3H6AA

Structure of the calx-beta domain of integrin beta4 crystallized in the presence of calcium
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
109
Chain Sequence
MRDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin beta-4
publication title Structure of the Calx-beta domain of the integrin beta4 subunit: insights into function and cation-independent stability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 23
structure length 109
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h6aA00
3EADA 2LT9A 3E9UA 2QVKA 2FWSA 3FQ4A 2KLSA 3GINA 3E9TA 2QVMA 3RB7A 3RB5A 3H6AA 3US9A 2KLTA 2FWUA 2DPKA 3FSOA
chains in the Genus database with same CATH superfamily
2WZPD 3O8XB 2BX5A 2UZYA 3CHOA 3ZL1A 2EUXA 2APFA 4U1MA 3SYQA 2AZUA 3QFJD 3ZZLA 4F3FA 4X5PA 2H6PA 3TWCH 4D7BA 4KROB 4W9EC 4YHZL 1EWHA 4YX2H 3FO2A 4BWTA 1AYOA 3FTVA 3GJFK 5J11B 1KOAA 4MAUH 4OKVB 1PZUB 4KZDL 1V7NL 2VDMH 3DOHA 4XP5H 4K73A 4AYEC 2Z1PA 4KRMB 3VJ6A 4XGZB 1HXMA 3K4AA 3W37A 1UQSA 1Q1JH 4GG8A 4A1RA 2NXYD 4P5TA 4XP9H 2CLZA 1BIIA 2B0SH 3C60B 4HKJA 4ONHA 5DHYB 2AV1A 4O58L 4M9PA 2WNXA 2Q3AA 3IDUA 3I50H 1TOXA 2YFNA 1LEIB 2EUWA 5I6LA 1ZVSA 3H9SB 5T5NF 5BW7C 3MRGB 2FEEI 4QHUB 4XCCL 5A2LH 1KYUA 3GXDA 3NAAL 4QOKB 3WEBA 1FVCB 4CVUA 5T33L 2BC4B 2I69A 3BPLC 3CCHB 5GGVH 2MMXA 4AQ1B 3VXSB 2M1KA 5EU3B 5AAMC 4MMZA 4EIZC 2V2XA 3GBML 2ZCKH 3J2PA 4BSVA 4FG2A 2XKNB 4Y4HC 1EAJA 1NPJA 2IDTA 5I0WA 2R8SH 5HYIA 3PXJA 4FCAA 4ZUWB 2J1ZA 1GCFA 4WSJA 2V3FA 5HVWA 4MA3B 1OP5K 4QXUL 4DZBB 4KFZC 4NX0A 1SOXA 4LHJB 4OJFL 5GS1C 2F7RA 3D25B 5TH2B 1Z0NA 2DLFL 4FABH 5EU6D 1UJ3C 4FNPA 5A1AA 4YSTA 3TBVB 5CBEB 2GUOA 5FS5A 2Q87A 4KQ3L 4K8RL 2WPGA 3EJUA 4JFTA 3SE9H 4NCC1 2CIIB 4RMUA 5LBVA 1MY5A 2P44B 1U8QB 1IAMA 3MBED 3MOAL 4H1LA 4RGOH 1I8IB 4HIJB 4Z7VB 1WBXB 2QADB 4L4TE 4FDWA 4Y9EA 1A4KA 3Q5TA 1QEWA 2YPLD 4P2RA 1WO2A 2LT9A 3LRLA 4YHLH 4IRJB 5FCUH 4UT9A 5I5MA 3MN8A 3AW5A 4HYTB 2GT9B 2QZQA 2XV0A 3P0VH 4J6IA 1CICC 5ICZB 5C6WH 4J1UB 4W4OA 3T2QA 4LFHD 3QRGL 3KPLB 1CTOA 3QS3A 2R2HA 2UVEA 4L18A 1ETZA 3ESOA 4PP2B 2WXIA 5BS0B 2J1YA 3GXPA 3OLIA 4JFEB 3MV7E 4W9FC 3HNTL 1CDGA 3BWZA 5FHAH 3U36B 2OLDA 3N0AA 1EFXA 3CFBB 4PJ5A 3HI5L 3UBXG 1NDMA 4JFDE 1D2PA 1XQ4A 5C0CA 1C5CH 1CLVA 4JQXC 5D7KE 1UACH 5C08E 4L29A 1HEZA 1TQBB 5EBWB 1DN0B 2E9IA 5BUAA 5L6YL 4RVBA 2XWJA 4AKOA 2LU7A 3Q5YA 4PJEA 4XNZB 5A6IA 3FH7A 4NEHB 3S4SG 1CO1A 1QNZH 2JFCA 1E3FA 4XOCA 4F24A 1DVFB 2CWRA 3KCPB 2UX6A 1ANUA 1YEEH 5AKTA 4BFEA 1LEGA 2WGNB 3OAUL 4R7NB 4WO0A 5DF0A 1T2XA 3KWWA 2ZUWA 4RMTA 3QNFA 1KIQB 4KOBA 3HZYA 1BJ1H 4NAMA 4PV8B 4PW9A 4DQOL 1ZLUH 2E7DA 1AXIB 2KERA 3HFML 3LZLA 2X7LB 1L0XA 1SY6L 3HN8A 1FG2B 1KACB 4MVBC 3VFRA 4DGVH 2J8UA 4N28A 4PD4K 5T1KB 4F8LA 5AUMA 5D96C 3EG9A 3GMMB 1PD0A 4KO6A 3VD2A 2VXQA 3MRLB 5E1QA 4MNQB 3EBGA 2Y6SC 5JXEC 3UYOD 3HJ0A 3L81A 1HHGB 3H7BA 2IGFL 2WQ8A 3IU4L 5D7JA 2H0FA 4BUGA 4QYAA 3F7VA 2ZP9A 4HVBA 3ULUF 4DPCX 3V0VB 4I3GA 1DQQA 2CO6B 4YHYB 2BSBA 1VLXA 4FQLL 4EN3C 3I85A 5CLZA 2LFGA 5DD0H 3UYPA 4AI7A 4AQEA 1J5OL 4MASA 3W0WD 4WY7L 4Y0GA 3T6ZA 3STLB 2ARJA 3EDJA 3V2AR 1QVOB 3TX4A 1GYVA 2XPGB 3BQUC 1ECZA 3VFWB 4MBOA 4WW2C 4E68A 2BFVH 4HKBA 1F8TL 1QW9A 2EABA 4P46C 4G82A 3EHBC 4F9LA 3O2WH 3VYPA 3CDCA 1HKFA 2WQSA 3CFJA 3FCSA 3EJRA 3S37H 2UY6B 2OZNA 1UT1A 3AS3A 3PG2A 4LCWA 4H8HA 3MRFA 2OMBA 5KTEL 1FSKB 1X44A 5IMOB 3T0ED 5C9JB 2QGCA 4MXWL 4LIQE 1XGZA 5AVZB 1JZIA 1GPOH 3PUUA 2F1BA 4HPOH 5IFAL 4ODUB 3O0LA 4KUCF 2C9VA 1G9MH 1V5JA 4PB9L 5KVMC 5BRQA 1H8LA 1MPAL 3SGDI 5GGUA 5JIMA 2BHZA 5CIPA 3K1KC 4XNYL 5ADPL 4MB4A 1OV8A 1UZ8B 4BK5A 3D85B 1LO0H 3FAWA 3TBTA 4MA1C 4NSKB 3UCRA 3WN6A 4IBLT 4RNRA 5HSFA 2DD8H 2OR9L 1H3PL 3FUKA 4NO5B 5KOVC 1OCOB 5L0QB 2ESVB 1T5XA 4HS3B 5ICXA 1JWUB 1HWGB 2AXGB 3AVEA 4WENB 2G9KA 4K5PA 4BFKA 5EUKB 3FSWA 3ARDC 1HHHB 1S9VA 2FT8A 2OJEA 4B9ZA 1BBDH 3VQLA 3T08A 4RRPM 5DK2B 4BWWA 3B2DC 1T21A 4H0HB 3HMWL 3LDBB 1AP2A 4NC1E 1H0DA 3G5XB 2NUPB 3MNZA 3A21A 5ACMA 2VM3A 3TZVD 2H32H 5ALCH 5D7LB 5A2KH 2R2BA 3NP4A 4B9GA 3NZ8A 5DMGD 5KBDA 1E42A 2D3LA 3L6FA 3DECA 3L17A 1J8HA 2YQ3A 1JVKA 1LVEA 1NFDF 2H2SC 2X10A 4ABQA 4M6OH 4JFOA 3TWCL 3BLKA 3SDXB 4P4KD 3FXIC 4FX5A 3T1FB 4ZXBD 2NY7H 4FKKA 4YX2L 4LPXA 1YAZA 4JDZA 1FPTH 1QA9A 3QI9A 3BPOB 2R39A 4MAUL 4PJ8C 1AD0B 3DUSA 2VDML 3FCTB 3EFFA 2ALAA 4XP5L 4ZAKD 1KUMA 1P4LA 3DUHA 3V6FB 1J8SA 5F7NC 3J27A 3JV5A 1Q1JL 3SCMC 4NQCD 2IMMA 2NXZC 4PVLA 3UBXI 5KSUA 1DQIA 3ZTJG 4XP9L 5I16B 6FABH 1G1CA 2OAAA 3IJSA 3DO7B 3FO0H 3MBXH 1AE6H 4QRFA 2NYKA 3SDCB 4NKDB 2EVHA 3BKYH 2SODB 5C0BB 3I50L 2IAMB 1FNSH 2PCPB 3IDMB 4PHZA 1U8NA 4JO1H 2CCVA 4MDIA 3QR1A 4TMPA 1OP5H 5GGVL 5JO5A 1LNUA 5TE7H 4MAYD 4QYOA 1T89A 3L8QA 5F0LB 3ZT7A 5J4MA 3EJJX 2F54D 1WZ1H 3QUZC 2CHXA 4JHAH 1CLZH 2Y7NA 1WRFA 3I3EA 2ZCKL 3EJQA 4M56A 4PJHA 4D0CB 2VIRA 5C09D 4KRNA 1MJJA 5TDPA 1R5IB 2W59A 5IWLA 5I6XB 2R8SL 3ILQC 5EIIG 1CD0A 4GW5A 1YEDB 3CZKA 4MJ2A 1U58A 3GYRA 5BJTA 3L2MA 4AVKA 4ANKA 2NW3B 1Z3GH 4MBRA 1C16B 3PFQA 1RUAH 4ZJ9A 4L3EA 1YA5A 4WJ5A 3W2DH 4FABL 3WXWH 5JMRA 4HWBH 4ODWB 4NZTH 4ZPTB 1QNIA 4G7RB 4P57A 3M86A 5TE6H 4JRLA 1TQSA 3KLKA 5DFVD 1BW8A 4GI6A 4PJ7B 3SE9L 4YEFA 4U6HA 3H8NA 4P23A 4XB3A 4X98A 1QSEB 2WVVA 3SKOB 1SY6A 3QJVB 3NZSA 4KAQH 2EXWC 4XCEA 4RGOL 1WIOA 3EKCA 4HUXA 2QGDA 2ATAA 1JERA 3TF4A 3EZJB 4Z7NB 3B9KB 1MUJA 1A6VH 1ZPUA 4YHLL 4C83A 4TQ8A 5BZXA 4GYBA 3DROA 3VWJC 2ZXBA 3L3HA 3AS0A 1I7TA 4AGNA 4FFZH 3KEDA 3P0VL 2P5WD 1KFGA 4F20A 4PJ9C 2QPFA 4MJ6B 3IS1X 3TNMA 5FK9B 4P07A 4XP1H 4ZODA 1K4CB 3G5VA 4MSWB 5B3NA 3KWXA 2VZ3A 5FHAL 3WEXA 4HXBH 5JQ6H 1FGVH 1FN4A 2JKXA 2H3NB 1C5CL 1K5NA 1AZUA 4MS6A 1UACL 3IXTA 4NN5C 4OGXH 4X8JB 1E5CA 5AVTB 3ALXA 3ZTDC 1WC7A 3GS0A 5E0QA 4PTUA 3LRSB 3OXRB 3JUYA 4EIUA 4HMEA 1BBJB 1QNZL 2RIKA 1JTOA 4QRPA 3BISA 3O41B 2AERT 4HBQA 1KPUB 3UTTA 1UB6A 4F58H 1UM5H 1TLMA 1YEEL 2ADIB 4DO6A 3MV9A 3UTSD 3D30A 2CALA 5F89B 3MRJA 3HMXH 3WFBH 3QXUA 3MLPA 4P2CG 3MFFA 2A4ZA 4NQXB 3H4HA 2FLRT 3NP3A 4NENB 4WNSA 4GKSA 3W39B 3VXPA 3VFTA 4ZMYA 4JFDB 3ZIYA 3QUGA 4QY8A 3B6SA 3MOQA 3BRDA 5ESQB 3HE7A 1XT5A 4DGVL 2ZWSA 4J3OD 3GDBA 4HIHA 3KL3A 2VE6B 2VN4A 5IB1B 2VXUH 4N25A 1BG1A 3APCA 4JLRB 5I1CH 4JUTA 3MUGB 4GFXA 1FL6A 1PFOA 4KJWC 2NZ1A 1M53A 3UAJA 5HHXH 4F5CE 1EXHA 1SXSA 5KSBA 2W0FB 2FR4A 1VGEL 1DCEA 2DJUA 1HILA 3DC0A 4YDNA 3BVNB 1IQWH 3DHUA 1MFVA 4FNRA 4NRXB 4UOW0 2LAGB 1ORSA 3NRFA 3PWPD 4LSDA 3A67H 3S5LA 5FYLD 5JIDA 1A6UH 5TDNB 2AQSA 4LVEA 1AKJD 5DD0L 4JHUA 5D71H 3FS9A 4FKEA 2OMZB 1CFMA 1DANT 4JQIL 4KX9A 2KPNA 4BZ2H 1MW3A 4AJ0A 5HGBA 2BLFA 4JFWA 4M8QA 4LVOC 3MBWA 3RE0A 1H3TA 4FLQA 3NIGE 5AW7B 3TYFA 1EGJA 1KBKA 2L7UA 5IMMB 2H9GA 1T6BX 3LQZB 4OIIH 3FT4B 5JQHC 3VFPA 2BFVL 1T0PB 3TFKC 4YVNA 3GSOB 3OKMB 2WNGA 2EYRA 3O2WL 3QK0A 3S37L 2VRAA 4MZ3A 4G8FA 4J4PD 1OY3B 1WFOA 3EJZC 2E7HA 4PRPD 4M7LH 3BPCA 2X6UA 3EUUA 5BRZB 4UCFA 3WTSA 5CEZH 4CW1A 3B3IA 4QRRD 3WIFA 1EJ8A 3BT0A 5FC9A 1LWHA 4OVUA 1GPOL 4HPOL 1J0JA 1MCEA 1WAAF 1G9ML 2EVGA 2ZOKB 5G55A 1MSPA 2XC8A 3RB7A 2A6DA 4MKMA 1S7XB 5C0AA 4DWHA 3VXTA 1V3LA 1LP9A 1LO0L 3G9AB 3H9HA 3V9EA 1Q9WB 3QDMD 4XP6H 3WTTA 3PQYE 2DD8L 4M00A 5ANHA 5JW4N 1P5UB 1G7IB 1YG9A 4XXWA 1GOFA 3LYRA 1BMGA 1S7TB 2V5RA 3WS6A 1XL4A 3MYJA 3LX9A 4XWOC 1BBDL 3PHAA 2G5BB 2YUVA 4J2XA 2NQCA 5CJXC 5PAZA 3PJLA 4GRWH 1A2YA 1RJYA 1T7ZA 4E41D 2HLAA 5ALCL 1CYGA 2QSTA 2F53A 5LNDA 1MVYA 1DBAH 3SYOA 4ZMNA 2QZ5A 3OVUB 4IRSC 2CG9X 3BLBA 1I3VA 3I2CH 4HIQA 3ZDZF 4NAQA 3LN9A 3EYOB 1F1AA 4M6OL 1VA9A 3VH8G 2NY7L 2A9NH 2K8MA 5E08H 2WBKA 1PF3A 3CN3A 1FPTL 1QEXA 1M7DB 2BP8B 4PYGA 4KRPC 4TKWA 4FFYH 1W0VB 5B8CA 3EFOB 3HRZA 1HC1A 1OAKH 4OF8A 2YS4A 4Y2NA 2W9DH 3FN3A 3CFTA 3FO0L 3FQXA 3MBXL 1AE6L 1GOGA 2L7QA 2BNQA 4ZX6A 3CPLA 5F97E 4HEMA 3ZKMD 3RLSA 4H13C 3C12A 1FNSL 4HIIA 3ZHFA 5I76B 2LAAA 5L8LB 4JO1L 3CFUA 3HVDA 1WDAA 3R7RA 2KKQA 3U2JA 3WY3A 3C5XA 1GL4B 5EU6A 3OR7B 5HYQA 1EZVY 5AB2A 5TE7L 2PW2B 3FN0H 4PV9A 1WZ1L 2W8CA 1YNTB 3NEOA 5GZNA 4JHAL 1CLZL 4N9GB 3QQ9D 5IEKB 3P54A 4IKJA 1B2WH 1B90A 4IEFB 5ICYB 4OFQA 3LQAH 2F74B 4RBPH 2CRMA 5CWSB 2K9UA 1HXKA 1NBCA 5LXVA 5JDSB 1NEZB 1YECH 5DZVA 4Z7OB 1UVQB 3TTYA 2YPLA 3S3PA 1KGXA 1KGYE 1Z3GL 3OR6A 3X13A 1X5JA 2Q86B 1RUAL 2UZIH 4OZIE 3ZDXF 3W2DL 3WXWL 2QKIB 4ELKB 4S0HA 1MFEH 4HWBL 4NZTL 3GMNA 3LVTA 3OD3A 5TE6L 3ZL4H 5IBLD 4KITB 3GLEA 1N0LB 1NGWA 3L3OC 3SBWA 3HC2A 3W56A 3RX8A 4XVOA 4A67A 3MR9B 4JDVB 3LH8A 4BIKA 3ET9F 1JZHA 4KAQL 2D2OA 4DP1X 4I85A 2JKWA 4LNRB 1XCQA 1Z7JA 2RGSA 4YNYB 2E59A 3TBBA 4HH9A 3BD4A 5F6IC 4G1EA 4MMXC 3LHAA 1A6VL 1FYHB 2ZSWA 2JJTC 3IFOB 2H1PH 3ARBB 2XA8H 1BD2E 4FFZL 1XIWB 1Q9KB 3RDTC 2P8LA 3BWAA 4GXUM 3BP7B 3TO4C 1PTZA 2VM4A 4A7GF 4ODXB 4YS4A 3EYQD 3V0JA 5ILTH 4XP1L 6CGTA 5F7UA 2JTDA 3U4KA 1X7QB 3EXJA 3Q1EA 4UUJB 4PGCA 2YOCA 3ZYOA 1I7RA 4HXBL 4ZYKA 1YRKA 5JQ6L 3IYLW 1FGVL 2OI9C 1A1MA 1HXYB 4FTDA 4JQIA 4Z7WE 2WQVA 5FGCB 3TV8A 4AQ8C 4BK8A 1T5WA 1G7QB 4EVNA 2HFEA 3SGEH 1WK0A 4OGXL 4UDUB 2R7EB 4G6AC 1WAPA 4PW3A 1XCWA 3HB3C 2YXVA 3LZOA 1WZAA 2VYRE 5EO0A 5EULV 4B9FA 1EEQA 4YN3A 4F58L 1UM5L 2IXQA 5HI5D 4AYSA 5IG7B 1V3KA 4L9LA 5JHDE 3HPLB 3V10A 3WFBL 1P7KA 2IDSA 4QI3A 5J89A 1U8HA 3LXUX 4N90D 3VWKB 1GH7A 1D5BB 2I7SA 1HL9A 3GRBA 1DANU 2O4EA 3DGGA 4ELDA 1VFBA 1FYTB 2VXVH 1I3RA 4DZ8A 3VU2A 3BOVA 3QUKB 1Y07A 4NGHH 1ZLEA 2V7HA 3L16A 2PR9A 5SWSE 5I8CA 3A6OA 4EO5A 2VXUL 3K0WA 5ABZA 2PYFB 3QNYB 3O3BA 5D2NB 3VFGH 1PYWA 1RHFA 2D31B 2C7UB 5I1CL 1PJ9A 5I24A 1XR8A 3CHPA 5HHXL 4LQFH 2CJUH 3K2MC 5C7ZA 4KKNA 4UV7H 2CBMA 3L9RA 4Y4KD 5IQOA 4YIQA 3RKDC 1IQWL 3FSAA 43C9A 2C8NA 3DOIA 1NDTA 4ZW3A 2HN7A 1ZVNA 3ARUA 2DJ4A 3A67L 4L4VB 4DVBA 3ARFC 4HOMA 2VLJD 1A6UL 1TQVA 4Y8DC 1SLUA 5FLVA 2XNAA 4WV1C 5D71L 2WM0A 1OQXA 4BZ2L 4FZ8H 1CR9H 3UZEA 2GAZB 1IEBB 3NH7H 3GJFA 4HJGB 3REVB 3FSZA 1XSJA 4LSSH 5ANMA 1QW8A 2X6CA 4OIIL 1RZ7H 5FB8B 3I6SA 3DIFB 4JMNA 1G4MA 4BA0A 3IF1B 2X70B 3HC3H 3CN2A 4MCZA 3CZLA 1IBYA 5DS2A 5SWZB 1ND0B 3CDFA 3D18B 4G5ZH 1YMMB 2PP8A 2XHNA 3D09A 4WWPA 5DUBA 3MVSA 3TU6A 4APQA 1NUDA 3BKCH 4LL9A 2QR0A 2OMWA 4M7LL 3ZW3A 2X4SB 5CEZL 12E8H 2E4TA 5LAXB 5FFOA 2ICES 1XMEB 43CAB 4U1NA 3LXCA 5C07A 5IVXB 3TIEA 1AGDB 4LASH 4XBEH 4ZMZA 1VESA 5J13C 4L23A 4XNUH 4AEHH 1S7WB 4WEMB 3HHSB 3UBFA 1FCCA 3N3EA 4DOHE 1MW1A 2WCPA 5I1AB 4K23H 4FQJH 4YSDA 1JPGB 3NZHH 5KYNA 4OZGF 4WWKC 4W6XB 4AIXA 3TASA 5FECA 1QOKA 3NJLA 2PTTB 1OT1A 4XP6L 2NY4C 3BZEA 3CN1A 3L54A 4NZJA 3FO9B 4PVBA 2DQCH 3IJ8A 5EWIH 2GTZA 2HXAA 1U8OA 3FF8A 4MNGA 4EI6A 1L7TH 1GGYA 1I8LA 1KBWA 4P4KA 4B7IA 1XR9A 5E2TH 1RHHB 1HYRC 1CURA 4NO0A 3SOBH 3QQDA 3K8KA 2ISDA 4JG1H 2R69H 4JZNA 4M1CD 5I1JH 4Z7QE 3HG5A 3VXQA 4ZAKA 1JNLH 1JPST 1BQ5A 1A5FH 2ROYA 2ZP0T 3I75B 2K78A 3CSYB 3TCXA 5ID0B 2V5MA 5GRWA 1A3RH 4NQCA 3R0NA 4WNJA 4JM4H 1Q0XH 4RFNB 4YHPA 2WWMD 2TAAA 1DBAL 4Y5XC 5IHUH 5DEZA 4QO1B 4JPIB 3DX9B 3QWRD 5DVNA 1LEKB 3PRZA 2CE6A 4X80H 3I2CL 5EC1B 3VGBA 2KLSA 2OJ1A 3MRMB 2IOIA 3NCYP 1ROCA 1NC4A 1C7TA 4Q58C 1PY4A 4YO0A 3DX2A 2APXA 5DD6B 1Z5HA 2IH1B 1J18A 2A9NL 3GSVA 4DIXA 5E08L 3BUYB 2IMNA 4DFIA 2BOLA 4FG4A 4XOBA 2E27H 1CDUA 3IJ7A 3CZEA 2R4SH 4FFYL 5C09A 5D4HA 3B7UX 4LLUA 1OAKL 2BIMA 3RUGF 2YEQA 3DKHA 3NFNA 2HA1A 3FU5A 2W9DL 3RTQA 3HE6D 1BVLB 2DIBA 2ZYIA 1UXLA 3RPKA 2NY6B 4I77H 1ETA1 4EI5C 1P5VA 3L2NA 4AE1A 2V7NB 2XBTA 3FTWA 1OWWA 5F7LB 3M88A 4YBQC 5JPMB 4FA6A 3FTUA 5GJSH 1IGMH 5IY5B 2J44A 1GOHA 4BFOA 3PP4H 4PJBA 1E43A 2YEZA 3FN0L 4LOUC 4N5EC 1QUNB 1A4JB 2BY3A 1F0LA 5I9QC 4P2RE 3GDCA 4FQXA 4HUUA 2WXKA 5AD0B 1B2WL 2DYPB 4R2GC 1WFMA 3DI3B 3LQAL 3F65A 1U91B 1YQVH 2EDKA 4JFZH 4JK0D 3WNOA 1RMFL 2JJVA 4NO2A 1FDLH 1CI3M 1YECL 3F7RA 1FF5A 3QA3A 3X2QB 3C5ZB 2C3VA 2SEBA 1AGCB 1TQUA 4GQRA 2UZIL 2WK2A 3T4AB 5FOBB 4F7EB 2QVFB 4AIEA 5C0DA 5MENA 3GMRB 1FZJA 4U1GB 2EAEA 4OFVA 1MFEL 5JLZB 1NM9A 2P5WA 1F13A 4PJ5E 1L9SA 5C0CE 3ZL4L 1D3CA 5DTFB 4PJFF 2YRBA 3F7QA 4HS6B 3UZVA 3MA9H 2RFXB 3B7SA 4IS6A 4ZZKA 3FQTA 1C1EH 4KI1A 4PJEE 4GT0A 5CR1A 2Y1VA 3G6JA 2G3ZA 2Q6WA 3CH1B 2HJFA 5LVEA 2EE6A 5LBSH 4R97C 3JWNH 4LSVH 2VABA 4NWTH 4Z7UA 4GSXA 3IMSA 4LP5A 3Q6FA 5DJXB 5J56B 5FF6A 4PREB 4LSQH 1SVBA 1UB5B 3GMOB 1R3HB 2C1PA 4R7XA 3W3BA 4WHYH 2H1PL 2DLGA 3ZYIA 1K8IB 3TVMB 2XA8L 3U6XS 1C5BH 5KVGH 3SGDH 5E6UB 1BDYA 3R06B 1NFIA 2Q2EB 4JJHA 1AY1H 4KQ4H 2D0GA 1HFUA 3IDJA 3SDDC 4I5BA 5DO2C 1XF5B 3UTSA 1BZ7B 3QISA 5ILTL 3KBFA 3WCYA 2YD6A 3GMQB 2J8UE 1PD6A 1RULH 5J7CC 2ZAIA 1OTUC 3K71A 4AOFA 1RLBA 4BZ2A 4HUWB 3CZUB 4O02H 2C4XA 1FVEB 3U4EB 3Q2CA 4Q9QH 3RX7A 3UTZA 4XVUD 3QHFH 4XT1C 4XN8A 5HHQB 5J9PB 1BD2B 2OXHB 1OTSD 2BH0A 2AGJH 2ZYRA 4MWFA 3Q9QA 5F1NB 3DVNA 4AE0A 3VI4A 2L3BA 2BVYA 4UTAH 1NCCH 4FMVA 4TLKA 3BH9A 5F8RC 5JOFA 5MEOB 1T66C 1HNFA 4LHUB 1FNGA 3NGBC 4F9PA 1A3LH 1AOHA 1RVFH 4WCYH 2EE3A 1GY1A 5F7BA 5FKPB 3VU1A 3ALWA 3CSTA 3LKSA 1A6ZA 5HHOA 3PWPA 4QCIA 2VXVL 4UAHA 3WTUA 4RAVA 2AW2A 4NQED 5D7SH 4ENEC 2QSQA 1I8UA 3BO8B 4NGHL 2C5DC 1OAQH 1TJIL 4JFPB 1GHFL 2YMTA 3F05A 5B4MC 4QXTB 4YPJA 3GSNB 4LCWE 3ATEA 1HH6A 5K33A 4S1RH 1EQWA 3VFGL 1L0QA 1QFWI 5FLUA 4N85A 3NDYE 5DQJB 3IGKA 2A9MH 1P9MA 5DYFA 4FAAB 2VXTH 2ZXEB 4LQFL 2CJUL 4FI6A 5FO2A 2DLTA 4N24A 4UV7L 4BFBD 3GUTA 4I18A 2NSXA 2A1WH 3WDHA 1UD3A 2UXTA 2R15A 3B7RL 3VW3L 4PRPA 3DXAA 3VI3F 4GBXB 5H94A 2BIPA 1TVHA 3BDXA 1REIA 2VW4A 4UZGA 1SMAA 4QRRA 2FEEL 3K6SA 5FV2A 3DO4A 2W07B 4WFED 5T3XH 4FZ8L 1EDQA 2Y22A 2F6AA 4ZMVA 1CG9B 3NH7L 4H5SB 1U6AH 4TQPA 5SWSB 5FDWA 3RY6A 3VGFA 4LSSL 3BDYH 1RZ7L 1HKLH 2O5NA 3D34A 5E4IA 5EPMA 3VVVA 4CC4A 1QBBA 4HIEB 4HZLA 5KSAD 3HC3L 2VLLB 3F58H 5I1DB 3D3VD 1DN2A 1IKNA 1RZJH 4B50A 3F7KA 4BXSV 3HRPA 3QDMA 4FQQA 3WNIA 1CBVH 1ZS8A 5E8PA 3KG5A 5IMKA 1DE4B 1GW6A 3T0XA 1SRDA 3QCTH 2AQPA 4G5ZL 4PLKD 5BCAA 1D5ZA 4DERA 4G8EA 4XBGA 3BKCL 3BP6A 1XCTB 3U1QA 3LZPA 1M1XB 3HW7A 3FTSA 12E8L 4TNFA 3QDGB 5KUMA 3KGSA 1OGTA 4FFYA 4LASL 1L7IH 2YJLA 4XBEL 4GI9A 4NN7B 3K4ZA 4XNUL 4JVPA 1SMOA 4XZUB 5DA4A 4GSRA 4AEHL 3QIBD 1J8HE 1QSFD 2VMDA 3EGDB 3QNZB 4UMSA 5IB4A 2OL3A 4K23L 4E41A 4FQJL 1J48A 2VLKD 3NZHL 5CD3A 1EX0A 1QSVA 2DYRB 4FXTA 3QW9A 1K3IA 1C5DA 3MUJA 4ZO7A 5FA4B 5J1AB 4QTHB 5GGTH 3PWJB 2BERA 2E9WA 5E1HB 1SHWA 2DQCL 1I9IH 3IPEA 2JF1A 2EDTA 3KWUA 1ACYH 4EI0A 2DM2A 4Q2ZA 3UEQA 1L7TL 2YSSA 1Y6MR 3QNXA 4BKLA 3LD8C 4TTDD 5AFAA 1R34A 1XX9C 1Q0EA 2OX5B 3CG8A 4QHNA 2L8AA 5E2TL 4G43A 3PYCA 3SOBL 2XA3A 3GHBH 4JG1L 2R69L 3KJ6H 4JGJA 5I1JL 3MJ7B 3HS0C 1JNLL 3R1GH 3I74A 1A5FL 3D0LB 3ABGA 4GO9A 4U1MB 1DBJH 1XGQA 4DOHB 1A3RL 3CZGA 3U7WH 1N5YH 1Q0XL 5IHUL 2J1WA 3KBEA 4NKQB 4X6CA 4BQCA 5EOQH 3FO2B 1WQVT 3ZQWA 4X80L 4OZ4A 4UOQA 1MCNA 2EEBA 1O9ZA 2XYCA 1KBBA 2Z31B 4MDRA 4PJHE 3U6RA 1FJ1A 2EINB 3WYRA 2ADGA 4QRSB 2PTVA 3ULVF 2C26A 2A6KA 5DS8A 4E5XG 2IVFC 2OA9A 1IM3B 2OTWA 1IARB 3TJPA 4QWWD 1BIIB 4HKJB 5DGQA 5D5MF 1SYVB 2E27L 4K71C 4EAEA 3DLQR 3CVHB 1JXDA 2R4SL 1HHJA 2VDPB 3JBG7 4CMHB 4L3EE 1SHMA 2BZDA 3HAEH 1MHPH 4G2AA 4M4RA 1WWWX 3KYNA 4JPWH 2BVTA 1ZHBA 1OZUA 3EO0B 3KNBA 2B14A 5B39G 1ES0B 1Z3RA 2DLEA 4I77L 1GYWA 3BGFC 3WGVB 1AO7A 3JT2A 1EEUA 1E9OA 4ONOA 1JMZA 5BQDA 1XH3B 5IROA 2ATPA 2NY0D 1IGML 5GJSL 3AG2B 4HJ0D 1I8KA 4PVMA 3PP4L 5E56A 1UM4H 4PLOB 1MF2H 5F1SA 2CQVA 4UQ3B 1M6OB 1RK1A 5TFSH 4RFEB 1J5DA 3KLAA 4OZFB 3X1FA 5IKCA 5FM8A 4ZMTA 2PPCA 3FAXA 3HI6H 3VRIB 5AZ2L 3FB8A 3QXDB 3MU3A 2XIDA 2GJZA 3NABH 1YQVL 4JFZL 1UT9A 2WKLA 5PCYA 1HJCA 2J88H 3EYVB 1FFTB 3WTVA 1FDLL 4I7ZC 4HS8H 4LCCC 2EUVA 4G42A 1ILUA 1WVZA 4PJXA 4Y2DC 3P4MB 3F85A 4ORZC 2MRYA 2ADJB 3L95A 2X5PA 4CSZA 1OK8A 2YJQA 2G4GA 2ICWB 3ZKQD 1NTDA 4X6FA 4X7EC 2YXFA 3GSWB 3OV6A 3QJZA 5SV3A 2ZKHH 4H1LB 4HCRH 3JQOB 3FCBA 3TLRA 2P5PA 3MA9L 4FNTA 4IK7A 2JTYA 1KB5B 1C1EL 4P2RB 3MUY1 1GGTA 5AOJA 1WT5A 3ES6B 4UDTB 1YY8B 4QRPE 1OM3H 1OW0C 2WLNA 3TN0A 2PUQT 4XMKH 3UTTE 5LBSL 3IM1A 4LSVL 4NWTL 4GT7A 1LXMA 3RGVA 3MV9E 4LSQL 1EZVX 4F2FA 1H6UA 4PJGA 2A83B 1JGVH 3CHXA 2R2HB 1ETZB 3NEEA 1C5BL 5KVGL 4FQHA 1IEAB 3HG1D 5I8EA 1AY1L 2XTJD 2Z3FA 3TONA 4KQ4L 1NDMB 5C0CB 4ANXA 4CBZA 2NY5C 1U93A 1DVZA 1G9NC 2WLHA 3ZXAC 4EZKA 1HEZB 1N10A 2CK0H 3IDNA 4GAYA 3IFNL 3MROA 1RULL 3E1ZA 5DEGB 4K3EH 4PJEB 3ZGIA 3RTLA 4XMUA 4GRLC 4FLHA 4N8CL 1SHSA 3C87A 1IC5H 2E3VA 3FB5B 4O02L 4WTZA 3TJHD 4GKZA 4R5XA 4DN4H 1GC1C 5JOPD 4YBLB 3INUH 1OHQA 4C59B 4Q9QL 3LEXA 2XWDA 5AOLA 4O51B 1ZD6A 5KSBE 3CQFA 4Q14A 3GIVB 3QHFL 3AZUA 1F1GA 3QPQD 4L0YA 1KIUB 3WLWC 3ECBA 2K6ZA 4NKMB 2DWTA 3MNWA 4HALA 5ETUA 1KT2A 1KJVA 4ZS7H 5FUCC 4UTAL 1NCCL 1JCKA 3MRCA 4Y4KA 1JJUA 1G4RA 2VH5L 4XTRD 1A3LL 1RVFL 4WCYL 3QHTC 2LHAA 4X5WB 3AAZA 5E1IA 2E6QA 1E8YA 1GA2A 5C0JA 4P59H 4X9HA 1KTDB 5E70A 4HUNB 4XBMA 5D7SL 4OJCA 1SXCA 1B6DA 1OAQL 3FT9A 3TBWA 3V5DA 1BF2A 5MHSE 3I3BA 4L8SA 5LDSA 4WWOA 4G83A 5D7JB 3FO1A 1N2RB 2P1YA 1HHKA 5AW3B 1S7QB 3D2UD 1YEWA 1F3DJ 2ATKB 4S1RL 5DC4B 3RWEA 1ZGLB 3SE8H 3O9WD 4F27A 1SOQA 3AY2A 5C3TA 3LZNA 3WJLC 4G7YL 1DFBL 2A9ML 3WIIH 1GY2A 4BZYA 1P4IH 2VXTL 3TT3L 4M8RA 4GS7B 5GRXG 2QJDA 4HGWA 1R24A 4XBPB 2YO3A 4AQEB 2X38A 4Z76A 2F7QA 2A1WL 4ODTH 4IDJH 2LQRA 3F7LA 2ARJB 5T1MA 2R83A 4ZMPA 3BQVA 2R69A 4R83A 5C0AE 5DVKA 2WXPA 3RX5A 5JW4R 4DGIH 3BW9A 5MEPA 1LP9E 1QO3B 2Z8WC 3MRQB 4HKBB 5DI8B 3BEWB 1OQOA 4I4WA 5T3XL 4FRWA 2ZWZA 1LYQA 1U6AL 3CFJB 2YBRA 3FCSB 4U0QB 5JIHA 3BDYL 1HKLL 2D03H 4ACPA 1CLCA 2I26N 3QDHA 5B1JA 3F58L 3G5YB 3GMPB 3KPSB 3MRFB 4F15C 5KZCD 2IBZY 1B0GA 1RZJL 2P8MA 2WQRA 1XO8A 3UOAB 1CBVL 1I1RA 2Q8BH 4N2FA 2O30A 2KUTA 1SEBB 3S35H 2WUBH 3QCTL 1L9TA 4EUPH 3F84A 3L2LA 4RWYH 1CIUA 4GOSA 3BRGC 5GGUB 2CDGA 5HI3C 1TJGH 5CEYB 2F53E 2MQCA 5AYTA 4MQTB 1L7IL 2YARA 4HHWA 4YDJB 1QBLH 4MVBD 4H25A 4MJ4A 5CGYC 3ZKXB 3RFZB 1UOLA 5DMKA 3PJSA 3O8XC 1MHHB 2V2TA 4U1LB 2F15A 3ASOB 3VSVA 4L9DA 3PWNB 1N70A 2RD0A 5ICXB 3AU1B 4KROC 1I7UA 2EYTA 4LL4A 2VUKA 4FD0A 2VZ1A 2ZOTA 5F70A 3SE4C 4R90H 5GGTL 2PO6B 3QWRA 2OJEB 3T2NH 1I9IL 1XGPA 1ACYL 3US9A 1RPUA 1AP2B 1QI5A 3IAGC 2HKFH 2IWFA 1UFGA 1TIUA 3OZLA 4HETA 1T2JA 4TNWF 4CGTA 2ZUQB 2YHGA 3C60C 3EH3B 3ZDYE 3C9NB 2BNQE 3T77B 1YEKH 3T09A 3GHBL 4GQQA 4EN3D 3KJ6L 3M1BB 4HEME 5F71A 1LE5B 3R1GL 2HVKB 2X1OA 1JI1A 2WTRA 1J10A 1DBJL 1QR4A 3QCVH 2EO7A 1N5YL 1AYRA 3MDJA 2NTFB 3OBAA 5EU6E 3B5HA 1BJ1J 1YPZF 4OLWH 3L1OL 2NNAB 3BAEH 4L8CA 3U83A 1DBKH 5EOQL 5BXFB 4AQ1C 4NKOA 1ZA6B 2ZKXA 4M7JH 5C3LD 3EYSH 3ME0A 3GPSA 3B9DA 3EFFB 3UIYA 4AZ8A 2P5EB 1F6FB 2NNCA 2QVIA 3C6EA 2WTOA 3RJOA 3F7YB 3DV6A 4I2XA 4S0SD 3S5YA 4YGVB 1CGWA 2W0LA 3KJ4B 3IJSB 5I1KH 2YPVH 3KEHA 2YPLE 1RV6X 3U7YH 5LBSA 1MHPL 2FRGP 1U8NB 4IK6A 3MRBB 4JPWL 1OE1A 5HYSG 2FZ3A 4GUPB 5F9AC 1YLBB 1LNUB 1BVKA 3GI8H 5EBMA 3ENEA 4R4ND 2GSMB 2HG5B 3HC4H 1LGVA 1V27A 4PJHB 3W9DA 5TDPB 4BCXA 3FUHA 1KBGH 2QKSA 3IWUA 1F4HA 5F7FA 5DVLA 1UM4L 4X8GA 1MF2L 2Q10A 3ZX1A 5T3ZD 4Z78B 5BJTB 2QADC 5TFSL 4RGND 2EDFA 4O02A 3HI6L 2LVEA 1MFNA 1ZIAA 4IRJC 4F80A 3Q43A 3NABL 3ZKND 1Z5LA 5M7QA 4MRBA 4D0BB 2J88L 3EJYD 5E03A 2A38A 1K9TA 4HS8L 5EO9A 4XVTH 2CPUA 2FLMA 3N40P 2WBJD 2I85A 4LOFA 5D2LA 4CU7A 4P23B 4X98B 4Z7IA 2DLHA 3KLDA 2WVVB 4Y1SA 4HOXA 5LGJA 3WXVL 3KS0J 4Q7DA 5E8DH 1R3KA 4WO4D 2ZKHL 4XCEB 4HCRL 5C2UB 3NYKA 4LPVA 2YAHA 2KMWA 3D2TA 3N41B 2PWDA 1TQBC 2XZQH 3UX9B 1BFOA 2TSBA 3MJWA 3SN6N 4D9QD 5CZXD 5ESVB 2JV6A 4NJ9H 1QKZH 1MUJB 4XNZC 1OM3L 1I1AD 2YZ1A 1EZSA 3DROB 4UF7C 3L3HB 4XMKL 2MKWA 1DVFC 3L3DA 4C56B 2NXZD 3L7EA 2ENJA 3I6GA 1H5BB 1WCQA 5DJZB 2DICA 1IQDB 4KTDH 2DQTH 3HS9A 3ZUNC 2P26A 2P42B 1JGVL 1EJFA 1OAZL 3KPTA 4NUPA 4YR6B 5I28A 5ADOL 5KYWA 3UBXA 4A2LA 3GLDA 2DPKA 3LQMA 4Q6IC 3LKOA 1KCUH 3WEXB 5DYOA 4J27A 3RVVC 4QXWA 4P0DA 3ZDZB 1JZDC 3AM8C 5SWQA 1K5NB 4M5TA 5ECJE 4UNVA 1NWPA 2CK0L 3BFOA 4XN5A 1SFHA 4XWGH 2WAHA 4PLJD 1WC7B 2E75C 1YUHA 4H26B 4PTUB 4K3EL 2BIIA 3SYAA 3T04D 2VL5A 1J8KA 3W11C 1UZ6E 2NR6C 1IC5L 3VNZA 4NO3B 2P45B 3INUL 1UCBH 4BH8B 4JPQA 4Z3EA 3UG5A 3SZ6A 1HNYA 1WLHA 5ES4B 3MRJB 1UD6A 2BNUB 2W91A 4JUSA 4GIPD 2I25N 4JQVA 1XBRA 5TDOA 3ZT6A 4HJJH 2CLVA 4CN6A 1AZZC 4YHYC 5JHLL 2FSDA 3VFTB 4ZS7L 5T5FH 1YDPA 2XJLA 1GGBH 3OPZL 2PWFA 2YD8A 4Q4EA 2Z0BA 2GITB 4HIHB 1VZGA 4RA0C 5F3FA 1RZKC 4Y5VA 3FU9A 5ANME 4XOAA 3SKNA 3EJPA 4IGBB 4DK6A 5KYXB 3BC9A 5EA0H 2IO5A 4YHKH 4P59L 1VFOA 3IKKA 3WKNA 2PLTA 1AQMA 2X4UB 4HQQH 1LMKA 3UGXA 3S3SA 5KYYA 1EVTC 1U95A 1QRND 2FR4B 1I1FB 1G7PA 2K3TA 5C0FB 3PNWA 1Q90A 3SE8L 1ZANH 1SDDB 4OF3A 5GGTA 1FSKC 3BN9C 3ISRA 3MZGB 3D3VA 1P4IL 3BUIA 4GAFB 3WIIL 1EJ6A 3A22A 4JG0H 5FO7A 1R33A 2KDYA 5C07E 3S5LB 1NEPA 2CO7A 1HINH 1BX2A 2VN6A 1BMZA 3ZDXB 1N6VA 4YDIH 1HDMA 1MI5D 2BCMA 2J6WA 5HGBB 4ODTL 3G5ZA 4XN9A 4IDJL 2ZF9A 3MBWB 1KNOA 2CRIA 4F2MA 4KJYB 4NUGH 4DGIL 4RAUB 4JRWA 5CF3A 1KZQA 2B1HH 1CLOH 3P4LA 4FFWD 2CRZA 2Z91A 2DH2A 2DM3A 3C5SB 5B38B 2R0KH 4OIBA 1I85A 2BRQA 2D03L 2FX9H 1QAWA 2AQ3A 4G8FB 1XSIA 4L2LA 4MNGE 5TPWH 5L0QC 4FE9A 3DSNA 5FM4A 1AIZA 3QEUA 4JFXA 3GXIA 1UA6H 2Q8BL 3L5XH 3KLHC 3S35L 2WUBL 2V2WA 3KPRA 1RK7A 4RWYL 4DKFH 4TQHA 3LDBC 5D72H 5F7DB 2D8KA 2WANA 4U1KB 4XZ4A 1C08A 3IJYA 5H35B 1PZ3A 1TJGL 2A6DB 2DWEA 4NQCE 4PRID 3WHE0 4K55A 3GB7A 3MFGB 5D1XA 4R3SB 3VXTB 1VERA 1QBLL 3AY4C 3H9HB 4AK1A 4JM2A 4MXQD 4AW7A 1T4WA 2BVPA 3MRKB 3C8HA 4MQ7A 4IKNA 2ZNXA 2G60H 1ZA3A 3QFJB 1OCRB 2J2ZB 5HJGA 2VDRB 1KCVH 2BMKA 2CXGA 1G94A 3MYJB 2AEQH 1BQLH 2ZTBA 4R90L 3T2NL 1KY6A 3L7FB 3BPOC 3BKJH 4E9QA 4L1SA 4LSRH 3NBNA 4X4XA 4W9ZA 2WMPB 3TYGH 3MQIA 5C09E 4LLVA 3H6JA 4U2YA 1DVYA 4JRXD 2HKFL 2AEWA 2A99A 2Z64C 5HTSA 3E2HB 1RJYB 4AEIH 2HLAB 1JGDA 2AJVH 3ULVH 1CZ8H 1X5LA 1YEKL 3SDCC 2WO4A 3VO0A 3KAAA 1DZ0A 3EO9H 1NLDH 2IAMC 4NZFA 1NGQL 2ZIDA 3QIWA 4F37K 1IGYA 4PD4J 5HYJD 3PGCB 3NT0A 3QCVL 1X3DA 2DQ6A 5EIVA 5D1ZD 4HUCA 4OLWL 1F42A 4GG6F 3BAEL 3CU1A 1TTAA 3TWYA 1DJXA 1DBKL 4NWUH 4PJBE 5BUGA 2AQNA 4LE8A 3EYSL 4WHTB 3NFPB 4KTYA 5B8CB 3HRZB 2BOBA 4HK0A 1EO7A 4N2EA 3OKEB 5GS0D 5I6XC 2DB8A 1M2VA 4WEUD 5F8QC 3CX5J 5I1KL 2YPVL 4M93B 5D7IA 3KGTA 4OVVA 3D69B 1BV8A 1VF5C 5HHVH 3U7YL 2JQAA 2ZE0A 3D39D 5HI4C 1D9KA 1TVBA 2VNCA 4FCHA 3IPFA 4AH2A 1BVNP 4BV1A 5MENE 5CHNB 3IETB 2P5WE 2HFFA 5EU6B 2FUQA 4X5XB 1RZ8B 4WK4B 1CU4H 2YD3A 3GI8L 1ZHNA 3O45B 2EQDA 1CYXA 3HC4L 2WSDA 1QR1A 3HKFA 4OFDA 2QFPA 3QORD 4X6DF 5EIIA 1X6NA 3G6JE 5CINH 2P80D 1T7XA 1KBGL 1NKRA 5ERWA 3S98A 1QFWH 3C6LD 3MBEB 1FL5B 2FNBA 4Z7UE 3BIKA 5B1CA 1YEGH 2CDFB 4NNXB 5FYJD 5BZDA 1UUNA 4JBSA 4HWEH 1D5RA 4XC1H 5C8JB 2YPLB 3B9KC 1D2OA 2D2CC 1TYRA 1U30A 2AVFA 2H2PD 5B22A 1S8DA 3MA7B 3X13B 4F1SA 4X5RA 1COBA 3CIQA 3VMPA 4P3DB 3K6IA 1DQDH 3SKJH 3RFRA 2YGPA 3GMNB 1KTRL 1FL3A 4XVTL 3T8VA 1IAOA 4PJIF 3UTSE 2X4OA 1DBMH 1E28B 4OZGB 5CNHA 1QLRB 3EJTA 5JHLA 1JOIA 1NBQA 4FLOA 1VEPA 1C12A 5BW7A 1U3ZA 5E8DL 1MJUH 3HVNA 3DARA 4AJYV 1G6VK 5KS9A 2OSXA 2J4WH 4MJJA 3FB6A 2YRZA 1A1NA 4JFFD 3AFLA 4YHNA 4ZQKA 4M03A 5AAMA 1SDYA 4HH9B 3K2IA 2VDOB 1A22B 1M2OA 1CXFA 1QKZL 4G1EB 4RMVA 4UT6H 5GRUH 2VR5A 4Q9CA 5I5IA 5KYUB 1JAEA 1MIEH 2UWEA 2ZSWB 4KXBA 3O2DH 3HN5A 4NQVB 3P4NB 4Y4HA 5H37H 5C0IA 4OLYH 4PN6A 2DQHH 3P3RA 3QJOA 4QRAA 4L4TD 4PG9A 4WEBH 5I17B 3IMRA 5JPNB 4HWZB 2WINB 3OKOB 3VI4E 4KTDL 4NCC2 2AKRA 5E7BA 1Z32X 2B9BA 3VRJB 2DQTL 5CEZE 3A4AA 1CF1A 1J5IA 3O3UN 5GS1A 3ECVA 1A9BB 5BQ7B 4X4YA 4KXCA 4YHIA 5AVXB 5BVPH 5E24E 1KCUL 4G9FD 3BJ91 3BVDB 4ZYKB 5HHOE 3PWPE 1UJ3A 5BPPA 5FYLE 4MMYB 5HDBF 4JFYB 1NOFA 3BXNA 1JWMA 1HWHB 2EJ1A 5IB2A 2CCWA 3ESVF 3MV7D 2M2DA 4RMSA 3OMZA 2A74B 2D7QA 4NIKB 2BINA 4FG6D 1BECA 4WHCA 3QZLA 4KI5E 5D7KD 5C08D 3WLBA 5L4FA 1ZHKB 1UCBL 4LLQA 3UBGA 4XNQA 1L3WA 1M05B 5IUCA 3HZVA 4Y4FD 3CLFH 4CKQA 5EU4A 1AGBA 4N2KA 3D2UA 3A4DA 4PRPE 3DXAE 1NH6A 5A2CA 4MD5B 2EDLA 2R51A 3FT0A 5IQ7H 2DWDB 1THAA 4HJJL 5KSVA 4EUPA 4QHLA 4QRRE 3G5WA 1G0XA 4FXKA 5E23A 3FONA 5T5FL 4GRWE 1I3RB 3FOLA 4DZ8B 3OL2A 4I1NB 5KBLA 4YL9A 1GGBL 5J6GA 3RIAK 1WD9A 3L5IA 4LT7A 4JNXA 4R9HA 3P3YA 3UMTA 1WIPA 5CSZA 1WFIA 3W0WB 1H8OA 1AFVH 2R2EA 3GSRA 4WWID 3TA3D 1CLYH 1KTLA 2YRLA 3KD4A 4PS7A 3VSUA 3O3BB 4RQQA 4Y9CA 5EA0L 4YHKL 3ZHDA 5JHAA 1LDPH 4OD2A 4JQXA 1LJMA 4HQQL 3H56A 3QDME 3KHOA 4N8VG 1MFAH 1TQCB 3ZUCA 4IYKA 3SY0A 4ABUA 5IFJA 2FJUB 2EE2A 1JZ6A 1PG7H 3GHEH 4KK9C 2X6BA 1ZANL 2WJ7A 5F6HI 1IZJA 3QC6X 3T0EB 4JG0L 4CDHA 3TO4D 3CN0A 4JX0A 1HINL 3N85H 3KYMA 4N8UA 2IQAA 3ZOAA 4G9DA 1BSIA 3KLLA 3Q2WA 1OCCB 4PJFB 2VKXA 1KV3A 1Y6KR 3H7LA 4R4FH 3ZZSA 3GSXB 4E41E 1VCBC 5DFTA 3RVUD 4NUGL 4HJTA 2CJTA 2DN7A 2B1HL 1CLOL 4BH7A 4DP4X 5DJ2B 5IVNA 4PRBA 1AHMA 2DDQH 3NCXA 1OSZB 4UAOB 2R0KL 4PGZA 3HZKA 3AXHA 4M9OA 5TPWL 5KAQG 1F3JB 2FX9L 2OFQA 1KLGB 2ICEB 5DUBB 1P5UC 4R7DB 3L4YA 4MJHA 4Q97A 1UA6L 1FBIH 1KLUB 2G9HB 5JXEA 3L5XL 3S8GB 4NLHA 1HQRA 3HNSH 3ARGD 1VFUA 3RYMA 1MCQA 3T3PF 3U2SA 4DKFL 5D72L 2R0LH 3U1SH 4AMWA 2YPVA 2GI7A 1JPFA 1UURA 1EFQA 4XPBH 4BEIA 3TZVB 3NUKA 3DTUB 1X6LA 5DMJB 3SGKA 4AC4A 3HG3A 4YFLI 1U21A 4X6CE 2B2XH 3SE3A 1WBYA 4EN3A 1VKXA 1NOAA 1CGYA 4RISH 4UTBH 2CJ3A 3KBHE 4OZHA 2LLGA 2JJWA 2G60L 3P73A 4EI6B 3F83A 2YR3A 3CC5A 4EXPX 1KCVL 2N3JA 3OWEA 4ECNA 2E74C 1W15A 3BQUA 5GPRA 1IIKA 4WW2A 1BVNT 4P4KB 1K3ZA 5HHPA 4P46A 4ZXBB 2AEQL 4U1JA 1BQLL 1RAMA 4JN2B 3SBPA 3BKJL 2X88A 4LSRL 2GIMA 3GLAA 4BQ6A 3TYGL 4JZNB 4WU7B 4F8TA 5D9SB 4ZAKB 1VFAA 1PIFA 3QB7C 4B9IA 4D3CH 4KY2A 5IJVA 2HB0A 5EN3A 1X5MA 4AEIL 1AS6A 3P77B 4L8BB 4NQCB 2AJVL 3ULVL 3Q48A 1CZ8L 2CNZA 3BD5A 4YZFF 4QIRA 1GJIA 1OB0A 3SSGA 2Y7QA 4JKKA 5MI0B 2IBZX 3APNA 3EO9L 2DEXX 4XNBA 3QXVA 1NLDL 4PSRA 3ARYA 4LF3A 3F64A 1LK2B 3BYYA 4B27A 4DAGH 1AO7E 3VH8A 4BE6A 4G6FD 1FFOA 4B60A 1UZGA 3EOTH 4TVPD 3RWCB 1R5VA 4IM8A 4QKXB 4YO0B 1JS4A 3VMOA 4Y7MA 4GO8A 4NWUL 1SMDA 2VISB 1N64H 2ZUYA 4IU2B 4MAYB 4QF1A 1P1ZA 5EUOA 4ZFOL 1IEHA 2F54B 4XVJH 3MLVH 1S9YB 3G08B 1QLFA 2C9QA 5C09B 4J7RA 4DP0X 4LLUB 2CLRA 5K9OA 1PZ5B 1U8PA 4I88A 3KL0A 4KKLC 4NT6A 4WF7A 2MIZA 4FJ6A 1YN6A 2RQ8A 3D06A 3VI3B 5HD8D 1S7UA 3VDBA 3ISYA 3LN5A 4PJXE 3T2LA 2XVBA 4XNMA 1WG3A 2BSDA 3AUVA 4PRNB 1R3JA 2QKIC 2Z7WA 4PRDA 2Y36H 3PY9A 1LO5B 5HVFB 4FEIA 2G2RB 3L4CA 1ECYA 1CU4L 2AK4A 4PJBB 4HKZB 4XN1A 3RL2A 3GEFA 1PLAA 4X6BA 5FX3A 1SDAB 4BKSC 2FO1A 5CINL 1AGFB 4HUUB 4FNUA 3M45A 5GGVY 5HBBA 3H0TB 3IJEA 3E3QC 4HA1A 1QFWL 5IM7B 2MCG1 1YEGL 3GS7A 3SY6A 4KJQD 2D3VA 1DLHB 1FZOB 2X1WL 3P02A 4OF6A 2YLKA 4HWEL 4AZUA 4PJ8A 3CN4A 4I0CC 4XC1L 2C3VB 4PJGE 1IBBA 1E9QB 4G80B 3RIFF 1GMIA 5IJBC 5F7WC 3BAKA 3ARBC 1A25A 2EDHA 4OLXH 3SCMA 1XIWC 2CDEB 1FVDA 4HW6A 4QRUA 4ZOCA 1DQDL 2IGTA 2P5WB 3SKJL 2KZ1B 2YN5A 2JWYA 1CFSA 4YUEH 1DBML 1BP3B 3FBKA 2FJSA 1PFCA 3ML9A 3NJXA 5JMOC 2DI8A 3DX7B 4J3WA 4Q0XH 1DO5A 1E5YA 4B9PA 3KLSA 5E6ID 5T5FA 4OLZH 5F9JB 1JYNA 4ALAH 3U0PA 3QEQA 3RWHA 3W5MA 1MJUL 2Q6WB 2R1XA 2HJFB 2XT1B 4KVNH 2UZXB 2J4WL 4ZOBA 4Z7UB 4IOSD 3NK3A 3QUZA 4LAJH 5FF6B 4UT6L 3DVGA 5GRUL 1F58H 5IQNA 1MIEL 3O2DL 1NICA 3HI1B 4OLYL 4WEBL 2DQHL 4GUCA 3G9VA 3CSFA 4QMEA 3IDGA 5I1EH 4YXHH 3MGOB 4M5ZH 4PJCA 4I3SH 1ASQA 3U4BH 4I5BB 1T4KA 2XZCH 3UTSB 1G0DA 1MN4A 3MLXH 4P4RB 4LAQH 4MLSA 4PSPA 3IMWA 4JR9L 5BVPL 1LD9B 1QQDA 2YGOA 3IE9A 5EBLB 2DWSA 4N3UA 4JRYA 4IMKC 2YD5A 3VWKC 4ZW6A 3MLWH 5FR3A 5GS2H 3ZHLA 1RSYA 4BFJA 4XVSH 4A2FA 2BS71 4XI5C 1D7DA 4DFHA 2H8PB 3GPEA 5AVQB 3DRTB 3UTZB 1YC8A 2A0LD 1DJIA 4EEEA 1QBMH 3EZ8A 3RAJH 3KLQA 2VR6A 3ILPB 3UPRB 4I13B 1GYCA 5D93B 5J3HC 5D2NC 3QDJA 1UJTA 3BWUF 1VAHA 1VADA 1NAMB 5KVFH 1IAII 3DVNB 5KJ4A 4LOVA 4Z0XB 1BMWA 3CLFL 5HY9B 3EUDA 3BH9B 3C8KA 3D05A 4BFNA 5BZWA 5F96H 1CFQA 2Z4QB 3SDYH 3VWJA 5IQ7L 4CVXA 4TQEH 2IPKA 1XHHA 2H3KA 2J8HA 4PJ9A 4QCIB 2FHFA 1AKJB 1B88A 4MB3A 3L9EA 3O6FD 1WUNT 1W72H 1X5ZA 1AG0A 1AFVL 1ORQA 3CHSA 3UP1A 1RFDH 1CLYL 4PBVC 1PDKA 1BYOA 1KLFB 3PHOA 4KH9A 4LRIA 1OSPL 5ACLA 4S1DC 1TEGA 3KPNB 4QAMB 1LDPL 2FWUA 4Y7OC 3UAFA 1ITBB 2A77L 1MFAL 2WLIB 4A6YB 4UM9A 5A2BA 4B95C 3T0AA 3REWA 4LBAA 2HRLA 4I18B 1PG7L 2GBTA 3GHEL 4QAWA 4P5KA 5E8NB 5AQ0A 2O61A 3MRNB 4PRPB 1U3HD 2PW1B 4AMXA 2EH8H 3Q2NA 2VITB 1N8OE 1OALA 1PZAA 2J55A 4Q89A 1JN6A 2K6YA 3AUWB 2AJZB 3KPOB 4QRRB 3N85L 3GINA 1G1KA 2WLLA 1O0VA 4WWNA 1HK6A 3F04A 4FN0A 4IQHA 2CU9A 2AJXL 2AP2A 1TO5A 4H2CA 5L2KA 1PU0A 2WNWA 2AJYH 3C5JA 1UOWA 5JZ7D 4R4FL 4L37B 3IMBA 3COOA 3EOBB 4PRIA 1U8IB 5EPMB 5HJ3A 1DEEB 3AQDA 1KIPA 3G6AA 4HZLB 4M3HA 3P11H 3N1MC 3UO8B 1MWOA 1DVTA 4R96A 1C9SA 1GSKA 3QDMB 3DMMD 2DDQL 1KTBA 3AGWA 3CPUA 1E5ZA 4P2OD 5E8PB 3FKUS 5GRJH 3G04A 5KEZA 4WGKA 4NHUB 3VD5A 1KPVA 2PMZA 4KKCC 2ZWLT 3BP6B 1MCPH 4ZFOA 1UASA 2V5YA 4GUOA 1XGTB 1FBIL 3PHQA 1D5XA 3K6NA 5E4OA 1MNNA 3HNSL 3K0YA 2IADB 32C2A 4MX7A 4BZ1H 2R0LL 5DDHA 3U1SL 4HSQA 4JRXA 4XPBL 1OKEA 2OL3B 4HUMB 4E41B 5B3SB 4G8AC 1MCOH 3L13A 3BHBA 4RFNC 2B2XL 4K5MA 3T6WA 4RISL 4UTBL 3FT3B 5HYJA 4MCMA 1AQKH 2HP4A 4I0PD 3TEYA 4CJ0A 1AQDA 3JVGC 4UYQA 2GJRA 3QNXB 4BKLB 5DRNB 4I2XE 1IC1A 3NJFA 2XN0A 2DS4A 3MCG1 4U7KA 3PQYD 1OB1A 1LE9A 2GPZA 1FGNH 3ETBF 3K6FA 3ARSA 1JXJA 5D6DC 2X4TA 4D8PA 5HYFA 4TVUA 3M1OA 1NOLA 5IMLA 4D3CL 1AD9B 1XGQB 3CFKA 3F6IA 4R5TA 2UYLB 3EYUH 3WELA 4HAGA 4C54A 3EGXB 1RSFA 2HJKB 1DYZA 4LSUL 3NPSB 1MEXH 2PCXA 2DOCA 4ORGB 2NY6C 3OXSA 4DAGL 1WITA 1FLTX 3D39A 3MREB 4NC2B 2J1KA 3S88H 3W5NA 1RIUH 3SQRA 3EOTL 4WI7A 4A2HA 2A6IA 4IIQB 4AYFB 2VDLH 1EAOA 5JPMC 2TRHA 3HR5A 4JCLA 4ADIA 1OE2A 1N64L 3H6AA 3QUMH 5A7BA 4XVJL 4OIAA 4D94A 2AMGA 2BVEA 1NANI 2XBZA 1CCZA 4OCSH 3QORA 2OJZH 2XWBA 4HX1B 4AYID 2XWCA 2ICCA 2GEQA 3VD3A 5C0GB 2MHAA 2ZZUT 3FQNA 5I2IA 2G4EA 3X1EA 1XWVA 3O2DA 3P9LA 5H37A 1JV2B 3FQ4A 4KBPA 3IVKA 3C5ZC 2WKOF 3KW7A 4XO8A 2CKBB 3MJ8A 5D2LE 2ID5A 5CJXA 5IF0B 3T4AC 2YD0A 4ATWA 3AMLA 4U1GC 4GEIA 4RCAA 3OB0H 1JFQH 2H26B 4HWUA 4JFVA 4ZMOA 1HSBB 1UFUA 3QUYD 1TKWA 3PWVB 1DHKA 3U79A 5FKAA 3T71A 1E4HA 1YEHH 3QJFA 4U1HA 4AWJC 1MCWM 4F7CA 5GIRA 1AS8A 1U8CA 3KLAB 5DRXB 1SZNA 1BM3H 5T1JA 1M9SA 3WN5B 2X40A 3GJEB 4CUCA 4OGZA 1FZMB 4NUJB 1NFKA 3L5WA 3Q2VA 1JZEA 4O2CB 5FUZH 4JFQA 5CP3H 1OAUH 1W6LA 4JFFA 3PLYA 1FLRH 3QJXA 2GY5A 2LTQB 3PGFH 4DP5X 4G42B 3ZE2E 2Q20A 1H19A 4NM4H 1XMWA 5KANG 4AQAA 1JCVA 5IJKC 3GGWA 3TVMC 3PXLA 4OLXL 2Y3NA 2O1AA 5F3HA 1U36A 3CQQA 4X6FB 4EZLA 1HCFX 3NCYS 2YMOA 4YUEL 3V4PA 1XB8A 4NHCH 5JQIB 1ZLDA 2JI3A 3X1GA 4Q0XL 4ZFZA 2NRDA 2KLRA 2MCMA 4OLZL 1UYWH 2DWXA 4G9FA 4GINA 5T3XE 5AALA 1RURH 2ZG3A 4NB7A 4KVNL 1GS6X 2R9HD 2ZSVB 3ILEA 5L2JB 1DVQA 3US0A 3DX6B 1QFHA 1FFNB 1OLZA 1F58L 3EADA 2CPCA 2VJXA 3BZ5A 4E42A 3FQRA 4OF5A 1R3IH 2OMVA 3TS8A 5JNYB 1QHOA 5I1EL 2PPFA 4M5ZL 4I3SL 3U4BL 5HDLA 2DL9A 2YA1A 1HSAA 3QPKA 1U93B 1WZLA 2XZCL 3GTVA 3MLXL 4Y4FA 4ZO6A 4LAQL 3IDNB 4GAYB 1YPZB 2XRAH 2H5UA 2GKIA 4QRQA 1INDH 4WQOA 4MZRA 3LSOA 4K4KA 2AXHA 4MDJB 3QO1A 3MLWL 4RH4A 5CGTA 1G7JA 5EEXA 4XVSL 4APXB 5FYKD 3VB9A 1U8MB 1LL1A 4G6MH 2NCMA 5HDWA 4ACTA 2Y6TE 3L3OA 1RERA 3LEXB 3H2PA 3HLAA 1QBML 2FL5B 4X7SH 2WIMA 3UYRH 3EXLA 4L1LA 3S3CB 1TITA 3K8LA 1EVUA 1SLVA 4IHOB 3ECBB 3CGTA 2V8MA 1NC2A 1OTTC 2ZP8A 5F7YC 3U9UA 3D3VE 5EFIA 2VM9A 1WCBA 5KVFL 3MNWB 3QCUH 1OF2A 1KT2B 4DP6X 1W0WA 3EH2A 2BVOA 1JK8A 4HDIB 3MRCB 3U82B 4Y4KB 5IESH 1L0PA 1F18A 5F96L 3SDYL 1FFRA 4J5VA 4F2ME 4GBXC 1AGEA 3AWFA 4H2AA 4TQEL 2Q1EA 1KENH 1ZY9A 4CSTA 5JHDD 4HJUA 3TOPA 3PDGA 3AGVA 3TO4A 2X4NA 2VLJB 3EDEA 5K9JH 3FU0A 4NXSA 1BVZA 4MCYA 4XC3H 2BRRH 3JZ7A 5JIPA 1CFTB 3O81A 1W72L 3TCLA 3ZMEA 5KVEH 4LHQB 4KMTH 1RFDL 2WOYA 5DK0B 1HHKB 2A3TA 2H1LM 3DX8A 3RWEB 3VFOB 2GI0A 4AQ8A 4ZW7A 4UTBA 1F6LL 2N4IA 5BV7B 5IV2A 3KPRE 2VR3A 4HGWB 3QIUD 5AW2B 1JZ8A 5DQ9B 4Z76B 2A5UA 3GK8H 1BEYH 3BZ4B 4JS7A 1BAFH 1DR9A 1JHKH 2EH8L 2HTLD 2X1PA 4DK5A 3VXOA 4FYSA 1HE7A 4JKWA 4Y2OA 1T1ZA 5FO8B 5D1XE 1GJWA 3V0HA 1A9EB 2ZKWA 4K7PH 4V2CB 5EZOH 4GQ9H 1QTSA 1T1YA 4NN7C 2WP3T 3ARGA 4NI6A 3FH5A 1JPEA 2PABA 1NBZA 2AJYL 2ITCB 4IBTA 1O6SA 1CGSH 3NCMA 3OMAB 1WA0X 3S3BB 5CSBA 3N91A 3O3DB 1IVTA 3P11L 3PU7A 2O72A 3DRQB 2P8MB 1XH1A 3UIZA 4TTGA 5JW5A 2FEDD 1IM9D 5GRJL 1U9KA 2VRKA 2Z93A 2PXYD 3EH4B 4PJDA 4E9TA 1XF2A 5I8OH 1NCWH 3EBAA 1I1YA 4K3DH 1LILA 5KN5B 4YFDB 1MCPL 2YEVB 3DTXA 3RVTC 3B56A 4YWGL 2HT4C 1NWOA 3MNDA 3IN0A 4FHBD 5ISZD 2FYVA 5F88A 2FJFA 2XCMC 4BZ1L 5DMKB 2WY3B 5E6SB 3TIDA 1G9NH 4ZSOB 5FW7A 1J0YA 3CBJB 4UINL 3NJVA 4FXGB 1ZTXE 5TQ2H 4PGEA 1FO0B 1MCOL 3ARFA 1UTDA 3VCLA 1I7UB 3MJ9H 3KPMA 2IJ0C 1BHGA 1FE8H 4PEEA 1NUNB 3FHQA 1GC1H 1AQKL 2Z31C 5E4EB 4NPKA 1CI5A 3PIQB 5KANI 4NP4H 5L4IA 3BJLA 1F3RB 3NRPA 4B0MB 5ACZA 2GK2A 3OX8B 1D5MB 3HZ3A 3LPFA 1FGNL 3ULUC 4A7VA 5D7IE 3WAJA 1W8OA 2HRPH 3IK2A 2A7BA 5C71A 3UZQA 1MCCA 5LCVA 4Y1AA 3OKDB 4WUUD 4A2GA 1PZBA 4HHAB 4P5TD 2O5ZH 5DFAA 4CMHC 1MVUB 3RZCD 4NPJA 2WTRB 4NQTA 1BGXH 3CFQA 3EYUL 4MJIA 4XX1G 5IJDC 5IHZA 4XMVA 1A6PA 1SLXA 2COVD 3HE6B 4KHXH 4M62L 1EERB 5F21B 4QT5A 1MEXL 2I7OA 4EBQH 3U4AA 3RKPA 2CA4A 4NKOB 2DBJA 4E5XA 4LO9A 1JYWA 3S88L 3L4WA 5JW3H 1RIUL 4KK5D 5DRZA 2VAJA 4AZ8B 2VDLL 1INQA 3VFNA 3GIZL 3QWOA 4J8RA 2MCPH 4WWKA 3MTRA 1GIGH 4Z3HA 3QUML 5KJRH 3KYAA 3B5TA 1EMTH 1OPGL 4OCSL 1E65A 1TTGA 2OJZL 1YYLH 1GYAA 3CSBA 4X7FC 1N5AA 1YCSA 1HT6A 4LLWB 4M5YH 4B3EA 5EZJB 5HDRA 5B39A 2DMBA 3FU8A 4WI8A 2OQJA 2E47A 4WW1B 5CGYD 1DL7L 3JVFC 4FQ1H 2Y5QA 2HRHA 4R4BA 2HT2C 1M3IA 5B7MA 2PPAA 4FJZA 1NGXB 4A7QA 2YD2A 2XZZA 2DQMA 2RCSH 3L1GA 1LDSA 5KS9E 2LE9A 3O4LA 4L8DB 3UTQB 1YEHL 4JZOA 2LVCA 4ERSH 3NJGA 1BM3L 1JK9A 2ZCZA 2UWEE 5F0MB 3OKNB 5FUZL 5A6LA 1Z5LB 4CILA 3CUPA 3NN8B 1T0MB 3QEGH 1OAUL 3RPIA 4KDWA 1FLRL 3PGFL 1F4XH 2Z92B 1H15B 2ZKMX 4NM4L 4OV6F 1QLEB 2Y23A 1U8KA 1S9KC 4IU3B 3IJHB 3FRPB 3L1FA 5AZ2H 3WL9A 1IKOP 1X9UA 1KJMB 4LLMB 4HG4K 3KPPB 3D33A 4FF9A 4NHCL 4P5SA 1GZQA 1BFOB 3S97C 4CNIA 4O5LH 3IDYB 1EFXD 3FC8A 4EI5A 1PSKH 3SKUD 4PJ5D 1UYWL 4W68A 4J39A 1LWRA 3EH1A 4Y8AA 1N59B 1N67A 5IJCC 1RURL 2MFNA 3L3DB 5IREA 5BNXD 4YBLC 4YJZL 3DYPA 4OKDA 5DK3A 4UQ2B 1AZNA 3FJTA 2C9SA 3NCEB 4C57C 1OP3K 5E8OA 3B7YA 1R3IL 4ISVA 1GGCH 3X14B 4KK6C 1QFPA 1U3NA 2OPCA 3LNEA 2EDDA 5JORA 1OWRM 2FE0A 3TT1H 1KV7A 3WS3A 2XRAL 4FFVC 3S4SB 5I5RA 5IB5A 4GG6B 1QBAA 1AHWB 1INDL 1M1SA 1YUHB 1AC0A 4NPYB 2VL5B 2APSA 3O11B 4K5NA 3HUJA 1PL3A 2C1OA 4XH2A 2XICA 2R4RH 4G6ML 3F12B 4NQEB 3CVDA 1JBJA 4U2ZA 1EEYB 2GB2A 1K8DB 3GRWH 3K4DA 3UYRL 1NJ9A 4X7SL 3ZIMA 3VD4A 2CIKB 5D7JC 3V79C 4B3VA 2PYED 3ZE1E 5IBTH 4L3AA 1SM3H 3M7OA 3IFPB 1OCZB 2DW5A 4PI0A 1CGVA 4BGDA 2P8PA 5TDOB 3ZE0E 1QP1A 4O00A 5A2JH 2WWKO 4WU5A 3JWDC 4OF0A 3CBKB 3QCUL 4KJPC 1TTFA 4PWEA 4BD4A 4GS7C 3RX9A 3VGDA 2VERA 2FT7A 2OW7A 4JO3H 2BSRB 2X09A 3PV6A 5FFGA 1NCTA 4PBWD 5IESL 2Q7NA 5DRWA 4Y5VB 3WJMA 1U3HA 1Q4NX 3OJMB 1KENL 4FGMA 3SKNB 5DJCA 2I07A 2LFEA 5E9DA 4BZ1A 5M94B 1SN5A 4X6DB 1YQ2A 5IGXH 5K9JL 5CJ5A 3FZUD 3FUJA 4TLTA 3SDDA 1TQTA 1JRHI 2Q9OA 2R0WH 4XC3L 3VYOA 4DK3A 2BRRL 4WVRA 2ZAHA 3OF6D 3L9YA 5KVEL 5KYYB 4UBDC 4KMTL 3W1ZA 3IBEA 1G7PB 5T5NG 2R27A 2WLKA 1E50A 1H3XA 3Q8FA 5KSAB 1DVFD 3OC8A 2AFNA 4BFGA 3N1PC 3D3VB 3I02B 4JVUA 3RQ3A 3DMMA 4LCWD 2CO7B 4I0KA 4P2OA 1CDCA 3GSQA 4B5EA 3LTVA 5ABAA 5LN8A 1ACCA 1X9QA 2Z7UA 5FGSA 3GK8L 1BEYL 2OK0H 1BAFL 3KDMA 2KL6A 5I5JA 1JHKL 2UVFA 1S9WA 1QZNA 1KNOB 1PLGH 3EIFA 1HI6A 4PJIB 4WKZA 2Q7YB 3TL5A 4ZNEE 3IDIB 1T5KA 2XBDA 3D50A 5DUPH 4BDVB 2Q3ZA 4K7PL 5EZOL 3JWNC 5HVHB 4GQ9L 3ABKB 3P2DA 3ZKXC 3RFZC 1J88A 3QIBB 2EH7H 4OZHE 1QSFB 5CXPA 3WY4A 1CGSL 4LPTA 4JPKH 4ELMA 3W11D 2VLKB 3MZTA 4O2FA 4XCNB 1P7QA 1YAIA 5GSRA 2TRYA 4AVJA 2YC1A 1FFPB 2GBAA 4R5VA 5LGYA 2PO6C 4G6KH 1PCSA 4XHJC 2ZWNA 2X89D 3QG6A 4M7KH 1SJEB 5I8OL 1MVFA 1NCWL 3QULA 4K3DL 3DETC 3D51A 2R29H 1C08B 1F4AA 2DEYX 2VGLM 4KO9A 4L3CB 3BP5B 1TFHA 3QZNA 4ZNCD 3UAEA 2ZUQC 1CQYA 2ZX6A 2JCCA 1E9PA 4ZPVB 5F1IB 2BVPB 5K9QI 1HWWA 1YMHB 5HDBB 2NY5L 4EJ1C 1RPQA 1G9NL 4PGBA 2A9BA 2HLFC 4BSJA 4F7KA 5TQ2L 1N4XH 2X42A 4DPAX 2BMKB 4X0NA 4G7QB 3MJ9L 5DURD 1J8HD 1TTUA 1MELA 5I75B 1P84K 4FQCH 1MZYA 4N2NA 5EUOE 1FE8L 4G8GA 1JPSH 1JV5A 4K8RD 3DX4A 4LRNH 1GC1L 2YD9A 1F02I 3D48R 4G7SB 4UOJA 4LLVB 4NP4L 4OM0H 5DC0A 4FXLA 1XEDA 1N3NB 5I6OA 3D08A 3MX0B 2YQBA 1JGDB 2EIEA 5T3ZE 3KJ4C 2HRPL 4KKZA 1QX1A 4FI8A 4IBZA 3A6CH 1WBZA 5IVZB 1EEZA 4N0FB 2O5ZL 4YSOA 3TJEH 5DXWA 1BGXL 1JNHA 1KPRA 4N87A 5DD5H 1E5AA 4KHXL 2XJKA 3IU3B 2F5AH 3HBQA 1RZKH 1W0YT 3RWIB 2AK4E 3RA7H 4EBQL 3GNMH 3SHSA 3X12B 5JW3L 5L9DH 3VXUD 1H3GA 4YSAA 4FA8A 5DHEA 3QO0B 1CXKA 2X87A 4XNDA 1RZGA 4HK0B 2MCPL 2NY0B 1GIGL 4PWFA 2XKUA 4GJTB 1SJMA 1QYGL 4HIXH 5KJRL 1EMTL 1IAIH 1QUPA 3B2UC 3T65B 4JAMB 1M3JA 1YYLL 3ETBJ 1B0IA 2BVQB 3B9AA 4M5YL 4MHHG 1ZHLA 4AH2B 1KDIA 3U48A 2RR3A 4ZX3A 2P3YA 2QQLH 1PQZA 2HFFB 2ZG1A 1TSHA 3BUDA 4V1DA 5GISH 1T20A 1JF6A 3M07A 1IFRA 1HOEA 1HU8A 4FQ1L 4L3ED 1ZHNB 3TA4D 3HS0A 4XMTA 3S9DB 3P1VA 4NOFA 3LHPH 2OYPA 1ET5A 1G5GA 3QEQE 4X5LA 3C75A 3WBDA 4XMZA 4TNVK 1J1OH 2AQ2A 5ERWB 2RCSL 1E5BA 4EPSA 2UXGA 5C0EA 3GWJA 5EU5A 5CFAA 3BIKB 2XN9A 5IOKA 2J6EH 2OSLB 4ERSL 5FFLA 2QTEA 4AXWA 1KN2H 4S2SA 4F7PB 5I0XA 4QRBA 5AKSA 3D6GA 1JF1B 5F0PB 2VN7A 2BOCA 2VN3A 3NIGF 3PAUA 2ENYA 3T3PB 3QEGL 1M56B 1H5BC 4HIPA 4IMLB 4EXKA 5CLTA 4PJCE 1UOKA 4QJ5B 1F4XL 4NQSA 2X4OB 2YPKB 3V52H 3O6MH 1MH5A 2H47C 1X4XA 2B59A 3QEHB 2XX0A 5D7HA 4CMMB 1WWCA 2Z4TA 3NCFB 3MRDB 3K72A 2IH3B 4LGRB 2FLBT 4JRYE 4JE4B 4WTZG 1KXVA 5BOJA 2A73A 2B7DT 3PXHA 1X5AA 3HG1B 1JDCA 4KDVA 2FD6H 1DQJA 2XTJB 5DJ0A 1N6UA 3TEUA 4HT1H 1GVIA 1IGIH 3E6HA 4TN9A 5KS9B 3K46A 3EDDA 4S1SH 3DUUA 4ZQKB 2OULB 4O5LL 1PSKL 4ONGH 1RK0B 2UWEB 4HV8B 3QDJE 4YBHA 4XHQA 3MCKA 5FA3B 4F57H 3F6JA 2DRUA 4PP1C 3KH4A 2GC4C 2NUTA 4JY6B 2E7LA 5MEQB 3SB3A 1I75A 3MXWH 4QRPD 1U42A 4B96A 5H4ZA 2WXFA 4LDOB 3SPJA 3UTTD 1J12A 4IKKA 5GS1B 3NCWA 1GGCL 3KVPA 1DVXA 2AJ3A 3MV9D 5GGSA 5ENWA 1QWHA 1HYSC 3NCJH 3MLYH 1EZLA 3TT1L 4LCCA 1JWMB 2BSTB 5F72S 4MNHA 2Y5TB 5EN2B 2XWZA 1BZEA 4LLAA 3MRRA 3FQ2A 3CSGA 5CD5D 3RVXC 4IKLA 4GMSL 4IGBC 4KZCA 3HE7D 5DJDA 5J06A 4AIZB 2R4RL 3T0WA 1JHTA 2XV2A 4G3YH 2FJHA 5JOEA 3FB7B 1HZHH 3GRWL 1L5GB 2P47B 1B4RA 4ZX5A 4YSPA 5D7EA 2WLMA 3AREC 5IBTL 5E1AB 1SM3L 5EU4B 1AGBB 3D2UB 4ZMQA 1S3KH 1OW0A 4BXVA 3O9WB 5SV4A 3UAJD 2WV3A 1ADQH 4XPGH 5KSVB 4HCGA 4FXKB 4JO3L 1HHIA 1LTXA 4F8QA 4BFIA 3F5WB 1F90H 3PWLA 1RU9H 4M1GH 3VXNB 1MJ8H 5L2KE 3ARPA 3T1WA 2NYYC 3H3PH 2X4PA 2XPZA 4PRIE 1A1OA 1M71A 3MC0A 5IGXL 4X5QA 2R0WL 4P3WA 3RWJA 1I7ZB 5DMIH 5F7AA 3S2CA 1TT6A 2WQUA 1NGZB 3BKMH 1AS7A 2NY1D 5AW9B 2F8VA 4V2BA 1NANH 2AQTA 3BAJA 2N56A 2ZWYA 4GRLA 4DN3H 4NI3A 3QZWG 5MHSD 5KZCB 5E8EA 1TPXB 4YSCA 1IM9A 3KYMB 5C92A 2IQAB 3JTSA 3CFIC 2OK0L 5F3BA 5K9KB 4KK8C 5HHMD 4JRXE 4F2EA 4Z8FH 1PLGL 3OGCA 3MCYA 2J71A 3MNVA 4YK4B 2FX8H 5DUPL 5ISZA 3CZNA 1TU2A 3FW6A 2EDRA 5BVJB 4PRBB 5HGGS 3VFUA 4Y5YB 2EH7L 1E4XH 5HYJE 5C0AD 1D6EA 1RQ5A 3HZKB 4U6TA 4PJAA 2W38A 4JPKL 4MHHI 1RJLB 3FFDB 4XXWC 4OZIF 4IBVA 1J9CT 3KXFA 3LKNA 3PJNA 2BP0B 3KMDA 4LKXB 5AOKA 1ET8A 3CXFA 3T8MA 3CFEA 4WGVB 7CGTA 4M7KL 4CVZA 2QDVA 3FT2A 2DI7A 4LK4A 2X9WA 2R29L 5ECGA 4LGPB 4PGDA 5A3ID 3E2HC 2KQMA 3WJLA 2F0CA 2DBLH 2ITEA 2ZWKA 3M1CA 2VQ1A 4NFBA 5J6HA 4YMPA 1E67A 3BLPX 3GQFA 3I6KA 1J9QA 4XB8A 1E6JH 4ZFGH 3NJJA 2GBVA 3U0TA 3LKPA 3QJUB 4E0RB 3D39E 2WAQA 4R8WH 3UJTL 4WUUA 3BESR 1Q38A 4CADB 2F53D 1ID2A 3NACH 3RZCA 3FUNA 3HIZA 3VXMA 3CC5B 4TQIA 1GGIH 3GS4A 1U8JB 2IDQA 2FSEA 2QL1A 2Y4SA 4JKMA 4MD0B 4FQCL 3OMIB 2XFGB 4GW4A 4OCNC 2UX7A 5IEHB 1JPSL 3KM2A 2P24B 4LRNL 5CAYB 3JWNG 4JJ5A 3BVWA 5J5EA 4OM0L 5B8CC 1UKSA 1VFAB 3HRZC 3OLEA 5GRZA 5ID1A 5IJVB 3AITA 4WHYG 4Z7WF 5DGRA 5FYJE 4UQDA 2UUDK 2K6WA 3A6CL 3DURB 5CP7A 1UCTA 3L3KA 4Y9FA 1TCRB 5IFHH 5AB1A 3TJEL 1FFOB 2PPDA 1NDGA 3AG3B 2EUZA 2BSCA 2BNQD 2V8LA 5DD5L 2XG5B 4KXAA 1R5VB 3EF7A 2F5AL 1RZKL 1PNCA 4JG5A 4J3TA 3RA7L 2ICWI 1BOGB 3GNML 1OGSA 2AC0A 3T3ME 2CD0A 2EILB 1NGYA 1DJZA 5L9DL 4ES8A 3Q2LA 3O8XA 5J6SA 3RZWA 1MY7A 4KNTA 5DLMH 4F7MA 3D0AA 1TZIA 2D7PA 2X2HA 5K9OB 1R6VA 5GZND 3N40F 4NT6B 3MBEC 3LS5H 5EC2B 4HIXL 4JFFE 2EKSA 2V9QA 1G87A 1IAIL 1A9VA 2Y06H 3BGAA 1EBPA 4OKVA 1IBDA 4RGNB 1C7SA 4CN1A 5MERA 4G8IB 3T0BA 2VCOA 4K94C 3P9MB 4X9GA 2CUIA 1NUFA 2QQLL 1ZT4B 2XSKA 2QVKA 4MJ5A 5DHYA 5GISL 1TEFA 3RL2B 1VZIA 2WBJB 4QHMB 3AWEA 3RJQB 1LEIA 3LHPL 1IZKA 4G9FE 4JFHE 2WIIB 4Z18A 5T1LD 4CN4A 3H9SA 4ZDHB 1G6RB 2ZOLA 1J1OL 1VIWA 2AQ1A 4JZJA 3Q7JA 3HEIB 4QHUA 4WO4B 4ZFFA 2BC4A 4QDGA 4AQ1A 2J6EL 3VXSA 4S11A 4U1SA 1KN2L 4CDGC 1IX2A 3FFCB 3E80A 4F93B 2ITFA 2PTUA 4N0CD 1MCLA 2XKNA 1I1AB 5TF0A 3GRWA 3P3UA 4YSSA 5JPNC 2NXZB 3Q8CA 4ZUWA 5JW4Q 4DUWA 2XN1A 4HK3N 5DJ6B 2FYYA 2X2UA 3V52L 4MA3A 1CFSB 4PWJA 3O6ML 2B1AH 5CJ8A 4QPEA 4DZBA 2YGQA 1WV7T 1UH2A 2A6JB 3D25A 1S5HB 3FPYA 5GSVA 2QV2A 3MRHB 4N2GA 1IGCH 2FD6L 5J8OA 4HT1L 1IGIL 3TBVA 3DBXB 1PKQB 4ZTPH 4S1SL 2HJLA 3VVWA 4ONGL 2A74C 5CUSH 5HHNA 1U8LA 2X0UA 2GW5A 4ENZA 2KDGA 2G3NA 1R0AH 3RVWD 2VC2B 3QQ4B 2OTUB 4F57L 1XEUA 2J5WA 3O3AB 1I8IA 3IDGB 4XPTH 3WMQA 1NCJA 4HIJA 4Z7VA 1BLIA 1WBXA 3QRBA 3T6VA 1V3MA 3MXWL 2AHIA 1T4KB 4LPCA 1UWGH 5AW0B 2PYEA 3RWGA 3CAFA 1WPCA 2NYZA 4LKCB 1RD6A 4W81A 2ORBH 3CFCH 3MLYL 3FH8A 1EK3A 2GT9A 3NCJL 5AW1B 3FQUB 5DVMA 5CBAB 1UA7A 2OMYA 2Q8AH 5ICZA 4J1UA 3WHXB 4C4UA 5DJ8B 3KPLA 1ZV5A 3RG1C 1CWVA 4PP2A 3S96B 5BS0A 4RA3A 1QWNA 4Z7QF 5J0BA 1AXSB 1PPIA 3CFBA 3HPJB 3V4VA 2EVFA 4G1MA 2R1WB 4G3YL 3I9AA 1HZHL 1TQCC 3TGXA 1DN0A 1P7BA 1WP6A 2AI0H 4NZRH 1E8ZA 3OF6A 1T1WA 1QRNB 2AEOA 5H8DA 4JCWA 3QVAA 4P9HC 1S3KL 5BZWB 1CFQB 1VACB 3UO1H 3ARZA 1DVFA 4CVXB 1ADQL 4XPGL 3IXAB 3HBZA 3BSGA 3T0EC 2ED7A 3MO1B 4M02A 1LMIA 2IG2H 4R7NA 1F90L 2VMJA 1MI5B 2XXMB 3AQXA 1RU9L 4H40A 4JANB 1MJ8L 1O6VA 4M1GL 4RDQF 5F1OB 4Q6KA 3UZEC 4CSSA 3K6DA 1ORQB 3U0WH 3H3PL 4PV8A 1E7VA