3H6AA

Structure of the calx-beta domain of integrin beta4 crystallized in the presence of calcium
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
109
Chain Sequence
MRDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Calx-beta domain of the integrin beta4 subunit: insights into function and cation-independent stability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin beta-4
total genus 23
structure length 109
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3h6aA00
2LT9A 2QVKA 2FWSA 2FWUA 2KLTA 2KLSA 3E9UA 3E9TA 3RB7A 3EADA 2QVMA 3FQ4A 3H6AA 3GINA 3US9A 2DPKA 3RB5A 3FSOA
chains in the Genus database with same CATH superfamily
4TNVF 4AQEA 3DDFA 3QFJB 5GGQL 4CVWA 4JFPA 5DK3A 2CLZA 1LEKA 3BLKA 3SSGA 4CJ0A 5D7HA 5B38A 2AQPA 4X99A 2XKNA 4FTVA 4KMTH 4PHXA 3RILA 4KVCH 4GSDH 4DSYA 2JJVA 2X2JA 3L3KB 4M03A 3B1UA 1JTOA 4W4OA 5FFOA 3GK8H 4J4PD 4JPIB 1DQMH 5B21A 1I4FA 1HSBA 4YR6B 2R51A 2M1KA 2Y22A 3QR0A 3Q0HA 1Z5HA 2FE0A 3CBRA 3RZCA 3O9WB 4IYKA 2KERA 2BHFA 3NPZB 4E9XA 3BUPA 2WLHA 3MJ7A 1KELL 1GGBL 1P7QD 4O51B 2RD0A 5J56B 2AXWA 2WM0A 4FQXA 3SKJH 5JZ7C 3U2SA 4POUB 5ICXB 4LQFH 2CCLA 2YXWA 3F6IA 1JD9A 4KJPD 4QYOA 1IGTA 2LFGA 5T1KA 4DPCX 1SZNA 5AUMA 3L3OA 3SN6N 4N0FB 5DHYA 3A24A 4W9JC 4JKMA 4HOZA 2D3JA 4WHCA 5TE7H 5G2NA 4XPGH 3K5RA 3D0VA 3QYMA 1QTPA 4ADIA 4MYPA 4U33A 3QEQB 3ZTNH 3U2SB 3D39A 1QZNA 4KK9D 3VG0H 3MCKB 1SEQH 3QUGA 3UJJH 4BH8A 2GSGA 3UDWA 4WQOA 3FUNA 3OB0H 5DC9B 2OAAA 1DLFH 5T1KB 3HVDA 3O3BA 3T77A 4AH2A 3L4WA 4JM0A 3ZYJA 2XBTA 4WO4B 4J8RA 5D1QA 3MRBB 3VXQB 4Z3TA 5JZ7D 5EC1B 3N1QC 4M7JH 1JZ4A 3WXWH 3T1WA 5D70L 4OD1H 5KG9B 1ED3A 1MZZA 1WFIA 2CK0L 3AS1A 1DJIA 4GKOA 4ZUVB 4HMEA 4MD0A 3WDHA 4M56A 4NZRH 5AVSB 3DTUB 5I17B 1BQKA 3REVA 3G3LA 4A67A 4NAJA 3VXNB 4PP2B 1AI1H 2KBGA 4OD2A 4IS6A 2VLKB 2J73A 4BCXA 4HT1H 3BWAA 3FU3A 1GJIA 1IRAY 3QK0A 1MNNA 1H3TA 4G11A 4F7MB 4Y1AD 5D7LB 2F15A 4LHUG 4ZUVA 1S9VA 4LHQB 3B5HA 1X5IA 2DIEA 4YSAA 5KW9L 1I3UA 3UP1A 5INCA 2O61B 1BAFH 1ZWIB 3FCSB 1JXJA 4KQ4L 4WSGA 3FRUA 4LCYA 3BP6B 3KPTA 5EC2A 3R8BB 3UAJC 4TQHA 5HHXL 2FHBA 2YPKB 3CFKA 3MA9H 3F01A 3BZ5A 3D39B 2EUVA 4XE0A 2YSSA 2X7LA 4MJ4A 2GSGB 4MXVF 3PP4H 2A6JA 2EDXA 3BVDB 3SEPA 2ZX5A 4WKXA 1CD1B 1OT4A 4N87A 3AQZA 2D2OA 5CSBA 2I5YL 3GLEA 4ETYA 3FSVA 4P4RB 2P49B 3IDGB 1FVDB 3FQRA 1U91B 4B0MB 3QUXA 1UH2A 2Y5TB 5DQJB 1PG7X 2M8XA 4JQIH 3BZEA 1H15A 5T1LD 2E6QA 3G5XB 5IEKA 1FJ1A 5ITBH 3MRLB 2VUKA 1KTKE 4XP6H 5EO0A 3ZQWA 4IJTA 1CXLA 1TFPA 2IH3A 2NR6A 2HB0A 2W9EL 4FXGB 4GBXB 5FO9B 2D7QA 5TFSL 3T4YA 3HIZA 2AABH 2GTWB 1JHTB 4R3SA 1E6JL 5D96C 3MXWL 1AMYA 1EZSA 3F00A 1OANA 1KIQB 3QDGE 1BIIA 2VABB 4LNVA 1OV8A 1NCOA 3QQ4B 5I9QB 3V6OA 5H37G 5CEXB 3S7GA 4GRLA 2ATPA 1S7VB 5MENE 1DSYA 1SXZA 3UYPB 4JS7A 1LDPL 4L2YA 3EH4B 2IH3B 4M5YL 1L3NA 3VRLE 2BNRD 4O2EA 3OKMB 3P4OB 3O0RH 4RGND 1ZGLP 4LCWB 1F6AB 5AW9B 3UAFA 1HINH 5IVZA 2XOTA 1AYOA 2WBJA 1ZV9A 1OD7A 5DJ2A 1HQ4B 3OZ9H 4MD5A 5DVKA 1FC2D 3NIGE 4ZXBC 4K3HA 1MHCA 3L3GB 4PCKA 1OSZB 1HHIA 3QO1A 2X3BA 5JXAL 2YRZA 5TF1H 5IJBC 3NABL 4PB9H 5DTFB 1KCWA 3CCHB 1TJHH 43CAA 5KTEL 1BFVL 5E24E 1A9VA 1Q9KB 1RD6A 4LDOB 4HPHA 4FTVE 1JNJA 3NN8B 2W07A 3VM7A 4U1MA 3CSGA 5IOPA 1XAUA 2Z35B 5KTEH 4FXKA 4I13B 1AI1L 3LS4L 2H2SD 3FYIB 3EUUA 5IMMA 1F3JA 5GRVK 1N9PA 4BFRA 4L1SA 3DO7A 2E9GA 1MJ8L 4OTXH 4CU8A 1TZOA 1WP6A 5D70H 1J88A 2BC4A 4ZFGL 3ZZSA 2D9CA 1CDHA 3HW7A 4D9RD 1E27B 3N85L 1WC7A 3BZ4A 4A39A 3ARTA 2QSVA 4BKSC 1XIWC 1NOAA 4NP4H 2CPCA 3P9MA 2XKSA 3PDDA 1F3RB 2F54A 4GUQA 4K3DL 1LEKB 2WGNB 3OB8A 4MDIA 4RMWA 1OP5H 4R0LB 5IR1B 3BIBX 5K1JA 2VDOH 3ULUD 3N43B 3QJOA 1EAPA 4WW2F 2BK8A 3F83A 3N5AA 3VWKA 3OLIA 1F42A 2W8CA 3K2IA 3ZE0E 3B2MA 1MEXL 1CLYH 5T33L 1K8DA 1SFDA 2YQ2A 5J13C 1CK0H 3WNNA 3KW7A 2OYMA 3RGVD 4X9IA 4FYRA 3L4ZA 4K5OA 5D1QE 4CW1B 1PD6A 2CG9X 1IC4H 3DOIA 3JWNH 3LN4B 5F1IA 1F3DJ 5F7WC 1MVUA 4DP5X 2LU4A 4MMXB 3RHWK 4JQIL 1X5HA 1CXFA 4OM1L 5E9DE 5C7XL 1JZ6A 5HGDA 3EFDL 4HPYH 5F96L 2FX7L 2FQGA 2XPZA 3G5VB 25C8L 2BSSA 4N28A 3FOMA 4FQCH 2VR8A 3WAJA 4O9HL 1EX0A 2VN4A 4R7LA 5E2JA 1KCLA 4QJ3B 2R1WB 3KCPA 3RGBA 3QZWB 2HG5A 2R0LH 1K8IA 5GZOC 3WOVA 1NM4A 1I8AA 2EDNA 5K9KA 1BAFL 3PXLA 3LEXB 3Q8CA 4P2OD 4F15B 3MRCB 2ZWYA 5HVFB 2DMKA 5F7AA 4HK3J 1EJOH 2GUOA 4HS6A 5JPNB 1LD9A 5HGHB 4YSSA 3L3IA 5I6LA 1MH5A 5DZLA 4LFHG 4JK0D 4JZNA 2K6ZA 1T2QL 3CMGA 3KWXA 1F6FB 3L3HA 4C83A 4LOEA 3GS4A 3H2QA 1M05B 4Z7OF 2HG5B 4BQ9A 2Z7UA 2D3VA 2E5EA 1QYGL 3BVTA 3E8VA 3FHQA 4XWGH 5D96B 2ZXWB 1GYAA 4PS4L 3LPGA 5ICZA 3BUTA 1WT5C 1ZSHA 5HGAA 2HUHA 1CC3A 1XDTT 2XZCL 4XH2B 4AM0Q 5C0EB 1AZUA 5EOCL 3QQNA 1U8JB 1MKFA 1VGEL 3QT2A 4LVNC 3ZT5A 4ODBD 1CIDA 1E9OA 5E8OA 4JFXA 3EGXA 1DJYA 2J8UE 2WO2B 1SDAB 3BKJH 3H4FA 4D3CH 3P30H 5EIVA 3NRQA 1JMXA 3BD5A 2H0FA 3F3HA 2VDRL 2VN6A 1KN2H 3JWNC 3QEHA 1KGXA 4ZQKA 5GXBB 2J5WA 1DL7H 5DRNA 5EUOF 1GA2A 1UM6L 4ONHA 1SVZA 4JFXB 5AOKA 1GJWA 2HZHA 1KENL 1MVYA 4XPGL 5D2LE 3G6JE 1KWGA 4OI7A 1EGJL 2ENPA 2EC9T 2NTFB 2HH0L 2OPCA 3IE4A 3M7OA 2PPAA 3TA3A 5A40E 3CVHL 1PZ5B 2NY0D 4K8RH 4TSBH 3S36X 4EIBA 3MRNA 3OX8B 3HZMA 4OZHB 2WSDA 3GJEA 5JORA 1XCTB 3CVIH 4CDGC 3K6NA 2XX1A 3PV6A 3O2DH 4NKQB 3RP1A 4PJ8A 3HFFA 1KJ3H 4FNSA 4TPRH 2UUDH 4BQBA 2ENQA 1CFSB 2WJ5A 3HB3D 4PJ9A 3QQDA 4EDXA 2EIZB 5I30L 2EDDA 5JO5A 5HI4D 1HZLA 4WI0B 2AF2A 3RWDA 1XH3A 2Z4QB 4YAQA 2VKXA 1B2WH 1N6QH 4HLEA 3BIAX 3RIFK 4DOHB 3AUVA 2MTAA 4OLEA 2I26N 4PJGF 4HUKB 2MCPL 1EFXA 3WNMA 4K7FA 3PWPD 3IFPB 1HH9A 3WGUB 1R4XA 1S4IA 2NQ3A 5C2UB 5FV2A 5MEOA 3N40F 3HLKA 2DBLH 3UBGA 1KB3A 3WELA 1A3QA 4LXFA 5ALCL 4B5EA 4U0QB 4N8CL 2G3NA 4YDIH 4KUCD 5C0FA 4AYEC 2I07B 5BJTB 1HJBC 5DJDA 2XA8L 4S1DD 5G5DA 1FDLL 1H9VA 4RSYA 3LQMA 3O3DB 1AG0A 2JH2A 2GJZB 4FFYL 1JZEA 3SPVA 2YMOA 1V3LA 2BRRH 4YE0A 3U0TB 5EBWA 1DFBL 4PJIA 1XR8B 4J3BA 3PQYE 1PZBA 3P2DA 3P0YH 4OUOA 5EIIG 2Q7YA 1GAFH 1HTYA 5AEAA 1VAHA 3AREC 2NY2D 1TQUA 3SGDH 4AK2A 3SJVB 1V3MA 5ACZA 3ZW3A 4BYHA 4JHVA 2AK4B 2HX9A 4JO8A 5DVNA 3MLUH 5DYOB 3NK4A 4G9FB 3V52L 1XZ0A 2DMBA 4P9HL 4TUOA 4U1SA 3B9KB 4X50A 4XR8C 1QBLL 4NQSA 1ZHNB 2PW2B 3O3UN 1IV8A 2CDFB 5AKRA 4P05A 2DQDL 1L0PA 1AO7A 4J3VA 3WTSA 3QJHB 4JLRB 2H26A 1UYWH 1DJGA 4AV0A 1FE8H 3L3KA 5E9DA 2CGYA 4LPYA 3OQRA 1KF9B 4OZ4B 3WS3B 4D8OA 2E75C 4BHUI 5GGRB 5CBEB 1PZ3A 3A0OA 4TUUA 1MW0A 5AVVB 4NO3B 4EZKA 1V54B 3O3DA 1Z9OA 4WENB 3RG1C 3GSOB 2W07B 1Z2KA 2ED8A 1NSNH 1RLWA 3KXFE 1FP5A 1P4BL 5IREA 3IVKB 4NRXB 5EA0L 2VLKE 2JSFA 2LLGA 5CZXD 4O02H 1G43A 2PXYD 4FOMA 2QADB 4PJHF 2VL4A 4U1IA 3U4BL 4ESKA 2P8LB 1UWFA 3SD5A 3BPOC 3KGUA 1ADWA 2VXVH 3HG1E 3HBQA 2IIJA 4L4TB 4KTYA 1A25A 1T2JA 4GAJH 1T3FB 4M7ZC 1GOGA 4E9QA 1ZDSA 3PGDA 1PFCA 5BV7L 2OMBA 4HJIA 1MFCL 5F1IB 3C5XA 1EHLH 4WHYG 1X7QA 3A67H 4QRSB 5SX5H 4APXA 4WTQA 1K9TA 1KFAH 1HHIB 4HEMA 5JIQA 1U8CA 5JXEA 4E9VA 5H4YA 4NGHH 5TDPA 1U3HD 2Y6TE 1RP8A 3K6OA 1UZ6F 3K5SA 5I76A 1FNHA 3OMNB 5CJBA 1FV1A 4WWKA 3QEQD 4K3JL 1KYOJ 4I1NB 5CO1A 4DO6A 4YSDA 4FYTA 4WJKB 1MIML 2EDOA 1ETJA 4FLQA 4TRPL 1NPJA 2CM6A 1VFAB 3D2UD 3L4YA 1RZKC 3W5NA 3QUMB 1AGDB 2YR3A 4AY0A 1QBAA 3LEYL 4ZYKB 1ACYL 3K6DA 1LE9B 4FXKC 2AKRA 3IDJA 3NCEB 1NUFA 4GNKB 3J2PA 4WTZA 2IAMB 3ULUH 2N56A 4DK3A 1IGIH 2EJ1A 1P5VA 1JWUA 3HC0A 1KEMH 3MRRB 3NSDA 4ZFZB 2F8VA 4WWKD 4D9QE 4E9LA 2P44B 2AS5M 2GJ6E 3REWB 1I9IH 4BCYA 4MNGB 4NO0B 3PHQA 1F2QA 1KLFA 2XZCH 4QRAA 5F44A 1KV3A 2G5BA 1RJCA 4F33B 1W0VB 3AACA 1T66D 3LH2L 2WTPA 3VJ6A 3SDDD 3GMOA 5MEQB 4QRTA 2F74A 4ZPTB 1SBSH 3N1PC 4S0TD 1QNZL 4PJ7A 3VFVB 2APTA 2H1LM 4A7QA 1WICA 4N0FA 5DHYB 4XPHL 1BGXH 2NY5H 4FNPA 1N8ZA 4HUWA 1IGTB 2X44D 3EFFA 4NUGH 2CGRL 1EJOL 1PTZA 5EOQH 3NJLA 3U7WL 5EZIL 5EDXA 4ENED 2VLRA 4WUUD 2GHZA 5DHXB 4JFYB 1YNTA 1UT9A 2YN3A 4QOKB 1IL1B 1MLCA 3VNYA 3VD3A 3OLGA 1M7XA 3KEHA 1G1OA 4K23H 1I8UA 3TVMA 3BH9B 4ZDHB 1DFBH 3HE6A 2K9UA 1Y6NR 3UTTD 2NUPB 3AQYA 4U1KA 4P2CG 3J07A 4NC1C 5EBGA 2R23A 5J9PA 3DLQR 4LEBA 4FA8A 1G6RH 1AXIB 5EN2A 1S9WB 2Q76B 1OE1A 5D7LA 2QVTA 3JV4A 3QPXL 1WGOA 3P4MA 1M1SA 2HFGH 4K55A 3D8MA 3L48A 4N2HA 4JHAL 3KWWA 5IUCA 3V7MA 3VXNA 2NUPA 2CLRB 4ZW3A 2ICEC 1UZ8B 2XWJA 4NQSB 1BVKB 1NDGA 3MOBH 5I17A 3HKZA 1DBKL 2UWEF 3MCYA 4XVSH 2AP2A 4BWTA 4WTXA 5E2WL 3ZL4H 1KBPA 1NM9A 4PJAF 1PU0A 4RFNB 1G7QA 3FRPB 1Q8MA 3FB5A 2NSQA 2WBXA 4UQ3A 5CZRA 1HNGA 1WFOA 2KZ1B 3R7QA 3A47A 5D2NB 3RX8A 1KLUA 3ECVA 3X14B 3BGFB 3OQ3B 4PS7A 1RHHA 4Q9RL 4X0NA 2DB8A 3F58H 2OMZB 3KLAA 1AKPA 5JNYA 4EQ2A 5TK2A 4DK5A 4Y89A 4JREC 4L8BB 4P9HC 1O6SA 1MHCB 5I1HH 1KJ3L 2WVSA 1KBVA 5HJDA 2WKOF 1ZEAL 3ZT7A 3M8OL 4DH2A 3BP5B 1CD1A 1ID5I 4NBYB 2KZKA 4PJXF 4ZO7A 2VT0A 2Y7SA 5I16B 3HN3A 1NGWA 3V9FA 3UG4A 3ARGD 3RKPA 5T1DL 1L0XA 4P99A 4JFED 4M7ZB 3B2XA 2B77A 3C75A 3DARA 5FECA 2EABA 1ACCA 1AVAA 2FQEA 5D7KE 5GS0C 4NQDE 2HTLD 2OZNA 3SKNA 3KXFA 3PAUA 1KIQA 1Q0XH 4H88H 1N5YL 1CLOL 1TSHA 4ORGB 4PWGA 4EN3D 2VTFA 4Q89A 5DUPL 1JHTA 4R3SB 3ABGA 4XN1A 5CKAA 3PXJA 5FS5A 2VDQH 3DVNA 4X4YA 2VZOA 2AQ1A 2R1XA 5D1XD 4L8SB 2WYTA 3RZCC 4D2NA 2XV2A 1TQCB 1OALA 4FJ6A 4KO9A 4RNRA 2AMGA 4H8UA 3ORJA 1YECL 4I1PA 1PDKB 4Q7DA 1HHJA 3KBPA 3L81A 2BW5A 5IB5B 3ZBMA 4JPVH 3GBMH 4G8FA 3CX5K 4TVSa 3S36H 1WIUA 5I15L 4PGBB 3MTRA 2JI2A 4YFLF 3ZKQD 1NCAH 2UYLA 1LP9F 4XPAH 1KZQA 1S7XB 4W1TA 3CN0A 1VRSA 4U3CA 3T0XA 3ZOAA 3QISA 1BXXA 3QDGD 2A0LD 1ETZA 3UROR 3U36A 1QACA 1T04A 3HNTL 4MD5B 2YJLA 4D9QD 2EIJB 1NGQH 2GW5A 2Y6SC 1T1ZA 3KGSA 2IQ9L 1A14L 3P40A 2Y72A 4QRPE 3TZVA 4RQQB 1AS8A 1ECYA 1GHFL 1A7RL 3EAKA 1LNUA 4WUUA 3VYOA 5LDUA 1FIGL 3DUHA 3F12A 2C9PA 2LU5A 4IHBA 2HCZX 4H5SA 1EDYA 2CUHA 1UCBH 1D6EA 2AJ3B 4KKAD 3H7LA 2VWEC 2IFFH 2OTPA 1XF1A 2G60H 1HL9A 3RWFA 4F5CA 3PPEA 2X70B 5TPWH 4KOBA 5JPMB 2XV0A 5KVEE 5C7XH 1XGUA 3HUJA 1GZPA 3NCJL 3UPCA 3CU7A 3OKOA 3K72A 4UV4L 2DQFA 1QLRA 2FJUB 2NR6D 1PY4A 1FV1B 2CMRL 4S1RL 4GXUM 2E7LA 1OOWA 1E5ZA 5BQDA 3VCLB 5E6UB 3H42H 1CFNB 4JCLA 4X7TA 4HS6B 2DQIH 5T3ZE 4X4XA 5C0JA 5DVOA 2O93L 3RDTC 1TVBB 2PPFA 1GW6A 2X40A 5ADPH 2F1AA 1XR9A 1CF8L 4FX5A 2WZ0A 3OLDA 1SHWA 4Y4HB 3UTZB 3KPPA 2VDQB 3PP3H 3IGAA 4XCFL 4XZUA 5FM5O 3WS6A 1ZE3C 3GBNL 2ICEB 1PZAA 5F9WB 1U6AL 4KUZL 3TEZA 5IJVB 1UGNA 3J8F7 1CD0A 3HTLX 3GJFB 1YN7A 4HC1L 1U8KB 2VZUA 1J5IA 1SOQA 1WS7A 1ZD6A 4K9JA 1HZHH 3N85H 5C08E 4GXFA 1UOVA 4H4NA 4NQUA 1NEUA 1FAIH 2F74B 2VXSH 1A6PA 4Y1AA 4WI7A 3L2NA 3QIBD 4BRVA 1JZ7A 1N4XL 3U1PA 1EZVY 4GPVA 5D7IE 2VLJD 3HAEB 5KVFE 3HS0C 1SJEB 1YMHB 4EJ1C 4MB1A 2E46A 5CSZA 2HYMA 2VLJA 4ABVA 2D0FA 3G04B 1P84K 2WINA 1P5VB 3HC2A 3MLXH 3OR6A 1I1AB 2D3NA 4ZT1A 4ZUTA 4HGWB 3HCVB 5D5MF 3Q2WA 3KPRD 5GGSA 4CUCA 5TE4H 4MASA 3KXFD 1CICB 1XCQB 4FCAA 3VFWB 2IH8A 3ULSA 3NACL 5IB3A 4FNLH 5JIIA 3BJ91 1G6RL 3GJEB 1F11B 3DSNB 3EO9L 4Z7QF 3L3IB 2EXYC 1NKGA 1JTPA 4Q58C 4XNQA 2W38A 4DQAA 4BJLA 5HHPA 5C8JA 4HWEH 4HGWA 4XXDB 4XNAA 1KBGL 3OR6B 1XXDC 5AZUA 5E99H 1A6TB 2W91A 4WU5A 3GINA 1E2VA 4GI9A 1MFMA 4UAHA 3O0RL 5EHFA 1IBGH 3RWCB 3D69B 4H7VA 5F6IC 3HI6L 2IOMA 3EYFA 3PL6C 4XPBH 4NENB 3OF6D 1U93B 2DL9A 2XTJB 3FSOA 3ULAB 1RERA 5AB0A 2PWGA 2IXQA 4I0KA 4XMLL 2V17L 5E1AB 1KXTB 2BSRB 3WJLC 3SCMB 2JCCA 2VZSA 2NRDA 4RMRA 2BIMA 3OKLA 2GY5A 3VGFA 4EKXA 5A43C 3CPLB 5DD3L 3VSUA 4MNGA 1NFIA 2B39A 1JK9B 4ZAKC 4WY7L 1INEH 1L3WA 4KI5C 5KANG 3AGWA 3BKCH 2QJDA 4X83A 2W9EH 4HUVB 4NENA 1FNGB 3T0EB 3CDYA 1BQUA 1GIGH 3QZBA 4R7XA 4N0UE 4UMGA 5GRYA 3UIYA 2P8PB 1LTXA 4F8QA 5KUKA 4OBSA 3DUSA 3K8LA 6FABL 4LB8A 1JGDA 4FLRA 5CINH 3GXPA 2X09A 4R4BB 5D9SA 3MLPA 3GS7A 2ZF8A 3PGFH 4W4NA 4L18A 2E6PA 4IBYA 1PW3A 4H40A 5B4MC 4J3OC 5HVHC 1A6ZB 3GSVA 4DIXA 2EIMB 5IQOA 3ULVD 1U2YA 1W6LA 1KN4H 2F61A 5HDBB 1G7HA 4X5XB 2EXTA 4G9FA 3CLEL 1MPAH 4GW1B 3T6XA 5CEZL 1T7ZA 3HNSH 1U33A 4JN1L 1V7NH 1T83A 1TO5A 4WGWB 1NPNA 4YZWA 2OXHA 1RK7A 3D2UB 4KK6C 3DK2A 5FHAL 3BSZH 2SODB 3QYCA 4BFBD 5FDYA 4JG1H 1HWGB 4X6CB 2VE6B 2H0PA 5DEFB 3MV7E 5GIRB 3STLB 3VGBA 2JB6A 3P9LA 5CS7A 2Q8BH 4BFOA 1WE5A 3FT1A 2W81C 4PQXA 5EU7E 5JIDA 4LSVL 2B4CH 1YAIA 5SV3A 4RGOH 3U4BH 1ZT4A 1YY9C 1K6QL 4R96A 4AW4A 4MNHB 1U92B 3ABKB 3SPCA 1DUYA 5E5LA 2XV6B 4IBTA 1IQWH 5FOBA 5FO8A 4P23C 1SUJA 1DZBA 4AGNA 4AC4A 4YC2C 1OB0A 1AHWA 4QHUB 3NRPA 4MQSB 4KQ0A 1PVHA 3AG2B 2QBWA 3IJSB 4IBSA 4WF7A 3D52A 5KYXA 2OMYB 4MXQD 5ID0A 3LDBB 4AV4A 5IHZB 2OYKA 2LFEA 1T7YA 4XP9H 2WP3T 3PGCA 4GO8A 3WU1A 3IFNL 2FBOJ 3GMPA 1UD5A 4IOIA 4GRWE 4KHXH 5EPMB 4IJ3B 4KO5A 3QIWB 4RSVA 5GS0L 4OAWB 4QGTA 4JUTA 1QPKA 12E8H 3HZKA 5HYJB 3HMXH 5IVXF 2DQHL 4UIMA 2HTKD 5DC2A 1Q94A 3P0YL 3TBWB 3NQIA 3GXTA 3ULVE 2H2PC 3O11B 1AJ7L 3EYQC 4IMLB 1UD3A 4ZMLA 3VX1A 4GG8A 1RPUA 3MNWA 4OLWL 2PXYC 1CGSH 3OPUA 3SQBB 1Y0LB 2JV6A 5EOCJ 3VD4A 2NCEA 1A5FL 4DPAX 1BLNB 4NKIH 3VW3H 2LABA 4ODXA 5I1DB 1CVRA 3SYOA 2G2RA 2V2XA 4RAVB 1UZGA 2OR9L 1PIFA 2LE9A 2R29H 3T3MB 2CD0A 3TYGH 3UZQB 4IU3B 3QHFL 4S1QL 4MMYB 5DI8A 3PL6B 4JG5A 4K73A 1I7TB 1S46A 4NDMA 3NOIA 2OULB 1ZDQA 4N6RB 5C0CE 3R0MA 3FSWA 2BIOA 1FG2A 3AABA 4IBQA 3U1QA 3GNMH 3VRJB 1NBYB 5A2CA 1VKXB 4RZCB 2N1TE 3DX0A 5HGAB 1KULA 4XCEB 1HHHB 4IMKA 5D4IA 5HJGA 3FT3B 3EYSL 3UTTE 1B0RB 1ZHBB 4GSUA 4NKOB 1IM9A 4YSOA 4HETA 2ZWKA 3RU8L 1I7UB 3N3EA 1E4XL 3C6LD 3IXAB 3ALWA 4X6EB 2XN9A 4L4TE 1FFPA 3RPKA 3VD5A 3S96B 3ZRFC 4O2FA 4TM9A 5LQBL 4NWUL 3ZIMA 4JO5A 1WYJA 1I4FB 1LWHA 4XO9A 1JPFA 4JO2H 5HI5D 4YXKH 3RY4A 1G4RA 1XEDA 3GSWA 3L3JB 4E9SA 2FD6L 4DEPC 2GPZA 4BZ2A 5K93A 5B8CC 4LAQH 3L17A 5JOPE 4N90E 5IWLA 1S7RB 3LCYA 4RFEA 5D6DA 1DVQA 3A4DA 5DJZB 4XO5A 1CYXA 3RDTA 3S3CB 5EU3A 3CE1A 3LEVL 4PRPA 4ZMQA 3Q2LA 1VCAA 4RMBA 1UM4H 3SDDC 2N59A 4DKAA 4Q52A 3V2AR 1JHLL 4HUXA 2KUTA 3C8DA 1MQKH 3T6WA 1TJMA 3DSFH 3WFBH 1OW0A 1JP5A 5J3HC 1QKZH 2AQ2A 3QG6A 2A99A 5EIIA 1V10A 4D3CL 3MZTA 3LNDA 5I8CA 5GRXG 1UACH 3ZE2B 3UX9B 4KZDL 4PJXB 3U30B 3T65A 4PJBE 1OP9A 2Z7YA 3RNQB 4BA0A 4C4KO 4G5ZH 4TVPE 1BZ9B 5CEZD 4FQ1L 3W2DL 2JKTM 3D33A 4ETQA 4IRZL 2EP6A 1NUGA 4RWYH 4NNPH 5FYKL 1T4KB 4MX7A 4PJXE 3DGDA 1JN6A 5J12C 1I8LC 1NOLA 1JFQH 3VI4B 3NH7L 4JHBA 1E5AA 2WNXA 2ZOUA 4NZTH 4A2FA 4Q74A 3DX2A 2BP5M 4EVNA 5AQ0A 5I66A 3DUSB 3IF1A 4AM0A 4CVZA 4J7RA 3FQNB 4M00A 3JSSA 1D5RA 3FQ2A 4WFGD 5TQ2H 2R56H 4ZG1A 4HAGA 2BNRA 1D5ZB 3MYJA 2EYSA 4MQXD 4WEBH 4AEHH 4ZX3A 1CVSC 4H8WL 5FX3A 3ROOA 2X4SA 3KPMA 4KNUA 4Y2OA 4CAGA 4P5MA 5I1KL 4L3EE 2WBWB 3LQAC 3QNFA 2IH1B 4KQ3L 5EU4A 5F70A 2BS9A 2WHVA 3R4RA 1BBDL 3GRWH 3K8MA 4N8VA 1C9SA 2P5PA 1IC7H 4N90D 2P5ED 5EZOH 2DLTA 4YXHL 4GKSB 1FVDA 3KYOA 3C08L 3SGKA 2B20A 2DQMA 1YDPB 3DOHA 1P9MC 1C7TA 3RKDD 4AI7A 1YVLA 5CCKH 2E76C 5C97A 3MRMB 5EU4B 4GG6A 1YUKB 4NJAL 2IJ0C 5AOIA 4F7MA 3ATFA 3HI5L 1GC1C 1RIVL 4POZD 3M86A 4EPSA 5T8IA 2NUTB 4S10A 4GQZA 4QDGA 3VXOA 3QXDA 5E8NB 4XMLH 3AFLA 5FGBA 3HE7A 4GP5B 4JY6B 4OH2A 4YL4A 4NO3A 1XWVA 3WJLA 4BUGA 1JGUH 3PV7A 3E3QE 2BNRB 4LLWA 4U1GB 2FR4A 4LESA 3HPJB 2EDBA 3UAJA 4NC0B 2OR7A 4XWOD 3S5LB 3ULVC 4FZEH 3H9SA 4S2SB 1S7VA 5C6TL 3QB7C 4P3DA 4S0HA 1G6RA 5JYLA 4ORGA 3CFMA 4UQBA 4H0GA 3KLSA 2HLAA 2NUTA 1T4WA 3SKNB 1O7SA 3CHRA 1UA6H 5E1QA 5E8NA 5D5MA 2LAGB 4IQHA 4M62L 4OZGB 2NY6C 1HHGB 4FE9A 1P6AB 1Q9LA 2IANE 1D6VL 1E6OH 1VLXA 5DLLA 5E94B 4POYA 5FDWA 1OB1B 5DJ8A 2YPLB 4NQCD 4TLKA 5GRUL 1S5HB 2C4XA 1WGVA 3FC8A 1ZLVH 1CFMA 4JQIA 3KPLB 4NC1E 1S9YB 5GZOD 3QZLA 2PWDA 5TGBA 5IMKB 3BEWA 5FK9B 4Q6IC 1BOYA 1G7IB 4Y2DA 3KL5A 2HVKB 3MUUA 5HY9A 3NIFB 5M7QA 3EJPA 3HNSL 5E2VL 3AB0B 5GSVB 2YXVA 4Q0XL 4ISVB 1T7WA 5HGBA 3QHZL 4KVNH 3WFEH 2YAEA 4BWUA 1ZVYA 3S2CA 3O8XD 3RNKA 1OM9A 3D39D 3T0DA 2JTYA 5ABAA 1RZFH 2Z31C 2A1WH 4Z77B 4MDRA 2FYYA 5DJDB 2HJFB 4KX7A 4MDIB 3H3PL 1CFQA 4AYFA 1G6RB 3BESR 1CICC 1I3RB 3CZGA 3UTPD 1EAOA 3JTTB 2H8PB 3HFMH 4ZW8A 1VEPA 4LL1A 4OGAD 4RVBA 3RBGA 4DO4A 1V8HA 4LEOB 5D5MB 4ELMA 1H3PH 1UD8A 1UQSB 2H32H 4HLZH 3MV9B 5GS1C 3K2UH 1OWRM 2DPKA 2FO1A 2CR0A 2FWOA 1IGYB 4GQ9L 1ZIAA 4WKZB 4XP5H 4WNSA 1NGYA 3C6LB 1IAKA 1N7ML 3KR3L 1OAJA 3CXFA 3MOAL 1I1YA 5D1XC 3RZCD 1YEHL 5DYOA 1DQJB 3KLLA 1E7UA 5EC1A 2DQJH 4YGAB 2VL5B 4PYHA 5KYXB 1BYPA 5FUZL 1L6PA 1OE3A 3QFJA 2FVNA 2DI9A 3CFBB 4IRSB 4N2BA 4UBDD 1GPOL 2Y1AA 4MA7L 1I7TA 3N44B 1O5DT 4IK6A 2QPSA 4XNUL 1ILUA 1QSZA 4XAWH 3PJSA 3FZUC 3NMEA 1HI6B 4NFDA 3PJNA 1M56B 1I1FA 5I5IA 1JG9A 3B9AA 1GY1A 4R26L 3SYAA 4IDJL 1LMKA 1ZANL 2DWEA 1SMAA 3OHXA 1FUNA 4P57A 5B1KA 4TL4A 2WCSA 4PJ5A 4KU1A 3NACH 1A0QL 2EEAA 1M57B 3VGAC 1A14H 4LSUH 4NP9A 4Z7NE 3N43F 3MJ6A 5HPOA 3KPQB 1FNAA 1KJMA 3DBSA 4B9YA 1VFBA 5KBMA 2HLFC 4TNWF 4DZ8A 1ESOA 4HJJH 2X42A 1S2EA 3LQZA 3GSRA 3E0GA 3L2MA 2G0KA 4A2HA 5HYQA 1KB5L 4IIQB 3KWWB 4XPAL 1AG6A 2VQ1B 3T8XB 2HJKA 4QT5B 3ZL2A 4M6AA 2CK0H 3KR3H 3FRPG 3C5ZB 2GIMA 2XTJE 3NSXA 2FH8A 5C7ZA 3BD4A 4Z95H 5EFIB 3LIZH 4F9LA 5HPMA 3GO1H 3P11H 2CIIB 4H20H 3PREA 1NJ9B 5FWQA 4PP1D 4J1UA 3E3QC 1WUNT 2P5WE 4HU2A 4F7EB 3O0LA 2RAMA 5E2UL 1IGIL 1CGTA 1QFUL 3UJJL 3ZY7A 1BG1A 3MGTA 1SDDA 3KM2A 4GAGH 1CT8B 1QSFD 1UD2A 5KN5A 5I1KH 4A1RA 5CEYB 4HU8A 2WXOA 4XN8A 5LUMA 2NY6B 4MWFB 1DDHB 5CSGA 3B7SA 5F3HA 3N91A 1KIRA 5J6HA 4IK7A 4DVRH 4GI8A 4B9JA 2DQIL 3ARBA 1L9RA 2J6WA 1ZLUK 3MPCA 2C3HA 3MNZA 4GMSL 3TN0C 4EIUA 1J9SA 4AG4H 2GVYA 2JB6B 3EJYD 4NGHL 1UG9A 4X4MA 3QIUA 1QTYT 2BZ7A 2VOTA 1EDHA 1T0MB 3VWJB 4JM2C 3UTSB 1ZEAH 2H2PD 5T3XL 4FMKA 1U8HA 2ENJA 1M2VB 4LLYA 5HDRA 2CNZA 5CEYA 4H8WC 4YAQB 3QJFA 1HXYB 1BZ7A 3ZKXC 4CNIA 2XG5B 4HBQA 3IJ9A 3FDWA 5BVJA 4KZ0A 3H9ZA 1G0XA 3QUZC 4MJJA 1IT9L 2WVVB 1AOZA 5CUSH 1DVFD 2IFFL 2IDFA 2EINB 4P9ML 3JTTA 2ZKWA 2VMEA 4RMUA 1J48A 1U8MA 1S7WB 2QV4A 2R2BB 4HAFA 3O6FB 4P5TD 2ZKHL 1HU8A 5AW2B 2ICCA 3S4SB 4LQ1A 2UZYB 2O1AA 1VSCA 1U8NA 1JYNA 4H26A 3TN0D 4FZEL 1M7IA 2YD4A 2YAPA 3VFTB 2MNWA 3HG5A 4HWZB 3WHE0 3RY6A 4P3DB 1KBWA 2VDKB 3QNXA 1E27A 4M61A 2PYEB 1ZPUA 1UWEL 2W0LA 3KYKL 4HKXB 5DD5H 3SPVB 1JZ8A 4LCCB 1JHLH 2UXVA 1JNNL 4R96B 1RVFH 1Q1JL 3C6LC 3GZOA 5E6IA 2BP8B 4AE1A 5JW5B 5GIRA 2ZD0A 2WXQA 1QRNE 2ADIB 3TV3H 5JQ6H 1J5OL 1BQ5A 1YECH 2Q7NA 1CLCA 3ILPA 3LPOA 2ZCZA 1BJ1J 1EANA 4XAKD 2ZX8A 2DEWX 1JK8B 3MC0A 5F7BA 1DJWA 4XN2A 3CQFA 4OSUH 5EOQL 1WZ1H 1TQBC 2KYIA 2AEPL 2WXKA 3U25A 3CD4A 2DW5A 1S78C 2VDNH 3TZVC 4P46C 4PJFA 3EO1B 3MRDA 3L95B 2FX9H 4QYAA 4PJ7E 5E9DB 2BVOB 4KRLB 4JFQB 1M7IB 3CVHA 3SDXA 2ZSVA 4HWNA 4YDZA 3CX2A 2BNUA 1U3ZA 5CZKA 5DA4A 3LTVA 4W6WB 5HYSA 4PV1C 1VPOL 4X9YA 3DMMB 2PW2A 3W1ZA 2C3XA 4I4WB 4WK0B 5CILH 1PAZA 1CFNA 4KGLA 4PJFB 4K94H 1BZQK 2YWYA 4X7SL 5K33A 2UZIH 3D87B 3K2UL 3ZO9A 3BN9D 3DPBB 1R33A 2YPLE 3BPOB 3MRDB 4TNVK 2WUBH 4HPOH 3NRFA 4OB5L 1GC1H 2FWOB 3HFML 1R3KA 1PX4A 2FNBA 4YDLC 3RVUD 1URIA 5B7MA 5KWYC 1TZAA 5IVXB 3PIQB 3TJEH 1KIUB 4PJ5E 2WK2A 4PVNA 5T3XD 3VX0A 4LCWD 3RA7L 3F6JA 3UTOA 3MMEB 2E4FA 2QGDA 3G6JF 5EBMA 3QGVA 4DP9X 2KMWA 4IHOB 5AYTA 4UT9A 4BBWA 1QHPA 2H41A 4XCCH 3PAVA 4OZIB 5E6YA 4KC3B 4MD4B 5CIPH 5L88H 2JE8A 1B9ZA 4MLSA 3LZQA 1K2DB 4IOSD 2VMDA 4LLDA 2J20A 3LXUX 2WXIA 4MWFA 1RSFA 4NHUB 5C0EA 2XVLA 3UBXA 4GINA 4BE5A 3WN5C 1MWAH 4NXSA 4XCNA 3MMEA 3IFNH 1BEYH 3PNWA 5J12B 4YDKL 2N1KA 3EGXB 1C08A 4XNQB 3FOLB 4KK5D 4XMVA 3M46A 1KENH 5FK9A 1Z32X 5F21B 5AALA 4WI3A 2W60A 4UQDA 5BUGA 3W38A 1D6VH 1R3HA 2DH3A 4EUPA 2JWYA 1WBYB 1XF3A 5GGTA 4Y2DC 3FH8A 2W94A 3IFLL 2DQCH 4XX1G 4K23L 5IB3B 2QT6A 4NKOA 4YOKA 1SVBA 1AO7D 1JPGA 1CPUA 1QSEA 3BKJL 4LOFA 1V7ML 3EJUA 3HC3L 4JM2F 5CCJA 1W0WA 3PWPE 2CJUH 2AJYH 1OE2A 3SDCB 3V55A 4I18B 5GJTL 3DX4A 4RGOL 4PJDE 1UURA 3G5ZA 4Z3FA 1IGFH 3QRGH 4JRYD 1I8KA 3ES6A 1URLA 4G8EB 4PLKD 2LTQB 4AL8H 2DWDB 2OCCB 4ODUB 5KG9A 1RIVH 3WTXA 3LH2H 1LO5A 3NK3A 5J1TC 4NCC1 2IWKA 4YDMA 4YDVA 5D1QD 1LP9B 3OXSB 3Q8AA 2QDVA 5FW7A 1KGCD 1R5VA 1TLMA 4NLHA 1DQDH 1GSMA 3FZUD 4ODVL 4DVBA 5E0FA 2DWDA 4U4IA 3U2JA 5CEZH 5JW5A 1HS6A 1IC7L 4PBDA 3T1FB 1F90L 3E2HC 4CSTA 5IM7A 1A4AA 4NKIL 3TO4B 3WEXB 4AXWB 3KPSE 1LO0H 1BQLL 3ISWA 4GKSA 3SDAD 3CJJA 2ADJB 2ARJB 3R0NA 4MJ2A 1YNLH 3HRZA 3MACH 2YPKA 4LVEA 4DVBB 1T5KA 2DDQH 1JZ3A 2Q6WB 2I60L 4AQ8C 2O72A 4FFTA 1TETL 3SPIA 4NN7C 4J5VA 2NZ9C 3O81A 1BW8A 1HDMB 5EEWA 5HD8C 4PGEA 4BKLA 3FRPA 4MKTA 4UQ3B 1ILSA 3KH4A 5F7EH 3P02A 4ES9A 3ES6B 3VI3A 3G5WA 4JPQA 1Z9PA 2VDML 1DBML 5CSZB 3GZQA 4ELKA 4YEEA 2VW7A 3GMRA 2Z6FA 3SDYH 2E9IA 4OZGF 4C58B 4DZ8B 5IBTH 1OD9A 4JFDD 2VCOA 1WC7B 2OZ4L 3H9SB 4GB9A 1CDCA 3CH1A 4AJ0A 3V79C 5IBLD 3MRHB 2JJSC 5F1NB 4M1DL 2BSTA 43C9A 5KYYB 3ELAT 5GJTH 1XX9C 4JO1L 3BO8B 3SGDI 3HE6B 1ULVA 3QIUB 2DQTL 5EH1A 2EDQA 2CIKB 1NDTA 3EZ8A 4CC4C 2BNQD 1V7MH 3ZJAA 3CDZB 4C57C 1U3NA 3ARDD 3QWRD 1RSYA 3H9HB 3T04D 3CC1A 1AQHA 3ESVF 5DUBA 1VERA 4ZUUA 4UMSA 2Q8AH 4UT9L 1LWRA 2MKLC 1DUYB 1JGVL 2VH5H 3MBXL 4PMFA 2WXLA 2WUCH 5FYLE 2Y1ZA 1UADC 1S7UB 4FQ2L 1EAQA 3BEWB 3LYRA 5F7LB 3KYOB 5DMIH 2E7BA 3Q1SL 4DGIL 3O6MH 4MYWB 1F4YL 1URZA 3ZE1E 5L4JA 1J8HA 4LHUB 4MJID 3FUKA 5KJ7E 3A6BL 4NIYE 1MG2C 3CVCA 4WLCA 3LV3A 5IHZA 4WIQA 2M26A 4U6XA 4PJ6A 2AQQA 5DO2C 1OK8A 1IZJA 1Q9OA 3NABH 4PB9L 4MZIA 2EDWA 2NY0B 3QA3B 3WIAA 1ZGLB 4OCRH 2BVEA 5SX4I 4CVUA 1JAEA 1MPAL 5FIEA 1LXMA 3PHSA 2F0CA 2CZNA 2G0LA 3ULUF 3B5GA 1L9NA 4R4FH 4ABUA 3DXAA 5D7IA 3HPJA 1FL6B 1EO5A 4BFIA 3BRDA 5IWLC 1HZHL 4IRSC 2FZ3A 1BAWA 1IGMH 3QA3A 1ZGLA 4ALAL 2IALB 4WO0A 5LBVA 2FLRT 2OBGA 2QTVA 3MJ9A 1A4CA 4MB4A 4FG0A 2WUBL 3MLRH 4HPOL 1F4XL 4MMXA 1GOFA 1CG9B 1MJ7H 2I7OA 5EU5B 1RJLB 4W9CC 1ETZB 3GXMA 4K7PL 4EDWL 4Z0XB 4Y5VA 5H35A 5LDSA 4KRPD 4ZMPA 3EH5B 2R29L 4JPKH 3QUYB 3X13A 5AAMC 3A4AA 2OXHB 2V5SA 4Y9FA 4BZ1A 4BZ1H 3V5HB 1UHVA 1U95A 3QC5X 2LTQC 1S9YA 1F4HA 3SGJA 5F6HJ 2D4FA 1CE1L 4CU7A 1ZLUH 2DV6A 3MV9E 4XP6L 2NYYC 1BOGA 2EQDA 4Z7OB 4KNQA 4P4KB 3WDIA 4F8TA 1G6VK 3LNHA 5L9DH 1H8LA 2V5MA 3PU7A 2IPUK 2FB4H 4LVOB 4PRAB 4F7KA 4QAMB 1UA3A 3LHPL 2YC1A 2R15A 1JGEA 4K5MA 5K59F 2VB5A 3RHWF 4LSQH 4F3FB 3ESOA 1QW9A 4NO5A 4KAQH 3RDTB 3SE4C 3ZIYA 2DIBA 3MLSH 2NY3C 1DSWA 3S5ZA 3BXNA 1YRKA 2V9TA 1JPFB 4C56A 1SPDA 1DANT 1UWGH 4P2YA 4PRAA 3VSQA 1FFQA 1LWJA 4AGMA 5J0BA 4AZUA 3V4VH 3LAFA 4F3FA 1JV2B 3FULA 1QSVA 3QNYB 4Z3IA 3LJ3A 1D5XA 4LEOA 3VWKC 4WGVB 1MCDA 1ED3B 3Q48A 4ZAKD 5K5YA 2AVGA 4Z78B 2ORBH 1UZ6E 5FYKD 2ZXEB 4GUPA 2Y7QA 1JERA 1U95B 3UFIA 1N59A 4GEIA 1RZJL 1UGKA 4JFDB 2IANB 4UZGA 2VSMB 3VXME 5F9OH 5AVYB 4KHTL 1QHQA 2XBZA 5ADOH 4M4RA 3TV8A 1DCEA 2GJ6D 4OCYH 4E5XA 5JIKA 1J1PL 1TITA 3WXWL 3CU1A 4MA1C 3UACA 1FAIL 5KVEL 1FZOB 1B3IA 3SKOB 1G7QB 5TQ0L 1KB5H 4HC1H 5EO1B 3VRIB 4Z0BL 1PCXA 3QJRB 1T2QH 2BDNL 4LAJH 3SQBA 1X5AA 4HUCA 2AZAA 4N8UA 2YMXH 1CXKA 1EZUA 1WBXB 2FUTA 2XWBB 3VG0L 4XB7A 4OZIA 4JG0H 4PJ8D 1D5ZA 5DZ9A 3BSGA 1C12B 4BGDA 2ZXAA 4JRWA 3ARFD 2WNWA 3AG3B 3TCLA 3NEXA 3ME0A 2OMTA 2NXZC 2PN5A 2Y4SA 3KPPB 1A47A 7FABH 3IF1B 3BWAB 4A66A 1ND0B 2ESVE 3HA0A 4XI5D 1IVLA 5CJXC 4U6XB 5CNHA 3EOTL 1C5CL 4NRZB 4L8DB 4DKTA 2CKBL 3QZMA 5IZ7A 1Q9OB 4O02A 1WPCA 3H42L 2XY1A 4KY1L 5E4OA 3FUIA 4N0CC 5DS8A 1EEYB 3RB7A 2IF7A 3TEXA 1FIEA 3OMIB 1ZT7B 4GIOA 1W6WA 3TTYA 5AAPA 3N0AA 4PP1C 5I1HL 5HI3D 3GJFH 1RXLA 1XFPA 1YDPA 1W16A 2ZYIA 1RH8A 3HZMB 1I1CA 1TTGA 2GSMB 4S1SH 4FG2A 4UZSA 3RVXD 4GAYA 1E8ZA 3PV6B 4R2GC 4K3EH 4NHCL 4NUJB 2B4CC 1QZ1A 3FN9A 2AEWA 1N64L 2XNAA 3VH8G 1UFGA 1C1EL 4L4VB 4OD3H 5IM7B 3O41A 4JQVA 4XC1L 2QKIC 5IFJA 4GP8B 1MEXH 2QTEA 3HB3C 3KLKA 4KY2A 5I6XC 1TTAA 3M1OA 4HWUA 4XC1H 1PKOA 4GQ9H 5E70A 3LN9A 3NJVA 4OD3L 3RIFF 3V0HA 5KYUB 1JIBA 4LL9A 4K7PH 4KOCA 1KY6A 1GYVA 4PGBA 1I85C 1UATA 1IEHA 1JWMA 1A02N 2GY7B 2JIXD 3ILEA 3KL3A 4ODTH 3BMVA 2V7NA 4B7LA 5ABDE 4JO4L 1BXUA 3D18A 5GGTL 1X44A 4ENZA 5LCVH 4JFEA 3U36B 3RGHA 4LIQE 2P24B 1B90A 1OVZA 3GHBL 1KGIA 4IGBD 2DLGA 3L3DB 2AANA 3OMAB 4RISL 5D93B 3S34L 1U8NB 2RTTA 1KPRB 1G9NH 1FC1A 3BFWA 1NMCB 5L8JB 2BWDA 3MRGB 2VR3A 1DJHA 5BRZD 3DO3A 4NQEB 2R0ZH 4PRHA 5AW8B 4B3VA 2IWFA 5AYUH 5JDJA 2X4TA 1P84J 4UQ2B 4YDLB 3PHAA 4BQCA 2V7HB 4X5XA 1KCSL 3ZHLA 5E5MB 1U8QA 5HHQB 1FG2B 5DUPH 2UZYA 3AVEA 5TE6L 2ZXDA 2WWMD 1H19A 5GRUH 3WIFB 2OSYA 3ETTA 2FQFA 4Z0BH 3LS5H 5DUBB 3SYCA 4JJ5A 1GS8A 4UNUA 1J0HA 2DYPA 3U1SH 2HKHH 2VZVA 3ARXA 4ZO8A 5EU6B 5I8OH 3K0WA 2XN9E 4L4TA 1R0AL 4G6FD 3WSQL 4ZMVA 2WQ8A 3L5JA 4MDJB 4HS8H 1MFVA 5CN3A 1MCFA 1HOCA 5AG8A 3L7FA 2OL3A 4FFZH 3I84A 3CSYA 5CLZA 1EJ6A 1TCRB 3MZGB 1XXFC 2ADIA 1ES0B 1H3VA 1SDYA 2Z91A 1W72H 3AU0A 1OXYA 3NDZE 3S5LG 4ODTL 4YSUA 2ICWJ 3MLTB 3NIGF 3FTUA 2I25N 4PRPB 1J12A 1MVUB 4K7FB 4EUPH 4Y4KB 5C6PB 2ITCB 5JW3H 2BY0A 1I7ZA 1KTDB 5GRZA 3BAEL 5DJ6A 3WN5A 5HJ3A 1G87A 1MWAA 4TUJB 4R5TA 5JMOC 1KTBA 5T5NG 4YHLH 2EH7H 5HHMB 1QP1A 1PD1A 2B1HH 3L3HB 3MBED 4C83B 4F7TB 3VI4F 2LU7A 3Q44A 5D55A 4E36A 3TVMB 1EIBA 3FQUB 4IRZA 3DIFA 4BWWA 5L2KB 2HMIC 4GLRI 1DYZA 3F7RA 2Z93A 1KXHA 3IJHA 2C3VA 3TESA 2I9TA 4Z7WF 4GBXC 2ZUXA 1FYTE 3FQTA 4C56B 2A74B 1TZIA 1TTUA 4ATTA 3WJMA 2QPFA 5F0JB 4ZXBA 3D9AH 1WAAA 3DK0A 4H8WH 4YDJA 1MCBA 2ZG1A 3AS3A 3LNGA 3FB8A 3W9EA 2O5YL 1E9QA 3JTBA 4OUUB 4N2CA 4DW2L 5KSBB 3GKWL 4WO4D 1CFTB 5JMRA 2VITA 3TT3H 3FJTA 4NI3A 4U0RC 5EBMB 2JKNA 5C3IA 2BCMA 3KDMB 3ECUA 3K6IA 4AIZA 4ZUWA 3UAEA 2D7TH 1YYCA 3W9EB 2QMKA 4QTHB 4TMPA 3V4PA 3F7LA 4YDJB 3B37A 1FZJB 1E90A 4G7VL 1F4AA 1CB4A 3FFCB 1OP4A 5L6YL 4NQQA 1NMAH 2B16A 4LRNL 1PYWA 3GSUA 4Y5VB 4ZS6C 1GKOA 5H35B 5LGKA 4AQAA 4OY9A 1S78D 2K8MA 2FTAA 1O6VA 5CJOL 2C3VB 2J44A 4Z7WE 3BDBA 2X6CA 2GUOB 3QAQA 5JPNA 1MCLA 2B14A 2H9GA 2WO4A 3P2BA 4IKIA 5FKPA 4OFPA 1MH5B 2Z4QA 2ZUQB 1CGXA 4EUPB 5DUMH 4P2RA 4EKJA 3Q1EA 4BDVB 5C0RH 1P1VA 5KSAA 1LK2B 2XXGA 4QOKA 1QSFB 4RMVA 1WA0X 1EUTA 5T1MB 3T0EA 4APXB 1BPLB 1TOXA 3JT0A 4NNYA 3FYEB 4L8DA 4BD4A 1N68A 3D5OF 1FDLH 3IEAA 3VH8A 1WWAX 4BM7A 3FO0L 2VN7A 2K8QA 3GI9L 3NJMA 1GSKA 1MCIA 2PWFA 3O4OB 3UL4A 5I8CB 1T0MA 3VWJA 5C0AA 1AHMA 4I48B 1BD2A 5D7IF 4TTGA 5FCUL 3NZSA 1PZDA 2XWTA 4M3HA 3GRBA 1X7SA 5FKAB 4A2LA 2VR7A 2YKLH 4AQOA 3U6XA 2KHAA 1WBXA 1S7TB 3ILDA 3KDPB 5TF0A 2DQTH 3HRZB 5T3XE 4A2DA 4WCYH 4XMUA 1HOCB 5D5ME 1B2WL 4JY5L 4ODWB 3RDJA 4Z7UE 1MCCA 3NSJA 3FQ1A 1SY6L 3DROB 1OSZA 1KTJA 1IAOA 1TJGH 1TMCB 1ZE3H 4Q9CA 2X4QA 4Z7WB 1CE1H 3TJEL 4PRIA 1SJHA 4NFCA 1KNOB 4IRJD 4M4RB 2X6UA 4KXCA 3SDYL 3VFTA 5IMKA 1OY3B 2COQA 4DP1X 3W9DA 1K72A 4I8DA 5J5EA 2NZ9D 2YA1A 1D9KA 1INQB 1PKQB 4Z6AT 2D7MA 3GDBA 1OLLA 3T6ZA 3NTCL 3B2UC 1TYRA 1DBAH 2XYBA 1O9WA 4GXVH 2R4RL 4NCDA 1J0YA 2WVTA 5DZJA 4H1LB 3U0PB 4Z8FL 4U6YA 2BNQA 1AGEA 1IM3B 4OQ1A 2NX5A 2VXQA 2FAUA 4E5XG 3VQLA 5E08H 4XNXH 1IAIM 2J25A 4WI9A 1FYTD 3FQWB 2XFXA 4MJ5A 4YO0A 1KPUA 1BQHG 2N7BA 1BVOA 4ELMB 1AXTL 3MO1B 3WUWB 2HP4A 4LSTL 4TSAH 5DSCB 2G75A 3UEQA 3VD2A 2VXUL 4Z3GA 5JPNC 2R23B 5EIQA 5J9PB 5IVXE 5IOPB 2YEZB 1AQKL 3A6CL 3LKQA 1T0NB 3M45A 1HNFA 2MEJB 1RIUH 2V37A 4X8JA 4DAGL 2VZ3A 5CMAB 3N44F 3FQRB 4A7TA 5TH2B 1BDYA 4Q4EA 3GMQB 3QULB 3EYUL 1L0YA 3NJIA 4Y4HA 5I6OA 4UIMB 4DJMA 1SDDB 1NIAA 1QNZH 1NQBA 1OAXL 4HJ0C 4J23A 1TKWB 1IGFL 3CFBA 1MCRA 2G3XA 5DD6B 3OJVC 4NM8L 5FA3B 3LNIA 3IYLW 1Y0LA 3MYJB 4A63A 3ULSB 2NY3B 2WKGA 5E5MA 5HHQA 4JAMB 4J2QA 1QLRB 2K7PA 4P3WA 5D7IB 2G9KA 4RLDA 1M71A 3FMGL 2R0LL 4JO3L 5FEBA 1MF2L 1CDBA 2ATPB 4ZOCA 2YA0A 1BV8A 2AQTA 3APNA 3DVGB 5IF0B 2C8NA 4PTTA 2JKRM 3ARYA 1J0ZA 3H3BC 4KPHH 4PB0H 2XHNA 4ZFZA 5CKGA 1JXGA 4NRYA 1X9QA 3D18B 5BZDA 3RTQA 4JR9L 3RWGA 4UOZA 4IBWA 1DQVA 1TJXA 4H5SB 1IBHA 1T03H 3BXNB 3H0TB 3FSZA 3ZHDA 1MRDH 2R9HC 4NJ9H 1SM3L 2D8KA 1VEOA 4ONFL 5IBLC 3Q01A 1SHSA 3ARVA 1AE6L 4JREB 5ID0B 4BSWA 4X6DB 5KOVC 1KFAL 2HFEA 4YXLL 3SYPA 1SLUA 2GFBA 3HEIB 4L3AA 2BFGA 4PWFA 1KV7A 4NPYB 1BYNA 4NEHB 3B43A 1F41A 3MCKA 2MNUA 1WBZA 2DQEH 4LEXH 3VXMD 2IPUG 1QSED 4M29A 2NR6C 2HT2C 2HVKA 2I60H 3CN1A 1FBIH 2IOOA 4NBXB 3WEAA 4JFYA 4R7VA 3B6SA 3VFMB 1X7QB 2VXVL 4J1UB 2X38A 4N2FA 2HFEB 5AYQA 2IAND 5GS1B 2B9BA 1RJLA 1A4JB 1XH1A 2P8MA 4NQXA 1RPKA 5DLMH 5DJCB 4B9ZA 1EHNA 4B60A 4TQIA 1NCDL 2HKAA 3F6LA 4N0UB 2BVTA 4HHGA 2AJUL 4A2EA 1GGCH 2Z1PA 3D05A 3WFDL 4HSAC 4OM0L 3GO1L 3P11L 3PWNB 1IQWL 3QI9A 4Z3EA 1MJJB 1XGYL 2HT3C 3R06B 4IBUA 2AK1L 5KVDH 3B2VL 3LZFH 2C34A 1LK3L 4AYDC 4NM8H 1EA9C 3RZCB 3OAYH 4NQDD 2KI6A 1Q0EA 5C0AE 3SBQA 5DD3H 3FT4B 4JFHD 1R0AH 1WSST 2OMWB 3II2A 4XH2A 5A16A 3CPUA 5FYJL 2OMTB 4G7VH 2M83A 2CRYA 1XAKA 3K4AA 3BPLC 4UM9D 3AREB 3FPXA 4X5PA 1BSIA 4YHKH 1A21A 1RUKL 3FO9A 5I24A 4RZCA 3U2IA 2PO6A 2EUXA 2AJYL 5C0IA 1IBGL 4Y9EA 1JN6B 4Q56A 3T8MA 1IM9B 4BH8B 4YHZL 3CFIC 2C1OA 3P9WB 1KXTA 2BSRA 3FTSA 3OAUH 1IAMA 3B9KC 4KTGA 1QPXA 5LGJA 3PHOB 1E3FA 2ZXBA 1UXWA 1HSAB 5DJCA 3U9PL 2GSIA 2L3BA 3K3QA 5JHAA 2E9JA 1JPEA 2A4CA 4Y16B 2OX5A 4NN6C 2FX7H 4X8JB 3OXRB 4HPYL 5F96H 1L9SA 2BSSB 3VDAA 5AOMA 3MV8A 1WFMA 2VLLB 1JPTH 5EO9B 1AGBA 2BVPA 2KQNA 1P6WA 2EXSA 3FT9A 1BFTA 4P5MB 3NESA 3RL2A 2XQYK 1PAMA 2OSWA 3BX7C 3DBXA 2F5AL 1UT1A 4F37F 2DM7A 3QH3B 1LGVA 3NVQA 1LEIB 4A7GA 5T1MA 4K3GA 3FU8A 1NFKA 1QRNA 3IMRA 4TULH 3JV6B 1A7BA 2EH8H 3ECBB 2JK5A 3TBYB 2ZWLT 5C08B 4UB0H 3VXUE 5T1JA 1EFXB 1U8IA 1XGRA 2K3HA 1AR2A 1HAWA 3FB6B 1YAZA 3VMOA 1JPSL 5GISH 2F53A 3VQ2C 1ZLWK 1RPQA 4LGSB 2A9NH 2ZP9A 5LGYA 1Z66A 3VFRA 4OB5H 2X88A 4Y88A 1SHXA 4CVXB 4XPFL 3ARBB 3A3YB 4WWNA 5CP7B 2AJSH 1FYTB 1AACA 3RPIA 2XRAH 2IGFH 2WBJD 1NCBH 2QADD 3WNIA 2XT1B 3US0A 2YKKA 4L29A 3PL6A 4I3SL 5E2VH 3TIDB 3UBXI 2QZ5A 2DQGH 1F3JB 3EZJB 1X7TA 4FI8A 3MRJB 1FORH 2WPGA 3HS0B 3ZHKA 2K1MA 4OLUL 1R5IA 5ANHA 5K1NA 1MLBB 2BFVH 1P4UA 1JZFA 4XC3H 3F7YA 1YHPA 4ZUSB 4YBLB 2UWEB 3CSBA 1MHPL 4X7CC 1I3VA 2X4SB 3KPMB 1JFHA 5TPWL 2G60L 3O2VH 4C47A 5IUSA 4X5RA 3VVVA 4Z95L 5DRWB 2F54B 5IW6B 2G9HA 4M62H 5IMLA 4G9DB 1X5FA 4OCYL 4D0BA 1N2RB 4LLMA 4MHHG 2EE9A 3B9DA 1KDIA 4GAAA 3B2UD 4NLAA 3CSTA 5IHUH 3ZTCC 1WT5A 3W39B 5C0AD 2BVQA 5ENWB 2XFXB 4MJ5B 4YO0B 1ROWA 4I9WE 4KDTC 3UCRA 5DEGA 4DP8X 2NY4D 4J3UA 1H6UA 3MJWA 1KT2A 1P7KA 3RWDB 1FZMB 2YFNA 2WXNA 1T1XB 5B1AB 3QQ9D 4PVBA 1YN6A 4UT7L 3MRMA 3H6AA 5HXMA 4BSJA 1GGTA 4PG9B 5KBNC 3W0WE 3VD0A 1VGKB 4M1GH 4U2ZA 2VLME 3NN8A 2N7AA 3K72B 3AU1A 1NH6A 3IDIB 1HXMA 2ATKA 3EFFB 3MLWH 4X7EC 5ECJE 1T0PB 1QFWI 2NY7L 1IZKA 1IGJA 1JK8A 2IC2A 3U6XS 4GG6E 2GUYA 2FCBA 4KV5F 1NCNA 4PIRF 2YEQA 3C2AH 4RESB 1A7PL 2V2XB 3ISYA 1SQ2N 3IMUA 4QHNB 4N24A 3WV0A 5JIMA 3TPUA 2VDQL 5J3HD 2ID5A 4BSWB 2CR6A 1Y6MR 2B59A 2O5ZL 3GRWL 1B2YA 1U3JA 4PJ9C 4ZMWA 4WUUB 1NLBL 1IIKA 3UGUA 3F7PC 2AHIA 4HIHA 3SQOH 1XD0A 2E7CA 1W0VA 4LCVA 1OAZH 2F58H 4AOFA 1AR1B 4H8QA 1FL3B 3OWEA 4ZMXA 2AC0A 1OTUC 2VJ0A 5HVHB 2CXGA 2ZUQC 4L48A 4NN6B 3B7UX 1FIGH 5DMJB 5JHLL 4PEEA 1IEAB 4O2FB 4NZJA 2R8SH 4U1SB 1NKRA 3HMXA 1KSRA 2DEXX 3QDAA 5KW9H 1ZHNA 3ABLB 1G9ML 2A74A 3WE1A 2UY7B 1QEXA 2WOYA 1W72L 4IRJB 5F89A 4MXVE 5I1GL 5JHDB 1F8TL 1PQZA 3HG1B 3FQUA 3H3PH 3W5MA 3NJXA 4GFXA 4N2NA 3HS9A 5J6SA 4E0RB 4XX1E 3VRJA 5CGTA 2XA3A 2QL1A 3P3SA 5K9KB 3WXVL 1MJ8H 4OTXL 3NA9H 4NC2B 5EBLB 4X8CA 1IJ9A 3WSQH 5C9KA 4WEMB 1KYFA 4HZAA 1FG9C 3UBXB 3LSOA 1J1OH 4LU5H 2P8LA 2HKFH 3S3SA 2J4WH 3KCPB 4QKTA 3Q3GB 1CFBA 1AQDA 2N3JA 1JK9A 4Q97A 3CQQA 3PGDB 1X6NA 2H5UA 3EGSB 4WK2B 3FRUB 1EERB 4LCYB 4BQ6A 4J4PA 5CWSB 3QEGH 3O6KH 3FN3A 3MOQA 2ZYHA 3FB5B 5FKAA 4NZDA 4RDQF 4YHIB 3T2PA 2C3GA 3FQXB 4OR1A 4HW6A 3RGVB 4FTVD 3V6OE 1D5BA 1OAUH 2H6OA 2X9WA 4Y16A 1AQDB 2ODIA 1ZANH 3RQ3A 3BYYA 2IGFL 3MREA 3Q43A 4AJYV 5JNYB 3DRTA 4YSRA 2EO9A 3TS8A 4BSVB 5DFTA 4LAQL 1KGYE 3A23A 3D08A 2KLSA 3C5SA 1PQZB 4AIOA 5ICZB 1LK2A 1XH3B 2F68X 2WTRB 5LNGA 4N2OA 2O5XH 1GGIL 2KT6A 1XBDA 3V6FA 1O7DC 1BZDA 5ICUA 5CD5D 4PYGA 4Y8AA 4XHJD 1W0YT 3ARRA 1KJ2H 3L6FA 2JLLA 4UM9A 5HHPB 1UWYA 3PWVA 4UI2A 3TF4A 4P59L 3QARA 4PS3A 4RH4A 3GUTA 2WXJA 1NA8A 1AFVH 2JCCF 3TA3B 1PSKH 4PCSA 3CFDA 4I2XA 2CKBA 4OIBA 4H44C 3HZVA 3HMWL 4NJAH 4QTFA 2H6UA 2W9DH 4XP5L 4XXWA 4KXZI 2VDPB 3MCLL 2XG5A 4WI6A 1ZLVK 3GSXB 3O3AA 1T1YB 1GVIA 2VJ8A 1IM3D 4TYUA 1NEZB 4BFFA 1LNUB 3SE3C 5B39A 2UUDK 1DQLH 3QJZA 1IGCH 4NQCB 5FO7A 2P48B 5D7SH 1I9JH 5HYEA 3WHE1 3OKLB 4H25B 4M6ML 3ECQA 1I7RB 3ZSSA 3PUCA 2A6KA 5IHBA 1G7JB 2GEEA 1M6UA 2XWTB 5J06A 2WLMA 4N1EA 2XN0A 2FJFA 5AKTA 4YPJA 3KJ4B 2XZAL 4FG4A 1WAAF 1LO0L 4LARH 1CZ8L 3FS9A 4AENA 4AQ1C 4WEBL 4R4FL 2EDMA 5GRWA 4AEHL 4EQ3A 4PJIF 1RU9H 3S8WA 3I6KB 5HHME 5F3BB 3DHPA 3T3PB 3PE9A 1T04B 3CHSA 2YD9A 1LEGA 3GTTA 4XODA 1EEUA 3MROA 5SWQA 2ERJC 5GRJH 12E8L 5JHBA 1Q0YL 4X99B 1DQDL 4ODVH 4FNUA 4L9LB 4L8SA 2Y7MA 2IG2L 5HDQL 1MFDH 2X28A 5F72S 1GTFA 1UXSA 1YEEL 2BS71 3RWJB 5F9DC 4WU7A 3VD7A 3CX5J 3WUZA 5L4MA 3CVDA 2E56A 5CEXA 5B1JA 4GFTB 2EILB 2AERT 1K3ZA 4AC2A 3C5JB 2VW6A 1XGQB 1GZPB 5ICYA 2CJUL 5F9OL 3NSCA 3DO7B 1MRCH 4H8VA 2Q2LA 3DV6B 1KEML 2Y25A 2AJUH 4XE5B 2Z65C 3N1MC 4QD2E 4G5AA 2NY5C 3DSFL 5JHLA 1TCRA 4KTDL 4RMTA 3U30C 1NCUA 1NKOA 3LEYH 3AT8A 4I89A 4F9PA 2MQCA 1KCUH 3MNDA 3MUGB 1SQMA 1S7UA 3VMNA 5CBEA 1BFOA 3CAFA 3LQAL 4KWUA 4DGUA 4MB5A 3NFSL 1NAKL 1YEWA 2Z93B 1TR7A 3ARUA 3QZOA 4JQXA 5CMAA 2EEFA 3AITA 2EIBA 3FH5A 4QRQA 1JNLL 3NJJA 4G6JH 4PRNA 2MOQA 3I50L 3PQYB 2R2HA 5DMGC 1BP3B 2EECA 1RU9L 3B3BA 3SCMC 1UVQB 3HHRB 4FN0A 1E50A 4NKMB 2L8AA 3S3DB 3BPLB 4JFZH 4KXBA 4FFYH 1VACB 1E4WH 4XTRD 3UYRL 3VGDA 5DFAA 3CVBA 4WFGE 5D1XE 1MCKA 3QFDA 5HI4C 4HBCL 1KBKA 1J0JA 4PTTB 4KK8D 5IFHH 4KKCC 1F58L 1CR9L 1FFPB 1IIIA 1NINA 5EZJA 2JQZA 4PJDB 1VACA 2ADGA 2LQRA 3PDOB 3ARWA 3AT0A 3FKUS 3KHQA 1F4XH 1P2CA 4RRPM 2J43A 3CHQA 4PY8J 2ESVA 2W9DL 3MRIA 5F6HI 3VW3L 5MEPA 3ML8A 2R7EA 4KI5F 4V1DA 2P7TB 2F19H 4A6YL 2MMXA 4RRPA 3QUYA 2YHGA 4LVOC 3F65A 4RWYL 3IDGA 1OGAB 1M9WA 1QBMH 2MHAB 3GIZH 1X4YA 4XMPH 1R24B 3KBHE 3V52H 5DVLA 3AW5A 4G8GE 4MMYA 5EU6A 4PBVC 5JW4R 3FCGA 1KJ2L 2V5TA 2V3DA 4XMZA 2B3RA 2GFBB 4UOQA 4ERSL 1BMGA 2WNGA 5DHVB 4GAYB 5F7HA 2QGEA 1YY9D 2GTZA 2FDBP 2EYRB 1T21B 1ZLDA 4OV5B 5EMYA 5INDA 4HKJA 1YMMB 2VXUH 3VXRA 1RJZB 3QDJE 5C07A 5L2KD 3IGKA 1NAKH 2NQDA 2YPLA 4HOWA 5MEQA 1F6LL 2C26A 4PH8A 1R5WB 4IHOA 3X3GL 4L1DA 2VQ1A 3T8XA 1MQKL 2A6DB 2WXFA 4A6YB 1QFHA 3FQNA 4L1BA 2CAKA 3IKCA 4FADA 4AQ1B 1IC0A 1JNNH 2HX7A 2RQEA 3N42B 4PLOB 4N8PA 3QJVB 4TQEH 3SHSA 5C1MB 2DTSA 3ZDYB 1WCBB 3ROLA 3ZN6A 1BM3L 1P7QB 1AGCA 1COBA 3QPQC 3MLXL 5A7EA 2F5BL 2X9XA 5ALCH 3EOAA 4G7YH 5JIPA 5HYFA 4DKEH 1R5WA 2FO8A 3DTDA 3OAZH 3LN5A 4ONGL 3WIHH 1BPVA 4KROC 4XOAA 3S3BB 1JGLH 2VDLH 1ZT1B 1UT2A 4XCCL 1I3GH 4OZHF 3UMNA 3AB0C 1UD4A 3CFNA 2K6YA 2NYZA 4I5BB 2ENSA 4GW5A 4K2UH 1YEJL 3TU6A 3LKRA 1A1NB 5DO2D 2YUWA 3CFCH 4WW2A 1IL1A 1MLCB 2IGTA 3QIWC 4KZCA 2X89A 3UO1H 4I77L 3TXAA 5LBSL 1TF4A 3GSQA 3BP6A 3D85A 2XKUA 4UOJA 3DRQB 2PETA 3MNMA 4NM4H 5I1LB 4ONHB 1DQJA 3LRKA 2PCFA 4PCYA 3PWJA 5D2NA 4ZD3L 2J1XA 5LAXA 3LKRB 2VL5A 5FFLA 3VB9A 3ZDWA 4EOWH 3HNVL 2CIKA 2BP0B 4HIXH 3H85A 3SKUD 3MODH 4N2LA 2N01B 2C3WA 3GI9H 4HYTB 4DUWA 1UZ8A 2XWJB 3IMBA 2ARJQ 3GB7A 2AITA 3QQ3B 3HBZA 4GOSA 2RQ8A 2XLLA 1AGEB 1IM3A 4F92B 1WF5A 1DANU 1WISA 1IFHL 4D0BB 3BFQG 1TEYA 4WZ9A 4GBXA 5CR8A 1MY7A 3G08B 5C8JB 2C7UB 1E65A 5I6XB 2OQJB 4WWOA 4Z3JA 4OQTL 3P3RA 1PZCA 5ID1B 5DU7A 4XNZB 4FQIL 2C4FT 1S8DA 5GS0H 2NNAB 5JQ6L 2OYLA 3ZX1A 2J1KA 1XL6A 4OJFL 4HF5L 4UTAL 1JS4A 2YGNA 4OLZL 2WKOA 1U4FA 4PSPA 1J8KA 5L6YH 5I8KH 4G9FD 4UYPA 4G6AC 4ICWA 2P42B 4NAMA 4Z7VE 3SO3B 4MXQC 4CW1A 1OWWA 1KTCA 3PWJB 1E4HA 3LPFA 1F00I 3QULA 4KX9A 5DSCA 3U46A 3WLBB 4KDVA 1MHHA 4UT7H 4EI0A 3MCG1 4F91B 4G9FE 4V1DB 4R7DA 3HI6H 2AJXL 3QRBA 2Y7LA 1FVEB 1FYTA 4GW4B 4KTEH 2G5UA 1JZIA 4GRLC 4K71C 2MIZA 4U1IB 4XRCA 4UU9B 4Y5YA 1D7BA 3FTGA 2OYPA 2WCPA 1JYXA 1RZJC 3BWSA 1RMFL 4Y0GA 2BJMH 3QWNA 5FB8B 5KSBA 1V5JA 3GMMA 3M17A 2Q3ZA 1WZMA 3BO8A 3DECA 4M4PA 4QXGH 3S37H 3QUZA 1IKFL 5CJ8A 4YJZL 8CGTA 3QWOA 1ZGLM 4U1HA 3KWUA 4MBOA 1AKJA 3DUUB 4S2SA 4IEFB 1Z5YD 1MRFH 2XKNB 4FTVB 1DBJH 5FYJD 4XMKH 2EDEA 3AY4C 3UAAA 5IW1A 4J12A 2JXMA 5KS9F 2FX8L 3QQ9C 1UVQA 4NQCE 4G7RB 3ARDC 4P04A 4WAFA 1OP3K 3VFNB 1WBYA 4XN5A 2B1HL 4HIPA 2YPVL 2QQKH 2EACA 3O3EA 1ZS8B 1SLVA 4F57L 3MRQA 1T5XB 4G8GA 1F1GA 2H7WA 4NX0A 4O5LH 5EZLA 5T1DH 3RIAF 4HHAA 2PTVA 4Q6YA 3OZ9L 1YEKH 1FNLA 2P8MB 3QFGA 4NQXB 1YN7B 2UVEA 1S6NA 3RVUC 4MAUL 3ZE0B 1FVEA 4GW4A 4NXKA 1PPIA 2XJLA 1SYSB 1BVLB 3GKZA 1NBYA 3Q8EA 1VKXA 4P3CH 3CFTA 4HCIA 4WW1B 2WNKA 2CHDA 4JW3A 1WCQA 5HVWA 2ZUYA 3FF7A 1MREH 1D9KC 3BHBB 4NDMB 3RGVC 3BUDA 2WW8A 1QR1A 1CL7H 4Y4KD 4RGMC 5KS9E 3KBEA 3GBEA 3M6DA 1AGFA 4OVUA 4MAYC 1N10A 4F33A 5EEXA 1E5UI 2A83B 3DI2B 3CK0H 3DTXA 4UB0L 3DV6A 4WEEA 1KDJA 5KVFL 1DP0A 4YLBA 3DYMA 1VZIA 3MRRA 2P26A 3TP4A 1GS7A 4OT1H 3TBVA 4YR6A 2W9LA 4O2CA 5JA8B 4XBEH 1AANA 2NLJA 3K6SB 1K85A 1EBPA 2DI8A 5E1GA 1YYLL 3T09A 2OMWA 2YJQA 5B38B 1XR9B 1KCSH 4C59B 5BQ7B 2FT8A 2CBPA 1FN4A 2XQYG 1CU4H 3MFGB 4KRPC 2CA4A 4F2ME 2A6DA 2Q10A 4UV7L 1I1YB 5F7KC 4JAMA 4B9PA 4KJWD 2Y0SA 1K5NA 3V0WH 3VU1A 1UCBL 15C8H 3Q05A 5LBSA 3ZXAC 2VLRB 3CFEB 4BK5A 1KGWA 3FFDA 5A2AA 4KJYA 4UTCA 5K59E 4LSDA 1D7FA 3NJFA 5KSAD 4MA8L 3HBPA 3VXTB 2ZOWA 5D2NE 5E7BA 4JFOB 2RJMA 4G1EB 1XGPB 4NUQA 3ZPDA 3FQXA 2JB5H 3ARDA 1WWCA 1HEZA 1UWEH 4WEUD 3X1NA 5L0QC 1ZA6B 2FJGA 3U7AA 4YE4H 5AAWA 1MNUL 4LKXB 4O2CB 1ZVNA 3AROA 2WLLB 2CO6A 4U31A 4JE0A 3S4SG 1VDGA 2YRBA 3P73B 1WWBX 3HAEG 3HHSB 2YSTA 4OT1L 2G75B 3QG7H 4HF5H 4UTAH 3RWCA 5EEVA 1OAYH 4M5SA 1J18A 5G55A 1ZA6A 1I82A 3N41B 4CBZA 5KVFH 4LSSH 3QFJD 4L9LC 2NSMA 4AGOA 2XDHA 3OKEB 2K6WA 4PREA 4LKCA 5FC9A 3C08H 5FYJU 3WO4C 1DVYA 2FJHA 3RWEA 3GI8L 3RTQC 3O9WD 3ESPA 3DMMC 4M6NH 1INDL 1AMXA 1QLEL 3VI3B 1NCDH 3OB0K 2FEDD 5IK3A 1XZ0B 2ISDA 4I88A 5DGRA 5H8DA 3TURA 1OAQH 1L9QA 5E94A 1I8MA 2VDNB 4XXDA 5I18H 1N6VA 2DLEA 2XX0A 4DERA 1W91A 2R8SL 2Y6SD 3E6HB 3E7JA 2QQLL 1QOKA 2WTRA 4OCNC 4PPTA 2AJZB 5HVGB 3HRPA 5F2FA 1OGAE 3FUFA 2YAOA 4OZHA 5C3LD 1LQSR 1RFDH 1XTLA 5IK3B 4JPWL 4AYBA 2AJSL 2QQLH 2F53D 1LMIA 1O75A 3A5VA 4JFEB 4FKKA 4YXLH 2X4NB 2VXTL 1MOEA 2LGNA 4P5TA 3UTQA 5CR1A 1AE6H 4NM4L 4UBDC 3ME0B 1A6AA 1YPZE 2QQNH 2Z31A 5LVEA 1PYWB 1LJMA 1NFDB 2DWTA 2K70A 3GSUB 1JNHB 3HHSA 2EC9U 4EIZC 2Y3NA 1ML0A 1QFUH 5DRWA 3AZUA 1A1MB 4ZX4A 1KCVH 1KYDA 6PCYA 2ZOKB 3ZK0A 3WNOA 5IROA 2PW1B 4HUVA 3OSKA 1T66C 1DQML 5TQ0H 3IN0A 1SXSA 3HN8A 3C2AL 4HALA 3C60C 1RK1A 4XGZB 3S3JA 5KVDE 2BNRE 3DJRA 4MRCA 1UA6L 1J1PH 4B5ZA 4KMTL 4OIFA 3QCTL 1JGLL 2TRYA 4H25A 2BZDA 4HLJA 2MCAA 2GBUA 4NQCA 5FO7B 3G5ZB 2VSDA 4GBXD 2CHWA 4WVRA 2CDGB 2X05A 1FO0A 2RHEA 2YLHA 3VG9B 2OX5B 1EFQA 1UFUA 5K9OA 4NZUL 5AUMB 4WK4B 2CM5A 4FQQB 4PJCF 5F1OB 2X4PA 2DWYA 4QI3A 4HXBH 1JGUL 3MXVL 2VAAA 4OGQC 2EYTB 3DURB 2FUQA 5IBUG 5EF1A 4JZOB 4ODHH 4R8WH 5TDOB 2X4OA 5F88A 3BVWA 2VLKD 1T1XA 5ACZB 1IO4C 1H6FA 4YFLI 4Z78A 1Q9LB 1P1ZA 4J2XA 5JHMA 3ALPA 3OX8A 4LBEA 3RVVD 3QCTH 3ARZA 3EXJA 5HJBA 5B8CA 5C86A 3DI3B 2AV1A 3VGAB 3NT0A 2R69A 4OJFH 1JBJA 4DN3H 1AHWB 1F2XK 3VFPB 4J6RH 3FBQA 3UJTH 3HE7C 1NTDA 3SKJL 2PUQT 4K9EL 4GRMA 4MMZA 3UP6A 3DROA 3L9YA 2BSBA 3KVQA 3Q13A 3U7WH 1XSJA 3HI1B 5EULV 1MFAH 4Z77A 4PW4A 3US9A 3FT4A 2DD8H 3L3OC 3MGOB 1D5MB 4QRTB 1J8HD 2PYEE 2CJTA 3DHMA 4OCSH 3WNPA 5E9AA 3CMOL 2MNJB 4MJHA 1DR9A 5KJ4A 3W11C 3MKKA 3GK8L 2PCPA 3IU4H 2FHFA 1KJVA 5E0QA 2XA8H 4Z7QE 1Y1UA 1HEZB 1DZ0A 5I74B 1ZA3B 4YDIL 1ET8A 2EEDA 2MQGA 3C12A 4XBPB 1RULH 3PLYA 4X80H 3HI1A 2IANA 2BO0A 3FUJA 2AQ3A 3HE6D 1Z0MA 1Z0NA 2P45B 3Q2CA 4ZXBB 3ZT6A 1ECZA 2PCYA 3F64A 4XNYL 2NYYD 3QJUB 2R83A 4E9YA 2RBLA 1DLHB 5BV7B 5GGVL 3HKFA 4XBGB 1N6QL 2AV1B 3UTZA 2ZF9A 5GQBA 4C55A 1AQ8A 1L6ZA 3F58L 4WWPA 3ZE2E 4BINA 4FNRA 3RVWD 3UTSE 1TZGH 1DUZB 1JF1A 3ARFB 1NDMB 1B3JA 1BX2B 2EH8L 3P9MB 4EZJA 5KSUB 4K3JH 4KH2A 3V0FA 3HCVA 4KVNL 4OF3A 3NPSB 2IADA 3RTQB 2WINB 3N40P 4WI2A 3RWGB 1YEIL 1CGWA 3VUAA 3DJ9A 1QLFA 4KKPA 2AKRB 3IDJB 3FCUB 3HE6C 2A77H 3RB5A 3JV5A 4E41D 1BQHB 2VIRA 4DP0X 1I7UA 1MRFL 4PJDF 4HZLB 3V0VA 4PY7A 4XP9L 2ZCLH 1YQ2A 3AM8C 3QPKA 3VTAA 4MA8H 2GKIA 4N0UA 4JFFE 3OD3A 3CG8A 5B7EA 2EYRA 3RNQA 5H4ZA 3INUH 2J12B 4GKNB 3I9AA 3V0WL 35C8H 3JWOC 3EYFB 4BH7A 4ES8A 2DL2A 1ZVSA 3VI4E 3QEQA 5I82A 2IDSA 2IPTH 4WJ5B 3WJMB 3K46A 1MN4A 3SE9H 1OL0A 2WB1A 4N68A 4Y4HD 1HC1A 4LPWA 2VYRE 3WAKA 3CFDB 4JO1H 1A3LH 1OGAA 2P80A 1U36A 2NY0C 2C9AA 2Y2TA 4OZHE 4PVMA 5HPMB 1MCOL 1JI2A 2CRMA 1NEZG 4UT6L 2EEBA 1KGUA 3UMTA 2XQBL 3BAYA 3GPSA 3LEXA 3T4AB 2G5RA 5LWYH 5GGSY 1FAKT 3G04A 3P2TA 8PAZA 2WLKA 3AS2A 1UB5A 4KJPC 1RQ5A 4N2KA 1I1AA 2VIRB 3C6LA 4OD2B 2R1XB 3C8KB 4LLYB 1DQIA 4I18A 1A64A 4W9LC 5B1JC 2GQHA 3C6EA 4S1QH 2JQMA 5IFHL 4JN1H 2EO7A 2QVIA 3IRZA 5D7JA 4F1ZA 4P46B 4MJ6A 3D4GA 3VMPA 3QIUD 1WFNA 3W0WD 2VSKB 5DQ9B 3JV4B 3V5DB 4B0MM 4J3OF 3U82B 1CQKA 4JDEA 5IEHA 2XQYA 5HYJE 4M1CC 1H8NA 3VWJD 3P4NB 4AH2B 3N1FC 3VD9A 3IAPA 3OKDA 4C56D 5C0FB 4FZ8L 1W2KT 4LP8A 4ZPVB 1HX0A 1FBIL 3KPRA 4AVJA 5I1LA 4GEJA 4O00A 1Z1WA 4CSSA 4K71B 3RL1A 4DNLA 1H0DB 2Z92A 1P7HL 1A1NA 4TKWA 3RWEB 1CI3M 1DQLL 2EXWC 2R56L 3QDJD 4MAYA 3IWUA 4I5BA 1HE7A 2ZSWB 4MHHI 3MJGX 3T6QC 3K74B 5JUEH 2JKLA 3JQOB 1L9MA 4AGPA 1WK0A 3BPNB 4PGCB 4AMXA 4J3XA 3SGJC 1XBRA 3LKQB 1YQVH 3UJIH 2H1PH 3HLAA 4TTDC 4JHWH 4AV5A 1HYSC 2DJ4A 2Z8VC 1TJGL 5DF0A 2A9MH 5GGRY 5C0GB 3G08A 3D0LA 3QRGL 3ZRSA 1MCOH 2VDLB 4F8PA 2EDKA 4QXGL 1QX1A 3ROOB 3BN3B 3MN8A 1BIIB 2VABA 2DQFB 5FGBC 1KXQA 5B3JF 3PIQA 3QQ3A 3S8FB 3FMGH 5GS0D 2O5XL 1LM8V 1UACL 3DX3A 1FH2A 3T0ED 2BH0A 5FECB 4M5ZL 1FE8L 3APMA 1YPZB 2HH0H 3PGCB 2UXTA 2B4CL 5A6MA 1EAJA 1FZKA 3V4UH 5TD4A 4CU6A 1FLRL 5PAZA 3RUGE 4N1HB 5ESAB 5IEKB 1INQA 1D9KB 2CCWA 4ZSOE 2CLZB 2BW4A 1PLAA 3NJNA 5I8EB 1MCWM 3DBXB 3PCYA 4A04A 2W5PA 3OVUB 1TTCA 4RGMB 3HG4A 3QEGL 1F3DH 2QSCL 3EO1A 3QO1B 1CTNA 4OZGE 5A2JH 4BKTC 3HC4H 4GY4A 4HOXA 5JYMA 1HL5A 4I18C 4NQEE 4E41E 3BJLA 3Q5TA 2XC8A 5AW1B 4NOFA 4YHMH 3TEUA 5J11C 4IOFD 1ZT4B 4JKLA 4HP5A 3X1EA 3L7EB 3V6OC 5E6ID 4TNGA 2WLNA 4PJHA 2NXZB 4M9PA