNA 1AR1D 1WE5A 3HAEG 1I1FA 4UT6H 4KRNA 1RUAH 4H88L 1L6XA 3FFCB 4JNXA 4YLBA 2D7OA 1OAYH 1Q9KA 2KL6A 5F9JA 2QGDA 3W37A 3ES6B 4TNVF 2WWKT 4JL1A 2EXSA 3TJEH 5A2AA 4RFEA 1IKFH 2CBMA 4HH9B 3VW3L 4HUUB 3EGSA 4HJIA 2EVJA 3TA3B 4NJAH 4YDJA 4E9LA 4ZTEA 5KSAC 4TUOB 2R4SL 4JG1L 1IC7H 2HG5B 3QDJB 4LVHC 5FIEA 2XZAL 2I32A 3HJEA 4MKMA 4WF7A 5A3ID 1P69B 4AL8C 4KXCA 3GHBH 3WEOA 3S98A 5I30H 1GJUA 4RFEB 3QWQB 4CN4A 5SX5H 5A2KH 4OV5B 4XNYL 3LQAL 1L9TA 4Q6IA 1CB4A 4G42A 4OZ4A 4RMTA 4KK5D 3SBWC 3N55A 5DS2A 5AKTA 3QFGA 1ZLVH 3KBEA 3ZBMA 1A4CA 3DWTA 2GIYA 2H0JA 4F33B 3SD5A 2J6EH 5B3JF 4PRBB 1NC4D 2ZCKH 4ZQKB 4XR8C 1QSEA 1UVQB 4XP4H 2F54A 3QNZA 4M7LH 4GBXC 4MLIA 3SKNB 3OWEA 1WP6A 1MREL 4IW4C 5E24E 5EG6C 1F0LA 1FN4B 3EJJX 5D6CB 1FVDA 3BIKA 3SDCD 2PW2A 2GBUA 2YUWA 3OGCA 3NZUA 3PWPE 1F3DH 1X5ZA 4LKXA 4LLUB 3RU8H 5MEQB 4JR9L 5DRWA 2KLTA 1UURA 3RVTC 3IETA 4XB7A 5CGYD 3V0VB 3TO2A 1LWJA 4NKIH 3K71A 5KN5B 3TONA 2Z31B 1IU1A 5AVXB 3KPSE 5KOMC 3C2SA 1DBBL 4NLAA 3ARFB 4S0HA 3MRQB 1AH1A 3SKUD 4N2IA 1NCAL 4Q2ZA 3DC0A 5FO2A 2F8OA 1HEZA 1CL7H 1HFUA 4KTGA 4JQXA 1A4JB 1ZT1A 2R29L 4X5PA 3OAZH 5DLLA 2VH5L 4K8RD 1KF9B 4APQA 3TBYA 1ZVNA 1HHHA 2EVHA 4AW7A 2NY0D 2UZXA 5E9DD 1ZIBA 4PVBA 5I66B 1ACXA 2D3JA 4DKAA 3PV6A 4CC4A 1AQHA 5HDRA 4HOMA 4GUPA 1E3ZA 1J1PL 1JHKH 2PR9A 2C1PA 3D69A 2WWKO 4YDLB 5FGCE 3ZHDA 1DANU 3VRLE 2VWEC 3ILPB 2YZ1A 4JFOA 4Q9RL 1SEBB 1PFCA 3LPPA 5KYYA 1W6LA 4OV5A 4N2KA 4OF5A 5IVXB 2AJ3B 1HQ4A 4YL4A 3ZGIA 1U8HB 4XZUB 4GRMB 2B3IA 2CJUH 1AOHA 4ICXA 2I25N 3CZJA 5L0QB 4PWHA 1LE9A 1M7DA 4NM4H 4NZ8A 2MQGA 3VGEA 5GRVL 3DVNB 2BFVL 4NQTA 1T03H 1NL0L 3GJFK 5KSBF 2BVTA 4XWGL 1L9RA 1YSOA 4BA8A 4DKDC 1BQHB 2EIZB 5I6NA 2XPGA 2C9RA 1AIFB 4X0KA 3O4LB 2DQDL 5AW9B 1K8IB 2OYKA 2H0FA 3D2TA 5E7FA 4JFQA 2VO8A 1LHZA 3A21A 5GIRA 3MRNB 1U58B 3QFJB 5FX3A 3DRTB 3OZKA 3H42L 2ZXWB 4DJMA 4DKTA 2ATKB 4CKQA 4Q9QH 4AGOA 4X5QA 5FO8A 5DJCB 5C07D 3QC6X 2EH8L 3ZK0A 3HPJB 2GJ6B 4KKAD 1QFOA 1NAML 3FL7A 4PREB 3ZR5A 5C6TL 4QCIA 1KIPB 3MGTB 3DGGB 2OYMA 4QO1A 3IRPX 2KPNA 2WXHA 5E0FA 4JM0A 1KV7A 1UCBL 1AGFB 3H0TA 4JGUA 2HTLC 5PAZA 1BQSA 3ZSSA 4YAQA 4XPHL 4P59H 4Z7VA 1K4CA 1CR9L 3CVDA 1QFUH 3C8DA 4K3EL 4RETB 4LQ1A 4WFGE 3S3BB 4GI8A 4XC1H 5CZRA 3V7AE 4AEEA 1VCBC 2GJZA 2IADB 3AG3B 1X7QA 1XCXA 4NSKA 4I1NB 4G11A 2YWZA 5D71H 4M43L 4Z0XB 2E74C 2RA1A 4NJAL 4Z0BH 1GXEA 4LDEB 1ZLEA 4JM2C 3DA0A 5T5FA 4ZXBA 1IEHA 4J1UA 4MDJB 2QPSA 1AR2A 1KOAA 1UA6L 3D18A 1MDAA 1INDL 4XZUA 5ACMA 4J3VA 2Y3AA 2G9HB 4IRJB 1T22A 1QYGL 1SXNA 4NENA 4W9LC 4Z7VE 3BSGA 1JZHA 1XAKA 4OJAA 4JFEB 5IROD 4U2ZA 3PL6A 2D0GA 4GW1B 1BD2B 4NKOA 3R8QA 1FI8C 4M7LL 4Y19D 5DQJA 5E8NB 2FH8A 4M6AA 3MRKA 1XCQA 3HPLB 5IBLC 4PGBB 1XMWA 1KNOB 4G43B 1MCWM 5GGRA 1A1MA 3H2WA 3ARYA 3NTCL 1KFGA 4WV1C 3P11L 1UACL 3G5VA 1KBBA 4KHTH 2CO1A 1JVOA 1MQKL 2WCSA 3QDMA 4JFFA 4PUBH 3CFJA 2DQCL 3KM2A 3IXTA 2EDMA 1X5HA 4JANA 2VGLM 4U3XA 2IAAC 4BZ2A 1EJ8A 1DBBH 4FE9A 5FGCB 2QDWA 3WFHB 2VMCA 4PGCB 2ZP0T 2VDRB 4ZBJA 4PJ5B 2J73A 4AZ8B 4X9FA 1BJ1H 4JVUA 5IFAL 1ZDQA 4POZC 2QPDB 3NJXA 3HS0B 4K5OA 3TM6A 3PAYA 3C60C 4FXTA 4GB9A 4ZW3A 2YA1A 3BOVA 3NJJA 4PW3A 4PY7B 1NUGA 2E5EA 4ZX3A 3OGCB 5AVUB 3O45B 4JG0L 4G9FB 7CGTA 4J8RA 3IEAA 3OHMB 3KL0A 4Y8DC 3L3DB 5I9QB 5F89A 1JHLL 1GZHC 2XBDA 5AAMA 1NIBA 1OQXA 1JCKA 4XMWA 2F5BL 3I9IA 3SE4C 4ZQKA 2L3BA 4N20A 1D2PA 1YMME 2IC2A 2ZCLL 3F7KA 2X70A 3I74A 1PG7W 5GGVH 4B9FA 1LO2H 2ZX5A 1NLBH 1TCRA 2JF1A 3QEQE 4YMPA 4UDTA 4FMVA 2PNDA 5L88H 1H15A 1RD6A 1OAUL 1M05B 2O5XH 4DN4H 1AANA 1EJFA 3D25B 4PS3A 3SY0B 3T3MB 4ELME 4G80B 4IIQB 2CGZA 3KPRA 1KZQA 1AD0A 4J3WA 3TT1L 4WTQA 2AEIT 4ZZFA 3EYQC 4JY4A 3D3VA 4HWUA 5T3ZE 4AK2A 3WFCL 1JPTL 5B38A 3AC0A 5GGTH 1D5MA 3L3HA 3JSSA 2X4RA 1EHKB 3NJIA 4FJ6A 5DVLA 2PPEA 2PWFA 2Q6WB 4CAGA 4F91B 3IKKA 1NLDH 3WD5H 3VXMB 6FABL 4FXKB 1YEGH 4ANWA 4H20H 4OJFH 2Y4SA 1JWSB 1ZT7A 4RISL 2BSDA 5DVKA 1A4AA 4GUOA 1TVBA 3A47A 2YBGA 4N2OA 4L1TA 3ARED 4KVNH 1X6LA 3OMAB 2XJKA 4F7MB 4HCIA 15C8H 1JNNH 4JDVA 2Y7QA 4KI5F 4P99A 4U6HA 4XN2A 4HV8A 1TO5A 3SN6N 5MHSE 4LHUD 5D1ZC 1KBWA 5I6LA 4AH2A 1IGMH 1KPVB 5ANHA 4F7CB 3P4OB 1UB6B 2J25A 5KYYB 3KWUA 4N90E 4DP5X 1U3YA 5C09B 1CTOA 5TK2A 1IT9L 4Y5VA 5F9AC 3T0ED 3CN1A 3HKZA 1FRGL 1J5CA 3O4LE 4M3JA 4U3CA 2IOIA 4OCSH 1RUQH 5TH2B 5GS0L 1SHWA 2QFRA 4GG8A 3SQOL 5FF6B 1FVEA 1DQTA 3DRQB 2WJ7A 2R1YA 4E9TA 4QIRA 5HVGB 3ZE1F 4EIGB 4K4KA 2R51A 1TJGL 1R19A 3EO0A 4U1NB 4YSSA 2Q10A 1JHTA 1TDQA 5JZ7C 4MWFB 2Y5TB 4L4TD 2ZUTA 3IWUA 4OB5L 2R0ZL 1H19A 1GIGH 4JUTA 2EVIA 3MV9B 4TNWK 2A1WH 4WEEA 5A6IA 1WWCA 3SZ6A 4FFYH 1OF2A 4WSKA 1AQKL 3WLWC 3DIFB 3SDDC 4XNDA 2YBRB 1S3KH 1KYOK 1TZGL 2VDOH 1BAFL 5JIPA 4OLYH 2BRQA 3A4DA 4O5LH 3QNYB 3RFZB 3ARWA 1AVAA 5DLML 4GAGH 1M9WA 1OGSA 1PU0A 3CN4A 4NO0B 2WXLA 1KXQA 3BCFA 1HSAA 4E42B 1JK9A 4CMMB 3FS9A 5DF0A 1RUAL 4H88H 5DO2C 1F4YH 4OGYH 1E5YA 2GJRA 2JJTA 3FUIA 4TN9A 3QORC 3J8F7 3LEVH 1H15B 1AAJA 3NCBB 3S96A 3QULA 3DI2B 3LRGA 4LNRB 2P26A 4U33A 2FJHA 4KKNA 4IK7A 4XH2A 3RL1A 1LO4H 1OP5H 3QG7L 1E28A 3FNKA 4PJ5A 2PPCA 3DSFH 2R0LH 2ZCHH 3OKEA 4I7ZC 4M00A 4P3CH 1DVQA 1P5VA 3FRPB 5DUPL 4QTFA 5KYXA 1ONQA 3LIZH 5KG9A 5IB2B 4QGYA 3BI9X 3VX0A 4JPSA 5IFJA 4ZXBB 4NGHL 3GNMH 4QY8A 2YPVH 4TNFA 1IAII 3OXSB 2N0KA 2F5AL 1LP9F 3WFBL 2DLIA 4LNRA 3SDCC 4Z7NE 5FAAA 3GJEA 2NX5D 1OALA 5GZNC 4B0MM 1E9PA 3T8MA 4EI0A 4EBQL 4N26A 2AS5M 1ZMYA 4IBUA 4K9EC 4XC3L 1GTNA 4PJXA 3DJ9A 4UUJB 4K3HA 3TO4C 3L5WA 3VYPA 1A9EA 4P5MB 1O7DC 4BZ1H 3OAUL 1DP0A 2TSBA 3CCHA 4MSWB 1AGDB 5KBMA 5H4YA 1TG8A 2OULB 1BOGB 3QJVB 1KC5H 4P3DA 3S34H 3VGHA 3UDWC 2BS71 2JJSC 1N59A 2V5MA 1E4HA 2WQ8A 3H8NA 4H8UA 3MRMA 4P4KB 4OZGE 4H7VA 2FT8A 3FCUB 3QUMH 3EOAA 5DMGC 4GQZA 5EWIH 1D6EB 2APXA 3OZ9H 2F53A 3KLHC 4RMWA 1RJYB 4I18A 4AXWB 3KPRB 1ML0A 5EBMB 1ED3B 4F15B 1A8ZA 5F0LB 4JFHD 4NI3A 3FB5A 5IIEB 1RXLA 1KG0B 3LPFA 2GUOA 3IMVA 4HEMA 5ITFB 4XP6L 5EU7C 5SWSD 5IG7A 3KNBB 1TFHA 2ZUWA 4LOUD 3L08A 3OKNB 1MHPH 3V5DB 3W81A 1TU2A 5DEJA 3B5TA 5BVJA 1SLXA 4UYQA 3T0EB 3PWNB 3B9VA 3QIWD 4YAQB 3REWA 4U6XB 3I6GA 3G3LA 5KYWA 5C09D 5T1KB 2EXYD 2AAVA 2YARA 3QYNA 3H7BA 2R0KH 5ESQB 4ZX4A 1NLDL 3B5HA 3WD5L 2A83B 4EUPB 2OL3B 2WLKA 5LXVA 3J07A 4YDIL 3F7RA 4P05A 3NRFA 4E41A 2FBJH 3ARDA 3LSOB 4HSCX 5CZVL 4BFIA 4C4KO 2OSWA 2YD8A 4HGMA 5C2UB 2HSIA 2HX7A 2Z8WC 4IJ3C 4G3YH 1IIKA 3SODB 5FKPA 4PJAA 4JFZH 5CZXD 1IC5L 2NYYD 3GHBL 4AUUA 4TQEL 3ALXA 3O8XD 2NNXA 1PD6A 2V17H 5M7QA 1WZKA 4XMUA 3HHSB 1F6FB 1C12A 3WXWL 1WAAA 4G8GA 1CXHA 1TJMA 2YAFA 3IJYA 3MROB 3SO3C 2BERA 3ZDYB 1T2XA 2BSRA 4PAZA 3BZEA 1GGBH 4UNIA 1EAJA 2ZWLT 2VR5A 4L9LC 4MXQD 4IKIA 4J12A 5J56B 2AVFA 3L1EA 4PGEB 2ENYA 4G71B 4FG4A 1RJLB 3TWCL 3QZOA 2LU4A 2C26A 3KPLB 4W9HC 5ABAA 3BQVA 3FOLA 4TULH 4HMDA 2GW5A 2C9UA 5INDB 2K6ZA 4HCRL 3OB0H 5F7YC 5D2LB 4XPAH 1BVNP 1FORL 1YEEH 3QP3A 1F2QA 5FFGA 1YEHH 1NC4A 4NQEE 1V3LA 4ETYA 1H3PL 3LX9A 1TR7A 4XP6H 2CUHA 3VFRA 3WJLC 4DCQB 1ZVSB 3KPSA 3INUL 4P04A 4FI6A 2VJ0A 3D08A 2HKHH 2WYTA 3KYOA 4N8VB 4FCHA