3GGWA

Crystal structure of fab f22-4 in complex with a carbohydrate-mimetic peptide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
218
structure length
218
Chain Sequence
DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSDGITYLYWYLQKPGQSPHLLIYHLSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGIYYCAHNVELPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB F22-4 LIGHT CHAIN
publication title Structural Mimicry of O-Antigen by a Peptide Revealed in a Complex with an Antibody Raised against Shigella flexneri Serotype 2a
pubmed doi rcsb
total genus 49
structure length 218
sequence length 218
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ggwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ggwA01
3LB6C 4YE4H 3MRCA 4EUPG 5DFTA 4Q9RH 3PGFH 4NRZA 1KLUA 1PLGL 1T04B 3MRRA 2V7HA 2NY0C 4MDIB 3WXWL 3A6BL 3HE7A 1WTLA 5B38G 1L7IH 3JVGC 3PABA 2FO1A 2HMIC 4G6FD 3SBWA 2R0LH 2LTQC 1RJCA 5J13B 4JREB 1MI5A 3HZKA 1S7QA 4MB3A 1OARL 3VXSB 3ULVL 1YNTB 3KXFA 5IB5B 1IT9H 1FVCA 1PG7X 3JTSB 3RVTD 1J9CT 4DKEL 2HJFA 1UVQB 3VFWB 1NCCH 4DGIH 43CAB 3VWJA 5F8QC 5T1KA 4C4KO 2F53A 4JHWL 3SDCC 1MCWM 4NT6A 4XNZB 2HTLC 4EN3C 4LCCB 4E0RA 2D9QB 5E8PA 1FFQA 4O2FA 5L6YH 3QJHA 4XPHL 3A6OA 4Q9QL 1O5DT 4L8CB 4ZD3H 1SJHB 4C55A 5FM8A 4HFUH 1MAMH 1M05A 2AXGB 1N26A 4IHOB 4BUHA 5DK2A 3ARDB 3OKKA 2V9TA 5DRZA 3MRIB 1X5XA 4KZEH 4I5BB 1ACYH 3MUZ1 4WHYG 1A2YB 4QRSB 4IRJB 3DO7A 3T4YA 1AP2A 4LSQH 2H8PA 4LSVH 1E4WH 1BPVA 1OGAE 1RK1A 2HRPH 4HIIA 2B4CH 4GW5A 1JYVA 3BPLB 3MRJB 2UYLA 1CGYA 3VFPA 3QQ3A 4K3EL 3FT2A 4JPKL 3T3PF 2Y06L 1HHHA 1T6WA 4NCDA 1H3PH 3HAEG 3ZKXB 2VDMH 5JO5B 3QO1A 3NZ8A 1G7IA 5SWSD 1OTUC 2W9LA 1CXEA 1JGEB 2EE3A 4I3RL 1VERA 5D7JA 3ULUC 3K81A 4WO4C 5DD1H 1I8KB 1CGTA 1ITBB 3PXJA 4W68A 1OL0A 4MXQD 3GI8H 3BJ91 2Z4QB 3MA9H 5DQJA 1R3HB 2PXYC 2ICCA 1GC1H 4LRNH 5IW1B 5J57B 2CPCA 3T0EC 4HIJA 2FO4A 3WSQL 1S7TA 2BHUA 3QUKB 4DCQA 5C0GB 4G8EB 5AAMA 1OAYL 4QGYA 1JNJA 4MWFB 5FYKD 4GAFB 4A6YA 4JPWL 4GRLC 3CLFL 4KPHH 2E9BA 3EFFB 3W0WB 1BJ8A 2VUOA 3L3DB 4UT6H 5D7SH 2UWEF 4X80H 4JFYA 3TO2B 4XCEA 4HJ0C 4ZUVB 2IEPA 2VQUA 3NCYS 5B4MC 2EC8A 3TBWA 2EKJA 4XVTH 2XZAH 4MB5A 1NDMB 3DVGB 4ACPA 1HHGB 2NLJB 1DBBH 1Q9KA 1T66D 4XNXL 1NL0H 1C7TA 3DI2B 3JWOC 5F7EH 1BJ1H 2R29H 4MD4B 1LP9A 5FKAA 4R96A 5L2KB 5FK9A 4OTXH 5CD3B 3UTTD 3PQYE 1U91B 3CD4A 3BH9B 4MDJA 3HI1B 5D8JL 5M95B 3VW3H 4KROB 4H26A 4TNWF 1NUFA 3A6CH 4ZO6A 3OSKA 3UYPA 1HNFA 4M6ML 4K3HA 5IESH 3TYGH 1KPUB 2FIKA 3TEUA 3CDYA 1S8DA 2FL5B 4LLDB 1YEHL 3DHJA 4HG4J 1QPXA 4B5EA 3QIBD 2FD6L 2J88H 3WKML 5C0JA 1DP0A 5HPOA 1IM9D 3W9EB 4JO2H 3E0GA 4OI7A 3K3QA 1PX4A 4XZUA 5J3HC 4XPTL 2ICES 4OLEA 5F6HJ 5ESVA 1MLCA 5IVNA 4XNMB 4I2XA 4PJGE 1LNUA 2AK1L 1P1ZB 1JK8A 2J3SA 1TQCC 4KI5F 1XF3B 3BD3A 3H0TA 4YWGH 4IRSB 1AXTH 2VMFA 1M6OA 2BVYA 5EWIL 2EDDA 2WQ8A 4OM1H 5JHDB 1ZK9A 4QTHB 5JPNB 2JB5H 3V8CA 2YRZA 4U31A 3VXTB 3VFGL 1JGVH 2BFVH 4ZOAA 5GRUL 1KLFA 2JE8A 2ARJB 5JW5A 5BV7B 2EIZB 5I6XC 1V7ML 2R4SL 6FABL 5J0BA 3NA4A 2BMKA 4MVBC 1KB9K 2R9HC 1DDHB 2X1WL 3QAZC 3MLYL 3IU3B 4RISL 2P1YA 2XKNA 1KJMB 2IBBA 3C6LA 5FHAL 3MV11 1GGIL 3KPMA 1RZKC 1XGQB 4NUGL 5D1XA 4LOUC 2W0FA 3U48A 5IMKA 2AEQL 1AE6H 3V7AG 1HXYA 4GH7B 4Y2DB 4NQXA 4PB0H 4K2UL 3WLWD 5ITBH 3HI5H 4ETYA 1S9XA 1T0PB 3MLXL 2R1WA 1F4HA 4ZQKB 4WUKH 1CD8A 3LQZA 4BZ2L 1P6AB 3VGFA 4LSRL 3HZMA 3TBVB 4U6XB 4ZFZB 2P43B 2NXYB 3UPCA 3FQTA 2X9XA 5E00A 3BPNB 5AYUL 1FNSL 3S4SG 1QBLH 1RJLB 5IHUL 1S5IL 1HZHL 2IQAA 4KUCD 3TV3L 3BHBA 2PNDA 2FSEA 2Y9RT 4ODWB 5FF6B 3QHTC 2GSIB 3OTTA 1LGVA 4Z7VF 1QLFB 1T2XA 1FCCA 1XCTB 3KYMA 4XI5D 1MCKA 1TCRB 2P5EB 5JQ6L 5IEKA 3LZFL 5DF0A 3OAZH 3UCRA 3OPZL 1B4JL 4X8JA 1I1YA 1BGXH 3AXLA 4HD9A 2PYFB 2OBGA 2HWZH 3EFDH 3GO1H 4QRPD 4ZS7L 2XN9E 3G04B 1KJ2H 4QHLA 3W0WE 1XAUA 4WY7L 4OZFH 4Q2ZB 3REWA 1KTDB 1UM5L 1J8HA 4Z0BL 4G6AC 1FDLL 4P5KB 1MLBA 4TVSa 3MJ9H 2R56L 4YXLL 4FXLA 3HMWL 4JCMA 1GIGL 4CU7A 3S97C 5DD0L 3IS0X 3L9RB 3JTTA 1IEBB 3PWLA 4ENEC 2VXVL 5DDHA 4CKVX 4Y5YB 3CDGA 4XH2A 3SJVB 3MRNB 4Z8FH 2VIRB 1N0XH 4XP5H 4YHLH 3GUTA 2VDQL 2WIMA 4LSSH 3SDAD 4LHJB 4OCWH 1I1AD 5JXEC 1T1WA 4WWKB 1UZ6E 5C0CE 2OP4H 5D1QC 1U42A 1V3KA 1D5BA 3GIZH 1MFCH 3TFKC 4U1SA 2HYMA 4UDUB 2J8HA 3MR9A 1NGXB 1D5XB 4PGEB 3MA7B 2DM4A 2D03H 3MLSH 2YRLA 1JF1B 3T8XA 1J1PH 2EZ0D 2HVKA 2EDOA 1FNEA 2Q86B 1KN4L 1DQDL 2JIXA 3F58H 4NQEA 4CJ1A 4EBQH 1ONQA 1CDBA 3TH3T 3BE1H 5IBUG 3V5HB 3MOBL 1T1XA 2WBKA 2LV4A 1FG9C 3NABL 4JFDB 4UQ2B 2JB6A 4FQHB 4MAYA 2AXHA 1SM3L 5DYOA 1OP3K 1XGPB 2Q7YA 2R2HA 1A0QH 5DQ9B 4JFED 5DVMA 5HHQA 4LVOB 2X70A 5I8KL 1A9BA 2CDFB 2NY3B 5JHDE 4ODHH 4WDIA 4C56B 2VLRB 3RWGB 5F8RC 4JQIL 4XPBH 1GSMA 2GTZB 3EYQC 1MFAH 5EO0A 5I1CH 4RRPA 2ESVB 3V6ZA 1UACL 4F33A 1KTLB 4KTYA 4RFEA 3VWKB 2ZUVA 2A77H 4XBEL 1DLFH 4QOKA 1PZ5B 3R0NA 3QH3B 2J5LC 3SQOH 4LEOB 4ERSL 4OV5B 1WBXA 5JQHC 3VA6A 2EDJA 4GRMA 3L95A 4ZTPH 5GS0C 2K3TA 3MRLA 5I17A 2QSCH 3X14A 3GRWH 4RMQA 1BQHB 1UCTA 5I75B 2F8VA 2DLHA 3P73B 3QZWG 2R2BA 2BHYA 3U0WH 3S96B 2N7AA 3V6OC 3KPLB 1G9EA 2P4AB 1DJSA 4X5WB 3Q1SH 2VZTA 4XBPA 4LRIA 3F62A 4ELMA 2GTWB 3CMOH 4LAJH 4WTWA 5GXBB 3RGHA 1IM3B 2AJZB 1ND0A 4PJDE 1HYSD 4F15C 3CSGA 1JV5A 3CSYB 4GKZA 4LDEB 4MNQD 4Q7DA 1BBJA 3SPVA 3D3VA 2JKXA 5ACZB 3CUPA 1FC2D 4XXCC 3QDJD 1TETL 2ADJB 4LVNB 3TN0A 1CICC 1UKSA 4KI5C 3OWEA 5EUOE 2VDLL 2QSQA 3U0TB 1T1YA 1D6VL 3IDXH 1PQZA 3T1FA 3NA9L 1TZHA 2CRMA 2YMXL 4HZLA 2GCYA 3VI3E 4PLJD 3IYLW 1HH6A 2P5EE 4HW6A 5K9OA 4R2GB 1IL1A 1UADC 1KEGL 2XXMB 4ODSL 3BP5B 1IGJB 3UYRL 3MZGB 3LKOB 2DLIA 3VCLA 2G75A 2BHZA 1B0RB 3FB8A 4U1LB 3DARA 2V2TB 2R0ZL 3BAEL 4LCUB 4L8SB 3L3IB 3ZDXE 3MNVB 4ALAH 5LGJA 4KVCL 2P44B 5ILTH 4PRBB 2YD3A 1FLRH 1NAMH 4P3CH 1CZ8L 4Y19D 5IBTH 3UTTB 2YC1A 3MUGB 1R3JB 2RIKA 1UWXK 2JCCB 1OT2A 2DQUL 4LVHB 3TC9A 3QDGD 4M8QA 4I18A 2DLGA 4MNGA 4P0DA 3QXDA 1FFNA 2EC9U 1A47A 4JHBA 2RGSA 1A3RH 4KJWD 1ES0B 4QXTA 1RI8A 5DR5H 5I74B 3V0VB 1DBMH 3IDJB 5HHXL 4XC3L 4UAOC 1WLHA 4GBXC 2VXSL 4W4OC 4XX1G 3VRIB 4RMRA 4Z0XA 1KLGA 4NO0D 3X11B 3SDYH 1RZJL 2DIAA 4O58L 5K9JH 4HH9A 5IWLA 5INDA 4AH2A 5IGXH 3ARBA 4WTZG 5T1MB 1WUNT 4RAUB 4M6OL 2J12B 2WANA 2JELL 3LRSB 4XXDA 1N8ZA 1HXMB 5GS1A 4GRWE 4QYOB 3GHBH 1P6FA 3C5ZA 3QNZB 1E27B 4H5SA 5DMGD 1RULL 1P4LA 4KRMB 3C8KA 4LKXA 4R0LA 4NN7B 1I1FA 1HNGA 4Y5XA 2KL6A 3PP3H 3PWUB 4GXVL 1INEH 4XMLH 5FM5M 1UQSB 5KSBB 1HDMB 2IALB 3BW9A 4JY4B 1QP1A 5FECB 2BOBA 2DQHH 4JDTH 3MRQA 2NTSP 1CGUA 1PW3A 4OD3L 4HPYH 3RKDC 3X3GH 1AHWA 4LGPB 3OR6B 3DX9A 3SO3C 2WBJB 1N64H 2DYPD 1DBKL 1JPST 3T77A 3E6FA 2MTPA 4OZGA 4R3SA 1W0VA 2NY5H 4Y4HA 1M4KA 2C26A 3TO4A 4LNRB 4LSPH 1U8PA 4NDMB 2WMPA 4MNHB 5F1NB 3LB6D 5FYJL 1IBGL 2HFTA 4HX1B 4N5UA 4B50A 2VL5B 1P7QD 2XWBA 1DANU 1YEFH 2NY0D 3BWAA 3QHZH 4GQ9H 2CO6B 1LEKB 4NQDA 3GSQB 1G6RA 5EOTB 3HFMH 2HMID 3RUGE 1I8MB 4PRIB 3O41A 2NXZB 4F9LC 2Y07L 5SWSE 3ESVF 3HLAA 3NFSL 1HK6A 1MH5B 2FEEI 4UUJB 4ZUSB 4JLRB 4OFYA 2ADIA 4OLXL 1B88A 3ARUA 1MFDH 4F3FB 4XGZA 4PJ5D 4JFFB 4M6NH 4P3DA 5CZVL 5BVPL 5IB3B 2FIRT 5FUZH 3WLBB 5HI5C 4XNQA 2HTLD 4WEBH 5EU6A 1DE4B 5DWUL 1Q0YL 2Z31C 4M9OA 1T2QL 5DJ6A 5I1KL 5I1LB 4WFHD 1LK3L 1FGNL 4POZC 2GKIA 4XCNB 5FYKE 5GSVA 3IU4L 5BVJA 4QRPB 3QDHA 1HIMH 2AV1A 4G9FD 1S7WB 3LKSA 2AGJH 4Q97A 5CCKL 5I15H 1TCMA 3F5WB 5IQ7L 1XH3B 3D39A 5C0AA 1JZ5A 4U0RB 1T0NA 5J11B 4HUNB 3WNNA 4DAGL 1K9TA 3ZT7A 1T21A 3STZB 5E4EB 2ZUQB 1OSZA 2OR9H 3SCMB 1I1CA 2YD9A 2F5AL 4PTUA 2YBRB 5CIPH 1JWMB 2BRQA 2VH5H 5EU5A 3BQUC 5GISH 2H2SC 2OCFD 4MA7H 1MCWW 4YNYB 2GSGB 4P5TC 1A6WL 4NN5B 1FORH 3BGMB 1RURH 3FAWA 4JPVH 3G5ZB 1I1AB 3DXAB 5DTFA 1QFUL 1I9JL 1JHTA 3VGBA 4ZDHB 5A2FA 1ZVSB 2D31B 4CVXA 3UTTE 1Q1JL 4HJGB 4PRHD 3CFCL 1X7QB 2CIKB 1EHXA 1B2WL 3VD5A 5D2LA 1AGEA 2APTA 3BKMH 4KHTH 4WO4D 3AVEA 4JANA 4HQQL 1IKFL 1G7MA 2RFXA 1A7PL 5DS8A 3T0XA 4LCWD 2PXYD 3SKOB 3BH8A 3BN9D 5E2VL 1A6UH 1A9EA 4U3HA 3T0ED 1MEXH 5SWZD 3GMRA 1SYSA 2GK0A 4JO3L 1JYNA 4JRXA 5D1ZB 3MGOA 5IOPA 1ZT4A 3F7RA 5D5MB 4PS4H 1T03L 4P99A 2BRRL 4F9PC 3Q6GH 4OZIF 2C1PA 4GRLD 3OAUL 1SJVA 2DIJA 3MYZA 4JFEB 3GSNH 2GJZA 3O0RH 5TDNB 4AIZB 5F96L 2QSTA 3ZYIA 3G6AA 4OLWL 4OD2B 4RMTA 4FFVC 5B4MD 4Y4FC 1EHLL 4M7ZC 5LQBH 4H25B 2XWTB 4KDVA 4PY7A 3O6LH 1MAKA 2ATPA 1A6TB 1CIUA 2OTPA 3BUTA 3MV7D 4NCC1 3TCXA 5K9QI 4I0PA 5DC9B 2FLBT 4BQ8A 3ARPA 5EZIL 4IDJH 1VDGA 2OTUA 2OTWA 2EE2A 4FP8H 4XB8A 4BFGA 2GK2A 3G08B 2OR7A 1OF2B 4MJ4A 5IB1A 1N4XL 2ZSWA 1BLNB 1AO7B 4IOIA 3DIFB 1H5BB 4LDLB 5KSBE 3TWCL 5L7XL 3BKCH 1OM3L 1M7DB 4ZUWB 3V5KB 5HYQA 2ZP0T 4ZXBC 3RZCA 1REIA 3O11B 3P4MA 3P4OB 5DVOA 4PRPD 4DFHA 1IARB 1NUGA 4O5LL 2YHGA 3KJ4B 4KK9C 3OR7B 5E8NA 5GGRY 4M5YH 5DMKB 4XC1L 3EUUA 4NRXB 1UH3A 2ATKB 1MUJA 3B2VH 5ENWB 4HUXB 4AT6B 2YPVH 2GHWB 3TNNB 4JY5H 4O9HL 2VITA 5J3HD 1WITA 1Z5LB 4Y16C 4KK6D 4LPTA 4WUUD 2NNAA 1XGTA 1A21A 5DRXB 3TA3A 5JIPA 3QXAA 3BO8B 3WO3B 3MO1A 1IQDB 1PX3A 3MXWH 3GIVA 5DJAB 1R3KA 2HT2C 3CFEA 4N1HB 3S98A 1TJGL 5KVDL 3QDJB 3ZE2E 5JUEL 4M1CC 2P45B 3IDMB 1QO3A 3V6FB 3G6DH 3BDYL 5I8EA 2F5BL 3WV0A 1IC5L 4Z7UF 2ITDA 5C71A 2A0LC 3B9KC 2YK1L 3NIGE 3ULVD 5I1IH 1F4AA 2VWEE 5IFHH 2AXJA 2R9HD 3L7EA 3V4UL 2BVPA 4LVEA 5CEYA 4YFLF 3L3KA 5D7LD 5K9QG 1Y6NR 5D7IF 4W6WB 4J6RL 1CXFA 4W4NA 4Y5VB 1KGCD 2WINB 3U7AA 4N5EC 1H3WM 4QRPE 5ICZB 4LOUD 4PJHE 3LPFA 3S88L 4Y19B 1ZVYA 2J2ZA 2ZUYA 5LGKA 1RU9H 1TENA 2PTTB 3OGCA 4PJCA 4D2NA 3H7LA 3QIUA 1AD9A 2LQRA 3REVB 3S37X 4PRAB 1BX2B 3GMMB 2B1AH 5HJ3B 2OQJA 2HTKC 3KNBB 1ITCA 3D48R 1H8NA 4HK0B 3HZVA 3NCCB 4JFZL 2DKMA 4ODBD 5C0IA 5TDOA 1DQLL 1QKZH 2EYRB 4JM4L 1KULA 4I48A 1YEJH 1CFTA 2FNBA 2H9GA 2VC2L 3K1DA 3Q48A 3ES6A 3U2SB 1CVRA 2VXQL 5ISZD 2KPNA 9CGTA 2XZZA 4HJJH 1M7IA 4R90L 5T3ZH 2Q6WA 4L9LC 3PDOA 3KAAA 3VJ6A 3MRPB 3PGDA 3LSOB 4GSDH 3FTGA 4DOHE 3CLEH 2R0WL 3O3UN 4GKOA 4Z7QF 1NFIA 1S9WA 1JTTA 3QCTH 4XVUC 4HIHB 1W72A 3MV9B 4YDVA 1QFWI 5JHLH 4YQXL 1JN6A 3BP7B 4OCXL 5C0BD 25C8H 4JFEE 4KUZH 5KS9F 3PL6C 5J06A 4JDVB 4NP4H 4TRPL 4X6CA 5C0FB 2BNQD 3CVIL 5A2LH 1CBVH 4HLZH 3MNZB 1JF5A 4NZTL 4ENED 1S7RB 5FO9A 3O9WB 1KXVC 4OJFH 4M48H 2ADGA 5HGAB 5HPMA 3T2PA 1OP5H 5CJBA 1NFDE 1PLGH 1FFPA 4YIQA 5D6DA 5DD6B 3FT3A 3WXWH 4C4KT 3A6BH 3HE7B 5D1QD 4PJ7A 4F8TA 5BZDA 5T33L 4Z95L 4A6YL 1KJVA 1S3KH 1JF6A 1A1NA 1YN7A 2DBJA 2X1OA 4NCC2 1VKXA 1Q72L 1PG7W 4V1DD 3TFKD 1JPTL 1CFVL 2QEJA 4J4PC 1MI5B 1OARH 3MV01 3ZE0E 5GJSL 2P8LB 4X9FA 1EV2E 4WFFD 2GT9A 1YNKL 1F4XH 1FVCB 3VFRA 4DKEH 3WO4C 1BFOB 1UM4L 2EDXA 2HJFB 5F9OH 4DQOH 4DZBA 4TVPH 4CNIA 4GG8A 3INUL 1GYAA 4UB0L 3MRGA 2I07A 4XAKD 4MXWH 4NT6B 5MHSD 3CH8A 1Z9LA 2Z92B 3C60D 3TBYB 5E2WH 5HVFB 2VLJD 2BNRA 5E8PB 3SDCB 3VFNB 3IT8D 3F6IA 2O5XL 4MNQE 3QJHB 4XPHH 4EN3B 4Q9QH 1J8KA 1HHJA 3SE3C 5FYJU 5H37H 4JQVA 4QXUH 3PWPA 4AK1A 3QDJE 4X99A 3K7UA 4P57A 1JZ6A 3D9AL 4JKMA 3AAZB 3B43A 1KB5L 4FHBD 5FUCC 5DJ2A 1QSZA 5LJYH 3EYQD 4X5XB 3NACL 1Q94A 1MRFL 5I1JL 1HCFX 3GJFK 3DO7B 2CDEA 3T4YB 2H8PB 3DO3A 1NMCC 2X44D 2BK8A 4HIIB 2CUMA 4GW5B 5DHVB 4ESKA 4ZFFA 3OKOB 1BREA 4L4TA 1DQJA 4K3EH 3TT1L 3FT2B 4JPKH 3VG9C 43C9A 5E6IA 3CFBA 5F1SA 2A83A 2DQIL 4OZ4B 5GS0D 1G7LA 3B8SA 2WV3A 4I3RH 5D7JB 4Y19E 2VR9A 2AJXL 3JWDC 4PRHB 5IK3A 4JVPA 4PD4K 1G9NC 5DQJB 5F71A 5AYQA 5BV7H 4M3KB 1ZHLA 1JNLL 3EOBB 5F7UA 4NKOB 3QDGE 4DGYL 1EVTC 5E6YA 4HIJB 1KC5H 2L7JA 2FO4B 2QR0B 5IVOA 4DCQB 3VWJC 1OAYH 2D0FA 1Z3GH 4P46B 1A7BA 1U3HB 3G5XA 4M1DL 1KIQA 5GS3A 2LVEA 4JPWH 1HQ4B 5EPMB 1A22B 3NFNA 3HHRB 4OCRL 3Q2CA 3SDXF 4BM7A 2KDGA 5ID1A 2GY7B 3AROA 3IFOA 2F74B 2AV7A 3OKLA 3JWNC 2A2QT 2FGWL 3MODH 4ODXB 4DZ8A 1VADA 2IH3A 1X3DA 3DVIA 3FO2A 3PV6A 4L1DA 5CJOL 3BWUC 5IF0A 1CF8L 4WHCA 1QA9A 1IGYA 5DD3L 4GW1A 3QUZA 1Q9KB 4YBLC 3L3JA 1YY8A 5KJRL 4P2RA 2Q7NA 3FRUA 3VI4E 1BF8A 1LP9B 5FKAB 4YDIH 2Z8VC 5L2JB 1YDPB 4J3XA 1VEPA 4MDJB 1J87A 3T4AA 4NKDA 5DUPL 3UBXA 2ZJSL 4MJID 1FRGL 1DLHB 1TJHL 4JZJA 3ARVA 3GHEH 3FQNB 2FIKB 1S8DB 3IDUA 1EEZA 1D3CA 3IRZA 1YEHH 3CU7A 5JDSA 1N2RB 2FD6H 2HLFC 3QFJA 4GW4B 4P2OC 3MJ8B 1CLZL 2VDPL 2QTEA 1NMAL 1OGTA 3G6JE 1J05A 1C16B 1Z9MA 2VXUH 2IGFL 4XZUB 4OF5A 1MCOH 1BQSA 1BD2D 1IAII 3H9SA 3U82B 3TIEA 2X4TB 1S9VB 4I2XB 4QGTA 1LNUB 3BP4B 1JK8B 5IROC 1HHIA 4U2ZA 4LHQB 4GBXD 3H0TB 1YNLL 3GMNA 1M6OB 1RZIB 4DW2L 2UV3A 4L8BB 3TVMC 1OSPL 3P0VL 4HKXA 3VFGH 4X4ZA 4HKZA 5AD0A 1QSFA 2X4OA 4XPFL 2W1NA 1V7MH 2R4SH 1EAPA 6FABH 4QRUA 1KCUH 1E6JL 4HGWA 1XF2B 1QPPA 4PJ5E 4AEEA 5I6XB 1IAOB 3WUWG 4P2CG 3SKJH 3MLYH 2XKNB 3O6FC 4I77L 3MJ9A 3C6LB 5FHAH 2D9CA 4HIXH 4M1GL 4XP1H 5D7LB 4WFHE 4NUGH 4CADB 5D1XB 3K1KC 3P0YL 2W0FB 1I7UA 2B0SL 3G9VA 4G9FE 3N1QC 2GIYA 4H88L 4KXZI 3RKDD 2LU7A 4GAYB 2Q3AA 2XFXA 2V2WA 3P0GB 3I9GL 4NNXA 2CGRH 4PJXF 3NPSC 1CTNA 2CUHA 5D96B 1A4KB 1S9XB 3GBLA 4PG9A 2R1WB 1KXQE 4J12A 4BZ2H 4Q58C 3QJFA 5GHWL 2YPLA 5J89A 5CUSL 5TH2A 4U49A 1FV1A 1RUPL 4L3CA 1NUDA 1FNLA 3T08A 1E6OH 1MJ7L 1HZHH 2IQAB 2P47B 3HPLA 3H7BA 1OAKL 5ITFA 4PRHE 5F1IB 4E5XA 3BPCB 3ULUE 4UT9H 4ODVL 5EORH 1NC2A 5JQ6H 3PWNB 4E41A 1P9MC 5IEKB 1ZTXH 5ISZB 3LZFH 4ZFOA 2X05A 5CZXC 1G7JA 5GZNC 1QLRA 2ADFL 3W39B 4LCWE 3TPUA 3CCHA 3MX0A 4MQTB 1I1YB 5HI5D 4O4YH 3T0EE 3AXLB 3RL2A 2VAAA 5SWZE 3OKNB 2Z31D 2CKNA 1B9ZA 4POZD 2AJYH 3K4DA 1J5OL 3O2WH 1ZT1B 4NHCH 4O51B 4L8DA 2CJUH 3QIWA 5K93A 4WY7H 4M7LL 3REWB 1WAAA 1J8HB 2IJ0C 4FQPA 1MLBB 3BD4A 4UU9B 1B90A 1GIGH 4MA1C 2BOCA 1I9IL 4UT7L 2E8ZA 4JM2A 3AREA 2VXVH 5DJDA 1FYTD 5MEPB 3CDGB 4XH2B 1T20A 3H9YA 1OVZA 4UIKL 4YDLB 3LKNA 3MBEA 5IMOB 2A6KB 3MV8D 1K8DA 3MV7E 2R1XA 3BQUD 3GB7A 3GRWA 1BBDH 3VXUD 3BXNA 5I18H 2J4WL 2Q8BL 4P5TD 4EDXA 4YEEA 3EW3B 1C1EH 3C5SB 4TSAL 8FABA 3BIKA 4WRLA 4Y7MA 5D1QB 1UA6L 3V8OA 3J7HA 3I6KB 3QUYC 4AQOA 3MR9B 2IPKB 4BH8A 1DBJL 3OX8A 1X5ZA 5DZOA 1YJDC 2PCPA 4APQB 1W0WA 4MSWA 2HVKB 3QEQD 3E6HA 3BKYL 4P4KC 4D3CH 3TZVA 3IFLL 2JIXB 5ESAB 4PRPE 5C0RL 1DQQA 3A0OA 4URTB 3AM8A 3AY4C 3QEHA 1LDSA 2D0HA 3U0PA 3NABH 2E6PA 5C0EB 1SM3H 4PJFF 5EO1A 2CMRH 1KNOB 4LKCA 2Q7YB 2CRZA 4WUUE 2FRGP 1KIRB 2VLJB 2X70B 4YGAB 5I8KH 5F21B 1A9BB 2EYTA 3TJEH 5KW9H 4L5FL 1FL3B 5DJCB 5I1HL 2ILLA 1I85A 1NMBH 1E4XL 1HHKA 5E5MB 2ITCA 4JQIH 5IIEB 2V17L 5EU3A 4JDZB 4FFVD 4Y4FD 4ZSOA 4OLYL 3S36H 5EO0B 1BOGA 3MLZL 1TQBC 4Y4KB 3T2NL 1TNNA 3VXOA 1H3GA 3FFCB 2ZPKL 2FX9L 4RFEB 1NAMA 1YC8A 4KJYA 1QFWM 3ARGD 2HFEB 4RA3A 4ERSH 1I1RA 5IB4B 1GZPA 1WBXB 1JGDA 1H0DA 1AKJD 3IXTA 4NC0B 4FQXD 5D7LE 3MMEB 4J8RA 3MLVL 2J5LB 3RWEA 2I5YL 4NNPL 1C08A 2VUYA 3B6SB 4N68A 2KUTA 3R06A 3W9DB 2R69L 3RWJA 3MRLB 5I17B 3X14B 5HHPA 4YAQA 3D85D 1Y0LA 2J8UF 2IAMC 5MEND 3L5WA 2ZUXA 1EFXD 3O3BA 5B38B 4PJBF 1UH4A 2R2BB 4HLJA 4OUUA 1MRDL 2W9DH 4KK9D 3O4LA 4K8RH 1PGRB 4X6BA 3ZDZF 1MCSA 4XBPB 4B7LA 4ELMB 5GIRB 2ED7A 5DA4A 4G43A 2DQEL 4GKZB 2P8PA 4WW2F 4Z5RA 4Y16D 1R3LB 3D3VB 4NQVA 5FYJD 3QPQC 1TETH 1FVEB 3TN0B 1A14L 4OCYL 2HT2D 3CU1A 5KVEL 4G6JH 1C7SA 2VDLH 3HNVL 2DD8L 5ALBH 1D6VH 1MSPA 3N06B 1H15B 1MWAA 1CICB 1PQZB 4M1CD 3T1FB 3AS3A 1TZHB 2YMXH 2J7LA 2M1KA 4C54A 2GCYB 1BZ7A 4R6UA 4PJGF 3IKKA 3B9KD 5K9OB 1RIHL 5ISZE 4NKMA 2FHCA 3E1F1 2R1YB 1CTOA 2CR3A 1KEGH 1WQVT 1QVOB 3DGCR 4ODSH 5CGMA 4KKAC 4Z7WA 4ZUUA 3LS4L 3LQAC 3VCLB 1U92A 5DJYA 2X4NA 3PDDA 2G75B 2DJ4A 4BK4A 2KZWA 4KVCH 4U1MB 5LGJB 3O2DL 4OFDA 1ZHKA 5DLMH 2AJVH 3QXTA 1G6RL 3F12B 4PJEE 4N5ED 3LN5A 4QRTA 1FNFA 1IAIL 1BFVH 4YGVA 1TVHA 4OFIA 5C0BE 4LGRB 2AABL 1R0AL 1HH9A 5HGBA 2DQUH 2BNQE 3KPSD 3BISA 3HAEB 3LEVL 4P5MA 4HAFA 5JDJA 1II4E 4I18B 1IEAA 4MNGB 5FKPA 3QXDB 1FFNB 1YYML 2HTKD 4HV8A 4LASL 1F02I 4EDWL 2JJSC 4U3CA 2HT4C 4QXTB 4XCCH 2DM2A 1BD2B 5KSAA 4QT5B 2VXSH 2Q76A 2DTML 2EDHA 2XI9A 2H32B 2DM3A 5AWNL 3T3PE 1KLGB 3NIFE 3FL7A 1BIHA 4V1DE 1RZJH 1CR9H 5FYLE 4O58H 3TH2T 3OJDB 3DMMA 4HH9B 3T04D 3ARBB 4WFFE 4M6OH 4CMMA 2VQ1A 4XXDB 1N8ZB 2E3VA 5GS1B 4Z7VB 4P23A 3X3FL 3C5ZB 4H5SB 2BJML 5FA3A 4PP1C 5T3XL 1QUNA 4AENB 2H45A 3QO0B 3C8KB 4LKXB 4XAKE 3HR5A 5MHSE 5L8JB 1I1FB 4Y5XB 4OM0H 4XVUD 3PP4H 3STBA 2MCPH 2VLJE 1U0QA 1DFBL 4I0KA 5FGSA 1JZ2A 4HK3N 3PL6D 3MRQB 3BFOA 3IETB 5FGRA 1X4ZA 2D0GA 3AB0C 3HE6A 1JNNL 2LVCA 4JAMA 3U36B 1AHWB 4QHKJ 2UWEE 3X12B 5CBEB 3DX9B 1DBKH 4TSBH 1LE5A 4OZGB 1ZHBA 1W0VB 2CSPA 3FFCE 4R3SB 3SO3B 3MUJA 5KAQF 4ZNEE 1FE8L 3TO4B 3EDEA 3NAAL 1L6XA 3SGDI 3B5TA 1A4JA 2EKSA 4LNVA 4WTXA 2XWBB 1YY9C 4NUJA 5DK3A 3RWDB 3OQ3B 5EG6C 5H35A 4X7FC 3STLA 5DMYA 1J1XL 2X9WA 2Y07H 3ZE1E 4J4PD 3NFSH 1MNUL 3HLAB 3SDDA 2ADIB 3SGJC 1OGAA 3CDFA 3LEYH 4JKPL 4FFZL 4X7TA 3UDWA 4XWOD 2VL4A 5CJ5A 2SEBB 4BKLB 1IAIM 4YHKL 4XAWL 3V6OE 3BGFB 5CZVH 2VE6A 4P3DB 4F7TA 5BVPH 3MCKA 3GSNA 1MHHA 5AUMB 4XNQB 1VEMA 5DWUH 1Q0YH 5EU6B 1URLA 4S1QL 1E4KA 1T2QH 5EOCH 5E8OB 1AXIB 5DUBB 4M61B 5TGBB 3EJJX 5GSVB 2Z31B 3NZHL 4UTAL 4KRPC 4H1LH 2AV1B 3QDAA 5CCKH 1N6QL 1UWGH 3WFCL 4DN4L 2NY6C 5EC2A 4KI5E 5IQ7H 3KPQA 2ARWA 2OR8A 4PJ9D 4DAGH 1GOFA 3O8XA 3LAFA 1T83C 3I75B 3TBSA 5C6WH 5EU5B 4AEHL 3MRKA 1J0JA 1A6WH 1RK0B 5DTFB 1NBYA 3BQUB 3L1OH 1MFBL 1QFUH 4JG0H 4I13B 1I9JH 2F54D 5HI3C 5C8JB 4U1JB 1Q1JH 3CFCH 4K94H 5J12C 5L0QB 1CFBA 1V7NH 4MJIE 1PBYA 1EGJL 4JANB 1IKFH 5EZOL 3W82A 2RFXB 5B3JF 3MRBA 4F7MB 5DS8B 4NNYB 3BP6A 3BH8B 1NEZG 2EH8H 2ERJC 3MLRL 3OB0K 5E2VH 4EI5A 1GL4B 1CDUA 3PQYA 1ZA6B 5B39A 1AH1A 1SYSB 2GK0B 3EO9L 4W6YB 3S3JA 1PEWA 1B0WA 1G84A 3VWJD 5IOPB 1ZT4B 1T0MA 4LLVA 1T03H 4ZYKB 4EXPX 2BRRH 3DUSB 2XWJB 1A02N 1BD2E 2F53D 2YXMA 3DRTB 3VRLF 4WW2A 2DWEA 3V9FA 2EXYC 4TQEH 1MCPL 2GJZB 3OKDB 5F96H 1AY1H 4WHTA 4QKXB 4OLWH 4Q9RL 3PGFL 4P9MH 5KOMC 4DVRH 1FO0A 5I0DA 4Z7VE 2ATPB 5EUOF 4U6YA 1L7IL 1EO7A 4PJGA 5D7KD 1KF9B 2OTUB 1YEKL 2R0LL 4LDOB 1FZOB 5E08H 3WIHA 5FDYA 1N4XH 4CN1A 2ZSWB 1BVKB 1ULVA 2QQKL 4IOIB 3TWCH 5L7XH 1AKJB 1OM3H 5I2IB 3KYOB 1QFOA 1UVQA 3KPRD 5HYQB 43CAA 1NCCL 4DGIL 3UBXG 1NEUA 5HYIA 3TBTB 4CN4A 5HTSA 2HP4A 4ZXBB 3RHWK 3SE4A 4NWUH 3KYNA 2HLFD 3VXRB 4XC1H 2FJGB 4P2OD 4HUWB 1RIVH 4R7NA 4GS7C 1QLEH 3ZZ1A 1DQTA 4R4BA 2YWYA 4HKBA 3OF6A 3M1BA 32C2A 1DUYA 1Z9SA 3FCTA 4O9HH 3ZTNL 2AXGA 2DMCA 4IHOA 4NHUA 2VQTA 3RDTA 2NNAB 5HVHC 3DV6B 3NCYP 3QXAB 1MREL 3MO1B 4NO2B 1G7QB 1W72L 4KZEL 4I5BA 5FAAA 1ACYL 3VXMD 3GSRB 1ZLUH 3CFEB 3L3OA 1TDQA 1A2YA 1ORQB 4QRSA 5JUEH 1HWGB 3C8DA 2F8XC 4LSQL 2QKIA 3TVMD 3UAJC 1E4WL 2F5BH 5I8EB 4RFOL 2HRPL 2LE9A 2ITDB 3T09A 1NCNA 2YK1H 4PJIF 5HHOB 1P4IL 4HXAH 1D9KC 4NYLB 1XF4A 4L4VD 4NQUA 3UPRA 5JO5A 2VDML 3V4UH 1JPFB 5HGHA 5CEYB 4HEME 1CDJA 4OZFG 4U1HB 2MFNA 2BXZA 3O6FD 1KCKA 1G7PB 2AQ2A 5K33A 5GRXG 5DD1L 1I75A 1I8KA 4J6RH 2EDYA 1F3JB 5HXMA 4GRWF 2Z4QA 3GI8L 5M7QA 1D6EB 3MA9L 2JF1A 2EIEA 1UEYA 1YMHA 1MHCB 5IW1A 3BKJL 2LABA 4NIKB 2JJTA 4NQCD 4KY1H 2DQFB 3BMWA 2KH2B 3UPAA 2MJWA 2XZQH 1U9KA 3KPSB 3OV6A 3QIUB 3QPXH 1AD9B 1FYTE 4QXGL 3CNKA 2XN9A 3FRPA 2OQJB 3W81A 3V7AE 1JZ8A 4LP5A 5IJVA 2X89D 4R97C 3W0WA 3EFFA 4KPHL 5IG7A 1MIML 2XQBL 3MV8E 3RTQC 3MYJB 2EDBA 4JFZH 2MQCA 5E2UH 1OY3B 3VXUE 3LHPH 1PKOA 5TDOB 1DQLH 4JM4H 3UMTA 4XVTL 4PYGA 1IC1A 4HUVB 2XZAL 3VGHA 2H9GB 4YHNA 3DVGA 3ES6B 4NKIH 3GJFA 5F7FA 3M45A 4JVWA 4R90H 2YUWA 5F7EL 3WMSA 4AZ8A 2ICWI 2ZG1A 4S0SD 2YUVA 2R29L 3PDOB 3QI9A 4MD4A 3RUGF 1ZEAH 3PGDB 2BVQB 3VJ6B 3QDMD 1ACZA 1O7VA 5E7BA 5CD3A 4PG2C 1U91A 1U3JA 3BH9A 4LMQI 3HI1A 5GZND 2RHEA 2EEAA 3VW3L 4M6AA 4JO1H 3A6CL 5DHVH 1NFIB 1S9WB 5E5RB 2O5YL 5IESL 1KPUA 3TYGL 2FL5A 4LLDA 4YEFA 4JFOA 5SX5K 1JHLL 3V52H 4YQXH 1VA9A 1JN6B 3DBXB 3DNKA 3KLHC 2YA0A 4LCIL 2J88L 2IPUK 4TRPH 2CLZB 4X6CB 3W9EA 2HLAB 4JO2L 2X1XR 3ROLB 3ULUH 4FG6C 5IFJA 4NBXB 2ZG3A 1KPVA 2WUBL 3ARFB 1P1ZA 1XF3A 2FH8A 4IRSA 3KGRA 4NFBA 1FFPB 3BI9X 5JHDA 4OM1L 4QTHA 5JPNA 5JW4M 2JB5L 1EIBA 5D93B 4U7MA 1KJVB 1JGVL 5C09D 1A1NB 1L0YA 1VKXB 2ARJA 4OV6F 2EIZA 2AXFA 1ZA3A 1I8IA 1CFVH 5B21A 3QUYD 4FFWC 4LQ1A 1Y6MR 5CD5C 1YPZF 2R23B 3G9AB 5JW4N 3IFNH 3WJJC 1OPGL 1KJMA 3VFRB 1GXEA 3RWHA 4IEFB 2C3GA 4DZBB 4UV4L 2IBZY 1J88A 4UB0H 4FTVD 4AY0A 3WO4B 3UXFA 2I07B 3BEWB 1GVIA 5MI0B 5K59E 5KN5A 3VD7A 1DUZA 5ADOH 2BNRB 4M93B 2O5XH 1CFQB 4ZPTB 4Z7NE 3JWOH 5LAXB 4LHUA 5TE6L 1HINH 5HGGS 5FYJE 3PWPB 5BRZB 4X99B 3HI5L 5DQDL 4OGYH 5I8CA 3QG7H 4CW1B 4OZIB 2M26A 4WUKL 3P4LA 5F9JB 4PJDA 5A2JH 1I3RA 5HHOE 3TBVA 2I9LB 5FIEA 4DEPC 1Q94B 3ZKSD 1NGZB 4NZDA 3BRDA 1RJLA 2B4CC 1QBLL 2AJUL 4ZO7A 4C59B 1HE7A 3F65A 1JIBA 5E7FA 1UKTA 4HC1A 5EUOA 4ODWA 4GG6F 4IDLA 4L4TB 4XP9H 3TT1H 2GSIA 1D5ZA 2GY5A 4OF0A 3TH4T 3I3BA 5F7YC 1GCFA 1QR4A 1RJYB 4BSWA 1VACB 2P5EA 3CFBB 3S5LA 1BECA 2A83B 3VG9B 1G7LB 4KKLC 1ROWA 1MVUA 2Z8RA 4KK5C 2BCKA 2IAMD 5IK3B 3L7FA 1OLLA 1BEYH 3VE0A 2A6DA 1GC1C 3KPSE 1ZHLB 2FJFB 1MHPH 5TQ2H 1CL7L 2BSSA 5CEXB 3GKWL 1QYGH 2G60H 3EFDL 1IQWL 3GO1L 3G04A 4DGYH 3LN9A 5JA8B 2F8OA 3P30H 4PGDA 1MJUH 4NQED 5E1HB 1RZFH 1FZMB 1OAXH 3FMGH 2LU3A 1MPAL 2QADD 1D5IL 4P5KA 3MJ9L 2A6JB 1D5MA 1KELH 4M1DH 5E56A 3G5XB 3QPQD 3L9RA 1IEBA 3NFNB 1KN2H 2OZ4H 3DUUA 4OCRH 4Y5YA 4GT7A 2IPTL 2OI9B 1U8NA 5GGTA 1CD1A 4Z8FL 2VIRA 5A40E 3WS6A 1N0XL 3IFOB 2AV7B 1J0IA 1PFCA 3OKLB 2FGWH 2ZUWA 2I24N 2IH3B 4OCWL 3S3PA 3WDHA 4WWKA 5DD5L 4AM0A 3FO2B 3PV6B 1E4JA 2OP4L 5CJOH 3NTCH 5T1DL 3LN4B 3W11C 3U4EB 3V2AR 1F2QA 4KUCF 4KKAD 3ZE2F 3D87B 4GW1B 3QUZB 1W0YT 1MFCL 4OZHE 5KJRH 1YY8B 3LPGA 4UDUA 3W5NA 2OJZL 1MJ8L 1NGXA 4RBPK 4PGEA 1JE6A 2MNUA 4YBLB 3MA7A 2D03L 3MLSL 1J1PL 3BYYA 1F5WA 4Q9CA 3T4AB 5DUPH 4NKDB 4IM8A 4EBQL 2AJSH 1FRGH 1TLKA 1TJHH 3BE1L 3B3IA 3VXNA 3V5HA 1MFEL 5HGDA 4WNQA 3RIFK 3L6FA 1LD9A 3H8NA 4H8WC 4JFDA 2DLFL 3BEVB 2ZCLL 4HK3J 4UQ2A 5JDSB 5L9DL 4FQHA 3QFJB 1INDL 2XA3A 3FO0L 2XTJC 3DYOA 4ZFOL 4OF7A 2NY4B 2WWMC 1A6PA 1NMAH 4PJHF 1OGTB 1WT5A 1J05B 2Y36L 2CDFA 1UYWL 3DGGB 5TQ0L 2G2RB 3RWGA 3WD5L 3H9SB 4XPBL 2MKLC 4HKJB 2GTZA 2HT4D 5E70A 3TIEB 3WNPA 1HHIB 3H9HA 3PWVB 5I1CL 1YNLH 3VD4A 4W81A 4DW2H 1KTLA 3VXMB 4BSJA 3RAJL 2V9QA 3P0VH 1Z9OA 4GAJL 1DLFL 5AD0B 3QH3A 3T2OA 4LEOA 4XX1E 1YC7A 1EAPB 5EULV 2NY1C 4L3EB 4QRUB 4HH8A 1E6JH 4HGWB 2CR6A 1FC1A 3RUGA 3I3EA 4PP1D 4NOFA 1IC4H 2I27N 3EDKA 5DJ0B 4GFTB 2NZ9C 2IWGA 2QSCL 4I77H 5HYJD 3GRWL 3IB4A 5DGRA 5SWSA 4CVWA 1BQHA 1VFBA 3QULB 4WI8A 3P73A 5E9DB 3S96A 1UJ3A 3DYPA 2B0SH 2GTWA 3FQUA 4H88H 4FFYL 4PJAF 3UO1H 5KS9B 5FYLH 2OL3B 3KPPA 3C08H 2XFXB 2V2WB 3I9GH 3ZTJH 4NO5A 3CSYA 3I02B 2V7NA 4NNXB 5FUCE 4PR5A 4PG9B 2ADJA 4NFDA 4YHZL 3NPSB 5CJXC 5GHWH 1A1MB 3QJFB 3MLUL 2YPLB 2X2YA 5CUSH 1H3TA 1T7XA 5TH2B 1YY9D 2UVEA 1G0YR 4L3CB 4JG1L 1ADQA 2IFFH 4U1NA 2F54E 4ZPVB 3HPLB 1NFDF 2GJ6B 5EO9A 5KBNC 1IGJA 3FB6B 4CU8A 3LKOA 4QHMA 2QQNH 1B0RA 1NC2B 1WBYB 2BX5A 3HB3D 4L8SA 3KPNB 4ZFOB 4CJ0A 4PRBA 2AP2A 1BQUA 3N50A 1G7JB 1FLRL 3MQIA 1NAML 3QDMB 3CCHB 4HAGA 5IBTL 3UTTA 1J86A 2H3NA 2A1WH 1R3JA 2VAAB 2JCCA 4GAGH 1F4YH 3B83A 3JV4B 1J5OH 1RD6A 4ISVB 4Y2OA 3O3EB 4L8DB 1ZT7B 1JRHL 3GEWB 1X5YA 2C3HA 4M7KL 4M7LH 4QTIL 2E7HA 4LARL 5F3HA 1RZ7H 2NY6D 5GS0H 2ZUTA 5CLWA 5CLTA 1NCWL 3PHSA 1ZGLA 3QNYB 3MRDB 1T20B 5HDBF 1ES0A 5DR5L 3V0VA 4Z7UE 3LKNB 4FMKA 1DBML 5CHNA 3QP3A 5MEOA 3ECBA 3FB5B 3GB7B 3VRIA 2JLLA 4KH2A 3GDBA 5D7KE 4G8GB 1KCSH 1QQDA 2VTFA 4UV7L 1HOCA 2J4WH 2Q8BH 3X11A 5DRNA 3EGSA 3T0AA 4EDXB 4M03A 5EU4B 4MJ2A 5K9JL 1RV6X 1RZ8B 3SKMA 5I19H 4MXVE 4TSAH 5T1MA 5IHZB 5HI3D 2EICA 3AMLA 8FABB 1VFMA 3BIBX 4XMKL 5HI4C 5D7IE 2QLVB 5E99H 4KMTL 4GKSA 5IP4A 4TNWK 1DBJH 4AEFA 4HS8H 3RY6C 3QNZA 2FDBP 1E27A 3KPRE 4NQDD 1EK3A 4QXWA 5EH1A 1FNGA 1MWAL 4YR6A 5INCA 1OTTC 3BKYH 3E6HB 3IFLH 5CP3A 1MIEL 3PHQB 1EO8H 2C4XA 1C5DB 3PWUA 4P4KB 1YMMD 4OFYD 3SO5A 5IMLB 3DROB 1QSVA 3IXAA 1UQSA 3C09B 4XCYA 1DQQB 1F58H 5KSBA 3DV4B 1RZGB 4JY4A 3VMPA 1JPSH 1AR2A 2Z9TA 4JDTL 4FTVB 5EBLA 3FO9B 1WZ1H 3RHWF 4HPYL 3X3GL 1N64L 2EYTB 5ACLA 5I1HH 2A6IB 2EXYD 4BQBA 3VXME 3OKMA 5HSFA 1E4XH 1OB1A 1HHKB 3MFFB 4LNRA 2V17H 4NDMA 5EU3B 5F1NA 1U93B 4OLYH 4ZSOB 5DRWB 1BOGB 3T2NH 2Q20A 3VXOB 4GQ9L 3QHZL 4QCIB 1LEKA 3VFVA 4LIQE 2DJSA 5EOTA 5C0AD 4L4VE 3LKQA 3QA3A 3LD8C 3WN5C 5CBAA 3DOSA 3JZ7A 3UTOA 5T5NF 1GZPB 5IHBA 1H0DB 4JLRA 1LMKA 1FJ1A 4Z7QE 4R7DB 5E2TL 2I5YH 3RWEB 3UZQA 1MFDL 5E9DE 3O6ML 3JV6A 3RWJB 4KDTA 1KCRH 4JFFA 2H32H 4G6ML 1K4CA 1U8IA 4QWWC 2Z93B 2QHRL 1FIGH 5KS9E 5C6TL 5IB3A 2V5MA 5FUZL 4OUUB 1DE4A 1FHGA 4OQ1A 4NQCE 2DTSA 5I1LA 4X6BB 5DVNA 4XCNA 2RCSL 3T0BA 2XY1A 5JLZA 3RPIB 3TZVC 4OKVA 4QRPA 3GSUB 1HIML 2VDOH 4XCFH 2B8OT 4PJHA 2P8PB 4Z5RB 5I15L 3TP4A 4NQVB 3F5WA 1XH3A 3RNKA 1ZANH 4K7FB 3G6JF 1BZ9B 4OCYH 1IGIL 2YSSB 5KVEH 4XP6L 5FOJA 3STZA 2X42A 3HNVH 5ICXA 2OR9L 4D0DA 1MWAB 2YBRA 4GOSA 3SDAA 4P2QD 1LQSR 1ZVHA 4MA7L 5GISL 4YNYA 1S9KC 1SJEB 4MX7A 2IAND 3BGMA 2FATH 1I1AA 3G5ZA 4OCSL 4JEGB 1D9KD 4O02H 2FH6A 4ZUUB 3QDME 1ZVSA 5DJYB 4HJGA 1X7QA 5JMRA 2CIKA 2Y5TB 3PJSA 3QXVA 4I0PD 4HLZG 4ONFL 2I60H 1ZLVH 5FCSH 3UTSB 5D71L 3LN5B 1YN6A 3CMGA 3BRFA 4D9LL 5ALCL 3G5VB 4QO1A 1IRAY 5EA0H 1A6UL 3EAKA 1MEXL 4LLYB 2W59A 4P5MB 3OAYH 2VOTA 4KRNA 3RGVC 5FKPB 4WU5A 2YWZA 3FRPG 3S34L 5E24E 4JFEA 5BQ7B 3GSNL 5TDNA 4EDWH 2DQJL 5HHNB 3LDBC 3RTQD 3DSFH 2I9TB 1VEOA 1U2CA 2MKWA 4D0BB 5BW7A 5KSAB 2IF7A 4KKBC 2Q76B 2XWTA 4KQ4L 2DTMH 4M5ZH 5C09E 3TA3D 1VB9A 3VGAC 1A6TA 3IJYA 4DKFL 5ERWB 4OF6A 1NKRA 2UY6A 4IDJL 3WXVL 1NFDA 4FP8L 1T1ZA 4HFWB 3KWWB 3TIDA 1YYLH 3QHFL 1JYWA 2Z0BA 1BLNA 4P23B 4HS3B 2KZ1B 5LWYH 5T3XH 2J8OA 5H37G 4ZUWA 3V5KA 4FTVE 1XR9B 2XV6B 3JSSA 5DFVC 3O11A 5J6GB 2E7BA 1NPUA 2GI7A 2VR4A 4NZRH 1S78C 3V0WH 1DFBH 4LPWA 2CKBB 3KLHD 3BD5A 4M5YL 2P24A 2VZVA 5FCUL 3QRFM 2ATKA 1JNNH 3HE6B 4AT6A 3SDXE 4FQCH 1HYSC 2BDNL 4JY5L 2UUDK 2NY5C 1MVFA 5GJTH 4FG6D 5DRXA 3PE9A 1ZHNB 4MNQA 4POUB 3NAAH 2X4QB 4XRCB 1X4XA 3QDJA 2HVJA 1A4JB 1EZVX 2A9NH 3CZJA 4NUJB 5IVXF 4Y88A 1ZLSL 5H35B 4CGTA 3CIQA 2HH0H 1J1XH 4K9EL 2AK4D 5CSBA 5I1IL 4FFWD 1QNZH 5IFHL 3WJLA 3SDDB 3HPJA 4PJ8C 2PUQT 1TVBB 4XWGL 1OGAB 4UILH 4OCMC 4FFZH 4X7TB 4OAWA 1KTKE 3U7WH 5T1LD 3DMMC 4YHKH 4XAWH 4OQTA 1QFHA 1EEYB 2EYSB 1A7QH 5ICZA 2AW2A 1MHHB 4S1QH 4Y19A 3WIHL 4J3UA 4NQEE 1EHAA 3BZ4B 4HGKC 4LK4A 2R2EA 4UTAH 2R0KH 4U1KB 2F58H 3TJHC 4DK3A 2COQA 4JQXA 1V3MA 1N6QH 3REVA 4PRAA 4DN4H 3GMMA 5HJ3A 3TESA 2RB8A 4KRPB 1KTRL 1A7OL 4U6HB 4OIBA 2XA8L 2WLZA 4HK0A 3EOAA 4N0UB 4WV1C 1IC7H 4ELKA 4KJWC 3O8XB 1X5KA 5GSRA 5FXCH 3P77B 3TBSB 1XF5A 3OMZA 3QNXA 2DF3A 5ICYB 4AEHH 3NGBB 4OF3A 3MRKB 3EYFB 3NFPB 1NBYB 4HWNA 3U2SA 2NX5D 2VLLA 1K4DB 4NO0A 1U8JA 1XEDA 4HJJL 3ULVF 5T3ZL 1NSNH 5F88B 3MRPA 5GS2H 1FIEA 4KKLD 1T5WA 1PSKH 4GSDL 1H8SA 2K1MA 3L3GA 5FM4A 4IIQC 4KK5D 2ENSA 3S9DB 1FAKT 1RIUH 1RFDH 1TVDA 5J12B 3CLEL 1HCVA 4JFHD 3LY6A 3H2WA 5EZOH 1CLYL 4U1GC 1ZS8A 1CFNB 3QCTL 4ODUB 4HIHA 4X4XA 5AG9A 4PJBB 1JTOA 3BP6B 4OLUH 3MV9A 3BP7A 1ORSB 4PJXE 4KUZL 5B39B 2MWCA 4JDVA 4NP4L 2ERJB 2X41A 1CK0H 5C0FA 4BQCA 5ANMB 5BZWB 1UB6B 4G3YH 5E2JA 1T0MB 5E8DL 5GRJH 1HSAB 3PGCB 4YC2B 1CBVL 1S7XB 3FONA 4RCAA 1BFSA 3HRZB 3SGEH 1O7SA 4WW2B 1S7RA 2DWEB 4BZYA 1Q9WA 5TFSL 1T89A 2DYPA 4OJFL 4M48L 5HGAA 3LKRA 1SBBA 2BZDA 2P8MB 3WE6A 1FO0B 1GGTA 5DD6A 5L88H 3RWIA 2NW2B 1N6UA 4L4JA 1P7QA 1IKNC 4ZTOL 3CVHA 4TULH 4U6YB 3W11D 1G0DA 3P9LA 1S3KL 4PJGB 4YHPA 5I16A 1YEKH 2NCMA 3JVGA 1LO4L 3HNSH 2FJHB 4ZO9A 2P8LA 5HYJE 2QQKH 4X7SH 4WGVB 1F4XL 5DEGA 1DN0B 1BFOA 2EDEA 2OSLB 2OMNA 5F9OL 3U4BH 4DQOL 4TVPL 5E6ID 1JWUB 5JMOC 4PJ5A 1T22B 5FGBA 4MXWL 1B0GB 3BJLA 2J6EA 3KYNB 3H6JA 3ISWA 7CGTA 2Z92A 4PJEF 3TBYA 4R7NB 5E2WL 2EDNA 3SDCA 1CXKA 2XTJD 3VFNA 4GJTB 3OGOE 4EN3A 2CIIB 2WWMD 4R4BB 2VISB 4RDQF 3GBMH 4HKBB 3FQXA 32C2B 3M1BB 4QXUL 1DUYB 3FCTB 3ZTNH 5MP6H 5CFHA 4ZODA 4NHUB 3AAZA 4TOYH 1OCWL 3RDTB 4G9FA 1A1OB 1MREH 1JI2A 3N1PC 5LVEA 3K2UH 1W72H 2P5WD 3W2DL 4X5XA 3FT4A 4X6FA 5EZJA 3KJ6H 1U8HA 3L3OB 2Z8WC 2QSVA 1WZKA 3N85L 3V4PL 4EQ2A 2QKIB 3LKPA 4RFOH 5DHVA 3OKOA 3QCUL 1P4IH 5A2KH 3FKUS 1SYVB 1S7UA 5DEFB 5HVGB 2NY1D 1XF4B 4RFNB 1SHMA 3NIFF 3UPRB 4OZ4A 5HGHB 1AXSA 2NZ9D 1FNAA 3S35H 3TT3H 4RNRB 5CGYC 4PRHA 1BQHG 3RY4A 4PJFE 2ICEA 2E27L 4JREC 4WO4A 3BDBA 1FNHA 5BV7L 3EOBA 1YMHB 4NKOA 3BN9C 4YUEH 3BKJH 3VFTB 1F6AB 4LCWA 1KC5L 2PXYA 2QR0A 2DDQL 4FQ1H 3DX6A 5DGQA 4N0UE 1MCLA 1J18A 1X5GA 4NSKA 3VD9A 1Z3GL 4P46A 5F1OB 3T0EA 1KYOJ 1U3HA 4FQIL 4WU7A 5SWZA 4K3JL 3QSKB 4QXGH 3RFZC 1HQ4A 2XN9B 4XNZC 3SE4C 5EPMA 5IJVB 3OZ9H 1QFPA 4HDIB 4LCCC 2HJKB 5IG7B 1MIMH 2XQBH 1BAFH 4GRLA 2F74A 2C3VB 2D7TH 4ODXA 3MODL 3CXDH 4UBDC 2B5IB 3ARDC 4UOJA 2IH1B 3M17A 2W0LA 4YHNB 4P9HL 3CAFA 3UTQB 2GAZA 1JHKL 3GJFB 3MV7A 4NOBA 4IRJC 2J8UE 4TUKL 2LFGA 2KBGA 3QI9B 2L4OA 5C0CB 4PJBE 5L2JA 4NO3A 4YDIL 2DBLH 5B8CC 1YDPA 3ZE1F 2DQTL 5JR1H 3BPLC 1FFRA 4M7JL 1YMME 2MSPA 3ZDZE 1H8OA 4C58B 5LCVL 4KTDH 5ANME 1E0OB 3O3DB 4HC1L 1MJJB 1DLHA 3ZKXC 2O5YH 4YHIA 2FX7L 3FQNA 3GHEL 3GSVA 4KVNH 4K71C 4JFOB 1JHLH 1N2RA 4LCIH 4GW4A 1CLOL 3S6CA 4PRPA 3MJ8A 5CMAA 4J23A 1CQYA 1TMCB 1RJZB 1C16A 2VXUL 4AL8H 1CQKA 5IFJB 1MCOL 4KK6C 4HWBH 4XP4H 1KPVB 1HSBB 3Q5YA 2WUBH 1MOEA 2X4TA 1S9VA 4WUUA 3BP4A 3E8UL 5FB8B 5SV3A 1RZIA 3WFZA 2ICWJ 1P84K 4L8BA 5J9PB 3OXSB 1PD6A 3OJ2C 1IGTB 1MCHA 5LBSH 2DICA 4U4BA 3MJ7B 1BVLB 4JR9H 4YFDB 3ULVC 5KZCB 2AXFB 5J1AB 5HI4D 3T0DA 4NKQB 1ZA3B 1I8IB 5GGTL 1H9VA 1KCUL 4PV8B 1KCVH 1XF2A 4N9GA 5T5FL 2V5YA 1IAOA 4OI8A 1A6ZB 2AK4B 3SKJL 1OTTD 3IGAA 1OPGH 1RUKL 2CO7B 4O00A 3RWHB 5DVLA 4UV4H 1Q9LB 4HIXL 4K23H 5D7LA 4XP1L 5HHMD 1F6LL 2FHBA 3SGKC 2OZ4A 5GRYA 4CADA 5T1LB 4E41D 1T5XB 3KVQA 5KN5B 3S36X 3A67L 1DUZB 3KLDA 3KS0H 1UZ8B 4HULB 3GGWB 4GAYA 5IR1B 4KROC 5TE6H 1EVUA 4LHUB 3MCLH 2CGRL 2H26B 1NC4B 4U05A 4W6XB 5DQDH 1A4KA 1JFQL 5I8CB 4NWTL 4AJ0A 3ORJA 4D9RD 4IJ3B 2E7LC 3QIWD 4HZAA 4PJDB 1L4IA 1I3RB 1JPGA 5I76B 4P2QE 1JZ3A 2IANE 2AJUH 4JM2D 1E6OL 2FWOB 3O6KL 4HMEA 5CSZB 5EUOB 2HKFH 5F1IA 3BPCA 4X6EA 1D5ZB 5BMFH 4UT9L 3ZKQD 5EORL 3MPCA 1CGXA 4KK8C 3B8YA 3PWNA 3E3QC 3S5LB 3VH8A 4BSWB 3SE9H 3NPZB 1ZTXL 5ISZA 3PF2A 1OAZH 2DWDB 5IV2B 4QWWD 1OD9A 1MVUB 2BCKB 3W39A 3L7FB 3VE0B 1TZIB 5DMJB 2A6DB 3R1GH 1N5YL 4O4YL 5IW6B 4FA8A 4QRRD 3OKNA 4OGAD 1CL7H 3QUMB 4H20L 3GSWA 2BSSB 3GKWH 4HT1H 1IQWH 4U6TA 5DC4B 1KENH 5HBBA 2AJYL 4LIQH 3O2WL 1ZT1A 3BT2H 2Q1EA 4MQXC 4NHCL 4O51A 1S7VA 4PJEA 2CJUL 3TZVD 4M62L 4PREA 4PGDB 3VD3A 1HN1A 5C0BA 1MPAH 1D5IH 4UU9A 4M3JA 1D5MB 2VLKD 35C8L 5SWQA 2BNQA 4YHOL 3HNTL 1MCFA 2IBZX 4Z78B 3DUUB 5MEPA 2IPTH 4HHAA 4NQTA 1U8NB 1CD1B 4Y2DC 5IHLB 3IKCA 1AJ7H 5IMOA 2A6KA 2BSED 4ZAKC 2OL3H 3DECA 5C08D 2CRIA 5DD5H 1BBDL 2XQYG 4AM0B 5I18L 3AMKA 1WEJH 5JXEA 5T1DH 1AD0B 1P7HL 2C4FT 5I1AB 1WTGT 3C5SA 2ENYA 1C1EL 1OP3H 4PJIB 1ZMYA 1Q9OA 3RX8A 5D1QA 1S9YA 2NXYC 4X7CC 3I6KA 4G6FB 4LF3A 4FXGB 2OJZH 2IPKA 1MJ8H 3GMOB 4MCZA 5SX4H 3S3SA 2X7LB 2YKLH 3LCYA 4KKNA 4APQA 5AEAA 3MGAA 4WJ5B 4D3CL 2O61B 1ADQL 4UNUA 5ESAA 4EXKA 5FA4A 3S37H 3K0WA 4GRWB 1MFEH 3B3IB 3VXNB 5HGDB 4WNQB 1LHZA 3L6FB 1LD9B 2ZOKB 4C57C 2DLFH 2PYED 2ZCLH 2FYYA 4RMUA 5L9DH 1INDH 1BM3H 5C0EA 3C60C 5L8KB 3FO0H 4HXBL 5GGQL 3FQRB 2CMRL 1KNOA 1VFUA 3B9VA 3RGVD 1N7ML 1MQKH 2Y36H 1KIRA 2VLJA 2XTJB 1YEEL 1S7SA 3HG1D 5F9DC 3TJEL 1UC6A 1FL3A 1UYWH 5DJCA 3V4VL 5KW9L 5TQ0H 4F80A 1NMBL 4YDJB 5E5MA 3WD5H 5IIEA 3C5JB 4JDZA 4RGOL 5EBGA 4XBGA 2UWEA 3S36L 4Y4KA 3H9HB 4KKBD 4MMZC 4JRWA 3FFCA 4EI6B 4ZNCD 4ZNEA 3RAJH 2AK4E 4GAJH 3CSBA 1KEML 2HFEA 3D2UD 2NW3B 4F58H 3V79C 2DI7A 5IB4A 4JJHA 1KG0B 5F89B 3MMEA 3C6SB 4OFPA 5CEZD 4L29B 4HWEH 3B6SA 1J7VR 5B3JE 3RUGB 3W9DA 1N3NA 4H1LG 2ID5A 4AQ1B 5SWSB 1VFBB 1F3RB 5DFVD 5CINL 5B38A 4GKNA 5E94A 4NBYB 2MHAA 4GMTL 2EC9T 1NBVL 1S78D 2W9DL 1UJ3B 3I3DA 4K8RL 1FZJB 3RNQA 5I73C 3ARZA 3VRLE 3FQUB 5GIRA 4FFYH 3V6OA 3KPPB 3OHXA 1FSKC 3HRPA 4NO5B 2V7NB 1R3LA 4LGSB 5I66A 4PR5B 1FVEA 2VDKL 4F7CB 2M2DA 3MLWL 4YHZH 4GMSL 3RL1B 3MLUH 1NCDL 4XXCA 4G6JL 3C8HA 5ALBL 2MOVA 4LVOC 3U9PL 1Z2KA 1H15A 1CICA 3SHSA 4JG1H 1UFUA 1UWXH 2NX5E 2NY3C 5I1DB 3C9NA 4YXHH 4U1NB 1KPRA 2R1YA 2AAVA 4I3SL 3ZHLA 1QVOA 5EO9B 3QEGL 1ZSDB 4YXKL 3MTRA 4QHMB 4PJ8D 1TFHA 5I71C 3FQWB 4YX2H 4JFHE 4U1MA 3VWKC 1YPZB 5GGRB 5C86A 4ONHA 4K3GA 1G9ML 4MZ2A 5DLML 3DMMD 2AJVL 5A16B 12E8H 3F12A 2FBJH 3EJYC 2X1QA 1BFVL 4HPOH 5DSCA 2H3NB 4RAVB 5J6HA 5I1GL 3MLTB 1MY7A 3WHXB 2BY3A 1V3JA 4MJIA 1QACA 3HAEA 1JRHH 4LSUL 4M7KH 4OLZL 3TJHD 5I75C 4QTIH 3GJEB 3GMLB 4OZFB 5K59F 4LARH 3QIBB 5C9JA 5F3HB 4PTTA 1IM9B 2ZUUA 1NCWH 1WFUA 4Z7NF 1ZGLB 3IJSA 1EBPA 4D0CA 5F9WB 1FH5H 5F3BB 3ARQA 3IF1A 1BD2A 4HIEA 4PJIE 4XCCL 3DX7A 4QT5A 5CHNB 5D5MF 5MEOB 3ECBB 2GITB 4UNTA 4HWUA 5IEHA 2H32A 4G7YL 4UV7H 1QQDB 4FZEL 4P4RB 1HOCB 1VGKB 5DRNB 3EGSB 4W4OA 1CR9L 3OJDA 3SKMB 4V2BA 1JL8A 4XMKH 3MNWA 2IADA 4KMTH 4O2EB 4GKSB 4Z7VA 4M43L 1FNGB 1MWAH 4YR6B 4AENA 5INCB 4R2GC 3QO0A 4FS0A 4JJ5B 1MIEH 2ED9A 4OM0L 3PP4L 4S1SL 2MCPL 4XCYB 3IXAB 2XTJE 1AGBA 3T3MF 4Q9BA 3VGGA 5HHMB 1BIIB 1CD9B 2A74A 3ARSA 4ZOBA 3OJVC 5EBLB 3IETA 2E6QA 3LQAH 3U36A 4FQJH 1P5UA 5CBEA 3TCLA 3X12A 3EIFA 5F93C 4FABH 3ARYA 4TSBL 1KT2B 1RHHB 5DJ8B 2BC4B 2P5WE 1SEQH 3OKMB 1OB1B 4A2LA 5EBMB 4LVHC 1CVSC 3NCJL 1J10A 1I7ZB 3RWDA 2ORBH 3VFVB 4N8VB 2JTDA 5IUSA 3LKQB 3QA3B 5CBAB 2IFGA 5GGVL 1MFNA 5I74C 4ZOCA 4N1EA 4F9LA 1FJ1B 5IJKC 3MREB 5E2TH 2D4DA 4MQSB 3LEYL 3EDFA 3O6MH 3JV6B 5I30L 4OZHF 2SEBA 4G6MH 4BKLA 1K4CB 1U8IB 1Y6KR 2QHRH 5LGHL 4ORGB 5C6TH 4K8RC 5AUMA 4JZOB 5FFLA 1U8MB 1AQKH 4HCRH 5EOCL 5E8OA 3U30C 5DUBA 4M61A 1T3FB 5TGBA 2RCSH 5DO2C 3K8MA 5C07D 5JLZB 1M71B 2Z31A 4OKVB 2W9EL 3OJMB 4JN1L 4MS8C 2VZUA 4X6DF 2YRPA 1UWGL 4PJHB 1V05A 4Y8DC 4S10A 5BJTB 4EI5D 3WCYA 1JUFA 3RNKB 4IS6B 1MCJA 2APWA 2ICWB 1PYWB 2CKBH 1AI1L 1IGIH 1R3IL 1JBJA 3MLPA 2D4FA 4XP6H 4OD1H 5ICXB 5KSVB 1FYTA 3GMQB 1A7NL 2WBJC 3I75A 3IAGC 4D0DB 5IVZB 3RJQB 4IMKC 3SDAB 3VFOB 3MV8A 4MX7B 4JO4H 3QYCA 1NBQA 1RK0A 1GRWA 1YPZE 4OCSH 4ZO8A 3BQUA 3L1OL 2P49B 3IDYC 4JG0L 3VXUA 2DMKA 4P5TA 5C8JA 4U1JA 2DMBA 3I6GB 1I9EA 4K94L 5AAWA 1CXHA 1G1CA 4XPGL 1V7NL 2F19L 1VGEH 3PJSB 4WI3A 5CGYD 3MRMA 3S4SA 1JVKA 2NXZC 4ONFH 4M4RA 5DI8B 5D71H 3EDDA 5JIKA 1YN6B 4D9LH 4YK4B 4F7MA 5CSGA 1PJ9A 5ALCH 3VXSD 4NNYA 2EH8L 1T7YA 2ZUSA 1ZA6A 4DOHB 5FO8A 5D2NC 4LPYA 3H3PH 4X7DC 5BO1L 4TNVK 2PYEB 4ZYKA 2GUOB 3DUSA 2XWJA 3DRTA 4WU5B 3OG6B 3WKNA 1AGDB 2QL1A 3S34H 3T65A 4F9PA 4TQEL 3OKDA 2DQJH 1LO5B 2DS4A 3HG1B 1AY1L 2G9HB 3CSPA 2XT1B 4WI5A 5A3IC 5KG9B 4KZDH 3FHAA 2Y25A 3HUJF 5FYKU 4P9ML 4GG6E 4UBDD 2ZZUT 4DVRL 1RZJC 3RBSA 4KQ4H 2GW5A 4CL7A 3ARDD 5I9QC 4Y4FA 4YHYC 2Q8AH 3DLQR 1VFAA 4KGLA 1QRND 5DJZB 3IJYB 4DKFH 5T3ZD 1GGCH 3WXVH 3ARGC 1NFDB 1FZOA 1T1ZB 1K8IA 5E4EC 5E08L 4IRJD 3TIDB 1QSED 3QHFH 3SCMC 6CGTA 1CFSA 4FQXC 4E9LA 3D2UB 1BVKA 4AYFA 3F7PC 1GGYA 4J1UB 1AKJA 5HHME 4KC3B 4NN5C 5I2IA 3KYOA 1EPFA 1P5VA 1DVFC 3MRFB 5C70A 4E41E 4X9HA 1J11A 2VKWA 1QHPA 3TBTA 4ZXBA 4NWUL 3VXRA 3QUXC 2FJGA 4HUWA 1RIVL 2P24B 4F7EA 5FCUH 1QLEL 3NBNA 3MC0A 2KKQA 3WYRA 3X13B 2BDNH 2W91A 3WS3B 1K2DB 2UZYB 4D9RE 4X9BA 1IFHH 4MAUL 3DV6A 1WAAE 3AUVA 4MNQB 4NO2A 1G7QA 2P7TB 3GSRA 5D1ZC 1ORQA 2HVJB 3EYOA 4XHQA 1CN4A 3GSXA 4QEGA 1ZLSH 3BZEA 5F6IB 3LMJH 3W0WD 4MLIA 1N0LA 3WNKA 5DUML 2FR4B 4POYA 5HHOA 1K3IA 2EXWC 4K9EH 4HXAL 3FO1A 4MA8L 4NYLA 3B9KA 3BX7C 1YEGH 3HPJB 1JPFA 3N1MC 4XWGH 1BJMA 4U0QB 1KJ3L 3SOBH 4U1HA 4MXVF 4TVPD 1OHQA 1FO0H 3LRGA 1G7PA 4OAWB 15C8H 3MROB 4PJ8B 4ORZC 1RQ5A 1F3JA 4QRRE 2EEBA 3CVHL 1D6EA 4HEPG 3RVUC 3PIQA 4N90D 1XR8A 3LV3A 1MHCA 5L2KD 3WIHH 4Q6IB 1H5BC 3TNMA 3UJIH 2OJEB 4XNUL 5F7NC 1DEEA 2R2EB 4B41A 4KROD 2NPLX 1IAKA 3D1MC 2DQFA 4KY1L 5C92A 2VLKE 4S0TD 2XZQL 3KPSA 3QPXL 1PVHA 3U46B 3QDGB 4LMQE 3KJ4C 1A7OH 3BYTA 5K9KA 2DN7A 2XA8H 1WC7B 3T2QA 5D6CA 4W70A 2J6EL 3EOAB 3MYJA 4ELKB 5C08E 5E2UL 3MBXL 5GSRB 3LHPL 4RQQA 3ZHDA 4CVZB 1XF5B 1T7VA 3QNXB 4WIQA 2KQMA 4LAQH 1C5CH 3Q6FB 4HUVA 4WFGD 4F57L 4F8QA 1JNHA 4K07A 2VLLB 4G8IB 4NKIL 3P3YA 4NO0B 4B0MM 1SEBA 1U8JB 5BS0D 1OT1A 3WBDA 4KK8D 5H94A 2XACC 2BVQA 1ZEAL 4TN9A 4DTGH 1T5WB 4JGMA 3B4NA 3L3GB 4L9LA 2NYYC 4QF1A 4G5ZH 2AEWA 3ROOB 4OZHA 4JO1L 1XIWC 1CLYH 4YHML 4IIQB 3CX2A 1ZS8B 1OWWA 4PJAE 4ETQB 2PYEE 4X4XB 1J0HA 1F90H 3V52L 4U1GB 4JFPA 3DBXA 4M9PA 4MQXD 3LRHA 2PO6C 2CLZA 4X4ME 3HS0A 3HG1E 4JHZA 4KMQA 4Y5VC 2HLAA 5E8DH 3GI9L 3PL6A 4JRYD 3ROLA 3FONB 4R26H 3ULUL 3PNWA 5A43C 5ID0B 3JXAA 5EIIB 1Q9WB 4X0KB 5TFSH 4RGMB 2DYPB 3VXQA 1L9MA 2AI0L 1KBGH 3ARFA 4Y2DD 4KAQH 3G6JB 3LKRB 5C0NC 3EZ8A 4MJ6B 4ZAKD 1ZWIB 1DSFL 3WE6B 2V2XB 1FG2B 3QT2A 4G9DA 3RWIB 2VDNL 4ZTOH 4RWYL 1P7QB 4XVJH 4EIGB 3CVHB 3P9LB 4YHPB 2NY0B 3LQMA 5I16B 1X44A 5CEZE 1T80A 2NXYD 1X4YA 2JJUA 3KG5A 1LO4H 3O45B 2W0KA 2LTQB 2R23A 3HKFA 4G80B 3IFNL 4J4PA 5DEGB 2Q3ZA 3ZTJG 4Z7WE 4XWOC 5TE4H 4ZUTB 4BJLA 5GPRA 5KVGL 3RU8H 2C5DC 4PJ5B 3BEWA 2P5ED 3GJFH 1L6ZA 3KHQA 3K80A 5ADOL 4RMSA 1CFQA 4ZPTA 3JWOL 5LAXA 1ZLWK 4NC1C 4RX4A 1HINL 2N4IA 3FQXB 4NBZB 5BRZA 5HDBE 1RMFL 3SE3A 1T4KB 4NZUH 1I3GL 4OGYL 3QG7L 4CW1A 4OZIA 1OCWH 3WIIH 3F7YB 4G9FB 2BSTB 5F9JA 1DEDA 3W2DH 3FB7B 5DHYA 4PJ9C 2VYRE 5IMMA 3FT4B 4X6FB 5EZJB 2I9LA 4R8WL 3WUZA 1U8HB 4RRPG 1TJIL 1NGZA 1EH9A 3N85H 5KVMC 1OW0C 3V4PH 2YS4A 4UTBL 5TE7H 3LKPB 3O9WC 3SJVD 5BXFB 5AZEH 3QCUH 1J0YA 5I0ZA 5GRWA 1S7UB 4XP9L 4HSQA 4OUOA 4Q6YA 1E4XI 5E8EB 4OFKA 4YDKH 3BESR 4EVNB 1RJYA 1VACA 4WWKD 3QR2A 2VZSA 2F54A 1AFVH 1AXSB 3HE7C 2QBWA 3MXVH 2NZIA 4XTRC 3SBWC 1QEWA 3WIFA 1BEYL 2A9MH 2E27H 2ICEB 4HWBA 4WO4B 4ONGH 2FJFA 5TQ2L 1MHPL 5CEXA 5FOBB 2VO5A 1QYGL 2G60L 3CFJA 3H9ZA 4R4NC 2Z35B 4LCWB 2PXYB 2DDQH 3P30L 5J1SC 1MJUL 3DX6B 1SY6A 1FZMA 1RZFL 3HMXA 1OAXL 4NSKB 2WIIA 3T0EB 3FMGL 1WCBB 4FQIH 2A6JA 5SWZB 4K3JH 4WU7B 1KELL 2GQHA 5FGBC 1HEZA 4R4FH 4CBPA 4JFDD 4N0FA 1CG9A 1KN2L 2JJVA 2OZ4L 2N56A 4WWID 4GRLB 4M8VA 1RZKL 5I1EH 2HFGH 2MMXA 1OAQL 1XGYL 5JOEA 3LEXA 3OB8A 4ZFGH 2OMBA 3RPKA 1F42A 2NY3D 3MFGB 5IVXB 3UROR 4C56D 2VLRD 3QFDB 2XPGB 3LN4A 3M17B 3NTCL 2RR3A 3U4EA 4Z7UA 4P9HH 5ACMA 3CK0L 3QRGL 3QWRA 1JHKH 2GAZB 5F9AC 3MV7B 1HKFA 1A5FH 2OK0H 1QRNB 2ESVD 1MCRA 2X4UA 4PGCA 1HYRC 5ABDE 4TUKH 1YUHA 3F8UB 3IFPA 3VWKD 4NO3B 2OXHA 1QSEB 2DQTH 1JGUH 1WWWX 2RQ8A 4WI6A 3MRHB 4M7JH 3N9GH 5IT2L 5LCVH 3EJYD 5D7IA 5B8CB 3WHE0 4HC1H 2AJSL 4HS6A 2FX7H 1GGBL 3KPRA 4YHIB 5IM7A 3GSVB 3ULSB 1HKLH 4E42A 3BEVA 5D7JC 2AQ1A 1CLOH 1G7HB 4K71B 4PRPB 4TTDC 5GGSA 2Y23A 5CMAB 2ZKHL 2CXGA 3EOTH 4P2OA 5C3TA 1F4WL 4XPAH 2C1OA 3DGGA 4JFXA 2G2RA 3MOQA 3QUMH 2K9UA 3SY0A 1VSCA 4HKJA 5HYSB 4OSUL 5KANI 4JKKA 4WUUB 3E8UH 4P59L 1LO2H 2B7DT 4P46C 3QWOA 3PWVA 1U3HC 2OYPA 3VXMA 5IROA 1TQCB 1J1OH 3W5MA 4AMKL 2X10A 5L8LB 1DBAH 3TVMA 2VABB 5EFIA 4I3GA 2VZOA 4Z9KB 1CE1H 4L3EA 5GGTH 2AS5M 2FGZA 1R5IB 4N9GB 4WI7A 5T5FH 1KUMA 4PP2B 3HR6A 5FGCE 5C0DA 4L4VA 5JORB 3RWCA 1IC4L 5DJ0A 3FN3A 4R2GD 3IGAB 1F3DH 1RUKH 3QAZB 3QULA 2P46B 1GGUA 3O6FA 4OGXL 3BOVA 3FJTA 5E9DA 5C07E 3EZJB 4ZMAT 2OXGA 3HZYB 2UZIL 1ETZB 2XYCA 4JZNB 3A67H 2VXTH 4I4WA 5KS9A 3UO1L 5IFAH 2OL3A 5FYLL 5DHXB 1LEGA 3C08L 5EZLB 2EDQA 3I02A 4DVBA 4NQCA 4Y1AD 3MZTA 3NN8B 3ZSSA 1JFQH 2W92A 2BY2A 4NWTH 2AKRA 1IGCL 4GRWH 2XRAH 1KB5A 4G8FB 4UINH 3SGDH 2D7OA 1VFOA 1A1MA 1FAIL 1YQ2A 1JPGB 4ELMF 2X89A 4N0RA 3MSPA 1Y18B 5HDQL 1NGPL 4J7RA 4H8WH 3FN9A 4PUBL 4LEXL 4BH7A 3RQ3A 4TTGA 3L3HB 1PG7L 3O6KH 1UXSA 5IBLC 2IFFL 1F8TH 4ZPVA 3CGTA 1ZOXA 2GJ6A 1L7TL 5KANG 4OIIL 3FB6A 1RUAH 4X6EB 2QQLL 5TF1L 2XIDA 2QQNL 3EO1B 3EO0A 1WBYA 3VH8B 3OBAA 1U8QB 3KPNA 5BS0B 3ZO0A 2G5RA 3BN3B 1XGUB 1AR1C 1P9MA 3VXSE 3QDMA 5C9KA 4K8RD 4LPXA 1N5YH 2A1WL 2ZNXA 3I50L 5F7DB 4GAGL 4H20H 2WP3O 3GSWB 1F4YL 3I85A 3JV4A 4LPCA 1R5VA 3RP1A 4ISVA 5DO2D 3O3EA 3DURA 1S7VB 4PJEB 1ZT7A 4WENB 3C6LC 3DI3B 4M62H 4MS8D 5ELIA 4PREB 1CIDA 5C0BB 1RZ7L 4TSCL 5GS0L 1DN2A 5D1XC 3T0WA 5FDWA 35C8H 7FABH 4YHOH 5SWQB 2BNQB 3HNTH 3QNYA 4RMVA 2DOCA 3D0VB 5IVXE 4TNVF 3MRDA 4JRYB 4WI2A 4HHAB 4DUVA 3EHBC 3WFDH 1LVEA 4S1DC 3IKCB 4I9WD 2PN5A 2WBJD 4LLAA 4MYWB 3U7YL 3FB5A 1QRNE 5C3LD 3D5OF 4PB9H 1RUML 5D96C 3TLRA 4G8GA 2DJUA 4U1IB 3WFBH 5T3ZE 1KCSL 1QBML 1QZ1A 5JOFB 4ZAKB 4K3DL 5EU4A 3HC0A 1ERNA 1MCIA 1QSEE 2WLYA 1RZ8A 5I19L 1IE5A 5IHZA 5FYKH 1Q9OB 1IGFH 1S9YB 5JXAL 3HN3A 5E99L 5C09A 4LF3B 5CKGA 5MERA 4MCZB 2X4RA 3D69A 4HS8L 2Z8SA 1JGLH 4V1DB 2YXFA 1UB5B 3QUYA 4N1CA 4PRID 2NXZD 2BY1A 3EDJA 1ADQH 2G5BB 2EDFA 3PHQA 1E28A 5FA4B 1EO8L 1C5DA 4P4KA 5D9SA 2HRLA 3DROA 4S2SA 5IMLA 1F58L 2WUCH 3DV4A 1RZGA 1JPSL 2CLVA 1X5LA 2FYYB 3QQ9C 2H2PC 4FTVA 4JFFD 4OLVH 3SQBA 4HXBH 5GGQH 2D7QA 3FO9A 4G6KH 3AY4A 4M4PA 4OI9A 1WZ1L 3GNMH 1N7MH 3C60B 2V5TA 1YEEH 2KQNA 2R8SL 1U8KA 1S7SB 5EOCJ 3V4VH 2A6IA 2OX5A 2X4SB 3MFFA 5C2UB 3V7MA 3WNMA 4RGOH 3SDXA 4XBGB 2UWEB 5A3ID 1U93A 1GZQA 1J12A 5DRWA 2WSKA 5D70L 4BA8A 5C1MB 2UY7A 1NAKH 4QCIA 2VZ3A 3ULVE 2YUZA 3LIZH 1I3VA 4OZGF 4G42B 2IQ9L 1KEMH 1F11A 4YDLC 3SGEI 3OAZK 3K4ZA 3SCMD 3THMH 4TVPE 1EJOH 5ECJE 4R7DA 2YD4A 3ZMRA 2EEDA 4EUPB 2B39A 2IG2L 1N3NB 1KGCE 1KCRL 3DXAD 4X83A 4OBRA 1DVFD 2Z93A 4N90E 4YPJA 3RVXC 1FIGL 5CINH 5L2KE 4GKNB 5E94B 2MHAB 4GMTH 1EUUA 1NBVH 2EDKA 4EOWL 2IAMA 3GMPA 4MQ7A 1UG9A 1VPOH 3QUXD 5TDPA 3RNQB 4APQC 3RPIA 3R8QA 4UQ3B 1Z6JT 3GSUA 3AU1B 5I73B 3OHXB 2VDOL 4PY8I 2EDTA 4XCFL 2QADC 3RVVD 5CP3H 2J1KA 3UTZB 1CI5A 2XKSA 5FUOL 4BSVB 1RAMA 1FSKB 4F15B 5I66B 4K7FA 1ZANL 3BGAA 2VDKH 3L5XL 3IDGA 3MLWH 4MAYC 1BZ9A 4GMSH 5D1ZD 2YSSA 1NCDH 3HC4L 4IBLT 1AGCA 3U9PH 5EB9A 2IBGA 3KDMB 2ZCKL 4YO0B 4PGBA 4WFGE 2Y5EA 1A3LL 4JKLA 3VG0H 1SJEA 3C9NB 1MCBA 1KPRB 5BS0E 3WEXB 1TTFA 2EXWD 2FATL 4I3SH 2YZ8A 3MGTB 4O02L 3E3QE 1NCBH 5IKCB 4YPGA 3QEGH 4WW1B 4Y4KC 4YXKH 4Z76A 4YJZL 2Y5TA 5BCAA 1BQLH 5MEQA 1PKQB 2BNUB 3SKNA 4H0HB 4KKCC 1KYOK 4ONHB 1G9MH 1YEIL 4U6VL 5I71B 1OP9A 2I60L 3BVNA 3QCVH 3UTSA 3RVUD 4JN2B 5DSCB 3G5VA 5J6HB 5I1GH 1AO7D 5EA0L 3DETC 4MJIB 1ODAA 1EZVY 4NFCA