1V27A

Solution structure of the first c2 domain of rim2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
141
structure length
141
Chain Sequence
GSSGSSGGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Regulating synaptic membrane exocytosis protein 2
publication title Solution structure of the first C2 domain of RIM2
rcsb
source organism Homo sapiens
total genus 12
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1v27A00
4KZCA 1UOVA 2CM6A 3NSJA 3QJZA 1E7VA 2V4LA 3CSTA 4GNKB 4GB9A 2EP6A 5EDSA 4ANXA 2UZPA 3F05A 4DK5A 3TL5A 5KJ7E 3QR0A 2WXQA 2JQZA 4JPSA 2WXHA 4WWNA 3KWUA 4NS0A 3FDWA 4PS7A 4FA6A 3P2BA 4BFRA 4HVBA 4URKA 3ENEA 4IHBA 3QAQA 3APFA 2RD0A 3F00A 4PS3A 2B3RA 4QJ5B 1BCIA 2CJTA 2WXOA 4OVUA 3JZYA 1E90A 2ENJA 3ZIMA 3F04A 4L1LA 3L54A 2CHWA 2K3HA 4A55A 1E8WA 5JHAA 2D8KA 1DJYA 4ANUA 3ZVVA 2WXMA 4F92B 3W56A 1TJXA 4WWOA 2LHAA 1DJWA 4XZ4A 3R7RA 2WXLA 2K8MA 4L1BA 4ANWA 3PRZA 2Z0UA 3L4CA 1BYNA 4FHKA 2WXIA 3PFQA 1DQVA 3RDJA 2X38A 3L13A 4HLEA 1WFMA 2WXJA 4QAMB 2FJUB 3DBSA 1A25A 1E8XA 2KI6A 2A5UA 1K5WA 3L08A 1DJGA 3N5AA 2DMGA 3HIZA 5H4YA 3ML8A 3QR1A 1W15A 2NSQA 4FJZA 2QZ5A 2K4AA 2YRBA 3PREA 5G2NA 2ENQA 3SD5A 2CJSA 1RH8A 3OAWA 4FLHA 4QJ3B 2CHDA 4AOFA 4KITB 3IBEA 4WWPA 4FADA 3MJWA 1UOWA 5CCJA 4OVVA 3ZW3A 1WFJA 1CJYA 3PS6A 3R7QA 3B7YA 1V27A 2NQ3A 1DJXA 1QATA 3W57A 2Q3XA 2ENPA 2R83A 4XE0A 4IQHA 3RPBA 1BDYA 1TJMA 4LCVA 4NPJA 4TUUA 4ICXA 1DJIA 3LJ3A 4DNLA 4WAFA 2ZKMX 3ML9A 4LT7A 1HE8A 1E7UA 2Y3AA 4NPKA 2A4ZA 2DMHA 1E8YA 2FK9A 3APCA 4TS6A 5T8IA 2CHZA 5H4ZA 4EZJA 3HHMA 2YOAA 3DPDA 2CM5A 3PYCA 4Y1TA 4NP9A 2WXPA 3IM1A 3L16A 3F01A 1DJZA 4F93B 4KZ0A 4V11A 4Y1SA 3FBKA 3L9BA 5CCGE 1W16A 5CCHE 2WXGA 2WXRA 3TWYA 4F1SA 2N1TE 1DJHA 2NCEA 2QZQA 4ICWA 4EZKA 4FHJA 4QJ4B 1YRKA 2WXKA 2WXNA 4XX5A 3APDA 4F91B 2CHXA 3QARA 1RSYA 3HN8A 4AJWA 1RLWA 4LDCA 4L23A 1UGKA 3NZSA 3QK0A 4TV3A 2ISDA 5JHBA 1E8ZA 3TJPA 2WXFA 1GMIA 4FULA 3S2AA 4PS8A 3CSFA 4WEEA 5G55A 3KWTA 3OHMB 2K45A 3T8MA 4ANVA 2Q0ZX 4FJYA 4L2YA 1DSYA 4G11A 2BWQA 4BGDA 3NZUA 3L17A 4J6IA 4EZLA 3GPEA 1QASA 4MJJA 3M7FB
chains in the Genus database with same CATH superfamily
1DVUA 1NCBL 5DYOA 4PV9A 2DQTH 3SJVE 3EH1A 3F7VB 5DF0A 1JDCA 5J6GA 1FLRL 4ODWB 4PRNB 2DI9A 3L3KB 4GSRA 3G6JF 5K93A 4FFWC 2VKWA 3FT3B 4P3DA 5K9KB 1ODUA 1U92A 3BRDA 4PJCE 5DHVB 1PTZA 1K5NB 5I6MA 3T0XA 4XHQA 3TCLA 1QYGL 2EDDA 1DHKA 1WITA 3F2LA 3NCXA 4O51B 4OLUL 4LVHC 4NO3A 2PCPB 2DQCH 3HZVB 3QFJB 4WUUE 4XB3A 5C0BE 1MCEA 3OC8A 4UTAH 1XB8A 1CICA 1I1AB 5H35B 3FFCA 2WBJA 4XMUA 3V4PH 1FZMA 1T20A 2BCKB 4ZW7A 5GS0L 1NL0L 2YGVA 4EJ1C 3D34A 5HVGB 2QPDB 3CWGA 4AYBA 4ELKB 4KO9A 3S0PA 3RFZB 3EHBC 3BFWA 1CVSC 3GDCA 2WZPD 1P7QD 4JB9H 1CQKA 3HIZA 3VRJA 3L9EA 1EEQA 1QPPA 4GW5A 3R1GL 2QGCA 3L1GA 4JRYA 4CW1B 5KW9H 5HYJA 1QSED 3PWPB 4AGMA 2CJSA 5I9QB 3D50A 4Z3GA 1BZ7A 1E4WH 1GS8A 4EN3B 2D7PA 1J88A 3HI1B 3OJDB 4IGBD 1A1NA 3GI9L 5HY9A 4KZDH 4XMPH 1BJMA 1IM3B 2P5EA 2BINA 4HS6B 1GGIL 2A9NL 3PP4L 4N0UE 1PG7L 1YNKH 2AEIT 1KLFA 1C5DA 2CA3A 3TNMB 1DBJH 1QBMH 5E9DE 5F6IC 3WY2A 1DJIA 3MLWH 4KX7A 5IJVB 4IOIB 4KRNA 5DC4B 1D5RA 2R2HB 1YCSA 3APCA 2ZUQB 1ZWIA 4QHKI 2VMDA 3TN0B 3L16A 2J4WH 1A14L 4L8CA 2FX7L 3KM2A 1ZHKA 3TA3B 1ACXA 2XWJB 2G3XA 3PWVB 3CVIH 2NLJA 4MAZA 1SDDA 1T6WA 1WD9A 3F6IA 3L6FB 2CCWA 1G9EA 1VB9A 1GKOA 2DYPA 3H9YA 1WFIA 2Y2TA 3HZKB 2VQ1B 4MA7H 4XPHL 4DN4L 3MMEB 3FHQA 5ICUA 4WI3A 1MJUL 1RZKH 2IADB 1YJDC 2MWCA 5F7BA 2AFNA 4J3BA 3SDDB 4TL5A 4ZFGL 2EVHA 5E5UB 2DMKA 4G11A 2IPUG 4XNQB 1PDKB 2XIIA 3NZUA 5CCKH 5TF1H 1XGPA 1IFGA 1CFNA 3N2JA 4MAYA 4HPHA 5I66A 4U6YB 5DEFA 4A6YL 1JCKA 5TGBB 2VXVH 3G6AA 4DUXA 2VE6A 3GXIA 3TFKC 4QRUB 3SDAD 3RVXC 3KNBA 2ZKHL 4YBHA 4W9ZA 4N90E 4PGJA 2WVSA 5CEXA 1SJMA 4PGDB 4QF1B 4X6EA 2AANA 3D39B 4GUPA 1IT9H 1U8IA 2QQNL 2QPEB 4PUBL 3DMMD 3O3EB 3O6FB 4DVBB 3GSRB 1IIKA 2B7DT 5AW4B 4K07A 5L6YL 2ZOWA 2OM5A 4Z7OE 1BQHA 4QRRB 3J8F7 1O9VA 2VLRD 3ARQA 4WO4D 4Q2ZB 4N2DA 3KYNB 3VACA 4PWIA 1N8OE 4X4ZA 3IDGB 4PS4L 3U0WH 3DKHA 5JW3H 2JFCA 5DVLA 1IEHA 1HXMA 2A3TA 1PYWA 3FQTA 1G6RB 3CLEH 3QDJB 2AZAA 4TUJB 1F4WL 5KSVA 2YMOA 1O9WA 1AMXA 1XZ0B 2OR9H 4X7TA 3I85A 2B8OT 2KQNA 4MJ5A 4GRLC 1IGFL 3IDYC 4XHJC 1KCSL 1WWBX 4JM2D 4FNTA 3IMTA 4AOFA 2KZKA 3P4OA 1ITCA 3JWNC 2NTFA 4ANKA 1JHTA 4FXGA 1RULH 4JFDB 5IHHA 3U36A 3RIAF 3E6HB 1ETA1 2ICEB 2N0KA 3ELQA 4AV5A 1EHNA 2VXTL 3WFZA 4HUVA 3O8XA 4MAUL 2ATPA 4YXLL 4NXSA 3U7YH 4QYAA 5J1TC 1N70A 3T0EC 3ZE2B 5HHQA 1PQZA 3CH1B 1IC4L 1FNEA 2HFGL 3QZMA 3HNVH 3V5DB 3UBGA 1ZLVH 3NZHL 3LXBA 1MQKL 5F9AC 1EZVY 4HUCA 4GAYB 1JXKA 5HTSA 4OGAC 5DJXB 5F97E 1X5HA 1A0QH 1QLRA 1DLHA 4AQ8C 4XCNA 4S10A 2PXYC 3ZZSA 2NXZC 3L2LA 2VLMD 5HP5A 4UB0L 4WI5A 1LXMA 3VD5A 3RZCD 3T0BA 1XR8A 5JHDB 1AC6A 1L3WA 5DMIL 2IO5A 2CQVA 3X12B 1NIEA 4FZEH 2BSSB 4ZS6C 3WMPA 3ULUH 2AJSL 3QQ4B 4KTGA 5FPIA 3HC0A 1P7KB 3CD4A 2N7BA 1SLWA 3SBWC 4NKDA 3EGDA 5C0IB 5EU7C 4GO8A 4E9RA 1MCWW 1NCCL 4Z78A 5KYUA 4ZMVA 3SPHA 1E7VA 1MCSA 2D7MA 2IANB 1AJ7H 3ARZA 5GGRY 5IJDC 5DYFA 2A9MH 3T65A 4GW4B 4IRSA 2R4SH 3ZT5A 3W9DB 3VU2A 1NLBL 5F96L 1UJTA 5GZNC 2XZAH 4Y2DA 4FYRA 1D6VL 1HESA 4IBTA 4AJVA 2YD1A 3D3VA 4CGUB 5IFJB 1S7SB 4L8DB 2EEAA 4HUXB 4Q4EA 4JQXA 3OKEB 5C08B 3CVHB 4ZXBC 3FB5A 5IBLC 2Y7OA 1LHZA 1I3GH 2DM3A 3EOBA 5EO1A 1YNTB 5B7FA 1CXKA 4JFFB 2IMMA 4ETQB 3DYOA 4Y4HC 3VFNA 4U1GC 5D7SL 4ECNA 1EV2E 5BQ7A 4MNGE 1XGUA 3UAFA 1INEH 1I8KB 3B7SA 3VXME 2GJZA 2ATKB 2YZ8A 1NEPA 4QPEA 3KS0J 3SD5A 4WI2A 2BP8B 3VH8A 3HAEH 5HPMA 3B3IA 4UQCA 5AZ2H 5AVXB 5EU5B 4Z3HA 1K8IB 4CN1A 4GMSH 3IXAB 1JNLL 5IQ9A 1JHKH 1SPDA 1UXSA 4G6JH 3WY4A 4HAFA 1AP2A 5D1QD 3EG9B 1AR1D 1WEJL 3TWCL 2VMEA 2VJXA 3ASOB 4BFNA 1OF2A 4YGVB 5FO9B 5GZOD 3V8OA 2DYSB 3VXRE 3L5XL 1NEUA 4OR1A 4X4ME 3VDBA 2NZ1A 4DN3H 3ZDWA 4L29B 2BP5M 2RFXA 1MPAH 3QFGA 5I1CL 5E2WH 1MI5D 2CR3A 4ZD3L 1NCOA 4JDEA 3IAGC 5FLVA 2NYYD 1OPGL 5G5DA 5TD4A 5J89A 1BQLL 4QXVA 3II3A 4LEOB 5DA0B 3DROB 3FH8A 4U7KA 4NNYA 1C08B 3B9EA 2CRZA 2H47C 2X12A 3NDYE 1OSYA 2CGYA 5CINL 4C4BA 2DZEA 3QDMB 3RGVB 1BLNA 2H1LM 1CLOL 4UUJA 1CIDA 3ASNB 1GMIA 2E4FA 5E4EB 3TONA 2DPKA 3QUYB 4F33A 4PS8A 3EZ8A 4PR5A 4YHPA 1NFKA 4X98B 5F93C 2IDSA 4BRJA 5FHAL 4NZUH 3MCKB 3MUGA 5BVPL 4WTZG 4AENB 3D5OF 2WMPB 4HCIA 1ES0A 3NIDB 3T6XA 2OS7A 3UP1A 3GO1H 4TSBL 1XF2B 4D7PA 2QR0A 3T0DA 2X5PA 4JG0H 2J71A 4RFNB 4U1JB 2MHAA 4X4YB 5I1DB 3KYMB 4PG2A 1CN4A 1V3LA 3TPUB 4PB0L 1I1FB 2R0KH 4PJAA 4UIMB 2JK5A 4QRFA 5EH1A 2HG0A 3I3BA 4QO1B 2YFNA 4BDVA 2OSXA 5GS1C 3B34A 2VXQA 3QQDB 2UXGA 3SDXF 1SMOA 3T08A 3PJLA 2ZYHA 3JWOH 4Z0BH 4UDTA 4UZGA 1XF3B 2IPTH 5DVKA 1JFHA 3BOVA 2CG9X 1N26A 3CZJA 1UFUA 1GOHA 2EIMB 4BSVA 2F8IA 3QULA 1OP3K 4IBVA 3V4VH 4Z7IA 4NZFA 1ZT1A 1J48A 5ITBH 3DRQA 1BVNP 4P5MB 5J3HD 2ZCLL 4OGYL 3QQ9D 1QNZL 5J11B 2E9BA 1NQBA 2M8XA 4QY8B 3ULVF 1LMIA 2WCPA 4BXSV 5JUEH 4YDVA 5K9JH 3MOAL 2GY5A 3L7FB 5FB8B 3HS0A 4YJZL 5F3HB 3S35X 2YD0A 5FYLE 3VD4A 4HD5A 2VWEE 4YC2C 1IX2A 5CCJA 3MCLH 3RX7A 1BM7A 3FO0L 2NCMA 1MRCH 1P2CA 1LNUA 4NQQA 3ETTA 3V0VB 1ZXKA 4LFHD 3ZJAA 1CGUA 4JY4A 3RI5F 1WBXA 2GTWA 4NQCE 4YHIA 1MKFA 4HS3A 1P7QA 1LWRA 5DK2B 1CFSA 1SXAA 3FCUB 1PZAA 4LPUA 5CMAB 4G8FB 4NKQB 2BP0B 3AGWA 3TPKA 2EDEA 3CDZB 4UQDA 1DEDA 1GGBL 2HB0A 4BE5A 2DEYX 3SE9L 1U8HA 2XA8L 3NRFA 2ZYRA 4M3HA 4JKPL 3WS3A 5IHZB 3SE4C 4IGBA 1NSNH 2ZKWA 3ZKQD 2UY7B 3LZQA 3BLKA 1YJDL 3GK8L 4PREB 1N5YL 1I8LA 2GY7B 5E1AB 4DCQA 3MNZB 1AKJD 4WDIA 4K9EH 4ODUA 4PWJA 4MNQD 5DT1L 2QHRL 3KJ6L 3MPCA 1I9IL 1PVHA 4MXVF 4WCYL 2COVD 2UY6B 4EZLA 3N1GC 1QRND 3JT2A 2GC4C 3KEDA 4MDJB 4G3YL 4TYUA 5D2NC 3PAYA 5B3SB 4B96A 3MV8B 4K5LA 4OF6A 4XH2A 3RVWC 1I3VA 2B59B 1A66A 2MCPL 4M6MH 1ZT4A 3MBXH 5A7EA 3LN5A 1LEIA 4YFLF 4LRNL 3UTQB 4NQEB 3TVMC 3UJIL 3DETD 3NYKA 3RX5A 4FLRA 4F27A 1YPZF 1VFOA 4DTGL 2MNJB 2GSIB 3TM6A 1RZJH 3SKOB 1PY9A 1OTUD 2XZQL 4GRWH 5BOZG 1U3HB 4IDJL 1J1PH 3GM8A 3HC4H 2D7TH 3OKMA 1CBVL 4QYOA 3MXWH 5DJDB 2KLSA 1AZNA 1D2OA 1PG7W 1T22B 3EFFB 1HHKA 2FJHA 3GS7A 3WDHA 4KQ3L 1NGPL 4ABVA 4OSUL 1GOFA 2AJXH 4NJAL 1BSIA 3CC1A 3HI5L 3O2VH 2IGTA 4QXWA 4NNXA 4O9HL 5EF2A 5KVFH 3CXHK 2UUDK 1DJGA 3TEXA 4NYLB 4R4BA 3HE6D 4UQIM 2BSEA 4Y7MA 5D71L 5MEQA 4WFGD 3DMMA 4LPXA 1G0XA 5I1KL 2FHBA 4JW3A 1I1AC 3ZDXF 1A6ZB 4M6OL 5ILTH 4BFBD 2P8LB 3D69A 3ZUNC 2ADYA 1XR9B 2VLRA 3FZUC 1RK1A 4TPRL 3P0VH 1N2RA 3BRFA 2YAFA 3ET9F 3RFZC 1NCWL 1Z9NA 5SWSD 3PU7A 4FNPA 4CBZA 2H6UA 3VFMB 4JQIA 3MXVL 3D2UD 3PQYE 5B1JC 3ZXAC 1W72A 3I74A 5C86A 1HILB 4G7VH 4XCFH 2Y24A 3PF2A 2XV6B 1GRWA 1EA9C 4PV1C 4LAQL 2FT7A 3KE0A 4NQVA 5D9SA 4AQ1B 4LQFH 2HJFB 4QRQA 4YHOL 4OJDH 4EN3C 3C08H 4NN7B 3G08A 1G6VK 3CZSA 3EDKA 1KXVC 4CVZA 2VDLL 5DJAB 1XF4B 2MEJB 1MSPA 3MV11 4JM2A 3VM7A 3T2NH 4FQHA 3IRZA 3FQWA 1XSOA 4G8GD 1X7QA 2AI0L 1T1XB 1MJ7L 1A2YA 4QUOA 1D3CA 5DHYA 2EDLA 1RKRA 4NNPH 5IB5B 2ZUQC 1WWCA 4JFYB 2ISDA 3BMWA 3ZMRA 2NYKA 5TFSL 1JD9A 4Y2OA 2VITA 4BQCA 2OTUA 3TN0C 4IHOA 1XEUA 2A77H 3K74B 1V7ML 4L5FH 3M17B 3DVGB 4E36A 4WEBL 3QIUB 2ZX6A 5EEXA 2YD6A 3CDFA 2FLBT 3TO4B 1X5AA 4HJIA 5CWSA 3V79C 3QJFA 3FTGB 3D48R 43CAA 4I18A 4DKFH 5I1AA 4B95C 1GC1C 3FUNA 5LGJA 1KYOJ 4DF9A 4AEEA 1D7CA 3PXHA 1X5ZA 2K78A 3F3HA 1W0VB 1CDIA 2Q86B 5KSBB 1C12A 3LKNA 4TMPA 5INDA 2AK4E 1N8ZB 1TZIB 4J3SA 3GEWB 3P2BA 3SDDC 3LZRA 5IIEA 4JHZA 1W0WA 4PJGF 3UPRB 2L4OA 3WFDL 4A2LA 4Y7OC 2R23B 5ACZA 1NUNB 3NIGB 3TH2T 4FFYA 1KIQA 2OXGB 1A7BA 3BN9D 4N0FB 4ODVH 3GBMH 2HFFB 4FCHA 4GQ9H 4Y5VA 4NJ9H 4PMFA 1JVOA 4A7VA 2K6ZA 3UEQA 5E8DH 4NKOB 3FJTA 3DXAD 3QG7L 3SY6A 4JPVL 1CFQA 3ETBJ 1M6OA 3BKJL 2LU4A 3W2DH 5KVGH 3O6FC 2C9SA 5DZJA 3RE0A 3P73B 3GLZA 2VN4A 1MWAH 3AITA 2VJ8A 4LSSH 4JY6B 3IDMA 2PTVA 3T77A 2B1AL 4PGCA 4KMTL 3N0PB 4NUJB 2LE9A 3NSXA 4IRZA 4TKWA 4LVOB 1UVQA 4HZLA 2SODB 1FO0L 1CJYA 3CFBB 3ZDYE 1GAFL 3QEQE 3TYFA 3ARTA 1RJZB 1MHHA 3WNPA 4CDHA 2P8MB 3OF6D 1U95A 3Q1EA 4HKJB 1QSFD 2OSYA 3FCGA 4CILA 1F4XL 3RWDA 5HYSB 2WJ5A 2Y5QA 1CGXA 3R06A 1ZT7A 2ZQKA 5EBLB 3N3EA 1VENA 3UC0L 1RHFA 5ESAA 2CJUH 1NBZB 1CURA 5HGBB 2PYFA 1TT6A 3O41A 3ASWA 4B9JA 5GGTL 3GB7A 3MRGB 2E59A 4JM0A 2OFQA 1Z0MA 2ICEC 3BGMA 3EYQD 2LAGB 2Q5BA 4JS7A 3SE8L 8PAZA 1S7UB 2E6JA 3B2UD 4JFWA 4XBGA 1HCVA 5D1QA 1NCDL 1G5AA 4MHHG 5AAWC 2YPLE 1T83A 1NEZB 2J7LA 1QQDA 4GSDH 4N5UA 4WNSA 2BVYA 3VJ6A 3X11A 2DWEB 2QGBA 3NDZE 4JO1L 1J8HD 5GZOA 4FYQA 4G6FD 1CB4A 4LOFA 1NTDA 1CDUA 1WCBA 5E2VH 1JSYA 4OJEH 3S97C 1R5WA 4XPBH 3CZGA 4K2UL 5L4MA 4YLCA 1KBGH 2N3JA 3BJ91 4GG8A 4NUGH 2MRYA 4CAGA 1DN2A 1MI5A 4KKAC 1IAOB 1ZHBB 5G4NA 1S3KL 1TU2B 3FB6A 1MFVA 2CM6A 4QWWD 4CL7A 3KPRB 5DUPH 2R1YB 4XODA 3DSFH 3O4LD 4N20A 3CVBA 4P07A 1IEBB 2IXQA 1DVFD 2V9UA 1FLTX 2CHNA 3ZPDA 2ZXGA 1KELH 3C2AH 1XGTA 4I0KA 2EDMA 4X6DA 1WC7A 1ZA3A 4KK8C 1A9BB 1F6AB 4G8IB 1MFUA 1PF3A 1TG8A 2VDMB 4B27A 1FYTA 1ICTA 3MRJB 1MEXH 3CDYA 3OG6B 2Q6WA 3V0JA 4MZIA 4MD0B 5F7AA 4PBVC 1GGCL 2W92A 1E0OB 5E2TL 3EFDL 2D3NA 5M94B 3W82A 1M1XB 1CGYA 3QC6X 4ZPVB 1Z3GH 1A7PL 3C5JA 4XMKL 2OL3H 2WBWB 1CFVL 3KYOA 4P8QA 2Q8BH 3U7WL 2R69L 2D7QA 5MI0C 1TZOA 3KPOB 3MRPA 5DWUH 4O02H 4BA0A 1LE9B 2BWDA 1FL5A 1XEDA 3GINA 3HR5A 1ZS8A 2RACA 4OZFH 4P9MH 4WU7B 1JWMB 3FMGL 5AVRB 1ZV2A 4I0CC 2XV2A 1JZHA 3FAXA 1LP9F 3L3GB 3NFSH 1NIDA 4OM1L 3QEGL 4HF5L 1WP6A 3ZO0A 2J44A 4ZUSB 3WN5C 4L4JA 2OMYA 4IK6A 2ZXAA 3ORJA 1MCJA 3C2SA 3MRCA 1EJ8A 1W9XA 5IJKC 2O61A 4DNLA 3RIAK 2FK9A 1UYWL 3Q13A 4BH7A 1DQJA 4RFEB 4ODHH 5CO1A 4PJHE 2WYHA 4MMXC 4ZMAT 2BDNL 1BVKB 2ZWLT 5CP3A 1BJ1J 1WBZB 3GTTA 3WLBB 1QFUL 5KSAA 4WY7H 2DLEA 2NY4C 3SJVD 2XA3A 1QZNA 4FQQA 4NDMA 5GISL 4CKVX 3ISRA 4X5WA 2R9HD 3ZYJA 4JN2A 4K71B 5F89A 4LDCA 1VGEL 5EU4B 3S3BB 4D0DB 1J1OH 2EINB 2DQMA 5ALBH 4X6CE 2WK2A 3GSWB 2ETWA 5I18H 4PJEB 4HQQH 4PJXA 3MRBB 4S0HA 3L95A 3ES6A 3GRWH 1JGLL 3MKGA 4TVPD 2YO3A 4F7CA 3R19A 4FI7A 5EIQA 3D05A 2ZWKA 3GTNA 5JOPE 4LCIH 3PNWB 3X2QB 2GAZA 2AJ3B 4WUUD 2DJSA 1AS7A 3RGVC 3QPQC 4FRWA 3ILDA 4ANXA 5JXAH 3CN0A 1ORQA 5KYYB 4IRJB 1JV2B 1T5XA 2M1KA 2FH6A 3NMEA 4P2QD 5BS0B 4IKLA 1FDLH 3VI4F 4QTHB 3H0TB 2FQFA 1AKJA 1P53A 1E2VA 3F7YB 4KDWA 4MXWH 1HQ4B 1SBSL 2DJUA 2WBKA 5IVNA 5DEGA 5ISZE 4NBZB 1N67A 2YSSB 5BQDA 4HUWA 1D5ZB 4P5TB 5IVXE 5JHAA 2D7OA 1DJYA 3IJEB 2MCMA 1QRNA 4R90H 4RFNC 4AEFA 3T4YA 3FONB 3PGDA 5ABAA 5BMFL 3DVNB 3IJ9A 3FQNA 1U42A 3EO1B 5D96B 1UQSB 3LMJH 3F7QA 1OGPA 3QT2A 4Z7UF 2ZCZA 1CXIA 1AIFB 4QT5A 1H0DB 1IFRA 2QT6A 4D7BA 3DO7A 1C5BL 4BKTC 5HGAA 1CLCA 3BHBA 3KPNA 2ZAHA 5E9DD 5GJTL 4DEPC 3ML8A 1E6OL 1GZHA 5B21A 2HLAB 2JJSA 4L8BA 1RMFL 2IALB 2NNFA 4TTDC 2N7AA 4Z0XA 2JQAA 1ZLSH 2OLDA 4JO3L 4YUEL 2NNRA 5ID0B 3VI3E 4CJ1A 1BAFL 2N4IA 1SYVA 4LLQA 3L2MA 5DRXA 3HLAA 3PDGA 3V5HB 1QYGH 3OBAA 4I9WE 5D7KE 4RAHA 3M8OL 3NIFE 2EC8A 2PWHA 4NKMB 1XD0A 3UTTA 2HTLC 3KXFE 2APBA 1H6FA 3QJHB 4JPQA 4NUQA 3AZUA 5J11C 3UX9B 2QGDA 1RCYA 4N6QA 3ML9A 3GJEA 2F7OA 2XTJD 5LBGA 2KC0A 5GS0H 1F13A 4GFTB 4R6UA 3BVTA 1WWAX 2CM5A 3FCTB 3HE6A 2UWEE 1KIRA 4X42A 4L1TA 5F7NC 5I1GH 2WTOA 5E99L 4CBPA 3WIHA 2QFPA 2VLJB 4NRXB 3VTAA 2NY3B 4IMLB 2Q3AA 3TZVA 3FT1A 3DYMA 2WQAA 3C6LA 1JXFA 1LEKB 3UYOD 5KS9E 5IWLA 1E9OA 4Z18A 5I8EB 5SWSA 5IOKA 4OTXH 1JMXA 3E80A 4MA1B 3GI9H 3OSVA 4U6VL 5K1NA 2EVGA 4N90D 2RGSA 5HGDA 1MIML 4M7LT 2A9NH 2C3HA 3T5WA 3PP4H 2XCMC 3ROLA 1PG7H 3UAJD 5L9DH 2JCCB 1Q1JL 4L1DA 4A7UA 5CBEB 1TSHA 2ED7A 3QJVB 1GC1L 4S11A 5FXCH 1EO7A 3VWKD 4H8VA 4AVIA 4KFZC 3ERXA 3U25A 3QDHA 1JPEA 2Y5TA 2XN2A 5E70A 3KCPB 3CHQA 4G8GA 4KDVA 4M62L 4OCXH 5D6CB 2BIOA 3BKCL 2R2BA 2G2RA 3TV8A 5LGKA 2H6OA 2X87A 4A2EA 4ZMLA 1JZEA 4H26A 3QXTA 2G75A 2Y2YA 1MLBB 2ADIB 4AMXA 2CBOA 4UOW1 1OB0A 1NCNA 3ILEA 3HPLA 1K8DA 4AG4L 4DN4H 3BYYA 3OKDA 3BZ5A 4KKNA 3WUWB 5DWPA 3F62A 3LKRB 1XIWB 1KJ3H 3AREB 4A7TA 1P4BH 4MJIE 1T1YB 1FZOB 4L3EE 5B39G 5DGRA 3WHXA 2GSGA 5JPNB 4UV7H 2R8SH 1YEJL 4JEGB 2OJEB 2X4PA 4RCAA 5DMGD 1WS8A 2GK0A 3S4SA 2HKFL 4Q6KA 3SDCA 3JVGC 3SY0B 3WLWC 5MENB 2XKNB 1WZLA 2W80C 3I75B 5F7DA 1HHHA 1U3HC 4IIZA 1JZIA 4DP9X 3KW7A 4UNTA 1A6PA 2JLPA 2ENQA 1UT2A 1IL1A 2HX7A 1IVTA 3LRLA 3OAWA 4OLZL 4P3CL 1ZLWK 3MJWA 1JGVL 2QQNH 1G6RL 2AXFB 3UGEA 1HWGB 3CXFA 1FPTL 2C1PA 1ECYA 3FXIC 2R29L 3DUUA 4UZSA 3RBSA 5EBWA 5IM7B 2J6EL 4EIBA 1T21B 1D2PA 2GBTA 3BWZA 1P84J 3VE0B 4LCWB 1WIPA 3HC2A 2XWBB 3G5YB 4ZZKA 4WWKB 2YQGA 3Q06A 1OWRM 4UBDC 2VMFA 4GKSB 5FO2A 1NWOA 4ZJ9A 3IDIA 3ZYOA 1A4JA 2GITA 2IH1B 2OV0A 3MGTB 2NXYB 4FLQA 2Z92A 3RI5K 1U33A 5FGRA 3CQPA 4XXDA 3FU3A 2JI1A 1F4WH 3V0GA 1DQTA 1XH3A 3D1MC 3F6LA 5CJ5A 2B5IC 3KPMA 3KPTA 1EGJH 1OAXL 3ZOAA 1IGFH 2WXNA 2EVJA 1XGYL 5FFGA 1QEWA 4RMRA 4M5YL 4F5CA 5JO5A 4KUCF 4WFEE 4AQ1C 2BVPA 2H5UA 2EEBA 3OF6A 2F58H 1UWFA 4NO5B 2XFXA 3GRBA 3MJ9L 4NN7C 2X1XR 5FC9A 3CZLA 4EDXA 3ROOB 2Q0ZX 2BH0A 2VXTH 3QB7C 1U8JB 4EKXA 2VT0A 4MAUH 1DUZA 4XX1G 3OGCB 4WZ9A 5DYOB 4PV9B 2WWMD 5D5MA 5DURB 1WAAE 3L4ZA 1IC4H 4KPHL 4U1KA 1YMME 5J6GB 3HG3A 1PKQA 2HFGH 1ZEAL 5KVGE 3NZHH 4C56E 4B9GA 1BYOA 1LK2A 4P3DB 5KJ7E 1U92B 4Q97A 1M2VA 3V5KA 3QIUC 4MYPA 2ZPKL 1AG6A 2ZIDA 2CDGA 3P9MA 4X9HA 1BVLA 3TCLB 2CPCA 1SY6A 4UM9D 3V6OC 4NO3B 3GMOA 1AFVH 1QTYT 4GQRA 1DYZA 5GSVA 3P2DA 1AQHA 3VFRA 5DVPA 1YEGL 4UQBA 4U3HA 1CICB 2O6EA 2AJYL 2NT0A 2WBJB 3FFCB 1FZMB 1T20B 1X5JA 3SOBL 4ELMA 2ZAIA 3OKKA 4UT9L 4MS8D 5GRJL 2MH4A 4Z7NF 4X8CA 4LE8A 4HFUL 4NAJA 5SV3A 4JZNA 2FO1A 1DVFA 2C9XA 1AQDA 3NJLA 4PTTA 3CVHL 1TYJA 3VRJB 2KYIA 4GW5B 4KKQA 2APSA 2VDPB 3VXRD 4JRYB 3G6DL 4K3JH 5HYJB 4HEPG 3MHZA 3LPWA 1DQDH 4AKQA 2R4RH 1BZ7B 2EJ1A 3CG8A 3U2SA 4NQUA 4ATTA 1A1NB 2XYBA 5HY9B 1YN7A 4QRPE 1RJYA 1OSPH 4IBQA 2P5EB 2XNAA 2C9VA 1XF1A 2EDQA 3Q7JA 4UMGA 1JZ6A 3U30C 5DVOA 4KXDA 2BSRA 1KLFB 1C5DB 1UM5L 3BPOB 4UAOB 4OLVL 2EIBA 1BOYA 1V3MA 1ZWIB 2WCSA 3L9YA 4U3CA 1MW3A 3NCCB 1U8LA 3EDDA 3VFTA 3VYOA 3TH4T 2HT3C 1J5CA 4L8CB 2JJTC 1ZHKB 1DDTA 1S5HA 1QKZL 5FYKU 1PLGL 2NLJB 1SDDB 4WI4A 3RY6A 2ARWA 5TJWK 5HGHA 3FHAA 1XSKA 1RZQA 5D7LD 2DYPB 1JNNL 4NPYA 4XP5L 3VYPA 1E4KC 2E5EA 5E6RB 5KJRL 3BPNB 4DKAA 3UBFA 4HSAC 1RLWA 1E3FA 4BSJA 4J4PD 4OB5L 2EYRA 2H1PL 5AKVA 3HMXA 3K2UL 5FV2A 5KYXA 3IFPA 4G6KL 4Z7WE 3NJVA 1K2DA 1WEJH 3TWCH 2DQ6A 4XGZA 1L9SA 3QI9D 1V8HA 4P2RE 2BWQA 2FBJL 1XGPB 4LEXL 4LCCC 2IEPA 1CFNB 4MAYB 1KB5H 3WTYA 1MFCL 4YEFA 5I66B 5DEFB 5EFIA 5C07E 3K3QA 4YMPA 1HZLA 5AB2A 1G7LA 2MKWA 3G6AB 1JUFA 1IAKA 3MACL 5E4AA 5I1CH 2VE6B 1IGCL 3KNBB 3SJVA 1O6TA 2AXJA 5CEXB 4X6EB 5C1MB 1C1EL 3GMMA 1OPGH 3ILQC 4WWNA 4I0PA 1BQLH 2FCBA 4GUPB 2KUTA 4U4IA 1U8IB 4X5LA 5D7IE 3TCTA 2YXFA 1A3LL 4X9GA 4PJIF 1OE1A 2HYMA 5AW9B 5CINH 1BZ8A 3KGTA 2HFEA 4K7PY 4MCMA 4HUNB 1BQHB 1MW1A 1KCVL 2QADD 1CLOH 4PJCA 3D0LA 1G43A 4Q9QL 1AVAA 1VFUA 3O6KH 4WU5A 5AW0B 2Y7MA 3SCMA 5A40E 5FYLD 5C0BA 5FHAH 1E5ZA 4WUUA 5HYFA 1IMHC 5HHOE 1Q72L 5BVPH 1HXMB 1PYWB 5AFAA 1N0XL 1UH2A 3FQTB 5MEPA 3K4DA 1D5IL 5AVWB 4MVBD 2FJUB 4ZTPL 1MCFA 5KSVB 5JIDA 1OW0A 2QMKA 4X7TB 5EMYA 2OI9B 4MJ5B 2X4SA 1AD9A 5FUCC 4FXTA 1P0SE 4ZBJA 4NQCD 1KYDA 3P4OB 4PBXA 4C47A 1J18A 3VRLE 2NTFB 1R34A 1KWGA 1JHTB 2YXWA 5FOBA 2NNAA 4PIBA 3U36B 1GOGA 4HUVB 1IEAA 5LG6A 4KHTL 3O8XB 2Z6FA 1F56A 1QFWM 3K6OA 3K1KC 2ATPB 3A24A 2CO7A 3WGVB 1C9SA 4JFOA 5EZPA 5I19H 1PQZB 2ITCA 3C6SA 5F7YC 1FNEB 1NCAL 4N0UA 2GG1A 4PYGA 1A4AA 3VG9B 5E9DA 5FYJU 5FW6A 2BFVL 3DX2A 5JXED 3NJMA 3TBSA 3U9UA 5FAAA 5LXGH 1DLHB 4YHKL 1F90L 1L0XA 2XI9A 4XCNB 5IP4A 5CCGE 2P80D 1MXDA 2ZNXA 4OGYH 1JWSA 3U0TA 1IGJA 1XL6A 4KK6D 5I1EL 4PJDE 3WNIA 3MOAH 3S5YA 1XR8B 1EVTC 1FC2D 2F54E 1ZD6A 2E9WA 2F7PA 4A37A 5J9PA 4MLIA 4I1PA 2KBGA 3X3FH 3OJMB 4JR9L 1H19A 2XG4A 2CR6A 4HIPA 2PW1A 4KI5E 3UTSE 1KGCE 2EE6A 3HC0B 1AZCA 2P47B 3RKPA 3WKQA 1EXUA 3T6ZA 1CLZH 4CC4A 4NKDB 4OJFL 1F86A 3EGDB 1E6JL 4Z78B 5KYUB 4IBYA 2EEDA 3WELA 4ERSH 3LNDA 5D2LB 1E2ZA 1AGBA 3DARA 3NEOA 4NZJA 4K71C 2PCFA 3FQXA 4B0MB 3VB8A 5C2UB 3T65B 5LUMA 4S0TD 1DJSA 4TQ8A 3RTLA 2ROXA 4FEIA 1QFOA 2DIBA 2XA8H 2V2XA 1TYEB 4QAWA 4ZUTA 3GMNA 4Y2DB 3G7TA 1HHJA 1QHQA 4JPIA 5B8CA 1AZUA 5EN3A 3TEZA 1YJDH 1IILE 1AC0A 3D3VB 3ZDZE 1N5YH 2J8UF 4AIXA 5E95B 3FB5B 4GW1A 4HWBA 3LRMA 3WS6C 2X88A 3VWKA 1NMAL 3EOBB 5EO1B 3U4AA 1TQVA 1E4JA 2VDRB 4XE5B 5DT1H 2IBZY 4IRJC 2QHRH 3KJ6H 4HHGA 1R0AL 5ANHA 3VFNB 1OQXA 4OAWA 3A4AA 4OF7A 3L4CA 2GFBA 2BOLA 4HBCH 5DQDL 3VXPA 5BQ7B 5LBVA 1A6VL 4J12A 1XGUB 2VZ1A 1RUPH 1Z5LA 3VMNA 2GJZB 2VXSL 4EE2A 3SGJC 1SGKA 2MCPH 3HVNA 2AKRB 5HDWA 3VH8B 5BNXD 5HPMB 1OP4A 4IMKA 3B3IB 2K7QA 4P5TC 4LRNH 4BK5A 4ETYA 1KLUB 5FGBA 4HOWA 5IQ9B 5JR1L 1DQLH 4YDIL 3WIIH 3ZTJH 3I02A 4ZW5A 1UXSB 1AP2B 2I69A 2DOCA 1GL4B 4FEMA 3FFDA 4LSTH 5B1KA 3VFWA 5E1HB 1KXHA 2E75C 5J4MA 1CD8A 5ICXA 1OF2B 1PZ2A 3QE5A 4IDJH 2H0EA 1L7IH 1SLXA 1S5IL 1GSMA 3QWRD 1CBVH 3QXDA 3BMVA 4HKZA 2Q9OA 4OLEA 2RFXB 1TETH 4KQ3H 4ZW3A 4OSUH 2MPVA 1Z1WA 4NJAH 4JDEB 3TBYA 4ISVA 3MLTA 2WLLA 3AUWB 2IWKA 5G5DB 4AIZA 5AYUL 3BUIA 3TWYA 4NNYB 1CLYL 2PMZA 1AD0A 5D71H 5AZUA 3JWNH 2XN0A 1EZUA 1YN6A 1BLNB 5BZZA 3TEWA 2BCMA 4UUJB 3RWGA 2UZXA 3QUGA 3MNMA 1JGUL 4FKEA 2HRPL 3S5ZA 4EBQL 4OT1L 4PJAF 4F33B 4FULA 4PLKD 4PR5B 3QIWD 1I9RL 5AYQA 1RURL 2CA4A 1NCWH 4DFHA 1TF4A 3MXVH 3L3JA 4RSVA 3GXTA 1ES0B 2NY3C 3S8GB 5CFHA 5J12B 5BRZD 4PLJD 3E8UL 1L5GA 4J3OC 4KDTC 1UOVA 2YXVA 4ZO6A 2QR0B 2BRQA 3I2CH 2MHAB 4TNVK 1YEIL 4KTDH 4MA1C 4XN8A 2LU5A 4Z6AT 5GGUA 5SWZE 3TTSA 4PJAB 4S2SA 2JK5B 3NJJA 2R0LH 2O30A 5HJ3B 2GEQA 3EH5B 4BDVB 2EE9A 4QTIL 1RK7A 3Q8BA 1RXLA 2AI0H 3T4AA 3LRHA 2YKLL 3BXNA 5IB1A 3VM5A 4QHUA 4ZS6D 3BZ4A 2F5AL 2AMGA 1GJIA 3IETA 4G1EA 1RZPA 3N1FC 4PYHA 1P5VA 1RZIA 3Q43A 2J1WA 2ZUVA 4UDTB 2ESVE 4FFZA 4MSWA 1HL9A 1LWHA 5JTWA 2XT1B 2MQ3A 1RU9L 3W56A 1FCGA 4WEBH 5HDQL 1OCOB 3BQUD 3QCVL 4R4NC 5I5IA 4BSVB 3QULB 1S6NA 3QEQD 3VX0A 2F0CA 3KLHD 1ZT1B 2XTLA 4LVNC 3DRQB 5H37H 3W0WE 4MWFA 1BF5A 3HG4A 4FTDA 2FD6L 9PCYA 5CILL 4YDVB 1XIWC 3AREC 1SOXA 4MNGA 4OLWH 3HS0B 4W9IC 3IT8D 4UM9A 5KYNA 3VXMA 4W9CC 1W91A 3TP4A 3WKML 2X4RA 3CBJB 3HG1E 2BSDA 2O5XH 5I0WA 3TCXA 3WFDH 2FWSA 4H25A 1ADQA 5IBLD 4DPRA 1P2CB 2PPFA 1LNUB 2FECI 4MB1A 4GLRI 4HAKA 3R8BB 1QAWA 4HC1A 4OFKA 5A3IC 2GIMA 3MRNA 3H2PA 4JY4B 4HEME 5EZIL 5AZEH 1WBXB 5IW3A 2GTWB 2YPLD 1CLVA 4MHHI 1X4XA 4YHIB 2F19L 3EYVA 1P7QB 2DQJL 4HS3B 1CFSB 4Q9CA 1U2YA 2WNGA 4X5QA 3QG7H 4JPVH 3VGBA 5AVTB 3BKJH 3VXRA 4C58B 3WEXA 3K4AA 2KZBA 1U8HB 3JUZA 1RP9A 2IAMA 5CGTA 3WS3B 3CIAA 1XCTA 4ZZFA 4IGBB 1JTTA 2P42B 3VU1A 2VR3A 2CDEA 3NABL 1X4ZA 5F21B 3VD2A 1XDTT 4WWKC 3P4NA 5K5YA 3ZKNC 4U7MA 3UTZA 4DCQB 4PPTA 4WDIB 4ODUB 4DEWA 3FYIB 4PJ9C 4P3WA 5FX3A 1HZHL 4F7EA 3Q8AA 2XOTA 1AE6H 2VDKH 3K2MC 4UYQA 1EVUA 3D4ZA 1U4EA 1F4XH 4XH2B 2YA0A 4DVRL 2IMNA 2PYEE 4QOKE 1ZT4B 4GB9A 4K5OA 4UV4L 3LN5B 3UC0H 2ORBL 3P0YH 1LEIB 1KLGA 4K73A 1FNSH 5GGTH 2ZAGA 2NW3A 4GOSA 3COOA 1E3ZA 4V1DE 5EUKA 4LK4A 3SE8H 1HWHB 3AQZA 4J4PA 4K55A 2G60L 5EF3A 1MFDH 1ONQA 1AS8A 3ZE1E 1NCDH 4B97A 1SLVA 1HN1A 3CZFA 1A22B 3QI9A 5E5LA 1FNAA 2WNKA 4ABQA 2DH2A 4J2QA 3OKMB 1GTNA 2H3KA 4PY8J 1MG2C 3PHOA 4QYOB 1CDJA 2DKUA 5TDPA 3IVKA 1HHKB 2FJHB 1M3JA 4G1MA 2GI7A 2X3CA 3I6GA 4LCUA 4HT1L 4L1BA 4ODBD 3LB6C 1N64H 1WQVT 3B4NA 4NNXB 1OY3B 2DLIA 3NGBB 3ZUCA 2VDML 1MY7A 1S3KH 5LNGA 3NCMA 4BCXA 5I6OA 2WIIA 1ZDSA 4R4BB 3VQMA 4G9DA 3N5AA 4E9YA 5H4YA 5MEQB 3DMMB 2DBLL 2QZ5A 5EU6B 1NLDH 3QQ3A 2WBJC 1RV6X 4X83A 3D69B 3MROA 2NX5D 2VLRB 1Q8MA 2V5TA 4IIQA 3G5XA 3M6DA 1RK1B 2A1WL 5E2UH 3V95A 1N2RB 1PFCA 3UP6A 3WENA 2Y6SC 2ZNWA 3QO0A 2JH2A 3V2AR 5EA0L 4QHMA 2MTPA 2CGZA 2HWZL 1W72B 2HJKA 3IYLW 4PWKA 1OGTA 4KK5D 1BG1A 4OQTA 4NQVB 5D9SB 1G7MA 1S2EA 3VG0L 1GGCH 3PXJA 4QRQB 3M88A 4S1DD 5E2TH 3E3QE 3B8SA 1LQBC 3QZPA 5H94A 2N59A 1QP1A 4FXLA 1V7NL 3G08B 4M43L 4NP9A 1ACZA 1FNFA 2E0PA 3BO8A 4CVZB 4JM2B 4NOFA 1A7PH 2YD9A 3HJEA 4NQCA 4AI7A 2H0PA 1CFVH 4FQHB 3FQWB 3SPCA 4BCYA 4PRPD 5EUOE 3FSZA 2R69H 3V9FA 1HX0A 4RLDA 3BPOC 1A2YB 5JOPD 2DIJA 3EO0A 4UAOC 5HBBA 2IOOA 2C9AA 5HYSG 2VXUL 4RMSA 3M45A 1FSKB 1E8ZA 3HHSA 4Y2OB 1CUOA 2VITB 2LVEA 2OTUB 2ENSA 1DQIA 1F58L 2BS71 4IHOB 1MY5A 3QEGH 4HF5H 2KLRA 4K5PA 3H2QA 2VQTA 3ZLQC 4WK2B 5CWSB 3QJFB 43CAB 3WTTA 4HJUA 5GJSL 4I18B 4BQ8A 3V10A 1S9WA 1MZZA 5I1AB 3UTOA 4NERA 5JXEA 3QR2A 4EIUA 4XR8C 3BPNC 2IBGA 5LGJB 2V4LA 4UTAA 2X05A 1NOAA 3A67L 3EJZD 1OARH 5E8PA 1C12B 2BDNH 3LKNB 5INDB 5IIEB 3IMVA 2F08A 4LKCA 4X0KA 5IR1A 1W0WB 1JPTH 4LOEA 1QFUH 2XX1A 4LSQL 5ACZB 4MAYC 1JRHH 3C9NA 3UJJL 5GISH 1HJCA 3EH2A 1KIQB 1VGEH 4D3CL 5AWNL 4YZFF 2VSMB 1OAYH 3EOYG 4NUPA 1TVHA 4Y5VB 1F8TL 2VSKB 4BZ1A 1UZ6F 3NTCH 5CEZL 1CFQB 1JE6A 1KXTA 1M6OB 4IEFA 1Y18A 3IU4L 3EJCA 3GSVA 1G7JA 1DL7H 4W4OA 3FRUA 1HHIA 4GEIA 3KXFD 2V6HA 3VDCA 2IV9A 3IDMB 3T77B 4PGCB 1UCTA 4KRPD 3U48A 2C1OA 1A9EA 3N06B 4P5SA 3U46A 1KF9B 1UVQB 1NAKH 4PJ8D 4HZLB 2DTMH 4AUJA 2XWRA 2KH2B 1NANI 3TYFB 1IAIL 3T3PE 1MHHB 1XCQA 3W39A 2EYSA 3HCVA 3OAYK 1YHPA 3C8KA 4HW6A 3GDBA 4HFWA 4PJ5E 1UOKA 3RWDB 3KPLA 2XZZA 2OI9C 2ITEA 2JKIS 3R06B 1ZT7B 1NINA 2C8NA 2JLLA 1JI1A 4Q6YA 5J5EA 5HVFB 4JG1L 5IOPA 3B9VA 3D2TA 3V6BR 2WLNA 5ESAB 2V2WA 3PQYA 4U6HA 2PYFB 2V8LA 3O41B 2VYRE 4FXGC 1TUPA 4MBOA 3GB7B 1I8UA 4CRPA 3IS0X 3EBGA 4KZ0A 2P52A 1W6LA 3RLSA 1DE4A 3VCLA 4EDWH 1S9VB 1YAIA 3BGMB 3N40F 3ZE0B 3O8XC 3FOLB 1T7WA 5GJTH 3UEZA 3HMWH 4XBGB 3RPIA 4QNPF 3AG1B 5D1QB 5I0YA 1RMFH 1U8NA 1NDMA 1XV8A 2D2CC 4DGIH 1QQDB 5GGSA 1P1VA 2B1HH 3VJ6B 3X11B 2VZ3A 3VG9C 3US1A 4ZSOE 1WCBB 4KJWD 4YDJA 1EXHA 1G9HA 1R5WB 2BXZA 1HEZA 2LLLA 5J6HA 3NJHA 1KBBA 2Q3ZA 4GG8B 1HK6A 1MI5B 1PMYA 3FU9A 4N0CC 3SQBA 1YO4A 2VZVA 4HWEH 2C5DC 1QFWL 4MRCA 3P02A 3CZUB 1U0QA 2IXQB 4L3ED 4WNQA 3BGFB 1E4HA 1SNRA 1DBKL 3ZKSD 4JGNA 3VSVA 5E99H 1XGTB 3T0VA 5DZOA 5HXMA 1FIEA 5LBSL 4X6DB 1WC7B 1ZA3B 4Y8DC 4YSOA 3H7BA 3QIWA 1BD2E 2AK4A 2W91A 3ZL2A 3U6XS 3TA3D 2GB2A 3DC0A 1FYTB 5T3ZL 2Q6WB 1ZANL 3F7PC 4Q0XL 4IRSC 3S96A 3LXAA 1CF8H 2IDTA 4L4TE 1MIMH 3BAKA 4WLCA 5K9QG 2BIIA 1ACYH 4F2EA 3CU1A 4YHML 4H1LB 4NZDA 4Y2DC 3SE3A 1J8KA 1OCWH 5FA3A 3C5JB 1OM3L 3KYOB 5FM5O 4RMTA 3SDDD 4PJ7E 4TQEL 1JFQL 3V6FA 4JQXC 4M62H 3BKCH 3MRPB 3AY4A 1FL5B 3HR5B 4RWYH 1ZS8B 1VADA 1ZCRA 3TESA 5BCAA 1X3DA 2WLYA 3OHXA 3UBHA 3TT3L 2G9HA 4ZOEA 3EH3B 3VTTA 3MJGX 2OMYB 3MRCB 3EGSA 2EKJA 3D39D 3BQUA 4MCZA 2O61B 4L0ZA 1EO8H 2FGZA 1TMCB 3QEQA 3O6FD 3T0EE 4BH7B 1DQJB 3MRFA 3RAJH 1YEJH 2VZSA 4QRRD 3V6ZA 1D5BA 2Z93A 3T6WA 4TLSA 2NTSP 5KSAB 1HJBC 2X4OA 4FN0A 4AY0A 4LLYA 4QXUL 2FWOA 3KPPA 3CSYA 4FQQB 4NDMB 3WIFA 4X5WB 3OR7A 1YMMD 4JN2B 3QJXA 1ZTMA 5F89B 4AJ0A 1KFAH 2FE0A 3RIKA 4GKOA 4C56D 2V33A 1M05A 1JGVH 1BZEA 4R83A 2WVTA 4WJ5A 5GGQL 3CSFA 4XOCA 2R29H 5GS2H 2J6EH 2YPLA 1SXZA 4Y9BA 4PJXB 3L95B 3ES6B 1OAUL 2P4AB 4F7CB 5J1SC 2QHLA 3QXAA 5K59E 1QLEB 4JFHD 4J3OG 4JFDD 2GAZB 1KT2A 4NT6A 2F5BH 3C87A 5BW7A 1M7DB 3AM8C 3BAJA 4LKXA 2CO6A 3R4RA 5CFAA 4LIQL 1UZ8B 2ADJA 1F42A 3OWEA 3D87B 1ORQB 4NM4L 3S3SA 4G72B 1T5XB 2AQ3A 3MRRA 1F18A 3CFJA 5HYIA 5FW8A 1AKJB 5AW3B 3D51A 2VC2B 2PW2A 3I9PA 2F7IA 4YLQT 5GSRA 1TJGH 4JRFA 1V5JA 1A4KA 1A4BA 1MG3C 2DL9A 4M5YH 5DEGB 5FV1L 3WGUB 5D1XE 5TQ0L 4HUWB 3HAEA 3V52L 2W59A 2ZCKH 1I3UA 1MRFH 1QRNB 4G5ZL 4GAJL 2YKKA 3T4YB 1JZFA 3PGDB 2X7LA 5CM1A 2C9PA 3FQNB 4XNMA 4PRHE 4AW7A 4ZFOA 2OR8A 1MUJA 2DEXX 1BQUA 3PRZA 4QT5B 5EZJA 5JHDD 3DO7B 5CGYC 2ZWSA 5HGAB 1ZGLM 4U0RB 3BHBB 5DFTA 3LPFA 4K7PH 1UM4H 1SQ2N 2YGOA 3KPNB 5E2JA 4MJHA 3BWAA 3WUWG 4R3SA 1ZEAH 1JGDA 2ZCHL 4L8BB 3RKDC 3PGFH 1CGSL 5CS7A 4Z0XB 5ESQA 1SOKA 3UC2A 2QPFA 3GYRA 3PJSA 1F2QA 4NC1C 1PG7X 1SYVB 2B4CC 4LLQB 1EHLL 2XDHA 2XXGA 2DL2A 3GXPA 4WWPA 5DRXB 3HLAB 4FA8A 1QLFA 3WKNA 1FL6A 4WW2F 1VFAA 3IMWA 7FABL 4DERA 3UTTB 4N2FA 4HGWA 2APXA 4YXHL 2B20A 5BO1L 3GJEB 2PF6A 4G42A 3GHPA 2Y1YA 2FB4L 3HS0C 2TSBA 3UMNA 4UT9H 3IK2A 3UG3A 3HE6B 4IOSD 3MA9H 3OMAB 1KIRB 5C08D 5TE6H 1GY2A 2X9ZA 4P2RD 1R3IL 5IJBC 4PRAA 2VW4A 3DOHA 2QSQA 3ARRA 4PJHA 4F2FA 4JFFD 3TZVB 2TRHA 1GVIA 3G6DH 3KPSE 3C6LB 5C07D 3AADB 4PW3A 5D72L 1QOKA 4ACTA 1E9OB 5I15L 2J5LC 2OK0L 5SWSB 4OFVA 4ORZC 3L3IB 4YZWA 4F2MB 3K8MA 3SEPA 2KDYA 3CSBA 2FSEA 2V3FA 3LN4B 5CZVH 5HGDB 1ERNA 1E5YA 1U30A 3ROLB 4FJYA 1PJ9A 1GTFA 3CZKA 3B8YA 3K6SA 1JBJA 1UM5H 3L1OL 3L17A 4IGBC 3HE7A 4OLVH 3BKYL 3HPJA 5GGVY 1PY4A 2Y5TB 4XNUH 5FCSH 3CSTA 1I8LC 3D8MA 4G8GB 1A8ZA 5KN5A 3QORD 3V0DA 1VGKA 2G2RB 3S2CA 2H3NA 2P3YA 2YGNA 4N8VA 1JZ3A 1EZSA 4H26B 4PJ6A 1PLGH 2G75B 2WXQA 1HVXA 3BT2H 4FTVE 4OCLC 5DS1A 5HHOD 5IMOA 4BWWA 1MCOH 3HPLB 2FYYA 3V4VA 3WFBH 1K8DB 4XP5H 4ABUA 2E47A 4PS3A 3WFEH 4LDOB 4K3EH 3OKDB 2C9QA 3MSPA 4OFYD 3GJFA 5HHVH 5ADPL 1HNGA 3U6RA 5A2IH 2D0FA 4OB5H 4DUWA 1DFXA 2BIHA 3BIAX 2ZG3A 3RBGA 4DJMA 4G6KH 4B9YA 3WHXB 2GSGB 3FQ1A 3A4FA 2FX8L 3EF4A 2R1WA 2E4TA 3QXWA 5E24E 2FBJH 4WHYH 1Q9KA 5IVXA 1AOHA 2X4PB 1GIGH 1IKOP 2GK0B 1MFCH 3QUYD 3S4SB 2WWOA 4HHAA 5AW7B 3SDCB 4EMZA 2BZ7A 3L48A 3UADA 5LN8A 5F7DB 5FKPA 4ZW8A 5JORA 1HHHB 3WD5L 3MACH 3AWGA 4Z7QF 3DTDA 2ZKYA 1IL1B 1KEMH 2Z91A 3A3YB 4ZQTA 1C1EH 5T5NF 4KFMA 4MA8L 4YHZH 5FR3A 4H0GA 1A3LH 4YDMA 3JV5A 4YK4C 1AGDA 2C1PB 2HSIA 3ZW3A 3DUUB 5IW1A 4LPWA 4GXUN 5EBWB 3RWFA 3OKYA 2R56H 3VI3A 4BHUI 4Y0GA 2G2PA 3B2VH 3FPYA 1TMQA 3DMMC 2F54D 2ZE0A 1X9LA 4EO5A 5IHUH 2UXVA 4DK3A 1YEWA 3IDIB 4TVSa 2JXMA 3KXFA 4UI2A 4BBWA 1A4JB 2GITB 1Q72H 4IU3A 2CIKA 2Z92B 1KGCD 1N0XH 1OLLA 1PPIA 4WO4C 4Y16D 3U9PL 4KQ4H 3WV0A 3D06A 2Q7AA 3IN2A 2ZP8A 4XXDB 4ELDA 3H3PL 3OAUH 1CZ8L 4XP4H 3OPUA 5B7EA 1HEJC 1XH3B 3PNRB 4PJ8A 1MJ8L 2UWEA 2OMUA 3KPMB 1G5GA 2WC7A 5EZOH 5K39A 3GSXA 1QEWB 2NSMA 3HNSL 4PRNA 1GYWA 4D0BB 1NCUA 5JO5B 3MLYL 2LW3A 5B39A 12E8L 1Y7VA 1Y6KR 3JWDL 4V2CB 4TV3A 2BVPB 4UTBL 1BMWA 4XWOD 2EECA 1FGNH 4URTB 1A64A 3A6CL 4W9FC 2XFXB 4EDXB 5KS9A 1I7UA 4JM2C 1N18A 1CD1A 3CCHA 2Y1AA 4OH2A 1JJUA 1DUZB 1OO2A 3DK2A 3UPCA 4AK2A 3SGKA 3FH5A 5D5MB 1U3ZA 1MFMA 4N28A 4RESB 3T04D 5D2NE 1CXFA 1NCAH 1PKQB 1FE8L 3MNVA 1KYOK 1HL5A 1LK2B 1FSKC 3INUL 3SHSA 1TNNA 4HOXA 1SHXA 3V5KB 3FDWA 4JJHA 5J06A 4WUKL 3P9MB 4LHQB 2CDGB 4DZBB 4M8RA 1D5XA 3ULVH 4G6FB 4X9BA 2YD3A 2F61A 4I18C 1ET5A 3GMOB 4XP1L 1DVZA 2BC4A 4UQ2A 5GSVB 3NSCA 4ZG1A 3VFRB 3FW6A 2GHZA 4QEGA 1SEBA 1GHFL 3AB0B 1MOEA 4MCYA 3PWLA 4HCRA 1ZHNA 1WE5A 1VRSA 3OKKB 4ELMB 1IBFA 3S36L 4OZIE 2VDNB 3RZCC 4UNIA 4PD4J 5DD0L 4OJFH 4BUGA 2ARJQ 3HRZC 1TQBC 4JZNB 4MJIA 4L3EA 1E6JH 1YA5A 1DVFB 2UYLA 4PTTB 2COQA 4FD0A 3D0VA 3GHEH 4DK6A 1BQHG 3RQ3A 4PN6A 3V0EA 2G3ZA 3ZTNH 4BH8A 1HFUA 2DDQH 5E7BA 2QLVB 4Y5VC 1B0WA 1T5KA 1U3NA 4AC2A 3U2SB 3MV8D 4GRMA 2VIRA 3T3MB 4CADA 3F7KA 3G6JE 1YN7B 5DVNA 1KYUA 4TNFA 1RJYB 5CHNA 3VXSE 1BQKA 2O6FA 2XNAB 5HD8D 5J56B 4P2AA 4A7GA 2BSRB 3P11H 3TF7C 1KPVA 2QDWA 4ZX3A 2EC9U 5JPMC 1BDYA 2VJ0A 1KCRH 1RIHL 1SHWA 1UWYA 2DBJA 4WAFA 4LNRA 2H26A 3BVUA 4U1SA 2RA1A 2ADFH 1YYCA 2DMHA 2Y3AA 1U8LB 4GY4A 1IGIL 2MCAA 3VFTB 2WUBL 1KB9K 1S5HB 5DQDH 4RMUA 1HCYA 5C7XH 2I26N 4UNVA 4ZNEE 5HGHB 2B9AA 1ASOA 2GK2A 4MXQD 3NCBB 4AL8H 2V5RA 4YS4A 4NPYB 1MCNA 2SEBA 2NDFA 1LK3L 5CN1A 6PCYA 2R7EB 2IFFL 1KYFA 4GFXA 4YQXH 1BVZA 1TITA 1KGIA 2ZOUA 5EOCH 5JR1H 1KBPA 2EYRB 4POYA 5KYXB 3IFPB 5DS8A 3UCRA 1K2DB 5SWZD 2ZOTA 4JHVA 4XGZB 4UBDD 5JNYA 1LO2L 3MFFA 1OB1A 2NMSA 4GJTB 3UGUA 4RVBA 1S5IH 2F8XC 4WGWB 2CR0A 5EFIB 4U6TA 1G7LB 5D1QC 5KJ4A 1AR1C 1JUFB 1IAKB 1IQDA 1UB5A 2EDFA 3RA7L 1B4JL 1IFHL 4KNTA 4M5ZL 3SJVB 1JNHA 3QAZB 5GZOC 5KYWB 3GMMB 1WAAA 5DLMH 3J2PA 1E50A 4I0PB 5AYUH 3DECA 1YMMA 1U8CA 1WTGT 4M1CD 2LT9A 1R3KA 2X2JA 4LCYB 1Q0YL 4JGJA 4C56A 1YVLA 3A21A 1ASPA 2HFEB 4ES9A 3S3PA 2BVUA 2MQCA 1XSIA 1X5YA 3CTTA 1JERA 4HA1A 4KGLA 2NYYC 4PJCB 3GIZL 1E90A 1MCCA 5C09E 3W0WD 5FDWA 2BIPA 1IQWH 2HRPH 4P5RA 5E7FA 2DW5A 4OT1H 4HLZH 3MV7E 4KROD 4WU5B 1TPXC 5CUSH 5AVVB 3SCMB 4P4KA 1BVOA 4XNZB 5C0BB 4JG9A 4ZOCA 4WUUB 3ZT7A 3HG1D 2OBGA 4BE6A 3R7RA 2VXQL 3MUZ1 5T1LD 3QRGL 2CPUA 4WI6A 4WI0A 2GQHA 5MEPB 1DBBH 4U1LA 5CXPA 5F0MB 3BSZH 4NBXB 2WXJA 1XD1A 4JKLA 4UILH 3NJNA 2M2DA 5L8KB 2X4SB 3MUUA 1AD9B 1MCIA 2B4CL 1Z2KA 3LH9A 3M1CA 1YEIH 3PE9A 1M4KA 2OP4H 3SODB 1F2XK 4I3GA 3H42L 4ATWA 1WT5C 3QEHA 3EOAA 2B0SL 5FOBB 2APFA 5DRZA 1GXEA 1DBMH 1X5IA 2NNAB 3LH2H 4S1QL 1XCXA 4N24A 1ET8A 4KZEH 1IEAB 3DVFA 1CE1L 3GBNL 4OZHF 3ECWA 5F7UA 2J21A 5C9KA 2XQ0A 1EFXD 3ZQ9A 2CO7B 2IGLA 1EBPA 3HEIB 2XWXA 4M48L 4JFOB 3KBEA 4AMKH 2ITCB 3C6SB 2WLZA 4N0UB 2HUEA 5CLYA 1RU9H 5KANI 5ECGA 5HDQH 1QHPA 3WY3A 1FWXA 5E9DB 1MF2L 3AG3B 3QCVH 5JQIB 1RVFL 1BYPA 1KOAA 4QRTB 5JW4R 3TBSB 4KVCH 3U9UB 1ZE3C 2I7SA 2E9GA 2Z7YA 2BFGA 1NPUA 1VPOL 4Y1SA 4UOW0 4A2HA 1JWSB 2DQIH 1NCGA 5F9JA 4TM9A 2QGEA 3FSWA 3GMQA 3S34H 1LQSR 3U0TB 1IGJB 2DLGA 3LEXB 3TF4A 3Q1SH 4QXGL 5CILH 5T3XH 5D70L 4C83A 2PYED 5TE4L 3RNQB 1F6LL 4JFEE 4EUPH 2XLLA 2L7EA 1DCEA 5J9PB 1U21A 4LLVA 3WKMH 5J3HC 1E43A 4GI9A 2C3VA 2PW1B 3CSGA 3US9A 1XBDA 2OZ4A 2Z8SA 1EXUB 1LO4H 3RILA 5L8JB 4C59B 3CH8A 4R26L 3NEEA 1SUJA 4IOSA 5IFJA 1ET7A 4Z7WA 1AGBB 5BZXA 3WJJC 1A7RL 5HI3C 3EOTL 4P2RA 5BOJA 2PCFB 1XSJA 1INDL 2EIKB 3FQXB 2DJ4A 1JPST 1KTBA 4YVUA 3AGVA 1SVBA 5AL8A 4DGYL 2CSPA 4OCRL 4ETQA 5C3IA 1CTNA 5C07A 2V2XB 2DH3A 4ZUTB 1ZK5A 5MEOA 1HHJB 2WB1A 1MCPL 4JPIB 4DP0X 1LVEA 5B8CB 1KTKE 4OZGF 1G7HA 3B5GA 3NABH 5TE7H 3K46A 5D7IA 4GW1B 2VW6A 4NUMA 4XRCA 1MNNA 3DRTA 1FN4A 4O02A 3ILPA 4XXWA 1E8WA 3VWKB 4CVWA 4N2HA 4Z7OB 4OZFA 1V3KA 2W9LA 4ANUA 3WDJA 1HZHH 3KZ8A 1G7PA 2XKUA 1K72A 4OAWB 4AZUA 5JOEA 1L9QA 4BHUA 2GFBB 3VXPB 4ALAC 3QORA 1IM9A 1Z5LB 2Y07L 3H3KA 4DVRH 4ZRGA 4MKMA 5EIIG 2E27L 5HHOA 4A39A 4K8RH 2ORBH 4OGZA 1XBRA 3U7AA 2F53E 5FWQA 2DLFL 3U83A 1UD4A 3MJ7A 5JA9A 5JQ6L 3BZEA 3I02B 4OFYA 1WO2A 5CU5A 2NY1D 1HNFA 4E2OA 2G60H 1VACA 3FFDB 2E76C 1MDTA 2TSAA 3FSVA 3FU0A 3VFWB 5L0QC 5ICXB 3SGDH 3WTXA 3DETC 2P5WE 4NPJA 2Z65C 1GZHC 3BWUF 1B3IA 2P1YA 1S9YA 2JJSC 5MHSE 3QXDB 4HKZB 4LMQE 4CDGC 3MRMA 3NOIA 1OTUC 2XQBL 4CUCA 3BAWA 3TBYB 1FORL 4ISVB 3MLTB 2WLLB 4JDZA 4DPAX 2ZXDA 2V8MA 5DJCA 3ARSA 3B7RL 4AIZB 1GPOH 4JQIL 4NENA 4ZTOL 3GRWA 1W72L 4X4KA 5FGCE 1AD0B 1NWPA 3VGGA 1K6QL 1RAMA 3MU3A 4YHYB 2Z34A 4DOHE 1YN6B 2F15A 3LNIA 5SWQA 4XBPA 3RWGB 2UZXB 4XVOA 3ZY7A 2A9CA 2DI8A 4JBSA 4Y4FD 5IMLA 1CDBA 1JF6A 2FTAA 1P5UB 4G71B 4L37A 3UGXA 5A2CA 3HE6C 1TEFA 4PJDA 5L7XL 5FM5M 3UZVA 4GMTL 2A6IA 2F54A 4U1NA 3OXRA 4ADIA 1CVRA 2QQKH 4JFZL 1HL4A 5CD5D 3L3JB 3FU8A 3WJMA 4Z3TA 2NY0B 3ZHLA 3UTSA 4XNDA 3TZVC 4YHLL 2RH0A 3M7FB 1L5GB 4Y16A 5GS3A 3CSPA 1J87A 1DLFL 3BE1L 3EYUH 3VG0H 3MRKA 5IWLC 2VO5A 3HC3L 1O7DE 4JPKH 1V7NH 1HXKA 5E8EA 5GGUB 5KVDH 2RAMA 4S2SB 1B4LA 1U93B 1YEEL 5C6WH 5I1HH 2VH5L 4HIHB 2E9JA 2OX5A 4MA3A 1JZJA 3N44F 4W9HC 4R4FH 3T4AB 1E5CA 3BXNB 5IB1B 2N0MA 5IBTL 4P57A 4QHUB 3BZ4B 3CAFA 3DGDA 3MN8A 3IETB 4G1EB 3UH8A 2D4FA 2ENJA 4XBMA 1P5VB 1RZIB 4MSWB 3BRGC 4FS0A 4CC0A 3MGOB 4FABH 2Z31A 4OIIH 1TOXA 1FIGL 1TJXA 3IFNL 4HJ1A 4LSPL 3FO2A 1LM8V 3UZEA 4FFYL 1YAZA 4LHUD 2J8HA 3A0OA 1ULVA 3A47A 1JF1A 3BKML 3C5XA 3R18A 1NPNA 4L0PB 4MWFB 4CGTA 3E6FA 4FLSA 4MNGB 4UM9B 3RVTD 3VXMB 1VZGA 5E23A 2NNXA 1UUNA 2H0FA 5TK2A 1GYVA 3UBXA 2X4RB 1JVKA 4CNIA 4H25B 5DJ6A 4LSQH 3HVDA 1Q94A 2HH0L 2VN5A 2BK8A 2YSTA 1Q9OA 3ARGD 4HIEA 4F37F 4ZMZA 4B5ZA 3FTZA 5B38B 3SDCC 3BH8A 1DQML 5I73C 5F70A 3MRNB 5IUCA 1P84K 4IRZL 5CZRA 5ANME 3Q8CA 1F3RB 3T1WA 3SDXE 3EYVB 1FNLA 4L9LA 2BIMA 3DTUB 5GRZA 2BLFA 3O6LL 4RGOL 3LQAL 5CEZH 1HOCB 1IGML 5I1LA 3VXRB 3WEXB 1NDGA 3BN9C 4P5TD 3E8VA 4RH4A 4BK4A 5IHLB 2IAMB 4OFDA 1PSKL 2QQLL 2WGXA 3FBKA 4UT6L 1XCTB 2PLTA 4ZX6A 1MCRA 1QFHA 1GS7A 3ME0A 2CDEB 2DQGH 3BFQG 1IC5H 3QNYA 2X1WL 4FQLL 2QEJA 3B9DA 4HJJL 3S3DB 1TTRA 3QARA 3UTQA 3UTZB 3S88L 3ULVE 1HKFA 3HN3A 4HJGA 4ZO7A 3AT8A 4N2NA 4Q8BA 1TO5A 4F7EB 1IAIH 3SZ6A 3P4MA 3NPSB 4UTCA 5ID1A 1E3XA 5DD5L 2X0UA 1BD2D 5LHDA 2YIHA 4CJ0A 3KPQA 4R0LA 1JZ4A 5GGRA 1EDHA 3LRSA 4I77H 4BSWA 2UXTA 2VLKE 1KLGB 3GFUA 3QRBA 3L5IA 3LRGA 4GG6F 1J86A 3X1FA 5J13B 1OALA 1G9ML 2P8PA 2JKRM 2NW3B 4M7JL 4R96A 2XUWA 5TDNB 5EUKB 4A2MA 9CGTA 1N0LA 1WLHA 1OZTG 1ONQB 2AQPA 4FQ2L 1IVLA 5CZXC 5SWZA 1SYSA 4G6ML 3CZFB 2XQYA 3QI9B 4L8SA 1AGFA 1H5BC 1E4XH 4P48A 3EYQC 3PHOB 4JM4L 5C0AE 2ZWZA 5IT2H 3CVCA 2NY3D 2P8LA 1JAEA 1I1CA 3B2UC 1KCKA 4G1MB 3NBNA 2X6VA 3CQQA 3I6GB 4TSCH 1GZPA 1P6WA 1JYWA 5ES4B 5SX5K 1ZTXE 1T89C 1BGXL 5F1IA 5FUOH 2ESVA 5I6PA 4DFIA 4F57L 4U2YA 1U8KA 4QRBA 1UWEL 4XPTL 4D2NA 4PGZA 1QR4A 2WIIB 4LAJH 4G9DB 4MXVE 1HDMA 2ZOLA 3EBHA 4HD9A 4XP9L 1QR1A 3IKCA 3QQ3B 2QKIA 2ZG1A 4HCGA 1MRDH 2YFOA 1BMGA 3NEXA 3W0WA 3MROB 3HNTL 4QWWC 4O5LH 4IIQB 3G5XB 2WIMA 2GW5A 2W0LA 4GIAA 3TOPA 3QO0B 1DVFC 1BEXA 1EAPA 4QHMB 1YPZE 3CJJA 1MXGA 1EGJA 3HG1A 2N7SA 2HJKB 5T1LA 1OGTB 5T3ZH 1J8RA 1ZANH 1ZSHA 2DTSA 3K7UA 4GAFB 2VOTA 1OT1A 1G7MB 4GBXD 1YEFL 1COBA 4F15B 4HSQA 2Y6TE 5H94B 5JMOC 3BO8B 4HEMA 3VXOA 4GSQA 2WOBA 2ZXWB 3FT9A 1DFBH 1R3HA 4NQCB 1OM3H 4JDVA 2FUTA 1J12A 3RB5A 4JANA 3EO0B 1YEHL 4X8JA 1ZGLP 3GZKA 2IWGA 2QQQA 4F91B 4JRLA 2EH8L 3HHSB 1EFXA 2AVFA 3BI9X 1JV5A 1XXFC 4ZDHA 2Z1PA 5IEHA 1QFWI 3CK0L 3KH3A 1SJVA 3ZDXE 1LO3L 2ZYIA 3RY6C 4X5RA 2Z4QA 1J1XL 1A3RL 2EUXA 3H6AA 4Y5YA 1S9WB 1F4AA 3REWA 5DMKA 5IQ7H 1UGNA 5KG9A 3FKUS 1XGQB 5D1XD 4LP4A 1M71A 5E8PB 3HFML 4UWQB 5T5FA 4PRHD 1KJ2A 2X40A 4LCWD 2IAAC 2PYEA 4MJ2A 5KOMC 4LKCB 4X0KB 5IR1B 1L6ZA 5C2BL 1QLEL 2AEQL 1NKRA 2WY3B 4LOUD 3C9NB 3ZTEA 1A1OA 1KDJA 2UZIH 4X9YA 2NXYD 3TO2A 5GGVH 2NY5C 4EI6A 2WD0A 3VGEA 1J5OL 4RGNE 4YL4A 4FAAB 1TVHB 3QJSB 4FQ1L 2DWXA 5GGQH 1NC4D 3QAZC 4ALAL 5AOKA 4HPOL 2OAAA 2R9HC 2VC2L 1KXTB 4IEFB 3CFNA 1Y18B 3GSVB 3ECVA 4N1EA 3MUY1 1G7JB 2P8MA 5TQ2L 4HPYL 3QRFM 3FRUB 1HHIB 3BUYA 1NA8A 4PWFA 4B50A 3HLKA 1BFSA 3NSFA 3T1FA 4LIQH 1A6TA 1YYMH 2C1OB 3DIFA 1A9EB 3NH7L 3U46B 1K9TA 3Q9QA 4GO9A 4NM4H 2D7NA 1WZ1L 1CL7H 4XN4A 4ABWA 5MP6L 1F00I 1IKNA 2O5YH 1CPUA 3LEYL 4H1LG 4Y5XA 5CP7A 5T3XE 3ARYA 4JGMA 1XCQB 3CIQA 3W39B 5CR8A 2EYSB 2V9QA 2FBOJ 1AHWA 1R24A 3EYSL 2Q3XA 3HCVB 4RQQA 3C8KB 4PJGE 4HFWB 3KPSD 3V52H 3E38A 3KPLB 5J6SA 2XWEA 5GXBB 1E7UA 2VW7A 5EN2A 5IOPB 5AAPA 2V2WB 3PQYB 4HV8B 2Y7QA 4U6HB 5KAQF 4JO4L 1SJHA 4TOYL 2WP3O 4YSQA 1DE4B 3VCLB 5I6XB 1CICD 1DP0A 4OJAA 5IB4A 3FFCD 3K0YA 1KB5A 2IJ0C 4AQEA 2W60A 1JN6A 5HHPB 3RPIB 1P4UA 1U8NB 3Q6FA 4DAGH 1NDMB 4E68A 5AALA 3MLXL 4H5SA 1IEBA 4JCLA 1PNCA 5GGSB 5EUOA 4S1RL 3NZSA 5LCVL 1T2QL 4YDJB 3BDBA 3WIHL 4FG6D 4FTVD 1HEZB 5AD0A 5J6HB 7FABH 1F41A 3WE6A 3CQFA 5L2KE 4KJYB 3BQVA 4YXHH 1MREH 4KX9A 4FQJL 5BO1H 2ZF9A 1WS7A 4KAQL 3SQBB 2VO8A 1QI5A 4H88L 1Z3RA 4R97C 2XN1A 5BZWA 6FABL 4HUUA 2YPVA 4FNLH 3BH9A 3VFUA 4PRDA 4WNQB 1CE6A 1A47A 2X1PA 3VFGL 1A5FL 3ATEA 1R3IH 2XTJC 4NS0A 4X6BA 5HHME 2NSXA 2NQDA 4BFRA 1HNYA 4Y4FA 4NM8L 2BOCA 4UOQA 4CC4C 3QS2A 2D03L 3H7BB 3QIWB 2AK4B 2P24A 4KNUA 5D72H 5I15H 3FQRA 2OK0H 3LPPA 4OVUA 3GLAA 3DV6A 1BXAA 3OAYH 3GS4A 5E1IA 3MR9A 1NH6A 4M7KL 2HJLA 3INOA 2H8PA 3S96B 4Z7VF 3BD4A 3NA4A 2JI3A 4C55A 3AT0A 3SSGA 1GR7A 1RUQL 1NBVL 4F92B 1UATA 4AWJC 5C0CE 4XN9A 3SO3B 4BWUA 3L1OH 2YRLA 1BYNA 4H8QA 5FA3B 4UT7L 2GCYA 2IPUK 5B8CC 4WFHE 4X7SL 5D7JD 4XMLL 3P3TA 2YD4A 1E8XA 3V6FB 3OB0K 4HXBL 1JPSH 3UAJC 3PDOA 1OP5K 3O0RH 3KDMA 2P26A 4ZFFA 4XB8A 1YSOA 5SX4H 4M8UA 3VWKC 3Q2VA 5I2IA 1VADB 3LV3A 3MTRA 4XCYA 3OHXB 2FSDA 5DZPA 5D8JL 3I9AA 1YY9D 2G9HB 4Q14A 4AM0A 3V0WL 3BP7A 3BAXA 3K6NA 4JHAH 4Z95L 5KVEL 4RWHA 3CMOL 3EGSB 3VB9A 2NY7L 3FUJA 2QVMA 1MFEL 3BQUB 3CXDH 4MCZB 5ADPH 3ZDYB 3TFBA 1NGYA 1MWOA 3BVVA 4D0DA 3QEQB 4IMKC 1CO1A 4BK5C 4LHUA 1EEUA 5ACMA 3MRFB 2PPEA 5FGBC 2HKAA 1MELA 2XVKA 1S46A 4PJ5A 3V6ZB 1TQWA 3DX9A 2ZUWA 1D5BB 5DD1L 2Z93B 2JELH 5FS5A 2CRYA 3KWWA 5EO0A 2X4OB 3MFGB 4LLYB 4I88A 2FWOB 3KPPB 3WD5H 3CSYB 1WJ3A 4KV5F 4RX4D 5KVDE 1NCTA 4PGEA 3WIFB 3OR7B 1FAIL 5DMGC 4H7VA 3ARGA 3K4ZA 1M05B 2AABH 3S35L 5AVZB 2G2NA 2E8YA 2OMZA 3G3LA 1UURA 1KGJA 2YPKA 4WJ5B 3QCTL 3NN8A 4A67A 4L3FA 2X9YA 2X44D 2YPLB 3EKCA 3FN0L 5BJTA 1TZHA 2K45A 3WSQL 2NT1A 1A3QA 3P1VA 1LP9E 3F7YA 1I53A 1M1SA 3FHEA 3GZOA 3KGRA 3Q9PA 3QXAB 2ZJSL 3C75A 4ZSOA 3U1SL 5G4MA 2R59A 3SE6A 3L3HA 3ULSA 1S7RA 1KT2B 3MLZH 4NT6B 4YHYC 5ALCL 1NUFA 4LKXB 2C9RA 2CO6B 2Q8AH 3BWUC 3TBTA 2ADJB 3AS3A 5KEZA 4WKZA 3U9PH 2W0FA 3KS0H 3MRRB 3KBPA 3WXWL 3CFJB 3CLFL 2CD0A 5AVYB 1MJ8H 25C8H 2VGLM 5CIPH 2PW2B 3F83A 5GSRB 1A4KB 3RUGF 4X2UA 4JUSA 1FV1A 5HDRA 1JRHI 3HAEB 5LXVA 2BS9A 4UTBH 1BWMA 2C7UA 4E9WA 2X7LB 3EAKA 1S7WA 4ZYKA 4XNMB 1BD2A 4ZFOB 1NM4A 5FYKH 1MUJB 1SY6L 1WHOA 4FQCH 5E6YA 2YLKA 4TNWK 5E6ID 1ORSA 3FCSA 1PAZA 2WXLA 1IBGH 5EZJB 5JHLH 3T4AC 4F8NA 1IZKA 1FNGA 3PPSA 3QJQB 4L4TA 1R46A 1B2WL 3BWAB 5TK4A 1FE8H 4MZ2A 4R3SB 3BYTA 1JGDB 4YSEA 1OF0A 2H32H 5DD3L 2EDBA 1FGVL 5ESQB 2VDNL 2W07A 3DOIA 3PJSB 2WWMC 3P40A 4PJ7A 3CPUA 1QLFB 4JCWA 5SV4A 4HCFA 2F68X 1NMBL 1FL6B 4PJHF 3AW5A 3O6MH 1VFAB 3QUMH 4RA0C 5AOMA 3S4SG 3KH4A 2CZNA 4XP1H 3D4CA 4HGWB 5D4JA 3CFIC 2FEEI 1HOEA 5DI8A 3VI4E 4JN1L 1YUKB 1CDGA 3MYZA 3MJ6A 1L0QA 1L4IA 4G42B 5I8EA 4N9OB 3KGUA 35C8H 2ZICA 32C2A 2FL5A 3D3VD 2Z8VC 4OUUA 3RDTD 5L4FA 5DD0H 4OD1H 4E9XA 3KR3L 2DIAA 1MAML 1Q90A 4XCEB 1DJZA 2DQHL 3W1ZA 4PRAB 5JYLA 4OW6A 5EB9A 4PJHB 1EIBA 4Z7UE 1IAMA 2WXGA 3QZNA 4MS8C 2AQTA 3WTSA 4HMCA 1ASQA 5EO9A 1RK0A 1QTPA 3MI6A 3KMDA 3P77A 4XNYH 3LPOA 1HYSD 1Z9LA 3FF8A 1EJOL 2PXYA 4LLMB 4M93B 2FSEB 5T5NG 5DJ0A 5I71C 2HX8A 2FNBA 4W9LC 1KGWA 3V7AE 4GBXA 3X3GL 1RZGB 3QHZL 5T1KA 3K6SB 4X6CB 2MNWA 3A5VA 3HE7B 2DQEL 1OAKL 1RIHH 3HPJB 3TBWA 3QZBA 3O4OB 1QEXA 3HMXL 2AXHA 1MFBL 5KN5B 1KN2L 2IBZX 1AHMA 4NAQA 2H3NB 4CSSA 1M9SA 1EHXA 3CN2A 4N8VB 4LP8A 7PCYA 4QHLA 3SBWA 1UKQA 2YMTA 4NFDA 4YWGL 1O5PA 2H7WA 1Y6MR 4NQDE 5IMOB 3I50L 4DQOH 2FYYB 3V4VB 2W9EL 2YGPA 3HTLX 3N42F 1KXQE 1T04A 3LCYA 3RL2A 5IF0A 3ZL1A 2WP3T 3APFA 1LK3H 3I9GL 1CTMA 5H37A 2CO1A 2IFFH 3GJFB 1L9TA 2AEOA 2JTDA 3QJUB 2ED9A 2H2PD 3U6RB 4F1ZA 2K3HA 5EWIH 4CSPA 5K69A 4LGSB 5FYJH 5HSFA 3N6YA 2AXFA 2A83A 2FEDD 5ISZB 2R1WB 4AGQA 5D1XA 1Q9KB 5IVXB 2BS8A 4F9PA 2Z7UA 4J4PC 3UXFA 1FYHB 1NDTA 4HHAB 3BVNA 4JHUA 4PRHA 4N2AA 1TVBA 1TQCB 3BAEH 4JL1A 1TJHH 3TEUA 5FKPB 5JORB 1IFHH 3QI9C 1OE3A 1U6AL 4FE9A 1NC2D 2OSWA 3LEVL 2Z91B 3WO4B 2HLFC 4AYEC 2J56A 4YIQA 4UIKL 2A9DA 3VW3H 1KJVA 1AGDB 4G83A 5I6LA 1UEYA 3B43A 3RWFB 4YX2L 1NC4A 3VI3B 2X09A 3LHPL 1RL1A 3QA3A 4FFVD 3IDXL 4NXKA 3GIZH 2XJLA 4OI9A 1T5WA 1OHQA 5AG9A 3VXUE 1GA2A 3NIFB 4XTRD 4F37K 2L8AA 1N12A 1A6WL 3L4XA 5I5JA 1G9NC 2JXMB 3KXFB 5HDBE 4TUKL 3GUTA 4IU3B 5KS9F 2QADC 2YQ2A 2RQEA 1RERA 2CIKB 2N1KA 3QRGH 4IIQC 4WI9A 3PYCA 4AGPA 5LGHL 4PJ8B 2AEPL 4HX1A 1OWWA 2OMUB 2UWEB 4PU2A 1C5CL 5K39B 1KG0A 2ZXQA 2B4CH 3GSXB 3TU6A 4JMXA 5ERWA 2J8OA 3FUFA 3X14A 4UZUA 1J10A 1S9XB 5B39B 4MVBC 5I8KL 2B0SH 4F15C 2AXWA 2DKMA 2ED6A 3KPSA 5EOQL 2CJ3A 4S1QH 3ZHDA 3IJSA 4BIKA 5KS9B 1I7UB 4K3DL 3PWNA 2BSBA 3GBNH 2NZ9D 1F4YH 1CD1B 3CCHB 2EXYD 5DO8A 3S7GA 4K15A 2WJ7A 3NCEB 5C6TH 4U33A 4MBRA 3OLGA 2AF2A 3MNVB 3HG0A 4M5SA 5F1OB 3U6XA 1MF2H 2B77A 5I1IL 1WDAA 2CLVA 5DQ9B 1AHKA 1R3LA 2YJQA 4LIQE 1RFDH 2ZKXA 1D5XB 2FJSA 5D70H 5A6LA 2BC4B 4OD3L 4UQ2B 3B2DC 4FTVA 5JXEC 2WUCL 1UKTA 1SEBB 1WFTA 2XZCH 1ZHLA 1QNIA 4MCYB 2F53D 4J2XA 2ROYA 3PWLB 2XPGA 4KU1A 1ZHNB 3PL6B 4IJ3C 5GS1A 4KK6C 3WNLA 4KK9D 3K6FA 3IMUA 1IGYA 3SKNA 1JGEA 4N3UA 4NWTL 3T2LA 4MJIB 4GS7B 4L3EB 2UYLB 1A1MA 3LOWA 3D0VB 3KYKH 4HWBL 4RZCA 2P5WD 1Z0NA 3EOTH 4MDIA 2A5UA 1INDH 4BH8B 5KVMC 1J0HA 3NCJL 4HS8L 1X5FA 1G0YR 5MHSD 3QR1A 2PR4L 4DGYH 4OCRH 3LS5L 5LVEA 3U79A 3QCUH 4GRMB 1V54B 5E9AA