3GGWA

Crystal structure of fab f22-4 in complex with a carbohydrate-mimetic peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
b'DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSDGITYLYWYLQKPGQSPHLLIYHLSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGIYYCAHNVELPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB F22-4 LIGHT CHAIN
publication title Structural Mimicry of O-Antigen by a Peptide Revealed in a Complex with an Antibody Raised against Shigella flexneri Serotype 2a
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 218
sequence length 218
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ggwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ggwA01
1L7TL 2VIRA 2P5EB 2OJEB 4HGWA 4AT6A 1Q9KA 2A6JB 2ADIA 1NKOA 3EGSA 4AY0A 1ZA3A 4OLVL 1U8KB 1RHFA 3N1PC 4R0LB 4D3CL 4IS6A 5DEFA 2VZSA 2NTFA 4QRRA 4WWKB 4JRXE 5DRXA 3EHBD 2R0ZL 1UG9A 4YHML 1YJDH 2YPVH 3P4NB 5JOFB 2CLVB 3JV4A 5EU7C 4JO4L 4HIXH 5C0IB 5TF1H 2WM0A 5DK2A 3C6LA 4HWNA 4NHUB 3QIWA 3MV8D 4OZFA 4U1KA 1CICA 3QO0B 1KCUH 3UEZA 3L3JA 4OFYD 4FQPA 2NY0B 5CD5D 5E08L 4H26A 5JUEH 2W9EL 1FAIL 3T2NL 4PJ8C 1NJ9B 5DC4B 4JPIB 5T5NG 2YMXH 1VB9A 4HJJH 2WWMC 3TN0C 3EUUA 2OQJB 1GIGL 4JY4B 4HJ0C 3GMNB 1LGVA 3O4LE 1HILA 1MWAL 1X4ZA 1MH5A 3LKNB 3M8OH 4U6YA 1FN4A 3ZE0E 2DIBA 4GUPA 3S3JA 4N8PA 4UDTB 3ZKQD 4HDIB 5DD6A 5EOCL 1UH2A 1M1SA 4HS3B 1OSPH 5JQ6L 2J6EA 4M3JA 3KPOB 1UWXK 5EBLB 2NW3B 2UWEF 1XGRA 3EYSL 1EJ6A 3HAEB 3BKCH 3C5ZD 3MRKA 3FHAA 4O2FB 1QSEA 4PRPE 4TUOB 3D48R 3Q6GL 1V05A 1I3GH 4YWGL 4Y1AE 3IRZA 3OTTA 1ZAGA 2ZNWA 4OM0H 3I6LD 5IOPB 4J8RA 1BQHA 1FNEB 3M45A 5I8EA 3SKOB 1JNHB 4N0UB 3C8KA 1CD9B 3BRGC 1LE5B 3CCHB 1ZWIA 3V6BR 2ITCA 4B41A 1N2RA 4PGCB 1G6RA 3LRGA 3ZL4L 4LBEA 2DI8A 3D3VD 4QXUH 3CLFL 3PWNA 4Z7WF 4ZO8A 2FIKA 2VL4A 3MJ9L 4F7MA 5EO9B 5KJRH 2BZDA 1HHJA 1DBMH 2HMIC 5CEXA 5CLWA 5CBEA 3I84A 4PBWD 5F93C 4PJCA 3N06B 4ODSH 2GQHA 2PXYB 1NCDH 4HUVA 1EHAA 3ARTA 2QSCL 2NY4C 1DN2A 4Y2DA 3N0PB 2I27N 1FRGH 3UJTL 4YPGB 1IGFL 4YXHL 2QTEA 4RNRB 2QADB 1DLHA 5DJDA 3QHZL 1QBBA 3OHXA 3BW9A 4N0YH 1OP3H 1KJMA 2W1NA 3BP6A 4JFPB 2VB5A 3IFNH 1Q8MA 1WCBA 1F11B 3O2VL 3ARWA 3DI2B 4JQVC 5CJQL 3NFPA 1XMWA 1IJ9A 3FFCE 3BH9A 4QGYA 3O45A 3HE7C 4IRSA 1BVZA 3CUPB 3OB8A 5C0RH 1N5YL 4GS7B 5B38B 3LN5A 5IP4A 4ZUWA 3EFDH 4KKLD 5E4IA 5E56A 2B4CC 5EZJA 4R7DA 4U1GB 3VW3L 2C1PA 1ZHLA 4J3TA 2G75A 1CDIA 3W81A 3WFDH 1MFAH 2JJTC 2A77H 4YH6A 1G6VK 3WN5B 3TNMA 1LEGA 3TBYB 4L4VA 4EDXA 5CGTA 5DUBB 4PJ5A 1A7BA 4LSUL 3WO3B 3GBLA 1GPOH 2Y5EA 3FO1A 1YA5A 1A6AB 4E0RA 2DBLL 5LCVL 1MCPL 1J5OL 2CJUL 1G1CA 3OKOA 2VXTH 4JQIL 2E8YA 3OKDA 3CMOH 4PRID 4KK5C 4RFEA 3AS2A 1N8ZA 5J1AA 4M93B 4K71B 4OAWB 4O9HL 4DAGL 5F1SA 2LQRA 1ZS8A 1HXYB 3SJVA 4NRXB 4D9QE 4CGTA 4FNLL 2OR8A 3A6OA 1H3UA 4ZDHA 5EB9A 4JDTL 1KPRB 2KPNA 1FO0L 1CDUA 5GS3A 4AQOA 4PJGB 1BJ8A 1DQJB 5GJTH 4KKAD 4PJIF 4ZNCD 3H6JA 1W0VB 3JWNC 4OCWH 4EN3B 2Y06L 4YNYB 4NGHH 3GK8H 4XXCA 5GGQL 4BK5A 5DXWA 3BP5A 3S35X 2X7LB 4L5FH 3ZDXE 3TV3L 3OKKB 1YY9C 1MEXH 1MFDH 5JPNB 3DRTA 4G5ZL 1EA9C 3JVGC 2IAND 3FFDA 5CP7B 1OSZB 3L3OB 2B1AL 5CILL 3K80A 1QFWI 4HHAB 5EA0L 4IMLA 2V5YA 4MD5A 4O4YH 2AJXL 3VXRE 1QFHA 4DUXA 4WVRA 4X7SL 2MNUA 2G5RA 4OTXH 4MNGB 4P2OC 3K4AA 4JGUA 3UTOA 4U4BA 2FGZA 2XQYK 3CVIH 1AO7E 1S7SB 3UJIL 1FNHA 4EXKA 4JFFE 4P5TD 1J18A 1FZMB 4HFUL 4KJPD 4LCCA 1KENL 1KPUB 2DQDH 2V2TA 1ZLSL 5IVXB 1NQBA 3MUGB 4JPKH 3O8XD 3MFGB 2QV2A 3V6OA 4CN1A 3TP4A 1ZT7A 2L0DA 4ZO9A 1WBZB 2AW2A 1FYTD 3CAFA 3HS0A 1YEEH 3KLAB 3OPZH 2CXGA 4JZOA 5TGBA 4MXVF 2AJYL 3D0LB 1OD9A 3G6DL 3FCTB 3NBNA 2QHLA 4JGMA 2ZCLL 1F00I 4NN7C 1CFSB 1D5BB 5HDQH 1A7QH 2YXFA 1A9EB 1S9WA 5BQ7B 3DMMC 4WJ5B 3L5XH 4AK1A 4JG0H 5ILTL 4YBHA 4NC1E 1BAFH 2X1XR 2XWJB 4ODTL 3FN0H 4XP9L 5TPWH 3TH3T 4JM2F 3O6FD 2V9RA 2FJHA 2Y1VA 1ZGLB 1TJGH 3QUXA 3BXNB 4DOHB 2C4XA 3HC0B 3C2SA 4MJIA 5DK3A 2B4CL 3A6BH 1A5FL 3LCYA 4U7KA 4OI7A 4Y16B 2VLKA 1T7WA 1D5ZA 2F53D 3DRQA 2R15A 3QDGE 5F88B 5BXFA 1RJYB 1I8IA 2YZ1A 5DHVA 5MP6H 5I1AA 4RMQA 1PY9A 3MUZ1 1X5AA 3RI5F 1GGCH 3LS4H 1I9EA 3O9WC 2Q3ZA 1JUFB 3DURA 1FV1B 4XPTL 2F19L 4M6ML 3TVMA 4A6YL 1QA9B 5IJKC 2LU3A 5ESVA 4F7TB 1OTTD 3L3HA 2ADFL 3QR2A 3GMMA 1ORSA 1UB6A 3W9DB 1DN0A 2FBJL 5DR5L 4WUUA 4K07A 3IDIA 1D5IL 2ZCKH 4HZLA 5KVFH 2FL5A 3GM8A 1OAUL 3WFZA 5IK3A 3T0EE 3MRLA 5GGSB 1SQ2N 3U82B 3V0VA 2ZUXA 3GSNH 4I18A 4WHYH 5DVKA 4Z76B 3RP1A 3PNWB 3HLAA 2OX5A 2VERN 3VFWA 1NL0L 2X40A 1IEHA 3RA7H 1FBIL 5KAQG 3PHSA 4MJ4A 2YRLA 5F7DB 4XHQA 2P46B 8CGTA 1T66D 5E2VH 2DQGH 2JLLA 3LKQA 4MSWB 5FYLE 3I6GB 4Y4FA 1AGBB 2EC9U 2DTSA 5DS8A 5I9QB 2VLLB 4UV7H 2H41A 3HE6A 3S3SA 3MFFB 4WO4C 3P0YH 2P5WA 3KYKH 3MV9A 3S6CA 2N56A 5HHOA 5EU5B 4J3OC 3S4SB 2PTVA 5FO8A 2N7AA 4R0LC 4UOW0 4ZYKA 1GGTA 4LSVL 2R2HB 1QSEE 2J8OA 2OP4H 3DVIA 4LSRH 1HEZA 3VXSA 4KVNH 4N0RA 4WWKC 4HAFA 1T4KA 1SJVA 4QHUA 4UI2A 4FQ1L 2DF3A 4JN1L 1FDLH 4MNQA 4M7LH 1S7UB 3WD5L 4LSPH 4AEHL 1Q94A 3WSQH 1NGXB 5IQ9B 2VQUA 2NLJB 3IJSA 5HGHB 5CAYB 3LKPB 1K8IB 1G9NC 2YD6A 1S7VA 2W38A 3CC5A 1N6VA 4CKVX 3RJQB 1JWSA 3SDDD 3MA9L 4RDQF 3HHRB 3GO1L 5EOCJ 4MD0A 4L8BB 1J0HA 1FNSH 5ICXB 3VMPA 3P0GB 3BPCA 2R4SL 4CNIA 2JK5A 3F58H 3QEUA 5ANMB 2AVGA 5JIHA 5ICYB 2IH3A 5HYSB 4KHTH 3D25B 2HH0L 3B8SA 5B39A 3MROA 2CK2A 5D1QA 1OQXA 3CX5K 2A6DA 4PJCE 5IMLB 3T0VA 3CD4A 4O5LL 1RZ8B 4LCYB 1A02N 1CG9B 1IAIL 2GJZA 1SEBB 2I24N 4PJGF 3DV4A 2J88H 4JM2C 5C0CB 2VAJA 4OD1L 3OJVC 3WIHL 3EDKA 2FWOA 1CFVL 3PWPD 4M5YH 4OZFG 3QI9D 4BSWB 3WUWA 1D5MA 3RL2A 4YC2B 4JKWA 3SY0B 5IUSA 4Q9RH 2R69H 5ITBL 4XMPL 5C2BH 1MWAA 5F1NB 3BSZH 1AJ7L 1EAPB 3JWDC 3NGBB 1J8HA 2E5EA 1IC4L 1TQCB 3DXAA 2VUOA 1DBJH 5IFJA 4UU9B 1DANT 1WWWX 2IBZY 4NO2A 4V1DB 1EMTL 4JKLA 4Y4HB 4PTTA 3JUYA 3HMXH 4OSUL 4FFYL 4ZOBA 3WS6A 1HYRC 3QQ9D 4HWBL 5K59F 5T33L 4NKDA 3EFFA 4YFEA 4J3WA 4L4VE 4WGVB 3D18A 4PJ5E 5D7LD 2O5YL 4XCNA 4E5XB 4N90D 1MHHA 3SQBA 2KZWA 2XTJE 1TZIB 1IAOB 5ICZB 3WLBB 2PXYC 4LCIL 4OKVB 4GSDH 3FO9A 1GZPA 1NBZB 4DVBB 1S7XA 5IVXF 4L8SA 2BRRL 1XH3A 2GFBA 3X3FL 1N64L 1UWGH 3LKOB 2CQVA 2QADC 5BW7C 3MGOB 3ARQA 3SJVE 3OG6B 3ARDA 1T1YB 4PB0H 2CGRH 3MJ9A 1N7ML 1BIIA 4E41A 15C8H 1N0XH 1PYWA 4ZXBD 1T83A 5FOBB 2YN3A 4XC1H 2E7MA 3W82A 5D6CB 3O3DB 1GCFA 2KBGA 2GEEA 1NCBH 4N5ED 1M7DB 4GXVH 5FOJA 3SKMA 3V0WL 3D2UA 4FABH 4GS7C 4S1QH 2DWDB 4M7JL 43C9A 3V95A 3U6RB 4K7PX 1C8PA 3GSWA 4K94H 4OQTL 3L6FB 1MIEL 4FTVA 1T21A 3GSOA 4RGOL 3I3DA 3L9RA 1I1RA 2VLRA 5D4QA 5T3XD 1EHLH 5IF0A 1WFOA 4Y19B 4WY7H 3IETA 3VMOA 3WN5C 2X4NA 4K3DH 3T08A 1VSCA 4Q6IB 4JN2A 4G3YL 4RQQB 4BZYA 1OF2A 4E42A 4TSAH 1U8HB 4KRPB 1BFOA 1DQDL 3VFSA 4BUGA 1OGAA 3MJ8A 4Y5VA 1IQWL 1G9NL 3RZCA 5LGHH 3HC4H 4FS0A 4GXUM 1E0OB 4PLNC 5E2TL 5ISZD 3QEHA 3MRMA 1UH4A 3QNYB 1MJ8H 4UILH 5DJ6A 4M93C 4HBQA 4N8VG 1EO8H 4YDLC 2BRQA 1FFOA 3K1KC 5T1KB 3PWJA 4ZD3H 2AEQH 2J3SA 1QSFD 2QQKL 2P8PB 1TCMA 4FQ2H 4XPGH 3EZJB 2A2QT 3VXUA 6FABL 3V6OE 3NCFB 5DSCB 3MRRB 4S1DC 1N0LA 1K6QL 3C09B 5EOTA 2R0KL 2Q86B 2HKFL 1NGZA 3QFDA 4EN3C 3E0GA 1DBAH 4NJ9L 4ZSOB 5KSUA 3VWJA 3RWEA 3L3GB 5JORB 3OXRA 3RUGF 3VWKD 1ZHBA 4ZUVA 4IM8A 3FONB 3HI1A 4U1NB 2XYCA 1Y18B 3VD5A 4DK6A 5E8OB 4U1JA 4POZD 2DMCA 3TN0A 3E2HB 3ZYIA 4KAQL 5T1MA 4WU5A 5F8QC 3CNKA 3T0WA 5E00B 5GS0D 3V2AR 2VDRH 1FO0A 1CF8L 2P24A 3JWDL 2Y25A 4XZUA 3G5XA 4OZIB 1BD2B 3T2PA 4MJIE 3O3AA 1CD0A 1A7OL 3MV01 3OJDB 2NY5C 4U6VH 3D6GA 5ETUA 2VLKE 2I5YL 3O4LD 1MSPA 3FRUB 3QDAA 43CAB 4BUHA 1JPGB 4ZO6A 3WFHA 3FQTA 4JVPA 2NNAA 2XIDA 3G04A 1A1MB 1IKFL 2PO6D 4ERSH 3ILQD 1CLYL 4DKFH 1XF5B 4JFQA 4L4JA 3EKCA 4YQXL 1F3JA 4KPHL 1FPTL 2BVOA 4HFWB 4X6DB 1HE7A 1YEKH 1FG9C 4M61A 2IMMA 5FO9A 5HGAA 4RWYL 5E5UB 2JCCB 3MLZH 4WUUE 2PW2B 1FL3A 3ELAT 2OTUB 3RDTD 1QQDB 3VGHA 1ZA6B 5A3IC 1HH6A 1IT9L 4Y1AD 3KPSA 3OL2A 3QDJB 2XV6B 5EH1A 3ARED 1TJIL 5FGCE 1BGXL 2FEDD 2VC2H 5MEND 3BPNC 1URLA 3DSNA 1RZ7H 2QQNH 1BM3L 1K5NA 5BS0B 1PZ5A 1ZT4A 1EGJA 5SWZE 4X80H 3MZTA 2WUBH 4MA8H 3WXWH 1Q0XL 2BFVL 5SWSD 4ZTOH 4DTGH 2IBGA 4NO3A 1DJSA 2C3GA 1C08A 2AK1L 2NY3D 3GGWA 4NKIL 2YN5A 3P77B 3MLUL 2RCSL 2DWEB 3PL6D 4OIIH 3PQYD 2Q87A 2P5WE 2PCPB 4LHUB 5F9JB 4HIHA 3N85H 1DL7H 3HPJB 1I8MB 1ZSDB 1A6TA 1I1AD 5D70L 1IAIM 3FT2B 3R8QA 4RGNB 3MLXH 3PHOA 1L7IH 3MJGX 4ZPTA 1M05A 3VXSE 3GM0A 1MQKL 4N1EA 5CSGA 2D7NA 3K4DA 4HUXA 2OCFD 2BSTB 1KLFA 4MNQE 4OZ4A 1RZFH 4HIIB 4B50A 4JLRB 4OZFH 3RKDD 4XX1E 5IBTL 3TJEL 4NJAL 5FA4A 1R3IH 3GMLA 3STZA 1B3JA 2HJFA 2J1KA 4NSKA 3BIAX 5I8OH 5DURD 5IW6B 3UPRB 2AV7A 1E4XH 2F8OA 2LVCA 3IDGA 4R2GC 5K9JL 4UTBH 3ABZA 4EUPA 3KXFA 3O6ML 3V6FB 4F7PB 2DLFL 1HHKB 2W9LA 1MHEA 3BE1H 3F7YA 2JJTA 3PGCA 4L8DA 4YZFF 3FFCD 2HJLA 5ALCH 2DQCH 1D9KC 1FIGL 3MLWL 3ZDZF 1P7HL 5DI8A 4OD3H 1CD8A 3WDIA 4FRWA 4PLKC 1SVZA 5DTFB 1LK2A 3X13A 3BRDA 5IB5B 3S36X 1OB1A 5H94B 2HG5B 3VFVB 1XF4B 3MUJA 1ULVA 5IMMB 5IR1A 2X89A 4XNMB 4PD4J 5ADPH 4GLRI 2V2WB 2X10A 1RZGA 2CKBH 3E8UL 3HR5A 3IXTA 1UM6H 1AI1H 1EHXA 4GBXC 5F1IA 4NDMA 4RZCB 4KXZH 2ADJA 2FDBP 5AG9A 5B8CB 2UUDH 3QXDB 5IEHA 4P3DB 5IKCA 3MO1A 1G6RH 5HTSA 2NY5L 4LGPB 4D9QD 2DM3A 3SE8H 2XFXB 4TUJB 5DQDL 4MAYD 5CEYA 3DXAE 1XEDA 2MSPA 1NMCB 5C08A 1CFTB 1CLZH 2FBOJ 3KWWA 3KPRA 4G9DB 3ZDYE 3OJ2C 1VACB 2CDEA 1BBJA 5C6TL 5I17B 2BSSB 5DFWH 2NYYC 1YUHA 1HQ4B 3E1F1 4TNVK 3SDCB 3BGMA 2D31B 4KUZL 1LO2L 5DJYA 3WO4C 4ZAKA 2NY2D 4Z7WA 4MXQD 2H45A 3AB0B 2FX8H 1IGIH 2HLAA 1FH5H 4AG4H 4JRYA 4CVXB 1YMMB 5DJ0A 3RVWC 3TH2T 2Z4QB 3QDMA 4G6MH 2VNCA 4MWFA 4RIRB 3T04D 4X99B 3LB6D 4YHIB 5C0AE 4YR6A 4HKXB 4O02L 4XX1G 5D5MB 1RK0A 2XI9A 1L6ZA 2R23A 5INCB 1G0YR 1FGNH 2R8SH 1KXVC 2GUOB 1T7XA 1ZOXA 1CWVA 1YYLH 2YC1B 1SJEA 4E41E 4I48A 3WIFA 2DOCA 1AO7D 3P4MA 4Z18A 5C0BA 4YHZH 4JFFD 4YHKH 4Z7VA 2YWYA 4H1LA 3W39B 2OJZL 3NGBC 3VA6A 3L5IA 1AKJD 1KBGL 2EE2A 3BP7B 2VDKH 3CU7A 4XC3L 4W6WB 1CD1B 1OM3H 4F2MB 5I74B 5EZLA 5B39G 4Y4HC 1G7PB 4FTVE 4GRLB 1WWCA 2VWEE 2HTLD 3U7AA 5GRJL 3RAJH 2VLRE 1B4JL 4FXGB 3MCKB 3FOMB 3DMMA 3FB6B 2CUHA 4DKEH 2PR4L 4OZIF 2H26A 3MRPA 3BHBA 3QCVL 5HPMB 1IKNC 2QR0B 4WFEE 5C0NC 5DHYA 1M71A 1QBLH 4NKMA 1BFVL 4K8RH 4K3JH 4U6HB 5HHVH 3WE6B 4BFIA 1OGAE 2RBLA 2VOTA 5D2LB 5IFAL 4OI8A 1T22B 3GHBL 1WAAA 5DUML 2XZCH 4I5BB 3IDXH 4NHCL 4G8FB 1DUYA 1B0GA 3W2DL 3ETBF 1R3HB 4Z95L 4NZUH 4XPBL 1AR1C 2HWZH 2EXWD 4APQB 1NANI 1HSAA 1E4WH 4P23D 3RPKA 1JTTA 3HZMB 3MQIA 4PJXE 4X6DF 3WFCL 4L29A 2FR4A 2JCCF 4X0KA 4NQSA 3BKMH 1OPGL 1Y0LA 1RQ5A 3UX9B 4GRWH 3BJ91 4DJMA 5EU3B 5T5FL 5L0QC 3VXUE 3V52L 5IJKA 1E6JH 3KNBB 1JZ7A 1EV2E 1VESA 5BZWA 1H3TA 3QDGD 3UTPE 3ALPA 4IIQA 1X5HA 3WIIH 4M62L 4KTDL 3MGTB 3I02B 3OMZA 5GRUH 1KELH 1SEQH 4NFBA 3INUH 2ZOLA 1IAKA 4ONGH 4PJIA 2OK0H 3DARA 4LU5H 3IU3B 1GGBL 3U0WH 1XF2A 1OAQL 5EU6A 4K3EL 4JM4L 1DE4A 4Q6IC 4OLUH 4PRDB 1BECA 1H3WM 3T0ED 2WINA 4QHLA 1T89A 3DWTA 1IFHH 5TDPA 4JY6A 4XPHH 3THMH 1QFWL 1RJLA 4GW4B 1CLOL 3QIUD 4MNHB 4DN3L 4HQQL 4HPOH 4WO4A 3TT1H 2AXGA 2MQCA 3UDWC 3S5LB 3ROOA 5ADOH 3PGDA 1JFQL 3C08L 5TE6L 4OQTA 4R0LA 1C5DB 5HI4C 1JF1B 1KIPB 4Z7QE 5FYLD 4OGZA 3OBAA 4BYHA 1JN6B 1AC0A 2IC2A 1VFOA 4QRTB 4Z7OF 1DVFD 1RAMA 1A8JH 4OT1L 5JOFA 3C09C 1FP5A 4GKNA 3RU8H 3PIQB 4X4MA 4JFZL 3C5SA 4LLDA 4FQHA 1QSED 5HDOA 4D9RE 4HD9A 4EVNA 1CE6B 3B4NA 5D7JB 4K7FA 5CGYD 2R1YA 2COQA 3KPSE 2X70B 4WHTA 5CINL 4KZDH 4JEGB 4NZDA 3QQ3A 1MI5D 1NJ9A 1DLFL 4FMKA 2KKQA 3NZ8A 2R1XA 1RUAL 3E2HC 2HT2D 4BH7B 3RIFK 3PGFH 1K8DA 5F89A 4JDVB 2DQEL 5C6WH 2BNUB 4XXDA 5KVDH 4P2RA 5DJ8A 1MHPH 2A1WL 5J6HB 4DUWA 5D72H 3UBXG 4I0CC 4ETQA 3T8XA 4NRYA 2Y07H 1OTSD 3EOTH 4DK3A 4PJEF 4BFBD 2CXKA 4RWHA 1HI6A 5DHVH 2NW3A 5MEOB 4ONHB 4JM2A 1BLNA 3NTCL 5JO5B 3H3PH 4O2FA 4G9FA 1UWEH 1OARL 3BPLB 2NW2A 4MDIA 2B1HH 2LU7A 4FQJH 4YBQD 3L5HA 5IOPA 5I75B 1FNEA 5DJ2B 5BO1H 1AGDA 4Y2DD 2BOCA 4XVUC 5CJXC 1MCWM 1UEYA 3VE0A 3EHBC 1GZQA 4KKBC 3U1SL 3CXHK 1CT8B 1XR9B 3KPMB 5FO7B 2DQUH 2ARJB 4XNXH 3ZKSD 3KXFE 4LARH 3DV6B 3FT4B 5HHQA 1RFDL 5A2IH 1YEJL 2QEJA 5CD5C 1BZ7B 3WHE0 2JELL 1RJZA 4TSBH 3JTTB 5C6PB 5EOQL 1ROWA 3CLEL 3GIVA 3LEXB 3IGAA 3PWLB 4UUJB 4MQTB 4P5MA 4RGMB 3UPCA 3T0DA 1ODAA 2RGSA 5H2BB 3AAZB 3GNMH 3C9NA 4O58L 3JTSA 4M1CD 1SBBA 4J3UA 5CUSH 4L4VD 2C1OB 4C55A 5TH2B 2NPLX 1NBQA 5F70A 4RNRA 2VZ1A 5BW7A 1VFBB 3QUMH 2XA8H 4NFDA 3F6IA 5EUOB 2XNAA 3FB5B 1MJ7H 2XTJD 3C5ZC 1C7TA 1MFCL 4TRPH 3F7RA 1TETH 1Q0YH 2ESVA 4OV5A 4J7RA 1UVQA 4U7SA 5JOPE 1FORL 4WU7B 2E7LA 1VGKB 3AU1A 1U8PA 2NX5B 2CPCA 1D3CA 3ARUA 4BFGA 3MOQA 4L4TD 3IAGC 2P7TB 1P84J 1TIUA 2XRAH 5F9WB 5CP3A 2D4FA 2CDGB 3REWB 1I4FB 1ZGLM 3SJVD 1L7TH 2HFGL 4PJHA 3IAPA 2BMKB 4Y7MA 4OLVH 4QRPA 3IF1A 3MNZB 2N7BA 5D2LF 3BDBA 4D3CH 4NQXB 3WN5A 4XH2B 5DUBA 3S37X 4JAMB 3LEYL 5JHLL 1HHHB 4F8TA 2XKUA 2APWA 2R0ZH 4YHMH 1AE6L 2CK0L 1VA9A 4PS4L 4JO4H 4HS8L 5DVNA 1NC4A 4JRYE 4X98A 2ICES 2P8MA 5HXMA 3D85D 5E08H 1KG0A 2W9EH 4LLUB 1FAIH 5FGBA 3T2NH 3DVNB 3H9YA 1VFAA 3RKPA 1LE9B 1V5JA 1P7KB 3OR6A 4O51A 1KCSL 1XR8A 1ZV5A 3VRJB 3CDFA 1GIGH 4PJGA 4U33A 3IKCB 3ORJA 4CVWA 4EUPG 1AY1L 5DYOA 5JHDB 1MWAH 5BJTA 3G5VB 5C0BE 4HUWB 2B8OT 12E8L 4Z7VE 3SKNA 2PNDA 2DI9A 4WV1A 3T2QA 5EOCH 2OI9C 4LNRB 4PJAB 4XBEL 1G7IB 2ZSVB 5JQ6H 4KZEL 1ITCA 3BAEL 3OGCA 3EYSH 1JWUA 4I0PB 3MBEA 1ES0A 2WAHA 2YD8A 4X4YA 1J86A 2ATPA 2CH8A 3Q6GH 4YWGH 7FABL 4LLAA 5E8DL 4LCWA 4YIQB 3UC0L 5FYJD 2ID5A 4EQ2A 3D0VB 2GCYA 4IMKA 3KYNA 3V5DA 3AB0C 1MELA 1S7WA 2Z91A 1GOHA 2Z31D 2VDPL 1T1ZB 1RSFA 1WAAE 5GGRY 2ENYA 3TF7C 1DEEB 1UFUA 3KHOA 1DUZB 3ZL4H 1S7SA 5E2UL 3SGDI 1EJOL 4U1MB 2JJVA 1QFWM 1UM4L 5ISZB 2A73B 1ZT1A 4L3EA 3DYPA 2G5BB 3CLFH 4H88L 3GSNB 3MJ9H 4JO3L 2Y7QB 5C09B 5IVXA 2BXYA 1MJJA 1C5BL 1Z6JT 2F9BT 1JRHI 4MJID 2W60B 4LVOB 4N1HB 5IB2A 2Y36L 1KJ3L 5DJXA 1AGFB 3MRGA 4BSJA 5IIEA 5JDSB 2X4QA 1ONQA 2QSCH 1ZVSB 3PP4L 3UJTH 2YPLA 2V7HA 2A6IB 1IGFH 1R5WB 2GSIB 4YXHH 4HWZB 5JW5B 4HH9B 1T0NB 4JRXB 3QHZH 4YLQT 4OLWL 5EU6E 1GHFL 3MJ6A 4PBVC 4WUUD 4M5ZL 2IMNA 3O2VH 5GGTL 5CJQH 2DAVA 3LN9A 4PG2C 2H6PA 5F6HI 4FQQA 2EICA 4G42A 2XN9A 2Y5TA 3MR9B 4KK9C 3TO4D 1N5YH 5H37H 1UT9A 3F5WA 4LPXA 5SWZD 4XBGA 4CMMA 4EI5D 5DEGA 1H8SA 3OAYH 1B6UA 4APQC 4D0DA 4PP2A 2V9TA 3CK0L 1OWRM 3VW3H 4GAGL 4H1LG 2G9HB 3B5HA 2YXMA 3TWCL 4R96B 2NXYD 3O4LB 1ED3B 4P5TC 1JUFA 4S1RL 3HMWL 3MOBL 4LSUH 4U6XB 1K4DB 1QA9A 1WISA 1IE5A 1RUML 4JPVL 2P5WD 2DBLH 5F7WC 1MCPH 3O8XC 1J5OH 2CJUH 5AZ2L 1EFXB 3FZUD 4JQIH 5DEZA 4P46D 2A0LC 4GAYB 5IVNA 5I6XB 1T1WB 1ZVHA 3E3QC 3QIBB 3W5MA 3RY4A 3VXSD 4PRPB 4G43B 1T3FB 3L7FA 1JP5A 4O9HH 4DAGH 4Y1AB 4M4PA 1UH3A 3KG5A 4Z76A 4FNLH 5TF0A 5T1LD 1WQVT 1PSKL 3RUGA 2KUTA 4JDTH 3I6KA 5IMOA 1FO0H 2ARJQ 1D9KA 3MLSL 1U6AL 1KTDB 3ULUE 1IM3B 2V17L 4P2RE 5JOEA 2EDOA 2BVYA 2Y06H 5EUOF 4AJ0A 3ULVE 4OKDA 3FT3B 1XGUA 2WMPA 1PAMA 3ZSSA 3O0RL 1OAYL 5GGQH 5I19L 1MLBB 5KSAD 1NUDA 2Z9TA 3DTXA 4LASL 2EIZB 5BZDB 2IPUK 1YMHB 1TVHA 2PYED 4TYUA 3NCCB 4J12A 3TV3H 1T7ZA 4BA8A 5D1QD 4V2CB 3ILPB 1KIQB 4G5ZH 4FQXA 5F7NC 4CADB 1HHGA 4GBXA 3DVGB 1NDMB 1JGEB 4MVBD 1HHIA 2B1AH 5CILH 5EA0H 2AJXH 1QPPA 2FLBT 3VXTB 4X7SH 3P9LA 1OTTC 3CFEA 5F21B 4ORGA 1IM9A 3MTRA 3B9KB 3LEVL 5HYEA 1AQDA 1R3KB 4XCEB 3UJIH 3GSXB 1A3LL 1VADA 4J1UB 2GJ6A 3SDAA 1U3HA 4HFUH 4LIQE 1KENH 2NCMA 2WNGA 2B7DT 1UEMA 2WLZA 1ZLSH 4LLQB 1U8OB 4R97B 1G7LA 3IT8D 4YGVB 4UT9L 3VXME 3FFCB 4I3SL 5ICYA 2PUQT 2YS4A 2ZWLT 4QXTA 5DD5L 5EU4B 3HZKA 3RHWK 3JXAA 4G8EA 2AJ3B 4KDVA 4QHNB 3QUYB 4WEUD 1CG9A 3ISWA 3BESR 2A6KB 4QRSB 3OAUL 2AJYH 2FD6L 2IH1A 3G6DH 1YY8B 5C0CA 3VD9A 5T5NF 2ZCLH 4RFNB 3BPLC 1HN1A 5HDBF 4R26L 2IPUG 3IJHB 2R2BA 1JVKA 1G7HB 4NKOB 1LDPL 2UY7A 3LKSB 1YEDB 2MCG1 1KXTB 5ILTH 2ESVE 3C60B 1BZ9A 3RWFB 1F02I 4KMTL 4ODTH 4PRHD 5FKAB 4OD2B 3U30B 4XP9H 5A43C 4MA1B 5C0AD 2EKSB 32C2A 1QFUL 2HT3D 3TBTA 3S34L 3BGAA 2NR6D 1AIFB 4NZRL 2APVA 4G6JL 2B4CH 1CFQB 5DJCA 1A5FH 2IG2L 4PJHE 1FHGA 1MLCA 4V1DA 2BC4A 4MJ6B 3STBA 4PPTA 2UUDK 4K7PY 4U2YA 5I1LB 4QLRA 2C3WA 4QRPE 5GGUA 2Z93B 4HKJB 5TE7L 3SDDC 3U9UB 1JYXA 3GHEL 5DQJA 4S10A 1Q9OB 5KANG 1IKNA 4XPTH 3R0NA 2F19H 4M6MH 4A6YH 5EBMB 4RGMC 5ID1A 4NYLA 3DHJA 4RRPA 1UJ3B 2ADFH 2P45B 4TTDD 4FTVD 5I16B 1IAOA 5ICZA 4PJFB 2FBJH 5DR5H 1D5IH 1A1NB 2NZIA 3KYOA 4JFDD 1OAUH 3AS0A 3GBML 4F9LC 4WFED 5TQ0L 3LKOA 2PKDA 1PJ9A 4OJFL 2DKSA 1PLGL 4R6UA 4EEEA 3VXRB 3QHFL 3PHQA 1NL0H 1FBIH 4XWGL 3QI9C 1YQVL 3RTQB 4HJGB 2M1KA 5D6CA 5AAMA 5AUMA 4C4KO 2GJJA 4RISL 4F3FB 5F3HB 1KPVB 5F9WC 1AHWB 1VPOL 1P9MA 4MQXD 4NNXA 1AGCB 1QFPA 1AKJB 3SKUD 4BSVB 5D7SL 2I9LB 2XKNA 5HYQA 2MCPL 3BH8B 4LSVH 3BIBX 3UTPD 2C3VA 1EVTC 3QQ9C 1V3KA 4KFZC 4BKLA 4FQ1H 2GSGA 1JPTL 4JN1H 3X17A 1T2XA 3WD5H 1VERA 1U8NB 1P7QD 4AEHH 4UQ3B 2YA2A 1MCSA 3MCG1 3EO0A 2EDTA 2F74B 2EYRB 3UDWA 3ZE0F 3MA9H 4PREB 1S78D 4QTHB 1A9BB 3HZVB 3GO1H 1CR9L 5EBWB 5E6IA 4KRNA 4L3EE 5B3JE 5I8CA 1CE1L 4QRQA 1Z9OA 1MHCB 2R4SH 1BVLB 2APBA 1LP9A 3KLDA 1ZLWH 1YNLL 1F4XL 4QEGA 3DX6B 1S5HA 5GIRA 1WITA 2HH0H 5GHWL 3T65A 1RMFL 3HPLA 2VIRB 3MREA 1CTNA 5LKNA 3OAZK 4HGWB 4AT6B 4JKPL 1Q9KB 4O5LH 2ADIB 3EGSB 3QDGB 1LK3L 1ZA3B 1IAIH 4N5EC 5FCUL 4IS6B 5DEFB 4XWOD 2HRPL 2NTFB 1Y18A 4OD1H 4QRRB 4RSVA 3WIHH 5GISL 5DRXB 1CFVH 3BQUD 3QFJA 2A9NL 3PWVA 5CHNA 4D9RD 3JV4B 3TCXA 1RK1A 3EDEA 5DK2B 3C6LB 2ZG3A 5ITBH 3LIZL 3QIWB 4XMPH 1OP5K 4OZFB 4U1KB 3U0TA 5HYJA 2FO4A 3HG1A 4X4XA 4JO1L 3CFCL 3T0EB 4OBSA 3TESA 2C7UA 1AJ7H 2XN9E 3LVEA 5EIVA 2NZ9C 4KU1A 1IC4H 4H26B 3TJHD 2EDLA 2IFFL 2DM2A 3QIUB 1Q1JL 1KB9J 1EMTH 3CFKA 4TULL 1FZJA 1NCAL 4OSUH 4FFYH 3VI4E 1PG7L 4HWBH 5T33H 3H9ZA 2DICA 1HILB 1MH5B 1T0MA 1MCQA 4U6YB 1FN4B 3S8WA 4GUPB 2O5YH 4MMXC 2IADB 2N4IA 5T1DL 4J23A 3SGEI 5K9OA 3PP3K 2LV4A 4PGZA 2PW2A 4LCIH 4DZBA 1LNUA 3MRKB 1XGRB 3CMGA 1RU9L 2BRRH 3NCYS 2YA0A 3MV8A 5JW4Q 3SOBL 1QSEB 3VWKC 4NUGL 3X3FH 1N64H 1IZJA 1JGDA 1WC7A 4OFYA 5FHBL 4J8RB 1WFUA 4QO1A 1BQHB 1CGUA 2JB5L 5I8EB 2NY7L 3C8KB 3KDMA 4P57A 4Q97A 1N7MH 1A4KA 3Q0HA 1HDMA 2V7NA 4G7VL 4Z5RA 4POZC 1ZWIB 1U2CA 3O41A 1N2RB 5IW3A 1G6RB 5E9DE 3LD8B 1WBXA 4LBEB 2HA1A 3V0WH 3QISA 5J11B 4M7JH 3O2DL 3O6LL 3PWNB 5F9JA 4OQTH 2FIKB 1MIEH 2EZ0D 4F7MB 4RGOH 3G6JA 1HHJB 2X9XA 4MDJA 3BD5A 2E9IA 3C5ZA 1RI8A 5CEXB 5CBEB 4NBXB 1WSST 2LE9A 4G3YH 3QZWA 5GGVY 4PJCB 5BMFL 1DQDH 3ILQC 4HUVB 3MACL 3TM6A 5TDNA 1TPXB 1I7TA 4XHJC 4A2MA 1IQWH 1G9NH 2C4FT 4Y2DB 2VISA 5GGTA 3RWGB 3FRPA 2AJSL 2X89D 4DVRL 4HK3N 5I6XC 5E2TH 2BHZA 2D0GA 1DLHB 3QIBC 5DJDB 3RDTC 3OHXB 5DJAA 2B5IB 1NGWA 4OBRA 3BW9B 4A2LA 1MOEA 4JDZB 2DBJA 2GJ6E 1KJMB 1BJ1J 3BP6B 5A2FA 3D3VA 3AREC 1WCBB 2ZUUA 5JLZB 1MCJA 1A3RL 2QQKH 3KPPA 4YBLB 4PJ9A 3ZDXF 5E95B 5ACZA 3BH9B 6FABH 3MJ7A 4LHQB 2PW1A 5C9KA 4RAVB 3O45B 1K6QH 1YN7B 4IRSB 2R0KH 4M4RA 2HKFH 3MNWA 5FA3B 1WFNA 3LN5B 4NJ9H 2R9HD 2DJSA 1PX4A 3CDYA 4ZUWB 2OM5A 2E7HA 2J8UA 5A40E 5EZJB 5L2KD 1RUPL 3BEWA 3EOYG 4R7DB 2RB8A 3MRHA 4OGAD 2C1PB 1ZHLB 2G75B 4PGDA 1KJ2A 3VFPA 4JZJC 3TNMB 5T3XL 1E4KC 4L4VB 1WJ3A 4EDXB 1UACL 4FZ8L 5MI0B 4ZAKD 4PJ5B 3GMRA 4MLSA 5KAQF 3B9VA 4PJEA 1BFTA 1I1AC 4E0RB 4KAQH 2XTJB 1QLFA 3OKOB 4QHMA 2VLJE 4X7FC 1CF8H 3JWDH 5CZXD 1DP0A 3MZGB 4RFEB 4YFDB 3WMSA 1N8ZB 3NFNA 3QQNA 5J1AB 5L6YL 2XFXA 3RKDC 1U3YA 1A7OH 1ZS8B 3SJVB 2MWCA 4H25B 2I5YH 5EC1A 1NEZG 1VACA 4ZDHB 2FLRT 3BUTA 3M17A 4YJZL 5ID0A 1IKFH 4UDUA 4R97C 1RUKL 3S88L 4GRWB 1CLYH 4FG6C 1PKOA 2VE6A 1NGYA 4YQXH 1IZKA 4KPHH 1FPTH 2E7BA 1KLGA 1RIHL 4RWYH 4YZFE 3F6LA 5GQBA 3BP5B 4CVXA 3QUYC 1IT9H 1Y6NR 4S2SA 4PRIA 5JQHC 4PB9L 5KSBA 2B2XH 5I73B 3PABA 1V7ML 1TJIH 3DRTB 4PUBL 5HPOA 4P4KD 1BGXH 3RBGA 2Z0BA 3NABL 3FFDB 2DTML 5FHAL 1BM3H 2P44B 2XY1A 2Y4SA 4IMLB 4MD5B 1Q0XH 2BFVH 4HG4K 3E6HA 3QHTC 1C5CL 4MA1C 5CP3H 2AK1H 4NKIH 3W39A 3OKYA 2ZUTA 4X5LA 1D6EA 4NQVA 3F7PC 3MLUH 3ZTNL 2RCSH 2D03L 2NXZD 2DD8L 4W6XB 4P49A 4HW6A 1IARB 4Q6YA 4MAYC 2V2TB 1EFQA 3HUJE 5EC2A 5D70H 2HVKA 1K3IA 1EAJA 5F6IB 1MQKH 1ZT7B 2IANA 2ZG1A 3J8F7 4NPYB 1UJ3C 2FHFA 5EFIA 3BDXA 3I50L 3S9DB 5IBTH 1CXIA 3TJEH 3Q5TA 4NJAH 4JZOB 5TGBB 2NY2C 4MXQC 2CO6B 2X4RA 4OLZL 5EU6D 1QKZL 5K9JH 4PJBA 2F54D 4Y89A 3RGVD 4M6OL 3O6MH 1S9WB 1F42A 2E9JA 2DLFH 3ALWA 5HHXL 5JNYA 4HV8A 4P5TA 3VFTB 3WKNA 3MRNA 3BVNA 5D9SA 1LP9E 2VDLL 4K9EL 1FIGH 3MLWH 2FJHB 3U7YL 4F58L 3QUXB 5SX4I 1X5JA 3RTQC 2CDFB 1UZ8A 4MJIB 2OS7A 4MHHG 3O8XA 2YBRB 1SYSA 3GKZA 2I07A 3T0BA 1AHWC 1WTGT 2VLKB 1D5ZB 3DRQB 4R8WL 4N9OB 5HHME 5BXFB 3ARFD 1J87A 1I8IB 5DHVB 3ZTJG 3T2OA 5I1AB 1FYTA 4WTXA 3VG9B 1EEQA 1IEBA 4X4ZA 3DURB 3EYVA 1ZEAL 5IV2A 3TVMB 3D9AL 2HTLC 4KGLA 4U0QB 2R1WA 3E8UH 3LPWA 5ESVB 4MA7L 3L3HB 4FMFA 3AM8C 1XCQA 2LAGB 3GMMB 4M8VA 1ORSB 1UB6B 1DN0B 4H8WC 2YD7A 4WUUB 2Q76A 3GBNL 3IDIB 4HZLB 1WT5C 3GJFK 1EBAA 1ZKAA 1JZ6A 1NFIA 4ALAL 3LN4B 3HG1E 4KI5D 5IK3B 2NY5H 3MRLB 2F58L 3B5GA 3O6FA 4V2BA 5DQDH 5FGCB 2M8XA 4I18B 2YK1L 3MMEA 4PJCF 3HLAB 5GS1C 3EO1A 5F8RC 3ULUD 1U41A 2MQ3A 5SWZB 2E8ZA 1I9RL 1MVUA 5C6TH 2F53A 4I0KA 3VFWB 4NC1C 1JHKL 1EEZA 4P23C 3ULVD 4YHYB 4U0RC 1Q9LA 3K8LA 3U48A 1A2YA 5J6GA 4PYGA 4ODHL 2NXYB 4KUZH 3LKQB 4JE4B 4Y4FB 4MX7A 1LO2H 1JRHL 4HMCA 2YSSA 3HE6B 5IVOA 2I9TA 2P5WB 3MLTA 5HHOB 4MB3A 5FO8B 2VQTA 4ZYKB 3MV8E 4ZS7L 1I9IL 4R7NA 3GEWB 3C5JA 4LPVA 4I3GA 2AK4D 2C3XA 4O02H 1HEZB 3VXSB 1T4KB 4QHUB 3I3EA 4MNQB 3NPZB 2VDQL 5FB8A 5C71A 1Q94B 2VYRE 1Y6MR 3C6LC 3IJSB 5J56B 1DANU 3CX2A 5JR1L 5FUOL 1A6WL 1S7VB 3T0EC 3UAJC 3CC5B 3UBXI 2OJZH 3TA3A 1JWSB 1J05A 4CUCA 2D9CA 1KBGH 2Y6SD 4XC3H 5J13C 2X4PA 4MD0B 3QIUC 3I2CL 5MEOA 4YHLL 2APXA 2FO1A 3VXMD 1HCVA 3BPCB 4M9PA 1JPFA 4M7ZB 2JK5B 5GRJH 4CNIB 4OB5L 3QEUB 3G6JE 1B4JH 4X83A 3SPVA 4D8PA 2IH3B 2PR4H 4WFGD 5B39B 3PXJA 3QCVH 3MROB 5B21A 3IJYA 5J1SC 5D1QB 5DMIL 2CRZA 1PKQA 3AY4A 2A6DB 1QSZA 1BFVH 4J4PD 1B9ZA 2X4UA 1DVFC 5IFAH 5LXGL 2GJZB 1YQ2A 1JYVA 3GHBH 5DUMH 1CT8A 3HR6A 2AGJH 3DV4B 4KK6C 4NHCH 1J0YA 4XAWL 5L8KB 3W2DH 4Z95H 2ESVD 3BN9D 3SEPA 4XPBH 3M1BA 2FWOB 5CGYC 3SDDA 3DROA 3WFCH 3D3VE 1D5MB 4HUNB 3IS0X 3WJJC 1OPGH 2BNRD 1MWAB 5T5FH 2HT2C 3MV7D 3V52H 1MCEA 3H7BA 4YDVA 3SDYL 1J8HB 5H2BA 3DXAB 4M62H 3LD8C 4KTDH 1ZLVK 5IFJB 1RIVL 4NO2B 2J8UE 1S7RB 4QNPE 4OZGA 4PTTB 4WGWB 1R3JA 5J11C 3EJZC 1Z0NA 1OTSC 4ZFZB 3QCTL 4NKDB 3EFFB 1FZKA 3VFRA 1GGBH 5EUOA 3D18B 1OAQH 2F8XC 4K3EH 4JM4H 2GKIA 4TOYL 4XCNB 5D7IA 4H8WL 4PJEE 1MHHB 1QYGL 3PWPA 3RZWA 2DLIA 4NN5B 3FN3A 3WJLC 3QI9A 5FFLA 1PEZA 4IOIA 1TPXC 2W9DL 3FO9B 1GZPB 4Y2DC 1S7XB 1T20A 1QFWH 3BPOB 4L8SB 1CLOH 4DN3H 4HQQH 2X4TA 5GRYA 2FB4L 1XH3B 2GFBB 2HT4C 1JZ8A 4PP1D 1A6VL 2B5IC 1JJUA 2FHBA 3ZYJA 3O2DA 3ARDB 1JFQH 3C08H 5TE6H 3G9VA 3QWOA 5J9PA 1L9MA 4ZOEA 3GMOA 1BIIB 4E41B 2FHCA 3U36A 4X7DC 1PYWB 4H0HB 4S0SD 5LGJB 3GRWL 4OT1H 5LAXA 3SKMB 2IEPA 3D2UB 5D7LA 4JFZH 3MBED 1O7VA 4CBPA 4FTVB 1T21B 1XGYL 3GSOB 2Q7YA 1P4IL 2V2XA 2CUMA 3L9RB 3QZWG 2VLRB 3BN3B 4UIMA 3CFJA 1UA6L 5IF0B 5CEZD 5LWYL 4PRIE 3IETB 3RFZC 2WBJA 5KSBE 4KWUA 3MUY1 5CINH 4M1CC 4LLUA 2FZ3A 2L7UA 2X4NB 2IQ9L 4JFYA 4JN2B 1UZ6F 1DLFH 3FRPG 5E03A 1OF2B 4E42B 1KT2A 1RUAH 1BFOB 4Q2ZA 3VFSB 1OGAB 4Y5VB 3CDCA 2XTJC 3RZCB 2DQEH 5D7KD 3JV5A 1OT2A 4PJ7E 2DLHA 2A1WH 3SGKA 1MVFA 3QEHB 1SJHA 3MRMB 4ZXBA 3TZVD 4TTGA 4UZGA 5DJ6B 4JREC 4OZHF 4N68A 3B2UD 3HNTL 1SM3L 5SX5H 4F7EA 4PJXB 3H2WA 1FFOB 2YUWA 3PWJB 2H3NA 3NTCH 4NT6A 1JZ2A 4XNQA 5BRZA 4D0CA 1OARH 4Z77B 2BY1A 2JB6B 3IKKA 5FYLL 3VXUB 3R06A 1JZ5A 5EOTB 5MHSD 1NGZB 4YIQA 3QFDB 3WDHA 4P3WA 3D0VA 3O81A 4QWWD 2A74A 4IRJD 3VWJB 5KSUB 2IANE 3RWEB 3LZFL 5JW4M 2J6EL 2BHYA 1JK8A 4XXCC 3OXRB 3LQZA 1ZHBB 3U1SH 4ZUVB 4LCUA 3FHQA 3I75A 2VZTA 3HI1B 4LPYA 5HHNA 1BF8A 4GG8B 3MX0A 4XNUL 1U9KA 4PJBE 5ISZA 2LU4A 3IB4A 3IAQA 4U1JB 5I73C 4GOSA 4KJWD 1FSKC 3TN0B 1RFDH 1YEJH 4WU5B 3U2SA 1NC2D 4OLEA 2JELH 4OCYL 4U05A 3F62A 2XN9D 1DDHA 1EHNA 3G5ZA 4G80A 5EOQH 3B9AA 3CLEH 3DJ9A 3LKRA 3N1FC 4P9ML 3G5XB 1T80A 1QSFA 4NQCA 1Q72L 3L3IA 3O3AB 1I3UA 4M48L 3GMQA 5ETUB 5HGBA 4O58H 4HLZH 4X6FB 1MCFA 3HTLX 3WFHB 2EDJA 3FQTB 5L7XL 1N5AB 1FYTE 3KJ6L 4JPWL 2GSIA 5F7EL 3VWKA 1NAML 2NNAB 3G04B 5ESAA 4XVSL 3RVXD 4JFQB 5J89A 2Z8WC 1U8MA 1MFCH 1F3JB 3V6OC 2BVOB 1FORH 5HGAB 3NA9L 4M61B 4OFDA 4PLJD 3BQUB 4Z7UA 5FO9B 4JKMA 1E4JA 4PY8J 1FL3B 1IMHC 5D2NC 1HH6B 5KSVA 3KPSB 5E8NA 4BQ9A 2HFGH 2Z31C 1Z3GL 5I1KL 1QOKA 2GYSA 1KTKE 1K5NB 5JA9A 1PZ5B 1ZT4B 4WI6A 2HTKD 5A16A 2ZCHL 4PRBA 2F53E 1INDL 3OB0H 5E9DD 1CLCA 4NO3B 1C08B 1UM5L 4TNVF 3DHMA 3LEYH 3GGWB 4KROD 5JHLH 1K4DA 1PG7W 5FIEA 4L3CA 2PO6A 3ARVA 1AXSB 2EDFA 4IRZL 4WTWA 1AE6H 2CK0H 3E6FA 5C8JA 2BJML 4PS4H 4HS8H 4NM4L 1SBSL 1LEKA 5C3TA 4HIHB 5DLML 3EYUL 3RDTA 3IFOA 4KJYA 3VJ6A 5DZNA 1T3FA 5KZCD 5KS9A 5F7HA 2IPTL 4XT1C 3VG9C 1UENA 3PHOB 3BOVA 3H42L 5JW3L 1T1XB 3H3KA 1M05B 4ZPTB 5DO2D 3AREA 3RY6A 2G60L 4HUXB 1KCSH 5MENA 1MAKA 4X7EC 1OWWA 5FYKE 3ZDYF 4OZ4B 1DZBA 3HRPA 1X5ZA 1AY1H 1IM3A 2VXQL 2EO9A 3KLHD 5FA4B 1W2KT 3GMLB 4OGXL 2HJFB 4NSKB 5SWSA 3STZB 12E8H 1WF5A 3SDAD 2GJ6D 3FT3A 3UTQA 2AV7B 3DUSA 4AEIL 1A14L 4EUPB 3KXFB 3WKML 2ERJB 1FNAA 4XP1L 5E1AA 4XBEH 2ICWA 4I18C 2H9GA 4KZEH 1MHEB 3BAEH 3F7YB 3PGCB 4L8DB 4JZJA 3PL6A 2EDBA 2HJLB 3PQYA 3WNMA 1SMAA 3B8YA 3G6AA 4EI5C 5KOMC 5DI8B 2V6HA 2JJUA 1I1AA 7FABH 5E8DH 2NXYC 1HINL 1WLHA 3UC0H 4Y4FC 1LK2B 3X13B 1PKQE 3HI5L 1EEUA 4WI7A 4X6CA 3HE6C 3F7QA 3AXLA 2A38A 2VDPH 4OF0A 3RVTD 5DJZA 5IR1B 3FZUC 5HI3D 2FX7L 4P46C 5E2UH 1EJOH 3QXWA 5IB1A 1RZGB 1UM4H 3KPQA 4H88H 1I7UA 3HR5B 2VLJD 3IXTB 4KI1A 3SE3A 3OZ9L 2HFFA 5F1IB 1O7SA 4JO3H 4NDMB 4BH8A 2ADJB 2OMNA 2BNQE 5IEHB 1C5BH 3FFCA 1XIWD 2X4OA 5IKCB 3MO1B 2DIJA 5F7MC 4O2CA 2Y36H 1KJ3H 1OLZA 2O93L 1WV7T 1QO3A 5CEYB 3VD7A 4BFEA 3K2UL 1U8IB 3KWWB 3VH8A 4OZGE 1OAXL 2CDEB 1NSNL 3PP4H 1BBJB 2DQHL 3I9GL 2FECI 4M7ZC 4KC3B 1MIML 2YRPA 1YUHB 4WIQA 3IJHA 3BGMB 4OLWH 1FAKT 1VEMA 1GSMA 1GHFH 3NCYP 3CSYA 1UKSA 1FG2A 5D7IE 5DJYB 5D1QC 1H5BA 4M5ZH 4ZAKB 1P4LA 4QY8A 4Z7WB 4RAUB 4PJXF 3PWPE 5FYJL 2HLAB 4NWTL 5GGTH 4JRYB 2EKSA 4JB9L 5DJ0B 3QDMB 4MWFB 3ARYA 4YR6B 2XZQL 1P4BL 1RK0B 1K2DA 4Z0XA 2R23B 3W5NA 3Q6FB 2N1KA 4MAYA 1AH1A 3CK0H 5BOZG 4GAGH 4OGYL 3TWCH 1TQBB 3QBTB 1SJEB 4I48B 3WIFB 4S1RH 5EN2A 1NGQL 5KANI 2I60L 4OM1L 3P4MB 5C0BB 4UB0L 3BUYB 3HMWH 3MOBH 3RL1A 4Z7VB 4H1LB 4UBDD 1RUMH 4JPVH 1T7YA 2L7JA 4XGZA 2X41A 5AZ2H 4P2QD 1A1NA 4N90E 4MJ2A 4HX1A 4NN7B 3ARBD 3BWAA 1CIUA 1ETZB 1QLEL 1BFSA 3MLPA 5EG6C 3DMMB 3UTZA 2CMRL 2H26B 3MRPB 1O5DT 3BHBB 4HK3J 1TNNA 1QG3A 4HXAL 3VA2C 4CVZA 4IHOA 5GGSY 4Y4KD 5DHYB 1M71B 2ZG2A 5IT2L 1PSKH 3NH7L 4NKMB 3JZ7A 1A4JA 3IDYB 3O3EA 3QEQD 5FEBA 3MLSH 4BFIB 1U6AH 5C92A 3WS3A 3O6KL 2X1OA 4Z7QF 2V17H 3QQ4B 5DGQA 5A2KH 1DUYB 5E6ID 4F3FA 1B0GB 3FO0L 1KJVA 1AO7A 3BPOC 4L8SC 1UCTA 4G8GD 1IGJB 4JFFA 2EYSB 3O0RH 2X09A 1OAYH 1HSAB 2HT3C 5I19H 4MS8D 2NR6C 1AKJA 1MREL 4L29B 2FR4B 1CI5A 4LASH 4W6YB 1WTLA 4NQSB 4JCLA 1Y0LB 1LQSR 3DETD 5BRZE 3P3YA 4JJHA 4HBCL 5T3XE 2D7TL 2ZOKA 5C07D 1U0QA 5DVLA 5BZWB 4IIQB 2R0LL 2KH2B 2ZOLB 2BVTA 1IAKB 2VABA 1FYHB 1UKTA 4PJIB 4PTUA 3LEVH 3VG0L 5JZ7D 1ZHKA 1A3LH 4EBQL 1XF2B 1J11A 5GS1A 1KGCE 5EU6B 3QNZA 2AABL 4X7TA 1DE4B 2ICEA 5FK9A 1UB5B 4AL8L 4MB4A 3K81A 3AROA 5D1ZA 4P23A 2K3TA 5T3ZE 2WINB 4QHLB 4W81A 2K7PA 4Y5VC 5TDPB 4UT9H 4JY6B 4I3SH 1RJLB 1QSFE 4NQCE 5DD5H 5HI5C 4OF5A 2APTA 4WO4B 4BQBA 3GRWA 2AXGB 5J57B 1GYAA 4LQ1A 1GGUA 4HCRA 4PJ8D 3QDGA 3ROOB 4KQ3L 1XF3A 2ADGA 3PGDB 5I1EL 3PV6A 1P84K 3ZKMD 3OAUH 2UVEA 2FD6H 5FXCH 3BFOA 3O11A 3VDCA 2B0SL 4MQXC 3TIEA 1KEML 1AP2A 1V3MA 4R26H 4KY1L 1M6OA 1LDPH 3K7UA 4ZFFA 2WLYA 4GKNB 1JI1A 4TNWF 4KMTH 3C5SB 4LLDB 4Z7UE 3VWJC 4FQHB 4YFLF 3T0EA 4EVNB 1QFUH 4ZOCA 5B4MC 4K7FB 3S34H 5J1TC 2R1YB 4NZRH 4WHTB 1AXIB 3EYOA 4G6JH 3WFBL 4M7KL 3QQ3B 3QIUA 1I9JL 2IG2H 3ARRA 4LRNL 1JWMA 1C16A 4U3CA 4YDJA 3NZ8B 2R1XB 5F1OB 5TE7H 5DWUL 1S78C 2IPKB 3GHEH 1OVZA 1AFVL 1MCBA 3H0TB 1K8DB 5F89B 2AP2A 4XXDB 4GRMA 4P2RB 5DJ8B 4JQXA 1E6OL 1EO7A 2WV3A 2IADA 4ETQB 3T8XB 4NRYB 4ZNEA 3CPLA 1DVFA 5GPRA 2LTQC 3UTSD 1HI6B 4D0BA 4G6FD 1YPZE 2CIKA 1BP3B 4JM2B 2YD1A 1BLNB 4ZTPL 3GBMH 4Y5XC 4G9FB 5ACLA 3F65A 4X5WA 1OTUC 4MDIB 2NW2B 2HMID 5TQ0H 2LAAA 5KS9E 1QHPA 2CRMA 2CO7B 5IM7A 4OJFH 4XWOC 1AGDB 1PZUB 3WJJA 1MI5A 2BOCB 1PLGH 5MENE 1KIRA 5EULV 3IDNA 1X9QA 3QHFH 4FQIL 3VE0B 5INDA 4XWGH 1GZQB 3BQUC 1I8KA 1YQVH 8FABA 5E7FA 5I0ZA 5SWSE 4RISH 2O26U 1VPOH 1YEGL 3WNLA 3WLWC 5HHQB 5HYFA 1RV6X 4PJ9D 3TJHC 4EZMA 1RJZB 3EJYD 5D7SH 1NUFA 3PQYE 3UTTD 2MCPH 3BGFB 3GIVB 1NAMA 3IGAB 1PQZA 4FFZL 4P5MB 4RBPH 3CFIC 3HE7D 3WJLA 1BQUA 1JPTH 3C9NB 2QKIA 4X6CE 3JTSB 3MSPA 3RWGA 3U4BL 4CDHA 1DFBL 3RBSA 4KTYA 4JY5L 4EI6A 4Z7VF 2XNAB 3QH3A 1CR9H 2E7CA 4JDZA 3MC0A 5E70A 5C0GA 1CE1H 4Y5YA 3GSVA 2ESVB 4OV5B 1UVQB 1MFBL 5DA0B 5JLZA 3ZMRA 3AU1B 1U8PB 3D69A 1YNLH 1F4XH 3NOIA 3V6ZA 4N8VA 2AXFA 3MODL 4RAVA 5GHWH 1YN7A 1RMFH 5FA3A 3IVKA 4MD4A 2AQ3A 4PJHB 3LHPL 1RUQL 1BWWA 4JKPH 4LVHB 3ZYZA 2Q3AA 1LK3H 3OX8A 2VITA 3G5YA 2ERJC 4QRPB 4DGVL 3VD4A 3IF1B 5FCUH 1FFPA 1UGNA 3VGAB 1K9TA 2C26A 3BEVA 3QCUL 1WAAF 2HRPH 2MTPA 3ROLA 2EZ0C 5GISH 2JIXD 2A9NH 5DK0A 4GW1A 1KCLA 1CL7L 1NC4B 2OTWA 3LIZH 3NN8A 4GG6A 4JO1H 4X98B 4ONOA 3CFCH 2P8MB 4JHBA 5E2JA 5CBAA 4CMHC 4L4TA 3EAKA 1YY9D 2IFFH 1KG0B 1Q1JH 4YDLB 4H25A 3FO2A 1VFAB 3OR6B 4O51B 4TULH 1NCAH 1XR8B 3V5KA 3IDMB 3EO9L 1MY5A 1PG7H 5E5MA 5J3HC 1J88A 1L0YA 4Y88A 4I3RL 5DYOB 4Y8DC 5GSRA 4AIOA 1JIBA 4NO0D 1CXFA 5BJTB 1JYNA 4P2OD 4FFVD 1ZANL 3RNKA 3SKNB 4WV1B 5T1DH 4IOSD 2GITA 4LP5A 2DQTL 2AEWA 3OGCB 2R9HC 1JWUB 1M7XA 1RU9H 3MBEB 1ES0B 1S9KC 3SOBH 4X4YB 2ATPB 4NUGH 5KOVC 4OGAC 2VO5A 3OKEA 2OTPA 5FHBH 3D85A 4GQPH 4LCWB 2JB5H 2GCYB 2NY7H 3KYNB 2XPGA 4ZAKC 3NIGE 1J0KA 4G7VH 3V5DB 1S7WB 2Z91B 2VR5A 5GZOC 1F8TL 2X9YA 3VFNA 1T5XB 1ZT1B 4L3EB 4FFWD 3O2DH 3O6LH 3GUTA 1EGJL 5DFVD 4M6NL 1BVKB 2FSEA 1TQBC 1MJJB 4OCXL 4Z0BL 2L4OA 4OV6F 3VH8G 5IB2B 5DJXB 3MRGB 4GJTB 4BZ2L 1NGPL 1AXTL 1KULA 5BMFH 4NPYA 4AIZA 2O61A 5IIEB 3MACH 2X4QB 1ONQB 1T5WA 5D2NA 3GSRA 1ORQB 4IRJB 2AJSH 4QHKI 4DVRH 5D96B 2YPLB 2V7HB 5DMKA 3ULUF 1NLBL 2D3VA 4QRUA 1ZLUH 1PVHA 2Z31A 3O4OC 4XPAL 3O9WD 3CZFA 3BPNB 1GXEA 4MXWL 3U79A 3ULVF 4ODUA 4OCRL 5D93C 2MFNA 3KPLA 4C59B 1GH7A 1A3QA 3VFTA 1A3RH 3IDYC 3DX9A 4KV5E 2DLEA 4LGSB 1NC2B 4NM8L 2H6PB 4FQQB 4G42B 2XN9B 2Y5TB 2CDFA 5IHZA 2YBRA 4MHHI 3CH1A 4DCQB 3QDHA 3F5WB 3U7WL 4XBGB 4CMMB 2XQYG 4U6TA 1A7NL 5DEGB 1GOGA 1JNNL 1RUPH 4D0DB 4PP2B 1NMBL 1BQSA 1LD9A 5JXEA 3ECBA 2NXZC 2VDML 5T3XH 3F7VA 1UACH 4FZ8H 3NVQA 2P1YA 4OZHA 4PR5B 1TDQA 2P5ED 3OXSA 4IIQC 2HLFD 5IWLA 1JCKA 1UXWA 4POYA 3I85A 3UXFA 2F5BL 3LN4A 3T4AA 5I1DA 4R2GB 1UXSA 5L6YH 1OGTA 1XGQA 3L7FB 3EDDA 4LEXL 5FYKD 4WWKD 1OD7A 3TO4A 2YUVA 4DFIA 1IBGL 4ELMA 1SYVA 3RUGB 4Z8FL 5SWZA 4HS6A 3I6KB 4RA0C 4EI5A 5IMOB 3RGVC 1D9KB 3BT2L 5HY9A 3CVHL 3TA3D 1T89C 2X05A 1RUKH 3S88H 4ENED 5E9DB 1XGUB 4KROB 2NY0D 1W0WA 1RIHH 4ZNEE 1RD6A 3QXUA 2UY6A 1IILE 3DTXB 2DJ4A 1TVHB 4P46A 3VI3E 4PB9H 3FQUA 1LO5A 1V7MH 4PUBH 3TCLA 3SGJC 3QO1A 1NKRA 4FQXB 3NABH 3QXAA 2DTMH 5FHAH 1HHGB 1L6XA 1P6FA 3L7EA 4GBXB 4PJHF 2K9UA 1UWXH 3NZHL 1HHIB 2AJVL 1MI5E 3ZE2E 1RIUL 3NCJL 4QXGL 5T1LA 4L9DA 3ARGA 3P9LB 5MERA 3CFEB 1C5CH 4JANA 1TXKA 4ORGB 1U92A 1IM9B 2AXHA 4HMDA 3BDYL 1EBPA 5E4EC 1AQDB 4ETYA 4C4KT 4RMRA 3ZTNH 1OL0A 1VADB 4XBPA 3SDAB 2GJ6B 2D03H 3N1GC 1OAKL 2DD8H 1U3HB 4QYOA 4Y8AA 1QEWA 2BNQD 3GMPB 4JRWA 5DD1L 4J6RL 5KSAA 1N6QL 2QQLL 1G7LB 1VFMA 4NCDA 1ZXQA 2PYEA 3BZEA 3ULUC 3WO4B 4QXTB 3HZKB 1U36A 3EJJX 3ULVC 3P11L 4G8EB 3DGCR 4UNUA 2VXVL 3GJEA 2DQJL 3I50H 2HKHL 3SBWC 2IH1B 3LV3B 1QRNE 4OLZH 1GJIA 1QKZH 1NUNB 1QACA 5KW9L 2CLZA 4M6OH 2R2BB 2R0WL 1ERNA 3TYFB 4Q58C 1YNKL 3BISA 1YN6B 5HHXH 5DQ9A 4PIRF 1BZ9B 1GRWA 1ACYL 1Z5LA 1BREA 1EPFA 2V5RA 1WZLA 1U8LA 3RWHA 3K3QA 2VDLH 4K9EH 5K9QG 3U7YH 4F58H 5FECB 32C2B 3TBTB 2ZPKL 3BD3A 5I76A 1I8LC 3P9MA 4ELKA 5DJCB 2QADD 4XPFL 1MLCB 1L0QA 1S7RA 2BC4B 4R8WH 5CMAA 4R4BA 5GGUB 3OKNA 3OR7A 4ZFZA 5EORL 2Y6SC 1CBVL 4LKCA 5DQJB 3BGFC 1ZEAH 2WQ8A 5CLTA 4ZQKA 3D9AH 4LLWA 4EXPX 1JF5A 4NWUL 3V8CA 1A6ZA 4C58B 5ID1B 4KVCL 5DUPL 4NYLB 4MA7H 5B3JF 2HAZA 4XB7A 1BF2A 3CU1A 3GBNH 1B0RB 2BY2A 3J7HA 4LDOB 3KYOB 2WBJD 3T0AA 4ALAH 4GG6E 2ZUSA 4PRHA 3NPSC 4J4PC 5C0AA 2F58H 4AEFA 2KZ1B 4L4TE 5GRZA 3FB8A 2GTWA 4LKXA 2YK1H 1O0VA 3RX8A 1I9RH 3UMTA 3BN9C 3PHQB 1JHKH 4CU7A 2DRUA 2E7LC 4PV8A 5L0QB 2WSKA 4YUEL 3IFLL 1T2QL 4ODHH 5AUMB 5LGJA 5DHXB 2I25N 1JRHH 4JFHE 3WEXA 5E24E 1WZ1L 2HJKA 4HLJA 1HQRA 4NNXB 4XB8A 5BRZD 1J9CT 1KEGL 4LVHC 1K85A 2XKNB 2ZSWA 1JE6A 5HYQB 2DQFA 3KJ4C 3VGAC 1CQKA 1HXMA 3SCMD 4JFDA 4ZS7H 4AQ1B 1I9IH 3GSQA 2C3VB 1G7QB 3K2MC 5HVHB 2VXUL 2FECL 2IGFL 1TZGL 1I3VA 4BKLB 4P5KA 2GSGB 2VDQH 4WUKL 3LH2L 3RX5A 2M26A 3HFML 3IU4L 1QR1A 3VI4F 1N3NA 1MCOL 3QULA 3S35L 3EO0B 1H15A 3C8DA 1KGCD 5FUOH 5JR1H 1A6WH 1OP9A 1B2WL 1U95A 5IESL 4LAQL 4Q74A 5E6IB 1F58L 1U3JA 5T3ZD 4PJXA 5I8CB 3I2CH 5FGBC 3UBXA 4QRQB 4YHLH 4IJ3B 1TJHL 5F44A 4AH2A 4NQCD 4OB5H 4Q7DA 3ULUL 5D5ME 1LP9B 4PP1C 4Z77A 1ZE3C 2JB6A 4W70A 1S5HB 3MRQA 5GIRB 3P4LA 3ULVL 1XGTA 3T65B 5FYKU 5DMIH 3HPLB 3MREB 3NIDE 2DL2A 2XA3A 3QUZA 4WV1C 1CDBA 1YEHL 5HHMB 5FYJE 5I2IA 1AC6A 5D2NE 5LXGH 4AM0A 3L3KA 3ULSA 1P7QA 5FUZL 1S9XB 3W11C 4GG8A 4XAWH 1WIOA 3MBEC 4I1NB 4GMSL 4N5UA 2DMBA 1W72L 4M00A 3QFJB 1LO3L 3PWVB 4LRIC 2WIIA 5CHNB 1IC7L 5E7BA 2F15A 1I85C 1RK1B 3CXHJ 4IMKC 4P4RA 2AEIT 2HFEA 3KYMB 3U0TB 5HYJB 2FO4B 3HG1B 2ED8A 4HIJA 4X4XB 4JHWL 2E6QA 4U2ZA 2C7UB 4HKBA 3SDYH 3MLRL 4LFHG 4MCZA 3OQ3B 1UZ6E 1MFEL 2FEEI 3KS0H 1B90A 4LIQL 1X7QA 5I1HL 1RIVH 3BIKA 4X6FA 4XP6L 2UYLA 3CFKB 4L3AA 1FZJB 3AMLA 3TZVC 1TFHA 3P30L 4Y5XA 1N5AA 4NNYA 4FZEL 3QCTH 4HMEA 3SE4C 4M8QA 4HWUA 1T0MB 2BCKA 3VMNA 2C4FU 4UOJA 4OZHE 4TOYH 1BX2A 4H8WH 3QPQD 1QYGH 1BBDL 1FIEA 3BQUA 5K9OB 3TBWA 5DD3L 4Y16D 4HEPG 4DZBB 1F4YL 1LNUB 1MAML 2W9DH 3AFLA 4QWWC 4IRJC 3MV8B 5D96C 3RWCA 2FB4H 1JGDB 1WC7B 4BK4A 3DGGA 3D39E 3ARPA 3ZKND 1A6VH 3OKMA 1VHPA 5FV2A 4ELME 3KDMB 4P57B 4F33A 5A2JH 1A4KB 2EIEA 1HDMB 2V7NB 3GB7B 4KH2A 1XGPA 4Z5RB 2G2RA 4P2YA 3P73A 4HSQA 4I2XA 3O41B 4J3XA 1AXSA 3GRWH 1WBXB 4TVPD 5F7LB 2ICCA 3STLA 1CYGA 5DD0L 3QUKA 1VKXA 1XGYH 3IYLW 1P4IH 1INEL 5CD3A 3FMGL 3G6JB 1UA6H 5LWYH 4MDJB 5C0EA 2VSDA 3C5ZB 4M1DL 1ZVYA 1F3RB 1T1XA 2IQ9H 4HKZB 3NCEB 1TENA 3QZWB 3OKLA 2VDNL 2MKWA 4JJ5B 4BELD 2LVEA 5TDNB 1I7TB 3CJJA 3L5WA 2J2ZA 3WNKA 3FTGA 2VISB 3SQOL 5TDOA 5MEPA 2DI7A 4PLJC 1FVCA 1IRAY 4L9LA 5CJ8A 5HYIA 3QG7L 5DJAB 3EOBA 1NGWB 3VXNA 3HNTH 1F5WA 1SM3H 1WIUA 3D3VB 4C56E 4YPJA 1H3GA 1S7QB 2X4SA 1S8DA 4RMUA 2HN7A 3KPPB 4PJ9B 1BMGA 4NO5A 5FYLH 5ACZB 5D8JL 2PYEE 3MJ7B 2PW1B 1U42A 2HTKC 3MGAA 4LP4A 5AZEL 3ZO0A 3MNWB 3DLQR 2EDXA 4YXKL 1MNUL 2NTSP 1MUJA 3LZFH 1RZIA 2J6EH 2J8UB 4KROC 3BEWB 3MRHB 2X6MA 5GS2D 2I26N 3RGHA 4PGDB 2GY5A 1KJ2B 1S7TA 1A1OB 3T3PE 2SEBA 3VFPB 4KKCC 4XNUH 5CEZL 1JTPA 3GMRB 3QJFA 4UNTA 2B20A 3BZ4B 4PJEB 4FQXC 2PTTA 4J3SA 1A7RL 1QLFB 2AKRA 4OCYH 4QHMB 5DO2C 4QKXB 4H5SA 1NBYA 3HUJF 3O3UN 4YDIL 4P9MH 3RVWD 3CVHA 4Y0GA 1UCBL 2VAAA 1Q72H 3NFNB 1OP3K 1H0DA 2OI9B 4X9BA 4OIAA 3BJLA 4Z78A 3KLHC 2AEPL 4M48H 3HC3L 3IDJA 1AD0A 2BSRB 1U8IA 2VZVA 5I8KL 3MRIA 5EC1B 3SDAC 2VDOL 4UAOC 3KPNA 1U3HC 1VENA 5L7XH 2OBGA 3KJ6H 3X3GL 3M17B 4JPWH 5F7EH 1TCRA 5JIPA 5L2KA 3H9HA 1NAMH 5ID0B 5IJVB 2XG5A 1CU4L 4UDUB 4RX4D 2EDKA 4M02A 4U1LA 4XVSH 2EXYD 5IBUB 2VE6B 1KTLB 1NGYB 1KTRL 3WNNA 4RAUA 1EEYA 3S5LG 1KLGB 3T3ME 3NA9H 4L8CA 4OF7A 2FGWL 5E8EA 4Y4HD 4MLIA 1LP9F 4PRHE 4S2SB 3WL9A 4PRIB 5KSBB 2NQCA 3PABB 1NLDL 5F96L 1Z3GH 4WEBL 4FP8L 3RVTC 5I1KH 5DVMA 4X8JA 3Q6FA 2V5MA 2EDRA 5HI3C 4G6AC 2BXZA 3SN6N 1F6AA 2ZCHH 1INDH 1PX3A 3E6HB 1UM5H 3BUYA 3VGDA 4HUUA 1A6PA 4HXBL 4IRZH 1D6EB 4NQVB 2NX5E 2BJMH 1FCCA 5IG7A 4NM4H 1SY6L 2YA1A 3HB3D 1VGEL 4JZNA 4TSCL 1SBSH 1EZVX 3JV6A 3C6SA 3HCVA 3BYTA 3DOSA 1V7NL 1HWHB 5HJ3A 1KACB 5DLMH 3FQXA 4JO2L 2VQ1A 3EYUH 2BVPA 1ETZA 5EC2B 3S3PA 3UYOD 4JFDE 2HVKB 1N59A 2IPTH 1G1YA 5JW3H 3H42H 4QCIA 3VD3A 5I1IL 5TQ2L 2G60H 1IC5L 2UZXB 4P4KA 2IANB 2YPKA 3L95A 2CR6A 4K7PL 5EFIB 3W0WA 2VXQH 1PFCA 3B3IA 3QQ4A 5LQBL 4OGXH 3FAXA 2X4RB 1G9EA 1X5KA 4NP4L 4PJDA 1EO5A 1IGJA 4AEIH 4PJBB 3HNSL 2EYSA 1A14H 4Y19D 2C5DC 5D1ZD 3DBXA 3WKMH 4XP1H 1HSBA 1N6UA 5L9DL 5JNYB 1XZ0A 4HV8B 2MHAA 4P5TB 5IHLB 2GIYA 4KRPD 4LLMA 1YDPA 3MRNB 3BVNB 5D9SB 5JMOC 3HN3A 2UV3A 3T4YA 2FH6A 3P9WB 1EXUA 2XWBA 1CCZA 1UZ8B 5DA4A 3O8XB 1HINH 1SYSB 2I07B 1CXEA 3HI5H 3Q1SL 1QLRA 5DRWA 5C9JA 1P9MC 3ALXA 1FYTB 3SGEH 3PDOA 1IEBB 4OCSL 4PJAE 2FX7H 3EYVB 5IV2B 5D1XD 1R0AL 1MPAL 3ARBC 1UB5A 2F54A 2R1WB 5I71B 4MQSB 5HVHC 3RGVA 1XCQB 4FHBD 3OZ9H 1U91A 4GKSA 3QWRD 1FLRL 3KYAA 2E3VA 2Q76B 1DQML 4JG1L 4LPUA 4QF1A 1NFIB 3PXHA 4Y4KC 3G6JF 2EDYA 2CD0A 2EDEA 3O6FB 3MXWL 4WW1A 3K2UH 4XCYA 2VN4A 1HWGB 3MMEB 4OLYL 5E6IC 5BV7C 3EO1B 5HSFA 1N4XL 5C7XL 1OAXH 1NSNH 1MVUB 1GL4B 4IJ3C 2DQHH 2F53B 5CKGA 2GT9A 3I9GH 1EEZB 3ARFA 3SGJA 3C2AL 1MIMH 3FQNA 1Q9LB 5J6GB 1A2YB 4D2NA 5L8LB 3K1DA 3X11A 4MX7B 4KK8D 5HBBA 1FFNA 1BD2D 2YSSB 3MRJA 2OLDA 3ZHKA 3LS5L 5EPMA 2W65B 5FYJH 4B53A 5HGDA 4NWTH 2I9TB 3MLTB 3VXQA 5AAWA 4M3KB 5DMGD 4JB9H 1FQ9C 3TO2A 1DQLL 2RR3A 4EDWL 4R7NB 3C5JB 4LSDA 2XZQH 1P53A 3Q3GA 3W9EA 1P4BH 1J12A 1X5XA 2VUYA 2J8UF 3ZHLA 5JZ7C 4QNPF 4XVUD 4OGYH 2IPKA 5FB8B 5GXBB 4P99A 1KCVL 1M7IA 2BP3A 3H0TA 5HVGB 2VZUA 4IDLA 1NGQH 4KKBD 2I60H 4OM1H 1R24A 4MAUL 4I2XE 4GMTL 2E27L 4UB0H 1X3DA 2YD2A 4DUVA 2H8PA 3DSFL 3TA3B 1J05B 3QDJD 3CIQA 4LOUD 2X4PB 1F2XK 3SBWA 2D0FA 2GK0A 4LLYA 1JPFB 5BS0D 1ZHNB 3ESUF 1QLEH 2GW5A 5GZND 3SPVB 1OHQA 5KTEL 4D8PB 2CMRH 3QEGL 3ZKMC 2VN7A 3IJYB 1G0XA 1W72A 2MPAL 4HXAH 3TH4T 2AK4A 1PKQB 5IT2H 3NH7H 5C3LD 4X6BA 4O2EA 1QRND 3VRIA 5DRZA 2X4UB 4KJQD 2E6PA 3O6KH 3NIFE 4LHUD 4UINL 1I8LA 3FO0H 2D0HA 1PEWA 1FNGA 3X14A 4RGND 3M1BB 1KLUA 4YE4L 3SDDB 4WFHE 1S9YB 3DROB 2NY6D 1E27A 1MREH 2LFGA 5FF6A 1F13A 4I4WA 3RQ3A 2BNQB 5F9AC 3VXMA 3DO7A 2D4DA 2CKBA 5GGRA 1MRFL 5KSBF 4HBCH 5EO0A 3MBXL 3H7BB 3DVFA 2D7TH 4YDVB 4HK0A 2DKMA 4N0FA 4R4ND 2R0LH 5IMKA 3QXVA 4QOKA 2XY2A 4H0GA 3V5HA 4DW2L 5IFHL 4WHYG 2IQAA 4LQFL 4OZGB 4OIBA 1R3JB 1TZHA 4J4PA 4WW2F 3BZFA 3KLSA 4PJ7F 1FZKB 3VFRB 3VG0H 4WTZG 2JJWA 3RWIA 4EBQH 3N1QC 4N8CL 1OY3B 2AABH 3AS3A 5D7IB 5F97E 3LSOA 3MRDA 4AL8H 3QAZB 4LF3A 2CLRA 3TT3L 3PWPB 3FQWA 3CFBA 3S36L 2OR9L 3QI9B 1Z0MA 1LEIB 4IOIB 4WI2A 3HKFA 5C0DA 1T20B 3S7GA 3V8OA 1A7PL 2BNRA 2X4TB 2O5XL 3KHQA 4XI5D 4P59L 1S3KL 2FATL 3MV7A 5BV7L 1DQQB 3BP4A 4LFHD 4XVJL 1H8OA 3CDGB 5GGVL 3VCLA 4KQ3H 5I1EH 5J4MA 3MLYL 1BEYL 2GAZA 3QWOB 5J9PB 3WFEL 5L2KE 3GMOB 1ACZA 5EDXA 3MYJA 2B0SH 4UQ2A 3U36B 1KEMH 4FQCL 4JFHD 4PJ9C 1T2JA 4KY1H 3EJYC 4PJBF 3SDXA 4NQDE 4WCYL 1DBKL 1X4XA 5LAXB 2ATKA 5D7LB 4YO0A 2IAMA 5AYQA 1L4IA 2OL3B 4CDGC 3L3DB 3FL7A 2Q7YB 2V2XB 4UIMB 3CFJB 5IHBA 2WBJB 3WFBH 3N9GL 4M7KH 1FVDA 2FZ3B 3R0MA 1I9JH 4JFYB 2GTZA 3H3BC 4LRNH 3SDCD 2XZAL 1KT2B 4PRAB 3BMVA 4Q2ZB 3IDMA 5DWUH 5EIQA 3B83A 1AFVH 3TBVA 4W4OA 3UPAA 4MCYA 2FYYA 1YMMD 2ICWI 1HYSD 1SJHB 1E6OH 4GAJL 4ZXBB 1NPUA 3OJMB 5ERWA 5SX4H 4J3VA 1CGXA 1JPSL 3QRGL 4PY7A 3F12A 1MCHA 4F7EB 5D71L 1CGTA 2IALA 2PETA 2H3NB 4NT6B 2DYPA 4ZTPH 4KKLC 4XNQB 3UYRL 5BRZB 4D0CB 1I3RB 4LRIA 2J5LC 3R06B 1LWRA 3SCMB 4P0DA 2YUZA 5C0JA 1I85A 2A74B 3DX7A 3MOAL 1K4CA 4X9IA 4PV9A 1JK8B 4FQIH 2C9AA 3L5JA 3W0WE 3H8NA 3LQZB 1F90L 3VRLE 4X9HA 4LCUB 3I75B 4GRLD 5HHNB 4BM7A 4PJFE 4PJDE 3GDBA 1YEGH 1T5XA 3TZVA 2CIIA 3H7LA 4WFFE 1CVRA 2M2DA 1BVKA 3CH8A 3U2SB 1P2CB 1XFPA 5LG1A 3SE4A 4F9PA 5IEKA 4GT7A 1DDHB 3WHXA 3G5ZB 4G80B 4WW2C 3LKRB 4Q9QL 3MRBA 4FFZH 1QSFB 2A9ML 1DCLA 4LLVA 4NQCB 3WNOA 4GH7B 1MJUL 2CR3A 1F4HA 4KK9D 5GRVK 4BQCA 3L3IB 4KKAC 3PDDA 3U4EA 2EO1A 3GMQB 5E1HB 2J4WL 5HGBB 1W0YT 4FFVC 4I9WE 3TPKA 4APQD 1ORQA 3U4BH 4IRJA 5JXED 1DFBH 2R4RL 5FM5O 4JY5H 3VWKB 1E28A 3NACL 5ESAB 3DYOA 4LEOB 2YRZA 2EH8L 1CK0L 1I1FA 1U8MB 4ZUSA 4R4FL 2F54E 1MFBH 1HKFA 1JPST 3VDAA 4FA8A 1CQYA 2YWZA 4Z7UB 1IGTA 3AS1A 1HKLL 1NC2A 1BQLL 2A0LD 3UJJL 1NBVL 3MODH 5KSVB 3D39D 1RURL 1D5XA 5E8NB 3DYMA 4XCFL 4DCQA 9CGTA 3VGGA 3LHPH 1RUQH 1ADQL 1YEIL 3I3BA 4KHXL 2WWKO 5DFTA 1SY6A 1UQSA 4DGVH 3GI8L 5A16B 1AQKL 5J12B 3QCUH 2X1QA 3B9EA 4PRBB 5EIIB 4FFWC 3QA3A 1CGSL 1I7ZA 4KJPC 4ZPVA 1KNOA 4MGXA 2BDNL 5DFVC 5F7KC 1PW3A 2YEZA 4MQ7B 2Z8VC 4PR5A 4L3CB 2PO6B 5LCVH 5DGRA 3K8KA 3E6FB 5C8JB 3P4OB 2BSED 2WQRA 1HNGA 1CL7H 1YPZB 1LEKB 1FCGA 1KJ2L 5DZLA 1N26A 4HUMB 5LGKA 3RDTB 3IFOB 3RPIB 4KJYB 3VJ6B 4OLXL 5KS9B 4KI5E 25C8L 1F4AA 5LJYH 3AREB 2DDQL 5MENB 3D87B 3WBDA 5I71C 3ARGD 4QRRE 4OZGF 3EO9H 1JZ4A 1EUTA 2MMXA 1HOCA 4I3RH 2XWTA 3UP1A 3V4PL 4N0CD 1NFDA 1NEZA 4RFOL 4JFEA 5SWSB 3QG6A 4GKOA 1ZANH 5E9DA 1KN2L 3UTQB 1Y6KR 4MA3A 3DUSB 5D7JD 2NY3B 3O6FC 4C56D 5IW1A 5D7IF 3JWOC 1QTYT 1WVZA 3U4AA 2DQTH 5E1AB 3PDGA 4BZ1L 2ICWB 4PGBA 2H9GB 2FEEL 1KYOJ 4JZJB 1JI2A 3FB7A 3PL6B 3PQYB 2KL6A 5EUKA 1J0IA 4UV4L 1S9VA 1WICA 3G6AB 1RHHA 2BX5A 2ORBL 1WWBX 1GC1C 4QHKJ 1I1AB 4WENB 4U3HA 3RY5A 3RWDB 2AK4E 5JA8B 1MRCL 1KB5B 4X6CB 5FM8A 4DQOL 3NFSL 3AXLB 1P1ZA 4HWEL 5TFSL 1F8TH 5DJZB 4YX2L 5KN5A 2HLFC 1EERB 3ARXA 5H35A 5IB1B 5DURB 2VJXA 3KPQB 1KOAA 1I7UB 3GMPA 5FUCE 1EGJH 4M6NH 2HFFB 4HG4J 4BH8B 3QUMA 4U7MA 4OCXH 4OI9A 4Z0BH 2X4OB 3LOWA 1MCCA 2Z92A 4O2CB 1HNFA 5ENWA 4BZ2H 1NGPH 2AS5M 2AJZA 4GQ9L 2VMFA 4WFGE 1QO3B 1AXTH 1T66C 3TA3C 4QOKE 5F1KC 4ENEC 2E6JA 2ZJSL 2EEBA 3VH8B 5DDHA 3LV3A 2NY0C 5LVEA 3RIAK 1NLBH 4XPAH 2QQQA 5HGGS 4MXWH 4Q0XL 4XNYL 3CSYB 2D7OA 3TYFA 1FG2B 4OCRH 1YN6A 1H5BB 4JCMA 1P4LB 4QY8B 5A1AA 1CGWA 5SV4A 4C83A 4H0IA 3AY4C 4KQ4L 2VLJA 3TIDA 5KVEL 4WDIB 1BZQK 1IEAA 5FECA 4NM8H