3GGWA

Crystal structure of fab f22-4 in complex with a carbohydrate-mimetic peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSDGITYLYWYLQKPGQSPHLLIYHLSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGIYYCAHNVELPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB F22-4 LIGHT CHAIN
publication title Structural Mimicry of O-Antigen by a Peptide Revealed in a Complex with an Antibody Raised against Shigella flexneri Serotype 2a
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 218
sequence length 218
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ggwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ggwA01
1T7ZA 1P2CA 4ZQKA 3SKNA 5C9JB 2W0PA 3MRIA 2HN7A 5ESVA 5ICYA 2Q20A 2DTSA 2R0KH 3SE9H 3KLHC 3ARTA 5D6CB 3QNZA 3EYUL 2VIRA 4NCC1 3WXVL 3V6FA 5IT2H 1I3RB 4HBCH 4HCRA 3VGGA 2HTKD 4N0YL 3ZE0F 1G6VK 2Z92A 4LRNH 1QSFA 5DYOA 7FABH 3QHZH 2YBRB 4F9LC 4YXHL 3QDMD 5CBAA 5CINL 4P5MA 2NQCA 5BO1L 3FT4A 3GJEB 3OKLA 1DTUA 2KQMA 4U7KA 4Z7NF 1AI1L 1P2CB 4ZQKB 3SKNB 1F8TL 1TZHA 3B2VL 1LO4L 2HN7B 3MRIB 5ESVB 1KXVC 4EN3C 5ICYB 1A3LL 1DL7L 3CD4A 3PQYA 4MWFA 4QTIL 1NGPL 3QNZB 2VDOH 4GG8A 2BFVL 5ESAB 3V6FB 4QXUL 2Z92B 4JZOA 4KJWD 4U33A 1QSFB 4IOFD 5DYOB 2AJYH 4EOWH 2LU7A 1V05A 4X6CB 2PYFB 1AGDA 1GGUA 4GXUN 2P7TA 4NN6B 5CBAB 3RGVA 4P5MB 4XTRD 3FOMA 2WAHA 3FT4B 1TJGH 3OKLB 2P48B 1WUNT 4PRNA 2V5MA 2B1AL 4OLXH 1TZHB 4XHQA 1FGVL 4LSDA 2A6IA 1INEL 1F2QA 4R26H 3PQYB 4MWFB 3ZKXC 5J12C 4GG8B 3NTCH 3FFCA 3KHQA 1OM3L 5LCVL 5E2UL 1Z5LB 4JZOB 3M8OL 3U46A 1AGDB 4ODHL 2P7TB 2J1KA 3RGVB 3FOMB 5EU7E 2X9XA 4WHTA 2F74A 3F7VA 3LQZA 3NCYS 4APQA 4MQSB 1UACH 1MHHA 2N7BA 5FYKH 1SMAA 3VFGH 4DGVH 2FHBA 4D94A 2CSPA 4JLRA 3EYSH 3QDHA 4YHIA 2ZG3A 1D5IL 2AK4D 2DQUL 3FFCB 1WF5A 4U1MA 4K55A 3QDGD 4RFOH 3GSRA 1DCLA 4OD3L 4MJ2A 2EDLA 3U46B 1QFOA 5TE4H 3EOTH 3D39D 1YYLL 4WHTB 2F74B 1L6XA 1MCPL 1MWAH 3F7VB 4YHKH 2EICA 4M6NL 3CXDL 1MHHB 2DQJH 2X4NA 1CZ8H 3SDAA 4I1NB 4JLRB 3VXUA 3GI8H 2QSCL 1UXWA 3VFTA 1KLFA 3MNWA 4G42A 4HKJB 4N9OB 4U1MB 2VTFA 3QUXA 3GSRB 2Y1VA 5EULV 5FHAL 2AS5M 5DO2C 1FAIL 1EGJL 4GG6A 4YHML 1HN1A 4LLWA 1YY9D 4WO4D 4JDTH 4JG1H 5GQBA 3GM0A 1V3MA 3DBXA 5CGMA 2CO7B 3PHSA 5ACMA 1GGCL 2PW1A 3MXWL 3C5SA 2X44D 5IMKA 3BPNC 4K94L 3SDAB 4P5TA 3VXUB 1UA6H 3TH4T 1KACB 1UXWB 2Z0BA 4L8SA 5F71A 3SOBL 3VFTB 3MNWB 4G42B 4NRYA 2E7CA 3QUXB 5AG8A 3B9EA 4MVBC 2CR3A 3S6CA 4GG6B 4KROB 4LLWB 2O93L 2QV2A 3LEVH 4HFUH 3H3KA 1LP9A 5KSBF 5IHLB 3DBXB 3UO1L 3ZTNL 4M61A 1HYSD 4B0MM 2PW1B 4L3EA 5I18H 1OCWL 4Y5VA 1MIML 1UCBL 3NZ8A 5EUKA 4NO5A 4P5TB 5LBSH 5CJOL 4L8SB 4NGHH 4ELME 2UWEE 4P2QD 3HN3A 1MRFH 4L4JA 3MRHA 2BOBA 3V4UL 1WGOA 5F7WC 5AEAA 1AO7D 1LO0H 4GW5A 3WLWD 2MQ0A 4KK5D 2Q7YA 3PDGA 4YFDB 3CJJA 1KTDA 1R5VA 3I9GL 5I71C 5ICXA 3SJVE 1FIEA 4F33A 4M61B 4U6XA 3CLEH 1UC6A 5GJSL 5DUMH 2EDXA 1E4WL 4Y5VB 5KOVC 1GZQA 3NZ8B 1DN0A 5EUKB 4NO5B 4I48A 5ESQA 5C0FA 4XNUL 2ZKHL 1KB5L 3MRHB 3RWJB 2BOBB 1JWMA 1NEZA 5TF0A 1H3PH 1GPOL 2IGFL 4GAJL 5FUZL 1J1PL 2ZUWA 1MNUH 4GW5B 1TQCC 4KMTH 3RKPA 3C09C 2Q7YB 4YWGH 1BIHA 1ULVA 1Z9MA 4QKXB 1KTDB 1R5VB 1G6RH 4KRPC 5ICXB 1E4XH 1NAKH 3LAFA 4U3XA 4F33B 4U6XB 1JNNH 1GZQB 4PJ5A 3MZGB 1DN0B 4WGVB 1NGXA 4I48B 5ESQB 3ALWA 3IXAA 5C0FB 3OQ3B 4LHJB 4GQ9H 3D9AL 3OX8A 4MYWB 1JWMB 4CRPA 1NEZB 4XWGH 5IV2A 1P53A 5E9DE 1I7ZA 1KCVH 4PLKD 2DJSA 3VW3L 3GI9H 4ZO6A 4PRPD 4P2RE 1NCWL 1PKOA 3MV7E 4XHJD 3MMEB 3NZHL 1P4BH 4YHZH 5BV7H 2P5WD 4TVSa 1J5OL 3BN9D 3IFLL 3LVEA 1MFAL 4EBQH 1NCBL 4NJAL 5SX4I 2NXZC 3P77A 4M1CC 4PJ5B 3T0AA 3CFDA 3MJGX 4P3CH 1NGXB 3L5IA 3IXAB 5D2NE 5GRUH 2ZCKL 4X80L 3OX8B 4I18A 1UEMA 1BGXL 3RWCB 3QEUA 5DGQA 4Y4HA 5BOPA 3C60B 1YEFH 3O6FA 3S88L 1U58A 5J3HD 4PJ7E 3WIHA 5FV1L 2AXGA 2V5RA 3L5JA 3R0NA 2HWZH 4QYOA 5CP7A 1GRWA 4FQ1H 3RX5A 1X44A 3MCKA 1CD1A 15C8L 3SHSA 2V7NB 3G6JA 2VKWA 4Y16C 4B7IA 3CVIH 3P77B 2GFBB 5E5RB 5LWYH 2X10A 3CFDB 1FYTA 3GRWL 4TSBL 3VXRE 5GGTH 1NLBL 1I85A 4I18B 1K5NA 1AR1C 1W8OA 4Y4HB 1A8JH 4BZYA 3O6FB 2XZCH 4TSAL 1RZKH 1U58B 5JPNA 4WHDA 3S36H 2O5ZL 2AXGB 4QYOB 5CP7B 3TN0D 3DHMA 1IGIL 4M48L 5H35A 1W72B 1FL3A 3MCKB 1CD1B 4R0LC 4WW2C 5LXGH 3G6JB 3SE4C 1IFHL 2CH8A 4J3OC 1A7OH 3TCXA 3O41A 1FYTB 3Q5TA 3LKNA 2J5LB 3HI5L 1F6FB 1FH5H 3ILQD 3L3HA 1K5NB 3V79C 4NQVA 5I6XC 3V8CA 4XMPL 3STBA 3UYRL 5JPNB 3TA3C 3VDAA 3O9WC 4LBEB 1CTNA 2EXWD 4OCLC 5H35B 1FL3B 4OIIL 4JRXA 1JI1A 3EDFA 4JG0H 3CZJA 4XP4H 3T3PE 2NXYC 5C2UB 1A1MA 4O5LL 5F9DC 3O41B 1TTUA 1RSFA 1F4YL 4PJCE 1JMZA 4LASH 2D7TL 3OHXA 4DCQA 1JPTH 3L3HB 5FYKU 3H3BC 4XAKE 5D8JH 2AEIT 1IRAY 4HJGA 2QQKL 4WIQA 5HI5C 3DETC 4NQVB 1H8OA 4PJIA 2CJUH 1BWMA 5FO9A 4YDVA 4JRXB 4JR9H 4L8DA 2Y5TA 4WI5A 4XVSL 3HMWH 1A1MB 1NBVL 4OUUA 4JREC 3L3OA 5C09E 5HGAA 3SDXE 2ICWI 3OHXB 4DCQB 4LVNC 1FFPA 4HJGB 2D03H 3T09A 3ZDZF 5EB9A 4QXGL 4PJIB 5FGRA 5IESL 5CJ8A 3OKOA 1TVHA 1UZ6E 1F90H 5FO9B 4YDVB 3AB0B 3DYMA 3UZQA 4L8DB 2VLJD 1JRHL 2QQLH 1DDHA 1QTYT 5E99H 5C0AA 5HGAB 1QLRA 1MOEA 1NCUA 4KY1L 1FFPB 4EXKA 3W82A 1CLYL 4G6JL 4GRWF 4BSJA 2CXGA 2WUBL 3BFOA 5HDOA 1MELA 4I0KA 3W81A 3X11A 3OKOB 3L7EA 4PPTA 2J6EA 1TVHB 3SDCA 5C7XL 3RU8H 4KJWC 1NLDH 1RULL 4X9IA 2DQGL 5CUSH 3WFEH 2BY1A 3QXDA 4XTRC 1DDHB 5C0AB 4BYHA 5ILTH 2YEZA 3BP7B 1A64A 1QLRB 3QZWG 3TBVA 3OBAA 4LL9A 2X40A 1BOYA 5EU6A 2A9NH 4LLYA 2VXVH 3ZHKA 5HJ3A 2OBGA 2Z8VC 4RX4D 1MJ7L 3L7EB 1SHMA 3NIDE 3FQRA 4M9OA 3SDCB 5FB8A 3ZYJA 3BYYA 1A1NA 2CKBA 3HCVA 4QHLA 1FYHB 3V95A 1U42A 3T2NH 2GY5A 3QXDB 3CSBA 1KGCE 2BCKA 2YEZB 5B39G 2ADJA 5E8DH 1A7RH 2XG5A 3TBVB 4X98A 5HHME 5F7MC 5IMOA 2PR4L 2C9AA 4KPHH 3QQ4A 1R3KA 5IFHH 5AWNL 2R2CA 2OP4H 1IC1A 2WM0A 5EU6B 4X6CE 1IZKA 4LLYB 4PJGA 3VFWB 5HJ3B 2DMBA 4OLWL 1RUKL 1GGIL 3CXHK 2DTML 1T7VA 4DK6A 4WI3A 3FQRB 1IKFH 5FB8B 1ZA6A 1A1NB 2CKBB 2CUIA 4PJHE 3HCVB 3LN5A 3O6LH 4QHLB 4QRUA 1KFAH 3ZT7A 4NQEA 4DW2L 1QP1A 3ULUF 2BCKB 3C8KA 2F53A 2ADJB 1T80A 2A2QT 4X98B 3S37L 4B53A 5F6HI 4E5XA 3F7QA 4UUJA 1M7DA 4MMXC 2V17H 3IFNH 3QQ4B 1R3KB 5KSAC 1HSAA 4RMVA 4NDMA 4WVRA 1KJ3H 4PJGB 4O2EA 3T0DA 3C8HA 2EH7H 1QHPA 2W65A 2NY0D 4D2NA 2WBJA 5DQJA 5DMIH 1Z3GL 4HS8L 4RMWA 1ZA6B 1SJVA 3LN5B 4QRUB 4YGVA 1YY9C 4NQEB 4X9HA 4OFVA 1FLRH 3EUUA 1I4FA 2YPVH 4LFHG 3C8KB 1KB5A 2F53B 4PG2C 3RAJL 5T3ZH 2Y7QA 3VGAC 3V6ZB 3FFCE 3VI3F 4E5XB 2V2WA 4M6OL 2OCFD 1AQKH 1M7DB 35C8L 3MNZA 1HSAB 1F5WA 4NDMB 3O2DL 1WQVT 3ZKQD 3D1MC 1NC4D 4O2EB 2X05A 2W65B 2WBJB 1PLGH 3MCLL 5DQJB 5EWIL 4YDLB 2J12B 2RCSH 3TO2A 1WFUA 2X9WA 1JCKA 1TNMA 3QFDA 3T4AA 3G5XA 4YGVB 3TT1L 5EU4A 3TO4A 1I4FB 1NUNB 3KYNA 3HNVL 3B8YA 1KB5B 1IL1A 4OCYL 3WFDL 2Y7QB 2V2WB 1J1XH 4D0CA 1HYSC 3MNZB 5F8QC 4L4VA 3MLWH 4I0CC 2Z8RA 2XZZA 1NFDA 3RVTD 4QF1B 4FQLL 1YEDA 25C8L 2BSSA 1R5WA 1QLEL 1R6VA 3TO2B 1RZJC 3IFPA 3LQMA 3WLWC 3QFDB 5LGHH 3T4AB 3G5XB 4KK5C 1UM5H 4POZC 4IM8A 4X4ZA 5EU4B 3TO4B 5F7LB 3KYNB 12E8H 1UWEL 1MLBA 1IL1B 3VXUE 3C9NA 4RDQG 3CU1A 5IMLA 1CL7H 4RDQF 4D0CB 3BDYH 5ISZD 4L4VB 5JO5A 2A6JA 3UTSA 5SWSA 1NFDB 4LCIH 3LKPA 4GG6E 1YEDB 2DQDH 2BSSB 4IMKA 1R5WB 1QSEA 1B0GB 1G0XA 5J7CC 4ZUUA 3IFPB 1LEGA 3X3FH 4KDTA 4N0CD 1JZ2A 3G6DH 4F7PA 5GS2H 5EOQL 3NFSH 2QADB 1K8IA 2NYYC 3GRWA 3U48A 4K9EC 1S7UA 2O5XL 1MLBB 1F6LL 3SJVD 3C9NB 2CK0H 1FVEB 5IMLB 4KI1A 1LGVA 2NMSA 5B3JE 1MCIA 3BOVA 3IT8D 2UUDK 2NX5D 3UTSB 3TC9A 5SWSB 3LKPB 3VRLF 4Q9RL 3L5WA 1YQVL 1QSEB 3G04A 1S7VA 1SEBA 4ZUUB 4PLKC 3G5VA 1LEGB 4OB5H 1EJOH 1HINH 3QI9D 5C0ND 2D4DA 4F7PB 5DT1H 5HHNA 4XHJC 1K8IB 5HYEA 1S7UB 3GMPB 3LKRA 5B8CC 4BKLA 2GJJA 3VFNA 3WMSA 5GZND 5AZ2L 2ED8A 4HK0A 4OD1L 3FB6A 3PIQA 4MD4A 1A9EB 3GSNA 3L5WB 3TT3H 2AJXL 3G04B 1S7VB 1SEBB 4P2RD 2AQ1A 3G5VB 1E4KC 3MV7D 4Q0XL 4A2MA 4KVCH 3DGCR 4NN7C 4ZTOL 5HVFB 1VENA 5HHNB 3GSWA 5J3HC 3KWWA 3LKRB 1XR9A 1EEZA 5GRWA 2Q8BL 4R4ND 4UILL 3VFNB 4BKLB 5IGXL 4PY8J 4O51A 2ZJSL 3QIWA 4HK0B 4YHOH 1NKRA 2F5AL 3FB6B 3GJFA 3PIQB 4MD4B 3RHWF 1FZOA 5I1DA 3CFCL 1AE6L 3BXNA 3QWQB 4HMDA 3H6JA 5DI8B 3GSNB 4CVUA 3L5XH 4EJ1C 4LLUA 5FYJE 3ARYA 3ULVH 1Q1JL 4HULB 4M7ZC 2FJFA 3GSWB 3KWWB 4XPGL 1RY7B 5FM8A 2MKLC 3IRPX 5F97E 1CN4A 1IAMA 1EEZB 3TN0C 5ANMA 3D0VA 5JW4M 2C3GA 1U8PA 4UQ3A 5I9QC 2HFGH 4K3DH 4D0BB 4O51B 1OT1A 1XAUA 3FRUA 3QIWB 4PJ8D 2NY7L 2XWBB 4N5ED 2AEQL 3GJFB 3VXRD 5I1DB 4FXKA 3BXNB 3ILQC 1QVOA 2Y06H 3RHWK 5T33H 1I1YA 2OXHA 4M7LT 4YBQD 5FO8A 2C3XA 4JO4H 1J0HA 4X7SH 2FJFB 5EO0A 4HAFA 3RTQA 3RZCA 1WITA 4NN5C 2EXWC 5ANMB 3D0VB 3FKUS 4URTB 4UQ3B 1U8PB 3T0EC 1F4WL 5HDQH 4FFYL 3FRUB 5JW5A 1JHLH 1YEHL 4YHPA 1LE9A 1A6WL 3PXJA 3IU3A 4LCCA 1CLZH 5FGCB 4FXKB 3UTZA 4C54A 1QVOB 5DVLA 1I1YB 3P0VH 1OAZL 4NO3A 4Z7OE 3CU7A 3HMXL 5FO8B 5E1HB 1C7SA 1DQML 1U8LA 1EVTC 3KVQA 4BFEA 4H20L 3BKCL 5TFSH 1CDUA 2K3TA 2VWEC 1UWGH 1HHHA 4L1DA 5EO0B 1D6VH 1YYML 4M7JH 1NAMA 3RTQB 3RZCB 3SKJH 1GIGH 2ADGA 5GS0C 2DQFA 5D93C 1FYTE 4CN6A 5HYJD 4J4PA 5FA3A 4XP9H 2ENSA 5JW5B 2LAGB 4RMRA 4YHPB 1LE9B 4HIHA 1R24A 5JIPA 4FFVC 5J56B 3IU3B 4LCCB 4U31A 3UTZB 3VFUA 2R4SH 3PABA 4NO3B 2YRPA 4WUKH 1JL8A 1U8LB 2YS4A 4NZUH 1NL0L 1AFVL 1GAFL 2NY2B 1HHHB 4ZD3H 1NAMB 2OL3H 3PDOA 3RDTA 2ADGB 4LVHB 2DQFB 1AY1L 4ODUB 1ZT4A 4U6HA 3EOBA 5FA3B 4TULL 1UG9A 5EFIA 4ONGL 5KVEL 1K3IA 3EO9L 2IADA 4HIHB 1R24B 5C09D 4M62L 2GHWB 6FABH 4S1QH 1OTTC 3RX7A 1BVKA 1RV6X 2VZUA 4ONHA 5F9OL 4MB3A 4WWKA 4KI5E 2EDHA 1A3RL 1X4XA 4LKXB 4ZXBA 4MLSA 5D7JD 4JRXE 5ECJE 2X1PA 1ZLSL 2GT9A 3RDTB 3PDOB 2ERJC 2XTJB 3QG7H 1ZT4B 4U6HB 5T3XE 3EOBB 5EOCL 5KSBB 1MI5A 3QUZD 3MA9L 1LQSR 2A6DA 3FB8B 1FAKT 2IADB 1QG3A 4HMEA 4PJIE 2VDQL 2RAMA 4R4FH 1CDGA 2FECL 3QR2A 3QEQD 1BVKB 2I60H 2AK1L 3WJJA 2ESVA 4LEXL 5DUPH 4WWKB 4FQCL 3SDYH 1C5BH 4DUWA 4ZXBB 3E1F1 5C6WH 2GT9B 1FNHA 4V1DE 5FM5M 2E9WA 1V3JA 3CX5K 5F96H 4LSQH 4O9HL 4E9LA 1KT2A 5BMFL 2AXJA 2G5RA 3UJJL 1QBMH 2A6DB 2VLME 5C8JA 4OGYL 3QT2A 2ESVB 1B2WH 4YJZL 2VN4A 1N4XH 4JFHD 4ZDHA 5J9PA 4KRNA 3TP4A 4JN1L 4PRIA 2IALA 2JE8A 2Y23A 1F4HA 1YJDC 4RAVA 1T7XA 4YC2B 1XEDA 5GGRA 3MODH 3CFEA 1UYWL 3HRPA 5C0AE 2AEPL 3GHBL 5C0RL 4GOSA 5D6DA 3T0BA 4OIAA 1KT2B 2AXHA 4LHQB 5K9JL 1IGFH 1I9RH 4OCNC 2IANA 1KGCD 5EU7C 5C8JB 2EZ0D 5T1LA 5HHMD 1T2XA 4JPVL 3ZDYF 4XNYH 4OZHF 4LLAA 3K8MA 1NCAH 4ZDHB 1EERB 4FXGA 3AUVA 2VDKL 2IALB 4PRIB 4RAVB 4DQOH 3MV8D 2GJ6B 3PGFL 5D72L 3UAJC 2NY0C 5C08A 5GGRB 3IGAA 3CFEB 4WNQA 5D7LA 1I9JH 3QHTC 3HE6D 1AHWA 4OJFH 4TVPL 2FNBA 4CU7A 2IANB 2HH0L 3P0YL 5T1LB 3TLRA 3FAWA 4HF5H 1HWGB 3MRPB 4X4XA 3CH8A 4FXGB 3UTTA 2ZCLH 2P8MA 1MEXH 1T0PB 5DR5L 1TMCB 2IAMA 4F9PA 3OL2A 2NY6D 1TQBC 3N1MC 1QPXA 1WISA 5C08B 3IGAB 5D7LB 4JB9L 4WNQB 5LAXA 2FSEB 2UZIL 4XXDA 1J7VR 4UBDD 4HC1L 1AHWB 3CDYA 3MLVL 4JFFD 5BVPL 4GXVH 3NCJH 2NTFA 2QSTA 1I7UB 1WWBX 2WUCH 4M1DH 1MY5A 2BSED 3NACH 4D9QE 2DI9A 4X4XB 4ZS7H 2W0LA 4NRZA 2EIZA 4QY8B 4GO6B 3UTTB 4DKFL 2P8MB 2WIMA 3W9EA 2IAMB 3PL6B 1YEJL 3RVTC 4NOFA 4ZUWA 4Q9BA 2R0WL 4NQEE 1D5MA 4H0HB 5IEKA 4YLQT 5LAXB 4XXDB 3SO5A 3DMMA 4PUBH 3ARSA 3GHEL 5E2TH 1IQWH 1J1OL 5DRXA 2NTFB 1MAMH 2MHAB 2ZUQB 3D85D 4CJ0A 4ZAKA 4NKMA 2P45B 1BBDL 3KYKL 5GPRA 3TPUA 4NRZB 4K2UH 5DJ2A 2EIZB 3EDKA 5T1MA 4PJBF 3DVNA 2EDOA 3W9EB 4CU6A 2BHZA 4LAJH 3TV3H 2XQBL 5LVEA 4ZUWB 4X7CC 1D5MB 4QTHB 4A6YL 2FBOJ 4L3CA 5IEKB 3T0WA 3C08L 4IS6A 2WLZA 3RA7H 3AS3A 3CSGA 2H8PA 1T66C 1R0AL 4CMHC 4N0CC 3DMMB 3WLBA 4KK8D 1DBBH 3VXUD 1EK3A 5DRXB 3TF7C 2AJVH 2EYSA 4FG6C 1EH9A 1IEBA 4UV4H 3QO0A 2I25N 4NKMB 3TPUB 4Y4FA 4HD9A 5FHBH 5I73B 1HILA 1UM6H 5DJ2B 2HRPL 3BZFA 5T1MB 5B38G 3DVNB 2ARJA 1J0ZA 3NCEB 3GMQA 2WWMC 2ZSWA 1ORQA 4KK6D 3RBGA 4L3CB 3DRQA 4IS6B 2H8PB 1QFUH 3HFMH 2OJZL 1CT8A 1CLOL 3WLBB 1WAAF 1MCDA 3VWKC 1G7MA 4L4VE 2QL1A 4TSCH 1HKLH 2EYSB 2YKLH 3SBWA 4QLRA 1IEBB 3PHOA 3QO0B 4OCSH 5KTEL 4UTAL 3IDUA 1X6NA 4Y4FB 3QRGH 2BRRL 4TTDD 4MA8L 1HILB 3BZFB 3ZLQC 2AKRA 2OQJA 2ARJB 3O4LA 2YD4A 1IM3A 4LIQH 1C5CL 4ZNCD 1MSPA 3DSFL 5DF0A 3GMQB 2ZSWB 4M8QA 4E41A 4UT6L 5IM7A 3DRQB 4FQQA 4HWEH 1CT8B 4JO3H 5GGQH 1VFAA 4NNPL 5DHXB 1U8NB 4MNQA 1RHHA 1G7MB 4W6WB 5EUOA 5SWSE 1AC6A 4R4NC 4BQ9A 4NO2A 3PHOB 5IHUH 5J06A 5CMAB 1QSEE 4JRYA 4XMLH 5DGRA 1KB9K 4J3SA 2AKRB 5SWZE 4GRWB 1A7QH 5D2NC 3O4LB 1U3YA 1IM3B 2YD2A 5C2BH 2VAAA 4M93B 1R3JA 1RJCA 5JZ7D 3F65A 4M8QB 2H3NA 4E41B 1TDQA 5IM7B 5K9QI 5E2WH 2GQHA 2VABA 3LB6D 4J3WA 2DBLL 1VFAB 3ARGD 4Q9QL 4XAWH 4MNQB 1RHHB 5EUOB 5D7SH 4U1NA 4NO2B 2XKNA 1JTTA 3OZ9L 4KWUA 3TCLA 4O2CA 4RZCA 3NBNA 2DJ4A 1A14H 3TVMD 5IKCA 4PJ8C 4JRYB 4P46A 5F72S 3QP3A 4YE4H 4N5EC 2E7LA 1KC5L 3ZE0E 4JO2L 4Z8FL 1FO0A 2VAAB 1R3JB 2H3NB 2B5IC 1P7QD 4XVJL 2N4IA 2BVUA 4LNRA 2IH3A 3RIFF 2VABB 5CSZA 4NQSA 1NFKA 2RJMA 4E0RA 4P23D 2CD0A 4U1NB 2XKNB 3TCLB 1EBAA 4O2CB 4RZCB 3H9SE 3C60D 4PB9H 2BJML 5B8CB 4P46B 4JKPH 4LU5H 3TPKA 4RGMB 4YNYA 2XQYG 2VDRL 1FO0B 1UENA 1XGYH 2CR6A 1GGYA 3EJJX 1RJLA 3SQOH 1N2RA 3ARBD 1FNEA 2Q86A 4LNRB 2IH3B 4JO1H 3R06A 1YNKL 5CSZB 5DC0A 3PHQB 4NO0A 4TPRH 4NQSB 3RIFK 1D6EB 4JZJC 3C2AL 4E0RB 5EIIA 3WCYA 4QHKJ 3JWOL 4K23L 4M3JA 4NQXA 1MVFA 5M95B 5IROC 1BQLH 4KUCF 4XB7A 3WNKA 2YPKB 3EFFA 1IT9H 3WDHA 4YNYB 4LNVA 4HS3A 3U2SA 1B4RA 2GTWA 1RJLB 2XQYK 4JKKA 5ANME 1N2RB 3SCMC 2NLJA 4XMKL 4X9GA 1JZ8A 4KRMB 2DKUA 3D69A 1FNEB 2Q86B 4ZTPL 4NO0B 1RZJH 3U0WL 5EIIB 3Q6GL 2VQTA 4ZMAT 2DLGA 5EZOH 3BKJL 3IJYA 4NQXB 2LU3A 1A0QL 1MHPH 3IU4H 1NJ9A 4HH9A 5L88L 4MD0A 4TNWK 3EFFB 3H7LA 1JGVH 2W91A 4HS3B 3U2SB 1PG7X 2B1HL 5HBBA 1IGJA 4NWUL 2GTWB 4NPYA 2NLJB 1WFOA 1EFXD 1TCRA 3D69B 5D7JC 1JF5A 1CGYA 4X9BA 2ICES 1U0QA 2ADFL 4NUGH 1CXKA 3EYUH 2QTEA 4X8XA 3U82B 3HA0A 1F42A 4ODSH 3IVKA 2JJVA 3IJYB 4UIKL 4K9EH 2X1XR 3OB0H 5IG7A 4TUOA 3RP1A 4NWTL 3BAEL 3IXTA 4HH9B 1NJ9B 4MZ2A 1CDBA 4MD0B 2EDRA 1CFTA 2QJDA 4YBLC 4I3RL 1X5GA 1NC2A 1PAMA 2X4RA 1JZ6A 3HB3D 3EYFA 3NCFB 5I1GH 1IGJB 2C26A 3BPCA 4XC1L 3KR3H 1PG7W 1F8TH 4NPYB 4JRXD 3RVVC 5FDWA 4GS7B 1TCRB 3U7WH 3E2HB 4ONFL 5JHLL 2OK0H 4P4KC 5F1NA 2DQCH 3QFJA 5T3XD 1NGPH 3TJHD 5DD3L 1G1YA 1QKZH 3IVKB 1DLFH 1AXTL 5IG7B 4TUOB 5I1CH 3IXTB 3V5KA 1OAQL 2Y4SA 1CFTB 1ZVHA 4J2XA 3DYOA 3LIZH 2CQVA 2XZQH 2Z8WC 1E4JA 1NUFA 1A7PL 1NC2B 1FCGA 2X4RB 2P46B 5DFWH 3EYFB 3RX8A 2B1AH 3BPCB 2APXA 2BVEA 2K7QA 4HC1A 3MOBH 5FDWB 3WFBL 4XX1G 1M05A 2GY7B 1C1EL 5KSBE 4OCMC 4V1DD 1LK3L 5IF0A 2XI9A 3CVHA 5F1NB 3QFJB 3WV0A 2XV6B 3W9DB 5HGHA 2I9TA 4KRLB 4BJLA 1ZGLM 4NM4H 1G9ML 5HHXL 3V5KB 2EZ0C 2IFGA 1BVLA 1BX2A 4FZEL 3V2AR 3A6BL 3TM6A 2FLRT 5DJCA 4Y89A 5LJYH 3HC3L 3OKDA 1M05B 2EIDA 3O8XA 4NN6C 2LTQB 5IF0B 4P9ML 4XPAL 5C0AD 3CVHB 2NZ9D 3WYRA 1BAFH 2X09A 2R0KL 3VWJD 3SE9L 5HGHB 2I9TB 4DGYH 2ESVE 3HE6C 5I76A 1Z9SA 4J23A 2QBWA 4LCWA 5JDJA 4OD3H 5IT2L 4PBXA 1IZJA 4HBCL 1BVLB 1BX2B 4IDJH 1CWVA 4LRNL 5DJCB 2G60H 3QHZL 4LPVA 4X7TA 4MA1B 4PJAF 1KLUA 1MCPH 3OKDB 3OR6A 2IPKA 3O8XB 3L3KA 3UPRA 1YY8A 3D25A 3GBNH 3FO0L 5A40E 3S3PA 4MJ5A 3V9FA 1GSMA 3LMJH 2NY5L 4UIMA 4UBDC 5I76B 3GB7A 4LCWB 1Q94A 1ZVSA 2VDOL 4C83A 1L0XA 3WO3B 1EGJH 4YHMH 2GJ6E 1RUPH 4X4YA 3OMZA 3EJZD 4X7TB 2AJYL 3P2TA 3QCUH 4EOWL 1KLUB 3ARFD 4M5YH 3OR6B 2IPKB 3L3KB 1E6OH 3UPRB 1TJGL 4IDLA 3QIBA 1YY8B 3D25B 4BSWB 2IANE 1G9NC 1GHFH 1J11A 4MJ5B 3G9AB 3BW9A 3JXAA 4R26L 1OAXL 4HLZG 4UIMB 3GB7B 5GS0H 2VXTH 3GMRA 3A6CH 1Q94B 1ZVSB 5EORH 1EEYA 2UZYB 4C83B 3NTCL 3FQXA 5EZIH 3LY6A 4D9QD 1A4JA 5KG9A 4AEIL 4X4YB 4I4WA 4YFEA 5D7LE 3L3GA 2XY1A 3H0TB 2UYLA 1Q9OA 3QIBB 3QHFH 4NQED 1MIMH 1UCBH 4W4NA 5FAAA 1UACL 3UTQB 5GRZA 4C56A 3VFGL 2QSQA 3BW9B 3V4VH 3ZSTA 4BFBD 4DGVL 3L3DA 2WWKO 3QPQD 3GMRB 3EYSL 2GJZA 4RIRB 2OTWA 4PJXA 3TBWA 3SDAC 1ZHNA 1EEYB 1CS6A 4RGND 3SGDI 3FQXB 1EIBA 3REWA 1A4JB 4JJ5A 3KYMA 1U93A 1GL4B 3QUXC 1X7QA 2MPAH 4HIXH 4I4WB 4QHMA 5TDNA 3GEWB 4RMTA 3L3GB 3UJTH 5TE4L 2UYLB 3CK0H 3EOTL 5DD0H 3WFCH 1TVBA 1E4WH 4YHKL 4OKVA 4C56B 2DQJL 4XNUH 1CZ8L 3L3DB 4U1HA 2JJTA 1MCNA 1GPOH 4IEFB 2GJZB 1VACA 2OTWB 4PJXB 3TBWB 1JYWA 2F54E 1ZHNB 5EC2A 4P5TC 4I8DA 2VLRD 4WEBH 1X5AA 3REWB 4M00A 4JJ5B 3KYMB 1U93B 1X7QB 5TDNB 4QHMB 4POYA 5E4IA 4C59B 4LMQI 4JDTL 3P0GB 4JFQA 2V2TB 1TVBB 2CO6B 4OKVB 5EBMA 3S3JA 4OFKA 1IQDA 4WFGE 4KZEL 4G7VH 4U1HB 5JHDA 3LOWA 1Q0XH 3T0VA 3T8XA 4KZDH 4Y5VC 1VACB 1UA6L 5EC2B 1Q9LA 3VW3H 3HKFA 2EIEA 5I1LA 1KCSH 1MLCA 3OJDA 3NZHH 4JHZA 3QH3A 1KNOA 1I7TA 4J6RH 5DS8B 1PY9A 1ZEAH 4BH8A 3LEVL 5DJ0A 4BELD 3FHAA 3H9ZA 4NJAH 3ZYOA 4JFQB 2VSDA 4TNVF 3BQUA 5JZ7C 3FZUD 1R3LA 2FX9H 5EBMB 1YJDH 5IFAH 1W0VB 3HAEH 5EA0H 1IQDB 5I18L 4NHUA 3ARVA 4JZNA 5JHDB 3T8XB 1DE4B 1IAKA 3LB6C 1MRDL 5LBSL 2EEDA 3OXSA 1Q9LB 1MRFL 3KPPA 2P8LA 5SWSD 3ZDZE 5I1LB 3S88H 1MLCB 3OJDB 3WNLA 3QH3B 1PQZA 3CXHJ 1LEKA 1KNOB 1QSED 1I7TB 1LO0L 4X6DF 1BFTA 4XNZB 5EC1A 5SWZD 1QLFA 1IM9A 4BH8B 3KPRD 5DJ0B 15C8H 4NZRH 3ZYZA 4M8VA 1LWRA 1FL6A 3BQUB 3GMOA 2CUMA 2I26N 1X9QA 4TSBH 5MENA 4NHUB 1VPOH 5DUML 4XWOD 4JZNB 1ZAGA 1IAKB 3TGXA 1FV1A 5DVOA 2GITA 2MMXA 3DUSA 3OXSB 5TE6H 1WICA 3KPPB 2P8LB 1SYVA 3VXSA 4GRWE 3O4LE 5CKGA 1H3PL 3QUML 4PLOB 1PQZB 4FTVB 4NOBA 1LEKB 1MNUL 4XP6H 4MNGA 4KMTL 2W9LA 3C60C 1IGIH 5D1XA 5EC1B 4OZHA 4G8FA 1QLFB 1IM9B 4R7NA 1SVZA 2LABA 4YWGL 2FIRT 1KG0A 1FL6B 1HHJA 1G6RL 2I9LA 2W9EH 3GMOB 1E4XL 5I30H 3K4AA 1NAKL 5EUOE 5MENB 1JNNL 4Y2DA 3ARBC 4LPUA 1FV1B 3W39A 2GITB 2FHCA 3C2SA 3DUSB 4JRYE 5C07A 4GQ9L 1SYVB 3VXSB 5E94A 4XWGL 2Z31B 1WTGT 4I18C 4MDJA 2ZG1A 3H9SD 1KCVL 2IMMA 5E7FA 4MNGB 4Y4HC 1T83A 5D1XB 1VDGA 4G8FB 4OZHB 1NDGB 4R7NB 1QFWM 4YHZL 4LLDA 5BV7L 1KG0B 1HHJB 4YIQA 2OR8A 5DMGD 2I9LB 1F4YH 1PZUB 2Z8SA 4EBQL 2D7TH 3NA9H 4Y2DB 3BSZH 4D8PA 5I8OH 2J8HA 4P3CL 3V52H 4GAGH 3AS0A 4P59H 5I1IH 3E0GA 3W39B 4M03A 1JMXA 5GRUL 4MHHG 5C07B 5DURB 1I8IA 5ETUA 2J5LC 5E94B 1I85C 3CFKA 4R2GD 4MDJB 2ZUTA 2JCCA 4PJ9A 1YEFL 4I9WE 3B9AA 3HNSH 3R8BB 5IVNA 3WN5A 2COQA 2E27H 1AXSA 4KMLB 4LOUD 1HK6A 1BQSA 4FXLA 2HWZL 4YIQB 4FQ1L 1NBVH 3MRLA 2HA1A 3CVIL 1HKFA 4D8PB 1TPXB 4D3CH 5LWYL 4ELMF 2UWEF 4OF8A 3O6KH 2VAJA 1JF6A 4QXGH 3HC0A 1I8IB 5ETUB 3HPLA 2AI0H 1KPUA 1PX3A 1V8HA 3KDMA 2JCCB 3HS0A 4NKQB 4PJ9B 4X5LA 2H32H 2XZCL 3Q1SL 2A83A 3ZKNC 1RZKL 3WN5B 5K9KA 1AXSB 3S36L 4G9FD 5KSVA 1RIHH 3NGBB 1JV5A 1XIWD 5HDBF 1U95A 4UMGA 5JXEA 1MHCA 4KI5C 3MRLB 5LXGL 3QIUD 1A7OL 5BJTA 3VI3E 3HC0B 5E6ID 1MAJA 1FH5L 5HGGS 5IB2A 1FZMA 3HPLB 3TJHC 3HC4H 4ZUTA 2DLHA 3ZTJG 3HS0B 1A7NL 3B9KA 3KPSA 1J87A 3WDIA 5C7XH 3GBLA 1OP5H 5K9KB 3FAXA 2NY2D 5KSVB 2I5YH 1M6OA 1JV5B 2VL4A 1U95B 3K80A 3MJ6A 1BOGA 5B38A 4NUJB 4JG0L 4MJ4A 4UT9L 1HYRC 3HZKA 3AB0C 4XP4L 3I6LE 4XXCA 2VLLB 2XOTA 3MRRA 1EHNA 3RGHA 5BJTB 1U2HA 1TJIH 4LASL 1FNGA 3QWOA 5IB2B 1FZMB 4LGRB 4LSTL 5D8JL 4XCFH 4U05A 1FG2A 4ZUTB 4YH6A 4CVXA 3OPZL 5F3HA 2BVOA 3B9KB 2DLEA 3KPSB 1LILA 1KN4L 2ZOLA 2CJUL 3NN8A 1JHTA 1A9BA 4P2OD 3SO3C 1M6OB 4JQIH 3PNWB 1BOGB 5B38B 1OP5K 2BZDA 4K3HA 4JR9L 3HZKB 4N0UE 4KGJA 3HMWL 3V6OE 4MD5A 3MRRB 4MXVF 5KZCB 4OTXH 1IEAB 2DICA 3RUGA 1FNGB 3QWOB 4QGYA 4UOJA 5GISL 3BRFA 2Z4QA 2NZ9C 4P3WA 1FG2B 3UDWA 4CVXB 4Z76A 2D03L 5F3HB 3VWJC 3Q3GA 2BNQA 2BVOB 5I1KH 1JNLH 3ALPA 4P4RA 4PJ7F 1CFNA 2ZOLB 2WP3T 4ZXBD 5J1SC 3LS5H 3NN8B 1A9BB 1F4XH 3TNMA 1I8MA 3T2PA 3ZO0A 4JE4B 1F11A 1F90L 4XP1H 3SDCC 3E6FA 3PWJA 1YPZF 5CJQH 4BFGA 2P5EB 2QQLL 1JPFA 5M94B 1IKNA 3U9PL 3HLAB 5E99L 4X4ME 3B83A 3RUGB 2PYEE 2OM5A 1FVCA 4Z76B 3VU2A 3Q3GB 2BNQB 4P4RB 1FIGH 1BD2D 1Z3GH 4WI4A 1CFNB 3VRLE 2N7AA 2OI9B 4MGXA 4JY6A 2VQ1A 4LSVH 1I8MB 1MWAA 4HGWA 3KPLA 5IMMB 1F11B 3RU8L 1NLDL 3EJZC 2R1YA 3E6FB 3PWJB 3WFEL 4AQ1B 1MCJA 3Q0HA 1JPFB 3C6LA 5MI0B 4ISVA 3MJ9H 5ILTL 3L1OH 1L0YA 3WUWG 3CGTA 4Q6YA 3ZE2F 1H8SA 4FHBD 4X8JA 5F7UA 3VMPA 1FVCB 2PCPA 3ZZ1A 5I8CA 1I9EA 4M43H 5MP6H 4OF6A 1E6JH 2GCYA 1G7HA 2A9NL 2GSGA 2VXVL 2FR4A 4JY6B 2VQ1B 2PTTA 2W07A 1UT9A 2GJ6D 1MWAB 4HGWB 2XWTA 3KPLB 5J1TC 2AXFA 5L8KB 2C5DC 4HQQH 1X5KA 1I8KA 2R1YB 4H1LH 1SYSA 3MPCA 3T2NL 5K9OA 2E9IA 3C6LB 3VFMA 1BBJA 3HI6L 4ISVB 4LVOC 3TJEH 5FUOH 4LCWE 5E8DL 1A7RL 1U8JA 3PGCA 4X8JB 2R69H 2MSPA 3AC0A 2PCPB 5I8CB 4KPHL 5IFHL 3QPQC 4V2BA 2OP4L 2GCYB 1G7HB 2GSGB 1RURH 2FR4B 3S9DB 2PTTB 3H9YA 4RWHA 5IVXA 1A6ZA 4U1KA 2XWTB 1IKFL 3PGDA 2WBJC 2AXFB 4YDLC 3LQAC 1MIEH 5CLTA 1I8KB 3O6LL 1H3TA 4HUKB 3ULUL 1SYSB 2XKUA 1KFAL 3FTGA 4UOW1 4XH2A 3VFMB 2VR9A 4NQCA 1BBJB 4DZ8A 4PJEF 3PGCB 1U8JB 1MJJA 4JFEA 3QULA 4HMCA 2V17L 5A2IH 3IFNL 1VADA 1URLA 2OZ4A 2X6MA 4WJ5A 1WCQA 3DXAA 4EUPG 5JOPE 4LLVA 1P84J 1KJ3L 3PL6D 2EH7L 5IVXB 1A6ZB 3F8UB 4U1KB 2YZ1A 1V3KA 1ZHLA 5DMIL 3ECBA 2EC9T 3PGDB 4WUUA 5DD1H 1DSFH 1U3HD 5BW7C 4PREA 2CDFA 2UZXB 1JYXA 2P24A 5IBLD 4GQPH 1OF2A 3FTGB 3VDBA 4XH2B 4NQCB 1FLRL 1QRNE 4GSDH 4DZ8B 1NSNL 3TO4C 5T3ZL 4WEMB 4JFEB 1I1CA 1MJJB 3QULB 4ZSOA 1N7MH 2YPLB 1AQKL 1VADB 4HJJH 1IILE 1YQVH 4WJ5B 2F54D 4OT1H 3DXAB 4LLVB 5ERWA 1A47A 4M1GH 1G6RA 4MAYD 1ZHLB 4WUUB 3L3JB 2RCSL 5HHQA 2CDFB 3CX5J 3FFDA 1EA9C 2P24B 4CADA 3MBEA 1OF2B 1CXHA 4U3HA 5EDXA 5AZ2H 1PSKL 5F7EH 3FB5A 4Z78B 3RI5F 4IBLT 2WBKA 3FZUC 3KPMA 4CU8A 4OCXH 4WFGD 4ZSOB 2UY7A 5HPMA 1J1XL 3QPXH 1A2YA 2MCG1 5ADPH 3MLWL 4W4OA 4P9HC 1IMHC 5ERWB 3CAFA 3BP6A 1G6RB 1MCEA 3OAUH 3BH9A 1OGTA 5HHQB 3EYVA 4OF3A 3FFDB 5LGHL 2Q8BH 1MY7A 4CADB 3MBEB 4U1GC 2FYYA 1UM5L 4KDTC 5D1QA 4G6FB 4Z7VA 1UB5B 1RD6A 3FB5B 12E8L 2CMRL 3QISA 3KPMB 2RQ8A 3T2OA 3RI5K 5HPMB 1CL7L 4KK9C 4L3AA 1A2YB 3BDYL 4PBWD 4PRAB 4XWOC 4OFYA 2GI7A 5E5MA 1GGBH 1Q1JH 3CFJA 3BP6B 4HPYH 2DQDL 3HG1A 4J7RA 4OGAC 3RFZC 3BH9B 1OGTB 3EYVB 5DQDH 3X3FL 3D3VD 4JFDB 3PE9A 5D1QB 3NFSL 4Z7VB 5JHDE 1F00I 5GGTA 4HKBA 3MNVB 2CK0L 1UGNA 4HWBL 5IQ7L 3ARDD 3BUTA 4OQTH 4F7MA 1J0YA 3WNPA 2FGZA 4ODXA 5CEYA 5M7QA 3ZKMC 4DOHE 5E5MB 4HK3N 3NPSB 1DQQA 3CFJB 2YA1A 3HG1B 3VRIB 4Y5YA 2SEBA 1K8DA 4OB5L 1EJOL 1HINL 5DT1L 2IBBA 3X13B 4UQ2A 1ETZB 5EN2A 3ESUF 3OAZH 4HKBB 1FFRA 5DMGC 4X7EC 1OP3K 2YR3A 2PO6A 4QEGA 4F7MB 3QIWC 4FTVE 4ODXB 5CEYB 3GMNB 4JRYD 3EOYG 5SWQA 1DQQB 5A2JH 4OV5A 4HEME 1NGWA 3H42H 4JM2A 3TT3L 4Y5YB 4R2GC 1NKOA 4R8WH 5FK9A 1PG7H 4W6YB 1K8DB 1FRGH 4KVCL 3S98A 4Z7QE 1WWWX 4PJAB 4HHAA 4LOUC 4UQ2B 3WBDA 5EN2B 2FX7H 1CDIA 1CE6A 5DK0A 5D4QA 4O58H 3VXSE 2PO6B 3MLRH 5F7FA 4Z7WA 4G43A 4YHOL 4LAQH 2DBJA 3OAZK 4HJ0C 5ITFA 4MNGE 1JRHI 3ZDYE 5SWQB 1EV2E 1FP5A 1DVFA 3ILPA 4OZHE 4BM7A 4OV5B 2Z91A 3B9VA 1GAFH 4JM2B 4QRPA 3LRSA 4Z0XA 2M2DA 3AXLA 5FK9B 4LDOB 1AY1H 4KJYA 1ZTXH 4IRSB 5DMYA 4HHAB 3U4BH 3I3EA 5AYUH 1MFBL 3RZCC 3NCMA 1W2KT 5DK0B 5C07E 4QHKI 5A2LH 2HFGL 4K3DL 3ULUD 1UVQA 4Z7WB 4G43B 2B4CC 1BM3L 3QIUC 5ITFB 2HMID 4KHXH 5B22A 1DVFB 3ILPB 3K74B 3FQTA 4LCCC 2Z91B 2Y06L 3OKYA 1E0OB 5T33L 1P6FA 3LRSB 4X5XA 5E2JA 4ZUVA 4Z0XB 3BPOB 4S2SA 1ZLSH 3AXLB 4JM4H 5FV2A 3EHBD 4JO4L 1G7IA 4KJYB 2B39A 5F6IB 4X7SL 5IJVA 1BJ8A 2NY2C 2EYTA 3NCBB 4LVHC 1YC7A 2NY1B 4J4PC 4U2YA 5HDQL 5HHPA 4JQVC 1UVQB 2ICWJ 4LEXH 3PWUA 1KCLA 4LFHD 4BZ2H 4G6AC 1CLZL 5JW4Q 5T3ZD 3CZFB 3FQTB 1LP9F 2VR4A 3P0VL 5T1KD 5HVHB 4ZUVB 4X5XB 1HIMH 2WINA 4S2SB 4QRRD 3UZVB 4WTXA 1G7IB 3VXMA 2AV7A 4BK5A 1LMKA 5TFSL 3DVGA 1UWGL 5IJVB 4P2OC 1D6VL 3SKJL 1GIGL 3IJSA 4V2CB 2EYTB 3RDTC 2XICA 1CLCA 3X3GL 4OGYH 1CYGA 4XP9L 5ELIA 3PWUB 5F44A 2DQTH 3E8UL 1KB9J 5J6HA 1OGAA 4U6VH 2R4SL 5TF1H 4PJBE 2WINB 1B6DA 1OTSC 4WUKL 2XG4A 1O0VA 4WWKC 4L4TA 4N68A 3VXMB 2AV7B 3C5JA 4HIJA 4NZUL 2PUQT 4ZXBC 4EIZC 3DVGB 4ZD3L 1NEZG 2OL3L 4M4RA 1UKSA 4P99A 1OOAA 4WHYH 2DWEA 1QZ1A 5C0CD 3QA3A 4ZNEA 1MCCA 5D2LA 3EAKA 6FABL 5IB4A 4S1QL 4NQDD 1A21A 5J6HB 1A6UH 1OGAB 1DFBH 2EH8L 1II4E 4FQXD 3WJJC 4W70A 3QDJA 1YECL 4C57C 5IIEA 4L4TB 2NW2A 3C5JB 4HIJB 5L7XH 2E9JA 5KJRH 4Z18A 1A4KA 3MQIA 4YC2C 2DWEB 2VLKE 3ALXA 5J8OA 1PEZA 4D0DA 2KPNA 2HH0H 2M8XA 3JVGA 1WAAE 3MRQA 5D2LB 4C4KT 4Q6IA 5GZOD 3TIDA 1ZKAA 5CWSA 5MEOA 2DKMA 4F7TA 3IKKA 3HE7D 5INDA 2PYED 4R4FL 2I60L 1BQUA 3PDDA 3MREA 5DUPL 4ALAH 4P48A 5JLZA 3QDJB 3TBSA 2W9DH 3SDYL 1C5BL 5IIEB 4J3VA 4GMTH 4HGMA 2G2RA 5JXAH 1K2DA 3QUYA 3GNMH 1A4KB 4NC0B 2VB5A 2P5EE 4UOW0 3L6FA 5F96L 4D0DB 4LKCA 3MRQB 5D6DC 4Q6IB 4OZIA 3TIDB 3OB8A 5F6HJ 5CWSB 5C6PB 3CNKA 5MEOB 4F7TB 1QO3A 5INDB 1W72H 4DKFH 4S1RL 3MREB 1B2WL 4LPXA 1N4XL 5IFJA 5JLZB 3TBSB 3RY6C 3ESVF 3G6JF 5FYKE 2G2RB 1OT2A 4G8GE 1IAIM 1K2DB 3QUYB 4HDIA 1MCQA 3DROA 4OM0L 3L6FB 1QEWA 1NCCH 3MODL 3ZHLA 1F3JA 5AAMA 1HOCA 2XN9D 1WC7A 3LD8B 4TUJA 4LKCB 4PV8A 2BVQA 4OZIB 1IGFL 4UDUA 3THMH 4JVUA 4LCWD 1QO3B 4XBGA 3VCLA 4X6EA 4XNYL 5KOMC 2X7LA 3U36A 1NCAL 2VDLL 3FN0H 3FT2A 4A6YH 4KKLD 4LSPH 4DQOL 3LN9A 3DHJA 1P5VA 4HDIB 3DROB 4F9PC 3S35X 3PL6C 3IJHA 1QEWB 2YD9A 5L0QB 4Y1AD 1FCCA 1JUFA 1F3JB 1HOCB 1I9JL 1WC7B 1U3HC 4AEEA 4TUJB 4WTZG 2BVQB 1UKTA 4UDUB 1EHAA 1J86A 1JIBA 2PTUA 3VJ6A 2BDNH 2HRPH 3VCLB 2YWZA 4X6EB 2X7LB 3U36B 1MCWM 1F3RB 3FT2B 1CIDA 5T3XH 2ZCLL 4HT1H 4AMKH 1MEXL 4RSVA 1RI8A 4F9LA 2OJZH 1MQ8A 3IJHB 1WCBA 5HXMA 1JUFB 4MAYC 4XC3H 5DJ6A 5DLMH 5A3ID 3AS1A 2DQHL 1YMMA 1YN7A 1QRND 4ENED 4EN3A 4FQIH 4LSSH 3DMMC 5DO2D 4I0PA 4GXVL 3NCJL 3INUH 3VJ6B 2WUCL 4M1DL 4PY7A 2X4PA 3NACL 3AREA 1XR8A 4ZS7L 4IIQC 4AYFA 5CCKH 4HFWA 3GSXA 1MAKA 5I1JH 1OW0C 1WCBB 1R3IH 4XBPA 3P40A 4H5SA 2C1PA 3CPLB 5DJ6B 5C3LD 1RJYA 4PRHE 4JFEE 1EDQA 2CRMA 1G7JB 2YPLE 4MVBD 5BXFA 4PUBL 4AQOA 5E2TL 4I0PB 1DBJH 3FT3A 1MAML 3WD5H 3DXAE 5LG1A 4PY7B 2X4PB 1VCAA 2IC2A 1T1WA 3AREB 4ZFOA 1XR8B 4HEPG 4WUUE 4WRLA 4K2UL 4Y4FC 4HFWB 2HAZA 3GSXB 4HV8A 3TV3L 2KQNA 4ZYKA 4X6BA 4XBPB 4H5SB 2C1PB 4HG4J 1RJYB 1RIVH 3VA2C 1FNAA 5CIPA 5BXFB 5HYQA 3RPIA 1DBBL 4G9DA 3KXFA 2BNRA 3K1KC 1WEJH 2AJVL 3EGSA 3GMLA 3O3EA 4R7DA 1MCWW 2GAZA 1KC5H 4UV4L 5TPWH 3WUZA 4I3SH 2EDBA 1T1WB 1ES0A 2JTDA 4ZFOB 3SBWC 3WS6A 4Z8FH 1UM6L 1CG9A 1JJUA 1PEWA 3RZWA 4HV8B 4KU1A 4OGXH 3OGCB 3F62A 4ZYKB 4RQQA 4X6BB 2QKIA 4WV1A 5E0QA 1QFUL 3HFML 1CVSC 3NCYP 3BRDA 3WHE1 5CIPB 5JW3H 5HYQB 3RPIB 4G9DB 1YPZA 2YK1H 3KXFB 2BNRB 2BJMH 4Q97A 4TSCL 1JN6A 4Y8DC 1HKLL 3GMLB 2YKLL 3O3EB 4R7DB 2GAZB 3VG9B 1JVKA 4J3XA 3LS4H 1ES0B 4KRPD 3JBG7 5ICZA 1OPGL 1S3KH 4JRWA 4AEFA 1I75A 4YDKH 1CG9B 3Q2CA 2NY4B 4LIQL 4JFDE 4Z7VE 4RQQB 1HWHB 2QKIB 4WV1B 1QNZH 1W8NA 4XX1E 4JO3L 5GGQL 5GRVL 4OZ4A 3BIAX 5IBTH 1YPZB 4PJGF 1RIUH 2X4TA 1JN6B 1SQ2N 2XACC 3OF6A 1QBAA 3EDEA 5CEZE 3HG1E 5IHUL 1QFWH 3BP5A 2HLAA 4FTVD 3VH8A 4KJPC 5IVZA 4XMLL 5JR1H 4PGJA 1A7QL 4JFXA 4H8WC 2NXZD 4H25A 4XMKH 5C2BL 2E7LC 1IAII 1P1ZA 4ZTPH 4O2FA 3JWDC 5E2WL 2FIKA 3CFIC 1T1YA 3A67H 3Q6GH 3TIEA 4IJ3B 4OZ4B 1DANT 1WZ1H 3LQAH 2XIDA 4XAWL 3L5HA 5D7SL 1WFNA 2X4TB 4CJ1A 4LGPB 5HHOE 2Z31D 1YUHA 1ACYH 1A14L 2VOTA 2HLAB 3BP5B 3VH8B 3WNOA 5IVZB 5A16B 3WUWB 4R97C 1M7XA 2J8UA 4YE4L 5D1XD 1F4AA 4JFXB 4Y16D 4H25B 2OL3A 1P1ZB 1D9KA 4GUPA 4PJAE 3MRJA 4O2FB 1S9XA 2FECI 1DN2A 2FIKB 3NA4A 1T1YB 4M7LL 4G3YH 3TIEB 1AR1D 1GOFA 3PWPB 2VXQL 4UIKH 4Y5XC 4JGMA 1L9MA 3BO8A 3QQNA 3MUJA 3CX2A 4M7KH 1KTKE 1WBXA 2DQEH 4PJEA 1YUHB 4J3TA 5KS9A 4I3RH 3VA6A 2J8UB 4JKPL 4LU5L 5J4MA 3SN6N 2P1YA 1KYOK 2OL3B 1XGYL 1D9KB 4GUPB 3MRJB 1S9XB 3P30H 3DOSA 3SQOL 3JV0A 3DX6A 2DB8A 5I71B 1TETH 4JO1L 5DD3H 3GZKA 2YRLA 4TPRL 4Z7WE 1NMBH 5ABDE 1NFDF 3BO8B 1C7TA 1XGPA 3CMGA 4W81A 3MLYH 4PJEB 5KS9B 1JZ5A 4DZBA 1BQLL 1XGRA 5LGKA 2JIXA 1U8QA 4OLVH 4OF7A 3BWAA 1IT9L 1ZS8A 4YHNA 4OCRH 3H7BA 4P9HH 5BRZD 4DWHA 1S7XA 1A3QA 5DXWA 1T04A 3I85A 3UP1A 4GS7C 2IFFH 5HI5D 1YN6B 1RZJL 1FJ1A 3DETD 4WI6A 5DD6A 2X89D 3KJ6H 5EZOL 2EC9U 5C9KA 4JY4A 4DZBB 3V6OC 1FFOA 1OARH 1XGRB 2C4XA 1MHPL 4O4YH 3IU4L 4UNUA 2JIXB 1U8QB 3ELAT 6CGTA 3BWAB 2OR9H 2B2XH 3EOAA 1ZS8B 4YHNB 4FQHA 3MXVH 3H7BB 4FQXC 4ODWA 1S7XB 4XPAH 5L2KE 4TTGA 1T04B 1H3VA 4OFIA 5F93C 4QCIA 1FJ1B 5EO1A 1UXSA 4NUGL 1J0IA 4ZODA 3W5NA 4ZUSA 4ODSL 4K9EL 4PG9A 1S7SA 1YEEH 4JY4B 5GZOC 1FFOB 4C55A 2EYRA 3VXME 5C0IA 3HE7C 3EOAB 5K93A 2VUYA 1BREA 2FEEI 3VXNA 4FQHB 4NJ9H 1V7ML 5DJDA 4OD2A 4ODWB 5I1GL 3FO0H 3KR3L 4W68A 3U7WL 5KVGH 2CLRA 3BI9X 2GK0A 4QCIB 3GSNH 2B7DT 2OK0L 4F37F 2NY5H 4WW2A 2EIBA 4BH7A 2LTQC 5EO1B 2VLKD 2DQCL 1UXSB 1IEHA 2VIRB 1UJ3A 4ZUSB 1U9KA 1QKZL 1OGAE 4LPWA 1F2XK 1DLFL 4PG9B 1S7SB 5I1CL 1TZIA 5E8EA 1KLGA 2EYRB 1TIUA 1FHGA 4DFIA 3LIZL 2XZQL 3MJ8A 1B6UA 2YZ8A 3VXNB 5AZEL 2IPTL 5FEBA 2APWA 5DJDB 2ARWA 4H0GA 4OD2B 3F7YA 2PNDA 3GJFH 3MOBL 2CLRB 2W1NA 4ZNEE 2GK0B 5JPMA 2P5ED 3O8XC 1OAXH 4IRJD 4BH7B 3EDDA 2C4FU 1UJ3B 3WSQL 3VD3A 4GJTB 4NM4L 3ULSA 1XF5A 4YK4B 4GKSA 1HCVA 4AEIH 5E8EB 1KLGB 3QDJE 2HVJA 3EKCA 4G80A 4N90E 1UQSA 4DUXA 3MJ8B 3QYCA 4OV6F 4X6DE 5I8EA 1NMAH 4GKOA 3F7YB 4PRNB 3BGAA 3MLUH 5H37G 4KKLC 4G8GD 3VFPA 1IJ9A 5JPMB 2A6IB 4TOYL 2IG2H 1BP3B 2WIIA 3NMEA 4YXKH 3GJFK 1BAFL 2NXYB 4OZGA 2AVGA 4HIEA 2VZSA 5EG6C 4DGYL 3BKMH 3ULSB 1XF5B 4GKSB 2HVJB 3P3YA 4PBVC 4G80B 1UQSB 2FH6A 2B4CH 4IDJL 4BQBA 5DUBA 3MOQA 5B4MD 3CLFH 5I8EB 1GJIA 2G60L 4Z95H 1IVLA 2EE6A 3LQZB 4APQB 1BECA 3VFPB 3MV9D 5KSAD 2Q87A 3GBNL 3QDMA 2WIIB 3QIBC 2O5YH 2IBZX 4QHNA 3P4MA 4Y19E 4YHIB 4OZGB 4NQTA 3MRNA 4XI5D 5A3IC 3LMJL 5D96B 4EZMA 4HWNA 4Y4KD 4LVNB 1NAMH 5TH2A 2FO4A 1ITCA 4ENEC 3VRJA 4N1CA 1G9EA 5CGYD 3HR5A 1RUPL 3I02A 5DUBB 4UZGA 3QCUL 4TYUA 4G6MH 4M5YL 5ACLA 1WV7T 4M3KB 1FG9C 1E6OL 2X4NB 4KZEH 5I2IA 3BPLB 1UKQA 3QDMB 1GHFL 4Y2OA 1DJSA 2HJFA 3HR6A 3L9RA 4GBXD 4OI9A 5GS0L 2VXTL 3V0WH 3A6CL 5IB3A 5TH2B 2FO4B 5EORL 3VRJB 5TGBA 1ITBB 5EZIL 2Y9RT 1FFNA 2YUVA 4KUCD 3HR5B 2DOCA 3I02B 1BEYH 3QG6A 4MA7H 3VFRA 5BQ7A 1U92A 2D0HA 1BFOA 1T89C 3SDDD 3ETBF 4HW6A 5E2VL 3O4OB 3WHE0 2NW3A 2GK2A 3C5SB 3QHFL 5IMKB 1IC5H 2V5SA 5I2IB 2D7PA 1MRDH 3BKYH 4PRHD 1ZLUH 1ROWA 1MQKH 2EDQA 2HJFB 3V4VL 3DV4A 2YPLD 3L9RB 5C3TA 1AIFA 4NRYB 1P9MA 5IB3B 5DDHA 2CK2A 3F6LA 1G84A 4S0SD 1DQTA 2JJTC 4AIOA 4PGBA 4IMLA 3P11H 3DXAD 5TGBB 2IH1A 4POZD 1WTLA 1L4IA 1G0YR 4X6FA 3S34H 3QG6B 2MPAL 4HIXL 3VFRB 5BQ7B 1LP9B 2AK4A 4X0KA 1FNSH 1U92B 4TN9A 1BFOB 3QDGA 3UJTL 5HDBE 3RJDA 1IBGH 2VSCA 3CK0L 2NW3B 4KKBC 4L3EB 4F8QA 5DD0L 3WFCL 4PJFA 3MLSH 1DBML 4Y88A 2EC8A 1JFQH 3RL2A 5C0BD 1KF9B 3D39A 3DV4B 3P4LA 1CFQA 4PB0H 3QUMH 5DDHB 5DK2A 3U6RA 4PGBB 4IMLB 1ZLUK 2IH1B 3N50A 4WEBL 1MJ8H 3ARXA 1S9WA 2NYYD 4YO0A 2PXYD 3GKZA 4X6FB 5CILH 4LGSB 3VD7A 1KEMH 2AK4B 4X0KB 3QDGB 3QWRD 4AL8H 4XNZC 4Q7DA 3N9GH 4PJFB 1MCKA 2Q8AH 5JOFA 3R1GH 4EKXA 1X4YA 4WO4A 3BQUC 3RQ3A 3RL2B 2P8PA 4OGZA 3D39B 4P2CG 4G7VL 5CAYB 1X4ZA 4PG2A 3TNNA 1Q0XL 4KZDL 1CFQB 1IGTA 1DUZA 2EECA 5DK2B 5DFVC 3U6RB 3MC0A 4FQJH 3QRFM 1KCSL 5DA4A 5JDSA 1S9WB 3HNTL 4YO0B 3GM8A 4J6RL 4JHAH 1FN4A 1G7PA 5F88A 1ZEAL 1BPVA 1RZFH 1NUDA 4YXLL 4JFDD 3QXTA 4Z77A 2YOCA 3RWFA 3O45A 4GAFB 3WL9A 2FX9L 4KV5F 1SEQH 1YJDL 2BNRE 3KXFE 4WO4B 4RBPH 3U7AA 5IFAL 5EA0L 5J89A 2P8PB 4FZ8H 4MXVE 5C1MB 2JK5A 1CXFA 3TNNB 5IV2B 1INQA 5IEHA 1IGTB 1DUZB 3VGAB 3ULVE 2OYPA 1I7ZB 5IW1A 1KJVA 5JDSB 5CEZD 2Z31C 2JKXA 4P2QA 1FN4B 1G7PB 3OKMA 2VZOA 5F88B 2ILLA 1MVUA 5D1XC 3EJYC 2B0SH 4NZRL 4WFHD 4LRIA 4Z77B 5C86A 1AO7A 5F9AC 3O45B 3RWFB 4HH8A 1I1AD 3WL9B 1YPZE 4HXBH 1CU4H 4P57A 2YMXH 1VPOL 2JK5B 1ADQL 1INQB 1OL0A 5IEHB 4Y2DC 3QEUB 5IW1B 1KJVB 5TE6L 4RBPK 3BISA 3Q1SH 2QHRH 5HHOD 4KKCC 4RA3A 4XP6L 2LQRA 2R56H 3O6MH 4P2QB 3N85H 4PRDA 3OKMB 1MVUB 1QRKA 4XRCA 1XMWA 1AO7B 5FYLE 2W9EL 5I30L 1OQOA 3IS0X 2FD6L 4P57B 3U7YH 4HZAA 1TPXC 3ZE2E 8CGTA 1N5YH 1A7NH 3DX9A 4WTZA 2DQIH 1NCDH 4CGTA 4RAUA 2IMNA 4PJDA 4PRDB 1ZGLP 1NMCB 1DEEA 3T0ED 2FH8A 3KJ4C 1XCTA 1G0DA 2CDGA 4IRSD 4UT9H 3WN5C 4XRCB 3A6OA 3R4DA 4PRPA 3PWPE 2EE3A 4Z7UA 3K81A 3NGBC 1T21A 3LKNB 4JCMA 3RVUD 3ROOA 4F15B 3QUKA 2P5WA 3SGKC 3NA9L 3BSZL 4LSTH 1U8MA 5I8OL 2D7QA 3OPZH 3V52L 4GAGL 5IW6A 1VB9A 4P59L 2BRQA 4LPTA 5I1IL 3DX9B 3OKKA 1KN4H 3S97C 1DVFD 5D9SA 1XH3A 5FDYA 1WWAX 5J13B 4RAUB 5GS0D 4PJDB 2CLVA 3HNSL 4S1DD 1CFSA 4KHTH 2IWGA 3IDYC 1DEEB 2JELH 4YFLI 3WE6A 2E27L 5I74B 3IETA 2GSIA 1XCTB 2CDGB 4WI2A 1Y18A 3WEXA 1KCRH 1J9CT 4PRPB 2APTA 3ET9F 4QOKD 2CUHA 4FFVD 4Z7UB 1T21B 5JXEC 5C6TH 1B90A 1WZMA 3ROOB 5E08H 3QUKB 2P5WB 5GISH 4D3CL 1U8MB 1BWWA 4MDIA 3HPJA 3AVEA 3O6KL 4PJEE 1FZKA 2YSSA 5IW6B 4RA0C 3OKKB 1RUAL 2AI0L 2BSTA 4NQUA 1XH3B 4OBRA 5D9SB 1H3WM 1RZ8A 2CLVB 3X17A 1CFSB 3B9KC 1BFVH 3DPBA 1DQDL 3WE6B 3IETB 2GSIB 2D4FA 1RIHL 1Y18B 2Y5TB 4ZO8A 3WEXB 3U9PH 4X5WA 4OUUB 5L2KD 3L3OB 1OTTD 1UH2A 4GRWH 3OTTA 3TN0A 5HGDA 4R96A 4MDIB 3B6SA 3HPJB 1FZKB 2YSSB 3GUTA 5I15H 2YXMA 1Q9KA 5CLWA 2BSTB 3FO1A 3HC4L 2HKFH 1RZ8B 4JKWA 1MRCH 3WJLC 2H2PC 1ZHKA 1OAKH 2I5YL 5EUOF 4XBEH 4L8BA 1CFVH 4M7ZB 4X5WB 1U8KA 1QPPA 1FE8H 4PP1D 4OLEA 1BHGA 3TN0B 5HGDB 4R96B 3B6SB 4U0RB 3GUTB 1CE1H 1I3GH 1TJIL 1EGJA 4JGUA 4IRJC 1KXTB 3GK8H 4XCFL 4N8CH 3X11B 1WIUA 5E70A 5T5FL 3PP3H 3TWCL 1ZHKB 1KJMA 1JHKH 3V5HA 2OI9C 4MSWA 5D1ZD 3S35H 4JQIL 4L8BB 1A6TA 5KN5A 3HI6H 1U8KB 4ZOEA 4H8WH 4R90H 5CJ5A 4PR5A 3LZFH 4MS8C 2A74A 4OTXL 1IKNC 3JWDH 5T1DH 5MI0C 3UTPE 1REIA 1QSFE 5EIVA 4HUNB 1EMTH 5FGSA 4L9LA 1IAIH 5I1KL 2DKSA 1JNLL 3QDJD 3LS5L 4O00A 1KJMB 5LQBL 2ZUSA 1F4XL 1ZXQA 3V5HB 4MSWB 3ULUH 3LKSA 1A6TB 1KXQE 3LH2H 5B4MC 5KN5B 3PQYE 3PP3K 4XP1L 5DC9B 1TITA 2H6PA 4PR5B 3WIFA 3UPAA 5CJQL 5D93B 1PW3A 4IHOA 5IMOB 1WSST 3JV6A 5I75B 1QYGH 4QRTA 2VLJA 5J1AA 1P4IH 3UAJD 4XI5C 2J8OA 4L9LB 1FIGL 4Y4KC 1ZHBA 3UROR 4D9LH 5FOJA 4LSVL 5C70A 4K7FA 3QUYD 5IP4A 1NH6A 4GKZA 3LKSB 5I0DA 5CGYC 4B50A 4CVWA 5K33A 1NSNH 3WIFB 2H6PB 2BY3A 4IHOB 2OMNA 4UUJB 4MNHA 3JV6B 3W11C 3MJ9L 3L1OL 4Y19D 4QRTB 4ESKA 2VLJB 2H26A 2Q76A 5J1AB 4M43L 4PGDA 3FOLA 4I13B 5GS1A 4GBXC 4RWYH 5MP6L 1E6JL 1ZHBB 5CD5C 3DJ9A 4PFEA 2NCMA 4U6TA 4K7FB 4ACPA 4CN4A 1DANU 4GKZB 5HD8C 2CXKA 4M9PA 2V9RA 1PSKH 3RIAF 4HQQL 2ERJB 3SDDC 2DM7A 5BZWA 4MNHB 3TJEL 5FUOL 3OAYH 4GW1A 2R69L 2H26B 2Q76B 4PGDB 5GGSY 3WDJA 3FOLB 5GS1B 1RURL 3MFGB 3PXHA 3MLZH 1HHGA 2VXSH 1J18A 1OHQA 3HAEA 1OY3B 5TDOA 1MIEL 2CMRH 2R4RH 2UUDH 2NY3D 4WEUD 5BZWB 3GFUA 3H3PH 4D9RE 3QNXA 3DVIA 5E8OA 1N6VA 1BZ9A 1WBZA 4GW1B 4RFNB 2AEWA 2H2SC 3ZKSD 3W2DH 3UPCA 1QFHA 4YPJA 3OAYK 2ZUVA 5E7BA 1EZVX 1HHGB 1T66D 2HG5A 1NGQH 1ZT1A 1R3HA 3CUPA 1GYAA 3HHRB 3VGBA 1MF2L 2X4OA 5DD1L 3BRGC 1DSFL 2PXYC 3HAEB 1CVRA 2JB5H 5TDOB 2WW8A 4FG6D 3MJ7A 4HWBH 5IQ7H 3U30B 1RU9H 3QNXB 3VFVA 1EPFA 4GSDL 4I0PD 5E8OB 1WBZB 5JO5B 2A6JB 4LQFH 4MA3A 3OKEA 1N7ML 2ATKA 3R0MA 1PKQA 2WWMD 1MHEA 4KAQL 3VXPA 3ARED 4HJJL 2ATPA 1LP9E 4OT1L 4PP2A 2HG5B 1ZT1B 1R3HB 4M1GL 4W4OC 1CI5A 3CUPB 1NBZA 2XXMB 4L3EE 4LMQE 2X4OB 3MRKA 4LDLB 3VWKD 1KTLA 3BGFC 3LPGA 1AJ7H 2NY0B 4K7PX 1T3FA 5F7EL 2Q3AA 1JZ4A 5D1QC 3VFVB 1EHXA 3G6AA 2DYPD 4MA3B 4OCXL 3OKEB 3PP4H 1B9ZA 2ATKB 1PKQB 3VXPB 1MHEB 3QPXL 2FL5A 5E9DD 3JZ7A 5ADPL 1X3DA 3EZJB 4PP2B 5JMRA 3QDGE 4CDGC 1OWWA 1NBZB 3EZ8A 3OAUL 3MRKB 4EXPX 4AT6A 1KTLB 1TQBB 1H3XA 2L0DA 1ZWIA 1T3FB 1TJHH 1HQ4A 1I1AC 1N59A 3KXFD 3G6AB 1UWXK 1CD0A 2EEAA 2J88H 2IQAA 5DD5L 2FL5B 1ZANL 1IGCH 2YD5A 4NM8H 1GGBL 4YX2H 2E7BA 4IRZH 4LP5A 1RZ7H 4HPYL 5ISZA 1OLLA 1B0WA 4PJ5E 4AT6B 1MFBH 5DQDL 4Y5YC 1XR9B 1BZ7A 2AJUL 2VUOA 3GO1H 5E4EB 1HQ4B 5CZVH 2WBWB 1BM3H 1NGYA 1N59B 1YEGL 2GTZA 1KCUL 5MERA 1FZOB 3PV6A 3C8DA 2IQAB 4OQTL 3QQ9D 3HI1A 5CSBA 3SJVA 5FKAA 1FPTH 2PO6C 1NCNA 4LLUB 4NFCA 1N0LA 3MZTA 4K8RC 4HKZA 5ISZB 1KJ2H 2NX5A 2HT4D 2GIYA 1BZ7B 4G8IA 1CDYA 4Y0GA 3CDFA 4FQPA 4IRSC 5FYLD 1SVCP 3W5MA 3QI9A 2GTZB 5F7KC 5MERB 3B8SA 4JPKH 1RJZA 3RVUC 3PV6B 3Q48A 3HI1B 3SJVB 2VXUH 3I2CH 3BE1H 5I8KH 4P2QE 1JGUL 5DHYA 1T5WA 4HKZB 4HK3J 2DMKA 3H42L 1DVFC 3G6JE 4R3SA 5DRZA 2NX5B 1AO7E 4R8WL 1PG7L 1T03H 1FRGL 5KANI 4S1DC 4G8IB 3X3GH 4PJXF 1OVZA 4MAUH 5F6IC 3PWPD 4P2RA 2FX7L 1JF1A 3QI9B 3MBXH 4O58L 1RJZB 3E8UH 1YZZA 4XAKD 3MLRL 2FB4L 5IB5A 4QXTA 4JPWH 4LAQL 2E6PA 3SCMD 5JA8B 5DHYB 1T5WB 3RJQB 3BJLA 4U4BA 4R3SB 4EQ2A 5DRZB 8FABA 2Y6SC 4B7LA 5I1EH 1ZTXL 4YDIH 4WCYH 2BSRA 1JBJA 3U4BL 2Y5EA 4ORZC 5AYUL 4P2RB 1JF1B 3QDAA 5IWLC 1K4DA 5CJXA 2CRZA 2EH8H 3VFUB 4LVEA 5IB5B 3K7UA 4QXTB 2FZ3A 3PABB 4JHWH 3OWEA 4PJDE 4HXAH 1P84K 1YECH 4KHXL 4U1IA 4PJ8A 1BQHA 8FABB 2VE6A 1AXIB 3VXRA 4JM4L 4PRPE 3SKMA 3MOAH 4Z7UE 2M26A 2BVPA 2P5WE 2BSRB 3UCRA 1YQ2A 5EFIB 2EDWA 3SQBA 4EI5D 1K4DB 1UJTA 5GSRA 1OWRM 3IF1A 2V9QA 5SV4A 1QFPA 2YRZA 1JGLH 4PP1C 2VC2H 4ONHB 2FZ3B 4BZ2L 2BMKA 5FECA 1B0RA 3RVVD 4U1IB 5FXCH 3FQUA 5IQ9A 4PJ8B 4DN3H 1BQHB 1HIML 3VXRB 4P4KD 3SKMB 2VYRE 2ED7A 2BVPB 1MI5B 3MJ9A 1JPST 5D1ZC 1RQ5A 3O2DA 5GSRB 2A9MH 3GIZH 3IF1B 3PUCA 1C5DA 2Y07L 3OG6B 4JZJA 5F7YC 3DTXA 4S1RH 2ZP0T 3K4ZA 4OZFG 5HYJA 1JE6A 2BMKB 5FECB 1B0RB 2FATH 2DQTL 2R29H 4UT7L 3FQUB 1ZV5A 5IROA 4N8VA 4U6VL 4PJCA 5TF1L 5ALCL 3K0WA 4OM0H 5SX4H 4Z7QF 4H1LA 2AV1A 3C6SA 2IJ0C 4YEFA 3GSVA 5DHVH 1T1ZA 5K59F 2NR6D 4S1SL 2I27N 4CL7A 1C5DB 1MUJA 5E1AA 2ADIA 3DTXB 3VG0H 2H9GA 5HTSA 5HYJB 4Q6IC 5FYJL 1I1RA 4FS0A 1P5UA 2VDLH 5J9PB 1QSFD 3NIGF 2P44B 1A6UL 2YC1A 1DFBL 4N8VB 1J0KA 1FVDA 5C09A 3K1DA 4N0FA 1P69B 4H1LB 2HT3C 1OTUC 2AV1B 5LKNA 5L7XL 5KJRL 1LE5A 1JK8A 3UBXG 3C6SB 1BF8A 3IRZA 3GSVB 3QUYC 1T1ZB 1Q0YL 3PQYD 5D7JA 3MX0A 2V2XA 4ERSH 1MUJB 3OJ2C 5E1AB 3LD8C 5EU6E 5DMKA 2ADIB 2EEBA 4CVZA 2H9GB 3CSPA 3NOIA 3V7AG 1C8PA 3QUZA 2E8YA 2YC1B 1KYOJ 1DQJA 3RGVD 5C09B 4ALAL 4CBPA 4F57H 3ARUA 1CIUA 2W9DL 5E00A 4GMTL 3QEQA 4N1EA 2D7MA 2KDGA 1LE5B 5JXAL 4LQ1A 3GNML 2DQHH 4MQ7A 1SJHA 5D7JB 1I8LA 2DLTA 1EZVY 1L7TH 1JTOA 1WJ3A 1XZ0A 2V2XB 3RWIA 2JCCF 1SY6H 3TYGH 3FFCD 1DBAL 4PJGE 3MRBA 4A2LA 5DMKB 4CVZB 2YD6A 1Y6KR 4MHHI 3QUZB 1W72L 5DJAA 3AFLA 1PZ5A 2YD7A 5D6CA 1DQJB 1CL7I 5E00B 3QEQB 2F53E 4APQD 4OCWH 2UVEA 5IBUB 5A1AA 2FGWH 2Y36H 3MRDA 3IB4A 1NCCL 4MQ7B 3I50L 2D9QB 3RWIB 1XZ0B 2VLJE 5TDPA 3MRBB 1CICA 2NY3C 3THML 3NIFF 2VJXA 4IOSD 1CR9H 5DJAB 2XY2A 1PZ5B 4K7PY 3FN0L 5ESAA 4WW1A 4YFLF 4LSPL 1UZ8A 3MROA 3N1FC 1GC1C 3MRDB 2G75A 3SDAD 4X6CA 2PYFA 3MV8A 5TDPB 2ITDA 1CICB 4ZAKB 3C5ZA 4D9RD 1D5BA 3QUXD 4PJHA 1VA9A 5MEPA 5CJBA 4MQTB 2BDNL 3HE6A 3I6GA 3JSSA 4I0PC 2X4QA 5HYSG 1IGMH 4KROD 4LHUG 3H2WA 3B5TA 3AREC 4WW1B 4PGEA 5HHMB 5T3XL 4HT1L 4DVRH 4AMKL 2VZTA 1UZ8B 3MROB 4DKAA 1Z5LA 5GSVA 2G75B 4Z9KB 4KKAC 1SM3H 1L6ZA 3FRPG 4K3JL 2EE2A 2BNUA 2KZ1B 4MXQD 3GIVA 4XC3L 2VQUA 4P5TD 5DLML 3FJTA 4HAGA 4DTGH 3MV8B 4OQTA 4WI8A 2ITDB 1NFDE 4FA8A 3C5ZB 4MJ6A 1A6AA 1D5BB 1RFDH 4FQIL 4LSSL 4PJHB 1CDCA 3INUL 5MEPB 1OPGH 1X5XA 3HE6B 3I6GB 2X4QB 1MFCH 2D9CA 3BZDA 3P9LA 4JFFA 1EUUA 1ORQB 4NP4H 5F1SA 4PGEB 2FO1A 5CCKL 2MQCA 4OIBA 5GGVY 3LDBB 3WXWH 5I1JL 5BCAA 4L3ED 1U3ZA 3DO7A 5GSVB 3RUGF 1R3IL 4HUVA 4LF3A 2BNUB 3GIVB 2D7NA 2NY6B 3UTSE 4XPBH 2VO5A 4MJ6B 5BOZG 1A6AB 3HMXA 1DBJL 3WD5L 1V7NH 1KENH 2OQJB 5DTFA 3P9LB 4JFFB 4NCDA 3VG9C 2JJSC 4NZDA 4U6YA 3ULVC 3WS6C 3D85A 1CGXA 4HKJA 4FQQB 5DJXA 4OUOA 2NY4C 4AM0A 3DO7B 4HUVB 1Y6MR 4LF3B 1RIVL 5E24E 4WV1C 5INCA 2XFXA 1PKQE 3QQ3A 2J6EL 3QO1A 1M1SA 1TTGA 4OLZH 5E6ZA 4LSUH 1WEJL 4OLYH 3QCTH 3I3BA 5DTFB 5F21B 1NEUA 5TPWL 1J8KA 4I3SL 3QXWA 2ZPKH 3CIQA 3QQ9C 4U6YB 3D85B 5FYJD 4AY0A 4NHCH 5DJXB 1HEZA 4OGXL 3O3BA 3S7GA 1FQ9C 1YNLH 4M7LH 4AM0B 1RZIA 5DQ9A 4PJ5D 2VXQH 5D71H 1Y6NR 4DUVA 2HT4C 5FF6A 5INCB 2XFXB 3QQ3B 5JW3L 1Z6JT 1JNHA 1PFCA 4C58B 3QO1B 4X99A 3OJVC 4XB8A 4DK3A 4IJ3C 2YK1L 4HUMB 3ZMRA 3WIIL 5IKCB 3EYOA 2XRAH 2CKBL 1U8IA 4JY5H 3LS4L 4QRSA 3MLXH 1S5IH 1S3KL 1IC7L 5DMJB 4YDKL 3K46A 1HEZB 1BZQK 3LRGA 3O3BB 3VE0A 2ZUUA 1GGTA 1RZIB 1UB6A 5DQ9B 2MCPH 3S4SA 3N06B 3WO4B 5IJKA 1QNZL 5FF6B 1MPAH 5GHWH 1JNHB 4KKNA 4X99B 5IBTL 3EYQC 4Y4HD 1RIUL 3EYOB 5IVXF 4PTTA 3O6FD 3BGMA 4Z5RA 2LV4A 1OSPH 1U8IB 3DI3B 5I16A 1RVFH 5ISZE 1QFWL 4PIRF 4QRSB 2PF6A 1S7QA 1V5JA 1DBKH 3HTLX 5BZDA 5JR1L 3RWJA 1EJ6A 3VE0B 2IEPA 3R06B 2A1WH 1UB6B 1D9KC 1Z9OA 3S4SB 1JWUA 2OZ4H 1FYTD 4FMKA 4NKOA 3BDBA 5L9DH 1I9IH 3A67L 5FGCE 4NSKA 4R6UA 1WZ1L 2HFEA 3LQAL 1NFIA 1O5DT 5ID1A 4PTTB 3BGMB 4Z5RB 4I77H 5I16B 3ARGA 1CDJA 1ACYL 2M1KA 2X1OA 3S5LA 4BSVA 2NX5E 1S7QB 2Q6WA 5BZDB 2HLFD 4F58H 3EW3B 1ED3A 4JFZH 4OM1H 3TVMA 3PWLA 1ZGLA 2WWKT 1JWUB 3QSKB 3MMEA 4NKOB 4G3YL 3WNNA 4XGZA 4NSKB 3T77A 1XF4A 1P7QA 2HFEB 5F7HA 1Q72H 3ROLA 1NFIB 3ZKND 1KELH 5ID1B 4EI5C 4YHYB 3VDCA 4M7KL 1UEYA 1T7WA 3JTSA 3ARGB 1MJUH 2DQEL 1AD0A 2XWJA 4EVNA 3S5LB 4BSVB 1X5JA 3M1BA 1ZA3A 3PJSA 4KI5D 1V7MH 4P23A 2Q6WB 3BEWA 2VH5H 4ODTL 1T6VN 4NIKB 3DGGA 3RWCA 1ED3B 3BDXA 3TVMB 3C60A 4XPHH 3PWLB 1ZGLB 3P30L 1PYWA 3T3MF 5AG9A 2YHGA 3M45A 4R9HA 4NKDA 2J3SA 2VMFA 1TETL 4FFWC 4XGZB 3T77B 1XF4B 1P7QB 3R8QA 3T65A 4JAMA 1NMBL 4KDWA 3ROLB 3ARBA 2B20A 1YNTA 2V7NA 2GFBA 4LP4A 1JPSH 3JTSB 3MLYL 1AD0B 5AD0A 2XWJB 3I3DA 4EVNB 3RVXD 1LDPH 5F7DA 3M1BB 3PJSB 1ZA3B 2IPTH 4P23B 5AZEH 5FGBC 2XTJE 2ORBH 3BEWB 1EX0A 4HKXA 4OLVL 4Z7VF 2Q7NA 1FGNH 3GGWA 3JV4A 3DGGB 2EDJA 5F9WB 1I3UA 2HT2C 3FL7A 4OCRL 1PYWB 4P9HL 3ZDXF 3SGEI 1CGTA 2FLBT 4UINH 3BWUC 4LSRH 4NKDB 1L7IH 4JJHA 2CKNA 3WSQH 1FDLH 5CEZH 2IFFL 4NFDA 3T65B 3UC0H 4JAMB 2RGSA 2VDPL 1W72A 4Q58C 3ARBB 2VLMD 1YNTB 4MCZA 1D7FA 2NR6C 4PYGA 3GSOA 3BVNA 3KJ6L 3VD4A 1KEGH 2YD3A 5AD0B 1OARL 1X6LA 4O4YL 5F7DB 3X12A 4YPGA 4HKXB 3GGWB 2OR9L 3JV4B 4OKDA 2B2XL 5E95B 5KSUA 4I2XA 1F3DJ 1MI5E 3FQNA 4ZS6C 4XP5H 3MXVL 4TOYH 4HG4K 1PDKA 4LBEA 2R1XA 2EXYC 2OJEA 3KLDA 2WNGA 2X4UA 1OD7A 4RGOH 1EFXA 5J57B 4MCZB 3VFSA 3GSOB 1H9VA 3BVNB 1UJ3C 1LNUA 4A6YA 1YEEL 3X12B 1ZOXA 4YPGB 4YK4C 3SDCD 3HZYA 5KSUB 3OXRA 4I2XB 3HRZA 3FQNB 5KW9H 2RR3A 4NJ9L 3O2VH 3GKWH 4S0TD 3RGVC 4K8RH 5KVGL 2R1XB 1CD9B 2OJEB 3GSNL 2ZNXA 2X4UB 1YA5A 1AGFA 5HYJE 5CZKA 2XPGA 1EFXB 2QEJA 4JM2F 4WGWB 3VFSB 4PRIE 5EU6D 3AS2A 1LNUB 2WMPA 3NABH 4A6YB 3U4EA 5JQ6L 2DN7A 3HZYB 3SE8H 3OXRB 3HRZB 2FBJH 5D7IF 2XZAH 2WQRA 4DEPB 3NH7H 5A43C 1S78D 4Z7WF 4APQC 1PX4A 4KV5E 4HLZH 3KHOA 3B2UD 1AGFB 1C12A 2XPGB 3LPFA 5CHNA 4N5UA 4OLUH 4V1DA 2RIKA 4M02A 3DRTA 5TQ0H 2EKJA 5CEXA 3U4EB 5D96C 1Z9LA 5C08E