3H6AA

Structure of the calx-beta domain of integrin beta4 crystallized in the presence of calcium
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
109
Chain Sequence
MRDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Calx-beta domain of the integrin beta4 subunit: insights into function and cation-independent stability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin beta-4
total genus 23
structure length 109
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h6aA00
3GINA 2DPKA 3E9TA 3RB5A 2QVKA 3FQ4A 3RB7A 2FWUA 2KLSA 2KLTA 3EADA 3E9UA 3H6AA 3FSOA 2LT9A 3US9A 2FWSA 2QVMA
chains in the Genus database with same CATH superfamily
4YN3A 1RULH 1M2VB 2EUZA 3FCTB 1NCNA 1YEFL 3SO3C 5TE7H 5F96H 1MWAH 2P5EB 2WK2A 4MQTB 3KJ6H 5ADOL 9CGTA 2BIQA 5JW4N 5LAXB 5E8PB 3QH3B 3P0YL 3RZCB 1CCZA 1EZVY 2BW4A 3ZTJH 3EYQD 1B0RB 2QEJA 4PJCB 4XNYL 3CNKA 4FFYL 2OR9L 1JZ6A 4DEPB 1MWAA 2AP2A 3V0AC 4WLCA 1KPRB 1OF2A 3ARGA 1NBZA 4I7ZC 5GZOA 5E9DB 3FOLA 3V4PA 5TH2A 5HHOE 3UYPA 3OD3A 4HOWA 3NBNA 1MVFA 2KLRA 1ADQL 5SX5K 1KIUA 2FK9A 2NT1A 3LSOA 4AEEA 1EFQA 4TL5A 3HNTH 5KSAD 5KVMC 4AL8H 4NWUH 5FIEA 3ZT5A 3NZ8A 3V4UL 4G8IB 3SKJH 5D7IA 1YZZA 5D7LB 5TE6H 5I71C 1EGJA 3M6DA 1FDLL 2QGBA 2FH6A 3Q8FA 2AXGA 1N59B 2APSA 2BH0A 1OGTA 3AWFA 4JFFA 4UT9H 4MCZA 2DDQL 3QUXB 5FB8A 4KMLB 1IC4H 5KBNC 2N4IA 1OM9A 3BUPA 3Q6GL 4J1UA 4N5ED 5BJTA 1I85C 3BP6B 3FQWB 3RBSA 4ZUVA 1HOCB 5C0BD 1JHTB 1O5DT 1KLUB 1XSJA 4MJIB 3MRGA 4S1DD 3RWCA 4AJVA 4NN7B 3IJ8A 4G6FB 4MNGA 2OP4L 5GS3A 5IREA 3DTXA 2HFFA 2Y5EA 4S0TD 4UQCA 5FA3A 5KYXA 4JQXC 3WXWL 3ZMRA 4NJ9H 5EU3A 2BSBA 4TOYH 4P3WA 3RQ3A 3CZUB 2VT0A 2WXJA 3NFPB 1NFKA 2CBPA 5DFVC 3MJGX 4GW4A 4KWUA 2RQEA 2JELL 2LE9A 5AKRA 2GJZB 1ZT7B 4NRZB 5F9WC 5KS9B 2AEPH 1MF2H 2X4QA 3HMWH 1NGXB 3APCA 3KBHE 3QUKA 2NNCA 4KMTL 4KTYA 5CSZA 1HH6A 1OWWA 1KULA 1F8TH 1QP1A 2V3EA 1KN2L 3OZ9H 2BVPA 4WHTA 4DZBB 4HLEA 1TZHA 1FFQA 1VAHA 2X70B 3ZRCC 1C5BH 1QNZH 2DQTH 3II2A 4IRSA 2OL3B 1I1FA 4YHYC 3LD8B 3G6JA 2WZAA 3KYAA 5I73B 3PPEA 2FHBA 3EBHA 4X7EC 5I9QC 1BX2A 3B7TA 3NGBC 3WFEL 5T8IA 1MOEA 1PVHA 3ZPDA 1TXKA 1YEKH 2WWOA 5DMKB 3ARVA 5GGQH 3CN3A 4KK8D 1YPZE 3KL3A 5GGVY 3GSQB 1WO2A 3ARFA 5L4FA 1R3HB 3VFMA 4Z7QB 2MTAA 4NNYB 3CHOA 3FB6A 2AABL 1ZANL 3FTGA 1KLGB 1X4XA 2IOIA 3DRQA 4TVPD 4DPBX 4IS6A 1HTYA 3QFJA 4PI0A 5LGJB 1A1NB 3P77B 1A9VA 3BKYL 4G8FA 2PTTB 4X2UA 2K6ZA 1T0MB 4FQ1L 4Z3HA 3GBNH 4O5LH 3REVA 2CA3A 4HT1H 3WD5L 4JKPL 3FS9A 3B34A 1MUJA 4LSTL 4F58H 2D0HA 4DWHA 2A4CA 4DGIL 3KPPA 4G43A 1CLYL 2OTUB 2X4NA 3FTSA 5ICYA 4N6QA 1VFBB 1NCDL 2GABA 3W0WD 2HT2C 5L2KD 1OCRB 4BKLA 4A6YH 4O02L 1YUHB 1T1YA 2YD7A 5DLMH 5F1NB 3QP3A 1OP3K 2ZXGA 3BT2L 4JFZH 4KBPA 3D25A 4HDIA 1QBBA 1M1SA 3ZMNA 5DS1A 1M71B 1UZ8B 3CFDB 4UZSA 5JQIB 3AM8C 4PRID 3ALXA 4ADGA 2H0JA 1J1XL 2DYPD 4AMWA 4G5ZH 3ISYA 4YDJB 3G6JB 5D6CA 5E00B 3OGOE 2YUVA 2PCXA 2VXQL 3K6OA 4R4ND 3PWPB 1YAZA 5I6PA 4ERSH 3GHEL 3RJOA 3K8MA 1QO3B 3NA9H 4NBZB 2ZWNA 4XWGL 2WQWA 2UZPA 3N06B 4QHNB 1A4BA 1JI1A 3ABGA 3T3PB 5FGBC 3ML8A 4JRWA 4GRLA 1IGJA 2KBGA 4K5MA 4DP4X 1ZPUA 3QRGL 4YDZA 3F7VB 4DGUA 4LF3B 2VSMB 4MA8H 4PJBB 4PWEA 5BOZG 4CW1B 3A5VA 2Y5TB 4WSJA 5CGTA 1XCQA 3MLWL 4IDJH 3ZYIA 4M8QA 3GUTA 2CSPA 4IS6B 4GW4B 5E2TL 4XGZA 1D5BA 3C5XA 1ZLUK 1GKEA 3Q3GB 1FNSL 2RAMA 4LLAA 4GKNB 4P23C 4PJDA 4X9HA 5GPRA 1CR9H 3TZVB 1KTBA 1S2EA 2JLPA 1RUPH 5D72L 1PLAA 4UTCA 1KIPB 1DVTA 1UJTA 3MRGB 2LV4A 2N1TE 3RWCB 2WNWA 4BD4A 5DJCA 4ZFOA 3QR0A 4EQ3A 1Q9LA 4ZFGL 3SDCC 1F4YL 1RZ7L 2E7LC 1EJ6A 2PW1B 3HI5L 4N25A 1LJMA 3L3IB 1C16A 4QD2E 2MHAA 1A1OA 1X5XA 3FQ1A 3M1OA 3LEYH 3UTOA 1DBML 3KYNA 1N8ZA 3MYJB 2F54A 2DWSA 2XZAL 3L95A 2K3TA 2P5WA 1M9WA 4Z78A 1BPLB 2CIKB 2DEWX 2CE6A 2OMVB 4UINH 5D4HA 3VWJC 1SYVA 1KCUH 2XY2A 2SEBB 1DQLH 2X6BA 4EUPA 1AHWB 1INDL 2VABA 2J57A 1INQA 4QHUB 4R4BA 1WS8A 1K9TA 5AB9A 1V54B 3FSVA 2NNAB 1X9LA 2X0VA 1LM8V 2GJRA 3CXHJ 4Q0XL 3F3HA 4KY1L 5CIPA 5D7LE 5F9AC 5HHQA 1PY0A 1WEJH 1FVEB 4WI4A 3R8QA 4NUGH 2HRPH 1LDPL 1NMCC 4GRMA 2GHWB 1IAMA 1COBA 1ERNA 5HGHB 1KLUA 1E8XA 4F7MA 5DJCB 4ZFOB 4TUUA 5IBUG 2H47C 1I7TA 4Z7AA 2MQ0A 1FCGA 2K8MA 4TUJB 3N1MC 4W9KC 4ABUA 1J1OL 2WLZA 5C9KA 3QIBB 1RPKA 3PWVA 1IBBA 4HBCH 5HGDB 2CGYA 4D2NA 4GKNA 3E8UL 5I5RA 2VAAB 5I8KH 1K4DA 4JDTL 1F90H 3WUWA 3TBBA 2VRKA 3L3GB 1ZLSL 3QUXA 3CZNA 1P1ZA 4OFPA 1U92B 3VCLA 1A3ZA 5E6RB 2PN5A 1BQLH 1MFEH 5GGSY 2ZKXA 4H1LG 5KSBB 4NI3A 3II3A 3NH7L 5T5NF 4D3CH 4TSBL 5HDBB 3BO8A 4IOIA 2XZQH 1SGKA 5GJSH 4EN2A 3EYSL 1MCKA 3U4BL 3ZHKA 3S2CA 2YGVA 4G8IA 3KWWA 2W60B 4WAFA 5I6KA 5JIPA 4X9IA 1RJCA 3PE9A 3A4AA 1JHLH 4MCMA 4TLSA 1Y6MR 2AGJL 2QELA 4AK1A 3EYOB 4CC0A 5BUPA 4ZFZB 3ZTDC 4HMDA 1NEZB 4MSWB 4MXQD 4ZOAA 2LLNA 5DUBA 4Q89A 2G4GA 4PUBL 5F1OB 3SHSA 1AY1H 1I7UA 4U6VH 1KGYE 2G5RA 3DV6B 3D7PA 4KZDL 2E7MA 2Y2WA 4IRSD 1CLZH 3WL9A 2A4EA 3HZKB 4M61A 2P24B 2WINA 3SKUD 4KOCA 2B2XH 3FO9B 1G9ML 3EGXB 4HJ0C 3ZXAC 1IGIL 3B4NA 4FJ6A 3WKNA 3KBFA 2IDSA 4K7FB 4WO4D 4N9GB 1Z3RA 3ZE0E 1X5MA 3ZHDA 4TS6A 1JZ3A 4NN7C 1XR9B 2AJVL 1KTJA 4BBWA 2Y3NA 3EJUA 4Y19A 2AJUH 2RH0A 4WI8A 2NW3A 3OLIA 3UTPE 4FA7B 1DSWA 5BZXA 4NNYA 2NTFA 1YNTB 2W9LA 1HINL 4P8QA 2UVEA 3BWZA 2H9GB 3VM5A 3CXHK 1L9SA 4R3SA 3K6FA 2Z1KA 3EFDH 2Q3ZA 5C9JA 4KI5E 4KKLD 5JPMB 4IU3A 5BZWB 2R29A 4Z5RB 3WMPA 2PTVA 3HB3B 4GRWB 5HYJE 3ENEA 5GS1B 2MQGA 2EINB 3NIFF 5FWQA 5I0ZA 5B39B 3GSOA 4F91B 2YSTA 2GJ6E 3T2NL 4A2HA 1OK0A 4YDLB 3HIZA 1KENL 4F7MB 3IKCB 3FO1A 5JQ6L 2FT7A 2WAHA 2KPWA 2F7OA 3O3DA 2ZUXA 3VXMA 3RFZB 1NCGA 1HHJA 2GVYA 2PP8A 2C3VA 4N5UA 4ZMYA 2HG0A 1T1ZB 3L2NA 4PJDB 5IFJA 4OZIA 2B20A 2Y24A 3KXFD 4R6UA 3PWPE 3UADA 3CWGA 4JFQA 4XGZB 5IKCA 3MV01 1FZMA 2GTQA 4F7KA 1U3HB 1QFHA 3VI4F 1UT1A 2FD6H 3MLTB 4RBPK 1I9RH 4KDVA 4NLAA 1H9DA 2F5AH 1A7NH 4P5KB 1M3JA 5D7JB 3TBVA 5TQ2H 2DAVA 3D4GA 1AHKA 4NRXB 5EOQH 4I18A 4UTAH 1NBQA 5IG7A 4U1SA 4WWKD 4XNBA 5TK2A 3RX8A 3O2DL 5A1AA 2DWXA 5EZJA 1H3VA 1T4WA 1IBHA 3WFBH 2CLZA 1CC3A 3D30A 2R0ZH 1A8JH 1CXIA 1OT1A 3RX9A 4PLKD 5KAQF 2YRPA 1LTXA 4HKBA 3ARXA 2OQJB 3HS0A 4AM0B 5E70A 2QLYA 5C7ZA 4FA6A 3LKPB 3NZHH 2NY6C 2RTTA 4WFGD 4EOWL 4OF0A 1TPXB 5DUML 1KXQE 3HZVA 3JUYA 1BHGA 1ZV5A 3FPYA 2FZ3B 4Y1SA 5SWSA 4LIQL 2A73A 2QGDA 3EZ8A 1QA9B 4LPWA 4NIKB 5TE4H 5E8NA 5JHDB 3NEEA 4P23D 2V9RA 2ATKB 5LNEA 4N0YL 2B4CL 2YBGA 1UH3A 3LPOA 2CO1A 3D05A 4HMCA 1E90A 3J07A 5CU9A 4MAYA 4L8CA 2B15A 4GXUM 1X5KA 5EU4A 2COQA 3K5RA 2ITFA 4DGVL 3ARUA 1RPUA 1AJ7L 3NABL 3AXIA 1MRCL 4X4XB 2C1PB 3C6LC 1B0WA 5KVEL 1AKPA 1TU2A 3LHPL 3PWNA 4WENB 3CSYA 3WNIA 1B6DA 3TNMA 5I28A 2YJLA 1DLHA 3TIEB 5BZDB 3SBWC 2JXMA 3KPQA 5DHYB 2WXFA 1SXBA 1WC7B 3VA2C 2Q8BH 4W4NA 2QPUA 1G0DA 1MVUB 2Y7QA 2ZUWA 3TOPA 5K1VA 2XY1A 4BKTC 4XP1L 4NBXB 5T1MB 4JGJA 2APBA 3CBJB 4Q6YA 2IMMA 3ULUF 2OSLA 3TV8A 3EH5B 1G7HA 4FMKA 4X83A 3H1ZA 2H2PC 2VSCA 2PMZA 1D5XA 2W59A 4MD0A 1J5CA 4LCUA 1EDHA 4HIJB 5C3IA 3X3GH 2VABB 5KS9A 2Y25A 3FU6A 3WTXA 1Z9SB 3CVCA 1OAQL 4XH2B 3I50H 3VCLB 3CDZB 1LO0L 4IYKA 3QUGA 4K94H 2VDNH 2COVD 3O8XD 5EUOE 2ZX5A 3RWEB 1T66D 4N8CL 4PJFE 2DW5A 3EJZC 4MXWH 4MBRA 3UBXB 1HYRC 2F19H 3QR1A 4XO4A 1UQSA 4MX7A 1E5CA 4OLYH 1OCOB 3IDXL 5AVQB 5C0CD 2W92A 3A4EA 4EAEA 1FSKC 3F04A 5D93C 3P4MB 5E0FA 1GMEA 3I2CH 1FV1B 1KXTA 3H42L 3ZR6A 4XP5H 5JPMC 4AGNA 2NXZD 4B27A 2BWDA 3Q01A 4U1IB 4AXWA 3PWJA 1P7KB 5EFIB 5EIIA 1HH6B 3MLSL 2EYTB 1JZHA 1H8LA 2RBLA 2Z93A 4J4PD 1UACL 5FKPB 2LHAA 3QIBC 2OK0L 3O0RL 3WG7B 3WXVL 2NY3D 3SO5A 3MR9B 3RFZC 1YCSA 4FEIA 1TJHH 2J25A 4BUQA 3IDYB 4ENZA 2EDKA 4JRYA 1OHZA 4K9EC 3WFHA 2GJJA 3EYFA 4JO2H 3BGFB 4KRPC 1ND0B 4Z7UE 3RHWK 3DARA 4JFOB 2K9FB 4JKNA 5FGSA 2YBRB 1LYQA 4NCC1 2Y4SA 2NLJB 2XBZA 4N0UE 4MDIB 4ATTA 5CGMA 8FABB 4QF1A 2KZWA 5CGYD 3BP6A 4OGYH 3VQMA 4HUMB 3U6XS 5KVEH 4X6FB 4M5YL 4UM9D 3FUJA 3OG4B 4RNRA 2IGLA 3VXOA 4HG4J 4Y2NA 3UBXA 1DL7L 5IMMA 1ZHKB 5C0IA 3N91A 5LGHH 3FQ4A 5FCSH 3T8XB 5BS0B 4I2XE 1CFBA 4BHUA 5GS1C 4AVHA 1QI5A 4HZLB 2M1KA 3MUHL 1KIQB 4Z7UA 2K1MA 3FCTA 3UL4A 1BD2E 5TE4L 4EVNB 1W8EA 1KACB 4HXBH 4H8HA 1EEYB 3B3IB 4QHKI 1YMMA 1BZOA 4FI7A 1GVIA 1SJEA 2MRYA 3OJDB 5AKSA 1WAPA 1X44A 3OAWA 4AUYA 4PD4K 3K1KC 5I8OH 4OI7A 3NZHL 4PGBB 2VZVA 1RUQH 2DKSA 2Y06L 3DGDA 4DKFH 3ATFA 4U05A 3ARBD 3SQBB 3DOSB 5EWIL 2B5IB 4LVOC 3AB0B 3MOAH 4HKJA 3JWDC 3L4TA 4PH8A 4GG6A 3VRLE 1YHPA 4F8NA 3WFBL 1I1YA 2YA1A 3SGJC 5DHYA 2FQGA 3KD4A 1ORSB 3NIGB 4NHUA 1CYWA 2A83A 3MLUH 5BQ7B 2E9GA 3F7RA 3FONB 4LVNB 2G9HA 1PFOA 4LP8A 1BBJA 4NKMB 4M02A 1V05A 4M6OH 4MDIA 2E7LA 4HF5H 4L9LC 1WHOA 2PCFB 3OC8A 1RUAL 2GC4C 3CAFA 2FD6L 3EG9B 4PJ9B 5AWNL 3V7AG 4EKXA 4ZNCD 2IMNA 2Q7YA 3B1UA 1BV8A 4XAWH 3W11C 3UTTD 3A4FA 1DBJH 4FXKC 5BPPA 2NCEA 3W82A 1OD9A 5JR1H 4WDIB 1QVOB 3IFOA 3L7FA 4YLQT 5I17B 4P23B 4IBQA 3BQUC 1IBDA 4KI5C 1ZSHA 1OSPH 2IDTA 4RH4A 1I8LC 3APDA 4CAGA 3NSFA 2QGEA 1AIFB 5GZNA 5JA8B 1FG9C 1DP0A 4WW1B 3BXNA 1FE8L 3QZOA 4BFEA 1D5IL 4WO0A 1BGXL 4PYHA 3SGDI 2XRAH 3GM0A 2EDHA 1KTCA 1R3IL 3KLSA 2XETA 1MHHA 3L48A 3L5WA 4QTHA 1JD9A 1A6UL 3EUUA 1MFDH 3E9UA 1FIEA 3PDDA 3TFKD 4NQDB 2CHWA 3NQKA 4KUZL 4R3SB 4QOKE 3FTZA 3RWEA 2EUXA 1AQDB 1NLDH 1USZA 5MP6H 3TCLA 1M6UA 1A9EB 5EC2B 5HYSA 2BFGA 5EU6D 1J7VR 4JLRB 4OCXL 1QHPA 3QB7C 1E5AA 3WHE0 4AKPA 1M4KA 3BVXA 2DB8A 3DO3A 3WN6A 3TVMD 3C6LD 3NP3A 3NCYS 3O2DA 4U6XA 3TM6A 2LU3A 4BWUA 3FAWA 4DKEH 5L8JB 4WI2A 1Z1WA 2ICWJ 1YAIA 1EZVX 2YIHA 3NCMA 4PSPA 4JUTA 4FG6C 2IALB 4M7KH 3H4FA 3EDKA 1KG0A 4J27A 3AG2B 4OQTL 2PO6C 4ODTL 4OBSA 4ZSOB 3CMOH 1MWAB 3MN8A 3ZQWA 4DERA 2V4LA 3W0WB 5IJDC 5L2KB 3ATBA 1X5GA 1MWOA 1BWMA 3TNMB 1P6FA 3PABA 4JZNA 4OB5L 4P2RD 2ZYHA 3FUFA 2K70A 3ARFC 4L9LA 4DN3H 3D09A 3ARBA 3D85D 1IZKA 3LKNA 2P5EA 4JO4L 2PXYD 1P4IH 1P84K 2EE9A 1FGVL 3W0WE 5L2KE 3TCXA 3EJSA 2EEBA 3JWOC 4FCHA 1YN7B 5F7EL 2DBJA 3EOAA 3QS2A 2J1KA 2R2CA 3KL5A 5IHZA 1QFWL 5LXGH 4QCIB 3ROLB 1IC5L 1RZGA 4N87A 3RGHA 4OIIL 1NOLA 5CBEB 3LZLA 3CE1A 2D7TH 3OB8A 5A2AA 4JDTH 2YKLH 4F3FB 3HG4A 1U4FA 2P24A 2WINB 3EBIA 3FU0A 4LVHB 4YGAB 2Q10A 4Z7UB 5DJZA 3KLDA 4LCWB 1AG0A 3D07A 3BMVA 4LLWA 2LLLA 4D9QE 1J0JA 4OIBA 1II4E 5HVGB 4X80H 1S7WA 5I0XA 1WEJL 3ZTNL 4R8WH 1O7VA 4ZSOA 1Z9LA 4LOEA 3P30H 5B22A 4GBXD 2ITDB 2IF7A 1KDIA 1MREL 1RIHL 3DECA 4NQED 1F11B 5LBVA 4XNMA 1U0QA 2V2WA 3BDXA 4XMZA 1DQLL 3NTCH 5ICXA 3KLLA 3TBSB 5I30H 1A6PA 2J1WA 1ZT1A 2WXGA 4OJFL 1U3HA 2DQHL 3FQ2A 3BO8B 4IOIB 2AANA 4P4RB 1YO4A 1GMIA 4U6YA 1N7ML 4QRSB 3QFJD 5GISH 3FQTB 5DD6A 4RSYA 4JFDB 1E9OB 1AGEB 2P7TA 2PYFA 5FYKE 1CF1A 4IRZH 1L5GB 3FFDA 3OLDA 1NGPL 2XG4A 5B1AB 4FMVA 4XX1E 1GGBL 4K8RL 4RGNB 3D4ZA 4TQHA 2HVKB 4IKKA 4NUPA 1CT8A 4JUSA 5DMIH 1GXEA 3HRZC 1KJ2H 2LW3A 1RKRA 1CR9L 3ZDXE 3IJ7A 4KOBA 2ZQKA 5E5MA 5GS0C 5LDSA 1P7HL 3IFNH 4N3TA 1FFPA 3UGEA 4OUOA 4X6DF 1AO7E 1AOZA 1XR8B 1V7NL 5EORH 3MLWH 5C7XL 4TNVK 2JKTM 4X9YA 5HJDA 1OOWA 1RUKL 3V5HA 4KU1A 1U8IA 5TJWK 4HZ1A 1ET5A 1WD8A 5JIQA 1E0OB 3KWXA 3HPLB 1I1AD 3MOQA 1FG2B 3GHEH 5E2WL 3WSQH 2PXYC 4O02B 3F7VA 4MFHA 5ESAA 4LCUB 2VXQH 4ZD3L 2IPUG 3RL1B 3FBQA 1OSPL 4AWJC 3I6KA 1J1XH 1NWOA 1U2CA 4Z6AT 4AQOA 32C2B 1KPUB 3IDGA 4AEFA 1FIGH 3MHZA 2H5UA 4HHWA 5J6HA 1GS7A 2F9BT 2BY2A 4I1RA 5CP3H 4K3DH 2PR9A 5C0DA 5IUCA 5I2IA 5AWNH 2BWIA 2VDOL 3UEZA 2A83B 3I6SA 3QUZD 4HF5L 1ZGLA 1S78C 4JO1H 3V0EA 1E40A 1W91A 3QJRB 5FFOA 4XB3A 2DQUL 1E9PB 1OTUD 5D2NE 3PV6A 3LQZB 1CLYH 2R23B 4U7KA 2OMNA 3BQUD 3TO4A 1WT5C 2F58H 4G7SB 4M8QB 4X6CA 3GUTB 2I9TB 5C0JB 2CO4A 4PW4A 4KV5E 3VXRA 4KHTL 4M7LH 5JHLL 1A1MB 3OTTA 1PZ5A 3MOAL 3RNKB 4XTRC 3RL1A 2BP3A 4J6RH 4QHPA 4FA8A 3QEUB 2FECI 4IRJD 1NUDA 4RWHA 3IGUA 3GXNA 3UZEC 5D5MB 1HQRA 2D3LA 1T0MA 2B9BA 3F12A 1XGYL 2VLRE 5GGQL 4P3CH 4ZOCA 3GS4A 2PYED 2J4WL 3MTRA 2F6AA 4HKZB 3BWUF 3KPMA 3AT8A 1YY8B 4PVNA 3EJYC 3NCWA 4NNXA 2P52A 3CFKB 4XCFH 4XE0A 2Z0BA 1OPGL 2B16A 2KZKA 4GLRI 1N64L 4TUJA 1XBDA 4GEIA 1INEL 1C08A 2ENPA 5IFHH 4XOCA 4M8UA 4PJDE 2NY4C 4TULL 4MJ6B 4ZUSA 3E8VA 5AYQA 4OGYL 4JDZA 5E24E 1ZGLP 2BM3A 2WHVA 1PLCA 1OCWH 4P57A 3VH8G 4X6CF 4N6RB 5IQNA 4JHBA 2JELH 2EE2A 3TO4C 1QLEL 1MLBB 3GRWH 4JM2C 4YLCA 1Q9WA 1WBXB 2UZXB 4X8GA 2CGZA 3P3SA 1AS6A 5DD6B 4DUVA 1IGFL 3VFSA 4MMXA 1WA2X 5B1KA 5C08B 1S9YB 3TBWB 4LEEA 2G75A 4WNSA 2CNZA 4AV5A 4JR9L 2I9LB 3SE9L 1JWMA 4NM4L 2BY0A 1CDJA 4M93C 4FJZA 2VXSL 3LH2L 3NPZB 2XWDA 4GAJH 1IQWH 5DJXA 4MCYA 3T2OA 2FEDC 4U3SA 5E7FA 4HEMA 1XD0A 4F2MA 1IKFH 4TTGA 4LCWE 1DQQA 3MLSH 1IM3D 1HOCA 4KKBC 3RI5F 3GYRA 2WO2B 5F9OL 5AVVB 1AXTL 3RLSA 1U8CB 4R97B 3WY2A 1WQVT 5J06A 1GIGL 4J1UB 1TZAA 2F1AA 3H42H 1FL3A 4ZRGA 4OJEH 3EFFB 5LG6A 1BIHA 2BHZA 1FDLH 3KLKA 4YXLL 2MMXA 2Z64C 1ONQA 2V9TA 4PJ7F 5DK2B 2ZUTA 4H1LH 2GJZA 3HMXL 4PRPE 5CHNB 3SPIA 5EUOF 4AW7A 7FABL 1MHEB 4XPAH 1HEHC 3NFPA 2Q9OA 2J8UB 3QAZB 5D96C 5T3XH 1UTDA 5FW6A 2WZ6A 4FXLA 3UC2A 1DSFH 5ACZA 5CF3A 2O61A 3VMOA 1F00I 1UH4A 2JE8A 2HMID 4JHVA 2ITCA 4M5SA 2BERA 3H9SB 3U7YH 3ZZSA 1ZK9A 4HJGA 2BVYA 4HUWA 1QBLL 3Q5YA 1KYDA 1BW8A 2IO5A 3JBG7 5DMGC 5AVTB 5IW6B 4AYDC 3U6XA 3QEGL 4B9KC 1IGTB 3CFQA 3MBXH 4H2CA 3U0TB 5B3JF 2GFBB 4E41B 5DJ8A 1YYML 3TEZA 1AGCB 1UWXH 2ZOLA 1QSFA 1EBPA 1MELA 4NO0B 1R3JA 1A7OH 1M6OA 2X2HA 2F8VA 1G4MA 3MKGA 4WEUD 1SDAB 1DN0A 1X9QA 4RGMB 1T2JA 2DPKA 2OMYA 3MXWH 1JZJA 2ALAA 5I1HL 1QZNA 5IROC 2UXVA 5ECJE 2Q2LA 3NFNB 3AU1B 1KTLB 4KH9A 5AAWA 5DUJA 4J7RA 5CJQH 2V2TA 2YPKA 4ZTPL 4OZFA 4P4KC 3T4YB 3MCYA 1UCTA 4XODA 1JWUB 4Y16C 4LU5L 5CHNA 1TTRA 1U8IB 5I8EA 3VI3E 4D9QD 5KEZA 3QWOA 3IDMB 1N10A 3RDTD 3GB7A 3SKNA 5FECB 2N59A 1KXHA 1WD9A 2F0CA 4FLOA 2V5SA 2IG2L 1FC2D 2EUVA 2BNQB 3BDYL 1XF4A 1M05A 4B9PA 4JFSA 4YAQA 4B5EA 2VDQB 4LDCA 5I76A 1T3FA 1P4LA 3FRUB 5E6ZA 43C9B 2WY3B 5I1CH 3IDGB 4DZBA 3SDDC 1AC0A 4BKSC 5C8JB 4AMXA 4PY8I 4XZUA 2Q3AA 4HHAB 1VLXA 4WRLA 2CJTA 1YEIL 1TJMA 1EJOL 1YQVH 2E59A 2FLRT 3I02A 5IW1A 1IC1A 4WW1A 5CD5D 3TN0C 3S9DB 2CJUH 5EN2A 4UTAL 5EZIH 5KSVB 5I1IL 1M7DA 5ICZB 4ZTOH 3VFNA 4PWFA 4YHPA 1L9OA 4X6BA 1SYVB 4UILL 1ES0B 2NY0B 1L7IL 3DYOA 3L4WA 4JY4A 5CKAA 3P73A 2E27H 3QUZC 3IFLH 3WJMB 2JLLA 5CKGA 3GLDA 4LRIC 4LHJB 1Q9KA 1AR1D 1C8QA 5C8JA 4KRMB 3MO1A 4MAUL 4LLUA 3T6XA 3FQNA 4LLYB 1Q9OA 4MYPA 1TJIH 1E8ZA 4Q74A 5I9QB 4J3OD 4N1EA 1JV5B 1T7ZA 2MOVA 1LMIA 2UX6A 3FQRA 4UIMB 4ELMB 3RBGA 4DUWA 3VG9C 1JF1B 3HAEH 2DI9A 4OSUH 5EEVA 2X4UA 2APWA 3LY6A 3K4DA 3QQ3A 4WJG3 5FWRA 4FJYA 4LSSL 4ENEC 2HLAB 2WYHA 4P23A 4KQ0A 1IL1A 3GLZA 3FQUA 2ZUUA 4C4UA 2O5XH 5JOEA 5T3XE 4HIIB 3I02B 1D9KC 2RCSL 1TR7A 3US1A 2KT6A 2AJVH 1OIOA 3FT9A 2WAQA 2XYBA 1KPRA 1OF2B 2P8LA 1JN6B 3VH8B 1RY7B 3B43A 4Q9RH 3GZQA 3D85B 3LZQA 4NKDB 4C47A 2EEFA 4LNRA 5TDNA 1IGIH 1WAAA 3I9AA 2FWLB 3DBXA 5ERWA 5CINL 1U36A 3AG1B 1MNNA 1U95A 3VFPB 5KANI 3MRDA 1EAPB 2DLFH 4KTDH 1M3IA 3GGWB 2QFPA 4OAWA 1J8HD 4KJWC 5JNYB 4BQBA 1M57B 4XP9H 3HHRB 5ACZB 1P2CB 2CKNA 1HE7A 5LCVL 1BFVL 2GUOA 2OTUA 1CL7L 1N4XH 1PKQA 2XTJD 2VWEC 2BP0A 1E65A 2FB4L 1GTFA 3WHXB 1Q0YL 2EH7L 2X4OA 5H2BA 1DQVA 2QV4A 2R0LL 4K73A 4F7CB 4YMPA 2VB5A 3P1VA 3V0JA 4IMLB 3OLGA 4ODXA 1AZBA 1NKRA 1CFTB 1ONQB 2CIKA 1REIA 3EGSB 1URIA 1KB5L 1WA0X 4X7CC 3QUHA 4IOFD 1P7KA 4CVXA 4RFEA 3IDIA 2ICEC 1R0AH 2ZOKB 3TT1H 2JKXA 1EMTL 1CGSL 1JTPA 4ZYKA 5FK9B 3SCMC 4KKAD 1W6LA 2AITA 3Q8EA 4F8PA 4QXTA 1Z9NA 2FWOA 4AQEA 2A6IB 1AR1C 1I1FB 4LSQH 4YHKH 1DYZA 2HAZA 4WUUA 3GMPB 4RAUB 1MZYA 4OLEA 1ZWIA 1X5FA 3B2UC 3IU3A 3C87A 3LIZA 1UM4L 4GSXA 2RR3A 3B6SB 3LH9A 3T0EA 3RJQB 1SUJA 1EX0A 1D5BB 3F6LA 4MMZA 2OKMA 4QWWC 4V2BA 1KCLA 4BCXA 3KPSD 3LV3A 4AUUA 5D1XD 4KNUA 1LQSR 1XMEB 2BSDA 1E42A 4HK0A 3BGAA 4Z78B 1UGNA 2XT1B 4GI6A 4OVVA 4EIZC 2NX5B 1E4KA 1JPTL 1KCUL 2NNXA 3C60D 4R96A 4AGQA 1IKOP 4NGHH 4ORZC 1NCWL 5E7BA 4XHJC 1QSEA 4FS0A 5ACMA 4HFWB 3WE6B 5EU6E 2ZXWB 1AQKL 2O6EA 3KH3A 3MRMB 3VXNB 1T1XA 1DBMH 1S7TB 2UY7A 2XJKA 4ZUUA 4FADA 1FLRL 5GHWH 4PGCA 1D5RA 4S11A 3ULVF 3HG1B 4N68A 3QEHB 1RZ7H 4MXQC 4XZ4A 3PPSA 4K5PA 4HWUA 3W38A 1KT2B 3PQYD 2C7UA 3B2PA 3O4LB 4L4TB 5EOTA 1WWWX 3CFMA 3VYOA 5JPNA 3UTSB 2PR4L 4PHZA 1YG9A 5DQJB 3S48A 2KPNA 4GRWE 1OAKH 3GI8L 3MLZH 1RK0A 3VJ6A 1CL7I 3H7BA 5I23A 2B3RA 2YSSB 2CAKA 4ZUWA 4FQPA 1IAOA 2CRYA 1HKLH 3MXVL 4I2XA 1KGXA 3IXAB 4P57B 5IVZA 1QA9A 4XO8A 5DHVB 1IAIH 3BVDB 1CK0L 4ZXBD 2P8PB 5F7AA 3D9AH 1YEGL 4AV4A 4YOKA 2WN3A 3UZQB 3LS4L 1B4JH 1GTNA 1YEDB 3DJRA 4NZJA 3SDDD 5ADPL 2CHZA 2H7WA 3D06A 1DVFC 1UC6A 1ZHBB 3D2UB 2NXYD 3WAJA 4HCRH 1MCDA 4OLXH 4HUUB 3VXSB 3CG8A 5IHUH 2CLZB 3WHE1 4L4VB 5TDPA 2EACA 4OJDH 3BVNB 5DEFB 2O5NA 5I74B 3UP6A 1CTOA 4FYTA 4K4KA 1A25A 1TZHB 3I85A 3PGFH 2W0FB 4CBZA 3BT2H 2K6WA 4S10A 2VDPL 4DT2A 3U83A 3IGAB 3PGDB 1MUJB 2I07A 1YNKH 1IAOB 3TBVB 1W0VB 4ZAKB 4C83B 1KEGL 1L6XA 2W38A 4JANA 2HWZL 4LEXL 4XN1A 5SWZD 2EIJB 2A73B 4PJ8D 1RZJC 1YN6B 1OKEA 4GKSB 4EVNA 5DD5L 3L3KB 2F54D 3A3YB 4U0QB 3MC0A 4XPTH 1EXHA 4O5LL 1CIDA 5DYFA 3QORA 4G7YL 1EERB 5EEXA 3SDXE 3FSOA 1LEKA 2DM2A 2ZG1A 3UABA 5GRZA 3AGVA 1O6SA 1T7XA 1ZANH 5E1HB 4GS7C 1ETJA 4GRWH 1VENA 4RZCB 1AI1H 1NGYB 4ZFQA 3NEOA 3ETBF 2WBXA 3FQNB 6TAAA 1VPOH 4KVNH 1WGOA 3OAYK 3US0A 2XICA 4R7VA 3K4ZA 1OY3B 4OCYH 2E4TA 4U1SB 5CS7A 5J13B 1UA6H 2WTPA 2AZUA 1U6AL 4AKQA 3O3BB 5EBMA 4WK0B 1WGVA 2OXGB 3R8BB 1QNZL 5JYLA 4HWBA 3VDBA 1H0DA 3MKKA 4PJ8A 4B3EA 1KCWA 2VYRE 4QRQA 1CN4A 3LXBA 3OZ9L 3LIUA 1U8MA 4W70A 3MODH 4QHMA 1M2OA 4I87A 2AFNA 1MF2L 3HMWL 4LASH 1ILUA 2W0PA 4LKXA 5D7KD 3ZRFC 4OZIB 3ETTA 3N43F 1D5ZB 4EDWL 3TBYB 2NY0C 5FW7A 5K5YA 4RAUA 2JQZA 2VERN 3CD4A 4MD5A 3QDJB 1V7ML 2V33A 4LAQH 5E9DA 3G7TA 4IBTA 3VXSE 3X11B 2AJXH 2OYLA 2R4SH 4AJWA 2D4FA 3RNQA 4B9FA 4KK6C 3MRNB 1WFJA 4Y9EA 4L3AA 5ELIA 4C4KO 5C2UB 3COOA 1JTOA 2UY6B 2F18A 3BKCH 2CGRH 2DQJH 3C5ZA 4NT6A 1ZHNB 1H8OA 5GS2H 1H3XA 4K7PX 4QAWA 2FEJA 2UVFA 1KBGL 3B8YA 3MVSA 5JHBA 2UZYB 3W9EB 4RISL 4PJIF 4GI8A 1A3RL 5HYQA 5F93C 4U7SA 5EBWA 3QEQE 1CFVL 4WV1A 3CXDH 2P43B 4OLUL 2GEQA 2Q2EB 3SDXB 4HS8L 3ZZQA 2W65A 5I1DB 3BP5B 3VSQA 4Z7VA 2XPZA 3KGRA 3KR3L 3BISA 4XVJH 3DJTA 1QPKA 1YMMB 1YN7A 3DMMC 1X9UA 2AXWA 3BUQA 4H1LA 4XVJL 2WLYA 5J13C 3ARFD 3D69B 4XN5A 3U79A 4C58B 2ZOLB 3VTAA 2FEEI 3DUUB 4FX5A 1CBVL 1EGJL 4F27A 3BVTA 1O9WA 2YD8A 1TYEB 3T5WA 2YD1A 2OSXA 3MRLA 4JCLA 3VGBA 1Q9OB 3ARDB 3FRPG 2JI2A 4H7VA 4FOMA 1JOIA 5H35B 4NHCL 4F37K 4LCCB 2CGRL 3WJLA 5E8OB 4EUPG 1A2YB 3CDYA 4ABWA 5ADOH 4L8CB 4GSDL 4LVNC 4XBPA 5EUKB 3ZE1E 1URZA 3N3EA 4MB3A 2W65B 4PP1C 2JWYA 5T1KB 1FGNH 3G9VA 4FQXD 1G7QA 4JFPB 4ADJA 4RAVA 3K1DA 1CDIA 4XHJD 1MCQA 2LT9A 4PRBB 1YRKA 3O4OC 4FQXA 1AHWA 3VXMD 2MNUA 4ZMZA 5FA4A 5HYQB 3S2AA 3VD9A 2GI7A 3VD2A 3TZVC 5F7HA 1HDMB 4WI5A 3MODL 5EF2A 3VGAC 4HHAA 3QORC 4XVSL 1DEEA 4LLDA 4CMMA 1MRDH 2G2RB 3K72B 5AB2A 1X5ZA 1RZFL 4LLYA 3CFIC 4YE0A 2FBJL 3H2WA 1ED3B 4UV7L 4KXBA 1BBDL 4F24A 4TL4A 1LWHA 4OKVB 3P0VH 4S1QL 4OCYL 4PJBE 1CDBA 1IT9L 4RFOH 2XPGB 5E1AB 1UOWA 4B9CA 4BSWB 2VMCA 5IB4B 4MCYB 5E6ID 1OF0A 3ASWA 1OALA 4YZWA 3I74A 4OKDA 4YSTA 5FKAB 2HJKA 2YD3A 3P4NA 2EJ1A 1BM7A 4JCMA 5J56B 3U7WH 4BZ1H 2ICEA 2X87A 4AYFA 2R1XB 4FQ2H 4KKPA 4MA3B 1MCOL 1A9EA 5HYSB 5CZKA 4HAGA 5LG1A 1DZBA 2F53B 5DHMC 1VIWA 4L9DA 2ZSWB 3MRKB 4Y2LA 5EZLB 1WCQA 1D6EA 3O45B 3GSNL 3MV7D 4QHNA 2YJQA 4QUOA 4D9LL 4XCNB 4HAFA 3MLRL 4XZUB 2IGFH 3FFCD 1KGWA 3ASNB 1DQML 2FIKA 1KEGH 1T5WB 1T0OA 2NYYC 1MHHB 4FNRA 4PY7B 1MN4A 1KJVB 4KC3B 2EYRB 4UOW1 4Z9KB 4M5TA 4ORGA 3L5HA 5L2JB 3G04A 2NCMA 4IQHA 1ZA6A 5JDJA 3VD1A 3DX7B 3S96A 5KW9H 3HS0C 3I6LD 3GMMB 1R5VB 1QABA 2E46A 3KYMA 4D8OA 5IHUL 2JK5A 4DTGL 1T89A 4HCRL 1WFMA 2VDMH 2C1PA 1ANUA 3N43B 1L0QA 3QXUA 3TF4A 1A5FH 1MCNA 1QZ1A 4JFDE 2WD0A 1V5JA 3M17A 1W0VA 2VXQA 4FKKA 2H2SD 3GNMH 1Q0XH 3C8DA 2QQKL 3T3ME 5C0NC 4OF8A 2J12B 4RQQB 3EGXA 3ZT7A 1RZQA 3EG9A 5D2LE 1ZK5A 1IEHA 1GW6A 5FCUH 2MNJB 3X12B 1A6VL 2ENQA 3FB6B 3V0DA 4NQEE 2IJ0C 3ZN6A 2G5BA 3GUFA 2IV9A 4L0PB 4E9RA 3CZGA 4HKBB 4NCC2 3U0WL 4MS6A 4BWTA 4PW9A 1DVFB 2KKQA 5K9QG 2F5BH 1SJHA 5DRNA 1ADQA 1A3LL 5HYSG 4NXSA 1UD8A 4OD3L 4R90H 3OXSA 4Z8FL 3MRRA 5DZNA 3LN5B 1D3CA 3ZE2B 3T0DA 3WE6A 1O0VA 1YYCA 5JHMA 3KVPA 4GPVA 4P5TA 2J8HA 5DU7A 3FN3A 1YSOA 5SWZE 3CQPA 2CUAA 5FYJH 4PJ7A 1KELL 2P26A 4EDXA 3ARDC 3FC8A 3SY0B 1FFNB 2IH9A 2VGLM 5TFSH 3QG6B 5DEJA 1NCWH 4OT1H 3SGJA 2FLMA 5ANHA 3V6OC 2PTTA 1JGUL 3BAEH 1KBVA 1N0LB 3DIVA 1IE5A 4JEGB 1D7FA 4G5AA 2KS0A 2ESVA 2VRQA 3LQAC 5DVKA 1G43A 4QRPD 5EIIB 3L54A 1NINA 3EFFA 2VH5L 3AREC 3L3IA 4H5SA 3DJSA 3O4OB 3HS8A 3WYRA 5F1SA 4E2OA 2MOGA 4MNGB 5FM8A 1G7MB 5BVPH 4PGCB 2WVTA 1TCRA 1A66A 1R6VA 2HLFD 3C9NB 3T6QC 1F42A 2HJFB 3HI1A 3Q2CA 4QRRB 1SJVA 3S6CA 4R2GD 4P9MH 4LSQL 1ACCA 3JVFC 1I1CA 4DQOL 2G3ZA 5ENWA 1O75A 3JWNG 2NY5H 3RUGE 5BNXD 4YDIL 5KYNA 1CGSH 1GGCL 1PG7L 1TT6A 1NGXA 2O30A 4IJTA 2NY3B 4XP4H 4EUPB 4ZO8A 3FN9A 1SQ2N 4PREA 1YYLH 2RB8A 2WXQA 2CJ3A 2I27N 4OCSH 5IJBC 1UZGA 2NYZA 4P9ML 4JREC 5DDHB 4KVPA 2HPTA 4AJ0A 4ALAH 4BFOA 1NFDB 2W9DH 4QI3A 3GJEB 4J3BA 1MAJA 1U8OA 2ZJSH 4JCWA 3GMPA 2DLHA 2C3XA 1SLUA 3C60B 3L1EA 4BH7B 3WNKA 3V0WL 4MXVE 2YWYA 3TPKA 1XZWA 4M7JH 3L4ZA 4ZTEA 2AXFB 5FK9A 4MQ7B 1HT6A 2Z92B 2CHDA 3GM8A 2NQCA 1CDCA 5F71A 4AQZA 3TLRA 3SDAC 3F7YA 2ADFH 1C1EH 1MCPH 2CNYA 3HE6A 4PS4L 1SZNA 3FHAA 2QPEB 5TFSL 1QTPA 4HGWB 3UJTH 1JGEA 5B3JE 5FYJL 1HQRB 4QJ5B 4H8QA 3EYOA 4J8QA 3FB5A 4PIBA 4JGUA 4PRAB 3PAYA 4UCFA 1F56A 5A2FA 1S7SA 1VZIA 5EUOA 3SOBH 3WTYA 4ZS7L 1P9MC 4BJLA 3GSRB 3EDDA 2M2DA 2Z8VC 5INCA 1QFWI 1X7QA 2YUWA 3VFOA 5T1LB 5AB1A 3HN3A 1U8QB 4TQEH 3BVNA 3BH9B 1DJYA 1XL6A 1OGAB 3E6FA 2FQEA 2Y23A 3WIIH 3TWCL 1IC0A 5D2LA 4OAWB 4YSCA 4DPCX 1DVFA 1M56B 1R5VA 3FHQA 2Q3XA 3FBKA 5KN5A 5E2JA 4HS3B 5AVUB 3ZL2A 4R4FH 4U1LA 5IMLA 4BGLA 3K80A 1QW9A 1WSST 4G70B 1QACA 1E3XA 3E1ZA 4PB9L 4XE5B 5ERWB 3VM7A 1SJXA 5C0DB 3EXLA 2KL6A 1R9FA 1NCCL 5LN4A 5H37A 2E5EA 2O6PA 4LQFL 1AGDA 2DYPB 2V9QA 1RU9L 3S36X 1CT8B 1BQUA 3CBRA 2HFGH 2DIJA 3SGEH 2ALWA 3BVWA 4WCYH 3TPUA 4XMKL 1UOKA 5FGCB 5H8DA 4JRYE 3UTTB 1H8NA 1MCWM 1R1CA 2CBMA 3PV7A 5EO9A 3BZ4B 1OTTD 4IHOA 3KEHA 4GP4B 2OI9B 4LCWD 1JNJA 4C4BA 2EC9U 4WO4A 3JTBA 3UG3A 3IFLL 3IAGC 2LAAA 3WJJC 1UADC 3N40F 3AW5A 1L7IH 4JLRA 3V5HB 4P2QE 3GSUA 4X0NA 3ZO9A 4MQXC 4H8WL 1L3WA 1GAFL 4BZ2H 1I1AC 5JA9A 2EIDA 3DX4A 3S35X 4IHBA 5AVRB 4R9HA 3CPLA 1MY7A 4FP8L 3VXMB 1DQMH 1I7ZA 2WNGA 1BSIA 1V27A 1ZLUH 3CV5A 4XMTA 1KJVA 2OSWA 4QTHB 3MBEC 1MNUL 1S7WB 3U7AA 2PP7A 4UMGA 4OIFA 1CG9A 2NY1B 3D3VA 3QUMA 3S5ZA 4E42A 1QFWM 2HVKA 5GZOC 3WTWA 2GBVA 5BOPA 1IQDB 4X0KA 2NX5A 1NJ9A 2AMGA 1PLGL 1CWVA 3RY4A 1JS4A 2EZ0C 1YVLA 4JY4B 5EO1B 2VL5B 4WZ9A 1YUKB 5ANMB 3PDOB 4PRIB 1MIMH 3FQTA 1VKXB 3RGVA 5FV1L 1JL8A 3T4YA 4RFOL 3H55A 1G7QB 4H0IA 4JFPA 4P5MA 3P0VL 3JTSB 4HS6A 1H5BC 2FT6A 4LU5H 4ZAKA 5HDBF 4C83A 1WZAA 4XNZC 2OMZA 1Z9OA 3NRPA 5D1ZB 3CJJA 1CU4L 4WW2F 3PQYE 4N86A 3CFEB 3O3DB 5IF0A 1SXSA 5KSUB 1DQJA 3WUWG 1FYTA 4OVUA 4I3SL 1FVCB 3KM2A 5INDB 5I1HH 1RFDL 4NRYB 3ET9F 3HB3D 3N0PB 2GFBA 4E41A 2IBGA 2GT9B 4WGVB 4CC1A 3E3QE 2G2RA 4G8GB 4U2ZA 1T03H 1BF5A 2V3DA 5C9JB 4LK4A 3CPLB 5KN5B 5DFAA 4Z23A 1G6RH 3CTTA 2WUBH 5DK0A 2G9KA 2UX7A 3FDWA 1N0XH 4Q14A 4Y9CA 1SF5A 1KCSH 2X1WL 4OZHF 1ACYL 4PJFB 4Y16A 3RVVC 3WDHA 1ZE3H 1QBLH 5ESVA 1GH7A 5FHBH 4OR1A 2P8PA 3RWFB 3O3UN 3PWLA 2ZYSA 4Z95H 1BFOB 5FYLE 3ROLA 4G59C 3TP4A 2Z65C 3QJFB 4K7FA 1I3RA 3QBTB 3T3PF 2HUEA 4HKXA 3U46A 1M7UA 1BREA 4FC3E 2B5IC 3DC0A 1HIMH 1CFQB 4JM2D 1BJMA 4QAMB 3RPIB 5I1JL 2HT3D 5H35A 1TIUA 3KH4A 4OM0L 4U1KA 4WW2A 2HTLD 4KZCA 3VWKA 4Y0GA 4JFYB 1CBVH 4JQIH 3T8XA 4N2DA 1CGUA 4NP4L 3AQYA 1FHNA 3TJPA 4UANA 5FYKD 4FQJH 5CBAA 3QFGA 2XXFA 4BA0A 3AXLA 1IAIM 1TFPA 1L9TA 2J44A 1KBWA 3B9KD 5HGHA 5MEPA 1RZJL 2X9ZA 4F2MB 4NO0D 1CFVH 3RTQB 3VVWA 1E28B 2ZXCA 3D48R 3GSRA 3QIUD 4TVPH 4A2DA 3PP4H 4UTBA 5CIPB 4KRNA 4OFYD 3X1BA 4UNIA 2ARJB 4GUQA 3EUDA 4PAZA 5EOCH 3KPNA 1MLCA 1RJYB 1EUUA 3FT4A 4GRLD 3VYNA 2XTSA 4GAJL 2VXSH 3LH2H 1VKXA 1FVDA 3ULUL 4HGWA 1KB3A 2PYEE 3ESPA 3NJGA 3M1CA 4P2OD 2D7NA 4YHOL 1PQZA 1FYHB 2N1KA 2VN3A 4UMSA 2R4SL 1UB5A 5E6YA 1ZWIB 4AEIL 4G1MB 3II1A 2OA9A 3L2MA 1BZ9B 4KVCH 5A3ID 1D9KB 2ZG2A 1OGAD 3WS6C 4KXZI 5KJ7E 3FT3B 1Q9KB 4O2CA 5KYWB 3BZEA 1P5VB 3K0YA 1G5AA 5BJTB 2OTWA 3QDHA 3HHSA 3FKUS 3MNVB 3P3YA 2XQBH 4P46D 4YUEL 3CU7A 5FM4A 5CZVH 1QR1A 5C92A 2VR9A 4WY7H 4N22A 4LKXB 2EDLA 5DT1H 1N64H 1XGZA 5H94B 1A47A 3VXSD 2CLRA 1OSEA 2ORBH 3CH1B 1F0LA 2VRAA 3RA7H 4R7DB 4MMXB 4B97A 2AHIA 2K78A 4X6CE 1XAKA 3EDJA 4AQAB 2JIXD 2Y0SA 4WKXA 2GK2A 3APNA 5L88L 4MJJA 5TF1L 3MLXH 5GRXG 2X42A 1XH0A 1A8ZA 1G7HB 1NGQH 1R3KB 2PCYA 1FFOA 1E7VA 1OAJA 3LPFA 5HI3D 4YVUA 1NANH 4A6YB 1XB6A 3FU3A 4OCNC 2I9TA 2OXHB 1L9NA 5DF0A 1CE1L 4ODHH 1JHKH 4JPVH 3G6DH 2BC4A 4K9EH 4PJ9C 3L6FA 4U1LB 3S37H 2BRQA 1SEQH 1BLNB 5JW5B 3U1SL 1GGIH 1K4CA 1CB4A 2GSIB 3MI6A 4X6EB 3UMTA 2AS5M 5FUZH 3GB7B 2HWZH 3QWOB 4LEXH 5FOBA 2K3HA 1BVKB 4AC2A 2DQUH 5J1TC 3GSWB 4TNWK 4W9HC 4M6NL 3WEOA 5HPMB 2ZF8A 1DBBH 5EF3A 4UZUA 2DJUA 4XCYB 4L1LA 1UXSB 4ELKA 2IXQB 4J3UA 4H20H 2JKWA 4EIBA 5MEQB 2JJSA 1JJUA 5JO5A 4Z3FA 3D33A 2XACC 2A6KB 2TRHA 2VIRA 1HNGA 4UOW0 2VQUA 4NN5C 2QKIC 3C09C 1A4JA 1KIRA 3NSCA 4OV6F 4WEEA 1WZLA 5IEHA 1SOSA 4X42A 1NCOA 4NQDE 3MRRB 4A66A 4CU8A 3UYRH 1SVZA 2Y1ZA 1F6FB 4L3CB 4P05A 4WIQA 1NAMH 5MEND 1CFNB 3KPRB 1QNIA 1KY6A 3LS4H 5DZ9A 3RVXC 2APXA 1HOEA 2IDQA 5J0BA 3D9AL 2YFNA 5FO7A 1OTSC 2OMUA 2EVFA 4XN7A 4LOVA 1BX2B 1LE5B 2X4PB 4H8WC 2EYRA 3GXUB 1K5NA 1AD9B 1HXYB 1TZIB 1V7NH 1NM9A 3OHMB 5DURB 4DP0X 5KUKA 1YPZA 4YFLI 3T0VA 5A3IC 1KPUA 3IFNL 3U82B 1TTBA 3MLZL 4GMTH 4LNVA 4JY6A 5IK3A 4PJIA 1PD1A 3GZOA 2MNWA 1CDGA 2X88A 2XXGA 3O8XC 4HK0B 4PJ5D 5AKVA 1XXDC 5F1KC 1G9EA 3W39B 4BEIA 3BPNB 5DQDL 3V7MA 4Q9BA 4MRCA 2YC1A 1F4WH 4DP9X 3TA3B 5HYJB 3O6FD 3SO3B 3DX8A 3VQLA 5GSRA 4X4YB 1PZAA 2RQ8A 1LO2L 1OB0A 1JE6A 4IRZL 5C0CE 2LGNA 2TRYA 4XXDA 4L2LA 3NN8A 5IW3A 5C0GA 4JKMA 2ADGA 1N12A 1N7MH 2ZG3A 5KVGE 2Y07L 3V6OE 4L0YA 3QT2A 2Z35A 3U30C 1M7XA 5E1QA 3MAWA 3FT3A 2FCBA 4LDOB 4O2CB 4ZK8A 4NJAH 1FH5H 2PYEA 2QPDB 2A2QT 1NDMA 1QSEB 5E95B 2VM3A 3AB0C 3PU7A 4GG8B 4TM9A 1J9TA 1X5IA 4OU3A 1BYOA 2NUTB 3JYCA 5DS2A 1RPQA 4XCNA 3MV7E 3B5TA 5CCKL 4LPTA 4MB1A 5GGSA 3BW9B 3HG3A 5DMYA 4S0SD 2F53A 3EJTA 1BVNP 1JVKA 3CLFH 4FNLH 2NY0D 4JM2F 5C08A 4CSTA 5DI8B 2EO1A 5I19L 2DQGL 3A24A 5IT2H 3T0EB 4RAVB 2C9VA 5E4EC 2L4OA 5AAWC 2YKLL 1X4YA 1NCIA 4OGQC 4K71C 2NR6C 3GMRA 1E28A 2OMYB 4LRIA 1IC5H 2DYSB 4ZZKA 4FZEL 3D4YA 4Y8DC 1CXFA 2A99A 1KB5H 2UZIL 2GIYA 1Z3GL 5F7EH 4ANKA 1JNNH 2G0LA 4Q52A 3IF1B 3OHXC 5I18L 5BOJA 1SMAA 5AOLA 2N56A 4PEEA 4POUB 1MCIA 4U1HA 2CZNA 1JWSA 4UT7L 4HULB 2WMPA 4G83A 4DEWA 2GITB 3EOBB 3GDCA 4MDRA 4KROB 4C59B 3LCYA 2F54E 2R51A 5EU4B 3N85H 2VCOA 2IALA 4KKAC 5EBLB 4FFVC 2CKBH 3NSJA 1YEWA 2YGOA 2ZP0T 1PZ5B 4B6ZA 4FQHA 2PUQT 3MLTA 3HR5B 3VX1A 4OQTH 5I1GL 3HRZB 3LPGA 3NCCB 3X1NA 5C0FA 5L8LB 1P2CA 1VZHA 3HZVB 3K81A 3MBWB 3UTZB 2EEAA 4Z7VF 3B2MA 4JGMA 4TN9A 5D1XA 1AKJD 5CINH 1E9PA 4WSGA 2BNUB 2IPTL 1JG9A 3ILPB 3ME0A 2WCSA 5BVJB 5D1XC 1KJ3L 3SYPA 2G30A 3JV5A 5C2BL 4FNUA 3RZCA 1X5JA 1JV2A 5EPMB 4GXVL 3KPTA 4FG4A 5IBTH 2DH2A 1PZ2A 2GT9A 2DLEA 4NUQA 4X8JB 1I8LA 1KLFB 3SDCB 3HN5A 5EZJB 1U8CA 2IH8A 2X4RA 4N2KA 4ZW3A 1DEDA 3PXHA 4H8PA 5DJ0B 2EC8A 3GMLA 1A6UH 3J2PA 1MDAA 2WBJD 4TQPA 5EZLA 4LCIH 1I8UA 4OSUL 4OD2A 2P42B 2VLJB 2XRAL 3SBQA 3BKJL 2XFXB 3EHBD 4OFQA 3S88H 3N1GC 4GUPA 2Y22A 3QPQC 4EEEA 3A0OA 1X6LA 5GGTL 1JRHI 2CXGA 3N6YA 1F97A 4QRQB 4ABQA 5HHNB 3RWGB 4N90E 4YGVA 5E1AA 4X0KB 3CZLA 4NWTL 5IQ9A 4M03A 1IARB 2Q8AL 3V4VL 2VZUA 4J3OF 1PEWA 1QFOA 1MFBH 2JSFA 2WLIA 3HC4H 1U9KA 1YPZB 2E27L 3DX9B 4EXPX 1IIKA 2ZZUT 3QEQD 5AOIA 3T3PE 4PYGA 2P28B 3HRPA 4RZCA 4PB0L 3REWA 2CU9A 4FTVA 1RP8A 2P47B 3FUDA 2TSAA 1TSRA 2DTML 4R7NB 2AJSH 3FL7A 5I1IH 1CFNA 3KPRA 3SKNB 2LLGA 4OZ4A 3L08A 1QWHA 4NZ8A 2B0SL 3WNLA 5FECA 1IO4C 2R8SL 2NNRA 4JPWL 3L9RB 1SEBA 1KN4H 4E0RB 4Y5VA 4GUPB 1M1XA 2PPDA 1YEIH 2LU5A 3KGSA 5BZZA 1PEZA 3LKQB 1WUNT 3CHRA 5B1BB 2AAVA 5KS9E 2NY2C 3GS0A 2J55A 2LVEA 3MJ9H 2AQ2A 3LNIA 2W94A 3F7PC 2ZUSA 4PJEA 4HPOH 4ZMWA 1SHXA 1WWBX 2ZX7A 3UTQB 2W07A 4JHZA 4XMPL 3QQNA 5ISZE 2FLBT 2W0FA 3BDYH 4WFED 5FYKU 3NJLA 2Y2TA 2IG2H 2CO3A 2I7SA 4U2YA 3KJ4C 1LEIA 3KNBA 1FNGB 4XNDA 1RCYA 4CN4A 3NJXA 3S8WA 4MJIE 2HCZX 4URTB 5BS0D 1PZDA 4WGKA 4A7SA 4N2OA 3GTNA 3SYCA 4LL9A 1OSZB 3SPJA 5I1AA 5L9DH 1HJCA 2CJSA 1XGQA 3LMJL 1NCAH 2R0WH 1I8AA 4NEHB 2Q7NA 4PWGA 3US9A 3QORB 4MSWA 8FABA 1F3RB 2Z4QA 3GHPA 4Q58C 4APQD 1DZ0A 1TOXA 2PETA 1H19A 5I74C 1S9XA 4NOFA 4YSQA 4M93B 1IGCH 2AK1L 3SQOH 2VLMD 1ZTXH 2FX7L 3U4AA 1S7RB 1PKOA 3GO1H 4PY8J 2HJLB 4PS8A 2DD8H 1EFXA 3TV3H 4XHQA 4XO5A 4ZX6A 4MXVF 2CKBA 1ASPA 2N0KA 3QYCA 2OV0A 3MREB 5FYLH 3ZO0A 3MRIA 1JAEA 1KMGA 5DK2A 4IRJA 5IVXF 4R26H 5A2IH 2CLRB 1S9VA 1NC4D 4AZUA 3IMWA 5I1EL 2FE0A 3L95B 5I6MA 5ID0A 3KYNB 3MYJA 4ZS6D 1MI5A 3V6FB 3KM1A 1TTAA 2C4FU 3O0RH 3WXVH 4NKIL 4G8GA 1TFHA 3MMEA 4TVSa 3FUIA 3K2MC 2JB6B 2EDRA 4NOBA 5KYWA 3BZEB 4ZDHA 4G3YH 2ESVE 4N1HB 3ARDD 3VXUE 2J20A 4KXDA 1B90A 5CJ5A 2UXTA 4PG2C 2VLKE 2BJML 4M6ML 4Y1TA 3QDMD 2YWZA 4P2QD 4N0RA 5T5FA 5CGYC 2BVPB 1FVEA 2FHCA 5FUOL 1WIPA 3HMXH 3Q48A 4K2UL 4FLQA 4CU7A 1GGTA 1T22A 1OT4A 3DHMA 1A4KA 2QTEA 3RUGF 4UDTB 2HN7A 3L3OB 1QUNA 5EC1A 1S9YA 2F19L 2IADA 1YNLL 3L4XA 5AYUH 1PX4A 3O2VL 1IFRA 4K94L 1GIGH 2OXGA 1MHCA 3QHFH 5CD5C 5EFIA 3B37A 4XR8C 3IBOA 3T8VA 4HUVA 1FL3B 4R2GC 3NCYP 2HA1A 4UQ2B 2P3YA 3U1QA 3SODB 3BKMH 2ADIA 1JNLL 3GJFA 4FERA 1JYNA 1RHHB 3IVKA 3A6CH 3PL6B 4KK5C 4V1DD 5J3HC 1YPZF 4JL1A 1JPGB 2B59B 4X50A 2IANB 4PJIE 3V6FA 1KB9J 1KNOB 1RVFH 2XN1A 2IDCA 4NYLA 2AQNA 1JWMB 3BPLB 1WRFA 4GEJA 5LBSL 4U1MB 3GRWL 4UAOC 1QLEH 1N6UA 1UA3A 1L9MA 1HEZA 2FX7H 1T0PB 3KZ8A 1OCWL 2XQ0A 1QVOA 3IFOB 3LHPH 4G7QB 1MHPH 4H0LC 4QRBA 2X2UA 3AMKA 5CWSB 2EDNA 2J88H 4ZODA 2J56A 3M1BA 1HL9A 3P11H 4UQ3A 1QWUA 3IB4A 3V5KB 1UKQA 3UG5A 2W1NA 4GQPH 2WCGA 2VLKB 4A2GA 2AV7B 1E4XH 2ZIDA 3CZFA 4BK5A 3ZL1A 3P0GB 1ZT4B 1LQBC 1WT5A 3GSVA 3LMJH 4I0PC 3FU7B 2B4CH 1UG9A 4F15C 3MACH 1AG6A 4CNIB 2J4WH 3DXAE 4XB8A 4PVBA 4FFZH 3S8GB 3MV7A 3IDIB 4EOWH 1RK1A 4YIQB 3RAJH 5I75C 1VGKB 5L2JA 4LQ1A 1NAMA 4OLVH 3KJ4B 1EHKB 3ZUCA 3QORD 3DOSA 4J6RL 4WFHE 3A67L 6PAZA 2IV8A 5IEHB 2WBWB 3O3AA 3VI3A 4F8TA 2VXTH 3V5DA 4N2HA 4HGKC 2VM4A 4TLTA 4YQXL 1SBBA 4HJTA 2BDNH 3BESR 5E6IA 3PS6A 2JI3A 4NQUA 4R0LC 4JFEB 4L3EB 3UO8B 1HJBC 2R8SH 4GO6B 4YBHA 4B60A 2KZ1B 3OHXA 3TA4D 1AP2A 3PAVA 3QJHA 2LQRA 1J0HA 1WZ1H 5KJ4A 1G5GA 2OMXA 2VDOH 3QXTA 5C0AE 4TF4A 1T0NB 3QO1B 3PHQB 4H26B 4XC1H 5T1KD 4RAHA 3GGWA 4GNKB 3GXDA 2VISA 1FPTH 3C5ZD 3MCKA 4IMKA 4WW2C 1MJ7L 3QAZC 2YD6A 1Q90A 5D1ZD 1HNYA 4P2RB 3GF8A 4ZUVB 1I1RA 1KBKA 4NWTH 2VZOA 2CK2A 2Z3FA 1QEXA 4G9FB 4LBEA 1UM5H 3OPZL 1F4AA 1H3WM 4JFOA 1CI5A 4XX1G 1OL0A 1BFSA 3CVIL 3DUHA 3CVHA 3S5YA 2VDKL 5ACLA 1JYWA 2OMZB 3ZYJA 3VSUA 2FQDA 3BKJH 2Y3AA 3OKOA 2B1HH 4QY8B 1DQTA 4JX0A 2VOTA 1GYVA 3MGOA 3QNXB 4OBRA 2P49B 3EFDL 4N90D 3DIDA 2MJWA 3TVMB 4C56B 3WLWC 4DEUA 3FOMB 3H2QA 1OCCB 1T7YA 4LFHD 3GMOA 4RMSA 1CD1B 1HINH 3L7FB 1PD0A 2V17H 4XO9A 3QUYB 2F74B 4E9YA 3NCJH 5ITBH 1SUHA 2WIMA 4PJXB 3SPVB 1S5IL 1V3KA 3P9LB 3UJJH 3ARZA 1Q38A 3FT2B 3MRJB 4NKQB 3IEAA 5KJRH 1U8PA 4QWWD 2A6IA 3HBZA 4WTXA 2AQSA 2GSGB 2VQ1A 3ZKQD 4RLDA 5A40E 3H9SD 4AGLA 1JCKA 5AFAA 4APQC 4O58L 3BGMB 3C75A 4GXUN 2QADB 5CN2A 5JLZB 5AUMA 3IN2A 4KX9A 4I0PD 4LIQE 3DO7B 1MCFA 5DTFB 4L4JA 3RWJB 2B2XL 5D1QC 3GLEA 4JK0D 1HC1A 4OF7A 3ME0B 3DX6A 3OKYA 2A6DA 4E9WA 3LRMA 4MS8C 2AXJA 2C9RA 2VDMB 1FBIH 3GRGA 4FHKA 5I82A 2NW2A 4QYOA 3NTCL 3PHOA 1CFQA 2YMXL 1IC7L 3LB6C 5D6DC 2HKFH 1HHHA 1UJ3A 3BH8B 2XSKA 4KHXH 4MD0B 4NQCE 3KDMB 4QHLB 2JV6A 5EBGA 1OE2A 1QSZA 5AENA 4D0BA 2H0PA 4F7EA 4RA3A 3W56A 3Q5OA 1CD9B 3X13B 5KZCB 2AGJH 2XNAB 1T6WA 1FO0B 1FZOA 5F9DC 5KG9B 3UTSE 3ARGD 3IDJA 1KF9B 3HLAB 3JTTB 4GJTB 4Z7QE 4OZHB 3TIDA 1IGYA 1BQSA 1KGIA 1SOKA 2GITA 4LLMA 4FFYA 2R4RL 1WZKA 3BWUC 4DVBB 2R9HC 1B0RA 3OC5A 3OQ3B 2UZIH 1IGTA 5JW4Q 1S7QA 3L3GA 1ZD6A 4D7PA 4P2OA 3F7YB 2A38A 2QL1A 3OV6A 4RNRB 3SIKA 4ODBD 4JG5A 3CK0L 4OIIH 3G6JE 2AVGA 1GZPA 1JD7A 1OP4A 1WZMA 4ODWB 4AQ1A 5MI0C 2HG5B 3QRBA 2WO3B 5LXGL 2VLME 3SKOB 4IBLT 2DBLH 3UTZA 4NQDD 4X7SH 1BEYH 5D1ZC 3D0AA 3TTSA 4KKCD 2BSTB 3UPAA 2G3MA 5I19H 5M7QA 4Y16D 1EBAA 4H25B 2K45A 3GHBL 3BP5A 5JHDA 4HS6B 1RIVH 5D4IA 2IOMA 3ESVF 2H41A 3T2LA 4JO4H 1ZKAA 3DX0A 2X4UB 1A7BA 3Q05A 4KY1H 2E6QA 3S3PA 4EZLA 1NGWA 2X3AA 1AQDA 1WISA 2EYTA 3GMQA 2YMXH 3QCUH 3WLWD 3BQVA 3W2DL 4PR5B 1EEZB 3NG5A 4E9VA 4Q6IB 4NO3B 3BD4A 3W0WA 5L2KA 1UASA 3L4UA 3MV9A 3ULUE 3S36H 2ZOUA 2C3WA 5C0EA 4AYID 3BEVA 4CDHA 3LEYL 1MY5A 5IBLC 4G82A 3GFUA 4KDWA 2BFVL 4DKEL 2O61B 4XO3A 5HD8D 3KWTA 2HX9A 1LO2H 3CMGA 4A7VA 1R47A 2FX9L 4ZFGH 4L8SC 2KQNA 2FSEB 4MYWB 4EN3A 2WGNB 3NCXA 5DR5L 5EU6A 4OCXH 1C5CH 4G2AA 1U8HA 4ZQTA 3AG4B 4YHPB 5MP6L 1RUPL 1NL0L 5D72H 1SFHA 3OMNB 2ZT9C 2Y7MA 1U58B 2JIXA 3V9FA 1S5IH 5EEZA 5I17A 4FYRA 2E9JA 3KE0A 5GQBA 5CCGE 3E38A 4Y4KA 1MIEH 2BIHA 2D4DA 5F9WB 2FUTA 1HCVA 5DJ2B 2EVIA 4YSRA 2GUYA 4MB4A 4ZOBA 3IGAA 3PGDA 5D2LF 2OS7A 3FFCB 4AGOA 4HSQA 4JG1H 3R7QA 2ZSVB 3IFPB 1D5IH 3QRGH 3GT6A 1DQKA 4AIZB 4FZ8H 3L3HB 3MRFA 1K8IB 3CVIH 3L1GA 1AVAA 1JZIA 2ADJB 1C08B 1XZ0A 1UXWA 1I7ZB 2F68X 3OPZH 3UYRL 2P5EE 3ZDXB 5BUAA 1E8YA 4FXKB 3NFSL 2H0FA 5CFAA 1UVQB 3AGWA 2YOCA 3EJYD 1MI5B 4POZC 1ASOA 5GIRA 4JDEB 3PL6D 2P80A 4ZPVA 3WIAA 3ECUA 2WC7A 2WLHA 2XKNA 3EW3B 2VDPB 1QTSA 1X7TA 2UV3A 2OW6A 4OZGB 3CZSA 3X14B 3VFSB 4WDIA 2AXHA 1AKJA 4PJBF 2NX5D 4O02H 5DLML 2HFEB 5HXMA 4D9RD 1H9VA 4M6NH 2APVA 2WOYA 3WEAA 2Z8WC 4Y2DD 2GEEA 4PU2A 2E6JA 2IXQA 3DX3A 2FL5A 4KPHH 2G60H 4JVWA 1EWHA 1VA9A 5F1IA 3VXRD 1LWRA 5IJVB 3TJHD 1HXYA 1TZIA 2MWCA 3AWEA 5AW2B 3ABMB 4ISVA 1J8HE 4W1TA 1F02I 1EK3A 1M71A 2QTVA 4LSVH 2QZ5A 3ES6B 1YJDL 4FXKA 5PCYA 3PHSA 2AABH 4E9QA 1UD5A 4F9LA 4QRPE 3RAJL 5GGVH 2DQFB 5KYYA 2DQEL 3TBTA 1UURA 1PZSA 2OL3A 1J5IA 4KKBD 4D0DA 2RALA 4JJHA 2YBRA 3WFEH 5DZOA 5C1MB 3UC0L 4DOHE 3I75B 4Y5XC 5ANME 2EECA 2BRRH 2A7BA 1A9BB 3ECWA 4HISA 4HCFA 2DQTL 4HUKB 3X2QB 3V4PL 3K4AA 2C3HA 4AEHH 4WY7L 3PWUB 3T77A 1OGAE 3ZZ1A 5K39A 5B38G 3LKQA 1MRFH 5CZVL 2R1XA 1XH3A 3V79C 3H53A 4YVNA 3P11L 5FO9A 3FMGL 2ENSA 1J1PH 5FKAA 2Z93B 1MHPL 2WJ7A 3RY5A 4PV9A 1BZQK 3FUKA 4IIZA 3TH4T 2DKUA 1MKFA 1BLNA 4KI5D 3MNVA 1J10A 1UWGH 1WBZB 4KVCL 3WEBA 4PP2A 5EIVA 1RVFL 1Z0MA 2MPVA 3IKKA 3DROB 4TOYL 1K3ZA 3OKEA 1FNEA 2GJ6D 5FGBA 1S46A 2X89D 3DMMA 3FULA 3LTVA 5KSAC 3TZVD 4E41D 4DHLA 1JPFB 2OP4H 5GS1A 1LP9F 3EH2A 4DIXA 3HB3C 4LZKA 1E4JA 3L3JB 5DVMA 2XCMC 3NN8B 5C0GB 4NXKA 5I6XC 3BKML 3DRTB 2VQ4A 3ZSTA 3QUKB 5FO9B 1UACH 5AVXB 5EA0H 1J87A 4TVPL 2GW5A 5GJTL 1QQDB 2UZXA 4XP5L 2JQAA 3RVUC 5H94A 4UT9L 2X4OB 1JDAA 3O2VH 5H2BB 5I8CB 3MBEA 2PWFA 2ARWA 4QO1A 3I75A 5EU3B 3I6GB 3TU6A 3K8KA 4LOFA 4ZMAT 5TE6L 2YMTA 5IIEA 1R3LB 3AROA 4PLJC 5A7BA 4J3VA 1FV1A 2EEDA 1I31A 2GK0B 2X89A 3LYRA 3DROA 1NCJA 4Q56A 1MW0A 2X4PA 5D7JC 4ANUA 5BRPA 1LO0H 4ZW8A 4BA8A 2C4XA 1XB8A 4M6MH 4PJCA 1HHKA 4X8JA 2ZOKA 1O6SB 1IRAY 4XRCA 5D7IE 3NOIA 5LUMA 4G3YL 3WIFB 2GTWB 3T1FA 1ETB1 3SE4A 5ISZD 4XH2A 5DRXB 3Q6FA 4WFEE 4BUGA 1DO5A 4NB7A 1EO8H 4ZXBC 4H1LB 5AVSB 4N0UA 1CQKA 5BS0E 4JW3A 3MRBA 5I66A 2ZKWA 4F2ME 3T8MA 1XFPA 1KCBA 1MPAL 4P5TB 4D0CB 5IV2B 2CMRH 2VC2B 2VERA 1LGVA 1KFAL 2OZ4H 4X6CB 3F5WA 4Z7WF 3OG6B 1MQKL 2HFTA 1HAWA 1DR9A 3PHOB 2GC7C 5LWYH 3IU4H 1UGKA 3SQOL 5IJKC 1IGCL 3ATEA 3QPKA 3OAUH 3N1QC 3GIZL 3ROOA 4OZFG 2ED6A 4FXGC 4DKDC 2YOAA 1CGTA 1QRKA 2IDUA 4P3DA 2Y7SA 2OMBA 5IMOB 3F7LA 1KUMA 4NKDA 4ODSL 5F7MC 4LSPL 5LAPA 2ZSVA 3IFPA 4GAGH 3GTVA 1JUFA 4HIEA 3KYOA 2FGZA 5TD4A 4BRVA 1GL4B 4ACPA 1LL1A 5EO0B 3DIFB 4YSOA 4DGYH 4ETQA 1YECL 3HUJE 3T4AC 2EIKB 2PW2A 4QPEA 5CJOL 2X1OA 3VJ6B 3D6GA 5G4MA 1DVSA 3GMOB 5BXFB 4I3RH 2IFFH 3DRQB 4HPOL 2ESVD 4XBMA 3AZUA 2WQRA 3MJ9L 4EJ1C 4UU9B 2VLKD 5CJ8A 3SZKC 3ZQ9A 3S35L 4PJDF 4FI8A 4J4PA 4L1DA 1JZGA 1YMHB 5EO1A 2WQXA 3TEWA 2NXZC 4GMSL 3EJPA 1N2RA 4HX1B 5HHVL 2IWKA 3ECVA 2MHAB 5AQ0A 5DJ6B 5HTSA 3L7EB 1KSRA 2ZCHL 3BP4A 5F0LB 4PGEB 5DZVA 5HPOA 2VDQH 1YC8A 3RNQB 3ULVC 3FCUB 4PB0H 5A16A 3DNKA 4EI6A 1M05B 2XUWA 1SM3H 4A7QA 3PJLA 4PFEA 4LVHC 3TZVA 5FUCE 1JYVA 2O5YL 2VLRB 1P7QD 3HC4L 1HI6A 4YX2L 4DH2A 4JFWA 3V4VH 2GY5A 4UU9A 5D7KE 1UD6A 1ZT7A 2J1YA 4NRZA 5J6SA 2Q8AH 1AIFA 1L7TL 5IR1B 4E9SA 2BW5A 3GDBA 3UFIA 4AYFB 4KITB 1HH9A 1JPST 1CICA 4OF5A 1AZVA 35C8L 4AE1A 1LK2B 5JQ6H 4HJ0D 8CGTA 3L3DA 6PCYA 1PAZA 5SWQA 4LCYB 2VXVL 1GGYA 2WM0A 2UYLA 1CXEA 1BQ5A 4Q7DA 1MAML 3S88L 1VFUA 4NDMB 1LO3L 4ZG1A 4DNLA 1UXLA 1ID5I 1T4KB 1R3JB 3JV6B 4WEBH 1RJZA 4F1ZA 1UFGA 4F2EA 3CCHB 5DJYA 5KOVC 1UZ8A 3CFDA 4TYUA 5GGRA 3DX1A 4J5VA 2QJDA 4QXGL 4AL8C 3Q44A 2EH8L 3ROOB 2XN9B 1E43A 2I60L 3MZTA 4LARH 5E1IA 5IBTL 4X5PA 3ZE0F 3UMNA 2ZCKL 5D96B 1I75A 3G9AB 2PF6A 5AOJA 1KJ3H 4Z7OE 1R24A 5IEKB 4BKLB 1SVBA 1UCBL 2D2OA 1LDSA 4FF9A 2B8OT 3BRDA 2BNRD 1ADWA 4OCLC 4DO5A 1WG3A 4YHNA 5CEZE 1L6PA 3DXAD 4FQCH 4HUNB 5EO9B 2J1ZA 3UPCA 2J8UA 2ZWKA 1BQKA 1NH6A 2EADA 3EOTL 4OJYA 3T6VA 4PS4H 2HT4D 1EEYA 1UD4A 3HNVL 3QG7H 1FZKA 2ADFL 4ELKB 4NO0A 3BUIA 1RK0B 3WFDL 1SBSH 3O3AB 2HG5A 5IHLB 3UAJD 2YAFA 2Y1YA 2OLDA 4K3EH 1OAUL 2BIOA 2VR5A 3QJOA 1NAMB 3RDJA 2Y6SD 2AJ3B 4TNFA 2ATAA 3WIFA 3SKMB 5E4EB 3WNOA 3CSTA 4A38A 3T4AA 4I8DA 1ZJBA 3L2LA 1BMGA 3EYVA 1TQCB 3HI6L 3BGMA 1JI2A 1B3JA 3VH8A 1S7TA 5I18H 3JZ7A 3X11A 1SYSA 2XFGB 3CFEA 1VGEL 3EZJB 1Z3GH 4JM2A 5GJSL 4WI9A 1MZZA 3IJEA 2J73A 3QNYB 4WWPA 4AZ8A 3N40P 3VXME 1OQXA 2IWEA 1P7BA 1YYLL 2PCPB 3VXPB 5LKNA 2NY1D 2GQHA 4MKMA 2BOCA 1JMZA 1UH2A 5DYOA 1UM6L 4AM0Q 1G7IB 2EQDA 1F13A 1SHSA 5EBWB 3ML9A 5DZPA 2UUDK 1F90L 4W81A 4HJUA 4QJ4B 3QISA 4HBCL 2UWEA 9PCYA 4UTBL 3BW9A 4DETA 4MASA 3LDBC 4OD1L 3P9MA 1PZBA 4PJGE 3CSFA 1MEXL 1NDGB 2O6DA 3QULB 4JPKL 5EU5B 4P5SA 2FSEA 4EN3B 5CZXD 5BVPL 2V7NB 4LRNH 2B1AH 1S7XA 3VYPA 5CCKH 1LDPH 4MD4A 4NUGL 4APQA 4CJ1A 3QJXA 2MH4A 2ZYIA 4UWQB 3OKMB 3O3EA 1U3JA 2BY1A 2JCCA 1TZGL 2W9EH 3QDGE 4MQXD 3DHUA 2FBOJ 1TO4A 2R29L 4YC2B 1DDHB 4M62L 5CAYB 3D50A 3MMEB 2OYPA 1JGUH 4WWID 5JZ7D 1BG1A 3BRFA 1EJ8A 5DC0A 1ACXA 4UINL 4NQCA 3V4VB 3TCTA 1QTYT 4HK3N 5HSFA 3L1FA 2G0KA 3QXDB 2YC1B 1OW0C 1EIBA 2ZX9A 4QJ3B 3RIFF 1ZA3B 1X6NA 3VQ2C 3HI5H 1E6OH 2BS8A 3D08A 3C08H 4EDXB 3WS3B 4OD3H 4I0PA 3L3JA 4WGWB 5DHVH 3ZKSD 1F4WL 2ZTBA 3IU3B 4Z8FH 4LFHG 4AUJA 2F5BL 4JJ5B 1GZQB 3BDBA 2Q20A 1PS3A 5C0JA 2L7UA 3ECBB 4FULA 4WTWA 1HQ4A 1R5WB 1U8LB 4C56E 1RURH 3IAQA 1NBZB 4G6FD 3LRGA 3CZEA 4HUUA 3VXSA 1NFIA 1NANI 1NSNH 4Y1AE 3DVGA 4H0GA 3NIFE 1TDQA 3TYGH 3X1EA 3MRHA 4WI0B 2D0FA 1OAZH 3CFJA 4O4YH 1DJXA 1P9MA 4G7VH 5FGCE 4X9FA 2HRHA 1V3LA 2QQKH 4G9FE 3QEQB 3QJTB 4WQOA 2Y5TA 1VFBA 1ROWA 3KW8A 3NZUA 1A5FL 5T5NG 6FABL 2IWGA 1IGJB 3MJ6A 1HNFA 2EE0A 5DC4B 4G5ZL 1QMUA 3QJFA 3G5XB 5ESAB 4Y1AA 3DGCR 2CO7B 4KO5A 5CEYA 4DTGH 3KS0H 2DS4A 5AZUA 5HI4C 3RWDB 5JXED 2VDOB 4OCRH 4LP5A 1E5YA 2XWTB 1AHMA 1KOAA 2NY3C 4PJ5E 2EXSA 3VXTA 1Z32X 2BMKA 1HZHH 3MRCA 1W72H 1PG7W 3PIQA 4DP8X 2E56A 4XC3L 3BPLC 4L3FA 1XBRA 5EEYA 1K4CB 3STZB 5I1AB 1DLHB 3TIEA 3IN0A 3RU8H 1XF5A 1QPPA 1JPEA 3L4CA 1JVLA 2J72A 5B1JA 4UBDC 4ORGB 3DO7A 3MLRH 4Y5XB 1T1YB 2C9PA 5F1NA 3VTTA 2DWDA 4LSTH 1IM3A 1L0YA 1GGIL 4F58L 1TQTA 1GYAA 3STLA 4L4VE 4ZMOA 4R7LA 4G1MA 3EH3B 4R96B 5DS8A 4J28A 4JFHD 4KK6D 3UZVB 1HHGB 1CE1H 5HJ3B 4BZ1L 5MHSD 3MJ9A 4OGZA 1XSOA 4UQ3B 4XCEA 5EZPA 5F3BA 5I5MA 4GUCA 2G4EA 4K23H 2ZCLL 4GP5B 2D31B 2EDBA 2DEYX 5TF1H 1KDJA 3IJHA 4PG9B 1ZT1B 2DLGA 2XIDA 2P5WE 1P6WA 2NTSP 2WLMA 1Z5YD 2C7UB 4L4TA 2HLFC 3KMDA 1EA9C 3FJTA 1E2WA 1AACA 1AR1B 3S96B 5K9JL 1PYWB 4PCSA 2X28A 5EOCJ 3UIZA 1B9KA 5DJ0A 3VGDA 2WYZA 2X2YA 1QFUH 4GAYB 4Q2ZA 3SJVB 5IQLA 2D7PA 4KMTH 1CTMA 1I9EA 4JG0L 4XXWC 4YDVA 3VA6A 1ZLEA 4HXAL 3K91A 2DYRB 4HIXL 1AO7D 4S1SL 4MZ2A 5E9DD 4J3SA 1WDAA 5HY9A 1I8KB 2ZSWA 3FB8B 3MRKA 5HI5C 1Q8MA 2P46B 5FYJD 3VGFA 3VWKB 4AEIH 4LPCA 4NC1C 4ZW5A 1QI3A 3BGFC 8PAZA 4D7BA 4U6YB 4NJ9L 2X05A 4YHOH 4ACTA 3B9DA 3VFNB 4GSDH 3B5GA 3EJZD 2E7DA 4M00A 4MMZB 3LKSB 4N9OB 4QIRA 4LSRL 5F72S 3SQRA 5J1SC 1FFNA 5M95B 1BDYA 3KHOA 1VESA 2VLLB 1J0YA 3W11D 4NHCH 3LIZH 4MBOA 4F92B 3FH5A 3UOAB 1GS8A 1S9XB 4XBGB 2YS4A 4LOUD 5J11C 3RI5K 5IQMA 5MEPB 4OFDA 5D1QD 5CNHA 4L1SA 1IC4L 3MTXA 4BK8A 2ZICA 5E8EB 3HZKA 5IB3A 1MFVA 2JXMB 3KPQB 3D5OF 4OLZH 4PWKA 5HI4D 3ARBB 4KZEL 5FEBA 3M07A 3JWNH 5IMLB 4LP4A 3VVVA 3BE1L 3QPXH 5AW1B 1NKGA 4FTVE 1I8MA 1RMFL 2V5RA 5ISZB 3V4UH 4KTGA 4NWUL 3TN0A 2ODHA 3HLAA 3JTTA 4RFNB 2NW3B 4W9EC 4APXA 4V33A 1G7JB 1XEUA 2ITEA 2QSVA 4XBGA 5AW6B 1GKOA 2ILLA 4P9HC 2BSSB 2WYTA 3V0FA 2NPLX 3IMSA 3AT0A 5LCVA 3IPEA 2R9HD 4HEPA 4A2LA 4AENA 4GXFA 1CTNA 1NBVL 4XNYH 5B1CA 5CWSA 3BH8A 1TVBB 1XGRB 3CSPA 3OX8A 4NX0A 2AEQL 4GG6F 2CM5A 4LCCA 4LO9A 3UAFA 3VMNA 5LGYA 4JJOA 1R34A 5EC2A 1MJUH 4PJXE 3CC1A 4KRLB 1J18A 5HYJD 5FHBL 3TVMC 4LSRH 2UUDH 1XGQB 2DQ6A 4LKCB 1ORQB 1CFMA 1LP9B 5F96L 5TE7L 4WTZG 1YEFH 1RIUL 3CGTA 4WU5B 1RULL 3RWJA 1KCKA 3QJSB 4DVBA 4MQ7A 3RPKA 1KYAA 4NRYA 1NLBL 2PO6D 2VZSA 4HIXH 5CLZA 2JCWA 1DQQB 4LASL 1S5HA 2Q5BA 2QSTA 5AOKA 4QGTA 2BIIA 3DJ9A 3BQUB 4YGVB 4CVUA 1OTSD 1GRWA 3EXJA 1YMHA 1PAMA 1V10A 4D0BB 1A7QL 2F74A 5C0RL 3N04A 2NY7H 3EYUL 3FQXB 4WNQA 2NY4B 2A9NL 5K9JH 3MROA 1U6AH 2X7LA 3OPUA 4YDMA 1M7DB 4DW2H 1NC2B 4UNUA 2D8KA 1TVHB 1NFAA 3KG5A 1QATA 3SE3C 3ETSA 4OTXH 4HWZB 3ZX1A 2R7EB 4LHQB 3QIWC 4AYMC 4Z3JA 1KFGA 5E0QA 3CLWA 3UAEA 3WUWB 2ZAGA 1K4DB 4XPHL 1D7DA