3H6AA

Structure of the calx-beta domain of integrin beta4 crystallized in the presence of calcium
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
109
Chain Sequence
b'MRDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin beta-4
publication title Structure of the Calx-beta domain of the integrin beta4 subunit: insights into function and cation-independent stability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 23
structure length 109
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h6aA00
2KLTA 3GINA 3H6AA 3RB7A 3FSOA 2FWSA 3US9A 2FWUA 3E9TA 3RB5A 2KLSA 3E9UA 2QVMA 2DPKA 2LT9A 3EADA 2QVKA 3FQ4A
chains in the Genus database with same CATH superfamily
1IC7H 1T7ZA 2QQKH 3UTZB 3HS8A 2GC7C 3WAJA 2ZKHH 2EDHA 5ADOL 1S7TB 4YFLF 4JDTL 2XX1A 4YUEH 4FYSA 4MAUL 1MRFH 1XBDA 5I1AA 3QFJB 4S1DC 4H1LA 5KW9L 3K4DA 4OF6A 5T5FH 1IC7L 2VR7A 2QQKL 1J8HA 4DGVH 3GJEA 3NSDA 1FGVL 1OCWH 3LRKA 2ITFA 4YUEL 2HVJB 4LQFH 3TO2B 5BQDA 1G5GA 4PTUA 3WY4A 3IAGC 1HYRC 1CTOA 3OGOE 1CZ8L 4OM0H 1C08A 3E6HA 4PS4H 3Q8CA 3L4CA 3QEQE 4K71C 1E8WA 4XAKE 3T3PE 2NT1A 2WIIA 4PCKA 1J8SA 3P77B 1TFHA 2EIMB 3VX0A 4UANA 4EJ1C 3LZRA 2VE6B 3FONA 2FNWA 3BIKB 5INCA 3FB8B 5EZLA 4YJZL 5L9DL 4LVOC 5MHSE 2R0WH 4RGMC 1A4AA 1YDPB 1RPQA 2K4AA 2DJSA 3GSQB 1U8QB 4H13C 5HHOB 4I2XB 1QR4A 4TF4A 3H3PH 3LV3B 1OW0A 3A67H 1NIBA 5C08E 3MRCB 3H2PA 1E6OL 1VEPA 4PJHB 1MY5A 2VITA 4QD2E 3MLZL 4KVCL 5CLTA 4ANVA 4Z8FL 1A14L 5KBDA 2BJMH 4AWJC 3KL5A 2WBJD 4Y2DA 2X4TA 2YSSB 1QSEE 4LRNH 3VFUA 4W6XB 4L1LA 4OBRA 5FKPB 2NMSA 4D8PB 2KZ1B 4O2EB 5FM4A 1NCAH 2PUQT 4RIRA 3WFBH 1YYCA 5HGDB 4DIXA 5DT1L 4KH2A 4EN2A 1WFOA 3F7QA 4J3BA 1JNJA 2D7NA 4G6AD 3O6KH 1QPKA 1TZHA 2J88H 1NCCL 4HZLA 1GJIA 1DBBH 4R8WH 4U0RC 2EADA 1NCAL 1J9TA 3WFBL 1EAPA 3PIQA 5DD1L 1QA9B 3UBFA 3ZDYF 3BKCH 2GFBA 4YWGH 4NLAA 3ISYA 1G6RH 3RBSA 4NT6A 3O6KL 1JF5A 3ZPDA 4R5XA 1FNSH 4X7CC 4DAGL 4LCYA 4W9JC 2EO9A 3SGEH 4XVOA 4L3EB 3CBKB 4ZMQA 4POYA 1EEYA 3OKKB 4YWGL 1W6WA 3C5ZA 2Y22A 3T6XA 1ECYA 4NHCH 3DETC 1AGBB 3UO8B 3SE9H 4QGTA 2I60H 4JGMA 4OLEA 4NC0B 1EXUB 5AB9A 4GFXA 2FLRT 3DMMD 1LQBC 3SIKA 4ZXBD 2X9YA 3MV7A 1IC4H 2ILLA 4AYID 2XV2A 3X14B 2JQAA 4MASA 3KL3A 4IBLT 2Q8BH 3S0PA 2CO1A 1YCSA 4DP4X 2DMBA 2G0KA 2JK5B 3LHAA 2H8PA 4KXZI 5ILTH 1AGDB 1MSPA 1PY9A 1THAA 1W0VB 4RMUA 2ZXEB 3B4NA 1HOCB 5GRVL 4EO5A 3JTTB 3D06A 3B37A 5E03A 3TPKA 1PLGL 4XVTH 3KGSA 1XAUA 1KT2B 3ULVE 4FJZA 4N87A 3TA3B 1KB5H 3OLIA 2CMRL 5AVYB 4P49A 4C54A 5CHNB 4Z23A 3B2UD 4ZO9A 1FZOB 1XSOA 5BRZB 1PZBA 2E9BA 1M7IA 2D31B 2BRRH 4XVTL 3EDDA 5C07A 2WC7A 4XXDB 2A6JA 2ZXWB 3A21A 3C8KA 3L9RA 4D2NA 3BAKA 3TJPA 1G6RB 1ZCRA 3VE0A 2LVCA 1JUFB 1QTSA 4KUCF 1KBKA 4HJGB 3ZHFA 2X6MA 4WI4A 4RZCA 4XO9A 1GGIH 3SYAA 4ZAKD 4ALAL 4RESB 3PWPE 3TFKD 5ESAB 3LIZH 5KVGE 2DLGA 4PJ9D 5FYJE 4AYSA 4YGAB 3KWVA 1MIEL 3CVIH 4WEBH 3HE6A 2GTWB 2YZ1A 3KGRA 2GITA 3B5HA 3GBMH 4ZW6A 1U8MB 2XUWA 1HH6B 4KO6A 3RZCD 5JXED 4WY7H 3KYMA 4HX1A 5T1LD 2ZNXA 2UZXB 5F97E 1E8ZA 2FO8A 4EUPH 1I4FA 4PRHA 3CVIL 5IQ9B 3A47A 4WEBL 2E7CA 4QRPB 5FYJU 3S88H 4YC2B 3CPLA 4XVUD 2F54E 3SOTA 3V0DA 4TSAL 4JFEE 3AREC 3QC6X 1Q72L 1U21A 4WTZG 4X7TB 5D93C 5K9JL 4QHNB 2FATL 4ZMTA 2HFGH 1TTAA 3FB7B 4GG6E 2UVEA 3ZE1B 1LYQA 4Z7OE 4NFCA 3TWCH 5BPPA 3E2HB 1ZXQA 1KB5B 1I3VA 3S88L 4LKXA 5AAPA 3OWRA 1IKOP 3TCLA 3UZQA 3GTNA 2FJSA 4UDUB 1KGWA 1X9QA 5J5EA 3FZUD 1WVZA 4EUPG 1ONQA 2HFGL 3NEXA 4WHDA 3ETBF 4NPYB 3WYRA 4JHVA 4OQTA 2XZAL 4Z7NE 5FOBA 5GS0D 4V11A 4WI9A 5DI8B 2BP0B 5EIQA 5HY9A 4FI6A 2OMBA 1ZAGA 4Y4FA 2GHZA 2FNBA 3WSQL 1EHLL 3ARBA 1W8EA 4U2ZA 4UYQA 2HKHL 2B8OT 3DIFB 4P07A 5D6CA 3KAAA 4YO0B 2R0ZH 1HU8A 2WXMA 3VQMA 4KV5F 3O8XB 1XH2A 3BUYB 5EU6A 4BFFA 2DF3A 3MLUL 2R27A 1FYTA 2HSIA 1K72A 4HA1A 4ZFOB 1LDPL 3S96A 5IJKC 1V3LA 2QPUA 1O75A 4Z7WE 1NAMA 3UOAB 3WXWH 1KIQB 3D87B 2R15A 4EUPB 4JY6A 3BMVA 3CUPA 3X17A 3GS4A 3H9HA 4AZUA 2Y7LA 1RIHL 1BSIA 2VZTA 4HU8A 2KT6A 4JPWL 4L37B 1WUNT 1VCBC 3NVQA 3CZEA 3A6CH 3MCKB 3W39B 1X9UA 3U30C 1BMZA 2WQAA 5EZPA 2APWA 1A6ZB 1DDHA 4NKIH 1TJHH 2EVIA 3BGMB 3UERA 2NZ9D 4O2CB 1ZHKA 4ELMF 5C2UB 2WLLA 2UY7A 3WLWC 4G6KH 3DO7B 4P46A 4LCWE 2W0FB 3L5IA 5GRXG 5J3HD 1ZHLB 4XB8A 1O7DE 3A6CL 4TN9A 1XIWB 3N50A 4MSWA 1T6VN 1G9ML 1KCUH 1RZJH 1VACA 4MXQC 3EFOA 5JDJA 2QJDA 4HPYH 1JGIA 4NQCB 2QHLA 4UILH 2A73A 5I6OA 4UQ2B 3D7PA 1HYSD 4UNUA 2B9AA 2GY5A 4NENB 3MLYH 3LJ3A 1KCUL 2AK4E 1EVUA 3QCTL 2E56A 3ABKB 4Y16B 5T1DL 3OB0H 3DJRA 3VNZA 1CICA 5K5YA 5MEQB 4H40A 2IXQA 4OLZL 4UILL 4WGWB 5I19H 4X6CA 4EI0A 4QHUB 5CUSH 3SDCB 2HUHA 1BW8A 3U6XS 4HGWB 3HPLB 3VYNA 2AABL 3BE1H 1DJIA 1MG2C 1U6AH 3RIAK 3V6FB 4WI5A 1MCIA 1CTNA 1DQDH 4DESA 2GCYB 4QHKJ 4TLSA 2E75C 5FGBC 2WNXA 4EN3B 4ZX3A 3C60B 1TQCB 3VXMB 1KTBA 3QPQC 4OLXL 4QLRA 1MCOL 4LQ1A 5A3ID 1SFHA 5JW3L 4EQ2A 1QSFA 3QUKB 2NY3B 4Q89A 1QRNA 3VACA 3DOSA 5GJTH 5FX3A 3NEEA 1RSYA 2EKSB 2FBJH 5A7EA 3LNGA 5IB1B 3GIVA 4MZ3A 2CGZA 4JVUA 2F58H 2HH0H 3VFSB 1P4LB 4L3ED 2W38A 4MNQB 4C4KT 5I17B 4LBEA 5ALCH 2IFFH 5FYLL 5GJTL 4F80A 3VFNA 5EF1A 1MI5D 2XPYA 4HP5A 4HS8L 3FO1A 2ZUSA 1HCFX 2WXKA 4UNTA 3US9A 1KCSL 1JBJA 2NNAA 5JOPD 4K7FA 2MSPA 4N86A 2H32H 3VSQA 2AK1H 4LOVA 5GXBB 1WBZB 3MMEB 1OIOA 1MCBA 2E59A 2OMWA 2PYFB 4OJEH 5D2NC 5EULV 5GGSB 4R90L 3PHQA 3SE3C 3FSWA 4CRPA 2YOAA 1U3HD 3GXTA 4GBXB 2WZPA 1RUQL 1MVUA 2OM5A 4HIEA 5SX4H 1EDQA 3H53A 3GO1L 1MVYA 2V0AA 3LRHA 3SDDC 4EPSA 2E9WA 2AK1L 1PW3A 3FPXA 3K74B 5KTEL 1J87A 2J5LB 3ULUE 2JCCB 3LHPH 3UAFA 4PR5A 4Q58C 3VFTA 3V0GA 1SJMA 2A9CA 2Z7ZA 2BVOA 3ARDC 3DVGA 1DVXA 2LOEA 1NC4B 4KKPA 1RERA 4UINL 3CXDH 4K3EH 4BQCA 4DUWA 3GRBA 4JR9H 2BFVH 3O2DH 1FN4A 1ZA6B 3KLDA 1E28B 4XOAA 5B3SB 5C0GB 3U4AA 4HAGA 4I3SH 1GZPA 2BNRB 4CVXB 1PS3A 1F11A 1CT8B 4BQ6A 2HJLA 4RWYH 4KRPB 3D85A 4R2GB 3W37A 5I1HL 1ZLUK 3RWIB 1E30A 3UFIA 3CXDL 4MD4B 2NOYA 1P4BL 4TLKA 3O2DL 5HPMB 4PGJA 3N1GC 4K07A 1IQWH 1ES0A 2CIKA 1HHJA 3B9KD 3MRNB 1XMWA 5DRNA 5JYMA 5JNYB 3HW7A 3HJEA 4OLVL 5T5NF 1FGNL 3GZQA 1LHZA 4L2YA 4PUBH 4GUOA 3HI1A 2XTLA 3THMH 5IBTL 2Z65C 2DQMA 3JV6A 1Y1DA 3EF4A 3BQUC 4BXSV 2I27N 3VXTA 4PP1D 3BEVA 3K2IA 4XVJH 4H4NA 4CU8A 1GTFA 5E2VH 5A3IC 4FFZH 3FUJA 3MJWA 2YBRB 3FH8A 3COOA 3FO2A 3THML 2R23A 3I3BA 5I1KH 1LP9E 4ZO6A 1BREA 4IBQA 4ACPA 3NESA 2MRYA 3AM8C 2RH0A 3U2SB 3EGDA 3CFEB 4RDQG 3NAAL 3ZKQD 5JMOC 5EZOH 4FTDA 4IRJB 3TNMB 4JM0A 5T1KB 1L7IH 4L8SB 4LLUB 4KO5A 5E2VL 5GSRA 1FFRA 4HMDA 1XO8A 1OAZL 3RPKA 1ASOA 4UQBA 5I1KL 3AACA 3IBEA 4LT7A 4ORGB 3D2TA 4NB7A 5EZOL 1MJ8L 3KPSD 2W0PA 1H15B 3DVNA 5H4ZA 3ARFC 2DYRB 2F19L 3JZYA 4IU3B 2KQNA 1DEEB 3EOAB 3IXTA 4CADA 2EICA 2GY7B 2Q6WA 2DTML 1Z9OA 4R5VA 4FFWC 4HEME 2CD0A 4PRBB 1T89A 1XR8B 1I8IA 1GTNA 3QUXC 1BX2A 1HVXA 1FZKB 3APFA 4OW6A 3Q1EA 4X4YA 2NYZA 2R2BB 1OGTA 3GB7A 4J3OG 1DSFH 4NZJA 5AZUA 3UJJL 2YSTA 5EV7A 3RWGA 4G7RB 1ETB1 3FRUA 5HHMB 3KDMA 2AGJH 4ZX4A 3T6ZA 1QBLH 3DGGB 3OR7A 3PWLB 4GP5B 3U9PL 4NWTH 3ESPA 1A8JH 3KW8A 5HJBA 3CMOH 2BOCB 5EO9A 2HJKA 3UO1H 1DSFL 1RU9H 3NGBB 4EBQL 4YSUA 1ID2A 3FRPG 3KGTA 2COQA 3O4LA 1DDTA 3BUDA 5DJCA 1SEQL 5BRPA 3B8SA 1S46A 2XQYA 4JUSA 1KCKA 1RUAH 2VR5A 4F2MA 4J4PC 5BZWA 3GMPB 5I0ZA 3VU1A 4NO5A 1D9KB 3RUGB 3RQ3A 2X4UA 2HN7B 1AI1H 3WNPA 1BOGA 1RJLA 3QEUA 4JFOB 4JHWH 3QORD 4WSKA 4QRQA 5I8KL 4N8VA 5SWSA 3VWJA 3DPBA 3FN3A 2EDNA 3QQ4B 5HDOA 2LTQC 5INDA 3UZVA 3IYLW 3IGLA 3K8KA 1QO3B 5TGBA 1HJBC 3MA7A 4OJDH 2OMYB 1E4JA 3MUGA 3VRLF 1EMTH 1JL8A 3HNSL 1K85A 1YAIA 4FQLL 4FEIA 4TVPE 1DVFD 5D1QA 4NQCD 4OFKA 3GRWL 4MVBC 1T1ZA 4HJIA 1KENL 4KQ3H 1N18A 3FRPB 1T03L 1OGAD 1PFOA 3MREB 3KWTA 1N4XH 1PZ5A 2P8MA 5I6PA 4MCMA 4AVIA 2C7FA 5DUMH 1D5BA 5D7SL 1UJ3A 4QY8A 4GFTB 5BW7A 1EMTL 1T1WB 2WV3A 2BXYA 3NCYP 4ES9A 3T0EB 1IGCL 3IJ7A 2CBMA 3W0WE 4NZDA 1URIA 2FX9L 1NPJA 2F8IA 4OV5B 3QPKA 5AB0A 1GY2A 3HMXL 3ME0A 5HVHB 1C7SA 2DH2A 5ICXA 3H9YA 3TT3H 4NKMA 4HKZA 5DWUH 1W0YT 3LXAA 3NRPA 4OU3A 4ADIA 5IB5A 3OTTA 4IRZL 4X0KB 2F68X 1GMEA 3L3DA 2HXAA 4HGKC 4PTTB 1LEGA 1KC5H 3ULUC 2XTSA 1FZJB 3ZZLA 1JZ8A 3M8OL 4JREB 2CKBA 4XN4A 4O51B 1EFXA 2PO6B 1D5RA 4M5SA 4QTIH 2FH6A 1K8DA 4MMZB 3GQFA 4HZ1A 3TBBA 3NJVA 1DANU 1FNHA 5LGKA 2XVGA 1CFVH 1GC1L 3H7BA 1S2EA 1KC5L 4AYFA 3MACH 3QR2A 3TV3L 4HLZG 3T6VA 4LASL 3W56A 3N1QC 5K9OA 1GCYA 1JRHH 2AXGA 4EDXA 1KCWA 3P9LB 3K6IA 2YPLE 4F92B 4ELMA 3B6SB 5EBWB 4KVNL 3VWKD 2YKLL 3VMPA 1KUMA 4F15B 5CR1A 5DZLA 4FHKA 2C8NA 2IFGA 3ILPB 3WS6C 2IWGA 5A6IA 3PJLA 1XTMA 4YBHA 4AK2A 2EVJA 6TAAA 1D7DA 2VXUH 1P7HL 2XPGA 3DROB 4XBPB 4B7IA 4MRBA 2AEPH 2Z64C 4LLYA 4PJBF 4A6YL 1B9ZA 4I18C 1GZQA 1EHNA 4QRRA 3ZIMA 2F15A 1MW0A 4F9LC 2FX7H 4G6MH 5CBAA 4QDGA 1A6AA 1Z9SB 2J2ZB 4IMKC 3RWDA 4ANWA 3G5XA 1PX8A 5C0ND 5KAQG 2AJSH 4TVUA 5CEYA 3QISA 3QIUB 2N1TE 3Q2WA 1J1XH 2A83B 3PV6B 1M57B 4HAFA 1SUJA 3RVXC 4C59B 2NY0C 3U1PA 3WJJA 1A7RH 4M5YL 4TQ8A 1U3JA 1WG3A 3QJTB 1DJZA 3ET9F 1CXIA 4UM8B 1K5NB 2LU5A 4G43B 4JJOA 1N59A 2WZ0A 1A3ZA 3NSJA 3U7WL 1CLZH 3GRGA 1A7RL 4QHLB 4A04A 1BEYH 1DSYA 4MFHA 1FFNA 1J05B 1M1XA 2PR4L 4XPBH 4AL8L 5A40E 3T77B 2GIMA 3C9NB 3Q9PA 1K2DA 1EANA 3ARGB 4NP9A 2WN2A 5MEOB 1OEZW 4FLOA 3WJLC 3VRJA 3ORJA 4P4RB 4OUUB 3TEUA 3QG7H 3EOBA 2G3MA 2W9EL 4HBCH 4XXWA 1ND0B 1A6UL 4KKCC 4NJAL 2AV1A 4D0BA 4NP4L 5LAXB 5AUMB 4GP8B 2I24N 2QGDA 3OMAB 4JLRB 3PDOB 4AXWA 5DVMA 5C9JA 4Y5YC 3WV0A 1CDGA 1OKEA 1X5MA 2WVSA 2GJ6B 4XNUH 2ITEA 2N56A 3RDTA 5IM7A 1U8OA 2AEOA 4BGDA 4KNSA 3B3IB 3S8GB 4G9FA 4L1TA 5E6IB 5T1KD 2Z8RA 3ZZQA 3DYOA 4R4NC 2HTLD 2A0LD 2YPVA 4J23A 3GUTB 3T1WA 3ALXA 3GSWB 3VXRE 3FFDA 4KUZH 2X2JA 4NM8L 2WD0A 5I6XB 3DV4A 4KU1A 5JPNA 1KZQA 3LKRB 1QUNA 4YXLL 2FRGP 4FLSA 3RKDD 3QJFA 5F70A 4PJGF 4PSPA 1LNUB 4MJIB 4PIRF 3KJ6H 5BS0A 1QATA 15C8L 2VWEE 2Y4SA 5HI5C 4FD0A 32C2A 3DOHA 1X5ZA 1BPLB 2A5UA 3PWVB 3T0VA 4OCNC 4HWZA 3TO4A 5TQ2L 3X3FL 4Z76A 4N6QA 1LO0L 5DHDA 4C56B 1B90A 1KACB 4U6YA 1H9VA 2DIAA 5D1ZD 4ZQTA 5MEND 3AABA 4XNXL 1R5WB 3HZ3A 1NFIB 1ZOXA 5M7QA 5AEAA 1TJIH 1E65A 2AAAA 4AGPA 4E68A 2KI6A 4GO8A 1HS6A 3STBA 4RETB 2CBQA 5DDHA 3FU7B 1TETL 2OZ4H 1MFAH 2YGQA 3F7KA 2F5AH 1PJWA 3N1MC 3WCYA 4WUUA 5B38G 1CFTB 3IU3A 4PJ7F 5SX5K 2NR6D 5IP4A 4UQIM 1BF5A 3LQZB 5F8QC 2VDRB 4JZJB 4P04A 4XCCL 1QFWI 5CO1A 1FVEB 1GSMA 3LNDA 3UMTA 2WY3B 4P23C 3CVBA 1ACYL 4FQ2H 2F5AL 2WSDA 3BLBA 2F53A 4WCYL 3JV4A 4HFUH 4P0DA 4ZUUA 4YQXH 4B27A 1JPFB 5FDWA 4AZ8A 4YZWA 5I6MA 4GH7B 3REWB 5KJ7E 2WYHA 4FQCH 2W91A 5T33H 3APNA 2F1EA 3OBAA 4IRSC 4FQ2L 5A2CA 1UG9A 1M3JA 3TS8A 2H26A 4NI6A 4R97B 3H0TB 1MLCB 3MRHA 4JM2D 1UVQA 1HI6A 1XV8A 3ZE2E 3MLVH 4JQXC 4P59H 5B38B 1AQDB 4J3UA 4XPFH 3WNOA 1U8HA 5DS1A 3QXDA 4FXLA 2J8UB 1R3KB 5F7EH 2BO0A 3HZMA 3MUJA 3IDMB 5J6GB 4KRLB 4NQXA 1TITA 2X6CA 3DYMA 1ZPLA 2NSMA 1B0GA 4MZ2A 3TYFA 3ZMRA 4ZW3A 4LLDA 4XPFL 3W3BA 2CIIA 2R0LL 3QAQA 4NUGL 1F4YH 1N0XL 4FERA 1ORQB 1JDCA 2WXOA 4POZD 4QT5B 2PWHA 3L1OL 3WLBA 2YRZA 2R83A 4UNVA 1F90L 4WSJA 1UQSA 4XCNA 3VXPA 3AS1A 4EEEA 4P3DA 3FN9A 3LEVH 4DZBB 3HRPA 3TZVD 4NQSB 3SY0B 5GGTA 1Q0XH 2JKJA 1KXVC 1CXEA 2ADGB 2WCSA 2WQ8A 4QXUL 4WRLA 3KPQB 2DWEA 3G5ZB 4AQEA 4Q6IC 2ZAHA 1RZ8A 3V0EA 2C9PA 3V5DA 4UBDD 5D5ME 2HUEA 3U9UA 1KGCE 1AS6A 4RGNE 1W72H 1X5AA 2XG5A 3MBEB 4WO4D 1KG0B 3CFNA 1R3HA 5H35B 3VM5A 3EYFA 1AYRA 5J11C 2HRHA 1B88A 1M7DB 4TXVB 5JW4N 1Z3GH 4HUUB 2K6YA 3RWFA 1G7QB 3Q6GH 2W94A 5F7AA 3WN5B 2ADIB 3OKNB 2IOIA 2Z3FA 4JGJA 5FK9B 3QYMA 1YUHA 4J27A 2D4FA 3DVFA 4AUJA 1OAXH 3QNXB 5I1CL 2WNGA 1NCGA 5LKNA 3FQRA 4YK4C 3VFGH 2AEQL 4IDJH 2R4SL 4Q4IA 4N90D 4OCRH 5I66A 5DHEA 3MRJA 1N6UA 4OLUH 2CLRB 1C8PA 4LAJH 3DTXB 3OKMA 2R1WA 2HRLA 2IG2H 1OAXL 5T3XL 5HDWA 1JGVH 3SJVB 2IVFC 5DSCA 2KDGA 2DQEH 3VFGL 5CCJA 3QDAA 4IDLA 3W9DB 4OCRL 4NYLA 4P2OB 5TJWK 3GC3A 3MRRB 4YE4L 3UBXG 2CHDA 4M93B 1NBVH 1WIUA 4L5FE 4F7EA 4N68A 1IFHH 2ZAIA 4YXHH 2IG2L 4HJ0D 1Z5LB 3JWDL 4ODXA 3L3OB 5TFSH 4AH2A 1VFOA 4X83A 1I3RA 4L1HA 3L4WA 4KDVA 3ZZSA 1FNEB 3R8QA 5DO2D 3U83A 2MCPH 2PYEE 3SPJA 1VFUA 5D8JL 3N55A 3L48A 5LBGA 4UTBH 1DE4B 1PG7X 2ZXCA 4K94L 5F9OL 2W0LA 4A2DA 3EO1B 2VSKB 4FNUA 4X50A 1B4LA 1W72B 4V1DB 5E0QA 2IQAB 4DPRA 1D5XA 2OMZB 3P0GB 1H8LA 2R8SL 4CC1A 1J1PL 4O02A 2A3TA 3EGSA 3PL6C 1B3JA 3PGCA 4M7ZB 1X5KA 4JN1H 4POZC 2AJVH 3BPLB 3UBXB 2XTJE 4PJEF 4DN4H 4Y19B 1DQML 1BEXA 4UAOC 3ABGA 2C1PB 3HN8A 5EORL 4KX7A 4DZ8A 5D7LE 4WEMB 2WINB 4Y4HB 2A77H 3MNMA 1HKLH 1RK1A 1KULA 3AREA 3TZVC 2YFOA 1EEQA 3QDJD 4AJVA 3ML9A 3DSNA 3CDFA 7CGTA 2W65A 1XGUA 3N9GL 2Y5TA 2BSCA 1T21A 1KYOJ 1WBYB 3CXHJ 3MA9H 4L8BA 1ULVA 4O00A 3LZNA 2RCSH 3KS0J 2XKNA 4KDTC 4E0RA 2WNWA 3LRSA 1TLKA 4B0MB 4YEEA 1L6ZA 4WI3A 5AYUL 1AFVH 1R1CA 2C7UB 1JMXA 1CTMA 4WK4B 4M1DH 4JDZB 4UWQB 4ZXBA 4F91B 4KKZA 3BH8B 4XTRD 3NA4A 2OP4H 4B9GA 3AY2A 4E2OA 1QLRB 4GB9A 2O5YH 4TLTA 5HHPA 4KI5D 5DC0A 3BFQG 2PF6A 4U1HA 5CEZE 3CHQA 4JGUA 4KBPA 5JIHA 2WAHA 3OF6D 5BV7C 1ZGLB 3ROOA 2HT4D 2CK0H 2OP4L 3V5KA 4BFJA 1TLMA 1QRKA 4JFHE 3BUQA 4G5AA 4EE2A 2PCFB 1XCQA 1XGPA 4LSPL 1U8PA 1YNLL 1N8ZA 3C08H 3HZKA 2JKWA 3HBPA 3FTZA 1UCBL 1EXGA 1YYMH 2J1ZA 3ECUA 4N0YL 3KXFD 1PZCA 3HRZB 1P7QB 4OFQA 4Y2OB 1LEIB 5JOFA 1A5FL 4ZS6D 3OJVC 1PTZA 4OFDA 3PWNB 2CM5A 3SQBB 3KJ4B 1CQYA 4C57C 4WW1B 3ETBJ 2A9DA 1BZ9B 5CSGA 4RAUB 5C0RH 2LR4A 2V2TB 4N5UA 4YPJA 4GINA 2XY1A 2XG4B 2Q8AH 1DBAH 4M6OL 1AXIB 1WWBX 3QWQB 3B9AA 4LOUD 2JKXA 1S78C 2X9XA 5K1JA 3C6LC 1JV5B 1NEPA 4PJDF 1ZLEA 4XMXA 5ESQA 4P2RE 5FUCE 2EXWD 1JK8A 2BNUB 5JXEA 4Y5VC 4MA3B 3V4PH 3FCSB 5IJVA 4Z78B 1HL8A 4ZI8A 3WGUB 2Q5BA 1FYHB 3BI9X 4E5XA 2H6PA 4F37K 3GXPA 3SPHA 1BHGA 1RZKH 3JWNH 1FIEA 1UD4A 5FUZH 5JZ7D 1LO3H 5ANMA 4PJGA 1IRAY 2MH4A 3NIDE 2VXQH 2WLMA 4K8RL 3M7OA 2XWCA 3N0AA 7PCYA 2FR4B 3TURA 3DBXB 4OZ4A 1QNZH 5D9SB 2NTFA 4G8FA 2FO1A 4G42A 1NCDH 4N2EA 2DB8A 1E27A 5B1BB 1BVLB 1QZNA 5IQMA 4AE1A 3P4NA 5FUZL 1TVDA 2V9RA 4MA8H 3IDGB 3GSVB 5ADPH 1BFSA 3L08A 1R5IB 4JY4B 4OM1H 1IU1A 4Y1AE 3O2WH 3W81A 1ZVHA 1T6BX 3JWNG 4O9HL 4QWWC 4HEPA 4XAWL 4FA6A 4J39A 2BVTA 2WKOF 4AYMC 5F1NB 3PV7A 4H20H 2RIKA 4PJCE 4BWWA 2NDGA 5B1CA 1PG7H 4R7XA 3SDAC 2E76C 5ADPL 5IHHA 5J1TC 5E9DD 4OM1L 1NJ9A 2E3VA 5ID1B 4PJ7A 1URZA 4DP1X 2Y7QB 1CGWA 4J6RH 1EEZB 2O93L 4OVVA 2R1XA 4JUTA 3HZVA 4XCEA 5SWZE 2HG0A 2WQUA 1PG7L 2I69A 3TJHD 1OSPL 3MLTB 5GIRB 3BFWA 2BVUA 2P5EE 3QO0B 2Z93B 4IJ3B 4MAYB 3NFNA 4NOBA 4BYHA 1FCCA 1FV1A 2GPZA 4I77H 4E41B 3GHBH 3OSVA 5J56B 4L0PB 3SD5A 2ADJB 4YHZL 4XGZA 5D2NA 3CDCA 1JAEA 3SE3A 3SO3B 1NCWH 4XNAA 2PWEA 3QFDB 5C09D 4NFDA 3T0BA 1JHKH 1ADQH 3SDDA 2FJFB 2EIZB 2VLKE 4NPJA 4ZOBA 1DBJH 1NAKL 2MQ0A 4HLJA 2QZ5A 4GQRA 4XODA 4X6DA 4WU5B 1YYLH 5D96C 4BUQA 3BDBA 1FF5A 2M2DA 5E8PB 3HC3H 1IARB 4MAZA 1EAQA 2DIJA 2NQDA 4G7YH 3UTSB 1ADQL 5HHXH 4NRYA 1HNYA 2V4LA 1DBJL 3HTLX 4APQB 4NCC2 2CLZA 2OSYA 1T22B 4PJIB 3U6RB 1Y18A 3QHFL 5C0BE 2X9WA 3RVTC 5CCKL 4JO4L 4R0LB 4GG6A 4L4VB 5CCHE 1OP3H 4CC0A 3GS7A 3QJQB 4MMXB 5L2JA 2WYIA 3NPSC 4LLWA 3GF8A 3HG1E 5KG9B 5TPWL 4GAGL 3DGCR 3S35X 4JY5H 5I18L 3EF7A 4UM9B 4OB5H 1M56B 3Q48A 5DMJB 2X6UA 3P54A 3V9FA 3ULSB 1IB5A 4OZGF 5IROD 4PVMA 5FYKD 3P4MA 1YMMB 1NPNA 2EDMA 4BFNA 6PCYA 4KKLC 1P2CA 1NIAA 2ROYA 2WTRA 1KWGA 1TEYA 2ID5A 1U8CB 4BH8A 1L9OA 3QWNA 2DEWX 1J8KA 3GSNB 4OB5L 3K46A 2RA1A 1JG9A 1O6SA 1OTTC 2IH1A 2X4RB 3RTQC 1ZD6A 4JFDB 1I9RL 2RGSA 2ZX6A 1NFDB 4Z0XA 3QNYB 1MCQA 3F7YA 3I02A 1PZ2A 2FHFA 4WW2B 1FH2A 2NY2B 1XGYH 2PW1A 4YDLB 1JGUL 1ILUA 2XWBA 3BWAB 4LB8A 4YSTA 1MFDL 3PRZA 5KSBB 3EYOB 4DCQA 3Q5TA 4GQZA 4DVBB 3S4SA 5IJBC 3AM8A 5A16A 4Z7WA 4PRID 2P45B 1ZHNA 1A6TA 2EACA 4ZNEE 5FHBL 2WWNA 4UT6H 1VGKB 4GW5A 2WWMD 5C0CE 1RUPH 2YKKA 1NLBH 3QJRB 3K6NA 3LN5B 1TTBA 1MI5A 5D7HA 4H25B 3LZFH 3ZTDC 3P3RA 2ROXA 5AW6B 2XWZA 3D3VD 4F5CA 3CSYB 4NQEE 3ALPA 2CO7B 3DHUA 4RMTA 3T3MB 3TIDB 3ARFA 2PP9A 4HS3A 1EZSA 1FH5H 1PDKB 4JN2B 4LCWA 4XXCA 3ZK0A 1XH0A 1U3HA 3LZFL 4NXSA 1QP1A 3K71A 3GFUA 3B7UX 4I0PD 5B3JF 5DWPA 3GZPA 1HL9A 5C7ZA 5DK0B 3UYRH 3VI3F 1HSBB 1H3UA 3MV9D 4QRUB 4Q0XL 1OSZA 1U95B 1PPIA 3QUZC 3TJEL 4PRPB 4AIZA 2CDEB 2PTUA 1XF2B 4MCNA 1NCJA 3SDXB 4X5XB 2UZPA 3BRGC 4ZD3H 4OY9A 3FUDA 1AD9B 1CXHA 4G1MA 2OX5A 3G6AB 4UMGA 3MYJA 4QNPF 3DJZA 1K3IA 3TH2T 5BQ7B 2EDYA 2IAAC 2RQ8A 1I1RA 2A74C 4I5BB 5DMGD 2YQBA 2HT3D 4LIQL 3C2SA 2PPFA 1A3QA 3OKOB 4PJEA 3L3HB 4ZMZA 4M3HA 1FBIL 1R24B 3TONA 3DXAD 2ODHA 3LEYH 4KPHL 2ATPB 1HEHC 3F8UB 3IKKA 2N7AA 4CNIB 4ENZA 1HNFA 3QDGD 4E9WA 4MHHG 3Q1SL 5JDSB 1JZ2A 3SPCA 3OXSA 12E8L 1MQKL 2A1WL 1AY1L 5HXMA 4PD4K 2R69A 3MRBA 4YDVA 4MBOA 5KBLA 1A4JA 1XB8A 5IB3B 4BQBA 2EIDA 3NRQA 1FL5B 1TOXA 4DHLA 2UXTA 3W9EB 2E27H 5ISZB 2BCKB 3GMOB 5GRJH 3V6OA 3B5GA 4X6FA 4W9CC 4FTVB 3FU5A 3CFMA 5HYJD 1WIOA 3OLDA 3VH8G 5G4NA 1PX3A 3T0XA 4OIIL 3QWRD 4BKSC 2ZPKH 3E1ZA 3CC5B 3U0PB 1INQB 5I8EB 1MXGA 1IGIH 2E27L 3SKMA 3QQ3A 3F04A 2OSLA 2ZUUA 4MX7A 5AZEH 3STLA 3LXBA 4JO1H 2NX5A 3FUIA 4LCCC 5KS9E 1JZ5A 2I25N 1ZWIA 1S9VA 3IJHA 3RWEA 4NEHB 5I75B 4OD2A 5I8OH 4MS8D 2OW6A 4JM2F 3C09B 2HJFB 2QADB 3ERXA 4WTQA 5DXWA 4NBYB 2BCMA 2LW3A 1EAOA 2I7SA 2CKBL 5I71C 1B3IA 3Q8BA 5AZEL 3NCEB 1SN0A 1JDDA 1KTJA 1NEZG 2GJZA 3PNWB 4G7VL 3L7FB 5CSZA 5IW1B 5C3TA 5DMIH 3KPSA 2BIMA 5CGYD 3DI2B 4E9RA 5I8OL 5E6ZA 4UZUA 4QXTA 2EDTA 4GEJA 3S35H 3SCMD 2IAMB 1A1OB 4FQXD 2HLFC 4YHYB 1QQDA 4UB0L 3MNZB 4FJ6A 2WUBL 4XN9A 1OY3B 5CD3B 3GSXB 5CXPA 2YD0A 2F5BL 1K8IA 3VFVB 4PWGA 5D7IB 1N6VA 2HFEB 4PGEA 4FOMA 3TYGH 5JHLH 2X10A 4NNPL 2HMIC 3FSOA 3CH1A 5F1IA 4N0UE 4ZUSB 3V5HA 1MHCB 4K4KA 5K1VA 4CN1A 3HPJA 4Z0BH 1R3LA 4KK5D 4KRMB 5IHZA 1N0LB 1PZSA 3NIFE 3MGTB 3UG5A 1NEZB 1WYJA 4LZKA 3NIGE 4PJDA 3TYGL 3JQOB 1UASA 5CN3A 4HDIA 3QP3A 3AT0A 5LGHH 1P4IH 2H41A 4U3HA 2IALB 1PF3A 4Z0BL 4AEEA 4YMPA 1RZGB 4I18A 3SY6A 1IQDA 2F0CA 3ELQA 3L3GA 4LLVA 3V4VL 4WNQB 1LD9B 3OMNB 5CWSA 4F9LA 3EBGA 1NUGA 3OJMB 3VRIA 1YJDL 4O4YL 4Y4KC 3ESMA 3QFJE 3QORA 1P4IL 4KX8A 5HYQA 2BHZA 3IF1B 1A7PH 1R5VA 3BGFB 2VZ3A 4OFYA 5DHMC 2CO6B 2XV6B 3RIFF 1G9HA 4CC4C 3GHEH 4P48A 5D1XB 2X4NA 4B9JA 2BP8A 3T6WA 3H3BC 3IDXH 3MUUA 2QVFB 1FNGA 2CH8A 2L8AA 3X12A 3DV6A 3BN9D 3RL1A 4C4KO 2GEEA 1X5XA 4HOZA 2A6IB 4TUJA 3OKEA 1AHWC 1GJUA 2VGLM 2DBLH 1UA6L 2DDQH 2Y5QA 3L7EA 4F27A 3VM7A 4GNKB 1UA3A 4U7SA 5CLWA 2WKOA 1AGEB 1T0MB 1JD7A 3WTYA 4Z3IA 5ABZA 2XPZA 3NMEA 2Q20A 1UKTA 4LDCA 3KYOA 3WJLA 2J5WA 1LE9A 5CR8A 1F3JA 3WBDA 1OCCB 3L3KA 5HHOE 1L9SA 2PXYB 4I2XE 3N91A 3KPLA 1J12A 1BVNP 5IVOA 2ERJC 4DP2X 5MI0B 2ZWYA 2A6KA 4WJ5A 5DUBA 1UFGA 1BFOA 3N40P 3NCMA 1Y7VA 2VMCA 4P3CH 4F7CA 3SE6A 2NXYB 2VQ4A 1IT9H 5FFOA 4F58H 2IDFA 3E8UH 4PJHE 3GSRA 4WI6A 1G7PB 1TPXC 2BK8A 3BHBA 3UTTB 3QIBC 3CNKA 2BC4B 3IRCA 1EDHA 3GMMA 4R7DB 1J5DA 25C8H 4D0CA 4P3CL 2ZCZA 3ZN6A 3S2AA 1H3PL 1P5VA 2BRQA 2VW4A 2YAMA 4YPGA 3EJYC 3MXVL 4PREA 4QYOB 1OHQA 2FEDC 5E2UH 1QTPA 3IVKB 4GXFA 3FFCA 5I1GH 2OCFD 2DICA 3MGOA 4NNXA 5IMMA 4CMMB 2OL3A 2IGLA 5LAPA 1XCXA 1MRCH 5E4EC 1DUYA 4TL5A 1KOAA 2IDUA 1KTDB 1AO7B 5HDQH 4AQ1B 4Z95L 2J7LA 4Y9BA 1XDTT 1MH5A 3MLSH 4EOWH 1N9PA 2HB0A 4KJPC 4IGBC 4NDMB 4UT9H 3RFZA 2ESVA 4MA1B 5GGVL 5KSUB 1U8LB 2R51A 4PJAB 3VGHA 3GJFA 1FAIL 3DUUB 1SMAA 4L3EE 4NO3B 5A2KH 1GL4B 1G7IB 5LG6A 5AVZB 3MJGX 2IOOA 4PRPD 3ZU8A 2W9LA 3GSOB 1XH3A 4NO0D 4N4YB 4UZSA 1DLHA 2HP4A 3IN2A 1BV8A 4XCFH 5DJ2B 5F44A 3QQDA 3ZXAC 5GGRY 5IESH 1Q1JH 3TBTB 4IHBA 3BP4A 5I16A 2YAPA 2ARJA 2R2CA 3W0WA 4HKJA 5IKCB 4KI5F 5DD5L 3O11A 3PNRB 1M9SA 4P23A 1U3YA 4N1CA 4YZFF 3QUMH 4AK1A 3SE8H 4TNVF 4L1SA 3C6SA 2FWLB 4XH2A 5I0YA 5IESL 1HH9A 1KLGB 3KR3H 3TBVA 1H3VA 1WWWX 4DK5A 1HIMH 3HI6L 1Z9PA 1UEMA 1WITA 3MNWA 5GRZA 2WXJA 2HRPH 1AD0A 2K9UA 4W4OA 4DGWC 2CDGA 3H54A 3SE8L 4IRSA 2Z31B 4KGLA 5H4YA 2QKIC 4L4TB 1CBJA 2X40A 4KH9A 1ETZA 5BRZE 2EQDA 2AW2A 5ICYA 2JMRA 3FFOA 2D7MA 5CIPA 4JQXA 5CBEB 1SLWA 5F89A 3O3AB 4YDMA 4BFGA 4GKNB 3BZ5A 2ZKXA 4J6IA 3RWJB 1FC2D 3QS3A 4QO1B 1FPTL 1KLUB 4IBUA 1G1YA 2DMCA 2P44B 3D18B 4PJ5D 2GEQA 4TUKL 1IBGH 4Y9GA 3QRLA 2JELL 3IDYB 5ITBL 3WTSA 1N6QH 4IOIA 1F6AB 2C4XA 3ZO9A 1P1ZB 4I1NB 3U4BH 3UC0L 2P8LB 5CZXC 5TE4H 4R4BB 3EBAA 3I6GA 3VI3A 1EHXA 2PPEA 5GGTL 1HXMA 2X4QA 3HCVA 4PGDB 1V10A 3ZDZF 1FFQA 2Z4TA 1T6WA 4I48B 4K3GA 3U46A 3U4BL 1JE6A 1S9YA 2BMKA 4ZUTB 2JI3A 5CJXC 4QRPE 1S7RB 1KXVA 2BH0A 2XXMB 5E6RB 3TBSB 3KYNB 3CDGB 4YAQB 1XR9B 5E08L 3U25A 2XZCH 4G5ZL 4Q6IA 3QDMB 4HT1H 4XP1H 3M7FB 3VU2A 1LK2A 3X1FA 5CCGE 5CP3H 2BNQB 3ARQA 3ZE1E 4S10A 1SDYA 1TO4A 1XGTA 3EH4B 5HVFB 3LNEA 4M7LH 1WSST 1DFXA 4IHOA 5D1ZA 1DJWA 3O3UN 3ZTCC 5EDSA 3A22A 3EXJA 4QOKD 5MENA 1D6VL 1IC5L 4G1EA 5GGVY 2K6WA 4NIKB 4YHNB 4N2HA 3GIZL 3EKCA 2WGXA 2OQJB 4K5PA 4P5MB 3E9UA 1EO8H 3QZMA 4ZYKB 3CAFA 4L2LA 1MCCA 2WQVA 4XWOD 4PFEA 2EYSA 1GW0A 2AI0H 3JUYA 3PAUA 2LV4A 4HCGA 2FT8A 4DETA 1KCRL 4XP9H 1MIMH 1A2YA 3FH7A 4UT7H 1V7ML 2DYPD 1A25A 2Z6FA 2XWJB 1HSAA 3R06B 4M5ZH 4ELKB 3KBFA 3B1TA 4AV4A 3DDGA 3FU9A 4HHWA 3UMNA 2AQ2A 4ZTPL 2F1BA 1FVCB 4L29B 2OTWA 4K2UL 3UJIH 5C6TH 1IM9B 1XD1A 3QYCA 2ZUQB 3FTXA 3PHSA 2AKRB 2CUMA 3GEWB 1ORSA 4LAQH 3BEWA 1DJXA 2NSQA 3HS9A 4LLMB 2WQSA 4WWPA 3T4AB 3V0WL 3OKDB 1FQ9C 4JB9H 5DK2B 6FABH 5LO7A 5LUMA 5F7NC 5C6TL 4MJ5A 3UP6A 3ZVVA 2X44D 3Q0HA 2B20A 1TQWA 4WV1B 2YMXH 3MJ7B 5LLIC 1F58L 1FO0A 3IBOA 4XHJD 5IIEA 1H3WM 3M45A 4MCYA 4JB9L 6FABL 5JR1H 1HHIA 5KVEL 3RI5F 3TN0B 5DZPA 3WY1A 4GYBA 5HJGA 1QFWL 4UQ9A 2QPSA 1M2OA 3TVMB 1UTDA 4PJFF 1HXYB 1E4XH 1F4AA 3ZDXF 4XP6H 2HVKB 3AQYA 3HG2A 3ARTA 2NNRA 4NQCE 1B6DA 2OS7A 2DWDA 4LNRB 2D8KA 1T80A 2FAUA 1OGAE 3TZVA 1QEWB 4JDEA 2F7PA 4XN2A 2DQCL 2FJHA 3DX6A 1IVTA 2IWFA 4DO6A 5LGJB 1LO2H 5E8DL 4XNMA 4Z7IA 3CFTA 1NCBH 1E90A 4CVZA 2O5XL 4HG4J 1ZA3A 1X5JA 2OMUB 1HL5A 2P24A 4IKLA 3LD8B 5E5LA 1XQ4A 3HFMH 4KDTA 4EF3A 4HCRA 1G7LB 4AT6A 4G9DA 2NY4B 5BOPA 4WO4A 2PWFA 4F33B 4L0YA 4AM0A 3IJSB 5GGQL 3V0AC 4XT1C 4JAMB 2X9ZA 3U0WH 4D9RD 1KEMH 3MPCA 3MV11 4FMKA 4UUJB 2GT9B 3FOLA 3DPDA 5E94A 4X5WB 3KPPB 3V8CA 1S8DA 1TCRB 3G6JA 1HQRA 5TDOB 2EVHA 3LRLA 1TJMA 3LNFA 3UXFA 4ODSH 1GGBL 4LL9A 3K0YA 4UNIA 2QGBA 3TA3C 2GBVA 4ZUVA 2Y3NA 4JO2L 1RURH 3VDCA 4KK6D 1FG2B 1T0NB 4XP4H 3WTVA 2VLJB 5G5DB 4MNQE 3F58H 4F20A 1R0AL 5E2TL 4UOQA 3ES6B 4BKLA 2BP5M 4ZOCA 2CA3A 1VA9A 1OQXA 3A6BL 1RI8A 3QIWB 4DGIL 2Z0BA 1RURL 2EZ0C 3T3PB 3MRLA 3V6ZB 4PN6A 5F96H 1OOAA 1KV7A 4H7VA 4L1BA 3SBPA 4W9HC 2CK2A 2GQHA 5ICZA 1MHPH 2XN9B 1P5UB 2D0GA 4G8GB 4NUQA 4G7QB 4F8NA 3VFWA 3RVVD 3CVHH 4OFPA 4X9IA 5ID0A 5GHWL 3LRGA 5JHDB 4KXDA 4WZ9A 2AAVA 1TU2B 2WK2A 2JCCE 4KXAA 2A4ZA 2VMDA 3DVIA 2ZYRA 2VR6A 4QKXB 1BXXA 4GT7A 3C6LA 4YIQB 5CSBA 1C1EL 1RFDL 3CVHL 1IO4C 1KIPA 1KLFA 4F2EA 4Y5VA 5IMOA 3MI6A 4AKQA 3L4YA 3NABL 1L7TH 5AWNH 1M05A 1Q8MA 1OAKL 2ADFL 3L17A 5AOIA 3CVDA 4DP0X 2X0VA 1ROCA 1DJSA 3BISA 5HDBF 3QULA 4NFBA 2BNRE 1H3TA 2ARJQ 2N0KA 3KBEA 4XBEH 1DVZA 1JWUA 4Z3JA 5EUKB 2BHFA 2YPKB 2V7HB 1GGTA 2R2HA 3QDJA 4ONOA 4PU2A 3ULVH 5AWNL 5IT2H 4O58H 4IJTA 4R9HA 5DFVC 3U2JA 4CSZA 4HWBA 5I76B 5D71L 4LCUB 3GLDA 1S7VB 2QQNL 1YEEL 3MRQA 4IK7A 4XBEL 5CN1A 1BP3B 5EEXA 3JTSA 1FNFA 2DQGL 1MCKA 2EIKB 2MFNA 4U1NA 5D72H 3O9WB 2VDKH 4PJ8B 1CURA 5C2BH 4O58L 5KVDL 2VC2L 2Z0UA 1SEBB 5E6YA 3F5WA 4WTXA 3LY6A 5F7WC 5AD0B 3NOIA 2CR6A 2OYMA 3I9AA 1O6TA 5DQ9B 2XXFA 3O8XC 3MODL 4QTHB 1JNNL 3SDAA 2ZJSH 1FE8L 4H8PA 3FT9A 3MKGA 5KVGH 5C2BL 5FYJH 2H1PH 3P0VH 2XLLA 5DJZB 3VXQB 2IJ0C 2OCJA 2DQUL 3J2PA 2DLFH 4OCYH 1BZ8A 1A3RH 4GRMB 4S1QH 1HZKA 3ASWA 3HNTL 5EF2A 2ZIDA 5DJ0A 4ONHB 3MXWH 4JPIA 2R29A 4PB0H 3FT3B 4U6HB 5F7FA 2VLRD 4PP2B 3VDBA 3P3YA 5IHWA 2AQPA 4WHCA 1W15A 2ENJA 3E6FA 3KXFA 4X80L 1BZQK 5PAZA 3VMNA 1GS6X 2CJTA 3VMOA 4LSSL 3LEXB 3LS4H 4GKSA 5KVFE 3UG4A 5BXFB 4U4BA 2AQRA 4C58B 1UZ8B 3A23A 1XIWC 4IBSA 3ZGIA 4GKZA 5CP7B 1F2QA 2YA0A 5EMYA 3EHBD 5IHLB 3OR6A 1HZHL 3O3DA 1WRFA 4FP8L 5FYLD 3SQRA 5HHME 1N64H 2YJQA 1I8KA 3T09A 5FGCB 3PHOA 3RU8L 4FQHB 2YD9A 1CFSB 1ZSDB 2Z4QB 1E5UI 4YL4A 4F7TA 1F4HA 3KPMA 1QOKA 1JMZA 4Y16C 4XRCA 3GGWA 3R8BB 1N64L 3OAUH 4GEIA 5BVJB 3TIEA 3GXIA 3SDCC 1Y0LB 3L9BA 9PCYA 2DM4A 2CHNA 2VAAA 4NN7B 2IDTA 1M7UA 2XN0A 3BAEL 3EDKA 2LFGA 3LKOA 1EO7A 3LAFA 1I9JH 3RUGE 3H8NA 4GXUM 3C60C 1TQCC 4RA0C 5DD0H 3LKQB 3BPCB 3KLAA 5B7MA 4GW4B 4OZHB 1FFOB 1UCTA 3FHEA 1DFBH 4FYQA 4L8DA 3CDYA 1N5AB 4HKXA 2NY3C 1QLEH 2EH8L 4ICWA 3TVMD 1ZHBB 3PJSB 4GSDL 1NBQA 2QSCH 5J1SC 2JXMB 3OGCB 2YD5A 4JQIH 4IOFD 2ZWLT 3AUWB 1JHLL 2XHNA 3UTOA 2EE0A 1OXYA 1AE6L 1YEGH 2M1KA 4YLBA 1XCTA 4JX0A 3H9SD 3L3IA 2XJKA 1H6FA 5IEKA 2VZVA 1KTKE 5E9DA 2BOBA 3T0EE 1ZANH 1I7TB 4HFWB 3SGKC 4HUVB 2DLTA 4JHBA 1KPUA 4GY4A 1BJ1J 1HILA 3EO0B 3IFPB 3K72A 4FQIL 3VXUA 1TYEB 4A2LA 4ZX5A 1KJ2L 5H37A 4PY8I 3HAEA 2R9HD 5FUOL 1JPGB 1A8ZA 1DQJB 2E6QA 4GBXC 3FBQA 5EG6C 2RMNA 3D48R 3BT2L 3QUYD 5DRXA 2B5IB 2UXFA 4B7LA 3EYVA 2J5LC 3WAKA 4NUJB 2FECI 4DPCX 5C09A 2GK2A 4G8EB 3L95B 4OAWA 1S4IA 1UOVA 1CLYL 1GGYA 2UWEF 2LU3A 1MAML 4TSCH 3FF8A 3P11H 4PRDA 4EI5D 1JFHA 4R6UA 2R7EA 3DURA 1ZEAH 3HMWL 2AEIT 5KWYC 3O2VH 3BXNA 5AVSB 1WC7A 1D5ZA 5HPOA 3O3EA 1YNTA 2DQFA 3QZBA 5LCVH 3SPGA 1QLEB 4QI3A 3A4AA 1I85C 1BIIA 1X5HA 3AB0B 1RZIA 2X70B 4ZODA 1YNKH 4KRPC 2L4OA 3QGVA 4YBLB 1T0OA 3RG1C 5LCVL 4MLSA 5EU3A 2VJ8A 4HJJL 5CKGA 1CB4A 43CAA 2APXA 4RVBA 1URLA 5J6HA 5I1AB 3D2UB 4OJFH 5LBSA 3VI4F 4H1LB 2BZCA 1E5ZA 2YC1A 4ODWA 1N2RA 4M8VA 2X0WA 1T1YB 3VJ6B 1J8HB 3GJEB 4HSCX 3FB5A 2BDNL 3IXAB 1BLNA 3B2VL 4TPRL 4OJFL 4PTUB 3S5LA 1C08B 4I7ZC 3IN0A 4GQ9H 3POCA 4DP7X 3QAZC 4KZ0A 2Q3AA 2AJYL 3BZ4B 3PGFH 2P4AB 2WIIB 2ITDA 5DS8B 3FTUA 3FXIC 1CR9H 3BZEB 3FQUB 1W9XA 4UTAA 2CBTA 2ZT9C 4WK0B 1CK0L 3CSTA 3K5RA 4LSTH 5INCB 4IRJC 2ZOTA 5EZLB 2ZKWA 4GQ9L 3ULUH 2NYYC 2ZCKH 5I1LB 3NACL 2OZNA 2F74B 5JLZB 3NQKA 4WENB 4CU6A 2FK9A 4PRIA 1KSRA 3IRZA 1E4KC 1MFBH 1XVSA 2VN5A 2VDML 4WWKD 3ZL2A 4M43H 1BVNT 5LHDA 4NQVB 4HV8B 2LAGB 3ULUL 4M6MH 1D6EA 2ZCKL 4ESKA 1UB5A 2VDQH 2W07A 5ETUA 4F7PA 1TQSA 4PJ8D 3K81A 4ODUA 2Z9TA 3K80A 3D3VA 1P6AB 2QT6A 1BFVL 4Q52A 2B2XH 2YWZA 4Y2DB 5DEGA 4JS7A 1D7BA 2V2WA 3FQWB 3CG8A 3IFOA 1YECH 3QI9D 4K15A 3ZQ9A 1IE5A 3ZUCA 3AITA 2NRDA 4LESA 3RAJH 2NY1B 3ASOB 4RIRB 3V10A 3GLEA 4OCWL 2GJ6E 1KBPA 2XFGB 3KNBA 3IKCB 3PG2A 1BF8A 1TNNA 1CG9A 1LE5A 4ANXA 1OPOA 2ZNWA 1BYPA 1TZHB 4FG2A 4EI5C 1NGPL 2YUWA 3MV9A 4HZLB 3BW9A 1HWHB 4URKA 3OSKA 3RAJL 4N2GA 1EAPB 5FS5A 3OG6B 2IBBA 4NSKA 2GFBB 3PQYD 4LVHC 5CF3A 3GBEA 1BCIA 4XWGH 3LB6C 4HIXL 3DHMA 4MDRA 5T3ZH 3MLRL 5GZND 4U05A 5CJOH 4E9TA 5IF0A 1OP3K 1HNGA 5JPMA 1TO5A 2V8LA 4HJTA 4MJIE 5AZ2H 2MQCA 2ZCHL 5J1AA 3DX7A 5EOCH 3UL4A 1EEYB 2EEAA 4J3OC 4XNQB 2VAJA 4PBXA 3C5ZB 1KCBA 4D9LL 2XA8L 3DXAA 5DJDA 4PWFA 2YQ2A 4KNTA 3FO0H 4G8IA 4MA7L 5CJOL 3RRQA 4C56E 2LLLA 5M95B 5AZ2L 2WXIA 1G0XA 3MV7B 3QDGA 3ETTA 4WVRA 3CLEH 2B0SL 3UACA 5FECA 4KX9A 1WJ3A 4JJ5A 3UG3A 2ED7A 1KGUA 1QFUH 4RMQA 5DK3A 4MQ7A 4CC4A 4XOBA 1YPZB 2FT6A 4NNYB 1DVQA 4HIHA 1FAKT 4JE0A 1C5BL 4WUKL 5HGBA 3EYUL 5GJSL 2Y06H 3CLEL 3T0EC 4FG0A 1AR1B 4ZPVA 4OKVA 5KBNC 5HYJA 4JFVA 3WIAA 4DSYA 3V9EA 4F37F 3QWRA 4GRWH 2FSEB 1E9QB 4K7PX 5HVHC 2L7QA 3FUHA 2KMWA 2OFQA 4WFHD 1EDYA 2C26A 5E70A 2DJMA 2DWSA 1CGSH 3MRFA 1M7IB 5C07B 3WEMA 1JGLL 1BA9A 1YMHB 4OQTH 4B50A 2B39A 4Z7UF 2A6JB 2E7LC 3C8KB 1OGPA 3FUNA 4JREC 4KK9D 3RIKA 4WGKA 3VE0B 4OGXH 2WLZA 5F7MC 3O81A 4N2KA 4ZMLA 3B7YA 3WL9A 1DVSA 3CLFH 5CEXA 1P4UA 4LDOB 4MNGA 1SY6H 1OAJA 2UZYB 3SCMA 4N0RA 5JW5A 3QIBA 4ODHH 3HE6B 1RJYA 4H8WH 3NFSH 2J8UE 2GITB 1XB3A 2E7MA 1QHOA 4M8QB 1WDAA 1AS7A 3VB8A 4J1UA 4YSRA 3DSFH 3G9AB 1RIUL 3KYMB 4F15C 4HX1B 2OL3L 4FI7A 4X0NA 4IM8A 5E23A 5GRUH 2A4EA 3WKYA 1I4FB 4JFXB 5KVMC 4X4MA 4PRHB 3Q7JA 2WLIA 3CFIC 4TQPA 5KJ4A 2IBGA 3FS9A 2YK1H 3CPLB 3WFDL 5KBKA 2AS5M 3I6SA 2NY6D 1M71B 3DSFL 3U4EB 2WXPA 2HKFH 4LEBA 1MCPL 4GSUA 2UYLA 4KY1H 2YD8A 3VFPA 4GRWB 4P2QB 4JFFD 4TVPL 4ZUWB 1B0RB 5IBLC 1N5YL 2MPAH 3A4DA 3NPZB 4IGBA 2P5WD 1A1NA 2BVEA 3K6SA 2PW2A 2FGWH 5E1AA 3EH1A 3GI8L 4HK3N 1GS8A 2BLFA 3T65A 1ONQB 5FDYA 5D7JD 2H7WA 4DUVA 1L6XA 4P5TD 3OC5A 4Z6AT 2CCWA 5FOBB 5TK4A 2MPAL 2PABA 5HY9B 2BSED 4KQ4H 4BFKA 4Y4FB 1DYZA 1RHFA 3FMGH 2HPTA 1DQIA 4XX1G 2H2SD 4CL7A 5FO8A 4PLKD 2CJSA 4Z7VB 4NM4H 4R5TA 1Q0EA 4ISVA 2F7IA 5D6CB 1S7SA 3LKNA 4GG8A 4MWFB 1RZQA 1IGFL 2KPNA 3LPFA 5EU6B 1UXWA 1ZS8B 2XBTA 2VH5H 2CJUL 3FMGL 2G75A 1FYTB 3ARGC 1U33A 1CVSC 2NXZB 3S96B 2HT2D 3SKNA 2MTPA 1CFNA 1NAMB 5KBMA 3AVEA 1BQLH 1X7TA 3B1UA 3P02A 3MBWA 5JHAA 3RVUC 3SJVE 4GRLB 2QKIA 3H9HB 2G2PA 3N42B 3GMNA 3CE1A 3LPGA 2WB1A 4HGMA 2EXSA 1RUMH 2G2RB 4HMCA 3PUCA 1JI1A 1VFMA 3QFGA 4MMYB 2YXWA 3T0DA 5I2IA 1DDHB 4M62H 2VLLA 3ZX1A 4JK0D 1NGXA 1ZHKB 2X4SB 2WLLB 1F8TH 2UY7B 4P5SA 5E6IC 2NW3A 4N3UA 3VG9C 4P46B 4PJFE 5AL8A 1UYWL 1H0DA 5FW8A 6PAZA 2SEBA 1F42A 4YHIA 3IWVA 3MLPA 5CNHA 3MJ9H 4MSWB 1VACB 1GAFL 4M02A 1QSZA 2MCG1 1TQBB 1NL0H 4M62L 4FYRA 3BPNB 5I6XC 2OR9L 4V1DE 5GRVK 4WNSA 1J0KA 2UWEA 2OSXA 1GHFL 2ARWA 1F97A 1KPVB 4CGUB 4I3GA 4KKAD 4OLWH 2A73B 3UCRA 4OGYH 1EUTA 1J88A 1KDIA 2EDRA 5AFAA 3KBHE 3DJ9A 3K1DA 1KJVB 1JFQL 3UTZA 3VTTA 4Y19E 5E8NB 3X13B 4Y2DD 5CJXA 1SHWA 2E9IA 2IXQB 4BIKA 4OLWL 2WVVA 3QCVH 4PJXF 4PWIA 4K7PH 4X6CB 4EIGB 4X6EB 1XL4A 3LS5H 5LNGA 4QRSA 3V55A 4JZOB 1S7XB 2DQHH 1EGJL 3LZPA 2PCYA 1KJMA 4WO0A 2IBZX 1S7UB 2HVJA 3IAPA 1MCEA 4M03A 3VI4A 4K7PL 4KI1A 5GGUB 1TFPA 3T04D 3IFLH 4CBZA 1CLOH 3FTGA 4H0LC 1DBKL 1MWAH 5FB8B 2EDDA 1QSFB 3OKLA 1QRNB 1ODAA 5DJAA 1MJUL 3DOSB 4JZJC 5F88A 3P77A 4KMTL 3WNMA 1KYDA 4JG1L 4KHTL 2VE6A 2R0KH 1VZGA 1E6JH 1CLOL 3EFDL 2OJ1A 1KFAH 3GIVB 3RX5A 4ADGA 3FPYA 3L5HA 2C1OB 2JB5L 1GRWA 1YEHH 1YDPA 3ARRA 5KYXB 3GSQA 1CLCA 3KCPB 2GBTA 1PJ9A 3DYPA 3JV0A 3VFNB 3ZSSA 1CBVH 3FO1B 3NZSA 3RWCB 1SBSH 3NA9H 2J55A 3NTCH 3UAEA 4M9OA 5IFHH 2R0KL 3UDWC 2NNAB 1DCLA 3GDCA 3LQAL 4QHMA 4R97C 5IMKA 3SB3A 1BAGA 1OK0A 2Y1AA 1B9KA 5E1GA 3EG9B 2OMWB 1W2KT 3PHQB 4KK8D 2ZOLA 2F8OA 2OV0A 2ZOKB 1MVUB 4JRXD 4TMPA 4Q14A 1MNUL 2JI2A 2YSSA 4JFPA 4X9YA 3TP4A 1E9OA 1QFWM 4W9FC 1G7HA 5FKPA 4DERA 3INUH 4PR5B 4I0KA 1C5DA 3VFTB 1YY9D 2XYBA 5D7EA 1CYWA 1H8NA 3DVGB 4PJ5A 2V9QA 1JK9A 4JFUA 2FQDA 3QRBA 4HUNB 5FC9A 5CS7A 1NBCA 4N8CH 2EO1A 3HB3B 1FN4B 3TX4A 4JRFA 2P1YA 4BZYA 4OCLC 1GZPB 5AOMA 2FO4A 3ZO0A 5IQ7H 1F11B 1R19A 3TM6A 2HJLB 3OG4B 2NDFA 1T5WA 3I50H 1ZTMA 1Q94A 4Y1SA 3PGDA 1NFKA 3ZDYB 1K3ZA 4HD9A 4FXKA 4NKDA 1JI2A 5PCYA 3FT4A 2APBA 4WKZA 5B3NA 1HHJB 3KS0H 3ATAA 2HRGA 5DRNB 4ZFFA 3MBEC 3UAAA 3ROLA 4DKFH 1EXUA 1MPAH 5KBPA 1RKRA 1OL0A 2YR3A 3IMVA 5L7XL 3HI1B 4FA8A 4PG2C 2VR3A 3IJYA 3WDIA 2XC8A 3X14A 3JV6B 4JKPL 1IZJA 2YFNA 1XHHA 5AALA 4TRPL 2MEJB 4WFED 3BEVB 1NBYA 2KHAA 3IPEA 1JZEA 3T0AA 2XKSA 2NLJA 1NWPA 1AC6A 2RJMA 3FO2B 2R23B 4FXTA 1W0VA 1CFMA 2HKAA 1WV7T 4K23H 2QVIA 2YQ3A 4UCFA 3RL2A 4WHTB 4U1GB 5BV7L 1T04A 2Y36H 3EGDB 3JTTA 4BUGA 4PEEA 3WG7B 4HLEA 3KEDA 3MRMA 3MJ6A 4DKDC 4FQJH 5GSRB 1XX9C 3BDXA 5EO0A 2AXFB 2E74C 4TYUA 5E1IA 2ZYIA 3H7LA 4AUUA 1NMCB 4HJSA 4BRJA 4P2OC 3Q01A 4HHGA 1UADC 1X4YA 4M93C 2FUQA 1I1AD 2B1OA 4JMNA 3FSZA 3TWYA 2DYPA 4AGMA 5EFIA 3V4LA 4XXDA 3DVNB 1UKSA 3L3OC 3DJSA 2KC0A 2DV6A 1G6RA 3G5YA 5I30L 4RDQF 3UC2A 2MQ3A 3BVXA 5J9PA 3ARBD 1KYFA 4HJGA 4CADB 1O5DT 2APVA 4U31A 3B7SA 3BQVA 4E41E 3P73A 1MREH 3WXVH 1I8IB 4Z7UA 1RZ7L 1BX2B 4MZRA 4ZO8A 4X4YB 3CV5A 3GB7B 1OGTB 1YN7B 1WWCA 5LNDA 5TF1H 3RWGB 2GTWA 3FRUB 2XBDA 3QW9A 2FTAA 1U8MA 3KDMB 3NK4A 3TCXA 3L3JA 1BQRA 5B1JC 3OR7B 4B6ZA 3F01A 2IPTH 4M7ZC 3WEXB 2FX8H 3CK0H 3VAEA 1VZHA 3BPLC 3MRDB 2DI9A 2HJKB 3II3A 3UTSE 3FT2A 4BSJA 3BPOC 4MNHA 3RWHA 2IQ9L 3O3BA 3PP4H 3V4UH 1WA2X 1IAMA 3B56A 5DJCB 1Z0NA 4Y4HC 3JYCA 4GMSH 3W5MA 1PYWA 1OT4A 2YA2A 4PJIE 4XPHH 5T1MA 4ZZKA 4DPAX 3CK0L 4QHNA 5IVXF 5L0QB 2VERA 5BZWB 1JHTA 2JKRM 4XC1L 4L4VE 1I8UA 2DMHA 2WLKA 2X4UB 2CRMA 3UBGA 2RAMA 3V4UL 1BOGB 1Q4NX 1RJLB 2XN1A 3QEUB 2HAZA 5SWSB 5HHVH 3QPXH 4QRQB 5I1DB 3KHOA 2CJ3A 3DPBB 3VWJB 1C16A 1UHVA 3HN3A 3UZVB 3W82A 5INDB 5L2KD 3HI5L 4DGYH 1AQKH 1T20A 3P30H 1PQZA 4BCZA 4CBPA 1UOLA 5K93A 3DTDA 5TGBB 3TL5A 1I7RA 3WEAA 4RFOH 4K9EC 1YMME 2BP0A 1JZDC 5D1QB 2ATKA 3IETA 4L5FH 4Z3FA 3FT0A 2VQ1B 1H5BC 2OA9A 4LGPB 4NZUL 1THCA 5F7BA 4LCIH 1F41A 1IGML 1PZ5B 4S0TD 4WIQA 1AQKL 3P30L 1OB1A 1L9QA 1D5BB 4JFDE 3LIZA 1NFDE 1QPXA 4QY8B 3MVSA 1X5YA 4I88A 4NZTL 4WTZA 3SOBL 3WHXA 1CICD 2CPUA 1ZTXH 1K5WA 5KYNA 4G11A 4XOEA 1QVOA 1MCRA 3U0TB 1GOHA 4FABL 4N2LA 2IDCA 5KSBE 1ZLVK 1R3IH 5BRQA 3ME0B 4BZ1H 4ZFOA 5DURD 2VL5A 3AUVA 5ICXB 4DGUA 1SYSA 4WU7A 3SGDH 1YUKB 4NKMB 5AVTB 1KIUA 4EUPA 5GS2H 4LU5L 1BXUA 1CDYA 1WIPA 3ULAB 2WQXA 3HRZC 3L3DB 3I74A 2PWGA 1IAKA 1LEGB 1KIRA 1ICTA 2C9AA 5SX4I 3VA6A 3ZKND 4XZUA 3VVWA 2GSGA 4YE0A 5HVWA 4K3HA 1YVLA 1EFXB 3KJ4C 3N85L 4YDIL 1U8NA 3D51A 1D7CA 1K8DB 4UV4H 5LNEA 3BGMA 4O2CA 3T3ME 3IJEB 1PD6A 1U9KA 3H7BB 3GKWH 3QZNA 4AYFB 4U4IA 5ENWA 1I3GH 4FFYH 1H6TA 4FCHA 5EEWA 2HTKD 3BN3B 3KPRD 3WFCH 1LK3H 2B3IA 5BO1L 2AXGB 1SOXA 5K9OB 3HR5A 1Z5YD 2O5ZL 4GW1B 1TZAA 1O5PA 4ELMB 1C5CL 4J3VA 5IQLA 1KBWA 3K6DA 3VD2A 1U8KA 4I3RL 4BZ2H 5IWLC 2GJJA 1V3MA 3RYMA 2IWKA 3HUJF 3W11C 4DH2A 4FFYL 1X7QA 1FDLH 4U1MB 4PRPE 3L4UA 4AC2A 1UM5H 4KROD 2VKWA 3BDYL 4L05A 3EJPA 3SDXE 5FA3A 2XPGB 2CALA 4X9HA 5F2FA 1J1OH 4M1CD 4LOEA 3AS3A 3FBKA 3KVPA 4LL1A 5AOZA 1WO2A 2D7TH 2FL5A 1GZQB 4QHUA 5CEZH 4QRRB 4L0ZA 4AYEC 1SHMA 1G7MB 2WZ5A 3IJ9A 1TKWA 3L45A 1JXGA 3RWDB 2B1HH 2DM3A 3G5XB 3C60A 3VXMA 4L9LB 2A6DA 1KXTA 5L88H 2TSBA 5CEZL 2XTJB 4QKTA 1P84J 3HB3D 4DP6X 2FIRT 1RIVL 2Y7SA 3IAQA 4PH8A 5CINH 2ZYSA 4OF3A 5C0JA 2EH7L 3TLRA 4BQ8A 3D85D 1ID5I 1SDDA 2J56A 5L88L 1Q0YL 3G08A 1FL3A 4X8CA 1RMFL 1N59B 3MHZA 2H1XA 4FTVE 3AC0A 5AYTA 1FFNB 1M1XB 2ENSA 4IEFB 2ZUWA 4GPVA 4XVSH 2IH9A 5E0FA 4BFBD 2VJ0A 1TTUA 3VRJB 3BSGA 1UM4L 2BS9A 4IJ3C 3GM0A 3DKHA 4KHXH 4DT2A 4UIMA 1UXMA 1QABA 3EOBB 3GXUB 2ZX9A 5EBMB 1VAHA 5DHVA 4MD0A 3QJHA 2PYFA 3SO3C 1TJGL 3RGVB 3ZHKA 1ZIAA 2AV1B 2AMGA 3JWNC 4D0BB 4G6FB 4M1GL 4BK8A 4XP5H 4AXWB 2VLRA 4KHXL 5FM5O 1CFQA 1MLBA 3WS3A 2VQTA 5IB2A 1CD1B 1U8OB 2A9NH 1CL7I 5JORB 1DQVA 1OAYH 4FQ1H 4GAAA 1S5IH 4G9FB 2Y6SC 4DKEH 2VXSH 5EUOF 4UU9B 1ACXA 1XWVA 1WZAA 3K2MC 3X1BA 1RZFH 2NNXA 1F4WL 3FFDB 3TXAA 1HINH 1AZCA 4APQC 3IWUA 5D2LF 3QRGH 2A9NL 5JPNB 2WBWB 1QUNB 4HK0A 1OAYL 2VDPH 3AWGA 1L9PA 1QFOA 1S5IL 4LARH 4QHPA 5D7IE 3R7QA 4EI6B 1DN2A 3QJFB 4R0LC 2CAKA 1CDHA 2E86A 4QOKE 4CVXA 1I85A 1T66D 4TNGA 5DVKA 4MMXC 5BS0B 2YXFA 4ZMXA 32C2B 2Y0SA 5LBSL 4MD4A 4Z5RA 1GYCA 4ZQKA 2VDPL 4HWZB 4R3SB 3TO4B 1ZK5A 1FORH 2HCZX 2YUXA 4PVNA 5GRWA 3T0WA 2R4RL 2HWZL 5G55A 1B2WL 2AQNA 4M1CC 5ELIA 1D5MB 1EQWA 3ZE0F 4F7MA 2JKNA 5IB4B 1V5JA 1TTCA 3POHA 3MCG1 4U6YB 4MB1A 2ZWNA 3TBYA 2JKTM 4ADJA 5FYKL 1N19A 5MEPA 1OPGL 2VL4A 4O5LH 2XIIA 2H32A 1MN4A 4LBAA 4P2RB 5KZCB 3N0PB 5DDHB 1A4CA 4M48L 2OTPA 2FB4L 4UTAL 3O4LD 3IU3B 5CJ8A 4WW2C 2NY2C 4TUOA 4YDLC 5F9JA 4JFZH 1A9BA 4ZTOL 35C8H 4O5LL 1OTSC 4BEIA 2VLME 4NRXA 1OTUD 5D1XE 4FXGA 4DPBX 2ZXAA 1E7UA 4CDHA 1GGCL 4JMXA 3NCJH 2F53B 1SQ2N 4LVOB 4ODTH 4BINA 4ZUUB 2CNZA 4K3JH 4NWUL 5FDWB 4AZ8B 3QEGL 3H9SA 4XMPH 2X1PA 1ZLSH 1KDJA 3RVWD 4ORGA 4Z7QF 2K70A 3T2PA 3GXFA 3O2DA 2H26B 2DQDH 2I26N 4R96A 5CMAA 1G6VK 4Y1AB 5IMLA 3MRHB 4N2OA 4PJ6A 3EYSH 3ZT7A 1L0PA 1UVQB 1HI6B 4XMPL 3RA7L 4IU3A 3OJ2C 4M7JH 3UJTH 1MJ7H 3QXDB 3SODB 3IU4H 1FLTX 1XR8A 4JO5A 2N3JA 3UGXA 4ZFQA 3BUIA 3EYSL 4XPAH 3BH4A 3ZL4H 1JRHI 2MCMA 1AACA 1B0GB 3TYFB 4HXAH 3S34H 2CIIB 2ED6A 5ACLA 4OD1L 2V5MA 1MJ7L 4MJ4A 3UTTE 1KN2H 3QH3A 2LAAA 4LP4A 3WLBB 3RKPA 3Q8FA 4S1SH 4EI5A 4XMVA 1UQSB 4XCNB 3VXPB 2VMEA 4U0RB 3ZL4L 1RPUA 1YEJH 4P3DB 4FFZA 3MBXH 1EFQA 3ALWA 5EBLA 3SZ6A 3FOMA 1DHKA 1GOFA 2CO4A 3I3DA 2H3NA 4BSVB 4TTDC 1KN2L 1TZIA 1KNOA 2YD1A 3L5XH 4ENEC 5AKSA 2FD6L 2UVFA 3GMPA 5DGQA 1PKQA 1QHQA 2K8QA 2ZP8A 1TTGA 3ZMNA 4NC1E 4JGNA 2CCLA 2Z8WC 2DWEB 1CGTA 2H45A 4PSRA 4AQEB 5FF6A 1RZ8B 4GS7B 4JFOA 1CI5A 3CFCH 1AO7E 3HHMA 4QRTA 5IVXA 3RFRA 2G0LA 2XG5B 3RPIB 3CSFA 5KOMC 1R3HB 5L4IA 2I9LA 3EYFB 4N8UA 4OLYL 5D70L 2AVFA 4PJAE 2G4EA 3RWFB 3CFCL 4IS6A 3LH2L 4YHPA 1DLFH 3HBGA 3UAJD 1N3NA 2QQQA 1YUHB 4I8DA 3HE7C 4P4KD 3V2AR 4MQSB 2W60A 3HVNA 3G5VA 1A02N 3U79A 5I66B 3VFRB 3T0EA 3MRJB 5KANG 2ENQA 4LVNB 3MV8D 3OKMB 4KJWD 2R1WB 4YXKH 2EILB 3DRTB 5B7EA 5DSCB 1NGQH 5I75C 2ICWB 4H88H 3FUFA 1U36A 3C09C 2QADC 1DUZA 3INOA 4MRCA 4NYLB 1A6VL 3EDEA 1PZDA 3MTXA 5HGAA 4F1SA 5IFAL 4XNBA 3WJMA 1ETA1 1JGDB 2YXVA 5IOPB 4GQQA 4RRPM 3SE4A 4ODXB 2E7LA 4AH2B 3UTQB 5SX5H 4CN4A 1PEWA 1I3RB 1TVHA 3GUFA 4LFHD 3SBWC 2IAMC 4FLQA 2V7NA 5AW9B 4YHYC 4FHJA 3QVAA 4BBWA 4CDGC 2AP2A 3Q44A 4IYKA 4KJYA 3GRWA 3RX9A 1INDL 1UEYA 2WBJB 3EJRA 1Z9LA 1OAUH 2ICEA 3QI9A 1WS7A 1IBFA 1D5XB 4UOJA 1UZ6F 3P9LA 3WTXA 3LZLA 2IDQA 4ZO7A 2AJUL 4O02B 4OJCA 3EGSB 2ICCA 3JBG7 2NZ1A 3OM3B 4MKTA 4PJXE 3PGCB 3UGUA 1ANUA 2VABB 4Q2ZA 2C3VA 1QMUA 1EPFA 5CU5A 3MRGA 5G2NA 4BDVA 4DTGL 3OWEA 3D69B 1A7NL 4DZ8B 1BBDL 1VKXA 4KKBD 1K9TA 5DD3H 1RK1B 3I2CL 3II2A 4Y5XC 4UIKH 2Q7AA 3PQYA 3HUJA 3DSNB 3RDTD 4P9MH 2W65B 4F57H 2UZIH 1XGUB 5DU7A 2CSPA 4LHUD 1T21B 1KTCA 3FSVA 1MZYA 1OT2A 4NO2A 3MCYA 4DNLA 1DP0A 1Z9SA 4PJBB 2XKNB 2Q3XA 3ECVA 4E0RB 3QDME 1LWHA 1OWWA 3NZHL 2IO5A 2BNQE 1YEKL 3D39A 1FL6A 1RUKH 4E9SA 3CIAA 4NQDD 3DMMB 3WNKA 4ZW7A 4LHJB 4W4NA 4H44C 1MUJB 1MRDL 4ZXBB 1A7OL 3L1FA 4KY2A 4YSPA 5C0AD 4H26B 1GYUA 1F3RB 3VO0A 4FG4A 4UM8A 1K5NA 5I6LA 5HHPB 3QEHA 4G43A 2EDBA 1O9WA 4U1HB 3QR1A 1EERB 2JLPA 2EDJA 2PETA 1PGRB 4S1DD 3T77A 3NJNA 4KTDL 2D4DA 1S9KC 1JTTA 3IMUA 3QA3A 4YHLL 1CWVA 5MEOA 5FWQA 1PX4A 3VXSD 1XCQB 2YJLA 1U8PB 3ZYIA 1A65A 3HZKB 4P4RA 1J48A 2PXYC 4AG4L 3U1SH 1WLHA 5MI0C 1EZUA 2QPFA 2D2OA 2V17L 1WGVA 4WUUD 5JOFB 4PMEA 5HGGS 1U93A 5KSAD 2NXYC 4FKEA 4RAVA 3TASA 3GK8L 3U30B 3PHAA 1AJ7H 2DQTH 1Z3RA 2DS4A 2ZOUA 3GSUA 1ZS2A 2EEDA 1BAWA 3EUDA 4ZAKB 1BZOA 1QR1A 3RJOA 3MUY1 2APTA 2DD8H 4PJ9B 3BCFA 3GSWA 2XCMC 3BKYL 1YQVH 3LKRA 5IHUL 3OLEA 4FCAA 5EUOA 3RZCB 3ZQXA 2W8CA 3CN2A 5IJVB 3SKUD 5T1LB 5IFJB 4AEHH 1JN6A 4E5XB 1WE5A 2H6PB 3WIFB 1G0DA 5D2LA 3VFOA 1LGVA 4AQ1C 4DN3H 3HKZA 5I9QB 4YSEA 4XMWA 4KC3B 4B97A 5JIIA 1XL6A 5JIMA 3FULA 1YQVL 3PABB 3PWVA 5I8CA 5E4OA 5TF0A 4KKBC 5ANMB 1FP5A 3KM2A 4PJGB 1JZ7A 1BVKA 1IILE 1PAMA 4MA1C 1NSNL 1AKJD 4OZ4B 2X2YA 2NTFB 3BX7C 4G42B 4JFFA 1NFIA 4FDWA 2P5WA 3P4NB 3IS1X 3WY3A 2IAND 4K5MA 1A0QL 3UBXI 4ONGL 4EZKA 2ZXQA 5I15H 5GQBA 3VSTA 5D7JA 1AGFA 3Q9QA 4P5TA 1CFTA 4I9WE 1BBJA 3V0IA 2GKIA 1WEJH 4X7SL 4ONFH 1WFJA 1UWYA 1FVEA 2BSEA 2XV3A 3IMWA 5C70A 3DWTA 3HS0B 1DJGA 2WQRA 1NJ9B 3D0VA 4PJ7B 1Q9WA 4AUYA 1IIIA 4S11A 1SHSA 5EF3A 1NMBH 1JPFA 2ZWSA 1CE1L 1TZOA 4ONFL 2R1XB 3P3UA 1YC7A 3DETD 4XCEB 2FWSA 1P9MC 1FIGL 2Z31C 5DQDH 3CSGA 3UDWA 3DLQR 3NQIA 1FV1B 1MLCA 4LLQA 2HX7A 1V7NH 2ZKHL 2VLJE 2AC0A 1MAJA 1RP9A 4XGZB 3TOPA 2C5DC 5D2NB 4TS6A 5EPMA 5B38A 3KCWA 1MRFL 1V55B 2JF1A 3VYPA 2JIXD 5T5FL 3KPNA 5KSAC 4HF5H 1V7NL 4DGVL 2DZEA 5HYSA 3IDMA 3DC0A 1OCWL 1JV2A 2ZCLH 4LQFL 3IDYC 5DC9B 4I85A 4EZLA 2XN9E 2V3EA 4OM0L 4PS4L 4G8GE 3LPOA 1G87A 4HC1H 4QT5A 4OD3H 1U30A 4NRYB 2X4OB 4QMEA 5JHDE 2OZ4A 1EHAA 1UKQA 3RNQB 1G9MC 5DCCA 4RWHA 2CLZB 5DRZA 2ZCLL 1IBBA 5EC1A 3FCTB 4X98B 4HC1L 2I07A 1E9PA 5DQJA 3EH5B 3BSZH 4BXVA 4HQQH 1IBZA 2R0WL 4NQSA 3SY0A 3JSSA 2H0FA 4LLWB 1NKRA 4Q9BA 3BO8B 3S4SG 1MCNA 4D3CH 1S6NA 1CI3M 4R83A 3H3PL 4EVNB 2P49B 2RBLA 3K7UA 4UOZA 5KJRH 2W88A 2ZZUT 3A67L 4K73A 3ZW3A 2OK0H 1NTDA 2P80A 2X12A 2EJ1A 1XFPA 3P4MB 2M83A 3Q5YA 4XHQA 5ALBH 3C2AH 1P2CB 2WTRB 1HOEA 5ABDE 4BH8B 1M7DA 3CFQA 1QBBA 2WUCH 4PG2A 5AYQA 2BJML 2IH1B 3D0AA 2ADIA 4DP9X 2GI7A 3FTYA 4DP5X 2OK0L 1WAPA 4LRNL 4Z0XB 1JVLA 3RNKB 3N3EA 3QJXA 3F7YB 3I02B 4CJ0A 5ALBL 1WD9A 3C2AL 2EXTA 3AGVA 2PW1B 4OSUH 4JHZA 5FXCH 2XWBB 1MFCH 1JPSH 3MNDA 4N25A 1LLAA 2O4EA 3ARED 4DCQB 4TTGA 3S4SB 4XN8A 5A16B 5JTWA 2VXTH 2CLRA 2V9TA 2J88L 1ZHNB 1A6TB 1DBBL 4R8WL 1S3KH 4GW5B 1MFCL 3KLKA 3BKCL 3FN0H 4P2OA 3SEPA 3QEQD 1W8OA 2UXGA 5DUPH 4XAKD 1G6RL 1MI5B 1DR9A 2ZSWA 3FKUS 1FNSL 5EWIH 5KYWA 3OXRA 3L3OA 4L1DA 3WD5H 2ZUQC 1MHHB 2CHWA 2WWKO 3QARA 4DVRH 4HS3B 1CN4A 5MHSD 1WT5C 5DUPL 5E8OB 2WXGA 4NHCL 5DMKA 1U3HB 1MDAA 1DE4A 3SE9L 2I60L 4JRXA 2CA4A 2GJPA 3BWUC 3K3QA 2GUOA 4XNYH 4AENA 4ZPTB 3WD5L 4D8OA 4JW3A 5LN8A 1IC4L 1W72A 2Y2YA 4WV1C 3X3GH 2Y7MA 2IQAA 5C08D 1B2YA 5B1AB 3VYOA 3N43F 4Y7MA 2ZG2A 2Q8BL 3GNMH 4XX5A 5HI4C 1T2QH 1GPOH 3U7YH 5HD8C 1R3JA 1S9XA 1YG9A 2P46B 2RALA 2D7QA 4IU2A 4JO8A 4U6TA 3STZA 4K3DH 1I1FB 3TN0C 4OF0A 5ILTL 4PWEA 3PJNA 4G1MB 2C1PA 4ZFGH 4HIIA 1QSED 1QSVA 3ILEA 1FJ1B 1G4RA 4Y4HA 5FPIA 4YX2H 1KB5L 1UT9A 3CU7A 2Q2EB 5CZRA 5FGCE 4JL1A 4PJEB 4MQXC 4Z3EA 3CN0A 1PY0A 3RJDA 1TG8A 4YDNA 5A7BA 5DVLA 3WLWD 2BRRL 4X7EC 2XVLA 3OXSB 3AY4C 4OGAD 3M6DA 1HCZA 2X2IA 3B9KB 4PLJC 1B6UA 4DO5A 4YDVB 4MXQD 2NY4C 2VDNH 1A4JB 1KFGA 1JWMB 2YARA 5K59E 1GGIL 3TESA 5L8KB 3GBNH 2E6PA 4EIUA 1H5BA 3LIZL 2QPEB 4OZHE 5LDSA 4X6FB 1N7MH 3BP7B 2BX5A 1N67A 1QLRA 3F7LA 2AFNA 3IDNA 4WLCA 4UTBA 5KUMA 2XJLA 3GBML 1AQHA 3NZUA 4Y88A 4ZFOL 3ZJAA 1OARH 2G5RA 4LMQE 4WY7L 1HESA 3SKMB 3QQ3B 3I6LE 1RAMA 2OSLB 4MX7B 2BVQB 2NX5B 2YMTA 3KVDD 1ZWIB 3IJHB 3PP3K 3RWEB 1DVTA 4OD2B 2EYTB 1T83A 4LSVH 4WEUD 1NUFA 1NCOA 1ZT1B 3NJMA 3QIWC 4XI5C 3W57A 2OI9B 3QPQD 5DYFA 3HRZA 4OV6F 1X4ZA 2GJZB 5CSZB 1I1AA 4XPTH 3TWCL 1MF2H 5IVZA 3KPSB 1QI4A 5E8EB 5A6MA 4X4KA 5KYYA 5BMFH 3ULVD 3CX5J 1P5UC 1BZ9A 1RHHA 1QQDB 3QSKB 4IK6A 4QXGH 4YOKA 4Y7OC 3AU0A 1JGEB 3L5WB 3IJ8A 5EZIH 2VM4A 3HG0A 1K8IB 4CA4A 3ZHLA 2Y69B 4LOFA 4PGEB 2OR8A 2TRHA 2ZSVA 2VDNB 3VGAB 3CQPA 4B3EA 1JV5A 1IE4A 4QXGL 2EYRA 5F1IB 2Q1EA 2J20A 3V5HB 2KKQA 4OZIF 3HPJB 2P26A 2VIRA 3FCSA