1V27A

Solution structure of the first c2 domain of rim2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
141
structure length
141
Chain Sequence
GSSGSSGGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first C2 domain of RIM2
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords Regulating synaptic membrane exocytosis protein 2
total genus 12
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1v27A00
2WXKA 1E8WA 2ENPA 4LDCA 2WXGA 3F04A 4Y1TA 4QJ5B 4NS0A 2D8KA 4WAFA 3TJPA 2CHXA 3R7QA 4KZ0A 3NZSA 2WXQA 5T8IA 4EZKA 1YRKA 1BYNA 3L9BA 4WWOA 4V11A 4AOFA 4TV3A 3PFQA 3IM1A 4FJYA 3NSJA 3PS6A 3QR0A 4J6IA 1DJWA 3NZUA 2NSQA 2Q0ZX 1DJYA 4QJ3B 3JZYA 2CJTA 1DJXA 2WXIA 3CSTA 3HIZA 3OAWA 2K8MA 3F00A 3P2BA 4ANVA 1DJIA 1E8XA 3PRZA 4FHKA 2KI6A 2K3HA 4TUUA 3HN8A 2WXFA 4A55A 1V27A 4DNLA 3DBSA 4IHBA 4Y1SA 3W56A 2LHAA 4JPSA 4IQHA 1GMIA 2WXNA 1DQVA 3S2AA 2WXRA 4ANWA 3DPDA 1UOVA 1QASA 2N1TE 2EP6A 2CJSA 3QR1A 1E8YA 4F92B 1CJYA 3L17A 4MJJA 1DJHA 5G2NA 2B3RA 3RDJA 4ANXA 3F05A 4F91B 4LT7A 4DK5A 1E7VA 3B7YA 2A5UA 3APFA 2CHDA 4OVUA 4FLHA 2K4AA 3FBKA 3ZVVA 4XZ4A 4NPKA 4L23A 3F01A 4PS3A 5CCGE 4G11A 5CCJA 2DMGA 2JQZA 3MJWA 5H4ZA 3PYCA 4FADA 3APCA 3FDWA 2CHZA 4XX5A 1K5WA 4F1SA 4FHJA 4NPJA 1E90A 4ICWA 3TWYA 2Q3XA 3HHMA 5G55A 3RPBA 4GNKB 1DJZA 3LJ3A 4BFRA 1DSYA 2CM5A 1HE8A 1E8ZA 2ENQA 3L54A 2WXMA 4EZLA 4BGDA 2DMHA 1W16A 3IBEA 1TJMA 1UOWA 3KWTA 4FA6A 2WXPA 2ENJA 2NCEA 4L1BA 4PS8A 4KITB 2YOAA 4HVBA 3ML8A 4NP9A 3TL5A 2CHWA 5CCHE 1TJXA 2NQ3A 2Z0UA 2ISDA 4QAMB 4FJZA 1DJGA 3QJZA 2WXOA 1QATA 4F93B 2X38A 1E7UA 3M7FB 2FK9A 2Y3AA 4TS6A 2CM6A 4ANUA 4ICXA 3CSFA 3L16A 4L1LA 1BDYA 2QZ5A 1BCIA 4PS7A 3ML9A 2K45A 3GPEA 4L2YA 3L08A 3N5AA 3T8MA 4EZJA 3ZIMA 2WXLA 3L13A 1RSYA 4WWNA 4WWPA 1RLWA 5JHBA 2WXJA 5JHAA 1UGKA 4HLEA 2QZQA 3L4CA 4XE0A 3KWUA 3R7RA 4AJWA 3QAQA 4GB9A 3ZW3A 2BWQA 4FULA 5KJ7E 4URKA 2FJUB 5H4YA 2A4ZA 3SD5A 1WFMA 1WFJA 3APDA 2UZPA 1W15A 3QK0A 4LCVA 2ZKMX 3ENEA 3PREA 4WEEA 5EDSA 1RH8A 3W57A 2RD0A 4KZCA 2YRBA 2R83A 4QJ4B 2V4LA 4OVVA 3QARA 3OHMB 1A25A 2WXHA
chains in the Genus database with same CATH superfamily
4LO9A 1ONQB 1KB5B 2WXGA 3ZT6A 1WZMA 3AM8A 4E9QA 3L1OH 4V1DE 3HR5A 4XPAH 5B39B 5CCKL 1WG3A 3GBDA 4HJIA 4G6AC 1HZHH 1L0XA 3QR0A 1QVOA 4ODVH 5IMLB 1UYWL 2XTJD 4YPJA 5J6HB 2D7QA 5C0DB 5GQBA 4XZUA 2VO8A 3ZBMA 3ABMB 4Y19D 1N3NA 1BFTA 1JWMB 3WXWH 2A4CA 4ELKB 4BFKA 4LVNC 4FXKA 3CHXA 2FIRT 2IV8A 2QKSA 1F4YH 1G6VK 4N2GA 4NZRH 3FONA 3O41B 4X6FB 1AXTL 1KTJA 3LHAA 3MZTA 3PUUA 3MRNA 1XGRA 3K7UA 3WO4C 1BX2B 5D1QA 1YNTB 3BGFB 2I9LA 3B7RL 4OH2A 4KFZC 4LKXB 4PN6A 1DVYA 2EEFA 1KYFA 4LT7A 4UOJA 4B3EA 1MCPH 4JE4B 4UU9A 4BUHA 3ARGC 2IOIA 4JFHE 4ZUVA 1HHKA 3NT0A 4GAGL 3D69B 4KVCH 1LNUB 5CEYB 5FGCE 5H37A 3QAZB 4O2EA 2CO7B 1FYTB 5HDBF 3H9SA 4N2HA 3FN0H 4N2NA 2XX0A 5IQ9B 1SLUA 2MTPA 4NKIL 5GRVL 4ZW7A 2HJLA 4HEMA 4JRYE 4HUXA 4L4TB 3K71B 1HINH 3CUPA 1SDYA 1E28A 4FFWC 4QRBA 4MA3B 3KWTA 2HN7A 1P84K 3O45B 2IDUA 9PCYA 3Q2CA 3K8KA 5L2KD 3LEVH 2CRMA 3EGDA 3K72A 4BFBD 2BLFA 3TV8A 4D9RD 3WFHA 3WNPA 5LGHL 3AWGA 3CN3A 4OF3A 3H9HA 4FA7B 2XWBB 2E0PA 3O4OB 4WGWB 1T4KB 1ZE3H 3RWGA 4ANUA 3GMPA 5CLTA 1Y1DA 4QCIA 4KDTA 3WS6C 4Z7WB 2ZP0T 1UA3A 5EIIB 2XTJE 1SLVA 4ACTA 3N5AA 4P4KC 2DLIA 4XNUL 1NMAL 5GGUB 2EDMA 1RZJC 1O0VA 2AFNA 2FD6H 5AWNL 1G7LB 2CGRL 2J56A 5GISL 1MAJA 2DYSB 3AQDA 1E27A 3HOGA 5KYWA 4KVNH 2GBTA 5C7XH 4LASH 3P4OB 4Z8FH 4UQDA 4JN2A 3P73B 43C9A 5C0GB 1J8HB 1ZT1B 3Q0HA 4IKJA 1EEQA 4RX4A 3LH9A 3L48A 4NOFA 4X5WB 3VGBA 1EJOH 4AM0B 3VMNA 2K7QA 2COQA 4HKZB 3TJHD 4YR6B 3NIGF 5EZOH 4YIQA 4JHVA 1BZ7B 1I31A 5E2TH 3CDZA 5IOKA 3KYKH 2D7PA 1IM3B 1AGBA 5CLXA 2DI7A 3ESMA 3HA0A 3IB4A 2CO6A 4BK8A 3GLEA 1YDPB 1I7UB 2LLGA 1E3FA 4G83A 1N4XH 2F54A 2QFRA 4Y5YB 4RMRA 2QQLH 5EOCJ 5CEXB 5I1KL 3F00A 3GK8H 3EYFA 3HE6C 5A2KH 3ATBA 5JA8B 3JTSB 4XWGH 3U2SA 3FCGA 4WI0B 4YFLF 1LP9A 2WJ5A 4LGPB 4YLQT 4I0PA 2JCWA 1KENL 2BY3A 3EDJA 1H6UA 1XCTA 3VE0A 1HQ4B 4OSUH 2FAUA 5M94B 3N44F 2FO4A 5B39G 1OV8A 3F2LA 3MDJA 2O5XL 1FVDB 2AV7B 3NSYA 5JW5B 1LK2A 3VXPB 3ZE0E 4OU3A 5L2KB 4M9PA 2A73B 5FCSH 2AV1A 4WO4D 1UENA 4EJ1C 1TETL 1MCQA 3EH4B 4X6FA 2EUVA 2K9FB 4QRRB 4NPJA 3ARSA 1QFPA 4XP6L 4EN2A 1OPGH 2EECA 3NFNA 4HCFA 2IFFH 4WNJA 4XZUB 3VXRE 4RX4D 1EUTA 2MKLC 5DJ0B 1ZHKA 2V7NB 1D7BA 2Y25A 3S48A 1DQJA 4LVOC 2ZWNA 5JOPD 4U1IB 2VZTA 1NC4D 3MODL 1IC0A 3IU4L 1UGNA 3G6JF 3SE4A 1MHEA 1QFWI 3V4VA 3HR5B 2XG4B 1SF3A 2KZWA 1YPZF 5AW6B 1KB5A 5B4MD 4UMGA 5T5NF 5TE4H 5EU7C 5D6DA 4A7GF 2XYBA 5C0EB 3T9WA 3HJ0A 2V2TB 2WK2A 1KLGB 2ZAIA 2CJUH 4NCC2 2BHFA 1KXTA 2CUAA 1OHQA 3RLSA 5J9PA 2XPZA 1IEAA 3MKGA 1ZAGA 3SKOB 3QC5X 2A4ZA 1FL6B 1CFSA 2PTTB 4WK0B 2Q8AL 1FFQA 2EABA 4TSCH 6FABL 3I6GA 4W70A 1GOGA 4ONGH 4ZAKB 3I50H 4YSDA 5J89A 2B9BA 1U8CA 3O3BA 5INCA 3OKOA 3SKNA 5DEFB 1PJWA 3BP7B 1D6VL 1DBAH 1HAWA 5HVHB 1GIGH 4WAFA 1SYSA 4M5ZL 5IHUH 2H1XA 3DX6A 3ULSB 3U0TB 4MMZA 2R7EB 1OLZA 2Z8WC 3W81A 1BFSA 3I50L 3SKNB 5IMKA 4TSCL 1OAXH 1K8DA 4M3HA 4KXBA 5TQ0L 1YY8A 1KJ2H 2X4NB 3GGWA 3GXMA 4MD5B 5D1ZI 3CSPA 1R3LA 1JGUH 3AJ7A 5D7KD 3I75A 5DLML 4AE0A 1NFDF 2NNCA 3KL5A 3TCLA 1XIWD 4L5FL 1DBJH 5LAXA 5DQJB 5EF0A 4PR5A 5FV1L 3TGXA 1JSYA 2HSIA 3DGCR 3CFIC 1CDIA 1VLXA 2QHRL 4MD0A 3JWOH 2GBUA 5IB1B 3MJ9H 1N10A 4RISL 3FSWA 1X5LA 3B7SA 1S7WA 4XCNB 5JDSA 5L8LB 2K6ZA 4GAYB 4HLZH 4ZO9A 4JKWA 4WHDA 3W5NA 1M6UA 3K46A 4KU1A 5EMYA 1RZGA 5CMAB 2N56A 2BIOA 4G11A 1BG1A 1QSEE 1A1OA 2A9DA 4M56A 2X2UA 1DQJB 4JZNB 4MAYD 2BSBA 2DYPA 4PCTA 3ESOA 5E2WH 1EEUA 2TRYA 1LD9B 1U30A 2VITA 5LBGA 2GEQA 3KLSA 4KVPA 3KBHE 3L54A 4CMMB 1BEYH 4GG6A 2VLRA 4XP5H 3S37X 1PDKB 4FL4B 1TJXA 4NQDB 4ODSH 3SDAA 1CR9L 2DQTL 1YUHA 4TM9A 2JKRM 3U46B 2QKIB 2AQ1A 2IPTL 2JSFA 3CU7A 2R39A 3VXTA 3I6LE 1AG6A 4LSUH 4MS6A 4PRPB 5DQ9A 1HEZB 5BO1L 2DQIH 4PQXA 1XF4A 2E7DA 2R23A 4G7RB 4LMQE 5SWSB 4IIQB 3CVHH 3FS9A 1P9MC 1KJ3L 4B9PA 1JV5B 1K4DA 3K6NA 2CUIA 3U9PH 2BWIA 3FC8A 5KN5A 5MEOA 2X4TB 5J3HC 1VACA 2UWEF 4ZW5A 1CFNA 3IMVA 1NBZB 1CUOA 3II3A 1LDPH 4KJQC 2GY5A 2FT8A 3TZVA 2W07B 2F1EA 1KTRL 4ZSOB 5LXGH 1F6FB 3VQMA 1U93B 2P8MB 2LV4A 1V7NL 3FTYA 3W9DA 1BWWA 3FULA 1SMAA 1UG9A 4L5FE 4JLRA 4GJTB 4F15C 4WJG3 4ZMAT 4NNXA 1ZA6A 3ISRA 5HHPB 4FKKA 1KDIA 4E0RB 3KJ6L 1II4E 1EJOL 1EHAA 4DPAX 1CICB 1EVTC 4AM0A 2APSA 4M8QA 2PO6B 1BVNT 1VACB 4QF1A 3DI3B 4LASL 3CZSA 3MV9D 4HWUA 5I18H 2A6JB 3OSKA 1JD9A 2G0LA 4FF9A 3V0EA 1YEFH 4FS0A 3UH8A 3QO1B 4RSYA 3PRZA 4MNQB 5E9AA 4N2KA 5I5JA 3GJFH 1GVIA 4OB5L 1AOZA 2YC1A 4NIYE 1ECZA 1HEZA 4XNUH 2JI3A 3KW7A 3U7WL 2IANB 1KCBA 2QADB 3ULVF 4QLWA 5D7JC 5JZ7D 2K6WA 3B1UA 1ZWIA 4JK0D 2ITDA 3L7EB 4LMQI 1B9KA 5DK3A 1D6EB 4JFDD 1UACH 2VW7A 2WWMC 4OLXH 4X7FC 3MROB 5KOVC 2OSYA 2OYPA 4F92B 3SO3B 4I48B 5LGHH 4MD4A 1T1WA 4GYBA 4ONOA 5CWSA 1GL4B 5CNHA 3ATAA 1F4WL 3D0LB 4NPKA 2Y1VA 1WGVA 1RZKC 3EGDB 4KK9C 5I1DB 3E6FB 4FYTA 5JMOC 2D9CA 1PBYA 3NIDB 1DVSA 3MA9L 3CX2A 3QW9A 2C9PA 3ZK0A 4G6FB 4HGWB 5JHDA 2BINA 1HOEA 1FIGH 3D8MA 3K71A 4L4VB 5FX3A 3HB3D 1U58B 4WUUE 2NZ9C 4YXHH 1I8MB 3BPLB 1OAQL 3S96B 4MRBA 3SDDD 2KPWA 5CCKH 3PJLA 4B27A 2JJTA 3OKKA 3STLA 1J87A 4AT6A 1XD0A 1VGKB 3A67H 3W11C 5HVHC 1AJ7H 1HHKB 2ZWYA 4IKLA 4MD0B 5I5MA 5IUSA 1ZA3B 1EMTH 4Z7OB 3E9UA 1HI6B 3ABZA 3SSGA 3MOBH 2YO3A 1JPSL 3QUMH 5F96L 3QPQC 1Q1PA 5HJDA 2I9LB 3T3PB 1EXGA 4XNZB 1J10A 1AXTH 1JTTA 3MBWA 3ARDC 4JM0A 1F4YL 1AR2A 3NJLA 1CTNA 1C7SA 3DXAE 3PHSA 4QRSA 2WQVA 4MMXB 4Y2DC 3R7RA 2XRAL 2DBJA 2X4NA 1JWMA 2AGJL 3MXVH 3GLAA 3PWUB 1JZ2A 3Q8FA 4GUQA 5H4YA 4M3JA 1MFCL 1UXMA 5CGYD 1TTUA 3FRUB 5IHWA 4HX1B 4FABL 1IKOP 5L7XL 4JFDE 3E1ZA 3QFJA 1SYSB 1BVKA 2AEOA 4OGYH 1T04A 2A77L 1L7TH 2PP8A 3MRBB 4MNQD 3T65A 3VDCA 4K3EL 4Y19B 1U8MB 5I5RA 4ESKA 1N6QL 4F9LA 1KPUB 2W5PA 3EJQA 3LN9A 4MDJA 5T8IA 3RVUC 4XHJD 1TVHB 2JB6B 2Q87A 5IB2A 5GS2H 1HL8A 2ARWA 3VI3F 5L9DH 3WIIL 3WIHL 1P7QD 4I3RH 1QPKA 4AC2A 2XTJC 3UZEC 3NA9H 1YEDA 3G04A 3F7VA 5I8EB 4MZ2A 3PUCA 1KSRA 5T3ZE 3SE6A 4JO5A 1CBJA 3FCSB 1G94A 5JNYA 5C0RH 3U1SL 4AK1A 3IU3A 4YNYA 2AJXH 2Q9OA 1JDAA 4KXDA 3AROA 1CGXA 2GC7C 2XZAL 1OCZB 3S3PA 3SIKA 3V4VB 4DH2A 4WW2F 1CGVA 5D5ME 3AABA 3N9GH 3PV6A 4OR1A 5FEBA 5CD3B 3PG2A 3QT2A 3RDJA 2ZCZA 2DAVA 4JFOB 1S5HB 3QHTC 4F80A 1AACA 2AJXL 4JFPB 2IPKB 2WGNB 4JCLA 4H8WH 5C0IB 3GMMA 3TIEB 3VD7A 1E42A 4AGPA 1I8IA 2CPUA 4K0OA 4K23H 1FA4A 3L3JB 3QCTH 4NT6A 3ROOB 2AI0H 2XN0A 4NSKA 4XBGB 4KV5E 3AVEA 4FQXB 1AO7A 1KY7A 5CZVL 1FBIH 2K6YA 4B7LA 3M8OL 4NHUA 5DRNA 2X40A 2K8QA 3GI9H 5JW5A 1J8RA 3H7BB 2X1QA 1MH5A 4JPKL 4MNQE 2WTOA 4J3TA 2QDVA 2FIKB 2Y4SA 3K0WA 4AGMA 2AVFA 2WQUA 5DRZB 3C87A 1R3HA 2V7HA 5F9OL 4K3EH 3N42B 1O7DE 1R5VB 2X70B 3U83A 1IGCL 3EBHA 1UXLA 1ZT7B 1ZHNA 4BQBA 1JCVA 2X89D 2DI8A 2WWNA 1BOGA 4BJLA 1ZGLA 1I3RB 3CMOH 4XBEL 1RURH 2UWEB 4ONFH 4P99A 4LZKA 4R2GB 5CBAB 1GGUA 2B39A 1UWXH 3X11A 3NEXA 3QORC 1CXIA 2NNAB 2NTSP 1J1PL 3EYVA 2EXYD 4LIQE 4ACPA 3TWCL 4GT0A 2EIMB 2ZUVA 5KZCD 3BQVA 4TRPH 4OFDA 1QBAA 3BVUA 4JL1A 3MACH 3UBXB 3EO0A 1F1GA 4HKZA 4LCCA 1ZK5A 4NI6A 2WVVB 4WVRA 1CGWA 4AQAB 1PW3A 4P3DA 5C6PB 3LKPB 2UZYA 3A67L 1ZT1A 3GI9L 3MNZA 5BVJB 2X9ZA 3CC1A 4NUPA 3P73A 3VJ6A 4W9CC 2FATH 4N0YH 2VISB 1MCWM 2WO4A 4LCUA 3KCPA 4NBZB 4AOFA 3F62A 1MOEA 2BO0A 3O8XD 2FUQA 4HXAH 1E27B 4QTHB 2YUWA 1B2WL 1L0PA 3F65A 5FUCC 5C07A 4X9HA 2FWLB 1Y18B 4KY1H 3U0WL 1U3HA 4Z3HA 3GINA 3S9DB 2WQXA 2XXMB 4X50A 5HTSA 1GZPA 3PCYA 4AV5A 5I30L 3A4FA 4B7IA 2C3XA 3QXAA 4PJXE 2NW2B 1W0VA 2OXHB 2Y69B 3HC4L 3LN5A 1P4UA 5I1IL 4CW1B 1BBDL 1Z9MA 2NUPA 5JPMA 4JREC 2C7UA 1NCGA 2F18A 5IJDC 1TJIL 4QXTB 1FH5L 3SKJH 2OJEB 3KGUA 3VFPA 3EBAA 4PG9A 3RU8H 1P5UC 2AJUH 4L1SA 2ZUTA 3BKYH 3FOLA 4OQTL 4LSTL 2VC2L 4R4FL 5MI0B 5DSCA 2ZOWA 3CSBA 6TAAA 5CEZH 4LLWA 1QSFD 4UAHA 2NMSA 3EFFA 2C3HA 3GSVB 2BY1A 1DQDH 4IM8A 4LAQH 5CZXC 2SEBA 1GKEA 3RWJA 3VFVA 3K6IA 2J1XA 3SPJA 1XWVA 1NUDA 2YWZA 3VXOA 1ZDQA 2XXFA 4I3GA 4UU9B 4WRLA 3VG0L 5L2JB 3L8QA 3AAZB 3BUYB 3ML8A 2L8AA 4OGYL 2NQ3A 2GK0A 2FNWA 2HCZX 5CJOL 5KBMA 5IF0A 4R2GC 1WS7A 3C75A 1JK8A 1SOXA 3QJFB 1IV8A 7FABL 1BX2A 1UT2A 2X3CA 5D1QB 4FABH 3TO4B 1FPTH 3PP4H 2IQAB 1NCHA 4ELKA 4PJ6A 5BZXA 1UXWB 3ARBB 4JQIH 2WXJA 4N3UA 3G5WA 4APQA 4Q52A 4NNYB 3U9PL 3QUML 5FYJL 2WLLB 1KDJA 3IKCB 1IGYA 1E4WH 3T4AC 5JIQA 2Z3FA 1LMIA 2DL9A 4DSYA 1SJVA 1QO3B 4KI1A 3DO3A 3NPSB 2F08A 4XOEA 1ADWA 4KGJA 3PP3H 4EQ3A 4A2MA 5DMGD 1E50A 2EDKA 1AHMA 1Y07A 2DQTH 3Q6GL 4RRPG 2A2QT 1UD5A 4NBXB 3UADA 1DBML 4GI9A 2EDDA 2VTFA 5HGBA 4POYA 2FECL 2HAZA 2ZF9A 3BIKB 4XXWA 5DI8A 3FB8B 4YHPB 4R7NB 3K80A 1I9IL 3VGHA 3HCVA 1AI1L 4KX9A 2FX8L 3OMIB 2DRUA 2HTKC 4LU5L 4FLSA 3BIKA 5DI8B 2WANA 4L0YA 1JWUA 4PSPA 2WXFA 1QEWB 2FBOJ 2OMNA 4HJ0C 2J5LB 4Y1SA 4OLXL 5JR1L 1J48A 3CCHB 3LN4A 2ED9A 4OZFA 3PDDA 5GZNC 4ETYA 4PRHE 2YFNA 1OD7A 2GBVA 3QJSB 4M6ML 3E3QE 3MRCB 2TSBA 4JG9A 3NYKA 2UX7A 1MEXH 2CDEA 5HYIA 2QHRH 1S9WA 4YL9A 4Q0XH 2GCYB 2JKTM 1E4HA 4L29B 5DEJA 5AB0A 3BQUB 5IVNA 3DX4A 5EU4B 5HGHB 1DBJL 3AXLA 5D93B 1RULL 2HVKA 1QSFA 1YEIL 2EE3A 3E8UH 4FQPA 1A6UH 3SJVD 4E9VA 2ED8A 1N8ZA 3ARBA 3TA3C 5C09A 5CN1A 3ZO9A 4MZIA 1JGEA 2IQAA 3U82B 5EB9A 1W0YT 5ESVB 2Q76B 1NIDA 3KG5A 3BLKA 2HJFA 5B21A 3OKDB 1FNSH 2BP8B 4GKOA 2XN9E 3TONA 1G7PB 2ENJA 3GF8A 4LVOB 4IBWA 5E6IB 3OV6A 5KSAB 2MH4A 5LXGL 1G9ML 3CC5B 2VGLM 4PCSA 1WT5A 1U41A 1G7IA 1S9YB 2DLGA 3OG6B 2NY4B 4KMQA 5BQ7A 4A66A 2EDNA 4P2QE 3QQNA 3CV5A 4HIJB 2NDFA 3GPEA 1KEML 1CDJA 3QIUB 4PRID 1WD9A 2PWDA 4JFEB 1NICA 1OVZA 4IDLA 2OMXA 4N2DA 3BSZL 2JB5H 1F97A 1HEHC 4PRNA 3I3DA 3GZPA 2R2HA 1QLEL 1YECH 2DQIL 4Y4KB 1MCFA 5I74C 3IMRA 4CC4A 1RAMA 1R1CA 2GEEA 1LWJA 3GBML 4HEPG 2ZQKA 4UDTA 1GS7A 5TE4L 5EDSA 2C7UB 2J8OA 3QUXB 1BEXA 4PYHA 3P0YL 4RETB 5GS0L 2ETWA 1SBBA 1KZYA 2AZAA 2WTRB 4J2QA 3E3QC 1O6TA 2CIIA 5B22A 4IJ3B 5KBDA 3H7LA 3QXAB 3RFZC 5EC2A 4KHTH 3ARED 3L4VA 4H1LB 1FGNL 2XTJB 2HLAA 3MLUH 1EBPA 5KUKA 2AK1H 1XF2B 2NY4C 1J9CT 4BH7B 1MZZA 4E5XB 5IB4B 1KBVA 5E2WL 2EH7H 2WBJD 3F7YA 4FC3E 1Y18A 4N0UB 2PYEE 3NCJL 2E7CA 5FYLH 2VXUH 2ZUUA 5CSZB 3M45A 4PLKC 2MPVA 3CN1A 5HHOE 1I7ZB 1E43A 1FGNH 3OKYA 4QJ3B 2XQYA 1XSOA 5J57B 3JWNG 1YEJH 4U1SA 3OG4B 3FU9A 4G3YH 3T1FA 3T0EA 4HAKA 1JZ6A 3QYMA 2IEPA 5H8DA 3LSOB 5FWRA 4M7ZB 3KPRE 4KBPA 4MWFA 2UZYB 2BW4A 3QWRD 3I9AA 4FCAA 3WU1A 1NUFA 4WZ9A 5SV4A 5KVEE 3BH4A 4JO4H 1PAZA 3GMOB 4KK8D 1LO3L 1HHIA 1YYLH 2MNUA 4XC3H 3T4YA 3U4BH 3FTXA 1MPAL 3P2DA 2BM3A 3R1GH 5FS5A 3MX0B 4OUUA 3FDWA 3QPXH 4AVIA 2V3EA 4KHXL 1JUFA 5B1JA 1XMWA 4OZGB 2MKWA 2VJ8A 2XPGB 3PY9A 3TBTB 5E1GA 2IO5A 1GGBL 3TJHC 2J1YA 1AGEB 3WNIA 4U4BA 3KYKL 2CXGA 1QR1A 3OHXA 2AC0A 2KLTA 2QGDA 1BFOA 1WBXB 4M48H 5AZ2H 3IWVA 4D8PB 5CF3A 1SBSH 1ZHBB 3IS0X 1DLFL 4ZX4A 3IDGA 4KPHL 1OK8A 4F8OA 1F18A 1J0JA 3RHWF 5IHBA 4QHUA 1M57B 2R69L 1MF2H 4KNTA 4NWTH 2VDPL 4HUVB 3HE7B 3PNWA 3NGBB 4AIZB 3IDIB 1AO7B 2K45A 4YZFE 4ZXBA 1BJ1H 3T2NH 2BNQE 5DWPA 4XBGA 4KJWD 1IJNA 4GG8B 1J0YA 4N8VG 3WS3A 1G4RA 2VMFA 4FDWA 2IAMD 4QTIH 5GISH 3KVDD 4L3CA 4RAVB 1QPPA 3LZFL 1XT5A 2FD6L 3ARDD 4JANA 5AW0B 4MSWA 3N50A 5C3LD 1D5MA 3LV3B 2DWEB 5GRUL 3ENEA 4JRYD 2MMXA 4OLVH 3OXRA 1OOWA 1WSST 4DEPB 5CD3A 1JHLL 3IGUA 1ZDSA 4WWKB 3PL6B 1TCMA 1RLBA 2PCFA 3SGKA 2F5AH 4GW1B 3R4DA 2IGFL 1XR9A 5ISZB 1I3UA 4UINH 1QABA 3GMNB 4XP9L 5ICZA 1A7NL 2HT3D 3TO4C 3QQXA 3MA7A 5DR5H 4MJID 3NQKA 1B4TA 1YPZE 3VXMD 3Q43A 4P3CH 2YGQA 5CJQL 5T5FL 4R0LA 5IB2B 1XVSA 1YNKL 3IPFA 4PJ8D 3I9PA 5F7NC 5H2BA 3B2UC 3FFOA 4ES9A 2FYYB 3MXWH 4NUGH 4WI8A 4ODWA 1UXSA 3GHEH 4TNFA 2LOEA 4OFKA 4H0IA 4GAGH 1U8MA 1FJ1A 1WDAA 1GAFH 2PETA 4OIBA 1NAMB 5TJWK 2WXNA 4J1UA 5T3ZL 2X41A 1EEYA 4ENZA 5AYQA 4HHWA 1VADB 1PD0A 1EQWA 2DJUA 4OW6A 5ABZA 3K6OA 5DJ8B 3DHUA 1Z5LB 3B7YA 4JDVB 4NOBA 3GK8L 1ASOA 2WN2A 3BHBA 3MFGB 5AVVB 2IF7A 1FG9C 4KC3B 2WWKO 1PAMA 4NQEB 1QTYT 3HBPA 3UTTE 3U0PB 3QUKA 3C08H 4MA8L 1KJVA 2YEVB 5LHDA 4TVUA 1UB5A 3PIQA 4PV9B 1N5AB 3RNKB 5I1GH 1H5BA 2CDGA 4NQVB 2D3LA 3WJLC 4DP6X 3WKPA 2X4UB 4L8SC 1SM3L 4A39A 1AHKA 5B1KA 3ZMEA 3FF8A 5EZOL 3ZL2A 3CVDA 5E9DB 5F70A 5IFHL 4HZLA 1RJYB 3GJFA 2JQAA 3QUXC 4ZMTA 3ARFD 3SGJA 2VM4A 2NXYD 4GRLD 1DQLL 1CYWA 1E5BA 1CD1A 5D9SA 3ZRFC 1ROCA 4YL4A 4UM8B 1AYRA 5K9OA 3QRFM 3U6RA 1T89C 4NQEE 1D5IH 2QLVB 1Q72L 4WUKL 2BS71 5C08E 2VC2H 4R4FH 2VMDA 5AWNH 4GKNB 5AYTA 5K39A 3BKYL 2NY3B 1B6DA 2R4SL 1Z66A 4PJBE 1ML0A 3FB7B 2YKLH 1QMUA 3NESA 3DMMC 3B56A 3WFEL 4QNPE 4M61B 4JPVH 3CTTA 4AMWA 2WP3O 2FB4L 1SOQA 3L45A 4NCC1 4XMUA 5MP6H 2AW2A 3MRFB 4I48A 3B9KA 4MJIB 4IEFA 4I88A 2R9HC 3LKRB 3GUFA 3HS0B 5I30H 2DQFB 2WXHA 3JVFC 4RIRA 4OCWL 3A6CL 1MRFH 2JVUA 5ITFB 2ZX8A 1CQYA 1R3JA 4BFFA 3O6KH 4E36A 4YHYB 2GAZA 4PJ5A 1KB9J 4RFNB 2PR9A 4QHMB 1GGTA 3C8KA 5D2NB 5AW5B 3O2DA 4LP5A 1A7OL 3D08A 3KXFA 4U6XA 5AVSB 4X5XB 3TF7C 3GS7A 4FJYA 2AJSH 1PEWA 3QPKA 4BHUI 3RDTA 1M53A 4LL1A 4M8QB 3RY6C 5ADPH 4AQEB 4H1LH 4YSTA 3UZQA 3MRIA 1I1FB 3HR6A 3MV7B 4MNHA 1JNLH 1A8ZA 3RJDA 5AB2A 4LRIC 2DQUL 3FUEA 4MQSB 1P2CB 1KV7A 3TIDB 1OT2A 3IFLL 3K1DA 4K8RC 4PD4K 2OLDA 5EDXA 4HKBB 5ABAA 5GGVL 4PRBB 2AXFB 2EE2A 4GUCA 3UIYA 4MQ7B 4P49A 3L1FA 1S6NA 3L4UA 1IGJA 3OMNB 2WO3B 5HHMD 4ONFL 4OVUA 1CFNB 4DEWA 4AL8L 1CO1A 1G7MB 1RURL 1MFAH 2HKFH 1WAAF 3K74B 3AU0A 3TVMA 5KN5B 4YHNA 5E94B 1L9MA 3DGGA 2Y5EA 4ODVL 3V0VB 3RJQB 5JQ6L 4N9GB 2ICEA 3OKEB 4HS3B 1ZSDB 2XU9A 3GJFK 3FYIB 2WKLA 4PVNA 4HEPA 2C3VA 4XPAL 3DK2A 1A2YB 4JX0A 4PRPA 3BDXA 3L4XA 1P1ZB 2EDBA 3KNBB 4LSRL 1E4XL 3O81A 4HPOH 2AMGA 3N0PB 4LRNH 3QEHA 1SQ2N 4EVNA 1EAQA 2ZCKL 3HTLX 1KYAA 1KCKA 1P4BL 5LGJB 5HYEA 3ARFA 4YXKH 3KYNB 3HC3H 4FFZH 3BN3B 5IVXA 3ARZA 1E7UA 3O6FC 4G1MB 4DUVA 1TENA 5E1QA 1ZJAA 4R4BB 3ZQ9A 1NGPH 4U3XA 1BIIB 4NNPL 2BVTA 1O6VA 1TIUA 1RZFL 3DRQB 5AKVA 2WSPA 4JG5A 1TZHA 2RAMA 4HCGA 1CL7L 3OPUA 2QVMA 4DP9X 4G6KH 4K94L 5DJ2B 3QEQB 4PWKA 4OGXL 1XFPA 4MZ3A 1SOSA 2EADA 1WLHA 1C5CL 1BF2A 1R3KA 2PR4L 7PAZA 3T71A 3LXCA 3ZKQD 3U1SH 3MJGX 4BQ8A 4TUOA 4RESB 5F8QC 2DBLH 2DJSA 3BD3A 4N8UA 4XNZC 2BXYA 3ZT5A 2OPCA 4GSUA 3WIFB 5LAXB 5I76B 4UQ3A 2EVFA 4XNMA 3EJCA 3CVIH 4P46C 3Q2VA 3A47A 1SXSA 2ZNWA 2CKBH 3I75B 2WVTA 2LU4A 1JPEA 3DA0A 4OZHF 3KEHA 1H3WM 2FJHB 4GBXA 4O58L 5I1CH 2RFXB 3U1PA 4RMBA 1HXMA 2VXQH 2ZSWA 1JK9B 5IBLD 4WTWA 4XPBH 1DVFA 4F2EA 1ZOXA 4PJFA 5IMKB 4X6CE 2ZNXA 1E8XA 1UZ8B 2MPAL 2NLJA 3KYAA 2R7EA 3SCMB 1JDCA 4YSPA 3MYZA 5K9QG 2B4CH 1XSJA 3WY3A 4DVBB 4PGBA 1JZJA 4XN2A 3KPNB 4OIIL 4UT9H 4G7QB 4H26B 4BZ2L 3K2MC 1UH4A 1MFCH 3SO5A 2C8NA 3MXVL 3V95A 4NUQA 1NA8A 4UQBA 2PTTA 4G43B 3EFDL 3FO0L 3L1EA 1I1YA 3BWSA 4B9JA 2VZSA 4MJ6B 1U3HC 2LT9A 3ARBD 4XO9A 4PJIF 2ARJB 2VXQL 3D6GA 3GKWH 3MUHL 3TT3H 4X8JB 2BRQA 5F88B 2ZXDA 1X5JA 3U4EB 3ARFB 5GSRA 3FFDB 4EO5A 5TQ2H 5IMOB 3N6YA 4PYGA 3TA3A 1ZT4B 5DURD 3CU1A 1PZSA 4YE0A 4KXAA 1OSPL 1TTBA 2DBLL 2X1XR 4NP4L 1H9DA 4F7EA 3CVHA 4HFUH 3K0YA 5HHNA 4H20L 3U9UA 3WDHA 4DOHE 3FO1B 2AK4A 5GJTL 3AXIA 1AVAA 5EZJB 5A1AA 2B9AA 2BIIA 3LKQA 1NC4A 3CPLB 3HAEA 2JELH 4NIKB 1A4AA 4G8AC 3ZTJG 1N19A 3VH8A 4K9EH 3MV11 3HG1B 4X4KA 1A3LH 4U3SA 3CFJB 3NFNB 4YSAA 5I2IA 3HZYB 3SY0B 1F4WH 1RUPH 4TTDD 3V4PA 4ZMPA 5KSBE 4DN4L 2IFGA 3KGTA 5ID1A 4C56B 3DECA 4GRLB 3VXQA 1MCEA 4A63A 1MRCH 2ALWA 2JKWA 4XMTA 4KV5F 4YDIL 3ZHNA 1UM5L 35C8H 2C9SA 4HSQA 5IROC 5EA0H 1A1NA 5AL0A 5AKSA 1QFUH 3SPIA 2X6CA 5BXFB 3T3ME 4OB5H 3B5HA 1NWOA 4X6DE 1Z3GH 2N0MA 4FNSA 1O9WA 2KDYA 2CA3A 4MRCA 4UM9B 2HXAA 3EYFB 2VQ4A 2WV3A 4NKDB 4NWUH 5CN3A 1A6ZA 2ADJA 1IX2A 3BH9B 4X80L 3C8KB 2B8OT 1PYWB 3UX9B 3AW5A 3VTTA 4PJAE 1ZVSA 2R2EA 5IHHA 1NMCB 2IOOA 2VR3A 2YFOA 3BDYH 1ADQA 2HKFL 3HVDA 1AGBB 4UUJB 5DEGB 3P77B 3R0NA 5HPMB 4Q9RL 1O5DT 1HCZA 3MJ7B 4QRUA 2DMCA 5I1LB 2FZ3A 4KROC 5G5DB 4CADA 1J9TA 1JTOA 1FLRH 1GXEA 3MLSL 4G9FB 4PGZA 1E9PA 4YDJB 1Z0MA 3TLRA 5I1LA 4X6DB 3MJ7A 4Z18A 3QA3B 3UIZA 1RZPA 2ZE0A 4LPXA 3G5VA 1MWOA 1RUAL 2DQUH 1W72A 2VRQA 4DCQB 1FZJA 1J88A 3EO1A 4PGDB 4XN5A 4A7VA 4F3FB 2JWYA 2A74A 4WHTA 1QR4A 1J1OL 2Y36L 4JDEA 2H9GB 4Y9CA 3V55A 2GQHA 4B9FA 1NDMB 2EKJA 1KJ3H 4BKTC 4PY8J 2ZT9C 1IE4A 2FECI 3P0GB 4LE8A 1IT9H 5IUCA 2EYRB 4XPHL 2EC9T 3CLEH 2FT6A 1DVUA 4UM9A 4PV8B 2WZ0A 4TSAL 3S36L 4OCXH 3VWJC 1HHJA 3V52L 2H1PL 3TPKA 2PCYA 4RAUA 3IGFA 1LEIA 1VFAA 2CUHA 4MNGB 2CGYA 2OV0A 4Q14A 5HDOA 1HXKA 2I69A 2YD1A 5AW4B 4OF5A 3UAEA 2GYSA 3IBEA 3F58H 3WHXA 4ADGA 2EUWA 1EDYA 1D5XB 4A67A 1FN4B 2YPKA 3GMLB 1JNHA 4QAMB 5FGCB 4RDQF 4GRLA 3QWQB 4P04A 1M7IB 4NJAH 3S8WA 4F93B 4QWWD 3QI9B 3ETTA 4XNQB 1V5JA 1CE6A 1OAYL 2CRIA 2ZTBA 3CUPB 4S1DC 5SX5H 1PS3A 2FEDC 3NDYE 4FHBD 3GXNA 1IGTA 3WTXA 1TKWA 5E2JA 1TT6A 1FNGA 3WHE0 4QHKJ 5A6IA 2ZZUT 3D39A 4HKJA 5EWIL 5FYKL 3VGFA 2X44D 2E27H 5I1HH 5DJYB 2EXTA 3H9SD 4HUWB 4AGQA 2M8XA 1X6NA 1NKRA 3NZHL 4KUCD 3ZJAA 1UT9A 3MBXH 4Y5YC 4GPVA 4RISH 3O9WA 3OQRA 2HRGA 2E74C 4LCVA 1GGIH 5HHNB 4G5ZH 4ZS6C 1NMBL 4GKSB 2NXZD 2HFEB 2ZAGA 4WU5B 4HH9A 1COBA 1F3DJ 3X1GA 4HV8B 2OXGB 4OLUL 1VFOA 2FYYA 3SGEH 3QSKB 4ANKA 1S7SA 3ECBB 3GI8L 1EO8L 1BQ5A 4I4WA 4PH8A 1IQWH 1G1OA 3PWPD 2FT7A 2AVGA 2Y7OA 4M03A 4EZKA 2YD6A 4MB5A 5LGKA 3BESR 5DHDA 1EZUA 1R3IH 4IGBB 5IHLB 1HKFA 3GZQA 1SLXA 3NGBC 5ACMA 2C4XA 5IJCC 2QSCH 5ICZB 4MJ6A 5KSUB 1K8IA 1XR9B 3S97C 5CIPH 4NQCB 3JV6A 4M5ZH 2DMKA 2IBZX 1HX0A 2G9HA 5DD1H 1OAUL 5ICXA 5B39A 3PL6A 1Q9OB 3P1VA 4LIQH 1HJBC 2G9HB 4I1RA 6FABH 4WV1A 4RVBA 4NQCA 2Q8BH 1OTTC 2NW3B 4N2FA 4F1ZA 2HRPL 4ERSL 4WKXA 3UCRA 2PYFB 1N64H 2XWDA 1UZ8A 4M7KH 1G9HA 4X6CA 2YLKA 3FPXA 1CF8L 4O4YH 4QY8B 1DVFB 2O6PA 4MJJA 4MXWL 2AJ3A 3GHEL 4L3CB 1ZIBA 5HHOA 2I9TB 1S7RA 3EGXA 4GG8A 3WS3B 5GZOD 1XR8B 5DZJA 3TZVC 5EBWB 2P8LA 3OX8B 1S7SB 2GJRA 3ECBA 1RZKL 2DMGA 2ZX9A 1EAPB 1MFBL 2NPLX 4WDIA 5AW8B 1RJCA 5AZUA 3FUDA 3WIFA 3TJEL 3P9WB 4ZFGL 1T5KA 3QJTB 4QXGL 4HUCA 1T21B 4FXGA 4U1GC 3ZKXB 1NAMH 4D8PA 4O02H 4ODXA 4P8QA 1SN0A 5CINL 4EAEA 2ESVE 2F5AL 3ZN6A 4U31A 4EXPX 3PWVB 4ZOBA 1M7UA 1Z32X 1Q1JL 2VO5A 2XWEA 4WW1B 1I8UA 2LAGB 2A9CA 2YGOA 2C5DC 3V0JA 4ETQB 3MJ8A 2NXYC 4FZEH 4PLOB 4XNQA 5F9JA 3UPRA 3FXIC 2IALB 3ULUL 2NY5H 5MEPB 3T3MF 4R7DB 3AG1B 2Z4QA 5C70A 4F57H 1IAKA 5CEZE 1X44A 4LPCA 1MLBB 4IIQC 2BMKB 2D3NA 5IVXB 5IVXE 3D25B 3P30L 1XGYH 4P9MH 5E56A 3CFTA 1HYRC 1KCSH 4C8XA 2ATKA 1B4JL 5BJTB 2CK2A 2ZD0A 4UNTA 2ZG3A 5BZDB 2R69H 4EVNB 2XN9A 4RWHA 1CI5A 1P1ZA 3KNBA 3QUYC 5E03A 1MCIA 3BZDA 5EIVA 1HH6A 1WPCA 2R9HD 3OAUH 2OSLB 1E8WA 4M48L 4YHKL 1EJFA 4Q4IA 4MMYA 3Q01A 1X5XA 4UZUA 2ZKHL 1L9PA 1WWAX 3TPUA 1KBGL 4GIAA 3O4LB 4PJ9B 5AYUH 4PGDA 1WV7T 4TV3A 4OCYH 1W72B 1UUSA 1P7KB 3MRJA 1G1KA 2H32A 2PWFA 3U2JA 3H3KA 2HPTA 1IGJB 1LO2H 1DN0A 1OGSA 1CLYH 3UXFA 5HYSB 3WJMB 5AB1A 4FLRA 1YYLL 5C0BA 4HKBA 3P54A 1LO3H 5F21B 3P77A 3KW8A 4JO4L 4KTYA 2NR6D 5DZ9A 3I84A 4NZDA 5CIPB 3MV7A 1NMBH 4MNHB 1G1YA 3DHPA 3KAAA 1GGIL 3EOAB 3LNFA 4JFUA 5E23A 1HN1A 2WLYA 1NLDL 1LDSA 5CP7A 3BGMB 3DROB 1U8NA 1IUZA 3DO4A 2G3XA 4QT5B 1LK3L 5EWIH 4UB0H 5LQBL 4JB9L 4AG4L 4QLRA 4BBWA 4KZDH 2L3BA 4QGYA 1CDCA 5T1DH 1TJGL 4HETA 1R0AL 5GGSB 1N9PA 4Q97A 3FYEB 4L9DA 1A1NB 2OA9A 2I32A 2JLPA 4NO3A 4PG2A 5C86A 4FQXC 2J8UE 3CC5A 3QB7C 3DOIA 3WV0A 3WAJA 4KNUA 2YA0A 3VXQB 1OIOA 1NCCH 1ZEAL 4IOIB 2GY7B 4KJWC 5GRJH 3LKRA 1JWSB 5AW7B 4MJIA 1BQHG 4ZJ9A 1ORSA 4JE0A 4XCEA 3TL5A 1QLFA 1E5AA 4OCNC 2JJSC 3FFCB 5KJ4A 2N3JA 5HHQA 4X6EA 2YEZA 2VUKA 1T03L 4NRXA 1DQML 4Y5XB 3C5ZD 1UA6H 3DJSA 4XODA 3L9EA 1CLOL 4K7PH 2UZIH 4PJCB 3V5KA 2UZXB 4ENED 4ORZC 3TCTA 3MCLL 2GJ6E 4PRAB 15C8H 1KJ2A 4WJ5A 5C08A 4XMKH 1LILA 2GCYA 4L29A 1U8IB 4KJYB 3PPSA 3BSZH 1FCCA 4OZGE 4E9TA 5FK9B 4KRPC 4Z3GA 1DUYB 3UBHA 1J1OH 4J6RH 4P5TB 4F7EB 1M1XB 4P5MA 2X3AA 1KTDA 1SDDA 3IJ8A 2WMPA 2HT3C 4L3EB 4OT1H 3ZLQC 3UG5A 3UACA 1MWAA 1E9OB 4B9KC 1CIUA 5DEZA 1MDTA 4M7JH 4ELME 3EO9L 3IJHB 1L6PA 1JWUB 3QIBC 3MR9B 4AQ1B 4E42A 1S7VB 2KHAA 3B2UD 4FEMA 3QDME 1BGXH 3EOYG 4RBPK 1KELH 1MWAH 3VXRB 1K4CA 4XB7A 1Z7JA 2IAMC 1UB5B 3QEUB 3RZWA 4H44C 3T09A 2R8SH 4R7NA 1UYWH 4P2RE 3QQ3A 3WFZA 3ZZQA 3FQRA 4G7VH 2NQDA 1F3DH 3QVAA 4A6YL 2WBXA 1RZ7H 4IMLA 4KTEL 4HP5A 4Z9KB 5I6XB 2HMIC 2IANE 2WXIA 5C97A 4OKVB 1G1CA 1CVRA 3MNWA 4QPEA 4J39A 3UROR 3DURB 1BFVL 5EZLA 1L3WA 2MCG1 4F24A 4M93B 1XGQB 1B9ZA 5TDNA 2DIBA 4LKCB 4WI6A 2QPSA 1TPXC 4XMKL 3JSSA 5E5UB 5HD8D 3U4AA 1KCVL 4F7TB 5F6IB 1AE6H 4EIUA 3F5WA 5L4FA 4R2GD 4DK5A 4P2RB 4DGYL 1P4LA 5ILTL 5KSAC 1YPZA 3LIUA 1REIA 4NENB 5E4EB 2VMJA 3MLVH 4XMLL 1J05A 4RGND 1YPZB 3O2WH 5F8RC 5FPIA 4P2RA 4FADA 2HG5A 4XN8A 4CSZA 5F1KC 1WICA 3JWOC 2HFFB 1NCCL 1ZEAH 2MHAA 3KPSA 2QELA 5T3XH 3VU1A 2KYIA 2QGEA 3LIZA 2Y07H 2ZJSH 4U1KB 4BFRA 2WBKA 2QVIA 2TAAA 4F5CA 4UAOB 3Q3GB 3H56A 3FT2A 3QEQA 2VDLH 2CJ3A 2WXPA 3WELA 3WNLA 4ALAC 5T1DL 3MYJB 3BQUC 1HU8A 4OKVA 2X4PB 1BVNP 3P11L 4B6ZA 4WI7A 3T3MB 1F4XH 3BP4A 2A9AA 2FWSA 5AW1B 5PCYA 3B2MA 3QRBA 4L8BB 1DEEA 4KXZH 4XNBA 1XXDC 2OL3B 4RFOH 3TT3L 4QO1B 4XXCA 3WFDH 3VFPB 4S1QH 2ROXA 4MXVE 2F19L 3NIGE 1VGEL 2G60L 4BQCA 4FQQA 4PGJA 4JPWL 3ETBJ 3HC0A 4GLRH 4UTBH 4CW1A 4EI5B 5GS0D 5DO2D 2H2PC 3ARFC 3VFNB 4F7PA 4RWYH 3S5LG 4R6UA 3UO1L 1V7MH 4A6YA 3HBQA 1SLWA 5C0JA 3QORA 2Z6FA 1C5DB 2MPAH 4MB4A 2W65A 4K5PA 1KBWA 1I1AD 3A5VA 4OCSL 2EDTA 5C08B 3HHRB 4FTVD 1GHFH 4KO7A 1RMFL 1SXAA 4A7QA 2MQ3A 4LAQL 1IM3D 2P5WD 3MSPA 4EXKA 2CKBL 1ZTXH 5AVRB 2FX7H 4WEBH 3IJEB 1BZEA 3SGDI 2WIMA 2L7UA 1FO0B 4J4PD 1U2CA 2EIZA 3DX7B 1U6AL 4HCIA 1Q0YH 3GMOA 2R2BB 3FFCA 4HWZA 4HOMA 2WBJA 2W9DL 3O0RL 2WWKT 3K4AA 1CTMA 3SQOL 3S7GA 3O9WD 1A6WL 3AG3B 3UAFA 4WFGD 1EPFA 2FNBA 3NVQA 4OLYL 3DX3A 3DVFA 1KXVA 1OGAD 4ZTEA 2ZCLH 4YXLL 1T0NB 3EYVB 3IFOA 4KI5F 3OBAA 2E5EA 3KXFB 4U6XB 3Q5TA 4WTZG 5F6IC 5F97E 1URIA 2Z0BA 4KNSA 4MAZA 4PRIE 4OZIF 3BLPX 5FFOA 3E8VA 3RVXC 3TBCA 3ES6A 3LKOB 2F5BL 1BWMA 1QI4A 5IG7A 1NGPL 4JDTH 4L1HA 3TURA 2XG5B 2CH8A 3QRGH 3IF1A 4PJ9D 3WE6A 3T0EC 3GRGA 2V7HB 3PGFH 4YHOL 5KW9L 2R4RL 4J3BA 4P9HH 4JKLA 1DJZA 1I3GH 3S34L 1DVTA 5DCCA 1SUJA 3ALPA 5DS8B 5F89A 3ZTDC 4LLAA 1IVLA 3QUGA 4B9ZA 3KLKA 1ZS8A 3BGAA 4A7GA 3VD4A 4JQVA 3HPJB 1NCWH 1Q0XH 4YDKL 4NP9A 1BAWA 2V5RA 5GS1A 4PJDF 4ZPTA 1EXUA 3L5WB 3JT2A 3RBSA 4LRIA 1UCBL 2J71A 4WQOA 2R2HB 4FFZA 3T6QC 2FJFB 3V2AR 4O9HH 2PYED 1CD1B 2FQDA 4IKKA 5KSBB 5DJZB 2IPKA 5C0IA 3T04D 1MAMH 3TPUB 4UIKL 1CS6A 4HIJA 2Q8BL 2YIHA 3L7FB 2V17L 4I0PD 4ZTPL 5IT2L 4FLOA 3MNMA 4KTDL 2Q5BA 2Y0SA 4HWBH 4JGMA 2O5ZH 4WCYH 3WEAA 3BUTA 5CJXA 1MY5A 3B9DA 1QYGL 4Y5VB 3KPLB 1U3ZA 3FB5A 1E3ZA 3FT1A 4PRPE 4Z3TA 3JUZA 4NQEA 3BVTA 4P23A 3DDFA 1MJ7H 3SE9L 2VXTH 4V2BA 2WNGA 5ADPL 4M7LL 3AY4C 2WXQA 1G0YR 2AJSL 4WHCA 2A7BA 2JJUA 1NBQA 1KMGA 1VADA 4XVSL 3IJSA 2PP7A 5HDRA 1EEYB 4G6AD 4TNWK 3FT2B 4A7SA 3JWDC 4PTTB 3JZYA 3O6KL 4OGAD 2FL5A 3F3HA 3MRCA 5DHXB 1Z2KA 2HVJA 3VWKD 2AABL 1T04B 3MRBA 3NABL 2CLRA 2MHAB 2BJML 3KPSB 3GFUA 3PXHA 4L05A 4RZCB 1VRSA 1RU9L 2IADA 3NP3A 1JFQH 3L4WA 3DPDA 3DYPA 4PB0L 1NUGA 3MRHB 4U2YA 1ILSA 4NENA 3GSOB 2RQEA 4XPTH 1TUPA 3FOMA 4G80B 4TQEL 1G6RH 4UF7C 3WFEH 1LE9B 3H8NA 3V0AC 1KWGA 2WVSA 3BOVA 4QRPB 1JIBA 1QBBA 2BNQB 1NLBH 4FQ2H 2IAAC 2WO2B 4Y4HD 5AG9A 5KVGH 3VAEA 2EEXA 2J7LA 4LPVA 1RERA 3L2MA 1H8NA 3QUZB 3COOA 4OM0L 3H2WA 4HJEA 3BD5A 2BRRL 4H88H 5TDNB 1CDGA 1L9OA 4LLYA 3FO9B 2GC4C 2AXWA 3HI6L 3OXRB 1TJHH 3EOBB 4JMNA 3EJSA 5D2LB 3V52H 1RIHH 1WFIA 3MNWB 1U4EA 4HU2A 4N1EA 2BVUA 1SHXA 4NX0A 4XVSH 4IDJL 3QO0A 1X3DA 5GRWA 3GSNA 4OQ1A 1FRGH 2YK1H 4IJ3C 1HL9A 4JANB 3OZLA 3ZDZF 1I8MA 2P47B 3L6FB 3AT8A 2ISDA 3FK3A 3VD0A 4S1RH 2H3KA 2MEJB 4ZDHA 1F11B 1K8IB 1ED3B 3VCLB 2VDRH 1GJIA 2XWJB 4BA0A 1QYGH 5IR1B 2EH8H 1GC1H 3MRHA 4PLJC 5ADOH 3RVWC 4LBEB 3PPEA 1U95A 3OZ9L 2YD9A 5J12C 3WI9A 3ZE2B 2QGCA 4H1LG 3DOSB 4Z7WF 1MHHB 5HY9A 5IFJA 4CKQA 3ARWA 3BPNC 2E7HA 2P52A 3TNMB 4XX1G 2OMYA 3BRDA 4ZTPH 1PG7W 1TZGL 5FW6A 2CLRB 1R47A 5EU6B 3DX0A 3MOBL 3K6SB 2AF2A 5D72L 1SDDB 4IMKA 4L3EA 5EOTB 2XWRA 3SD5A 4M62L 1NQBA 5E0FA 1CMOA 5JA9A 2Z9TA 2GT9B 5IQ7L 1IC5L 1U3HD 4NC1E 1U8IA 4LDOB 5EORH 1D9KB 1X5YA 4WGVB 3QISA 4OM1L 4NWUL 5DFTA 5F9WB 3RWJB 2COVD 2UZXA 2WN3A 4RNRA 3DV6A 1UKQA 1RFDL 1TKWB 2KH2B 4NRXB 3SKUD 3D2UA 2PXYB 1QLRA 1FIGL 2XVBA 4AQ8C 25C8L 5JOFB 4I5BB 4X4ZA 4MAYB 5AVQB 3M1CA 2AZUA 4BFOA 2K0RA 5J13B 4R26H 5HHPA 3UP6A 2ZXGA 2GBAA 5B7FA 1DJYA 1WWBX 3L4TA 3HMWH 5JPMB 3GMLA 2VZ1A 4X83A 2G4GA 1RY7B 3QQ4A 4AYGA 1W0VB 2OXHA 2V2WA 1I9JH 4NZUL 3IDYB 2NW2A 2YSTA 4UTAL 4IK6A 2Y9RT 3DBSA 3ELQA 5L2KE 3IMSA 4M8VA 2XN2A 4G9FD 4D9RE 2P5PA 4PJ5D 3T8VA 5CSZA 1AIFB 2J3SA 3T6XA 4L48A 2NYYD 2P3YA 5JIHA 4ODBD 4AYBA 3GUTA 2A9BA 5DFVD 5EU3B 3FCUB 1PZ3A 3EOTL 1PFOA 3GXPA 3HS8A 3LDBC 4K3HA 1V3KA 3V0IA 1OSZA 4JKMA 4UQ2B 3VI3B 1N12A 2BFGA 3G6DL 4JDEB 2R51A 4AUUA 3EJTA 3WYRA 1SQMA 4XX5A 4JM4H 3BAKA 4UNIA 3US9A 1R33A 2XBZA 5KYXB 1AQHA 3LNGA 1LHZA 1UJ3A 3BYYA 3IAQA 4AC4A 1OSYA 2QPUA 5C0AD 2XG5A 4XNAA 2CCVA 2DLTA 4IS6A 5IB5B 1IC7L 4HVBA 3OMZA 3B3BA 4BUQA 4X9FA 3HNVL 4QRTB 4JDZB 3PWNB 4ZOAA 5DMKB 3TBYB 1ET7A 4HMCA 1GGBH 4CGTA 3O4LA 1GY1A 4BKLA 3TVMD 1ZJBA 1B0RA 2VLJA 5HJBA 4R84A 5ECGA 5AVUB 2C26A 2G3MA 2J43A 1LLAA 4S2SA 1M71B 1NM9A 1OANA 2XFGB 3W39A 5E7FA 1O6SB 1JN6A 2EICA 1A4KB 3L08A 4YBLB 5DS2A 3TNNB 1LEGA 3CFKB 3FTGB 4DW2H 5KUMA 4JPWH 2B4CL 5F9WC 3U4BL 1L7IH 4L2LA 5DF0A 2FWOB 1R5VA 2HVBA 2MFNA 2X70A 4OIFA 4NFCA 5DZAA 5HDWA 2HJFB 5JHLH 4RGMB 4R97B 3T77B 5DRZA 2QQNH 4LSUL 1U2YA 2CPCA 3ZHKA 3FFCD 2OJ1A 2W94A 1FCGA 4ZMNA 1F90L 1F4XL 1CR9H 1AC6A 2FEDD 2WYZA 3ZT7A 2Y6TE 3BPNB 5B38A 2IALA 3P4NA 3AXLB 4XBPA 5AKTA 3ET9F 5HHME 1AZCA 4K8RD 4F15B 1IEBB 2IG2H 5T1MB 2WYIA 3VWJD 5DUPH 3MV8D 3GGWB 4M5SA 5GGVY 4W6XB 2JCCB 1DE4B 5F7FA 3OAZK 1T1ZA 1LO4L 1P53A 2EH7L 5IP4A 4LCYB 3NQIA 1U8PB 2QQKH 5AALA 3S35L 1C5CH 4R90L 3DX6B 5GS0C 2NXZC 4ODXB 1OF2A 1ANUA 1J7VR 2GI0A 4FG6D 1I9RH 2G3NA 1T21A 4FXGB 2EDOA 4ZAKA 1TQUA 1CGYA 2UY6B 1DZBA 3FT3B 3MGOB 1CL7H 4NFBA 5JOPE 3KLAB 1DQTA 1G9NL 3HRZA 4AJ0A 4WI2A 2OR7A 1TQBB 1X5IA 1EAPA 4J3OD 3N43F 1RP9A 3KVQA 4HCRL 4AXWB 2P8LB 3SKOA 2YPLA 1DEEB 2FGZA 3BD4A 3LRKA 2C1PB 4K3DL 4CU6A 1FFRA 5CD5C 3WN5A 4X8JA 3ZE1E 1NEZG 4DZ8A 3WKYA 4HFWB 1KGXA 2Z34A 2ARJA 4QY8A 1YC8A 3HZVA 3CX5J 3F01A 3GO1L 3L1GA 4Z7NF 1DR9A 4YHIB 1JGUL 1TVHA 5EOQH 2UXTA 3ULVD 5F72S 4JGUA 1KG0B 5BW7A 3HG3A 3UJJH 4ZTOL 5E08H 4ICWA 3TF4A 4RH4A 4XGZA 5FDWB 1USZA 3KPNA 3MV9E 4PJXB 4B53A 4DAGL 2OMZB 1HWHB 4MBOA 2DLEA 3HRZC 1DVQA 1IBYA 4HLZG 5LVEA 2Z8RA 3D48R 4YZWA 1XF5A 1FNEB 2JK5A 4NO0B 1CURA 2CSPA 3PWUA 3JV4B 4NQTA 1JNNL 2OYLA 1I1AB 3NACH 4MCNA 3RA7H 3F7PC 6PCYA 4TS6A 2F53E 3SDDA 2VL4A 3L16A 5H35B 4I2XB 5K93A 3E8UL 1RULH 4XPGH 3KJ4B 5FKAB 1KLFB 3MRLB 4LF3B 3AM8C 2YUZA 4HK3J 3AACA 3QHFH 5ALBL 4LCIH 4K71C 12E8H 1LQBC 3VM7A 1OB1B 3GSNL 1A3RL 2FJUB 5AQ0A 3WGUB 3HMXH 2SEBB 2CCWA 3TOPA 1IEHA 1B0GB 3U6XA 4KJQD 3X1FA 1JXDA 1JMXA 2OW6A 4IRJB 1CLOH 2WQAA 5DUBB 5BUGA 4EDWH 4JFZL 1MREL 1R6VA 3EJUA 2XIDA 2VE6B 4Q9CA 2D0HA 5E00A 5D7LE 3IS1X 3WSQH 3E6HA 4L9LC 3LXAA 3D12B 3DKHA 4HWEH 3I2CL 2J8HA 4FJ6A 1JGLH 2V8LA 3CG8A 4ODUA 3E6FA 1TU2A 2XVGA 2WOYA 2IGTA 1MJJB 2ADFH 4FFWD 1M05A 1OXYA 1J5IA 2Q20A 3GM8A 1MFUA 3RKDD 3GC3A 3IXTA 4HA1A 3UBXI 2OTWB 1MWAB 3E38A 1UB6B 2D9QB 3FU7A 3HN8A 2AEWA 3GHBL 3N41F 4FQLH 4HIXH 4P5MB 4POZC 4JVWA 4DTGL 1T0OA 3ECQA 1U3HB 1MCDA 4OI9A 3C6LD 2BX5A 1F42A 2IDCA 1BZ9B 1KJ2B 4ISVA 4GO9A 2PMZA 4MNQA 1CICC 1IFHH 3CBRA 2ICEB 3FH7A 3RL2A 2H9GA 5DT1L 4ABVA 1D5BA 4JRXA 4XWGL 3BE1L 2WWMD 2E6JA 1PF3A 4M1GH 1M2OA 1FVCA 1WFOA 3UCQA 4CSSA 5DMIL 3TVMB 1FZJB 4RDQG 3VVWA 5HHQB 1FZOA 1M3JA 2XJKA 1GSKA 4XO5A 2IQ9H 4G9FA 3SZKC 3V4LA 3GMPB 1THAA 3U7YL 3WNNA 2F58L 3HZKA 1BA9A 3BUPA 4MQ7A 4QHKI 2N01B 4N6RB 3PWLA 3T4AB 1DDHA 4X5QA 1RXLA 4ENEC 1CU4H 4Q2ZA 4TTDC 4JLRB 4Y4HA 4ZD3H 1EJ8A 2R27A 2FTAA 1U93A 2P8MA 3O45A 4HJGA 4NO3B 2NNAA 5CJOH 2W60A 5AYUL 3U7YH 1L5GA 2BOCB 3KVPA 5C07E 4FQCL 1BM3H 2Z64C 4AQEA 1DQQA 5IROD 3CXDL 1AMXA 2Y6SD 5DMIH 5ABDE 5HYQB 2G75A 4M1GL 2VM3A 3D0AA 2UXFA 4PJDB 2ZCHL 1E2WA 3FZUD 1TTAA 3OF6A 2CO7A 2YXVA 3QIBD 5F3HB 5BZWB 5KS9E 4PJ5B 4TNEA 4QRQB 2W38A 3BWZA 4LVEA 4OY9A 4X5PA 3W2DH 1W2KT 4UNVA 3FQTB 3MV9A 4WI9A 3TESA 1MIML 1TLMA 3P30H 3DYMA 2D31A 5F7EH 2ZWZA 4L3ED 2VXVL 4DP7X 5EUOE 3RWHB 2ZOTA 4XXDA 5DK2B 1P4IL 4Y16B 1IM9D 5ESAA 5EZIH 4FQXA 1LVEA 2OFQA 2QR0B 1UTDA 3FN3A 2XZCH 3LEVL 3DI2B 3ZXAC 1UURA 4O2CA 5IESH 4DQAA 1AIZA 2BDNH 4PWIA 3UFIA 4MVBC 4Q89A 5DXWA 3S3SA 1Q1JH 1DFBH 1DQIA 4FZ8L 2JJSA 1ES0B 2IGFH 3UYRH 2DYPB 3CDGA 1NC4B 3NZSA 2X4OB 1CFMA 4X4XB 5TDPB 3G5XB 3JWNH 4TF4A 2VXSL 5AVYB 1J5DA 3TEZA 1SJXA 1S9XA 1Y6KR 5J8OA 4OD2B 4QUOA 4TNWF 5D1XB 4E9WA 4HMDA 4OZGF 4TVSa 4TUUA 5KSVB 4LOFA 5ALBH 4TSBL 4W68A 1RUMH 3IAPA 4LARL 3GSWA 4JPSA 3BVXA 4ZMYA 2VYRE 5M95B 2VT0A 1CLCA 4XPGL 4PWFA 3C2AH 2CJSA 4GAAA 4NPYB 4NZRL 1MF2L 3QIBA 3U0PA 5AVTB 4YQXH 3TZVD 1FZMB 1P9MA 4U3CA 1QWUA 4KPHH 1TVDA 4H26A 5AG8A 2NT0A 4JY5H 5E0QA 5LB1A 5IY5B 4QNPF 1U92A 3H9SE 1HXYA 3UTQA 1AP2A 1DN2A 3DIVA 3QFJB 2P80A 3IETB 3VSUA 1HOCA 1MFEL 2NY1C 4H25A 1OTSD 3OKOB 4HC1A 4ZOCA 4PJFE 4PJFB 4XWOD 5F9OH 3EJPA 5FXCH 4TUJB 4DGWC 1JXKA 2IPUG 3V0FA 3ZDYB 4F27A 2V3DA 5C71A 2JJTC 1BVOA 4HCRA 3T08A 1CXEA 3QPXL 4XN4A 1KGUA 5HHXH 1NFDE 3VFGH 1I8LA 2DQGH 5ES4B 1EV2E 3UTZB 3ARGB 3GXFA 3FTZA 4X9YA 5EBWA 4UAOC 1G6RB 5MHSE 2VDLB 4DZBA 3EJJX 3GSWB 4FD0A 5AW2B 2JI1A 3KR3L 3V6ZA 3WKMH 5FCUH 5IBUG 3S37L 4ZO8A 4TN9A 4FNLH 2P46B 3KDMA 4HHAA 4HF5L 1VGKA 2OR9H 5D1XA 2AQNA 3RPKA 1IILE 3RWFA 4DO6A 1AO7D 4MLSA 1HWWA 2OMTA 4R96A 5I1HL 5T3ZD 1WAPA 1E65A 2RCSH 3DNKA 3BO8B 1A64A 3KPSE 4GW1A 5FYKH 5JQIB 1KCRH 1WZKA 3KXFD 4H2AA 5C0FA 3E7JA 7PCYA 3PQYD 1RHHA 2VOTA 3DUHA 4TQPA 4BWWA 2VDNL 4E9LA 4KXZI 4U1IA 1XGTB 1PEZA 3ARUA 3BZFA 4KKCC 1JPGB 1ESOA 1LO4H 1MW1A 2CRYA 2W0FA 2YRZA 4E41E 4HGMA 4KRPB 1NSNL 3GLZA 1OTTD 5F1NA 3MLUL 1WK0A 4R4BA 5J12B 1NEZA 5E8EA 2D8KA 1KYOJ 1YMMD 3CE1A 2Y72A 2X1PA 2J8UB 5IEKB 5I9QC 3IDIA 3L9BA 3CFDA 3FQUB 2P5WB 5L9DL 4JY4A 4Y16A 1G7QB 4M3KB 5JW4N 1HZLA 1L3NA 2ITDB 3L7EA 5D2LE 3A23A 4IRSC 3GBMH 2E7LA 2RALA 4G8FB 3VWJB 2IANA 1MLCB 3QIWB 4YBQD 3CK0H 4TSAH 4E68A 2FO4B 4G6FD 2YC1B 1YECL 1BZ8A 4ZG1A 4MXVF 1RJLB 4X4YB 4Q6IC 2X0UA 3BN9D 3OKEA 3OPZL 4I0PB 3QO1A 1GJWA 3CHPA 2FH8A 3H6AA 3T8XB 4GRMA 4EIGB 1SEQL 4HKJB 2A6JA 3M1BB 2XWTA 1MW3A 2P43B 3T1WA 2DPKA 4JBSA 3HB3C 5HYQA 1E8YA 4XAWH 1CE6B 3BMWA 4MKMA 1JNJA 1EO5A 2YLHA 1ZA6B 3HLAB 2XN1A 4HJGB 1ZLUH 3ZDYF 2N7SA 5FO9A 2Y7QB 3HI1B 2F8XC 3TIDA 1HFUA 4JQXC 4Q2ZB 1D7DA 1M7DA 1DDHB 5A16B 4JHWL 5DHYB 3AGVA 1Z9NA 2EDQA 4YHMH 1SHWA 2EAEA 3HAEG 4N90D 5EBMB 5AOLA 1I1AC 3RZCC 5D70L 1LEIB 1GA2A 3KPMA 3BVVA 3LSOA 4PV8A 3MLWH 1OCWL 3HFFA 3N41B 4U1SB 4YXHL 4FJZA 3T1FB 4OJYA 1DJGA 4N2AA 4GY4A 4QHMA 1U8JA 3EFOB 1H19A 4YX2L 4AL8C 4RRPA 1BVLA 3O4OC 1W6WA 2RIKA 4P5KB 3GBNH 4KX7A 2VB5A 4KOBA 5AAMA 4Z3FA 3MRGB 1ITBB 2UX6A 2F8IA 1OGAB 1QI3A 5CILH 4OD3L 2NZ9D 3UZEA 3QZOA 3L13A 4U1MA 3BZ4B 4K8RL 1LGVA 4R7XA 5A3IC 3RUGB 4QRUB 5FO7A 4HUUB 2ZOLA 3UAJD 1FYHB 2R1YB 3L5XH 2XJLA 3K72B 3I85A 3QCUH 3QGVA 4LU5H 2EILB 4M61A 3LB6C 3QUXA 5DEGA 3GZKA 3LMJH 1KEGH 1ZVSB 2R2EB 2HN7B 4IOFD 1QAWA 1EGJL 4BA8A 4ZUSA 5BVPL 2XN9D 2H6OA 3QDGA 4UMSA 4YX2H 1A1OB 4A04A 2AQ3A 1AKPA 3APMA 1I7TB 2YA1A 5GRYA 3QYNA 3FTWA 3GDCA 1KPVB 5IQ9A 1QFWL 3OD3A 1OCWH 2WZ5A 2PP9A 3DBXB 4NC2B 1NCTA 4JHBA 2BFVL 4G6ML 4ONHB 1BXXA 3ZE1B 1FE8L 3S5ZA 4XNYH 3IDXH 3F12B 4J6IA 2JIXB 3LH8A 2VQ1A 4M62H 4GG6E 3BKJL 3MMEB 4WTQA 1PKOA 5BRPA 2I5YH 5E6IA 4AMKL 5DQJA 1IAIL 4YSOA 4NGHL 3RGVC 3NIDE 4HPYL 2IJ0C 3GKWL 4KKPA 1HHGA 4U1GB 5CP3H 2RGSA 4U1HA 1WFTA 4PV9A 2BP8A 3RNKA 3S2CA 4A55A 4P4KD 3S0PA 2NY1B 2PWHA 1NBVH 4RGNB 3TN0B 5HD8C 2EC9U 3BAEH 3AG4B 3UOAB 1TCRB 4NRZB 1XTMA 1A14H 1RZQA 2EH8L 3BHBB 4AW4A 3MNDA 4OFIA 1WHPA 2CR6A 4TVPE 1G9NC 3GSXA 4OIIH 4UT9L 4BFIB 2GKIA 3FB6B 4TLUA 2X0VA 1S5IL 4NM8L 1YEWA 1J18A 1XD1A 2NUTA 5IMLA 3DO7B 3OPZH 5CCGE 2XIIA 3SCMC 3BEVB 2X9YA 1JF5A 4PJXA 2YD0A 4X98B 5INDB 3LRSA 1VZHA 4IDJH 4WKZB 1BVZA 2P5WE 1CQKA 4DP0X 2P4AB 4ODWB 3CHRA 4H13C 1Z1WA 1HILB 1USQA 3O6FB 1SFDA 4OLEA 2AEQL 1OP3K 1U8HB 1CFTB 2BRRH 4H88L 4QRRE 5EIQA 4KJPD 3K81A 2AAAA 4LSTH 2ZSVA 4HFWA 3BKCL 4YFLI 2V5SA 1CG9A 2X3BA 3KPRD 2DDQH 1ORQB 5E1AA 2BZDA 3C60B 3LKSA 1K72A 1YJDH 1KEGL 4P2RD 3EBGA 4FI7A 5FLVA 3VWKC 4B5EA 3D07A 3KCWA 4UIMA 5E99H 2PCFB 2F54E 2UY6A 3MGOA 3L3IB 3VQLA 1GH7A 1BAGA 1OTUD 4ZOEA 4CILA 1OSEA 2B4CC 4G6KL 1OF2B 2IH9A 2J88H 4Z5RA 3ZTNL 4J23A 1IM9A 3LV3A 1Z9SB 1MNNA 2G2RB 1T1ZB 3VRIA 4MSWB 5KJRL 5CLYA 3JWOL 2RTTA 2FEEI 3KBEA 3P3UA 4NNPH 3IKCA 4FFTA 5K9JH 3JWNE 1OCCB 4FG2A 4HXAL 4G8GB 4Y2LA 1OOAA 3LKNB 4PLJD 4HUNB 4YXKL 3SKMA 3MLWL 2IBGA 2KQMA 3HE7A 3VI4E 4LK4A 3JV5A 1FVDA 3RZCB 3TX4A 3WENA 1FORL 4JHZA 3FF7A 1MI5A 5HHXL 3PWJB 1CB4A 4NZTH 5EIIG 5LBSL 4AYID 2QVKA 1HQ4A 5TQ0H 1NGXA 4LEOB 2A6KB 1YYML 4HBCL 3NCMA 1VZIA 3TWCH 2VDQL 4OCLC 4G9DA 4OTXH 5F7AA 1M42A 3LEXA 1GZHC 3QRLA 4QRRD 1BPLB 4TPRL 1JN6B 5EUKB 1QSEB 2ZXEB 1JGVH 32C2A 3M1OA 1UKSA 1NGWA 3MGAA 4XBEH 3V9CA 4IBYA 5ANMB 1PZ5B 1YDPA 2ZX7A 4O9HL 1U8KB 1BIIA 4M7LT 3SODB 1SEQH 1J8KA 3BAJA 1Z5YD 4W6YB 5GGVH 1IGCH 2AEPH 4WW2C 3BFWA 3ME0A 1SHSA 4BSVB 4IS6B 2CQVA 1UCBH 4PJ8B 4X5LA 3FOLB 5HYFA 4XMPL 3GMRB 1AR1C 3CFBB 4GSDL 4OBRA 4QXUL 1IKNC 4LARH 3AG2B 2NY7H 4V1DD 5D5MA 5I8OL 3KPRB 4UT6A 3LZRA 4C4UA 1KPRA 4JO8A 4Z7UF 5JXED 2B59B 2NR6A 4ODTL 1INQB 2Q1EA 4YLBA 3QEHB 4MWFB 1F1DA 1AD9B 5E51A 5DC2A 3V6OA 4JJOA 5E95B 2O26U 4N2EA 4AZ8A 2IAMA 3MC0A 4MS8D 1J0HA 4Y5VC 5D1ZA 3RDTC 1YEGH 5FKPB 1HE8A 2M2DA 5IJBC 1IMHC 1HSBA 4HS3A 5CZKA 4JZJB 2B2XH 4JCMA 5DO2C 2WNXA 3UYRL 3DGGB 4GQ9L 5IGXH 1YEHL 3REVA 4HK0A 1A9BA 2ODHA 3EG9A 1CTOA 2YMTA 1G7MA 2WLZA 3BISA 1TR7A 4PJXF 5IQLA 5I71C 3WTVA 4QCIB 2J44A 5I1AA 3RVVC 2NX5D 1FFNB 4HXBL 4AZ8B 5HHOD 3TV3H 1B3IA 3QXWA 2C9XA 1RSYA 4GO6B 5FR3A 2NY1D 3TN0D 3H9ZA 1OE1A 3O3DB 3OGCB 4Z76A 1CCZA 3RFZB 2EUZA 2W9DH 4JFTA 4WFGE 5D5MB 1I1FA 4KKAD 4MAYA 3OSVA 5LNGA 5HHVL 1XF3A 3MJ6A 3D3VA 4BSVA 2VH5L 1VFBA 3D2UB 5JORB 3IFNL 3RDTB 5D7LB 1ZTXL 3IMWA 3O9WC 2CLZA 4U1LA 3ZQXA 2DQGL 2YARA 4RNRB 1K3IA 3VFGL 3PHAA 5ANMA 3O3AB 1URLA 1YYCA 2OP4L 3CLFL 4HT1H 4OZHA 5LBVA 32C2B 3V6FA 5KANG 1BM3L 2DQCL 3QUMB 3VH8G 4MXQD 3VD5A 3BZEA 1VEMA 1NBYA 3D1MC 3VO0A 1HK6A 3LS4L 4P57A 5CJ5A 4Z7OF 3SYQA 1SM3H 4PFEA 3NPZB 2B1HL 3HS0A 4GSXA 4RWYL 5FHBL 3IGAA 4B9GA 3N2JA 5IVZA 3TBSA 4JY5L 2FSDA 5CHNB 2C7FA 5I6MA 3FONB 3O41A 4UTBL 1WS8A 4MA8H 4UQIM 5C3TA 4NO2A 1MI5B 4LEBA 4PJ8C 3RUGF 1DANU 1U0QA 2QMJA 4EOWL 2H4EA 3EJYC 2Z92A 3SQBB 4PGEB 1N3NB 2PUQT 1C12A 2EDRA 2BP5M 3EHBC 5C0DA 4QMEA 3VCLA 3HPLA 4OAWA 4XOBA 1QA9B 5FHAL 4H8HA 1XGZA 3OLEA 4L4JA 2GSGB 3L6FA 1E6OL 3B43A 5LWYL 2A99A 3NJFA 4JRWA 1KIPB 1YG9A 3FSZA 5DYOB 4NM4H 2EDFA 1F8TH 3QO0B 4FLHA 5C6TH 4DTGH 1SXNA 3QJRB 2VN7A 3JYCA 3LN4B 3ZUNC 1OARH 5IVXF 4YGVB 4ZQKA 4FTVA 3ARRA 5CJQH 4AYEC 1JVOA 1XHHA 1JJUA 2D7NA 2JKIS 2F1BA 1EK3A 1DSYA 3H0TA 2L7JA 2CM5A 3ZKMD 2BNUB 4Y2DD 1AD0A 1UM4H 2Q3AA 2BNQA 2RACA 1N5AA 2BERA 3E1F1 1OD9A 3G3LA 1PIFA 2BDNL 4F20A 2Z7UA 3IPBA 1RPKA 3L3KB 3DRTB 5E70A 1UD3A 3G04B 3H0TB 2BSED 4HKXA 3NJKA 4PJ5E 5EZIL 5HGAB 2Y3AA 4HIHA 5FYJE 1C8PA 2VAJA 1DO5A 3G6JA 3IRZA 1U3JA 3S5YA 4KXCA 1HILA 1OARL 1WZAA 2KMWA 4NZ8A 3QP3A 3A3YB 1KPUA 1MW2A 4KO5A 4V1DB 1INDL 1A3RH 1KXVC 3ELAT 5EO0B 3ZOAA 3W2DL 5JHBA 5LNEA 5F44A 1NAMA 3U36B 1FZKB 2CGZA 2WC7A 2WINA 3PGCB 1ZGLP 1F58H 3MREB 2NY4D 5AAWA 3ATDA 3ZZSA 2B08A 1S3RA 4NKQB 3QK0A 5CJXC 5AOIA 5CD5D 4OAWB 4KK9D 4R0LB 3STZA 4S1SH 4QKXB 1RZ7L 3VDBA 4K5OA 1E4XI 4LCWB 4F8QA 2O6EA 2BVQB 1GS8A 3MA7B 5C0AE 2VDMB 2NY5C 5HJGA 3KJ6H 4ES8A 1NGQL 4YHLH 3I6SA 1BIHA 5IB3B 2Z7ZA 4LOUC 5CHNA 3EZJB 4YHZL 1BMZA 1ETJA 1YO4A 3C09C 5B1JC 1SN5A 4JZOA 1DQKA 2F58H 2IH3B 4R0LC 2XXGA 2V2XA 4ZRGA 2A1WH 2K4WA 2ICES 1ACZA 4EEEA 5EO1B 3WMPA 5E08L 5C6TL 4YWGH 4PP2A 2CO4A 3BE1H 3LOWA 1CZ8L 4Q4EA 3IMBA 3GJEB 1U58A 1BD2E 2A3TA 4PJHF 5LCVL 3S2AA 3EAKA 4ANWA 4DO4A 4ZUSB 1WE5A 4ZXBB 5FYJD 1A6PA 3QDGD 1H3GA 2ZXBA 2WQRA 1MCJA 2BVEA 3FRPB 2NRDA 3QI9D 1PCXA 5DJCB 1G7HA 4YDNA 4J8RB 4HUUA 3MFFB 3PL6C 4UTAA 2CHZA 1YEJL 2IWGA 4HXBH 3RVWD 1XAKA 3WG7B 3A4EA 1GZPB 2EIEA 3AS1A 4R90H 3NJNA 5EV7A 4L8SA 5IG7B 1JGLL 1FFOB 1ZWIB 5I8KH 3REVB 2HX9A 1QRND 2J6WA 2O93L 3R06A 5DJ6A 2A83B 5C07B 1H8OA 2GIYA 5ECJE 3WTTA 4U7MA 4JFZH 1T0NA 3IFOB 2VISA 3IFNH 2CO2A 2VH5H 1W0WB 2QGBA 4KNQA 1RIVH 3KPMB 5BVJA 1V10A 3LTVA 1XAUA 3NEEA 3BJLA 1W9XA 4FQIL 3KPOA 1U8LA 4LGRB 4MVBD 4BWTA 2R2BA 4TMPA 5JHLL 4X4ME 4PWJA 3ME0B 4GBXD 4PJGB 5E4EC 3ZRSA 4YJZL 5T1LB 2CBTA 3CJJA 4EI6B 5J1AB 3ARDB 1U8KA 3US0A 3ZX1A 4KK8C 2OMVB 2UWEE 4FNRA 1H3XA 1LO2L 1E30A 5CR1A 2FBJH 3FAWA 2A83A 1ERNA 3IDUA 5IHZA 5EUKA 3NFSL 5HDQL 2W65B 3Q13A 4BXSV 4YSUA 2A38A 2XWTB 1ZHNB 5E2VH 4ZFOL 4QHNA 2HLAB 1XF2A 4HIIB 5KVDL 5E5MA 2ZG1A 3F6IA 4NN7C 4DAGH 1RJLA 4X4YA 1XF4B 2W92A 1A4JB 1OQXA 2EEBA 3AWFA 4LL9A 1PZUB 5GGQL 4G8FA 1UT1A 4FQQB 2JKSA 2NSQA 3UDWA 5JQHC 5EOQL 3ZIYA 2WD0A 3GO1H 1YEIH 3QZNA 1AMYA 4KKQA 4MDIA 3I9IA 1T83A 3OAYK 4XMPH 5IK3B 5HYJE 2H5UA 1IE5A 2D73A 3H9YA 2CO1A 1S7XA 3ALXA 3JYBA 1ZLDA 4UT7L 3H53A 4GUOA 5K69A 1WGOA 3DUUA 4FQ1L 5LJYH 3ZGHA 4NDMA 4PTUB 1WBZA 4XWOC 4FAAB 4U05A 4U0RC 2VJ0A 2ZICA 3QEQD 3HE7D 5JW3L 1WZ1H 4UOZA 4Y2DA 3MYJA 1CT8A 2OMWA 3ZTNH 2D7TH 4F91B 1KYOK 2EXWD 5L4MA 1OHZA 3GSUA 3TVMC 2FE0A 2YPLD 4FXGC 4ADIA 4OTXL 3ARBC 5JYMA 4FFVD 3V9FA 5E99L 2CR0A 3FRPG 1NAML 4CAGA 4X2UA 4P3WA 1WIOA 4UTBA 3NG5A 3X13A 1ORQA 4XP6H 4Y5XC 3TH3T 3V7AE 3VFOB 4OV5A 2DH3A 2B20A 4P2QB 1N8ZB 1M2VB 1QD0A 4XB3A 2FSEA 3I6KA 4I0CC 2QT6A 1U8HA 3AT0A 4BDVA 5K9JL 4MDJB 4JPQA 2EUXA 3MREA 1NL0H 4GMTL 4JUTA 4ZUUA 1J9QA 2X2IA 2OS7A 4IYKA 4MXWH 5DMGC 1D7CA 1HWGB 3LRSB 4Y19A 2ZOKA 3MLRH 3MLXH 5LG1A 3QJOA 4M4RA 4C57C 3RTQD 3IETA 1F02I 1ZPLA 4MMZB 1L0YA 5MENB 4IU2B 3H4HA 3C09B 1Q38A 1RLWA 3LS5H 3ULSA 3DX1A 3UTQB 1AQ8A 4ALAH 1TZIA 3INOA 3VFRA 4P5TC 5EFIA 1QEWA 1V3MA 4KX8A 4PUBH 4WY7H 3QNYB 4DKAA 3Q7JA 5E6ZA 3OZ9H 3DRTA 5I1EL 4XHQA 2YMOA 3HUJA 1ZVNA 3TN0A 3RPIA 3Q05A 1K3ZA 4ZS7H 1FPTL 2YRBA 4XB8A 3OZKA 3RAJL 4PU2A 2DDQL 4NN6C 4U1HB 4YHPA 1MHCA 5E2TL 3RVVD 1IQDB 1UM6L 1KIRA 2EE0A 3F04A 1FC2D 3FCTA 3BN9C 5HDBE 4E42B 4O5LH 1BREA 1XGUB 4K3GA 2Z8SA 3GI8H 1CVSC 4WWOA 3ZMNA 5CGTA 4AYDC 3L3OA 3EADA 2EIBA 2WMPB 1NPJA 3WY4A 3I3BA 1LEKB 1PJ9A 3B9AA 1DUYA 4KJYA 5IQOA 4PJAA 1DJIA 4DEUA 5JHMA 1IFRA 2KI6A 2X4OA 2VXQA 4X4XA 4NNYA 1EA9C 3L2NA 3HPLB 4JO2L 1X7QB 2XDHA 4DHLA 3QH3B 4WLCA 3ZO0A 5I1JL 1H8LA 1A6TA 2H47C 2NY2C 3MV01 1EFQA 2BNRE 3BDBA 4QRRA 1HCYA 3L17A 3SDXE 1UFGA 2ICWJ 4LPWA 1NCIA 4YBQC 4U6YB 1V3JA 3CZNA 2CHDA 3QJFA 3JBG7 4AMKH 2YXWA 3UC2A 2VMCA 2BJMH 2HLFD 3EYSH 3IEAA 1BZDA 3BPCB 3F58L 3OKNB 3IDXL 4LSDA 2OAAA 3QEGL 4HJJH 3X12B 1E4KC 4K94C 4Y4FC 2WUBL 2XX1A 3SJVB 1KC5L 1X4YA 1M6OB 2G75B 4JO1L 3RWEB 3BUIA 3BKML 3VDAA 2EIJB 1EGJH 2I27N 5D70H 2E4TA 1MJ7L 2Y36H 2W8CA 2MQCA 3LB6D 1QATA 3GRWL 4R83A 2W60B 1YHPA 2EYTA 2FK9A 5CIPA 2EDEA 4Z76B 3L5XL 3MACL 4L1LA 3RG1C 1FNAA 4DGVH 4S1DD 3W9DB 4NLAA 4N6RA 1FLRL 3T4AA 2A6DA 5KVGE 2R56L 4BV1A 3WJMA 2ZYIA 1FFNA 4J27A 5JHAA 4NKMB 1U3NA 5I1AB 1UVQB 1WC7A 4XE0A 2CCLA 2DJ4A 3U1QA 1FZOB 4XAWL 2ZUWA 1KN4H 2NZ1A 4A37A 2DZEA 2EDLA 3OKMB 3BT2L 3V6BR 4HK0B 4DESA 4JFFD 3DWTA 3NFPB 3OVUB 1A0QH 4CGUB 4JZJA 3RL2B 2GK2A 5C0AA 3VWKA 1ADQL 3WL9B 4GMSH 4QTHA 1WJ3A