1OE1A

Atomic resolution structure of the wildtype native nitrite reductase from alcaligenes xylosoxidans
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
336
structure length
336
Chain Sequence
EDADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Native Copper Nitrite Reductase from Alcaligenes Xylosoxidans and the Active Site Mutant Asp92Glu
pubmed doi rcsb
molecule tags Reductase
total genus 94
structure length 336
sequence length 336
ec nomenclature
pdb deposition date 2003-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe1A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1oe1A02
1ILSA 2MRYA 1NZRA 2J56A 1SFDA 2XX0A 5I6LA 5IY5B 4NB7A 2H5UA 4BXVA 1ZIAA 2BP8B 2VSKB 3MBWB 2FQEA 4RH4A 4E9SA 1V10A 3BQVA 5I6KA 1BQRA 4HCGA 5I6OA 1PCSA 2PCFA 4HZ1A 4A2HA 1NIFA 3AG4B 3AW5A 4BDVA 5B1AB 3EF4A 2PP9A 5EHFA 1A4CA 3PXLA 1J9QA 4GXFA 2DYRB 1N68A 1OCCB 2A3TA 3EH5B 1DZ0A 3X1NA 1QNIA 1URIA 2UX7A 4NERA 2FQGA 2J57A 4DPAX 4L0PB 1N70A 4BWUA 3TU6A 3CVCA 2YXVA 1ILUA 1AIZA 4QKTA 3H4FA 4W9ZA 2FQFA 1GSKA 1V54B 3IEAA 1JZIA 1PZCA 3QJTB 3ABGA 1BEXA 1X9UA 2Q9OA 2GI0A 1IC0A 4JHVA 5B1JC 4G7SB 1OF0A 2VMJA 1AG6A 2R7EB 1A8ZA 1A3ZA 5I6NA 2PCYA 2XYBA 4K9JA 5TK2A 1PAZA 3CZUB 4GP5B 4KO5A 9PCYA 3QJQB 1OCRB 2HX8A 4E9RA 1EZLA 1AZBA 4DP7X 1JXGA 2AVFA 5AKRA 3FPYA 2CJ3A 2BW5A 4E9VA 2XV3A 1OCZB 2VW7A 2VM3A 2IDFA 8PAZA 2GC7C 2X88A 3QJRB 3S3CB 5F7AA 3NSCA 1DYZA 3H4HA 3PAUA 1MG3C 2YAMA 1BAWA 4YSEA 4W1TA 1M56B 1AZUA 4KNTA 4E9XA 4AKPA 2EIKB 3NJFA 3PAZA 3T6XA 1IKOP 1RZPA 2VW4A 3FSZA 1CYXA 3OQRA 3NSFA 2OV0A 3WKQA 2XXFA 1M9WA 4GY4A 3T6VA 1SHXA 1XMEB 2FT7A 2UXTA 3AG1B 4CSZA 4YL4A 3CDZB 3T71A 2XLLA 2BP0B 5I5IA 2YAHA 1A65A 4PCYA 1JZFA 1JXFA 3KW8A 4A2GA 1OV8A 1OE2A 4KO9A 3WI9A 5I6MA 3NJNA 2BZ7A 3WG7B 1YLBB 2OJ1A 1KYAA 1TU2A 3UACA 3CVDA 3H56A 1MZYA 2IDSA 1BXVA 1SFHA 4N4YB 3RYMA 4DP4X 3UADA 3TBBA 2XV2A 3ZX1A 2VN3A 2EIMB 3FYEB 3OD3A 3AG3B 5B1BB 1NDTA 2FQDA 3GDCA 3QPKA 1KV7A 2GHZA 1WA1X 1NINA 5B1JA 3PAVA 4P5RA 2IDQA 4DP2X 3S8GB 3ABKB 4AX3A 1ETJA 1BYOA 3NP3A 2J5WA 1GYCA 3FSVA 3OMAB 2NRDA 3EHBB 1PZBA 4G72B 1ID2A 1CC3A 1JZJA 4BXSV 1PY0A 2GC4C 1TEFA 2QDWA 4DP1X 2QPEB 5AFAA 1MZZA 2H47C 3FU7A 1ASOA 3ERXA 3HEIB 5PCYA 3OM3B 1I53A 1GS6X 2AFNA 2E86A 2ZONA 3SQRA 1BYPA 3SBPA 1BXUA 2YAQA 2FNWA 1FA4A 1WAEA 3QJSB 2DWTA 4Q8BA 6PCYA 1AS7A 3WKPA 4G71B 1SNRA 2DY2A 3WIAA 1R1CA 1AOZA 4BK5C 2BHFA 1MG2C 2H3XC 1PF3A 3FT0A 1KGYE 2DYSB 4YSDA 2XU9A 4HALA 4FAAB 2CCWA 2PP8A 1OCOB 2BWIA 4M3HA 5PAZA 3EH3B 1XB8A 1CUOA 3MX0B 1AZRA 4DP8X 2LLNA 1HAUA 2FJSA 2YAPA 1KDJA 2UXGA 2IH9A 2ZOOA 3AY2A 1W8EA 3PCYA 4YSAA 2PP7A 1KCBA 4AKOA 5AZUA 1KCWA 3TASA 2PPFA 1GR7A 4TXVB 1IBZA 2XXGA 7PCYA 2YARA 2WSDA 3NP4A 1JOIA 1SDDB 1ZDSA 2FWLB 3NJLA 3UAEA 1CYWA 1KDIA 1PZAA 3IE9A 3ZIYA 2GSMB 2TSBA 3TBCA 4A66A 4UAHA 4G7RB 3UAAA 1JXDA 2P80A 3DKHA 1AZNA 2UX6A 3FQ1A 4YSQA 2I7OA 2AZUA 3FU8A 1GW0A 3OMNB 2IDTA 3FS9A 2GIMA 2EIJB 1PNCA 4DPCX 3ABMB 3AG2B 2DV6A 1GY1A 3NJHA 5TK4A 3TA4D 3ZBMA 1B3IA 2B3IA 3FU9A 4DP0X 3T9WA 2BZCA 5B7FA 1AANA 2VW6A 3JTBA 2WO3B 1J5CA 4A2EA 1NICA 2N0MA 4WTQA 2BWDA 3T6ZA 4F7KA 2JKWA 4E9YA 1KBVA 3X1FA 1JVOA 2HRHA 3D12B 3NYKA 3V9CA 2OCCB 1AR1B 3DTUB 3X1BA 2HZHA 2TSAA 3T6WA 2CAKA 1ZDQA 1F56A 1J9SA 3C75A 4DP5X 1ZV2A 1RCYA 1AS6A 1NWOA 4F2FA 5LDUA 1GS8A 2PLTA 3NT0A 2CALA 2HXAA 3CDZA 4HIPA 1PLCA 2BP0A 1ASPA 2GB2A 1J9RA 5E9NA 2YQBA 2WO2B 4FA7B 3FPXA 3N2JA 1SJMA 1CURA 4M4RB 2PPCA 1NTDA 1ET5A 2HRGA 2VSMB 2ZXWB 4NAJA 4EF3A 2Y69B 2W8CA 1T5KA 2CBPA 3AZUA 3FYIB 4AI7A 4CSPA 3SBRA 2Q5BA 1J9TA 2FT8A 4BDVB 1TEGA 2EILB 3U25A 2JXMA 1RKRA 3DIVA 2MTAA 4HCIA 4AKQA 2HX9A 2IDUA 1WA0X 1SF5A 4ZK8A 1HFUA 5A7EA 4KOBA 1JERA 1AZCA 1ADWA 2ZWNA 1NIDA 1SF3A 2BP8A 1J5DA 3GYRA 2P80D 1OE3A 2IH8A 2QT6A 2XWZA 1NPJA 2DWSA 1E30A 1PMYA 5I5JA 2I7SA 3IN0A 1VLXA 1E5YA 3KW7A 1KBWA 4Q89A 5D4HA 2YXWA 4BWWA 4G7QB 4A67A 1JZEA 1V55B 3IN2A 3NSYA 3PPSA 3ABLB 1SHWA 4YSUA 3FSWA 1X9RA 3ASNB 3PLYA 2W88A 5F7BA 4A2DA 1L9RA 3NJJA 1L9SA 5B1KA 1NIEA 6PAZA 5D4JA 2QPDB 2YAEA 3QJVB 1PNDA 4UF7C 4WKXA 2IWFA 3EH4B 4YSOA 4YVUA 1IUZA 5I26A 3S8FB 4N8UA 3SBQA 2YAOA 1E67A 3BVDB 4ENZA 5I28A 2HLEB 4GP8B 3CG8A 4YSCA 4GP4B 3ASOB 3NJIA 4AZUA 1OE1A 2Y1AA 2B08A 3NJMA 1RZQA 2EINB 1A4BA 5FC9A 2R7EA 4BWTA 3X1EA 3NJGA 1TKWA 3S3BB 5B7MA 3FQYA 1E5ZA 3WNIA 4E9QA 3IBOA 3QQXA 4E9WA 4UANA 1SDDA 4DP6X 3GXUB 2I85A 1WA2X 3NSDA 4KO6A 4P5SA 2GBAA 4KNUA 4DP9X 4YVNA 3S3DB 1NIBA 1PLAA 3NJKA 5B7EA 4JKNA 1M57B 4G70B 1FFTB 2BO0A 2AANA 2FTAA 4GYBA 2IWKA 1W6WA 1IBYA 4DPBX 5I5MA 4YSRA 1UATA 1XB3A 4KO7A 2XV0A 2FT6A 1QLEB 4YSTA 4PAZA 1QHQA 1BQ5A 2PPEA 3HB3B 4F2EA 2VM4A 3UGEA 1FWXA 2XVBA 1JVLA 1NWPA 5I6PA 1L9PA 3N55A 4HHGA 4HCFA 4MFHA 3JT2A 3ZDWA 2UXFA 3WNJA 1L9TA 1W6LA 1PLBA 1JZHA 1AS8A 2CUAA 2PPDA 1ET7A 1L9OA 3X1GA 2XX1A 5B3SB 1OOWA 2IWEA 4KNSA 1BQKA 1NIAA 2QDVA 1NPNA 1WS8A 3FSAA 3QJUB 4YSPA 3CVBA 2RACA 3X2QB 2XUWA 2YAFA 5ANHA 4YSSA 1XB6A 1E65A 1EHKB 4X4KA 4E9TA 1AACA 1WS7A 3FU7B 3G5WA 1ZIBA 1ASQA 4A2FA 4JHUA 1GS7A 3UABA 2UXVA 1AQ8A 2HX7A 3OMIB 3V9EA 1A4AA 4HHWA 1GY2A 1ZPUA 1BXAA 2JFCA 2BW4A 4QLWA 7PAZA 4HAKA 1AG0A 2PPAA 1L9QA 2X87A 2J55A 2AZAA 4A68A 3FQ2A 1JZGA 1MDAA 1ET8A 5D4IA 2IAAC 3L45A 4KOCA 1AAJA 1HAWA
chains in the Genus database with same CATH superfamily
3VFWA 4E9LA 1GXEA 3FUDA 2YK1L 2IEPA 3P30H 5D1ZI 4Z6AT 4R84A 2CA3A 1BQRA 1BIHA 4R26H 1NIFA 3OAUL 3H9SA 2G5BA 3OJDB 3VFNA 2WAQA 1DN0A 2AEQH 2F15A 5HI5D 5FYKE 4C54A 5FGCB 1MF2L 1FDLH 2YEZA 4GXFA 3AJ7A 4DCQB 1X7QA 4ZW3A 2JVUA 3WN5A 4JY6B 4AVKA 4K3GA 4DGVH 2QADB 3WJLC 3H3PL 2QV2A 4L8SC 2AVGA 4KKPA 3Q1SL 3VMOA 1A1OB 1MLBA 1UZ8B 1FE8L 1LO3L 2XI9A 3GSUB 1F11A 2HFFB 1IGFH 5GRZA 1K8IB 2VXSL 4LLUA 3H4FA 4QTIL 3SDAD 5H2BA 3QH3B 4P2RA 4BHUI 1UURA 1AP2B 3KWXA 1NFDF 4CILA 5J6HB 1IQDA 2CO4A 1FLRH 1GCFA 4PJ9C 1GVIA 4YGVB 1TZOA 2YD6A 1QBBA 4GAGL 2CDFA 1IGML 4YAQA 2BCKA 1ZSDA 1ZHLA 1U3ZA 3OWEA 2AGJL 4KXBA 3L95A 4PCKA 2VMEA 4BBWA 1U30A 2AK4D 4UQ2B 1AD9A 4X6FB 1VKXA 4PJCA 4B60A 2CBQA 4KDTA 4C83B 4QXVA 1P0SE 2V2WB 1YYLL 1XGQA 3MU3A 1U92A 3REWB 3G5VA 1A7NH 4Y4FA 4NLAA 5EOCJ 4HCRL 5JYLA 4QEGA 1PZ5B 4XPTL 3AREC 1IBHA 2FIKB 3O8XA 4AYSA 3PHAA 4JN2B 3UFIA 3VD9A 4DZBB 2WQAA 3GO1H 3TZVA 4NHCL 2A6KB 3UL4A 4F7TB 3JYBA 4OZHA 2WUBH 5JIIA 3WU1A 3KEHA 3S7GA 4MMZA 1BWMA 4DNLA 4P9HC 4L9DA 4BINA 2BNRE 2XSKA 2OMWA 1X4XA 2MOQA 3TNMA 5DMGD 2IMMA 1K9TA 2VW4A 3EDKA 3BLBA 3OQRA 1DSFH 2QR0B 3I6KA 4GRMB 4JPKH 2HKHL 4JY5H 4TOYL 4QHMB 1QSEB 2F6AA 3O3DB 4OF0A 1JHLL 2HJFA 2YAHA 2DI8A 2WM0A 4YIQA 1JZFA 4CNIA 5DZAA 3CNKA 3I9PA 1K3ZA 3B6SB 1GHFL 3SZKC 1IRAY 4Z8FH 2WLLB 3AY4C 5FF6B 1GL4B 3S97C 4UOQA 5EZPA 3T0EB 1T4KB 2ARJQ 5DQJB 2HG5A 4Z95H 5HYQB 1NBVL 2MNUA 3T2QA 1XF2B 1T5WB 3NUKA 2Q3XA 4X8XA 2ZKHH 3SO3C 4NO0D 1RK7A 1DJHA 3IDIA 1OB0A 2DWEB 1LO2L 3T8VA 4HS3A 5KSBE 3AG3B 1AMXA 3ULUE 3VD2A 2H8PB 4NQSB 4PWEA 3ETSA 4QRAA 3O2DL 4L0ZA 2ATPA 3L3HA 3ZDXB 3PAVA 4JFPA 3V52L 2C3VA 2ZOKA 4AJ0A 3IWUA 1OT1A 4I9XA 4MBOA 5J06A 3RWFA 3MGOA 1FSKC 1Y6MR 2ZP8A 1NEZB 3HN3A 5I1LA 1DJXA 2VUYA 2EVGA 3FUIA 4AWJC 1ID2A 4R97B 4XMKH 2CD0A 3EJCA 2YPVL 4F33B 4ZSOE 5T3XE 1XFPA 1D5RA 3GSNB 4IOSA 3F7RA 4JO8A 1IVLA 3OKMA 2E86A 3SDXF 2WLZA 3G08B 4B41A 1QI4A 4HIHA 3FZUC 4ZXBC 3WTVA 1REIA 4R0LB 3QRLA 4W9CC 2GTWB 4RWYH 1RFDL 3BEVA 4ATWA 1VSCA 2XY2A 1P9MA 3D0VB 5LXGL 3M7FB 1XQ4A 2GTZA 2JH2A 3HG4A 4Q6YA 4Q8BA 3T2NH 2JTDA 5E4EB 3MRRB 1T66C 2XN9B 5IBTL 3RNQB 4EI0A 3CHQA 3MUGB 3CBJB 2BHFA 5DZOA 3C6EA 3MV9D 4P57A 3AXHA 1WE5A 2AABH 4OD1H 2XU9A 4UM8B 5E8OB 2HYMA 3JWNC 3ZOAA 4RMRA 5BS0D 2BWIA 3LRSB 4BYHA 5C97A 3NIFE 4JFUA 1H8NA 1N5AB 5L2KD 3F05A 4RMQA 4DCQA 1KBGH 1A7PH 4OZGB 1I31A 3F58L 4P2OD 2UXGA 4JRLA 2PP7A 3QJHA 4LBEB 3ZKXB 2WKOA 4KV5F 4OI7A 1V3LA 1A1OA 4LVEA 4G5ZL 4Z7OF 1UZ8A 3GSUA 1T1WB 3PAYA 5IW3A 2HFFA 2DMGA 2VWEE 3NJLA 3NPZB 4EN3C 5F7MC 3US1A 2X38A 3WNNA 4KKQA 4KY1L 1PZAA 4IGBA 2V5MA 4TTDD 5J6HA 2D2CC 2OJEB 3QEQD 2GG1A 1NCAL 2B4CH 4A66A 1JXDA 1U6AL 1IAKA 4YZWA 4HUWA 2ITEA 4CUCA 3GS4A 4L8DA 3FU8A 1CI5A 4H88L 4V2CB 2W38A 1C7SA 3MLVL 3MRKB 1CLOL 3GT6A 4X6FA 4KXDA 4C83A 1TDQA 2JWYA 1B0RB 1IGTA 2V2WA 3P0VL 3P3UA 1LDPH 3LZOA 4J4PC 3AG2B 4JKKA 2Q86B 1EEQA 4AUUA 4W9HC 4NRXA 5TK4A 2G60H 1BZ8A 1PZ5A 4ZUSA 1GOHA 1DJGA 1ZA3B 3G6JE 2Y2YA 2FIKA 5BVJA 6FABL 1RAMA 3M17B 4HC1L 1DFBH 5ISZA 4KUZH 4LOFA 4JGMA 3L1OH 5B4MC 3S96A 4DZBA 4O5LL 4KXZH 4AITA 2PW2B 2A6KA 3S36H 4TULL 3VRLF 1LE9B 2CLVB 3I6LD 4HHAA 3RVXC 1LTXA 2TSAA 1QZNA 4OIIH 3LKQB 2B2XH 4OGXH 1JRHH 1ZLEA 2O30A 4BFJA 4U1KA 1ZWIB 5T5NF 2QR0A 2A6IA 4GRMA 5BV7B 1IM9D 4MASA 4QHMA 3O3DA 1WAPA 1JPSH 4GKOA 3U1QA 4HG4K 5IHWA 5IZ7A 3VD0A 1QFHA 2G3ZA 4NP4L 3FB8A 1WCQA 4TVPD 4XMVA 3FB7B 3NA4A 2APBA 2H26B 5SWQA 2YGPA 3QDGE 1NM9A 4G7YL 3CH8A 3B6SA 3MOBH 4J6RH 3TO4B 3VXPA 5C0DB 4RA3A 1EZVY 3NZHL 2XN0A 2CDGA 3LZFL 3WAJA 4XMWA 4HWNA 4GXUM 1KIRB 4FFWD 1T4KA 2Z92B 1RSYA 3VFMA 5HVHC 5D1XB 4I3RH 3BWUF 3IJ9A 5DQJA 4C59B 3WTTA 5DUBB 5EUOF 5HYQA 2NY2C 1XF2A 3GJEB 5DD3H 4XVSH 1T5WA 4YDZA 1U41A 3KDMA 4U1LB 1OSZB 3MV7D 4P4KB 2YD5A 5GS0L 4GAYB 5JXEA 2AQSA 4KK5C 1OHQA 3VFGL 2H8PA 3DETC 5D7LE 5BVPH 3K80A 5HHME 2J72A 3VGEA 3PWPB 1KTJA 1NGZB 3F6JA 1L6XA 3HBGA 1NEZA 3O81A 3O9WA 4HKBB 5KVDE 4KI1A 3AXIA 4IOFD 3KR3L 4NKOB 2F53E 1IC1A 4XO5A 3NCWA 3RWIB 4CMMA 1R5VB 5DRXA 5CD5C 5FYLE 1UJ3B 1T0NA 2HWZH 1WWCA 2BP8A 2P80D 1Z2KA 2DWSA 4QRQB 3ZN6A 4J3TA 4R0LA 1MJJB 3SDDD 3WEOA 1R0AH 1T0PB 2GTWA 5IOPB 4P23D 4GG8B 3D0VA 3D09A 3ECUA 4F7EB 1V55B 5L6YH 3MRRA 2XIBA 4LSDA 2XN9A 3C60B 2IADB 3GSNH 3RNQA 1L9RA 4JZJB 4NGHH 4Y0GA 4YXLH 2XZCL 4UQ9A 1RI8A 1MPAL 3EOTH 1EHLL 2FLRT 3UG4A 1RZ7H 3EH4B 1H8LA 3JVGC 4UM8A 4HKZB 5E8OA 1LO0H 1ZGLP 4N1EA 1Q1PA 3K6FA 4RGOL 1OHZA 4U7KA 2RQEA 2VXQA 3LRSA 3UBXI 1YQVL 1N5AA 4FN0A 3FFDA 4Y2DA 2Y1AA 2NY0B 2YWYA 3NJMA 3QS3A 3HG3A 2WBJB 4R4NC 3OXSB 4PP2B 3WEMA 1F1AA 3QWOA 4FHBD 2P5EB 3NRPA 2GJ6E 2CJUL 2XWJB 3H55A 3QCTH 2MCG1 4IBLT 1DANU 1XGYL 5KJ7E 3GM0A 1T1WA 4KQ4H 1IV8A 1BZEA 1U8OA 5DJXB 3U7AA 2VXQH 3O0RH 3R7QA 5FOBA 1Q0YL 4NHUB 1A7QL 4FP8L 2QSCL 4NBZB 1LVEA 2PXYC 2WN3A 3DTDA 4BH8B 4X4MA 4Y1AE 5D1QD 4KZ0A 3NCJL 1MCSA 2N1KA 2WQVA 3V10A 1AGCB 4JFDB 3PIQB 3H85A 4NOBA 1ZRUA 3MRKA 1UATA 4Y4HB 1OKEA 5D8JL 5DHMC 3SGDI 6CGTA 1B0RA 2E0PA 2VDRB 4G8GE 4Q0XH 4TQIA 5IB3B 2Q86A 4UTCA 4YDVA 3F6IA 2JSFA 5L0QC 2F5AL 2H0JA 1IKFH 1ZA3A 3ZLQC 5HYEA 3J27A 3M17A 5B1CA 5AAMC 3U1PA 4WF7A 2APVA 3IM1A 1E3FA 4K7PL 4WNSA 1FAIL 3ZGHA 4XNUH 4C47A 1BG1A 2A1WL 2Y7MA 2HKFH 4ZMXA 4WEBH 1CFMA 1YNLH 2FL5B 1Y0LB 2CLVA 3IJHB 5E70A 3WEXA 4HJGB 3KS0H 3K0YA 3I3BA 5IQ7H 1GW6A 1JYXA 2Q1EA 3V6ZA 4S1RL 4PRAB 3UTPE 4PR5B 3ARRA 4UOW0 4EZJA 1NPNA 3BPNC 3MV01 5KN5B 5IWLA 3RHWK 1ZWIA 2E4TA 3X2QB 3QDMB 1CPUA 3KVDD 1J9CT 1YYCA 3NCFB 4TSAH 2CHWA 5F1NB 1CGXA 1EHKB 1ZLUH 4UNTA 3QK0A 1ZIBA 4ZOCA 2DH3A 5TE6L 2ZSWA 1HNYA 3L4WA 5DSCB 4JHUA 3TTSA 1D5XA 2HX7A 2PWFA 2NNCA 2JELL 3TO4A 4BFNA 1ZPUA 1CL7L 5BV7H 2XIDA 5DFVC 2WV3A 5BPPA 1L9QA 1KIRA 3MA9H 5F1OB 2VLJA 4WI9A 5IHLB 4EI5D 2Z92A 3RL1B 4PRID 5DUBA 1FH2A 4HCGA 4KX7A 4QHLB 1HAWA 4R2GD 1UUSA 4EXKA 4U1LA 5D5MB 5C0BB 5T5FL 1FH5L 3T4AC 2VSKB 2QZQA 2YFNA 4RH4A 4FZ8L 1RULL 3QR0A 2AEPH 2IAMB 4CSTA 3AADB 3T3PE 2ITFA 2X12A 5B1AB 2YWZA 4ES8A 1AXSB 3PWPA 4ZI8A 5J1AA 2EEDA 3VI4B 3B2MA 2X6CA 3CZGA 2YC1B 3I6GA 2ZZUT 3ZRFC 5IR1B 1URIA 4BUQA 1OAQH 4NKOA 3RWIA 1J1OH 4G9FD 1T03L 1R5VA 4JR9L 2EC9T 1KXVA 1UJ3A 5I8EB 4G9DB 2XYCA 1S7UB 4DW2H 1X5YA 3CVCA 1F1DA 2OXGB 2OMTB 3NGBB 4ACPA 1VERA 4YE4H 5LGJB 3SY0A 2EVHA 1XZ0B 3X13B 3I74A 5IOPA 3CFEA 4L05A 2IWGA 1M42A 5JTWA 1KSRA 3BMWA 2EDBA 2JLLA 3O6KL 2EDJA 4UNUA 3ZZLA 1EO7A 2Q9OA 4F7EA 1M1XB 3PPEA 4Q4IA 3GUTB 4GB9A 1MH5B 1I85A 1I9RL 3ARYA 3C60A 3MCLL 2IADA 3EO1B 3NIGE 5E99L 2MCMA 3SQBB 5I1GH 1QFOA 2E47A 4OCWL 2TRHA 2G2NA 5ANMB 1QTSA 4RMVA 1L0PA 4MD5B 3VDAA 1AO7D 1T2QH 3M1BB 3UIZA 4HKZA 1WLHA 4D8OA 4ERSH 4ZZFA 5C0RH 2E76C 3F00A 5D7IE 3VXSB 4A2LA 1EZLA 4LXFA 3BLKA 3SQOH 1G0XA 4R90H 2YQGA 4UYQA 5KSVB 3ILPB 5D2NC 4NUJB 2BVPB 4TM9A 2A38A 2IXQB 2VM3A 2WBJA 3DDGA 2IDFA 3AWFA 3OXSA 4PP2A 4R5VA 2V5TA 1BZDA 1DN2A 2X88A 3S3CB 2P5EA 3NSCA 4FFYL 4JW3A 1F97A 2XWJA 4ZTPH 1QI5A 1MG3C 1BAWA 3CQQA 5I0ZA 5DJXA 3L7EB 4Z7UE 1JK9B 3PAZA 3MV8D 3RURA 4NHUA 1KTDA 3AU1A 1J8HB 2GK0A 2WTRB 2XXFA 3ARPA 1EJOH 2DM7A 5IFHL 3ZE0E 3RFZB 4CSZA 5KW9L 4NPKA 2BHZA 2FZ3B 5AVRB 1BQSA 4LPYA 3DRQB 2WWNA 5AZEH 5JA8B 1OAZH 3OXRA 4RGND 4U31A 1AGCA 3PIQA 3VXOB 4DWHA 3WNKA 3RGVD 3W9EA 4Y4HA 4JHWL 4A2GA 2NCEA 3SPVB 2V2TB 5IB3A 2EDHA 2RTTA 1MY5A 1OTTD 1MCPH 1XF4A 4LARH 4O2EB 4JKWA 4G6AD 3CVDA 3BO8B 3RYMA 5E5MB 3MJ6A 1JG9A 4HJIA 1G4RA 1ZK5A 5DZVA 3UP1A 2H2SC 3ZX1A 2M26A 4P4RB 3IJHA 1Y0LA 3OD3A 3NSXA 2MIZA 2VDRH 4HJGA 1NMAL 1SHSA 1TZIB 5KAQF 1TLMA 3QHFH 4PR5A 3OLEA 1ONQB 4FNSA 5F0MB 1N64L 1J86A 3W37A 2KZ1B 3K0WA 1WISA 2AK4E 1NJ9B 2HTKC 4M1CC 3GSVB 1P5UB 1GOFA 3UERA 3QDMA 5I82A 2GJJA 3LEYL 4Y5XA 2W95A 4YZFE 1PJ9A 1RJYB 5F1NA 2PYEA 5FWRA 5CZRA 3OMZA 1PEWA 3HHMA 4HUNB 5MEND 4JFEB 4JFQA 2WXLA 3PGFH 4PJDB 5DSCA 3FT3B 3HPLB 1W16A 3A5VA 3OKOB 5J57B 3DJZA 5J5EA 1OTUD 3HRZA 2CE6A 2ZUQC 1CICD 4KITB 1WDAA 4FCHA 5E94B 2GABA 3B7YA 2ED7A 3EUUA 4APXA 2DLHA 3CH1A 1MVUB 2A74B 2F7QA 1X5HA 4WU5B 5CR1A 1SM3L 6PCYA 2AK1L 3EFOA 3RL1A 4QHLA 1IM3A 3KH4A 5A2LH 2H3XC 4MA8L 2WQRA 5D5MA 1HINL 5AUMB 5C0BA 4L3CB 4FMKA 3S35H 2R83A 3L7FB 1DBBH 1OY3B 1XCQB 5FGSA 4LIQL 1YEIH 4RMTA 1MAKA 4XP9H 1UVQA 1JGVH 2HMIC 3CGTA 4Q9RL 2RIKA 2DQDH 3GFUA 4PRHA 1FNSL 4Y16B 2YC1A 2P24B 3EJYD 1JXKA 2C1OA 3L2NA 2YAPA 3DX3A 3ARDA 1OK0A 1OP3H 2UUDH 3QXTA 5C70A 4U1MB 4X6BB 4FDWA 1OGTB 1IVTA 2VLMD 1CB4A 1YJDL 3KWUA 2GCYB 4G9DA 1UA3A 2OXGA 2OMTA 5C6TH 2HFGH 2Y36H 2KKQA 3HRPA 5T1DH 5LGJA 2FLBT 1XZ0A 3LB6C 4LGRB 3WHE1 3CZKA 4DHLA 1CYWA 4QO1A 4WKZB 3S0PA 3INUL 1I7ZA 2DJSA 4BGDA 2QTVA 4OGAD 5F3FA 2Z3FA 2Y5QA 3VWJC 4UV4L 1KCVL 1IC7L 1MJ8H 4ZUUB 1OALA 1PPIA 3EO1A 3SQBA 4CC4A 2CG9X 2Z31D 2ZUVA 5ANMA 5DMYA 2BFVH 1J5OH 1OARL 4KMTL 3DXAA 3ABMB 5KSAC 1ID5I 3VXSA 3UPRB 5IREA 1HXKA 3N1GC 2WP3O 3PHQA 1AVAA 1AANA 3RZWA 2OKMA 5CF3A 4CN1A 1JI1A 3X11A 4NUJA 2BVPA 2IXQA 3T6ZA 4LL4A 2YBRB 2VB5A 4LCWE 1FHNA 5EU5B 3VMPA 3V6FB 2AJXL 3RTQD 2YK1H 3SD5A 2FR4B 5GS2H 2HZHA 1G7LB 4MVBD 3V0GA 2HG0A 1J9SA 4F93B 5E24E 1ZS2A 3J07A 3OAUH 1SY6L 4ZTEA 3QT2A 1T83C 2WTRA 4J3XA 5F0JB 1MF2H 1YN6B 4H8QA 3RDTA 3QUGA 5LDUA 1TNMA 1AHWB 5SWZE 2FZ3A 2HLAA 4KC3B 3MDJA 5IROA 2K7PA 3H3PH 3FFCB 4H8WC 3W11C 3D08A 3Q1SH 2VABB 4EQ3A 1H5BB 3VXOA 3E3QE 3GSRA 3HR5B 3PL6B 4M6NL 4LASL 2AMUA 2V2TA 1ZV9A 3SPVA 1FE8H 1LO3H 3L9BA 1CURA 2QGEA 3EOBB 2KERA 2VXSH 2HRGA 7TAAA 4QTIH 4FNQA 3HOGA 4MCZB 3MOQA 4QRPB 4O2EA 4FA8A 1XL4A 1FV1B 3BO8A 1T5KA 1NGXB 2CBPA 4HCRA 1FGNL 4D9QD 4GAGH 4UDUB 1XH3B 1A2YB 1IGMH 3TF7C 3ULVE 1G6RA 3QEQE 4ILDA 4U49A 2NY7L 2G0KA 3CHSA 3TIEA 2A0LC 5EMYA 1HS6A 5I19L 2CKBL 2R27A 3MODL 5AW3B 4N1CA 5GJTL 1LWRA 2XKNB 3C5JB 5A1AA 1RK1A 4AMKL 1ONQA 2F8IA 1RKRA 2JJVA 4AKQA 3TO2A 3M1OA 2XKSA 3GSVA 1P5UA 2ZXQA 4HCRH 4XPTH 3R1GL 3LZRA 4DGYL 1I8MA 1RJYA 3BIKA 5DQ9B 4GFXA 5AAWC 5I1KL 1PG7W 4W4OC 4JFEA 5EO0A 1E9PB 1NIDA 1SF3A 4NHCH 1TFHA 3GYRA 5JUEL 4I1NB 4U3CA 1WQVT 4PRNB 3HPLA 1OAKH 1OLZA 3B9AA 1FNHA 4FLRA 1L7IL 1V3MA 2H32B 4ZAKB 2G9HB 1ZVNA 4HJ0C 3I9GH 5E94A 1FL6B 1EH9A 2EDLA 4XP6L 4BWWA 2FO1A 2E6QA 1MVUA 2A74A 4XMPL 1X9QA 2JMRA 3EGXB 4L1LA 5HI4C 3PLYA 2FSDA 2HKHH 2W88A 1WEJL 4TOYH 1N26A 1ZD6A 4XWOC 3QCUL 3A4FA 2NY1B 3NJJA 4X6CE 5JPNB 3OPZL 3LRMA 1CGWA 4IBYA 4DKEL 5AUMA 5C09D 3OAZH 3QJXA 4YHLL 3L7FA 5I26A 3ZT6A 5KS9B 1XCQA 1KN2L 1Y18A 2VJXA 2DMCA 1I8LC 3Q1EA 4MQSB 4J3VA 1GHFH 4U0RC 3O2DA 5AWNL 2Y07L 3GBNL 3VRIA 4Y16A 3LEXA 1AD0B 3BGFB 1OE1A 2P24A 3K4AA 5AALA 4YDJA 4ZT1A 1HSAA 3PJSB 2XKUA 5DQDL 3VFUB 2EE3A 1K85A 2RBLA 3GSQB 1B4JH 3VWKC 4X6BA 2C7UB 5I1CL 3QAZC 1OGTA 2BNUA 2GCYA 4P2QB 2UZYA 3VSQA 1LO2H 1E4WH 2YPVA 2Z65C 3E9TA 3QQXA 1EUTA 1A6VL 3GRBA 4UANA 5FOJA 2EDTA 3SE4C 4D0DB 1XGPB 1NC4A 1RZIA 4NYLB 5T1KD 3ARXA 3CZEA 3O2DH 2JKTM 2K9UA 4TNGA 4X7SL 1CDBA 3HBZA 4OLVL 3V52H 4CVXB 5IJKC 4P05A 1R3KA 1MW0A 3KJ4B 3N44F 3K2KA 1HYSD 1NIBA 2PYFB 3KL5A 5TTRA 4Z7QF 5DO2D 4I9WD 3SGJA 2BP5M 5D96C 5DVKA 2X2UA 4ZUUA 3CXFA 4NBXB 5C7ZA 4MLSA 2YPVH 2AANA 4OIBA 5GRVL 2AW2A 4J7RA 4YHNA 3BPOC 1BQ5A 4XP5H 4DQOH 4OCRL 4YEFA 1U36A 5A43C 4GINA 3OKEB 4WW2C 1OGPA 1L9PA 5LXGH 4MMXB 2FBOJ 5DURB 3BSGA 5AEAA 1SEBB 3W56A 1HWGB 2YBRA 3IJSB 5IBTH 5EFIB 2IBZX 5DJ8A 4R3SB 5EU5A 1U8CB 1TTGA 3QDHA 4S11A 2R4SL 5JIKA 4WHTB 5KOVC 4NO5B 3HS0B 3QQ4B 4HIJB 2FR4A 5ABAA 5HHOE 2W59A 1RJZB 3QJUB 2FNBA 4YSPA 3SPJA 2O1AA 3IKKA 4WWKD 1YN6A 3DGGA 3F58H 3CN3A 4ENED 1JWMA 1D9KB 3CSGA 5GJSL 5C1MB 1BM7A 2RJMA 3FFCA 2NX5B 3DV4A 1O75A 3O4OB 4U1GC 4DOHE 4MA7L 3HR5A 3PL6A 4G5ZH 1U3HB 1IILE 2P4AB 1XXFC 1L3WA 4QMEA 1TZHA 2HT4C 2VDQL 3EYFB 3EUDA 4QRPA 4BA8A 2FBRA 3SPHA 4KY1H 4TNVK 5JORB 3HG1E 1ET8A 3CIQA 4Y5YA 1NGXA 5EOTB 2IFGA 1NCAH 2NYYD 1YY9D 3NFSL 3LQAL 4UDUA 1A2YA 5ICXA 1U6AH 1MI5B 4HC1A 4RAHA 3T3ME 2PO6B 1NC2B 2ZX8A 4XWGH 3S34L 1NBZB 3R19A 5JW4M 4GQZA 4H88H 1YPZF 4L3EE 1AQKL 1KGJA 3MLVH 1CLOH 2D8KA 4PJ5D 4NPYB 1G7JB 4UUJB 5D1QE 3C5JA 3BQUC 2PP9A 2DRUA 3P0VH 5EHFA 5IESL 3GTNA 3PXLA 1J9QA 1KC5L 4FZEL 4WQOA 1D6EB 1QSFD 5DEGB 3O3UN 4UQBA 4HDIA 4ONFL 1HH9B 6FABH 2ERJB 2EO9A 5DQ9A 4HC1H 4NZDA 2PCPB 2B1OA 5HYJB 4DFIA 2ZWYA 4BWUA 1E9PA 5FHBL 3MCG1 2AQPA 2IV8A 4BSVB 4U1SA 4I0PC 3GD1C 4POZC 1Z3RA 2H1LM 4IRSB 5DVMA 3I2CL 2IBZY 3BFWA 4LSPL 5FV1L 4ZMYA 3HZVA 2H32A 1GSKA 2P48B 3MREB 2G9HA 1KPUB 2VJ0A 5EU4A 1FL6A 1PZCA 5KVEE 3ABGA 5C0JA 2D7TH 5HGAA 4PY8I 4KX9A 4NQEB 5E6IC 5EIVA 5IQ9A 3IB4A 4HMDA 2NTFB 2XWXA 4XVUD 1D5BB 2VMJA 3MI6A 4CU6A 1NMCC 1A3ZA 5JPNA 3L4TA 3CXHK 5DUPL 5K59E 3DROB 4JBSA 4UV7L 1H3GA 1G9HA 4ORGA 3PJLA 5B8CC 2VLKD 4AOFA 5LJYH 3EG9A 2O72A 2H32H 4HIEB 4MJIB 4G6FD 5KS9A 1LLAA 4PCSA 2FD6L 4G7YH 5T1LB 2COQA 1GKOA 4JREC 3NZHH 4AC4A 2GHWB 3II1A 1AD0A 4K15A 5I8OH 5GZNA 1CD9B 4B95C 1E4XL 2ZPKL 3E2HC 3GSQA 5FUOL 8PAZA 3TBSB 2C7UA 5FYLL 3VCLA 4YHKH 3PAUA 3QB7C 3N85L 1J0YA 3PQYE 4PRIE 4IU3B 2YD7A 5LNEA 2CO6B 4WSKA 3RIAF 1S46A 5EIIA 3DURB 4NYLA 1C5CL 1UASA 5E8PB 3VFGH 4B9IA 5KBKA 1ZCRA 2K3HA 3D05A 2IF7A 5F7DB 3MR9A 1J0HA 4NQCD 2FJFB 1CLZH 3I9AA 3UIYA 2PYFA 2LABA 3FTGB 3SDCC 2HFEB 3KR3H 5BQ7B 4FG6D 5DVOA 1S78C 2WCGA 5GGTL 1JWUB 5J3HC 5J13C 1OPGL 1FFNA 1E2VA 2MWCA 4FULA 4QHUB 3DVIA 4HP5A 4Z7NF 3FO1B 1KB9K 4G9FE 3GLZA 5D2LA 3D69B 2YPLB 3OKEA 4GSRA 5EWIL 3AT8A 4PRBB 4MMXA 4NO3B 5I73B 3BC9A 5EN2B 1ZT4B 1E40A 4MZ3A 4NN7B 1ETZB 3SGEH 1SEBA 1CJYA 4HSAC 1ACYL 5F93C 3IJSA 1WZMA 4FHJA 5EFIA 1DHKA 1DJIA 4A7GA 2XZCH 5INCB 1U8CA 1MPAH 1EHLH 2H1XA 4DPRA 4HXAH 3KLAA 4LHUD 4NO5A 3HS0A 4HIJA 4WJ5B 1WA1X 4X6DB 2PTTA 3AS3A 2P42B 3VM7A 4OFVA 1A3LH 2A73B 4M9PA 4M6OL 2VUKA 4G1MB 4RGOH 2CH8A 5DD5L 1NOLA 1OM9A 1AO7E 5F21B 1YQVH 2F1BA 4GAJL 4RGMC 3QUZD 4Z77B 4IRJC 3I3EA 2J6EA 2ZF8A 4HISA 2QTEA 1ZE3H 2NX5A 4D3CL 1CFTB 1RZJC 1UM6L 2CJUH 2ZXGA 3DPBB 3IPFA 3LZLA 3P4LA 4PV8B 1GMEA 4KBPA 3SE3A 4JQVA 2APXA 1N59A 3OGCB 1Q0YH 2C3GA 5LHDA 4K55A 3VDBA 3EYFA 2R8SL 1A7QH 1AY1L 3MSPA 4FP8H 5JORA 5IW6B 5F72S 3LPGA 4IMKC 3VGGA 3MV8E 5EOTA 2QL1A 3ESUF 1IAMA 3L3DB 5D7JC 3WS3B 3ZE1F 4WUUE 3FT0A 4N9GB 2C9PA 1EO8L 2PO6A 3V4UL 3NCJH 1NC2A 1T1YB 2J4WL 1F4WL 3I50L 3P69A 3CK0L 1A6UL 4RA0C 1MCIA 1G7JA 4GOSA 4NIKB 5ALBL 5D8JH 5CFHA 1G9MC 2AXGB 4NQVA 4PG9B 4RGNE 4AVJA 4U1NA 5DEGA 4XCYA 4GRWE 1Y07A 4G6JL 1HH9A 2F5AH 3FHQA 3STZB 5SX5H 1MREL 1QTPA 3P2TA 4HIIB 4ZOBA 5F1IA 4YMPA 5ESQB 4K7PH 1FAIH 5KYNA 2A1WH 5CN1A 2X40A 4GIOA 4HT1L 1TTCA 4ABVA 1YEJL 2R1YA 4IRSA 4EQ2A 2F7RA 4GG6B 4S1RH 2WK2A 3C87A 2OTWB 5DEFA 2ZWSA 5DS8B 2R39A 1KPUA 3RZCB 1XGUB 1M05B 4L4VD 4NQEA 3ZDZB 3W1ZA 5A3IC 2NTFA 1AZNA 1D5BA 1VZHA 1ZXKA 2A4ZA 1MVFA 5A2CA 3DROA 3OMNB 4QOKB 4AXWA 5TE6H 4F8NA 4HIEA 4GT0A 5T5FA 2N1TE 3QI9B 4JFOB 2JELH 1TVHA 4E41B 1WT5C 1I7UB 1DVFD 1CL7H 3T9WA 3ETBF 1JXJA 2OTPA 4KJYA 4CRPA 3DRTB 4Z7VF 5SWSA 2AKRA 1IQWL 2UVEA 1J48A 2VCOA 2DWXA 1IU1A 1J11A 2DKSA 4ODUB 2V9QA 3PJNA 3TM6A 5T5FH 1AR1B 3DTUB 1NCWH 1NSNL 2CO6A 1RULH 1U42A 2NSMA 5E8PA 4RRPM 5F7DA 5EBGA 3H9SD 1ACCA 2IH3B 2CR0A 3UTSD 1MFBL 2FLMA 3FTGA 1P5VB 1MCFA 1E4JA 2BVOA 5LG6A 2GB2A 2VAJA 5K39B 1BPVA 2YQBA 1D7CA 3THML 1MCOL 1KENL 5GGRA 4FXGB 4JR9H 1PQZB 3CQPA 2E59A 1JWUA 3DARA 4QHUA 1N6UA 3FO1A 5EB9A 4OUUB 4K2UL 1GC1L 3ATBA 3MLXL 3TFKC 3C5ZB 5HI5C 4KJWD 3IMWA 1JGUL 1F86A 4P2RD 3O6KH 4N6RB 2X4TA 4PRBA 5E6SB 2JKIS 3WY1A 1ZT4A 2ADIB 1ETZA 1PYWB 4W9JC 1F2QA 2OZNA 1I9RH 3MCLH 5E99H 3BH9A 5GQBA 3JWOL 4RISL 1U8LB 5I76B 3VA2C 4WJ5A 4X6DA 4Y19D 1OAYL 4FFYA 1VHPA 2FDBP 3U25A 3V9FA 2MTAA 4ELMB 2DYPB 1EDHA 3RPBA 4G1MA 1C5DB 5DGQA 3AGWA 3DUUB 4JHAL 5TE7L 2IG2L 4ZK8A 1KYFA 3BWZA 1WYJA 1RMFL 5A7EA 4XP1L 5DUJA 4Z77A 3VFRB 4PJ7E 2F2HA 3B37A 4FQXB 3NH7L 1GZQB 5EH1A 3TZVD 2HTLD 4FFYH 1G1KA 1U8PA 3DPBA 5GZOA 4PV8A 1KCSL 4HOMA 4UM9B 4PWIA 5CJ5A 4IKKA 3QZOA 3D8MA 3FDWA 4ZFZA 4K71B 4YFLF 2XJLA 3OGCA 5L88L 3QNXA 4GEIA 4Y9CA 5CJXA 2R0KH 3RB5A 1TQUA 3L3DA 3ARZA 4PLNC 5IFHH 4ODXA 5FUCE 1QLEL 3CPUA 1XCTB 1MEXL 2P26A 2VZVA 3QIBA 2X42A 4UF7C 4N2CA 1BHGA 1N0XL 2R56L 4NT6A 2XQBL 3F65A 2KLRA 3NZ8B 4EUPA 2AXGA 4HS6B 3AUWB 3WIFB 2CKBB 3BEWA 4JDTL 2BNRB 3TN0B 5DMGC 4XMTA 4C55A 3ASOB 2VN4A 1XF3A 2X6AA 2EVJA 4S1DD 4XB8A 4BWTA 1QRNB 2MHAB 4AIXA 3PWJA 4MAYB 5ESQA 2LU7A 2AJSH 4AYID 3U1SH 2YD4A 1DLHB 1A1MA 5FFGA 3V4PL 2N0KA 4MS8D 3HE6B 3RJQB 2XWBB 2V7NB 5EULV 5AOLA 1X7SA 5DS8A 1N64H 4FYSA 3ARQA 4JPVL 3HZYB 4FL4C 1BLNB 2Z0BA 3DI3B 4NZTH 3LEYH 3F2LA 4FGMA 2EZ0C 2E9WA 4F15B 2HSIA 1FVDA 2GVYA 3GMNA 4UQAA 1RK0A 5DJAB 3FUMA 4BKTC 5I5MA 3TCLB 3KGUA 2NXYC 1F3JB 6TAAA 4F2EA 3ARSA 4LAQL 4P9HL 3TNNA 5KSBB 4GW5B 4E41A 3QUXD 1I7UA 3QZPA 2D7MA 2NY5C 3GB7A 4HHGA 4O2CB 3JT2A 1S9VB 1SM3H 4ZDHB 2AK1H 2UZXB 2N7AA 1RH8A 1IIIA 5E51A 4ODUA 2X70A 4MA8H 1DTUA 3M45A 3ZMRA 1HINH 4ZSOB 4LDLB 3HPJB 3GIVB 2I9TB 5CJBA 2VIRB 1AHMA 2UUDK 3ZL4L 4LIQH 3QPQC 1RUQL 1DCEA 2EDYA 3CVBA 1HEZB 2RACA 2JI3A 2YAFA 5ANHA 4Q9RH 3TYGL 1AQMA 1FNSH 4HJSA 2GK2A 1P5VA 1UA7A 1HT6A 3VYNA 2BJML 2P7TB 5K39A 4U2ZA 4TQEL 3U9WA 2QADD 3GSWA 5AL8A 5DTFB 4MCYA 1YJDH 2UXVA 1PQZA 4NFDA 3UCRA 4HHWA 1XZWA 1HJCA 5IFJA 2NT0A 3TFBA 4OB5H 3OJMB 4H26A 4OUUA 2K0RA 2X87A 3C5ZA 2ETWA 4N2IA 1M7UA 3INUH 4I2XA 2EAEA 4KOCA 5E5RB 4BE6A 3WY4A 3CZNA 4UV4H 3Q01A 1KCVH 1IC7H 4Y4KA 1QP1A 2MSPA 4P2OC 5I6LA 1V27A 1RZGB 4AEEA 1A6WL 5EEWA 4AQAB 1U8LA 3ZO9A 1OK8A 2J1KA 1YMMA 4KMTH 2X3CA 4MYPA 4WEEA 1G1CA 1MFVA 2OP4L 3K8MA 1A4CA 1BVLA 2BDNL 2RFXB 3C9NB 4KKAD 2VZ1A 4X5LA 4XI5D 5FYKH 4C56E 5ABDE 1C5DA 2BOBB 3DUUA 3E6HA 4BFGA 1YY8B 4TTDC 1SY6A 2QVTA 1R5IB 3PWLB 2GAZB 2MOGA 1N70A 1QPXA 1GZQA 3PHOB 2AJXH 3MRFB 4AGPA 5LCVH 4UM9A 4CA4A 12E8L 2W5PA 5EBMA 3V6OA 2IPTL 4XMLL 1VFMA 3L6FB 3ALXA 2KQMA 1SY6H 5C08A 3ZPDA 2Z8SA 3NA9L 1IC0A 1X6NA 1U2HA 2V4LA 2VDQB 3G6JB 3ZDXF 3ULVL 3PABA 4DK3A 1NFIB 1XCTA 3K4DA 1QSED 4GQ9L 1YC8A 3IT8D 2VOTA 1BOGA 3FKUS 1OGAE 2P5WE 2VLRE 4HAGA 4E9RA 4AY0A 4M6NH 4LASH 4WV1C 5CXPA 4HS6A 3WIFA 5LDSA 3UBFA 2WB7A 2J88H 3ATDA 5ERWB 5HJ3B 3ZDYB 2KBGA 3T0ED 1TPXC 3IKCB 1QRNA 1FGNH 3QJRB 4PLKD 4MAYA 2YZ8A 2VH5L 3LKPB 5MEQB 1HOCA 5CM1A 3LZPA 2NY7H 3HE6A 2XWBA 2V7NA 2CKBH 3MODH 2Z93B 3TH4T 3NPSC 5GJTH 3JT0A 1GGCL 2D3LA 2NY6B 3B2PA 4JN1L 4KH9A 5AYUL 4AMKH 1UCTA 4PJ5E 1MN4A 1BLNA 2NSQA 3QISA 4R7NA 3DX7B 3R1GH 2H6OA 4DGYH 2XLLA 1MVYA 2BP0B 5I1KH 4LMQI 1CIUA 5AOZA 3GMLB 1A1NB 1NDMB 4OZFG 4OZGF 3TCLA 4OLXH 1F3JA 5JUEH 1EVUA 3NEXA 3FQWA 3WI9A 4F8LA 5FEBA 3DHPA 1CE6B 3A4AA 3RWHB 2Z64C 3WG7B 3GINA 2IANE 3SCMB 5D7LB 1NUGA 3KD4A 3MRNB 2ROYA 2TAAA 3CSYA 1FZOB 2VXVL 2IDSA 4XP6H 3OAZK 3UADA 1S9VA 1KWKA 5EZOL 4XMPH 4ZDHA 2VT0A 2UZXA 3UJTL 2BFGA 4IIQA 4IOFC 1WEJH 1CDIA 2WXMA 1UD5A 3QCUH 1BF5A 3BISA 3T08A 5CZVL 2XN9D 2ADJB 2F53B 4WFGE 1H3TA 5EF1A 3HPJA 4H7VA 2GFBA 2I9TA 1CLYL 1KG0B 2VIRA 2KYIA 4YHLH 5H94A 3IJ8A 1KN2H 2ICEB 4C8XA 1ETJA 2VGLM 3UDWC 1HEZA 1SMOA 1FIEA 2GIYA 3BWUC 1KCLA 3SIKA 3GBNH 3QORB 4NX0A 2BZDA 4DP1X 5AFAA 4AEFA 1VFAB 4JJOA 3IE4A 5DQDH 3S35X 1KJ2L 1JPTH 5I1CH 4GBXA 2MTPA 1CYGA 1QWNA 2A6JB 4ZS6D 5DS2A 3HN5A 4H8UA 4N2LA 4R5XA 1XIWB 2W9LA 1UXMA 2YD8A 3CJJA 1AS7A 2X44D 4X7SH 2KC0A 4OLVH 1WRFA 4XGZA 2XWDA 4FRWA 1BZQK 3WIAA 3P11L 5T1MA 4BK5C 1W91A 2XTLA 5C8JB 4QYOB 1F6AB 3LTVA 1SJHB 1RZGA 2O4EA 4DN3L 2C1PB 4NQCE 4ZMPA 2WXNA 1EDQA 3C2AL 3MBEC 2D03L 2YSSB 2PP8A 2LOEA 2NCMA 2RGSA 3U9UB 1LE5B 2RFXA 3P4MA 3C9NA 3QNZA 1W0WB 2BOBA 4JHZA 1A47A 4FXLA 4NC1C 2VQ4A 2FJSA 3L13A 1WH0A 1VCBC 1PKQE 3NAAL 3TXAA 2GAZA 1RVFL 2EUZA 2QELA 3DIDA 3JUZA 3ES6B 1J10A 4Y1AB 5EEZA 3ZKQD 1ND0A 3K6IA 1UWGL 1YEFH 4HD9A 3MRFA 1P4BL 1HN1A 3H8NA 4FG2A 4UINL 1KV3A 4KZDL 4NM8L 5T33H 2Z1PA 3H0TB 3OB0H 2E9JA 3ZKND 3RLSA 2HT2D 4OVUA 3FXIC 5G2NA 3SY6A 4GPVA 1NFIA 4WO4B 1ZGLM 1HK6A 4H0LC 5GJSH 2ARJA 2IIJA 4N0RA 2JKLA 1OB1B 4PJFE 3V79C 3NESA 2WXQA 4MA7H 4HJTA 1H3XA 4U1JB 2WCPA 1DQIA 3RVVC 1Z7JA 1WBZA 5C2UB 5F89B 4J8RB 3FU9A 1AFVL 3IMTA 3TO4D 4PVBA 5B7FA 3UGUA 5JMRA 2A77L 3TBVA 5HDQL 1ZV5A 2VDQH 1NGYB 4KI5F 4Z9KB 1LO4L 5ERWA 3NJVA 5HJ3A 1YDPB 5ACZA 3IKCA 5D1XD 2JKWA 3P0YL 5J11B 3NFSH 3LQAH 4E9YA 1EO5A 4WK2B 3V9CA 2VDLH 1Q4NX 3T0VA 5MEQA 3BP7B 3S34H 4P4KD 1T1XB 4OZFB 1MCLA 5EZLB 1MFNA 1AQKH 4WDIA 5KVEL 3AXLA 5KJ4A 5IESH 3Q06A 4FZEH 1KC5H 4YBHA 3OR7A 3PWPD 1KFGA 4C4KO 5K1VA 2A7BA 4ONFH 2BHYA 4CBPA 4EI5C 3DX7A 4BGLA 5A16B 4PJHB 3W82A 4A1RA 4CDGC 2BP0A 3QRGL 1O6VA 4KHXL 4JFFA 3VNZA 3QO1B 3DUHA 4GO8A 3GMLA 5G5DB 4JRYA 3ZW3A 1A1NA 1SJMA 5FHBH 2QSVA 3P9MA 1CE6A 3RWHA 3D52A 1IGCL 3FNKA 2VJ8A 5E2TL 4EF3A 3MRNA 3DSNA 3SOBL 4OV5B 3CPLA 2GJRA 2D9QB 4I18A 1Z66A 4ZFQA 4ZUTA 3NTCL 1UB5B 3APMA 2Y6SD 3HC4L 3D0LA 1TJIL 1XCXA 5DC0A 4L4VE 3C60D 5DUPH 1UT2A 4MNQA 4UV7H 2DEYX 3LD8B 4N2MA 4YK4C 4I77L 1URLA 5D7KD 1FN4B 2B16A 2ICEA 2DQTH 3WTXA 2FD6H 5EORL 4BQ6A 2MMXA 4ZMLA 1H3WM 4ZFGL 1A4JA 5KVDH 4KOBA 1LD9A 3DX8B 2W0LA 2NOYA 2G75B 3RX7A 2EICA 1YG9A 3UOAB 4TN9A 2NY0D 2ZPKH 4PTTB 5FUOH 4FADA 4ZMNA 2O93L 3GXPA 1IFRA 5FYLH 1OOAA 4WJKB 2JIXB 5I5JA 1FCCA 5K9KB 3N85H 2P5ED 5EBLB 4S10A 3EBAA 1JZ5A 1E5YA 5EOCL 1CGSL 5GGTA 3E7JA 3EO9L 1C5CH 4H0GA 3F6LA 3AQXA 4N9OB 4OLUL 3HHSB 3ATAA 1MNUL 3RQ3A 2KDGA 1EFXA 4A2DA 1J0IA 2YFOA 1UTDA 3L81A 2X6VA 2HLFD 3QG7L 6PAZA 3KPMB 3EFFB 1F6AA 3H9SE 4QYOA 2K9FB 4NZUL 5DLLA 2C1PA 1E8YA 1DVTA 5GGTH 2YSSA 4DK5A 4AGOA 4JFDD 5TH2A 5ICZB 2YAOA 1OPGH 4PWFA 1E67A 3FTVA 4QAWA 1LE5A 4Y4HD 1O6SB 1W0WA 3BP4A 1RUAL 1AXTL 5SX4H 4DQAA 2DL2A 2LAAA 2XWTB 2Y2TA 3EDDA 4LVOC 4OGZA 4WHYG 1EGJL 2CCLA 2AJYL 3EBGA 5CNHA 2P47B 3A23A 2CR6A 4GUPB 4UNIA 3L9RB 1JPGB 4FA6A 1ACYH 3ES6A 2LLLA 4P2RE 4LOUC 4A38A 3RGVC 1IBFA 4ODWB 3WBDA 2HPOA 1PZDA 3H0TA 3IGLA 3DJSA 1E5CA 1A02N 4LO9A 4M6OH 4P5SA 1OTTC 1NCOA 2QGDA 1A6AB 3NCCB 4Y9FA 5EU6B 5DD5H 4H8HA 1HHJB 4OF6A 1FUNA 2PR4L 4G6AC 3QDMD 4PJCE 1II4E 5I6XB 3FUHA 3HLAB 4PS7A 3WE1A 1FFTB 3APNA 4WO4A 5LXVA 1IBYA 3A0OA 4P46B 3C6SB 3VI4F 5JHBA 4HEPG 1OB1A 1QLEB 3S2CA 3SBWC 1UM6H 2YKKA 3F7YB 5K69A 4L9LA 4U1JA 4JO3H 4LU5L 1FWXA 1EHNA 1WITA 3VYOA 5EU7E 5F89A 1MLCB 1CFQB 3CSPA 1LEIB 1CF8L 4OZHE 1VRSA 4ZD3L 1JMXA 2UXFA 3LS4L 4L48A 1AY1H 5TGBA 4X9BA 1YDPA 4NJ9L 3VFTA 4HWUA 4PV9B 1KLGA 2E7HA 1HKFA 2ZWZA 4D9RE 1F42A 2ICCA 3KZ8A 3J8F7 4PJ9B 1CWVA 1EO8H 3U46A 5MERB 3CU7A 3APCA 2H3NB 3BP7A 3RIAK 3V4UH 2IWEA 5C0BD 1T1XA 3BUQA 3MKGA 1F4WH 3I50H 2P28B 3CK0H 4MMYB 5EZLA 1BREA 1A6UH 2P45B 5SX5K 3VFSB 3ZXAC 3V4PB 5C3LD 4IM8A 3DK0A 2IAMD 1OTUC 5JOEA 5EU3B 1S7WB 3VW3L 5FFOA 4B3VA 1CICC 1QVOA 3D30A 4G6JH 3FUKA 2AHIA 4HK3J 2OMYA 4X4KA 5A16A 4FJ6A 1FVEB 4PJHA 3F7PC 4L1BA 1OQXA 4WCYL 4XXCC 5FA4B 3SKOB 3L17A 4Q9QH 4LGPB 4OZFH 5IG7A 2J8UB 4U3SB 1MW3A 5E56A 1AQ8A 4JMNA 3OMIB 3MOAL 4HT1H 3T65A 3V9EA 4DKTA 2YXMA 3U0PA 2A9AA 1M1SA 4QLWA 1YEJH 4JRXA 3C6LD 2J55A 1G9NC 1JZGA 4JDZB 4AVIA 4OV5A 4UQEA 1YHPA 1KNOB 4LLMB 2JF1A 5TF1L 3EJYC 3ZTCC 1UT1A 2MRYA 4PJXA 3OHXC 1UB5A 4PHZA 4BELD 3Q6GL 4Q4EA 1C9SA 3MRCB 1JFQL 1OSYA 3N42F 1FN4A 4ZW7A 2Z35B 2UZPA 3D25B 2XTJE 3N40P 4MJ6B 3FN9A 3E1ZA 5GS2D 1A6PA 4ADGA 2DLTA 3QUYA 3W0WB 3ZVVA 3R18A 3DX8A 4ONGL 2HAZA 2QQKL 3IU3B 1MQKL 5LAXB 1IQWH 2UWEB 4PTTA 1TG8A 5JYMA 1CDUA 4GUCA 3TU6A 3PXHA 4N0UB 2Z31C 1UEYA 2JIXA 15C8L 3F8UB 5GHWL 3OKNB 1E0OB 1NSNH 2FQFA 5EBLA 1N19A 1XWVA 2ZXAA 4IDJL 1H6EA 3ZYOA 2VDNL 3HHSA 2Q8BH 4HZLB 1R3JB 4GW1B 4PWJA 4Q14A 3B7UX 1FYHB 1J8HD 1AG6A 1A8ZA 1MFBH 1HL4A 5AYQA 5LQBL 5DK0A 2WLMA 2WLNA 2ZOWA 3KPMA 1UKQA 3L3IA 3FTZA 3ORJA 1FSKB 2XYBA 4RBPH 5TK2A 2PWHA 1CT8B 3AROA 1MCOH 3I02A 3THMH 1KENH 3TWYA 2WWMD 4KTYA 4PJGB 3RTQC 4M6ML 5ICZA 2IPKB 4B7IA 1MCNA 4MVBC 1O6SA 3FCUB 4K2UH 1GC1H 1LILA 2F58L 3MLXH 4UWQB 1JNJA 2XWTA 1JGUH 1N6QL 4G80B 2KUTA 2XBDA 2WXKA 4GUPA 4JVPA 3L4ZA 3L9RA 4KK6C 4N85A 1WG3A 5SWZB 3FCTB 3BPCB 1AZUA 4E9XA 3JWOH 4RISH 4J3UA 5HYIA 5LBGA 2J43A 1OAYH 3Q13A 1ADQL 1HDMB 1A6AA 5CWSB 1XMEB 5EU6A 1HHJA 4G2AA 1K6QL 4JHAH 5AVWB 5TE7H 1TQTA 4B3EA 4PGCB 1RMFH 5I5IA 4XE5B 4XP1H 3HLAA 5BRZB 3SKMB 2JK5B 1CF1A 3DO7B 1TJGL 3NH7H 3C6SA 1FG9C 3CFUA 1QZ1A 4GFTB 1OV8A 4UIKL 5CFAA 2WSPA 3WJLA 5ISZE 3B1UA 1KCSH 4L8SA 4MB5A 3ESPA 4MS6A 1M6OB 5E7BA 4OQTL 1MLCA 1CFQA 3C5SB 1LEIA 3H56A 4HOWA 1UCBL 3K6NA 1ZJAA 3V0VA 1DEEA 1A4KB 2WIIB 1F90L 4M5YL 2W80C 2WLKA 5AVUB 4ZMTA 1MJ7H 2VXUL 3TT3L 4LCYB 2Z91B 3TVMC 1NAKL 5FM5M 2JKSA 4PJ9A 4LMQE 1MEXH 3BUIA 3ZRCC 5MERA 1LXMA 5FS5A 1N0XH 4MMYA 1SYSB 2R56H 2XQBH 4HD5A 5IMOA 4B0MM 1R3IL 3V4PA 4LCCC 1YRKA 3BI9X 4PJBF 1S7WA 2ZCHL 2K4WA 5EU3A 1VCAA 3EHBB 4JDTH 4G72B 4R6UA 1UH2A 4BXSV 1PY0A 4DESA 3C12A 4XN4A 4RESB 3SKOA 1FVEA 2Y5TA 2E5EA 3HFFA 3OM3B 3CZFB 3LZNA 2XVLA 3AREA 5H35B 4LLAA 1E28A 2J8UA 4U3SA 2NW3B 2ZUTA 3I6SA 3V4PH 1RIVH 1NCCL 3AT9A 4G82A 1KN4L 4NCC1 1I7TB 2KL6A 4JPVH 4MSWA 1UB6A 1OTSD 4M8RA 4K7PX 4FNRA 4LLMA 1QFWI 4PREB 4MXWH 2EADA 4GKLA 1R9FA 2JKRM 3OKLB 4WRLA 3LCYA 4PPTA 5GGQH 3MRCA 3O2VL 3O6FB 3TPUA 3MRMB 3FTXA 4OFYD 3WL9A 2AEOA 3O11B 1ODAA 3QIUB 2IBGA 5IB5B 2Z35A 1ZHKA 4LAQH 4P9HH 5JNYB 5CEZL 2AV7B 4MJ6A 3KPPA 2APSA 2Y7SA 2HJKA 3W0WA 5DJ2A 5MHSD 2H0EA 3AY4A 1G7PB 3S5LG 5BXFA 1HYSC 3UBXB 1TKWB 1YQ2A 3IU3A 5DO2C 1KCWA 2UWEA 1Q90A 2CUHA 1RZFL 4N0UA 4J2XA 1KJ2B 2H9GB 2NY2B 3PU7A 3DGDA 4I89A 4WHCA 4OIFA 3OKNA 1FFQA 2WZPA 4UDTB 5BQDA 2L4OA 2WXIA 2XN9E 5EA0L 3ZL4H 1HHIA 1R24B 1RUQH 3BAKA 3O3BB 1OAJA 1V3JA 1R3JA 2YLKA 3D3VB 4GW1A 3QEUB 5I8KL 3GHBL 3MGTB 3TYGH 3MNWB 2B1AL 4NP9A 1KJMB 1VDGA 3GUFA 2XG4A 1C12A 1EANA 1CT8A 2F8VA 4TQEH 3B1TA 5F96L 3VH8G 3FFCD 2QVKA 2DV6A 2OK0L 4DP0X 5I1DB 4A39A 4WHYH 5HHOB 1JN6A 1I75A 2ESVA 2FEJA 4P0DA 3TJEL 4PJIF 4EDXB 2LVEA 2BIOA 4LEOB 4ZXBA 4QRPD 1QQDB 3FO2A 2YLHA 2ZKWA 1YEGL 3BX7C 3GEWB 4G80A 3OAYH 4HIXH 5E03A 5B38B 4PGJA 3DX0A 4ENEC 2LU3A 2OCCB 3LQZB 4YX2L 4K7PY 3FCTA 4G8EB 2CK0L 3BPCA 2CAKA 1RZ8B 4HEPA 3VXRA 5DYFA 4DOHB 1B6DA 4DP5X 5KBDA 3WS6A 2QPFA 1QASA 2JJUA 3TA3B 4X4ME 4NRYB 1RCYA 2OP4H 1HDMA 2BDNH 2X7LB 1OPOA 1INEL 5CWSA 1O9VA 1I3VA 2BIQA 4MRBA 1O5DT 3HG1B 5BRZA 1YY9C 2MCAA 4ZFOL 3LHPL 4ELKB 5H8DA 3MO1A 4XCEB 2XQYA 3T3MB 4FG0A 1HXMA 4XBGB 7FABL 4GI9A 4TUJB 4ETQB 1KTRL 4NQTA 4L3EB 4BK4A 2RQ8A 1I9JL 2D0HA 2J21A 1M6OA 2QVFB 4KJQD 4F5CA 3C5SA 2Y06L 2XZAL 4XOAA 2IPTH 4FFVD 3S3JA 1XR9B 4ZAKD 1A4KA 2WIIA 3ARBD 4HUVB 1ERNA 4EN3A 1SBBA 2BOCB 3NA9H 2UY7B 3CFIC 3P3TA 3DX4A 3MRBB 4LCYA 2FX9L 3T4YA 4D7PA 1KXQA 2XETA 1F4HA 3PUCA 5KVMC 3ULVH 4Y5VC 3EBHA 4GQ9H 1BCIA 1VFBA 2NY1D 4QXUH 5GGSB 2EILB 2QQQA 4M9OA 2V7HB 4A2MA 2VL5B 3NIDF 2IPUG 1WA0X 2DQJL 1DLFL 2X2HA 4N25A 4ANVA 4GRLC 4V33A 1IGIL 2O5YH 4Z7WA 5F9DC 4J4PA 3QDJB 3B2UD 4XB7A 5L0QB 4X7FC 1TJXA 1YEDB 1N12A 4XVUC 1TJMA 5DMJB 5FKPA 1T1ZA 3AMKA 4PJIA 2VH5H 2VLJE 3FUJA 5A2JH 2X4OA 4PG2C 5D1XE 1VLXA 4P2QD 2V9RA 1KBWA 4NRZB 1I7TA 4Q89A 5I1IL 1AKJA 1GGCH 5KYYA 1SHWA 1IZJA 2VNCA 4B9GA 3KBFA 4PREA 5AVTB 3BPNB 4RNRA 1YNTB 5EBWB 3S5LB 1Z1WA 3QJVB 2WN2A 1IT9L 5JIDA 3PWPE 3JQOB 4MXQD 1OXYA 5ID1B 3VTTA 3MRMA 2VQTA 1NCUA 3PQYB 4NAMA 2O5NA 3BAWA 1KB3A 3O11A 3ZHFA 4GQQA 1Q94A 1UEMA 4IBZA 2AV7A 4QRUB 5L7XL 2OJZL 4UIMB 2VXVH 2HRPL 3L5JA 2EINB 1JZ8A 1JF6A 1G7PA 4FNTA 2NW2B 5EZOH 1RLBA 1TKWA 5DURD 3UJTH 1WCBB 2D2OA 2F19L 4QRTB 3LPFA 4FG6C 1KJ2A 2H9GA 3LHAA 3VH8B 1EXGA 3QZWG 3HI6L 4JCLA 3NSDA 1CLYH 3D33A 3DHMA 3T4AB 1D5MB 1B0IA 1R24A 3OKKB 4YVNA 3S3DB 3FK3A 5JHDA 2CJTA 3D3VA 3GI9L 4CN4A 3GLEA 3K72B 5D7KE 1BVNP 3MGTA 3VXQA 2EEXA 1WFNA 4Z3JA 3F3HA 1KJMA 4Z3IA 1OW0C 3NCYS 2FTAA 4PWGA 4N68A 1UWEL 4TUOB 1JUFB 3IU4H 1XGTA 1Q8MA 1KJ2H 1CK0L 1TZGL 5JOPE 1D9KD 4UILL 4XNMB 2VM4A 2BSSB 2CK2A 2NX5D 3MCKB 1I9IL 4WNQB 5IVXB 1RURL 1P69B 4Z18A 1U3HD 1OSPL 4XZUA 3U4EB 5I1DA 4W70A 3OG4B 4HF5L 4EDXA 4MFHA 1VPOL 2P5EE 3WIHA 3WMPA 3DBXB 1QQDA 1BMZA 3QUZC 4MJ5A 3P11H 5AOKA 1ET7A 2IOMA 4LLYB 1OF2B 2W9DL 1CFNB 4LHJB 5B3SB 5D70L 4G8EA 1MI5D 1EAOA 1RZ8A 2PO6D 3C2AH 1NC2D 4WWPA 2D03H 3FU3A 4HPOL 4H1LG 3SGDH 1CD0A 1SJEB 3P77A 3GS0A 2P5PA 3JVGA 1XB6A 1ES0B 4JFDE 3RVTD 1CBVL 1P6AB 1Z9SB 4JPQA 3BPLC 3QG6B 1ASQA 4HFUL 3GGWB 3EYOB 1IJNA 1RVFH 1WAAA 3OB0K 1TYJA 4ELKA 1KLFB 1L3NA 5HYJD 4WUUB 2WWKO 2IC2A 4XCEA 4HV8A 5D2NB 4K3JL 1JK8B 4LKCB 1UWGH 5AW6B 1YMHA 1P4BH 2MKLC 4PB9L 4UINH 5IBLC 4KZDH 4NM8H 2AZAA 4IRSD 4LPCA 3L5XL 1TTAA 5JPMC 3WD5L 4ZPTB 5B22A 1AAJA 1XHHA 4RETB 4GRWB 2NQDA 3WDHA 2BOCA 5DT1L 4NQED 2C3XA 3MRBA 2Y5EA 4IRZL 1BZ9B 1PCSA 2PXYA 4HZ1A 1IAIM 3QDME 5GGSA 5GPRA 3KLSA 3C09B 4EIUA 1RZJL 2XN1A 2V7HA 5K9JL 2VL5A 3WLWD 2PYEE 4MJID 1XR8B 5AKSA 4X8GA 5T1LD 4KRNA 1PIFA 2A77H 3MYJB 1K72A 4WFED 5HDQH 2FQGA 1PVHA 3QDJA 1C08B 1LO4H 1YEDA 3T6QC 4HH9A 2DIAA 4LP8A 3P0YH 1I8KB 4YNYB 1TQVA 3LXAA 5DJZB 4Z7IA 1UGKA 3P4NB 1ILUA 4XO4A 5AAMA 3HZ3A 1D6VL 5GRUL 4F9PC 4ZQTA 1ZKAA 1Q0XL 4YDLB 5GXBB 4NRZA 3VD4A 3K6SA 4AMXA 1IC5L 4L29B 3VSUA 5KVEH 5D5ME 5C0BE 4G7SB 2VZOA 2R7EB 3PFQA 4OI9A 2PCYA 3PWUB 4DO5A 1YNTA 3KS0J 5EBWA 3FQUB 3BVVA 3QRGH 2UY6B 3V0WL 3IF1A 4KHXH 3L3KB 5F9OL 5DFTA 4KO5A 3CFTA 2MEJB 1CL7I 4O58L 4PRHE 1J7VR 1YAZA 1HQ4B 4HJUA 1GA2A 5EEXA 2IQ9L 4N2AA 1P7BA 1IGCH 2IALA 4YC2B 3FPYA 1CCZA 5IW1B 4DEUA 4I85A 1H15A 3SOBH 2G5RA 4UIMA 2YPLD 2R2BB 4QJ3B 1JYWA 2E8YA 2ZUQB 1PZ2A 2NW2A 3NTCH 2CSPA 3RKPA 3WY2A 1CI3M 2ZP0T 4WWOA 1WCBA 5CJQL 3AQYA 4GO9A 1A9BA 3HC4H 2F08A 4QRTA 5E4OA 3CCHB 1TJIH 4S1SL 3SKUD 4AKPA 3VFVB 3VH8A 3F85A 1Z3GL 4LSTL 4PSPA 1Q38A 2OV0A 3T4AA 3OKKA 3Q6FB 3ZQXA 4X4ZA 2OX5B 2DQCL 2R15A 2X53A 4PS3A 1R6VA 5ANME 4KJWC 4ZFGH 3VD5A 3P02A 2AMGA 1UD3A 2VDNB 4P9MH 3DXAE 4TUOA 3UP6A 4LVNB 3VXSE 4APQB 3QVAA 3B3IB 3PGDB 4XNMA 1BG9A 1H6TA 2A4CA 1GGIL 2AQRA 1X4YA 2BSSA 4OJFL 3IGAB 3MCKA 5GZOD 2J71A 5F8QC 4WNQA 5IVXA 5EOCH 1CGSH 3U4EA 4H1LB 3EO9H 5HHNA 4RWHA 4OLUH 1FIGL 2B5IC 2R0ZH 4F8PA 2FE0A 3KCPB 4W81A 2VO8A 1O5PA 3DBXA 1MNUH 2ICWJ 3KJ6L 4GG6F 3GXIA 1A66A 2EIMB 1S7QB 3CC5A 4LLYA 1EGJA 3QG7H 1OF2A 1X4ZA 4KPHL 4PUBL 1H6FA 4PJ7B 1CFNA 3QPKA 1DANT 2HTLC 4HUCA 3S8GB 3G6DL 4Q58C 4OZIA 4FNPA 3N6YA 3V8CA 4MMZC 3HJ0A 4WTZG 5C2BL 4EDWL 2Y0SA 1ES0A 1AXTH 2DQMA 4TQHA 1KGUA 2AERT 2C5DC 1Z9SA 2QPEB 3BP6B 3HI1A 1EGJH 2AJYH 5PCYA 3QG6A 4JVWA 1SOQA 1ZHNB 3GGWA 5KZCB 3EYOA 3LRHA 5IGXL 4UT7L 2GITB 4N87A 1MQ8A 1PJWA 4RAVB 5D2NA 1WZKA 1WUNT 1JK8A 1AJ7L 1ZVHA 2V8LA 4LKCA 4ZO7A 4XNDA 2FHBA 5CEXB 5HDBB 1LP9B 4A55A 2G3NA 4LE8A 2MFNA 5IKCB 1HOEA 2WMPB 1FYTB 1XTLA 2XY1A 3RZCD 5LNDA 1IARB 1MXDA 1PF3A 5DRNB 1AE6L 4S1DC 3LY6A 2X0UA 1DL7H 1QFPA 4LSSL 4FAAB 1BZ9A 4M1GL 2AITA 1S3KL 3RIFF 4D7BA 3CHRA 3D4GA 4XO9A 4QOKD 1WWAX 3O45B 1XR8A 4FXTA 4W68A 4LLQB 2WBWB 3QI9D 2YA0A 4JFEE 4GRWH 4DVBB 1KDJA 4E41D 1U8QB 3MYJA 2ZOOA 1CF8H 1G5AA 4AQEB 4YSAA 4ZD3H 3LS4H 1HQRA 4NJ9H 3CFMA 1MCCA 1X5IA 2XV6B 1QI3A 2WSDA 5DZLA 3P4NA 3UC0L 3CFBB 2WUCL 4JAMB 4W9KC 1AR1D 4TL5A 2DN7A 1KDIA 4IHOB 3RL2B 1TEYA 1TO5A 1J5HA 3KHQA 3TBYB 2MNJB 5JO5B 3TBCA 3VW3H 3QUXC 3UROR 1LK2B 5C7XH 3O6ML 1WFTA 2UX6A 3IDGB 1N7ML 2AZUA 1O0VA 3FQUA 3HAEG 4WCYH 1TCRB 1YO4A 2UY6A 4KK8D 4IJ3B 3L3KA 1OP4A 2EIJB 4DPCX 3CTTA 4M48L 5CZKA 3WUZA 3JV4B 1HQ4A 3DC0A 3MOAH 1PKOA 2GEQA 3QZWA 3CU1A 3ZE2B 3DJRA 4HVBA 4Z3EA 3TV3L 3DJ9A 3JTBA 2WO3B 4HWZB 5IW1A 3ABZA 3C5ZD 3E6FB 5AOJA 2R2BA 2DM3A 2NZ9D 4GO6B 4XN2A 5FYKD 4JDEA 3TBWB 2V3DA 3KGTA 1NUDA 5TF1H 2JB6A 2R1WA 1FNFA 3D9AL 2FJGB 2H6UA 3Q6GH 3MRPB 3H3BC 3CCHA 4EAEA 1E8XA 5HP5A 4KNQA 3C08L 3DYPA 1OWRM 2B4CC 2JI2A 1F56A 1T5XA 3OLDA 1JHKL 1JFQH 1MCJA 3OV6A 4OY9A 4JG5A 3VM5A 1YC7A 2DYPD 4J8QA 2BHUA 3BHBB 4JGUA 5CILL 1TF4A 2NY5L 4AE1A 4B96A 4YDNA 2P43B 2BIIA 4U0RB 3VB9A 4FFZH 2QQKH 4JL1A 1JD7A 5I74C 3KH3A 4FQXD 5MHSE 3V0EA 5KG9B 1T20B 3VWKB 15C8H 2ZKYA 3IGAA 2EDXA 2Y69B 4UM9D 4TYUA 5IQNA 4H1LA 1KOAA 4IQHA 4KKAC 4XI5C 3VGAB 4BFBD 2CNYA 4K5PA 3LNGA 4FTVA 3KCPA 2VDNH 4C56B 4EI6A 3ZTDC 2AV1B 2I9LA 2Z4TA 5IB4B 4ZQKA 4AEIL 1PD6A 4GMSL 4GUQA 1S7QA 2WLYA 2ADGA 4JY4B 3BKJL 3VQLA 2M83A 4BDVB 3X3FH 3GMOA 4AH2B 4QT5B 3FL7A 4KROB 4H1LH 1JIBA 3G3LA 3RB7A 1S5HA 4M6MH 3MV11 4XNZB 4FABL 1KACB 4YH6A 3D2UA 1HFUA 1I1FA 3KPNB 3WHE0 3FFCE 2F58H 4X5XA 2BNRD 1GYUA 4EO5A 3TN0D 1ADQA 2WLHA 3SB3A 5KSBF 4S0HA 1N6QH 4I7ZC 3ULUF 4WW2B 4D9LL 4GKSA 3VAEA 2QT6A 3ZYIA 3T1WA 4J3BA 1QRND 2BX5A 2VC2H 4J3OF 2B0SL 4A7VA 4MAYD 4QRPE 4RAVA 2VITA 1JBJA 4ZFOB 8FABB 5F7WC 1OGAB 1FBIL 5CEXA 4URKA 2VLRB 3VFPB 1LP9A 1EXUB 4OD3L 3IN2A 1PSKL 5IKCA 1KELL 1X9RA 2WMPA 4Q6IB 1FYTA 5F9JB 4OQTA 1K6QH 5B1KA 1S7XB 5BUPA 3T0EC 1T83A 1VF5C 4M8UA 2HCZX 5AZ2L 1KEGL 1TJGH 4PBWD 2GT9B 4OM0L 3U30B 5DK3A 1GYVA 2EXWD 2LVCA 1MHHB 1G7IB 5CR8A 3WXVL 4RIRB 4ENZA 2WGXA 5E4AA 4F3FB 4RFEB 4U1GB 1S9YB 1ROWA 4OJCA 5ETUA 1J8RA 4DVBA 3RNKB 4LRIC 1ZLVK 1DBKL 1WBYA 1UCBH 3MXWL 4TUKL 4AQEA 1F90H 2FGWL 4H40A 4M5YH 3UG5A 3MGAA 2VXUH 4P5MB 3TT3H 3F84A 1MJUL 3HAEB 4K73A 3UAJD 1NAKH 4RDQG 4R97C 1JGDA 3NIFF 4NN5C 3N5AA 1JTPA 2I85A 3D18B 4FQJL 4R4BB 2WAHA 3EGSA 5HHQB 5D6CB 2HH0L 3RL2A 1R3IH 3D39B 3MJ9A 3TBYA 5JO5A 2EABA 2IANB 2ZCHH 1ZVSB 4R0LC 5I0WA 3L1GA 4HFWA 3V95A 4U2YA 5DRWB 5KS9E 3MJ8B 4C4UA 3B5TA 1TCRA 3LMJH 1HVXA 3F62A 3BDYH 2QGCA 5AAWA 2WXRA 3JV4A 4JFTA 3IVKB 1HX0A 3BWAB 4HJ1A 1NCCH 1OEZW 3HMXL 3FUEA 1KN4H 3V7AE 2H1PH 5AW4B 4HWZA 5CP7B 3SYPA 4LDCA 3E6FA 2CUAA 2YUXA 1AGBB 2YJLA 1Y1UA 4N24A 3QJFA 1NUFA 1PU0A 2Z34A 3B2VL 4KKLD 2BXZA 2BSRB 4IEFB 32C2A 1NEUA 3G6JF 3ZKXC 1NMCB 4ZS6C 2O26U 4DKFL 2ADFL 2ZOLB 5DFAA 5F7KC 5CEZH 1HYRC 3KNBB 4LVHB 1I8LA 4YHOL 2RCSL 4NCDA 1BVNT 4JREB 5FGBC 3VU1A 5D2LE 1N67A 3ROLB 1A4AA 3DVGB 5CO1A 4NO2B 5F1IB 3E2HB 5KG9A 1T20A 2IFFL 3VWKA 3QIWB 1WICA 2RMNA 2XVKA 1A22B 1T80A 3MLUL 5EA0H 4WTZA 2AV1A 4L37A 5IB4A 1TQSA 3HUJB 2EXSA 5ECGA 2YS4A 5I8KH 3LN5A 3AS2A 2B1AH 5LBSL 2EEAA 4BRVA 1J0JA 1DVUA 3ALWA 3MBWB 4OCLC 5IJKA 5I6KA 4JY4A 5LGHL 4G6ML 4R9HA 4W9LC 4BDVA 2BMKB 3B43A 5F96H 3SDCB 3BZDA 2VDKL 3HG2A 5GRXG 2RALA 4L23A 1G7HB 1R19A 2N59A 3OAYK 3PP4L 3QA3B 3BVXA 1M7IB 2WQWA 5HJGA 4HAFA 2OK0H 4GSUA 3ZKNC 3BKYL 5J13B 3KPNA 4G1EB 3T77A 2NX5E 3TJEH 2MJWA 4GIPD 4JCWA 1KBPA 4WW2A 4M62L 1YEGH 1F3DH 2EUVA 3AC0A 3CDCA 3G04B 2OLDA 3L3JB 4X99B 4OFDA 1AIZA 3UTTA 5FDWB 3RWGB 4YX2H 5B3JE 2CK0H 2ZF9A 3EH2A 4ZZKA 2FRGP 4ZFOA 3Q0HA 4F7CB 4MCMA 4ATTA 2JI1A 4DTGL 1A3RL 1K5WA 3VFPA 1EXUA 4YHIB 3GMQB 4HLZH 2NY6D 1INEH 5F9JA 3ZRSA 4AL8H 1R3HA 1S7XA 3NCEB 1Z5LA 2H2PD 3BE1L 4WSGA 5D1XC 3B4NA 5GS1B 1EBPA 1UXLA 4GP5B 4N3UA 3DX6B 5AW8B 3KM1A 2LE9A 2GT9A 1AIFB 1L5GA 1OD9A 1AXIB 1S9WB 3LHPH 4IU2B 4MWFB 1UA6H 4P99A 1IL1A 4WUKL 4P4KC 1MIEH 3N1QC 7FABH 1MHHA 1G7IA 4HXBL 4AJVA 2I32A 1CLCA 4E2OA 4EVNA 4F3FA 1I9JH 2HVKB 2NMSA 2D7NA 1KT2B 1S9YA 4RFEA 4ZX3A 2XQYK 3SCMD 2XZAH 2D0FA 5D7LD 3RNKA 1L9NA 1RP9A 5B39A 5BRPA 1MCEA 5BNXD 5CSGA 4P5MA 4M8VA 2FX9H 4YSEA 1VAHA 2IGLA 3QWNA 1M53A 1ZHBB 3VI3B 3QYMA 3P3SA 3D18A 3CN4A 4R4BA 4NQEE 2F53D 3BZFA 3CN2A 4ZMQA 3NSFA 5TDPB 1TO4A 5FYLD 2FYYB 4KI5C 5M95B 1SHXA 4I48B 2DQJH 4PVNA 5LN4A 3AG1B 5JW3L 2JCCB 1ZVSA 3BP5B 4MAUH 5I0DA 5ICYB 4M7LT 3BQUA 4LSVL 4Z76A 5DRWA 3HAEH 4IK6A 2R2CA 3UZVB 3ARFB 3QORD 3UG3A 2V0AA 3TF4A 1JXFA 4R4FL 2ITCA 1F5WA 3RILA 4FI7A 4V1DB 4IOIA 3C60C 1Q9WB 3Q5OA 1NBCA 4I3SL 4JZJC 4LNRB 1TXKA 5KSUA 3K46A 3BWAA 1A8JH 5SWSE 1L0YA 4N90E 3H6AA 3P4OA 4DP4X 2DQIL 4RX4D 4I0PA 4H0IA 3L9EA 5CP7A 5I1IH 1XIWD 3ZMEA 2X9WA 4JB9L 4MQ7A 4QAMB 3TBBA 1QA9B 1PAMA 2XV2A 3CMGA 3Q8CA 3FYEB 1NANH 1XV8A 4HUMB 3RGBA 5E6IA 1S7TB 2G0LA 4MD4B 1IT9H 4L1TA 2BSRA 3VSTA 4IEFA 5TPWL 3S37L 5ESVB 3FRPG 3WYRA 3ABKB 1CVRA 4PBDA 3NP3A 4XC3L 2GJ6D 4LLVB 1WIOA 1SN0A 2OL3L 2ZOLA 1E4XI 4F7PB 5B8CA 2WSKA 5HHPB 5L7XH 2OJZH 3KNBA 3VGHA 3WOVA 3BZ4B 2HRPH 4F57L 5DK2A 1N6VA 4N0YL 3MXVL 2VN7A 3CFCL 4LSQL 2HLFC 3ROLA 2EQDA 2G5BB 4DVRL 4F2MB 1NOAA 3VTMA 4AT6B 3DVGA 4KUCD 1P7QB 1WAEA 1OZUA 3GWJA 1BBDL 2CLRA 4NO2A 3L4VA 4Y1AD 2VDML 4N2KA 3QIWA 2LU5A 1F18A 3HI6H 3SEPA 5L2JB 4BEIA 3B3BA 1PBYA 1R1CA 1WJ3A 2JJTC 2ZYIA 3HUJA 3GI9H 4OSUL 1MLBB 4G8IA 4UT9L 4X6DE 4HLJA 3Q43A 3MBWA 1F11B 4X9GA 1UWEH 3BN9D 4DIXA 3C5XA 1TZGH 3UJJL 3SDCA 1NH6A 4M3HA 4UILH 2Q3AA 3IBEA 5JIMA 3TH2T 1G7HA 4GAFB 1I9IH 3RUGB 3QFDB 3QA3A 35C8L 3IRPX 1OSPH 2CDFB 4YAQB 3T0AA 3TYFA 4F20A 1ZSDB 4G1EA 5FB8B 3ESMA 5BOZG 1VPOH 3L95B 4X9YA 5D7SL 3K4ZA 3PV7A 4LCUA 3WY3A 5A2AA 2DWDB 3MJWA 2ARWA 5CMAA 3T3PF 4PJCB 3G04A 2WJ5A 3L3JA 2NUPB 1XGQB 3WO4B 1U92B 2W9DH 4X42A 3RWGA 4Y4FB 2SODB