3H6AA

Structure of the calx-beta domain of integrin beta4 crystallized in the presence of calcium
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
109
Chain Sequence
MRDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin beta-4
publication title Structure of the Calx-beta domain of the integrin beta4 subunit: insights into function and cation-independent stability
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 109
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h6aA00
3RB5A 2FWSA 3E9UA 2KLSA 3US9A 2QVKA 3FSOA 3GINA 3E9TA 2KLTA 2LT9A 2QVMA 3EADA 3FQ4A 3H6AA 2DPKA 3RB7A 2FWUA
chains in the Genus database with same CATH superfamily
4RGOH 4KZCA 2WINB 3VXME 1MNUL 2JIXA 3PQYB 4K2UL 3N43B 3QDMB 4X5XB 5I1HL 1T04B 5ACZB 1JHLL 1H8SA 5BNXD 3PWLB 4BFJA 2QQLL 3I74A 3OKKB 4L9DA 5C07A 1MJ8H 1VDGA 1IEBA 1ZV2A 4RGNB 3LB6D 2I60H 1KZYA 1R6VA 3ARDD 3FJTA 5E99L 5CILL 3K5SA 1E2VA 3RFZA 2GJ6A 3US1A 2QV2A 2Q3XA 1I31A 4LPWA 4PG2C 4BH8A 5CP3H 4F9LC 4PS4L 5E8PA 2CUHA 4CKQA 4HF5L 1N5YL 4OZHB 3REVB 2FATH 4UAOC 3VXRD 4IKIA 2AS5M 4GXUN 1MWAA 4B60A 5I1CH 4M1DL 1AQDB 3QIBD 5CAYB 4PCSA 3RBGA 2FLRT 4R2GC 3LVTA 3QIUB 1D6EB 3QORC 5D70H 4MNGB 2NXYB 2OMTA 3KNBA 3MRDA 1DVUA 1ZKAA 3RG1C 1BCIA 3NIGF 1NCWL 5DJYA 3TCLB 3VGDA 2IWEA 1FNEA 4NSKB 1E3ZA 4GINA 4KKCD 4HIEA 4RDQF 3RVVD 4LU5L 4WO4B 2KZKA 2TSAA 3B2VH 2C3XA 2VISB 5KSBF 1JZ2A 5DTFB 1NJ9B 4LEEA 3N1GC 4P99A 5G4NA 4GW5B 1HWGB 4WY7H 5IQLA 1FGNL 2BDNH 4FFZA 4X2UA 5GGTH 4IU2B 1HCVA 1N59B 4MA7H 3QORA 3W2DH 3FU6A 1P6AB 3WMSA 4A63A 4OIIH 1BZDA 2FHCA 2IF7A 4HW6A 3ABLB 1GA2A 3FFCB 1RZ7H 3VSUA 1T4KA 1KXVC 3IS1X 3C75A 1MG2C 4FKKA 4HJTA 2AITA 4RGMB 2YSSA 4JFFD 1X4ZA 1AZZC 3KLKA 5L8KB 2QVFB 3NA4A 4FLSA 1N6VA 3HNVL 4J5VA 3BGAA 3IWUA 3RUGE 1VZGA 3MLRL 3SD5A 1NGPL 2ED7A 3SKOB 4GRMB 2DQFA 3O8XA 3NIDF 3FQXB 1FA4A 4N2AA 4J2QA 2VDRB 4IQHA 3RY6C 3QPQC 5I6XC 2ATPA 1RUQH 6PCYA 1B90A 3HAEA 5B7EA 2ERJC 3CFCL 4X7FC 2GAZA 5ADOH 4P57B 3OKYA 5KSAD 2HFEB 3I3DA 5AVQB 4Y9BA 2NOYA 3D4YA 3SZ6A 5DD0L 5JHLH 5IJKA 1FFOB 1CBVH 3O2WL 2XZAH 3P9LB 1JFQL 5J6GA 4KJQD 5FXCH 2QGEA 3HN8A 3NPZB 4YFDB 5F7BA 5LCVA 4DP4X 5FM4A 4G11A 2NY0B 1OHZA 3HUJF 4WJ5B 3BUPA 4JFYA 3ULVL 3GXTA 4L4TB 1AP2A 3L4UA 2C3GA 4H8UA 2FR4A 1R3JB 3SB3A 2P24A 1OT2A 2OAAA 3UPAA 2R69A 5EEVA 1FRGH 1J0YA 5ICXA 4MMZC 1BYNA 4PJFA 4TM9A 1CD8A 1KGIA 4JFSA 3Q3GB 4U05A 1SXCA 1BEXA 5CUSH 4DQAA 1DJZA 2XPYA 4MA1C 4JQXC 1LMKA 3SBRA 1ADWA 4JRYE 1XH2A 1EJFA 1TVHB 1QWHA 3HE7B 1SFHA 2ESVB 5BS0D 2X9YA 2WY3B 4IIQC 2AANA 2DQEL 2K0RA 1YPZA 3SD2A 5F97E 3O9WB 5D7JC 5JMOC 1E6JL 4YC2C 5KVGE 5EIIG 4ZODA 1Z5LA 2WQRA 5DA4A 5F9JA 5HI3D 3C60B 3DDGA 3VWJB 3EOAB 5JW4R 3KYMB 4ZUUB 3IMWA 1XCXA 3TT3H 4MMZA 2BHYA 1Y1UA 2BO0A 1KLUA 4FTDA 1UM4L 2BIOA 1CVRA 2LHAA 3NIFE 3UBHA 3ZTNL 1SN0A 1SMAA 4JQXA 3EFFB 4IHOB 1NGQL 4FQXB 5F6HI 3EFOA 1KG0B 3SGDI 1T83C 4I8DA 2HWZL 5CINL 4F7PA 4XNAA 5JIIA 1ZJBA 4ATTA 2GSMB 1OPGL 3DIVA 3ARUA 1UG9A 3W81A 5D7JA 5FGBA 3ABZA 3MRMB 4K07A 3BSZA 1MUJA 1ZA6B 4Y19A 1THCA 5I1EL 5E6YA 4JFDD 5D1XB 4PV1C 3BIKA 1SLUA 2Z31C 1EXUB 2VR5A 2GFBA 4NRYB 2MWCA 5IFAH 4ZOCA 4JDZB 5DZVA 3UPRA 4ZMVA 3ERXA 1UUNA 5BW7C 5AW2B 1WZKA 4TUKH 1YEIH 3SJVE 3PY9A 4YGVA 5FF6B 4GUOA 2PYFA 1ZOXA 3B2PA 3DIFB 3T0ED 3ZKND 1LNUA 2W65A 4Y9EA 4ZO9A 4ZOEA 2FVNA 4KJYA 2RHEA 1J8HA 3HBGA 4EVNB 3KPMA 1EVUA 4IKKA 3U46A 5KVFL 1SOSA 4XB8A 4K9EL 5F96H 1UJ3A 2EQDA 2OMWA 5E6IC 3SGJC 1AOZA 4L4VA 1CR9H 1Z1WA 5CZXC 1CL7I 1M05B 1OB1B 4E5XB 5IZ7A 1PZDA 1PEZA 3HC0A 2HRHA 2GIMA 4M93B 4ODHL 2QZ5A 1HI6B 3CHPA 4N5UA 5HYIA 1MSPA 4B97A 5C0EA 1TVBB 3LPFA 4MRCA 1U8MB 1A7RH 4RDBA 1MNNA 3RWHA 3TBWB 3VRJA 3FB6B 1TTBA 5KYXA 2UYLA 2D7NA 3EYFA 4BFRA 3IRPX 2Q3ZA 5CSBA 5DJ6A 5EU6A 5FPIA 2ZCZA 1TQVA 2CLVB 3Q8AA 5DUBB 1PKQE 3E80A 5FM5O 8FABB 2F53B 4I9XA 4WWKC 3V0EA 4Z95L 2EADA 3I75A 4ZW8A 4UQ9A 4FQLH 2E86A 4V1DE 2WQSA 1NGZA 4K8RD 2K9UA 3K6SB 1ZGLM 1V3LA 3C12A 4DP6X 4P2QE 4BFIB 2JKIS 4Z7OE 1GZQB 1OM3H 1OP4A 2A9AA 1DR9A 1UKQA 1XH3A 3BGFB 4PRPE 3QJSB 5C09A 3SKUD 3VJ6A 5BO0D 3MTRA 2XJKA 1GGTA 4NNYB 4PIRF 4NPYA 2YK1H 5TQ0L 3WS3B 3WTUA 3CSPA 4HC1A 4PHZA 4N4YB 5D93C 1ZT1A 2H45A 1GW0A 1KN4L 4K3DL 5JNYB 4N0UE 4X5PA 1IU1A 2EAEA 1A8JH 5BRZA 2VZVA 5E8OB 2NZ9D 1J5IA 2DLTA 5FS5A 4Y1AB 2XUWA 1P4LB 4HIXL 2XPGA 2DEYX 3TBVA 1RULH 1AFVH 3WGUB 4K94H 3D07A 1LDSA 4PJGA 3VI3B 3RI5K 3GSUA 3M1CA 3MVSA 1J0JA 1A1NB 3BXNB 1ZXKA 1WT5A 4XP6L 1B4TA 1GGBL 1NLDL 5IEKB 2L7UA 4L3FA 4DTGL 1JRHL 3CHSA 4H25B 4FHBD 4M5ZL 4J3OF 5CKAA 3FN9A 3LIZA 1CU4L 2OCJA 3P2TA 3CHXA 2EXYC 4HUXB 4TULH 2C7UB 4XMLH 4I3SL 4QHMA 2X2HA 4K8RL 3X12A 1X4XA 1PQZB 2B20A 5AW0B 1T7WA 3BKML 3RZCA 1OF2B 4LARH 5D4QA 5IEHA 3GTTA 4Q9QL 1XD0A 5DVOA 3WKNA 2VJ8A 4N24A 3O0LA 1YA5A 4XPFH 2IDCA 4LRNL 2GUYA 5DT1L 3BDBA 5F1IB 1YYLH 4RDQG 5CF3A 3NN8B 5C9JB 4X0KA 3CLEL 4JZJA 2CO6B 3V95A 5A16A 4UAHA 5C6PB 2Z1KA 3O3BB 4XX1G 4TVSa 3WTSA 2J4WH 4R97C 3GGWB 5HDRA 2AV7B 4H2AA 1TNNA 3QXWA 5DMIL 5IBTH 2YQ3A 2PP8A 4QRSA 1OTUD 4GKZA 4L9LC 5IROD 2G2PA 4NRXA 2R27A 1JZFA 3KCWA 1WA2X 4KK8C 3RFRA 2V2WB 3JWNC 4AGQA 4XXCC 1J05B 3BWAA 4L0PB 4KZEL 3GJEB 3T2QA 3ZN6A 3BUBA 4G80A 1TEGA 1MFAH 5E8NB 4MXQC 1GYUA 1M9SA 4NN5B 4I9WE 3VMNA 2I24N 4DF9A 3I9IA 5F7MC 1MFCH 3VXTB 1S7QA 3GK8H 3DURB 4WSGA 2NY1C 43C9B 2H2PC 3SSGA 4AQZA 1JZ3A 4YE4L 1BX2B 4YHIB 3T8XA 3EYSL 4O51A 3KL5A 4TUOB 3WTWA 1RZFH 2LFGA 3IDXL 1VKXB 4WUUA 3ILPB 1QVOA 2F7PA 4R4ND 5SWZA 3VGBA 1LYQA 2APBA 3OAUH 4G6KH 4JFQB 4NWTL 4X6DB 4X4KA 3ALPA 4GI8A 1DSFL 5HXMA 1JPTH 1QRNA 1I7RB 3O4LA 3OLEA 5F9OL 5HHVL 1UUSA 1EHLH 1RPQA 1FBIL 4ZFOA 5K69A 1QUNA 2EABA 3D09A 4PV8A 3TF7C 2Z8SA 1FZJA 5I19L 1FO0A 2AEWA 4P5TD 3HFFA 1EBPA 4QHUA 1JGEA 3GMLB 5I73C 2C3HA 3VG9C 3EBIA 2X0WA 3POHA 3VFSA 2DQTL 1A3LL 4GG8A 1ETA1 2PXYA 3GSWB 3KW8A 3ARRA 3QWNA 1QLFA 5IQMA 1IAIL 3QA3A 3ZKQD 3A6OA 3N1MC 3QCTL 4Y4KB 5BZWB 4NGHL 2BY3A 4N8VA 4BK5C 4UTAA 3K4AA 4QDGA 3LRSB 4PJFF 1OD7A 4PBXA 1A7QL 1T7VA 5I8EA 2J8UF 4NKDB 1HTYA 3K4DA 3M46A 3OL2A 5E8DH 3Q9QA 2VSMB 4LDOB 3SY0B 4W9DC 5D2LB 5EUOE 1CGUA 5EU7E 4P5KA 2LLNA 4ZFQA 1QZNA 3FUMA 2AABH 4UBDD 4I2XB 3GO1H 3H42H 4ODVL 2JE8A 3ABKB 5DS8B 1CK0H 3ARFD 3CH1A 1HHHA 4RETB 4PTTA 5B7MA 4UDTA 3QJOA 3HFMH 2F2HA 3KWTA 4UILH 3SDCC 4M6NH 1CYGA 3I2CH 4U4BA 2VDQH 3ILEA 5MI0C 4JDEA 3N42B 1WK0A 4Z0XA 1QO3B 3RDJA 3DVFA 4LLWB 3S37H 2LAAA 2CMRL 1OAXH 1KIQA 1AG6A 2MQ0A 3FRUB 4Z78B 4RGOL 5KW9H 1H3PL 4S1SL 4U1SB 5EMYA 2ZX5A 3FTGB 4HLJA 1S46A 3NSXA 3SJVD 3VU1A 4QOKB 3EH1A 4R5TA 4PW3A 4JM4L 4L0ZA 4F7MA 4YZFF 3UC2A 4MNHA 4S2SA 5INDA 3QXDB 3OZLA 1KBWA 2FEDD 5E6UB 3WELA 2G9HA 3UGXA 3NFNA 5KSBB 1S7XA 2DTMH 2JMRA 4D3CH 5E94B 2YUZA 2I60L 1AXTL 4PJIF 5KVGL 2KLSA 1RHHA 1WZ1H 1JVOA 2R23A 5DK0B 5FYKU 3SDCA 3VO0A 1DVFB 1Q0EA 4LBEB 4U31A 3BFOA 3C6LC 2EKSB 4PB0H 3D34A 4N90E 4HX1B 2Y07H 5KZCB 3CG8A 1EAJA 1XTLA 3GB7A 3QB7C 2Y7QA 4BE6A 5SWQB 4DGIH 1M7DB 3WJLC 3STLA 3V5HB 1NMCC 5C08A 3QXAB 2IH8A 4HQQH 1TLKA 5I1CL 1MVYA 2H1PH 3FONB 2I27N 1IB5A 2ITEA 3LS4L 5EDXA 4DGVH 4KZDH 1T5KA 4YHZH 5KN5B 3DSFH 3KCPA 3QYCA 3UZQB 1N64H 5IW6A 1AXIB 4O02H 2I25N 5KS9E 3IU3B 1PIGA 4HDIB 3UTTB 1MZYA 3TCXA 3OWRA 1ZWIA 1F45A 4MDJA 5AZ2H 4NO3B 4QHNA 3NIDB 4KRPC 2VCOA 4IGBD 1TUPA 3N9GH 2BSRA 2WQXA 3C6LA 1NEUA 3MNDA 3IN0A 2RCSH 4V1DD 3HW7A 3UTPD 4A04A 2Z93A 2VL5B 5DZPA 1DJSA 2VLLB 3F7LA 2BFVL 3U7WH 2D9CA 3MOBH 4P2QD 1UKSA 3WBDA 1ZTMA 2W60B 2I32A 4X80H 1NC2B 1S9VB 1GR7A 4PRPD 1IM9D 4K0OA 4APQD 4XN9A 2DWXA 3HLKA 2ADFL 3JBG7 1KIUB 5DO2C 2OJZH 2X4SA 4MA7L 3TIEB 4G8IA 1IFGA 5ISZA 4B5ZA 3S35L 3W2DL 1MLBA 4KMTH 4OIIL 5FO8A 4YDNA 1RZ7L 5FA4A 3O6LH 1DJWA 4F57L 3OM3B 4O58H 4ZTPL 4YS4A 1YYMH 4WSKA 3UBFA 3H9HB 1U8CB 2PR9A 3A3YB 2N7BA 2Y7OA 2KKQA 1EBAA 4ODXA 4O4YH 4JGMA 2X7LB 1IC4L 2YGVA 4R0LB 3RWGA 4KVNH 1GC1C 4G6ML 1Z9OA 4G1MB 2Q7YB 5B4MC 4HHAB 1EHXA 2H0PA 3FO1B 2A0LD 1OCWH 3DO4A 4DWHA 2ZWNA 1Y7VA 4CVXA 4OQTH 5EU3A 4JJOA 1DN0B 2DJMA 4XXWC 3V4PL 4MD5B 4WV1A 1RUQL 4S11A 4MQ7A 4WW2C 4RMQA 2O6DA 3AT8A 1S7WB 1OAUH 3MCLH 3IDYB 5DHVH 2Z1PA 4N20A 5CGYC 5ADOL 1ORSB 3MGOB 4NHCL 2JELH 4WI8A 3GXMA 5A43C 3V9CA 4ENED 2EDEA 3I9PA 2XG5B 3RTLA 1JMXA 1Q72L 5JA9A 3A5VA 4GO9A 4X6BA 4AEFA 3QNZA 3IDMB 3II1A 4N0RA 4U1HA 2XZAL 2CLZB 1CDUA 3RJQB 2OK0H 2BMKA 3VAEA 3AUVA 2ZOOA 3HB3B 3LN4A 3QUXC 4H8WL 2IPKB 4NZFA 5IHUH 4J3OG 4Y1SA 5FO7B 3GLZA 2P5WE 4FNLH 5G4OA 4QCIA 5LG1A 4PJXE 5CZVL 4WW2A 4ZAKA 3QQXA 4RMRA 4ECNA 3H3BC 4H1LH 1E5AA 2R2BB 2F74B 1FI8C 1S7SA 4H0GA 4MQXC 3PGFH 4ZYKA 1PMYA 4C4KT 3KXFB 1NGXB 3M1OA 4WZ9A 4BCXA 1IEAA 1RZGA 4IMKA 3WFCH 5TD4A 2WOYA 4BQCA 4Z77B 4GRWH 4CNIB 5EFIB 4ODUA 3LQAC 3WSQH 4DEPB 4RBPK 5D5MA 3BP4B 4NP4L 4E9QA 3FU9A 3GFUA 3QEUA 1MCRA 1YSOA 3DUUA 3P3SA 5KANI 1IAKA 5AFAA 1OANA 3PL6D 4OZGE 5IBUG 1QSFB 3QJUB 2X2IA 4YNYB 3TT3L 4FTVD 5SWZD 2C3VB 4I9WD 4PGZA 3QDGE 4K3JH 3D2UD 1KTDA 1RK0A 2VERA 4QHKJ 1H6TA 3EOBA 3J2PA 5GRWA 5HHXH 1KFGA 3BPCA 3NCFB 3PHSA 3T8MA 1UA6L 2YMOA 4AVJA 3LXUX 4PJ5D 5DU7A 4FFYL 3ZDZB 4IBZA 4DN3L 2VABB 3IAQA 2QMJA 2BS8A 2MSPA 4KK6C 4XBGA 3MSPA 4JPWL 4NZDA 3QH3A 2CRYA 4H8HA 4N9GA 2A73A 1AHKA 4UB0H 1AIFB 4HIIB 5IFAL 5GS3A 3KJ4B 3MV7B 2EIZB 1YEIL 4UNUA 3HAEG 2YAEA 5J1AB 1GTNA 3G3LA 3DX3A 3LDBC 4ZSOE 5JOFB 1Q1JL 2FLMA 4WGVB 1BPVA 3NGBC 1ZE3H 4DVBB 1WAPA 3M1BB 5F96L 4C4KO 3UTQA 1JZ5A 1AXSA 2JH2A 1CR9L 2XFXB 3ILQC 3VE0A 4BK4A 1I7TA 2WVUA 1G87A 3I3EA 3P4NA 5C0DA 1YN6B 3OKLA 2WTPA 2YPLB 3T04D 4OGYH 5ABAA 3U1PA 1DHKA 2CPUA 4ODSH 4GRLA 1HINL 3APDA 1A7RL 1L9OA 2NY2C 3FTSA 2JIXB 1S9WA 2IDFA 4L37A 3RWDA 3WAJA 5HI4D 2ZKXA 1ZGLA 3VGAB 2KZWA 3AM8C 5BZXA 3SO5A 5GS1C 5C07B 1HYSC 3W37A 1IEBB 4MXWH 1CLVA 1AMYA 3TT1H 1UWYA 3WY4A 4LGPB 4L8SC 1E27A 3EF7A 2JLPA 2GJ6B 1CD1A 5C0BE 5F6IB 3RFZB 5BO1H 3EO9L 4PVNA 4BH8B 4RX4A 5E8PB 5JIDA 4Z3TA 1XAUA 3AG1B 3K1DA 4FL4C 2O5ZH 4LSQL 1KBVA 4F58H 2XN9A 2OR9H 2CIIA 3OHXC 4OCRH 1MWAB 3EYQC 2MFNA 1DBBH 3U0PA 3NJGA 4J6RH 2EIKB 3L3OA 1Z9SB 4XMWA 3AM8A 1VHPA 5C08D 5EORH 1OP3H 4A6YH 1AD0A 5AKRA 1OARH 2OMTB 3EBAA 4Y0GA 3KNBB 3MRDB 1WHOA 5FW8A 3FN0H 4MD4A 1RP8A 4N90D 5DJYB 3P2BA 3SKMA 3EFDH 2B1AH 4G6FB 4XN5A 1FNEB 4M48H 4HIEB 1QSEE 3WEOA 4U0RB 3WDHA 1ID2A 3DX7A 3CFMA 4M61A 2EVHA 4I3GA 4E41A 3CFDA 4OF8A 3TPUA 1KYUA 1D9KD 4R84A 5F72S 4UTBH 3VA2C 4R2GB 1BFTA 1NAMA 1SLVA 3BD4A 4JY5L 3QORB 4L8BA 3MBEC 1BQSA 4QEGA 1QFUH 1WFIA 3S97C 3L4VA 1OW0C 2EE3A 3RURA 5J56B 1T4KB 4F7KA 2YD3A 2M8XA 5HHMB 4XMLL 4PVMA 1JSYA 1PLCA 3TV3L 2JCCE 4BSVA 5DRXA 4WFEE 3QRFM 1GZPA 3QHZH 1BBDH 2GTZB 4LARL 2NR6A 2Q9OA 3LKQA 2VDKH 5AL0A 2DQFB 3O8XB 4N26A 3SBWA 2MTAA 7PCYA 1NCAH 1X5YA 4XPFL 5SV4A 4LOUC 1IILE 1DQIA 1N9PA 2XVGA 4A2MA 4QUOA 2ATPB 3MBEA 1OZUA 4AVKA 2DDQH 3P9WB 2VZ1A 3HAEB 3KYNA 2NY4B 5H94B 5JIHA 2GAZB 2WLZA 4IBVA 4OCYH 1HL4A 2J4WL 4M43H 3C6EA 3FB7A 2F18A 1AZUA 4DFHA 1WFNA 5IBTL 5EBLA 4U1IA 3TA3A 4L3EE 1CXLA 4CDGC 2KUTA 4B96A 4K3EH 4JHAL 1RUPH 4IJTA 4OLVL 5DJ8A 3UDWC 1EUUA 1RZKL 2JV6A 4D2NA 1MF2H 1RCYA 1VFBA 4PJ7E 4ZMOA 3V0DA 5I24A 5J6GB 3MRPA 4ZUWA 3O3UN 2Z65C 4JFYB 4F7CA 2FGZA 5I6XB 3H6AA 2VM9A 3D9AH 1MFAL 1CDYA 1IC7H 3AC0A 2FR4B 2P24B 2Z91A 4OH2A 4X8GA 4UT9A 5ICXB 2MOGA 4BQ6A 3UAJC 1JZHA 4DO5A 3DROA 1MFCL 1QA9A 1VFUA 3N1PC 3X1EA 2OFQA 3GK8L 3JV4A 3ZX1A 2YEZA 2VR8A 4OLWL 5LBSH 2ZNXA 3UDWA 2H32H 1DFBH 4RVBA 3IMRA 3Q8FA 4XHQA 3BP7A 4GKOA 4MZIA 1YPZB 3OAUL 4G6KL 1THAA 3QUYD 5JPMC 2HT3D 1Z5LB 3B7RL 1EHLL 2AJYH 4ANVA 5F9JB 4HCGA 4QRPA 1SUJA 4YBLC 1AR1B 1OEZW 2YUWA 2FK9A 2F7QA 4MMZB 3O45A 3LH8A 4Y5VC 1KLUB 3W9EA 4N2KA 4KNQA 2BOCA 4MA1B 1YRKA 1RIVH 1VRSA 1N6QH 3EFOB 4F7PB 1XQ4A 2BIHA 1A7PL 1EMTH 1NSNL 4M6OL 2BSTA 5D7JB 4YC2B 1LP9A 1MUJB 4Y19B 5E8DL 4EE2A 2X70A 3BIKB 3QDGD 2GFBB 1T66D 2CCVA 4EN3D 3ARDC 2F54E 4LE8A 5E03A 3UPRB 3MV8A 4P5MA 4F2FA 1SVCP 3H3PL 4KHTL 5B1JA 3T6WA 5IMOA 4YGVB 2YZ1A 4R90H 4NZRL 3HZKB 1OAKH 2W65B 1B2YA 5T3XE 3HPLA 3VXUA 2LAGB 1GYCA 4KJYB 2IBZX 4L4JA 3B9KC 1J8HB 3HFML 2IV9A 3QIBC 4UILL 3RL1A 2UUDH 3DSNA 1BAFH 1KXHA 3KPMB 1UQSA 5KJRH 2FJGA 1JPST 3U46B 3I2CL 1T0MA 2VDQL 4MJ6A 1DQQA 2CDEA 4FFWD 5HPMA 1ZLWK 1UJ3B 1JK8A 3CBJB 2UY7A 2UX7A 4L4VB 3X14A 3LS5L 3JWOL 1O7DE 4OZGF 4W9IC 4KPHH 3QXUA 2VDPB 4ICWA 4KNTA 3BN9D 3FT9A 3HC0B 4TUUA 4Z7QB 1G7HA 3SE8L 5JIPA 3L5WA 4ABWA 1USZA 4KKCC 1R0AL 1PAMA 4IBYA 4JHVA 3RVVC 3ARBA 5C0EB 2QHLA 1OP9A 4Q8BA 2OM5A 1ACYL 1JUFA 4LVNB 3RWHB 4YDMA 4NPJA 5AKVA 4D3CL 4TLTA 1DCEA 4YFLI 3SEPA 1AY1L 2R1XA 1E67A 3B9KA 3RPKA 5KYXB 2UYLB 1KGUA 3EYFB 3BT2L 5EU6B 3NJIA 5DJ6B 4AYBA 5I30H 2X2JA 1L4IA 1HCYA 5LKNA 1EVTC 2Y07L 2ZUUA 5E6IB 4DGIL 1UWGL 2BS9A 3I75B 3VXSE 1I9JL 2JKJA 1NGZB 4I85A 1YMME 1ZVSA 2G2RA 4B7IA 5I0DA 3GHBL 2WZPD 4KVCH 1PLGL 4HKXA 3DSFL 1NOAA 3AXIA 3RGVA 1M42A 1V10A 3BQVA 4Q89A 1XH3B 4FLRA 3VJ6B 5C09B 3QAQA 3NEXA 2KQNA 4NPYB 4F2ME 1U58B 3BZ5A 2A6JA 3OHMB 1JXDA 1ZT1B 1HK6A 3LRMA 5IQ9A 2BP8A 1TPXB 4AW4A 3N9GL 1BAWA 4I0KA 4PBVC 2RCSL 4YSQA 5BRZB 5EF2A 1B3JA 4PPTA 3U7WL 3MOBL 4PLJD 1BLNA 1TJMA 2H1XA 3L5XL 4X5WA 4JO3H 3SE3C 3ELAT 4X80L 1VFOA 2VDMB 5KSAC 2EDFA 3ATFA 4MFHA 2XPGB 3TBVB 5KJ7E 5E4AA 5K59F 2YGNA 1OOAA 4GI9A 2OJZL 4JRFA 4PJGB 5E6SB 3GSUB 4NQDD 1J5OH 4KMTL 4BFNA 3IMSA 1M7UA 1R5IA 4DVRL 1RURH 4KJQC 3I02A 3VWKC 4Y5XA 5D7IA 3MU3A 4EUPH 5LDSA 1X6NA 3RUGF 1QSED 1PSKH 4HJIA 5KBNC 1INEL 3ZIMA 2H8PA 32C2A 1X5FA 4OR1A 2W95A 3P4LA 4KQ4H 4O4YL 1BOGA 4QHMB 4UTCA 3FMGH 5HJDA 3X12B 3DVGA 4GIOA 4HWEH 3RZCB 1MJJA 2WWOA 4XN1A 1OCWL 3MRFA 4M6AA 4W4OA 3A0OA 4YHKH 2PYED 2QVIA 3QFJE 3MRCA 3U4BL 1TZHA 1O0VA 4WSJA 3KLDA 3QJTB 3S2AA 3CFQA 3MCLL 1RQ5A 4J4PD 3VWKA 4HS6A 4X0KB 3OJ2C 4JZJB 5C0FA 2RTTA 2JELL 5A16B 4D0DA 4PRNA 1LO4H 4WFED 5BMFL 3GTNA 4I4WA 2AQQA 3GSNA 4GNKB 2J57A 4QRSB 1PJWA 4GKZB 3U9PH 4OD2A 4CMMA 1MVFA 4NRXB 3ULUH 1X9UA 2LU3A 4GH7B 3TBBA 3ZRFC 5DSCA 3BAIA 3S36X 2BJML 3N0AA 4GRWF 3QC5X 3EH3B 2EDTA 4OZIF 3BWAB 5TK4A 4U1MA 5E2WH 5A2AA 2ICES 3SE9H 2K45A 4G80B 4MJIA 1BFSA 3DWTA 4P2YA 5IHLB 3OXRA 1SOXA 5I6NA 3NSCA 4L3ED 5E8EB 3SDXF 2PCXA 3RVWD 4OLUH 4QRFA 4PGDA 1S7QB 4MAZA 5SX5K 4L9LB 4NC2B 3WSQL 3T8XB 4O51B 5I71C 1JF1A 4MMYA 2IQAA 4WCYH 2X1QA 3MV9A 4WUUB 3T0EC 1QVOB 2HLFD 1I8LA 5FDWA 1NEZA 1QRNB 3KLSA 2IOOA 2VLME 2FX9H 3O4LB 4OLYH 4FJYA 3CFJA 3UXFA 4ZFOB 5IQ7H 1QUNB 3BKYL 4QRRE 1C5BL 3FU3A 5T8IA 3SDAA 1RSYA 3ATEA 3CZJA 3DV4A 3ASNB 3PWJA 1FZJB 1AGFB 3O6FC 1FO0B 2GG1A 4GS7B 5FK9A 5HHXL 4LAQH 3UTZA 1RMFH 4QHUB 3INUH 1JGEB 5FAAA 3LKNA 1VGEH 3VFSB 4FERA 4GG8B 2PXYB 1QLFB 3LKPA 3H54A 1NINA 2VLJA 2CCLA 3QA3B 2AJVH 1BZQK 4N8VB 5AG9A 3HEIB 3EG9A 4ABQA 1WE5A 3CVIL 4G5ZH 2NUTA 5I8EB 2AXGA 4OSUL 1SVZA 4UB0L 4JMXA 1A9BA 1F6AA 4XN4A 4XVUD 3R4RA 5J06A 4P5KB 1HE8A 3CD4A 1UD8A 3G9AB 4F3FA 2I9TA 2NZIA 2H0JA 3O6FA 2UVEA 3DNKA 1PLAA 2WIMA 1MHEA 4WI7A 5I73B 4K8RC 3EYUH 1PU0A 3CH1B 3UO8B 1HHHB 1J1OL 2AEPH 1DBML 4PTTB 4R4FH 1CFTA 4YEEA 4XR8C 4DOHE 4UDTB 1GCFA 2NW2A 1FC2D 3MZGB 3UTOA 4LSSH 2XHNA 4JDEB 4Z0XB 2CIKB 2EP6A 2F54D 5TDPA 2Z7WA 1KIQB 4G7SB 4OZFA 4GAJL 5L88L 1MXDA 3QQ9C 2OJEA 4YXKH 4ODSL 1VGKA 2G9KA 2V5TA 1WUZA 1ML0A 2NZ9C 3JSSA 2H5UA 4NKMA 4F7MB 4MNHB 3TBYA 5INDB 1KGWA 3VXMA 2G9HB 3F04A 4KO9A 4M5SA 5K9JH 5GSRA 1S7XB 1XF4A 2P7TA 3VFOA 4MXWL 2M2DA 4YXLH 4ANUA 1RHHB 1DO5A 2R23B 2D3NA 3SDCB 4PY7B 3ECVA 3NCYP 2D8KA 1PZAA 5BO1L 5IF0A 3B2UC 4P4RA 5MI0B 3W0WA 3GM0A 2MNJB 3T6ZA 3T08A 2HKFH 3GB7B 5FCUH 5LWYH 2Y7QB 1SXNA 5G55A 1JAEA 4FXKC 2YD1A 1FUNA 1XGYH 2Y1YA 3STLB 3WXVL 2VDNB 4OCRL 4LSPL 2RFXA 5AW4B 1LK3H 3HRZA 2GPZA 4GG6E 5JZ7D 2BVQA 1LEGA 1MI5A 3KCPB 5IW6B 5A2CA 1YO4A 2CA4A 5EORL 3ML9A 4A6YL 1UT1A 1QASA 4JCMA 3VQ1C 2A1WH 1ZWIB 3RNKA 4MDJB 3FN0L 4QHNB 5GS0L 1GGCH 3EFDL 2B1AL 5FUOH 3HG0A 2YFOA 2BSRB 4M02A 2KHAA 3C6LB 3HN3A 5TF1L 2Q6WA 2DBLL 3GF8A 3ZMEA 2Z93B 3FSVA 1ECYA 3KYAA 4BE5A 4TSAH 5JHDA 1QX1A 3D12B 4LCCA 3WKMH 5JXAH 4FFVD 4IRJA 4KITB 2GSIA 1FIEA 2AK1L 4YSAA 4N3UA 4UTBL 5T3XL 1T3FA 2LE9A 3TWCL 1OTUC 2PWDA 2Z3FA 2X4SB 3NJMA 3S5LG 4G8IB 5ISZB 2M26A 4UT7L 3EXJA 1MLBB 1F3DH 1QFUL 4GLRI 4MMXC 5FO8B 1T0OA 5DQ9A 1ROCA 2DEWX 1XF5A 6TAAA 2RALA 1ZIBA 4ZS7H 3PWNA 4O2EA 1Z9NA 1HEZA 1S7RA 3FPYA 4FADA 3II2A 4UIMA 3KPSD 3BN3B 2OTUA 2RIKA 5D71H 4ODXB 4MRBA 4G9FB 4NJAH 4P46A 1YEWA 5HYQA 1F90H 2NQ3A 2VDKL 4WI3A 3RWGB 5I75C 2CHNA 4M29A 2AI0L 1NCNA 5I8KH 1NCAL 3S4SA 4JPIA 5LXGH 4EI5D 2F8VA 5HDBE 4MSWA 4CVXB 3GT6A 3QXVA 4I48A 5EU3B 5PCYA 3V0HA 1U8IA 5CN3A 2A4CA 4HJUA 4YPGA 2W5PA 2DKSA 4WV1B 4Z7WA 2Y7LA 4MQ7B 3I9GH 4R4NC 2XWTA 5BZDA 2OMXB 2DQMA 4ZW5A 5FKPA 2X4QA 1SHXA 3GRWA 2FT7A 1T1XA 3FCUB 3OKDA 3K81A 2NRDA 2XNAA 2YA1A 5I0ZA 1RUPL 4X6BB 3TZVD 3IJHA 2FO4A 3QNZB 4U1HB 4FNSA 2AQ3A 3B9AA 1MF2L 3QFGA 4P5TC 2O26U 1FFPA 2BMKB 4K5LA 5D7IF 4XCEA 3LN4B 2GJJA 3JTTA 2MPAL 3QZNA 1BZOA 3D9AL 4QCIB 5FUCE 2GK2A 3N85H 4MCYA 4WW2B 4ZAKB 1X5IA 2VC2B 3BP5A 3ARTA 3MA9H 4KKRA 7TAAA 5F7UA 3BAWA 5TE7H 4RAUA 5F7WC 3ZY7A 2HN7A 1S7SB 3OR7A 4KO7A 3WEAA 1SBBA 5JYMA 4PRIE 1JZ7A 4ZYKB 3VD7A 4FQHB 1YEHH 2MEJB 3FUDA 5LBSL 3Q1EA 1J87A 1IEAB 1RZGB 4H20L 1DFBL 1IKFH 4WWID 1NH6A 5E24E 4M7LL 2EUZA 4ODUB 1N6UA 4JRYA 4NXSA 4M5YH 1DSYA 3UX9B 3MTXA 5D5MB 3ARFC 3F7KA 3L4CA 2AJSH 2G4EA 3QARA 3QEUB 4NQTA 1EGJA 2AJYL 2F08A 3DUUB 4U1LA 4DZ8A 1IAKB 5IESH 1ACCA 1KJMA 4MCMA 5HVHB 4QHPA 3B4NA 4Y7OC 3BIAX 4HJEA 2Q7AA 3FO0L 4AEEA 2ZXQA 3D30A 2XPZA 5BQDA 1KTDB 4TNWF 3MLZH 4AYEC 4D8PA 1RK0B 1XIWD 4EAEA 1AJ7H 3EOBB 3EZ8A 1F1GA 3AREC 2WYHA 3BPCB 1E7UA 1RIVL 2BNQE 3B3IA 4XT1C 1N6QL 2R0KH 5CJQH 2B8OT 3CDGA 5LQBH 1D7DA 4PR5A 3KPRE 4CSZA 3LNHA 3W56A 1UOVA 5EC2A 5IVXA 1BXUA 3CSFA 3MLVH 3QH3B 3FAWA 2G30A 2IEPA 4N9GB 2A73B 3PJSA 3GJFH 2N1TE 2MKWA 3OAWA 3HTLX 5DJ0A 4ZJ9A 2BSSA 2BVTA 4JN2A 2QFPA 2QGDA 4R90L 5A1AA 3AREA 1ADQL 5J13C 1G7QA 4GUCA 4RMBA 4LSDA 3GHEH 4LP5A 5LNDA 4PRDA 3H2QA 1NBQA 4LAJH 4NQXA 4JM2D 3FB8A 2APXA 4R7XA 4PJ8D 2OYPA 1BAFL 3QFDA 1V27A 2LVEA 5EBGA 4AL8L 3JYBA 4PGEA 1QFWL 4LLUA 4JFPA 3KS0H 4NQQA 3UTQB 2XKSA 1Q38A 1AXSB 2WKLA 3HG1E 4R3SA 3VE0B 4BD4A 1ODUA 1I7TB 4KPHL 5FO9A 3GBNL 3P4NB 4DZBA 5C0DB 4LESA 4IGBC 1U4EA 3EYVA 3OKLB 4CN6A 1OGPA 4EPSA 2CM5A 3ZQ9A 3KWWA 2DQHH 4GRLB 5EU5A 3QI9C 4IBTA 2QFRA 2AQ1A 3DHPA 1IM3D 1E5ZA 1S9WB 4L37B 5DHMC 5H8DA 3RWDB 1INDL 3LH2H 1ZGLB 2EUWA 5AZEH 3UP1A 2XWBB 1U8HA 1I1YA 4APQC 3PYCA 3Q6GH 1Y6MR 4N8CH 3L5HA 3VXNA 3NGBB 2A74C 3PGDA 4LMQE 4H8WC 3V8CA 3DX9A 3OR6B 2AEIT 4JM2F 3MJGX 5KOVC 3ZTEA 5F0JB 3V4PA 4K55A 1E27B 1NBVH 2FEEL 1CD1B 3EO0A 2LFEA 4XP5H 1PKQA 2NTFA 4HGKC 1ZVHA 4OM0L 3CZGA 4ZFFA 1C1EH 2XN9B 1WEJL 2WLMA 4KVCL 3FBQA 4WUKL 2CIIB 2CGRH 5CR1A 5GGRA 2OV0A 1ZVYA 3QI9A 1VLXA 5CCKL 3FKUS 5F1NA 3DDFA 3FSZA 4JG9A 3U0PB 1NPUA 4HXAH 3CIAA 3AQXA 3L3OB 5LGYA 5EZPA 2PPAA 1VERA 5H4YA 4A7GA 1NOFA 1G84A 1AD0B 3MMEA 3VFNA 2A0LC 1WH0A 3VRLE 1A3ZA 1W0VA 4MD4B 1UD5A 3EJCA 1HC1A 1HDMA 3SKMB 4L8SB 4EEEA 1T7XA 4JDTH 5EN2A 1PS3A 3BLBA 4YSEA 1E5CA 1BIHA 3P02A 1DVQA 4JHWL 3V0FA 3DX7B 4Y2DA 2OCCB 2AQTA 3ULUD 1N8OE 1MCBA 4M61B 1SHMA 3OJVC 3P11L 4E41B 3CFDB 4ENEC 4HS3A 1ZEAL 3AWGA 1YAZA 4LP8A 4W9ZA 2K78A 4IBWA 2P8PA 2WXJA 1J5OL 3RTQA 2WZ6A 4ZQTA 2I7SA 4TNFA 3ZYJA 5JHDD 3NDZE 1NAMB 3WN5A 2J20A 4L8BB 5DYFA 2ZIDA 3VFMA 4J2XA 1RK1A 5KYWA 1KJ2H 2OMNA 3MRGA 1XF2A 2VIRA 2QKIA 1HU8A 4BSVB 5C8JA 3VFWA 5DRXB 5H35A 3FMGL 2WXMA 3LX9A 5LUMA 3UBXA 1GZPB 4HWEL 3GDCA 4BZ2H 2X4OA 3APFA 1JGLH 2V9RA 3LKQB 5CXPA 4YSDA 1OTTD 1QQDA 4JKPH 4Z7VE 4YHKL 3T3PE 3ULUF 1WWCA 3CXHJ 3E3QE 25C8H 4G6JH 4DEWA 4Q4EA 3T2LA 4FFYA 5ABDE 3CK0H 4GT7A 3MV11 2EDYA 1ZA3A 2P43B 3MBEB 2ZXGA 3KYNB 4QTFA 3D3VA 5DLML 1MHHA 2DM7A 1G94A 3FB7B 4IOSD 3PL6C 4BEIA 4XAWH 1HOEA 4X5QA 2Y3NA 1QLEH 5EBLB 1FLRH 4GP5B 4U1IB 5TQ2H 3TA3B 3BEVA 3V7AE 1JHKH 3ECBA 1S9YA 4I77H 2NNCA 5DJ8B 5T1KD 5EULV 2ICWJ 5DVLA 5H37H 4R9HA 5ELIA 5D1ZI 3T3ME 1DCLA 4I18A 1VFBB 1DEDA 4AVIA 1GOGA 2HVJA 3MRPB 4MB1A 4ZUWB 1PD6A 1DVSA 2VH5H 5E2WL 4HOWA 5EO9A 5DRZA 4D0BB 4F7CB 3CDYA 1HZHL 4P3DB 4X4MA 2Z91B 4M7JH 4JKLA 5B3NA 4P23D 1R24A 3KPOA 3ROOA 3GS7A 3DROB 1CFNA 3M45A 1QA9B 1W0WA 4YK4C 2AMGA 3PAYA 5FLVA 1KGXA 3JV4B 2YEZB 1FG2A 4NQCE 5GGUA 3FU7A 1CD9B 4PD4J 4Z7WF 1KOAA 1XGQA 2H9GB 3QNFA 5A6IA 1IUZA 3T4AA 1G9MH 4JB9L 3KPTA 3BP7B 1YQVH 1FWXA 2A5UA 5I1KH 1XXFC 1TO5A 3OKEA 3BZDA 2DRUA 1INQA 1VEMA 1KYOK 3HBPA 1AS6A 2FAUA 2FX9L 3G6DL 4OLYL 1AGDA 4LSTH 4QRPB 2MCG1 1E5YA 3ZDWA 1L9PA 5C0AE 1ZLSH 3LN5A 1QTPA 3LNEA 5I17A 2A3TA 4AQ8A 4N6RA 2BWDA 3O45B 5BPPA 5I1DA 3NUKA 1RMFL 1DL7H 1WICA 2VXTH 3INUL 5EU7C 3W9EB 3IMTA 4GP4B 3NEOA 1EHAA 4MYPA 1EDQA 1TQUA 2BOCB 2IAAC 2P5EE 1SVBA 1MW3A 2OULB 1AQMA 4K94C 2XA3A 1JF6A 5HI4C 2Y6SD 1QD0A 2BSTB 3S2CA 5KBPA 1DSWA 1LP9B 4XVJH 1D6VH 4XI5D 4K3HA 3AS0A 2HTKD 2X70B 2XTJE 1OSZA 1H3UA 3PDOA 1HESA 3BSHA 2FO8A 4NRZA 1E8ZA 3VGEA 1O6TA 2ZICA 2OW6A 2C26A 3MV8B 4P5MB 5EUOA 5B1AB 3UCRA 2CRMA 4ZRGA 5IR1A 5IMOB 4HYTB 3OKMA 1FFTB 2DEXX 3KPRD 4QTHA 2AEPL 4IRSD 3DHJA 4IW4C 4OD3H 3HPLB 3VXUB 2VSKB 1PYWA 3RL1B 1QABA 3X17A 3BPLC 3F12A 3DSNB 3FRPG 5HJ3A 2CXKA 4ZO7A 2C9VA 1UQSB 1EFXD 2FJGB 4HU2A 4GY4A 3RU8H 1T0MB 2J6WA 4MJ6B 1DQQB 2CDEB 5HPMB 1P84K 5EU4A 4LASH 1JK8B 5DI8A 2UY7B 3S96A 3X14B 2C4XA 3DYMA 4OI8A 3HR5A 3F6IA 2D3VA 5FKAA 5GRVL 4YXKL 1GY1A 3L13A 2MNWA 1G7HB 1PG7X 3L5WB 2EILB 1HHGA 1X5AA 4WQOA 4ZZFA 3ARBB 5IK3B 2EO1A 5F7KC 2NCEA 1U36A 1JUFB 1CLYH 2ICEC 3HE6D 1RH8A 2GT9A 1BHGA 3V6ZA 1P4IH 1ED3A 1RZKC 2CBPA 4YXLL 1FYTE 2R1XB 5AUMA 4PY8I 3B9KB 1NCTA 2DYPD 3WO3B 1BQLL 1HX0A 4KO6A 1WBXA 3HC2A 2VXVH 5D55A 5E9DA 2AZAA 4MJJA 5J57B 3CVHH 3JWDH 2WNGA 5CD5D 4JO8A 1Q9LA 4NBXB 1OM9A 5LWYL 2HKFL 5FCUL 3BZ4B 4AQEA 3BUDA 3DXAA 4P49A 1Z9LA 5AD0A 1XGYL 3N5AA 5E1GA 3LIUA 5CCGE 1ZPUA 5DD1L 1ZVSB 1FCCA 2G2RB 4FQIL 4GAGH 3F62A 5I18H 3F3HA 1MAKA 4BUHA 5C2UB 4KDTC 1R75A 4PJ9D 4WHYG 5DQDH 2CU9A 3RGVB 4JL2A 2F7OA 2V7NA 5A3IC 1CURA 3K5RA 1GGYA 2IQ9H 2XBDA 1BEYH 2A1WL 2DMHA 1LEKA 2NSMA 2A6JB 3F64A 5SX4H 3LOWA 3QIWC 2QDVA 3P0VH 4CGUB 5IQ9B 2BP8B 4HSAC 5KS9A 1GGCL 4HWNA 1D2OA 3T2NH 1A6WH 3V9EA 3DJSA 4GFXA 2CR6A 3KJ6H 5CU9A 3WS6C 3BJ91 1SY6L 3JTBA 4UNIA 1O9VA 2J44A 4Q9CA 4MZ3A 1MCHA 1T1WA 1BLNB 2CKBA 1M1XA 4KFZC 4TSAL 4X5WB 5DEGB 3WKML 4M7ZB 4TQEH 3KE0A 1FF5A 5HVWA 4D9QE 4BM7A 1J1XL 3BUIA 5HGHB 4YSUA 3EHBD 4NQED 3V0AC 1N68A 1LWHA 1R5IB 4OUUA 1CLOH 3BVDB 4N2HA 3QIWA 5KANG 1QBBA 1ES0A 4Y5XB 1NIFA 2UZXA 5D7IB 2B0SL 3T0BA 1E6OH 3UAFA 4NBYB 4W9GC 2C9PA 4PJEF 1MCIA 5CKGA 2H8PB 32C2B 3ZDXB 3QEQE 2P48B 1X5MA 1BOGB 1YNKL 2WBWB 4TS6A 1QFWI 4Y9FA 4A7GF 4DEUA 3DVGB 1F90L 1LDPH 4W4NA 1NMBH 1BMWA 5DK3A 4AUUA 2FGWH 1MJJB 5LXGL 2XYCA 3MRFB 4LSRH 1I75A 4DFIA 2K4AA 4FF9A 4P4KC 1GGUA 4X9GA 4EIGB 3MRCB 3WU1A 1TZHB 3T0DA 3LYRA 2AK4A 4N87A 3V5KA 15C8H 4YR6A 4G7RB 5EZIL 4GIPD 3H8NA 4YFLF 4Q97A 3VWKB 4HS6B 2QV4A 2X4RA 3ARGD 3QUYC 4DUWA 3IXAA 4D0DB 4PRNB 4AKPA 1C5CH 1GY2A 3TL5A 1NCOA 2X12A 3DX8A 4I4WB 4ANKA 1BVLA 3GSNB 1J8SA 4TNWK 4WGKA 3O2DH 3Q8CA 2XTSA 4MX7A 4OD2B 5D4IA 4CMMB 4PQXA 1A14L 3ZDYB 3D39E 5DSCB 3EDEA 1PLBA 1DUYA 5AAMA 4J27A 2C9UA 3DX6A 2DWDA 3QR2A 4TQIA 5I74C 5GZNA 4P4KA 4U1MB 2D0GA 3N85L 2NY5H 1OSYA 4XVSH 4AYID 1FAIL 2P5WA 2J5WA 4MJIB 3MA9L 4QXGH 4OJYA 4PJXA 1CIDA 5TE7L 3OXRB 5B22A 3CXDH 1B2WH 1OCRB 3ARYA 1AO7E 1T66C 1EEUA 5DC2A 1DBKH 3NZSA 4PGDB 2GBVA 3CC5B 4RFNC 5ALCL 2CK2A 3GMMA 4LNRA 2TRHA 1JF1B 3IETA 4MMYB 2IQAB 3MXWH 2BNRA 3MV9B 1J12A 4PCYA 4ELMB 2AJSL 3SYQA 2OXHA 1TETH 1Z66A 3B2XA 3F7YA 3RDTD 3RIAF 5IESL 3Q5OA 5DJ2A 4WKZA 5FDWB 1NEZB 2BPBA 5IJBC 1SHWA 3CFJB 3CX5J 4I1RA 1HQ4A 4E9TA 4FFWC 3H9SE 3MLZL 3SDAB 2IADA 2PW1A 1AJ7L 3DV4B 4UM8A 3PWJB 5FK9B 4I5BA 3UTZB 3LKNB 4X7SL 3CSBA 3GBMH 3FK3A 3BN9C 1EK3A 3HPJA 4W93A 5CJQL 1IBYA 1J0IA 1XCWA 2VW4A 5C7ZA 3SDDA 3LKPB 1I3GH 2VLJB 2FSDA 4FQ2H 2WQAA 3MLVL 1IGYA 4QD2E 1CCZA 2NUTB 3M07A 2AXGB 5F1KC 3J7HA 3S4SG 1IGMH 1EHKB 4C58B 4GSXA 1A9BB 3CFNA 1F6AB 2CGYA 1R17A 3IPEA 3QUGA 2FUTA 3K8LA 5BV7B 4U33A 4PEEA 4RIRA 3FQ4A 2F5BH 5ITBH 3QZMA 4TPRL 3O6FB 4F3FB 5MENE 4PB9H 2I9TB 2WBJC 2O6CA 3O11A 5ES4B 3GHEL 1MHEB 2YRPA 4WLCA 1HKLL 2BIQA 5KAQF 1FFNA 1Z5HA 2RMNA 3COOA 4Y89A 5AALA 2ZKYA 2EDLA 1CFTB 2ZAGA 1ZTXH 1BGXH 2NW2B 5B1CA 1QACA 2O6EA 4TF4A 2EVIA 4XMUA 3FF8A 5F71A 5INCA 2NNAA 2XTJD 3QZPA 2LT9A 5HBBA 4QRUA 4Z3EA 2VKXA 4JDVA 5TDPB 4OD1L 5DXWA 3ZTCC 4OZFB 4IJ3C 3TTSA 1IC1A 4XCYA 2GK0A 2OJEB 2YPVH 2DQHL 1VGKB 3X2QB 1T22A 4PLJC 2WBJA 3FT4B 4NDMA 2EVGA 1XSIA 2WLIA 4CRPA 3TBYB 4P9HL 3VXMB 4X99A 1X9RA 3OPUA 3LPGA 1OWRM 4TOYH 4QRAA 1R3IH 5GSRB 1XF4B 2P7TB 5J89A 3VFOB 2ZPKH 1HZKA 1YDPA 3L3JA 5F9DC 4HUUA 1G43A 1KB5L 2VAAA 3IJ9A 3OF6D 2R56H 4HG4K 1QEWB 3GXDA 2VM4A 5IF0B 2FL5A 3ISRA 4P4RB 4FZEL 3W0WB 4XP5L 5JW5A 2JTYA 3EAKA 1QEXA 3CN0A 5C0BA 1C1EL 4FQCH 2CGRL 2OZ4H 3AABA 5EZOL 3ZKMD 2RFXB 3HRZB 1HVXA 1GW6A 1PY9A 2WBXA 4HXAL 2BVQB 1LK2A 4UZGA 5GHWH 1LEGB 3O3EA 1FYTD 5DRNB 1BVZA 3DJ9A 5FCSH 5HGGS 4F5CE 5EOCH 1JYWA 2NY6B 1FL5A 3RNKB 2PCFA 4XPGH 2YGPA 4LVHC 1E4WH 5ID0A 2ATKA 1JZJA 5DD3H 4C54A 4JDTL 4K23H 1XGPA 3CSTA 2Q6WB 4J4PC 1RU9H 4L1DA 2X89D 3OJDA 1T7YA 4YHYB 1WCBA 4LCCB 3C6SA 4IRJB 2GSIB 3S36H 2WXFA 2YBRA 4F91B 1T3FB 5F6HJ 2E9WA 3TU6A 3GTVA 4KXCA 1G9NH 3JT0A 5BRQA 4AW7A 2VYRE 3LZFH 3FTWA 1L9SA 5DQ9B 4HFUH 4WHTA 4RSYA 3MBXL 1XF5B 3FHQA 4ZMTA 5C0CE 5CEXA 5K9QI 3C5ZD 3PWNB 4O2EB 2XA8H 1HEZB 1S7RB 5FYLE 4UIMB 1A5FL 1LHZA 2OTUB 2X05A 3GXUB 4NERA 3F6JA 2JCCA 2D03H 4P46B 5SV3A 5HYQB 2AJ3A 3RVWC 4BFEA 3DECA 4JKPL 5C3TA 3S4SB 2FQFA 1MQKL 4JPIB 4R8WH 4MSWB 4I48B 1W72A 3K72A 1U8IB 3HMWL 4YPGB 1ZE3C 2F15A 4LOFA 1VJSA 4MMXB 4OJEH 1JZDC 1DJYA 5BZDB 1TZIA 4NS0A 4AG4L 4CVUA 3Q43A 2H3KA 5FKPB 2X4QB 1XV8A 4U6HA 4XAWL 1KXQE 3ELQA 1T1XB 2J1WA 3NABH 1QLEL 3SPIA 4RWYL 3OKDB 1FLRL 3TYGH 5IOKA 3NTCH 2YD9A 4MA3A 1UFUA 2X9XA 2XNAB 1JHKL 5IQNA 4I77L 4A2FA 1T89A 3WNIA 2FO4B 2Q0ZX 5E6RB 1P5UA 3ET9F 5AW5B 3ZKXC 4D9RD 4NJ9H 2QJDA 3U2IA 4QKXB 4AENA 5JW4Q 1FFPB 1VF5C 1V3MA 5G2NA 3P69A 1ZTXE 2NDGA 2VH5L 4XCEB 2JI3A 3RBSA 3POCA 2MQGA 4JPKH 1FDLH 1YMHA 2VTFA 4X7CC 4B95C 3JTTB 1KN2H 4GJTB 3U9WA 8CGTA 4Z3JA 4M7JL 4MCYB 4YDIH 3AT0A 3CZFA 1TJIH 2FO1A 3BP5B 3MKKA 2AJXH 4RAUB 1CLCA 2HN7B 3OR7B 2EH8H 2IAMD 4XVUC 5IFJA 1S9XA 4KXZH 3P77A 1YEGH 4CL7A 1AIZA 1UYWH 3LNGA 3J8F7 1PFCA 2R4RH 1YQVL 4JRYB 1BBJA 3ZT5A 4I3RH 1AS8A 4U6VH 4RMUA 1CFVH 1A7NH 3UAAA 4YDKH 3CDCA 2LABA 3E6FB 3VD0A 4XCFH 4U1LB 4DZ8B 2C34A 2F19H 4LSTL 1OSPH 1ZY9A 1KJMB 2ZG1A 3QRLA 4X9HA 2ZUQC 5KVEH 2EINB 3OB8A 2XLLA 4HVBA 1EERB 1KWGA 1KEGH 5D1ZA 4D8PB 3TO4A 1JG9A 1X7QA 5I15H 1KYDA 1F3JA 1KC5L 1E4XI 1WA1X 4D0CA 4KKBD 2NTSP 3B3IB 1V7NH 3W57A 4MA8H 3BFQG 3CDGB 3QR1A 1CZ8H 1UENA 2DI8A 4PR5B 3RP1A 1OF0A 1UWEL 3KBEA 2WANA 1H3GA 5DK2A 1YEEH 2IANE 4LK4A 4XVJL 1D6VL 5EC2B 5IVXB 4X4YA 1G7JB 3ESOA 2ENYA 3FB5B 2WXIA 1KY6A 3H9SD 3OPZH 4R26L 3PJSB 1HNYA 4LLYA 5A2FA 5DJ0B 1O7DC 4NFCA 4HFWA 1N7ML 2BSSB 3LRGA 4HHWA 1VAHA 5BVJA 3S88L 4YDJA 4JN2B 4HJGA 3HZ3A 3CPUA 3V6OC 3OAYK 2ENSA 3AITA 1RLWA 3AREB 4FP8H 1G7QB 5CBEA 1Q90A 4LF3B 3FTXA 4G8GD 3L3GA 4PRDB 5TPWL 4X6CE 1U6AL 3FB8B 3BZEA 5JZ7C 3QFDB 3BPNC 3DI2B 4ONGH 2WQWA 4LLUB 4PGEB 3RU8L 4JFPB 4LASL 5JOPD 4R3SB 2OCFD 2GC7C 5T5NF 3TGXA 4PP1D 5FO9B 1I1FA 3GSVA 1N12A 3L08A 5E70A 1MG3C 4DZBB 1EQWA 3EYVB 1E2WA 2WM0A 1U2CA 3WUWG 3DX2A 3KWWB 4YXHH 3W39A 5EU5B 3NFSH 3RA7H 5J1TC 1CLYL 1OT1A 2A2QT 4QIRA 5J13B 1KYOJ 5CZRA 2L7EA 1TQBC 1OK0A 3WV0A 4FFVC 4PBWD 4PJCE 1PZ2A 2ZXBA 5GZOD 1U8HB 1EJ8A 1I1YB 4YZWA 3RZWA 1HT6A 2VXVL 3VXNB 3PGDB 2W91A 1IGCH 4GXFA 3DX9B 3KVPA 4QT5A 1NFDF 1KB9K 1OE2A 5AVYB 2BIMA 2YOAA 5EB9A 3V4PB 2YC1A 4A2DA 4QGTA 3EO0B 4YLBA 2FJHA 2XZZA 2P3YA 3PHQA 5IHHA 4HV8A 1PKQB 2NTFB 5IMLA 5LVEA 4GAGL 4F15C 2XV2A 5KAQG 4ZFFB 3VXSA 1EV2E 2CLRA 5DZ9A 3NJJA 4A2HA 5LGJA 4V2CB 1Q1PA 2E75C 1YMMA 5DQDL 2XCMC 5GGRB 1JGUH 3QR0A 1L9RA 3QI9B 5FYJU 1LGVA 1C5DA 5F1NB 3AY4C 1BEYL 2JI1A 3VXOA 3GI9H 4Z7OB 5I1LA 3FU0A 4NO5A 3C08L 4G3YL 3P0VL 3MMEB 4XMVA 3VFNB 2J5LC 1W0VB 1A6WL 3ZYIA 5J8OA 1DVTA 3O6KL 3L3KB 5DJXA 1HDMB 4PIBA 1RUML 5EN2B 4JL1A 1MIEH 5I0VA 3B9EA 4Y2DB 5D4HA 3B5TA 4Y88A 4HS3B 4JN1L 1WIUA 1NPJA 1R9FA 1BLIA 2EICA 1S9KC 1T20A 3TZVC 3GNML 2P8PB 3AY4A 4GMSH 5B8CA 3RTQB 1MCLA 5F7DA 2TSBA 1DVYA 3CQQA 3OSVA 3N0PB 4DUXA 2Q2LA 5HHOE 1CLOL 3PP3K 3WN5B 1NUDA 2DIBA 2LOEA 3KLQA 1E0OB 1YJDH 3QDJE 3VFMB 5JXED 3ILDA 1RK1B 5T5FL 3KL3A 5KYWB 1CB4A 2VDRH 2Y4SA 4NIKB 4ZMNA 1IVTA 3MRGB 3SCMC 1XF2B 3FS9A 2VIRB 1KF9B 2MOVA 2QKIB 3DPBA 2X5PA 1P0SE 4AH2A 3D06A 4K73A 3VFWB 4ESKA 4FABL 5C8JB 5H35B 3VH8A 3DO3A 1LDPL 1BQKA 4JUSA 3UBXB 1NMBL 3KWVA 5C92A 2WXHA 2FGWL 4P05A 2OMYA 2X4OB 5TGBA 3T77A 4EKJA 1P7QD 3I6SA 4PRHA 5DLLA 1QQDB 2XIDA 2BRQA 3DJZA 3B34A 4UYQA 5JQ6H 4XAKE 1TT6A 4LPTA 4QLWA 15C8L 2R29H 2L7JA 1ZA3B 3QFJA 4AL8C 3ATBA 3RIAK 2YXMA 2HAZA 4OFYA 1D5IH 3ETBF 3D3VB 1EUTA 4A67A 1MHHB 1X5KA 3ABGA 1C5CL 3SCMA 1R34A 4R7NB 5L8LB 1TTRA 2BXZA 4G1EA 1F1AA 1SXSA 4F24A 3BEVB 3O2DL 2R0WH 4MNQD 3VFPA 1X7TA 1FNLA 3ECBB 1S9YB 5HDQH 2APTA 3CGTA 1XIWC 3NPSB 3HI6H 4JVPA 3PPSA 4I18B 4XZUB 1ADQA 1I85A 1UWXK 3QDME 2HVJB 3CAFA 3SGKA 2X2UA 2YUXA 3RY5A 2ITFA 4NO0A 5EO9B 4XVSL 5DRZB 4RCAA 4XP9H 2RR3A 3DHUA 2WINA 3LMJH 5JDSB 3QPXL 1B2WL 4ONFH 3GEFA 5LBVA 3PQYA 1R24B 2XDHA 3KPOB 4WFFD 1T5WA 3PWVB 1CFNB 1W0WB 2XXMB 3MLXH 5GGVL 4LRIC 3WO4B 5H37G 4C56D 1FG2B 2QSQA 3MNWA 1LD9A 5GGUB 4YSCA 3FU7B 4K3GA 5JW3L 1XGQB 1YY9D 2V4LA 1QTYT 3H4HA 3T4AB 4N2FA 3CTTA 2PP9A 3SYOA 2HRPH 3BCDA 3OKEB 4B27A 4BWWA 2YD2A 1KBKA 1INQB 3MPCA 4JM2C 1QFHA 4PJ8C 5IBLD 3MACH 1AGDB 1S7TA 1BVNP 2NX5D 3ARQA 3C9NA 4PWIA 4J3BA 1I7ZA 3LN5B 3B7TA 4N0FA 3L7FA 3Q8EA 4HK3J 4TQPA 1WZAA 1YEJH 1FGVL 5FYLL 3ZE0F 5I17B 1GYVA 4AJ0A 5I1DB 4QRRA 4NPKA 5SWSD 2WUBH 3AU1A 3MC0A 3GBML 3MLWH 3OSKA 4NQSA 1JE6A 1NIBA 1CE6A 5EF0A 4AKQA 3SO3B 4M3JA 4PU2A 3U0WH 1I3GL 3VI4F 5AQ0A 4FQ2L 4BFFA 5HGBA 4A7QA 4RAVA 4WEUD 4X7TB 3WEXA 1A4AA 3I50L 7FABH 3X3GH 2IPTH 3FCSA 3TJEH 2JWYA 2WWKT 1OQOA 2VZOA 1KACB 3IM1A 2GC4C 4ELKA 2X87A 1TITA 1OSZB 4N1CA 3L3DA 3PDOB 4OCSL 4GW5A 4NRZB 3DTXA 4WU7A 5I6MA 5EUOB 6CGTA 2YZ8A 4JQVA 2O61B 5IR1B 5D9SA 5AW8B 1YNLL 3OKMB 4QTHB 4TSBH 3P73A 4LHJB 1TJXA 5CIPA 1ZTXL 3S48A 3LY6A 1PYWB 2QLYA 1BGXL 2IAND 4WFGE 5D7LE 3F12B 3V52H 5HJ3B 3FSAA 2M83A 4L29A 5JHBA 1IVLA 2OL3L 5GS2H 3DMMD 5EU4B 3MRBA 2RBLA 5DI8B 3S96B 1VEOA 4YFEA 3HR5B 1E90A 1MH5A 5FKAB 4LEXH 4GRMA 3TN0D 4MAYA 3FQXA 4ALAL 2NYKA 4KJPD 1HHGB 1V05A 3TXAA 3N2JA 3UEQA 4ZXBC 4ZMAT 3R7RA 3ULUC 1AGCA 3FQRA 4YSRA 1R3IL 1YC8A 4L3AA 3V6ZB 1ED3B 4LL1A 2R4SH 3VQ2C 2HT4C 2WB1A 5AUMB 2VSCA 3HVDA 3L16A 5JR1H 4PJDE 1WBXB 4TLUA 1CICD 4IDJL 4R4BA 5E9DB 2R39A 2QQNH 3QW9A 1Q9LB 3KR3L 4XNYL 1RLBA 2DBJA 2WKOA 3NQIA 4AQEB 1HL5A 2Z8VC 3L4XA 3DXAB 3NK4A 5AD0B 5D1QA 4FQCL 2OZ4L 3BDXA 5D4JA 2XX0A 1HHJA 1FC1A 3O2VH 3QULA 2WWKO 2ZP8A 5HYJD 2NZ1A 4K15A 1BXAA 5GHWL 2Q2EB 1KCWA 3S9DB 4ZXBA 2V7NB 2D7TH 2V17L 3K71A 4CN4A 4TVPH 3U36A 5AG8A 3FZUC 2JTDA 4XVTH 3CMGA 1WVZA 1REIA 1UCTA 1B4JH 2ESVE 4PVLA 1LEKB 3CDZA 4XPGL 4JKWA 5T5NG 2VLKE 5KS9B 5DD3L 4ORGA 1KCBA 5AVTB 1U3HC 4GFTB 4QXUL 2AZUA 3ZE1B 5E2TH 5HYSA 1RU9L 4PGCA 1T1WB 3QRGH 1A8ZA 2CKBB 1M1XB 1P6FA 3S36L 3FO9A 3PPEA 3CN2A 4JFEA 3N40P 4KROC 4X5RA 4LGSB 1QFOA 3GMOA 2QPSA 3WNNA 4UMGA 5F7EH 4GMTL 4FRWA 3LZFL 2IOMA 4XZ4A 2WGXA 5TE6H 2IBZY 3NJHA 2K8MA 3QIWB 4E68A 5ICUA 5D8JL 5K39A 3IGAB 1ES0B 1TDQA 1U3HA 1GYWA 2UZXB 2XA8L 5CEYA 4UQ2A 2E6JA 1AGEA 4FG2A 2X88A 4HWBH 1NCCL 3PDGA 4ILDA 1HNFA 2NXZC 4IHBA 4G6AC 5I16A 4P23C 2AQPA 5CJOL 1O5DT 4NOBA 1Q9OB 5E6ZA 3UTSA 2NY3D 2W9DH 2W80C 1HIMH 2ARJQ 2V8LA 3QDJD 4DP2X 1II4E 4PJHF 5I1GH 2AK4B 2YQ2A 3V5KB 4YR6B 5FFGA 1SEBA 3DKHA 2CZNA 5FUCC 2JKTM 3IXAB 3NABL 3CZNA 4KV5F 4WK4B 4I0PD 1IQWH 4FJ6A 5D2NA 5K33A 4L5FE 5TE4L 3DX8B 5IW1A 1H3TA 1BVLB 2CG9X 3ML8A 1WP6A 4MX7B 2CQVA 4FQQA 1OL0A 4AMWA 4NJ9L 2E6QA 4Y16A 1KDIA 5E9AA 4BZ1H 1UASA 1DUYB 5DZLA 5FC9A 3DX6B 4PVBA 2AQSA 4U2YA 1M05A 4G42B 4P4KB 3HZVA 3E9UA 4E5XA 4YDIL 1BZ8A 3U1SH 2WSDA 2GQHA 3BGMA 4KUCF 3VM5A 2P5WB 1BFVL 5GRYA 1J5DA 3P4OA 4HETA 3IMUA 4PJXB 4KMQA 4XI5C 4QJ5B 2HTKC 3FPXA 4PREA 2EH8L 4B9FA 5IVNA 1YEGL 3Q1SH 1F42A 2APSA 1UYWL 4PRIA 3ZE2E 3ULAB 1KGCE 2R4RL 4OBRA 5CP7A 1OGAE 1UM6H 3A67H 3PQYD 4LNRB 3QDMD 2XVLA 4HCRA 4I3RL 1KULA 4U6VL 1CFVL 1A7NL 3IETB 2BNRB 4JCWA 3K2MC 2CBOA 4G72B 8FABA 1J8KA 2OXHB 4HSQA 4IRSC 5I74B 2BCKA 2F19L 4ONOA 3NZ8A 4RGND 3WHXA 5BOPA 1OSPL 4OLXH 5DJ2B 1I9RH 4WKZB 3QAZB 3KLHD 3K6SA 5IUCA 1AG0A 2VLRE 5IG7A 2WXQA 1HQ4B 1WDAA 4DO6A 1PG7H 3TFKD 4IRZL 12E8L 1CIUA 2IADB 2PW1B 4XOBA 4UM8B 5I15L 4L1TA 1XAKA 4I5BB 5IUSA 1OY3B 2IDQA 4WFHE 3FYEB 4M1GL 1TYRA 3HPJB 1CZ8L 4Y1AE 4RFNB 4FAAB 3SDDB 4TRPL 4TVPE 4UT6A 2BNQA 2ZCLL 4ELDA 2YXWA 3QIUD 1YEEL 3HE6C 3VI3E 1OTSC 3N43F 1IGYB 4N0CC 2NXYD 1MHPH 2XX1A 4YIQA 5IJVA 5CHNA 4DKDC 5CD5C 5KBLA 4RIRB 5K1VA 4WO4D 4PP2A 4GB9A 3O3DA 1SY6A 4UYPA 1MFUA 3UG3A 3ZRCC 1XB6A 4Z7UE 3O11B 3VA6A 5DQJA 3VD5A 1NFKA 2J6EH 4ES9A 1FFNB 2Q1EA 2DWEA 4OZHF 4Q9BA 4ONGL 1L3NA 3DRQA 5GRZA 1FPTH 5KTEH 5T3ZE 4RWHA 2VR3A 2A38A 1OCOB 1NANI 5INCB 2UXGA 3UL4A 2D3JA 2NNAB 2VR6A 5I5IA 3FFCD 4WJG3 4QNPF 4JDVB 4KBPA 3B7SA 3HG1A 2NNFA 1ZJAA 4JO1H 4NZTL 2LU5A 4XCYB 2GK0B 4Q74A 4TQ8A 4XNXL 3NFSL 4GBXA 3RA7L 2FT8A 1T22B 5I5RA 2WBJB 1DBJH 2DQDL 1CXIA 2WLIB 3QUZC 3R18A 4NDMB 1TYEB 4U6XA 4Z7NF 1HILA 3A6CL 5TJWK 2B4CH 2H2SD 4WFGD 4X99B 4N85A 4Y2LA 3PWPE 1WHPA 1IGCL 1YDPB 1SXAA 3ARSA 3L3JB 4UOW1 4E9XA 4HUUB 3RVXC 2VAAB 5LAXA 3EHBC 4A2EA 2EDOA 3GS4A 2FL5B 2P42B 3IPBA 1KTLA 4DNLA 5JW5B 4BYHA 5IHBA 3GM8A 4XP4H 5C0BB 4NUQA 3MXVH 4IJ3B 2EUVA 2OQJA 3K46A 3EUUA 4AYMC 1JGUL 2BNUA 4HJJH 2A9NL 3AB0B 1ERNA 2HTLD 3QUZA 1LK2B 1P5VA 3O3EB 1PZBA 2DZEA 4U49A 3GMPA 5GJTH 4C55A 3IFLH 1N2RA 3BCFA 5HVGB 3HMXA 2NY0D 4JRXE 2Q8AH 3STZA 3KPQA 2Z7UA 1FL5B 1EANA 3CHOA 2ZXWB 4YSSA 3BIBX 1MCWW 2WP3T 5EPMA 4L4TD 5ID0B 3VFVA 2ATKB 2Y24A 4YN3A 1V3KA 1MIEL 1XGPB 2X1XR 2CUAA 4DP5X 4CC4C 2WQUA 3ARGC 1KCUH 4FXLA 3DOSA 2VMEA 4P2OC 3OJDB 4EXKA 5B38A 3S8WA 3T09A 2VXUL 2KZ1B 1WCBB 1YEDA 3C6SB 2XI9A 3U2JA 4P2RE 4PUBL 2YBRB 3LPOA 3ARWA 1S5IH 4GMSL 2Y1AA 4OT1H 5E5UB 3HE7D 1I7RA 1F41A 1WAAE 2ESVD 4XCCH 1F3DJ 5K93A 4B9CA 5IT2H 2QADC 5I9QB 4Z7IA 3O9WD 3ZJAA 5I82A 3E3QC 1YJDL 3PRZA 1ZLDA 4WHTB 3UZEC 2WAHA 2V7HA 3O0RH 4XOAA 4LVHB 4AEHL 2XQYA 4B7LA 4BWUA 5CEXB 1HHKA 3C60D 3VWJD 5FX3A 1NCBH 4UUJA 3TX4A 5FUZH 3MOAH 4L18A 4L1BA 3WLWC 4POZD 1MEXL 4Y4KA 3DA0A 1CI5A 1F4YH 2JCCB 2YHGA 4HT1H 2AJ3B 4FA6A 2JFCA 3A6BL 5JQ6L 2F1EA 4FQXD 1O7VA 4Q56A 4JY4B 4XCNA 1OGTA 3UABA 1K3IA 1W72B 3K72B 4Z7VA 1ZSDA 4XN8A 2Q76A 4U6YA 2Z9TA 1QBML 4ERSH 1TZIB 4Y4FA 2BWQA 5D1XD 4M6ML 2FYYA 4I1NB 2WNKA 4U6HB 3FUJA 1CFBA 3KHQA 3R0NA 2QR0A 5I28A 4MA3B 1M4KA 1VA9A 1KELH 5HDQL 1U8JA 2XRAH 2PWGA 3HLAA 3QWRD 1P5UB 2W81C 2WP3O 3HG2A 3HVNA 1M53A 3NIGE 4QOKE 5J3HD 2D0FA 3BLPX 2CUIA 2H0FA 4AENB 2ZXAA 3FC8A 1Z0MA 5LDUA 1G4RA 4FQ1L 4FNRA 4M7KL 1FSKB 1IKNC 4P9HC 4AOFA 2YJLA 1YMHB 5KSBE 2WO4A 5DEFB 3N1FC 4Y1TA 5FWRA 4Z78A 4XP9L 4XX1E 1P53A 1VZIA 2QVMA 2WLYA 4HEPG 4NM8H 3LMJL 3CZFB 1MRFH 4ONFL 3WDIA 4RBPH 1KMGA 3HNTH 3VXRE 2I5YH 1A6PA 2JB6A 4EIBA 4IKNA 1JV2A 1WFTA 3IRCA 5E2JA 2EDMA 1QBAA 1J0KA 5IFJB 1S9XB 5E94A 3DBSA 3P77B 2A4EA 4TL5A 5BOJA 3LXCA 5AB2A 3DX1A 4NENA 1YUHA 4NQCA 3QNXA 4FE9A 3TVMA 2WMPA 1BBJB 2VDLB 2HRPL 1X5ZA 2EDXA 5GS2D 3EOTH 3MACL 3IXTA 1FZMA 4U1JA 3H0TA 2XBTA 2YAHA 3QNYA 4R7VA 4POYA 4HKBA 1KB5A 1SM3H 3CSGA 3NIDE 1YEJL 3X1GA 3LQAL 2F53D 2XTJC 7CGTA 5D1ZB 3D85A 4TSCL 2WUBL 2OSYA 4WNSA 5C0AA 3TO4B 1X7QB 3MLWL 4NUGH 4GEIA 1L7TL 1F3JB 1FHGA 2NY7H 2NYYD 2QTVA 4YWGH 2O72A 1KGCD 3U0WL 4NKIL 4D0CB 3T8VA 1DDTA 2KC0A 1D5BA 4PLKD 1MCPH 4CSPA 4ZD3L 5AOKA 5A2LH 2W0LA 2HUHA 1HQRA 5J0BA 3X3GL 4AGMA 1GIGH 2IPTL 3TJEL 4XO8A 5DK2B 4MB5A 1AHWA 4X4YB 5J9PA 1NUFA 2FB4H 2XZQL 2W60A 4R5XA 3SQOH 4JFFE 4XPAL 3L4WA 4LLYB 4L5FL 4S1QH 5L7XH 1TENA 4HFWB 3NSDA 4DKFH 5BVJB 5C0RL 4H8VA 4OI9A 4YDJB 3HUJE 2WXKA 3KW7A 3BE1L 4HJGB 1KEMH 4Y1AD 3BUQA 3PNRB 4TVPD 3CH8A 1FE8H 5CBEB 2P26A 4IMLA 4JJ5A 3L3GB 4KXDA 4QGYA 3RGHA 3TH4T 1BJMA 1KNOA 4N2CA 1T5XA 3GINA 1D7FA 1H15A 1CF8L 1CFQA 3KS0J 2CR3A 4L8CA 3WDJA 5IFHH 1C12A 2ID5A 4AJYV 1G6VK 5F44A 4LEXL 1I1FB 3GMRA 3GSVB 4P59L 4R0LA 1QI3A 3UROR 1X5JA 2BXYA 4UNVA 3TBSB 3W39B 3HN5A 3M6DA 3AZUA 4MD5A 4J3OH 1XZ0A 1MWAH 2E0PA 2R4SL 4PCTA 1BJ1H 5JR1L 3LKSA 2N7AA 3BDYL 1IC5L 4QJ4B 5B3JF 4QT5B 3U30C 3VI3F 2VXQL 2WJ7A 2X53A 2YC1B 5GRJH 4XH2A 1UEYA 3PHQB 1XT5A 2GBTA 4HV8B 3C2SA 4QRTA 5D96C 2N56A 4PYGA 5IMLB 3C5ZC 3K8MA 5MP6L 3O2VL 2APFA 2OMBA 5FGSA 5C1MB 3VXSB 2CLRB 2IBGA 2FQGA 3FQ1A 1YMMB 3A4DA 1QTSA 2DQUL 3KXFE 5FO7A 1N0LA 2D4DA 1FNFA 5EIVA 4BGDA 1C5DB 3H53A 3JXAA 4QKTA 4TVPL 3N40F 3QUKA 5DGRA 2EIDA 3VXOB 3X3FL 5I1LB 4Q6IA 1B4JL 1IGIL 1TQWA 4NO5B 3GI8H 3SYCA 4FFZH 4JBSA 1AYRA 2PO6C 3MDJA 3CLWA 3Q2WA 5AEAA 3X1BA 5BVPH 5L0QB 4WW1A 1WPCA 3QP3A 2P80D 4JLRA 2B59A 1ZDSA 5DJXB 1OO2A 4LDLB 1BMZA 4F9PC 3QRGL 4MAUH 4EI0A 1L7IH 3HC4L 3NZUA 4YHLL 5M7QA 2Q7NA 4YX2H 3MROA 4GW4A 4XNUL 1MIMH 2PCYA 3FBKA 4KZ0A 3SKJH 4XODA 1T20B 5EBWA 5F7EL 5B8CB 2WZ0A 4U7KA 5F7DB 1I1AD 1FP5A 1FNHA 5T33L 5TE6L 4JREC 2Q3AA 2QDWA 3L1GA 4JFDE 5T3ZL 5IWLC 3WY3A 5E0QA 3X1NA 3VVWA 2PO6A 2W0KA 3H3KA 4AQ1C 4NHUB 2X4UA 4JMNA 2R2HA 1EEZA 2EIEA 2Y5QA 2ZOLA 3HAEH 4H7VA 3SPCA 3DPBB 3T4YA 4AH2B 4E0RA 4PJAA 2A9DA 3T0EE 3VH8B 3BWUF 1UT2A 3AMKA 3NJVA 2V37A 2P47B 2X42A 3LRKA 3QEQA 2OMYB 1UXLA 1ZLEA 5TGBB 3T77B 1K4DA 2E7DA 1PZSA 2W9DL 4PRHB 2IAMC 2HXAA 2H6UA 4BWTA 4HBCH 4Y4KD 2YKLH 3IGLA 3D25A 4FHJA 4ZFGH 1QR1A 4OKVA 5LCVH 5IWLA 3CHRA 4NN6C 3QFJB 3MX0A 1K4CA 1IQWL 2A6IA 4X6DF 3C5SA 3SCMB 3OLGA 1CS6A 2E4TA 1E4KC 2EC9T 2XQBH 4G1EB 4JG0H 4PLOB 3VFGL 1G1OA 2R69H 2O6FA 4ZT1A 3U6XA 5C3LD 2VO8A 3VFPB 1XGTA 3V4VA 1O7SA 1DQVA 4RFEA 3TEYA 3MJ8A 2OZNA 4KKBC 4CU6A 1FG9C 3D39A 4KHXL 4NO0B 1HWWA 5DJDA 3QQNA 3MO1B 3U1SL 4AC2A 1Q8MA 4W9HC 2E7BA 3U1QA 5AOMA 3FTUA 2GJ6E 2FX8H 2LVCA 4JHZA 1T5WB 1MREL 3Q1SL 1NBZA 4MZRA 5CJXA 4QOKD 5FHBH 2WXOA 3MNWB 1IARB 5D2LF 1UM6L 1LD9B 1AO7A 1TEYA 3QISA 3N6YA 4WNQA 3T2OA 1WISA 1MFVA 3J07A 5F1OB 5CNHA 4OLXL 4GSRA 1I9RL 4UV7H 4L2YA 2MQ3A 1DVFD 3QUML 1S7TB 1JWSA 2EH7H 3C9NB 3OAZK 2YEVB 4BFOA 1I7ZB 1PG7L 1ZV5A 1MVUA 3BSZH 4N0FB 5KZCD 3L7FB 4CBZA 3BAEH 5T1JA 3WD5H 4XO5A 3MFGB 4HMEA 4KTGA 1JHTA 4PP1C 1Z9SA 3N42F 1MRCL 4QRRB 4LVOB 3AU1B 4NQSB 4U1GC 4CMHC 1CE6B 1KENH 1T2JA 1JNNH 5IB5B 4N2GA 1F58H 5HGBB 4RAVB 3WEXB 5I6KA 2HFFA 4Z9KB 4AQOA 3UTTD 3FCSB 1PNDA 1MHPL 4PG2A 4Z7NB 4F9LA 5GZOC 1OAYL 2IWFA 4Q0XH 1IE4A 2NQCA 4ELKB 2EEXA 1SJVA 3E1ZA 5BOZG 1F18A 3L3DB 3OXSA 3Q6FA 3VD9A 3DTXB 4WU7B 3KYKH 4JFOA 4XMTA 1A7OH 2VDPH 1ZLWH 4M56A 5D9SB 1BD2A 1EA9C 2CK0H 1NC2D 2J6EL 3K91A 5MENA 2D7QA 5FDYA 3P73B 1J5CA 3JV5A 1TQCB 2UWEA 3WN6A 3Q2CA 5CIPB 3ZZQA 4G82A 1MFBL 1UFGA 4L29B 1PX4A 4DOHB 1OXYA 2VXSH 5DS1A 2J1XA 3B5GA 2FECL 3MRBB 4HIHA 5EH1A 4P06A 2YRBA 1Y0LA 4O5LH 3RX8A 3WFBH 3AS1A 4R5VA 5K9QG 1BMGA 4H40A 2GTZA 1L9MA 1N18A 5T5FA 3SGEI 1XL6A 1MH5B 2ZUTA 3SIKA 4E5XG 5ANMA 1OAJA 2Q8BH 3ESMA 3JUZA 4MAYB 2DLEA 4Q9RL 3QWOA 2VJ0A 1R47A 2VUOA 4HWZA 2D2OA 2CCWA 3OZ9H 4X9YA 2B4CL 3UJJH 5IB2A 4IOIB 1NEPA 1AGCB 3FQRB 2JJTC 1FHNA 4NLHA 5DGQA 2FD6H 5H94A 1CXFA 3PGCA 4M3HA 4B9GA 1KXVA 1JS4A 2GABA 1MCWM 3L2LA 3BVXA 4R4BB 3NOIA 1FN4B 5AOJA 4HC1H 3P3UA 5B39A 5JXEC 3WNMA 3PCYA 3EXLA 1TNMA 4YUEL 5D1QB 4AUJA 4GW1B 1XEDA 4PJFE 1N0XL 1HHJB 4HJJL 3CQFA 3QULB 5IOPB 2J8UE 1I8KA 4ZXBB 5LN8A 2VDMH 3RY6A 3K71B 3LCYA 3U36B 2ZD0A 3IFLL 4W81A 2Q8AL 3HB3D 1TG8A 3CN1A 3CDZB 2ZSVA 4OKDA 5JPNC 3T0VA 5E4EB 3D0VA 4ORGB 5E1IA 2XZCL 4Z8FL 1WCQA 2OR8A 5DVNA 2HRLA 1WD9A 3ZR5A 4RRPG 5J1SC 2WQ8A 2YGOA 1OKEA 1XSOA 5FFOA 4MBRA 4NC0B 5HYSB 3PUUA 4C47A 4PGCB 2E47A 5FYKH 3LIZH 3ESNA 3KXFD 1Y07A 5AZUA 2GJZA 3D0AA 3FO9B 4JFEB 3ZO9A 3EGXA 3UZVA 2PPCA 5CFHA 4XCCL 4F93B 1JGIA 2XKUA 3GMOB 1VENA 4HOXA 2FLBT 4NWUH 3KM1A 4D94A 1DQDH 2ZXDA 1MCOL 2IGFL 5JPNA 5K39B 1U3HB 4YZFE 1QSFD 2FBRA 1YEKL 2ZOWA 4UQ2B 5CEYB 3S3JA 3KG5A 3R0MA 1AGEB 1KIRA 3E7JA 2J12B 4MGXA 1F4YL 3MYZA 5IB4B 4PJIE 4OJDH 4IIQA 5I16B 4V2BA 1HSBA 1NUNB 4XRCA 1I9IL 1YAIA 1KXTA 3DIDA 1F4XL 3UYRL 4KROB 3VGGA 3UTSB 4H5SA 2J88H 2BSBA 1OPOA 1KJ3L 1EEYA 4DAGL 1P7KA 1TU2A 3OGCA 4OTXL 5HDBB 4RFOH 1GGIH 2WKGA 4ERSL 1SEBB 1NBYA 4P07A 1Z32X 3WIHL 4EZKA 1CC3A 1Q9WA 4PMEA 5C2BL 4KOCA 4PG9A 1J7VR 1KBGH 5IBLC 9CGTA 3HZKA 1JNLH 5D2NB 4L4VE 3QZWA 2F7RA 1KELL 1RERA 3ASWA 3MV7D 5IW1B 1ILSA 2VGLM 3EJZD 3ZT7A 1T83A 2PUQT 2NXZB 2X3BA 2HA1A 4FQQB 4TV3A 4ALAC 2IGLA 4LSUL 1LVEA 1XMWA 2B5IC 2DLFH 4Y16B 5DRWA 5ESVA 2EDNA 1CG9A 4OLZH 4UCFA 1NC4A 4PAZA 1OD9A 5I8OH 2H6PA 1JTTA 1LO0H 1PBYA 4KTDH 2Z31A 5ACLA 1WBYA 3HZVB 4HCFA 1AOHA 5C0JA 2A9MH 4PJAF 5SX5H 3B7YA 3ZDZF 1MRFL 3BGMB 2MCMA 3H1ZA 3EH2A 3JWNH 5BW7A 2XWEA 1ECZA 3HNTL 3P4OB 5AB1A 2EE2A 2OL3A 5E23A 4NYLA 1CE1H 1EFQA 2KLRA 4XOCA 4PREB 1A1MA 5GGSA 1PCSA 5AVWB 2WXLA 2YPLD 3C09B 4LZKA 3E9TA 3SY6A 4KK5D 4PRIB 1H3XA 3PHOA 4JR9L 1FO0H 5CP7B 3DGDA 1SFDA 2JIXD 1KCSH 3HNSH 4J8QA 4PGJA 3RILA 3ZPDA 5D7EA 3D8MA 3EOTL 3SGJA 5E6IA 5KVDH 4X5LA 5C07D 1GCYA 1FJ1A 2BCKB 1EH9A 1UB6B 3NZ8B 3WHXB 3BAKA 3OKOA 4JO4H 3UTPE 4UTAH 1RUKH 1QATA 3BUTA 2GJ6D 4JFTA 1X7SA 5IG7B 3DMMC 1ZANL 2P4AB 4NN7C 4NUGL 2X09A 5HDWA 2DICA 3AQZA 4AWJC 2DTSA 2QSVA 1G6RL 5AVZB 2CO7A 2XXCB 1U58A 2C7FA 4J3OD 3TN0C 1T2QL 4GKNA 4YDLC 5DVMA 1CMOA 1WITA 3KBHE 4JK0D 2BNQB 3V5DA 1GIGL 1UOKA 4H0HB 1QNIA