3GHEL

Crystal structure of anti-hiv-1 fab 537-10d in complex with v3 peptide mn
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
214
Chain Sequence
QSALTQPASVSGSPGQSITISCTGTSTDVNGYNYVSWYQQYAGKAPKLIIFDVSKRPSGVSNRFSGSKSGDTASLTISGLQAEDEADYHCSSYTSSTPYVLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the cross-reactivity of genetically related human anti-HIV-1 mAbs: implications for design of V3-based immunogens
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab 537-10D, light chain
total genus 43
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheL02
4IJ3B 4XCYB 1KCVL 3B2UD 1U42A 2F5AL 1U8HB 3L6FA 1UVQA 3VU2A 5JPNB 2EDYA 2WIMA 4I2XE 2VDPL 3HUJE 1T20A 4LLMA 5F7DA 4MJ6A 4PBWD 1QLFA 4JRYE 3MV8A 5E2UL 4FQXB 1H8SA 1CDIA 3C60D 2R0ZH 3P9LB 3RL1A 3OB8A 3DETD 2AJYL 4GMSH 4RFEB 5T1KA 4BZ2L 3IJHB 1MJ8H 4FZEH 1ITBB 1RURH 1NKRA 1HQRA 1Z9SA 1NCCH 2VDLL 5D7LE 5JNYA 1E6JH 1D7FA 2DKSA 5KW9H 2B0SH 5J6GB 4JE4B 1XGRB 4JFPA 4H1LH 2R56L 3BHBB 3JWDL 4G8FB 4UBDC 2NLJB 3GHBL 4N0FA 5MEOB 3FQRB 4KUZH 4PTUB 1RZKC 5D1ZA 4OZGE 5HHXL 5EBMA 5E6IC 2O93L 3N1FC 5J9PB 3SPVA 3GSVA 4LLAA 4JHZA 5C09E 3F7YA 1MIML 3FTGA 1N59A 2IADB 3VMOA 1AGCB 5T3ZD 1E27A 2HVKB 3LEYH 5BJTB 2IPTL 2ED8A 5FAAA 4X5WA 2C7UB 4XPAH 4FQLH 2H45A 4KH2A 2Z31D 2XZZA 4MDJA 3VXMB 5IV2B 3L5XH 2BSSB 2X70B 4P59H 2VLMD 3VA6A 3U0WL 4ONHA 3MJ9A 5F44A 4Y19D 2IH3A 1A21A 5DJ8B 4Q9BA 1U9KA 2EKJA 3GK8H 3GMMA 3S96B 1RUPL 4FQJL 4J1UA 4UQ3A 3BGAA 3VFSA 1R5IA 5LGJA 3QXAA 1JMZA 4M1DL 3ULUD 5GGTA 3QHFL 3BRDA 1A2YB 3AREA 3LH2L 5GRUL 1XGPB 3NN8A 4R0LB 3E6HB 3PV6B 1LEKA 2A9NL 1LMKA 2NY7H 3MJ7B 4IRZL 4X5XB 3TWCL 3BQUA 1U8NB 3FMGH 1RZ7H 1HILB 2AI0H 3QSKB 1SEBA 5EU7C 4NQEE 1QBMH 12E8H 2VXTL 2UVEA 1D5BA 5C2UB 4KGJA 2D7QA 1J88A 3GSNL 4KMLB 3T09A 2XWTA 5C0FA 1AXSB 4MA8L 5KSAA 3RWJA 4O2EA 1TVHA 5ELIA 2APXA 5SWZE 4G8GB 2BJML 2XV6B 3KPQA 3RWHA 4WUUD 4B7IA 3GUTA 3O4OC 3T1FA 4QXUH 1PKQB 3PF2A 3RWGB 4OIAA 4QTIH 3WUZA 3VRIA 3P73B 5IM7A 2Q86A 5FYJE 4HJ0D 3DBXB 5EZJA 5DO2D 3UZEA 3IDMB 1IM9B 4GW4A 4ZUTA 3BQUC 2DI9A 4POZC 2KDGA 3FOMB 1H3PL 1YN7B 3WCYA 5GIRA 5IG7B 4GAJL 5IJKC 4YEFA 4Y5YB 3OAZK 4OB5H 3BMWA 3HS0B 5E2WL 5IR1B 4P2OA 1QR4A 4Z7UB 4LRNL 4NN5B 4YC2B 2V2TA 1B88A 4JN1L 3S37H 3CUPB 3QQ4A 4O9HH 1ZT7B 4WW1B 3DX9A 2YPLE 2YBRA 2OXGA 4DEPB 1IILE 4P48A 2DM3A 4RGND 4C54A 1U8JA 1GGIL 2WM0A 4YNYA 1FNAA 3TVMB 4WHTA 2SEBB 4GS7C 2G5BA 3BKYL 2ESVE 5D96B 1KPUB 4K8RD 4ODHH 4Y19B 1R0AH 4R8WL 1KPVA 3VDBA 2X4PB 3VFVB 1IKFH 2DLGA 4ZTPH 1G9EA 1OLLA 3U30C 5ESVA 2FNBA 4L8SA 4LLWB 1CF8L 5FHAH 2E9WA 2PYFB 4HD9A 4S1DC 4K55A 3QIUD 5MI0C 4JPKH 2X4TA 2FX9H 2VLKE 4OZFB 1K5NA 4ZXBB 1JHKL 2AK1L 1VFBB 2UWEA 5HGGS 1EO7A 3BW9A 4OLYH 3SCMC 4O5LL 1CT8A 4NQUA 5IIEB 5I76A 5DQJB 3VE0B 3BWAA 5GSVB 1ZSDA 1PZ5B 3BP6A 4AENB 4ZOEA 1RZ8A 3OAUH 1ITCA 1A0QH 2YEZA 1DVFB 5LCVH 1XZ0A 3P4LA 1BVLB 1A7RH 2ADJA 3VW3L 2R69H 3NABL 3VXOA 2HJLA 2OR8A 1UGNA 4ZAKB 1QFWM 3W9DA 5DRZB 2ESVA 4LVEA 1QO3B 3OJDA 4R7NA 4Y7MA 5KAQG 2NTFB 1IAOA 4M8QA 5F88A 3UBXG 3CD4A 5AYUL 3TBWA 1H3WM 1E4JA 2E7CA 1P2CB 4JZJB 5CUSL 4OCRL 2VLME 1E4WH 5DJ0B 1YMMD 1EMTL 2V9RA 5CIPA 4YDJB 4AQOA 1IFHL 2E8YA 3MZGB 1NUFA 3MLRH 1TZGL 5E2JA 4GAFB 2ZCKH 2W9DH 3QEHA 3ILPB 3G08B 5JOPD 1IGMH 1M7DA 5HPMB 4LPCA 5IVNA 3V79C 5CEZE 2BNQB 1HDMB 2W0KA 5IB3B 3MLZL 1BWWA 5DS8B 4NDMB 1MFNA 4AK1A 3GMPB 1MI5E 2NMSA 4ZNEE 4PLOB 4D2NA 2Q7NA 4GKSA 4WIQA 3OKMB 3WFDH 5K33A 3RY6A 4KUCD 3G6DH 4NUGL 3K4AA 3QXWA 1A6UL 2BC4B 2C1PA 3DRQA 4IRSA 3GSXA 1FN4B 5FYJL 3WUWB 1T03L 3DTXB 4OM0L 4XZUB 4Y4KB 2P45B 2XZQL 4YPGB 3SDAC 3O2DL 2F74B 2CRZA 2HWZH 1KCRL 5FOBB 2Z8RA 5KANG 5EUKB 2BVPA 1KJ3H 2VAJA 4UB0L 5DA0B 2X4NB 4J3TA 5F96H 2AJXL 4P0DA 3TA3D 5HGAB 1AR1D 3CX5K 1SEQL 5EO9A 2FR4A 4NHUA 3GIVB 5HHQB 1J1XH 3QIUC 2VLJA 4MJ5A 3HPLA 5L2KE 1ZE3C 5DJDB 2KUTA 4OKDA 4NO0A 3QULA 4LSRL 3MNVB 1ZVYA 2DBLL 3V9FA 1NC4A 5LGHL 5CCKL 5C6TL 4M7LT 4PJGB 1F4XH 1NL0L 1FDLL 2MCPL 5EBLA 3ZTNL 1QPPA 2JCCA 3IKCB 1K6QH 4Y4FD 1XR8B 3HZKB 3M17B 32C2A 4LSUH 4AIZB 5I1HL 2YPKA 2FLRT 4NZUH 5A2JH 5D2LB 5ANME 1WITA 3QUML 5HI3D 2JTDA 5C0CB 4ZYKB 3DUUA 4QKXB 1L7TH 4UT7H 4Y8DC 1TITA 3KWWB 5H37G 2VR9A 4O02L 4TUJB 4WU5B 2GY7B 5JR1H 4U1LB 5FM4A 4AL8H 4C83A 1ZANL 3TJHC 4UILH 4NQEB 3VXQA 3ZTJH 4U49A 1OPGL 5JA9A 2APTA 4XH2A 4JFFD 4NQDD 1G9MC 3DMMD 2F8VA 2VUYA 1WSST 3O3AA 4CADB 5T33L 1RVFH 3NCFB 3BZFB 5TGBA 4KKLD 5DJZB 5DQ9B 3QG6A 3BSZH 4G8GE 4WI7A 3L6FB 3RZCB 2R0WL 1JPSH 4CVZB 4RZCA 4PRHE 5GS2H 4QXTB 4CDHA 4FQXA 2GYSA 4P3DA 1E4XI 4UDUB 5KSBB 1FFRA 2DDQH 4HDIB 4K3DH 4XXDB 3MV7D 2P8PB 2VN4A 5F9OH 2UWEE 4AEEA 4XPAL 2WBJC 4G9FB 3ZL4H 2IFFH 4I5BB 2NXZC 2Q8AH 2ADIA 3OPZL 4X7EC 4NJ9H 3VGAB 1U0QA 1QVOB 3LEXB 1GC1L 2IFFL 5BS0B 1AC6A 1H3XA 1BBDL 1S3KL 2X4QB 3FQRA 5D1ZB 2YKLH 1PY4A 4XAWL 2Q6WB 3V6FA 4K71B 4X7FC 5J9PA 5TQ2L 5IMMA 5DJXA 1R5WB 2X9XA 5FKAA 3TZVA 5DMGD 1BZ7B 4NQCA 3ZKMC 4JFZL 3G6JE 4PIRF 4KK8C 8CGTA 2WK2A 1B2WH 1KT2B 1F2XK 5GZOD 3Q2CA 2GI7A 3U6RB 4GG6E 4OM1L 3HNTL 2WBJA 1F6AB 2Y07H 3CJJA 3O41A 5F6HI 1R3KB 5E5UB 4MJ2A 4YDIL 3A6CH 2H32B 1CQYA 2GCYA 3OXRA 3MGTA 3ULVF 3UJIH 1QYGL 1EEYA 4LCCA 4OI9A 1E6OL 5HHOB 4JFOA 2VQTA 4X98A 5E5RB 1A14L 3MV7A 1D5IH 3GZKA 3U0TA 1OHQA 1NMAL 2MFNA 3PWLB 4KJQC 1OP3K 3LD8B 4M1GH 3FOLA 1NCWH 3MOQA 4X5XA 3BQUB 3RIFF 1OF2A 1ZLVH 4CMMA 3UZVB 5HDLA 2OJZH 3O11A 3VXUE 3S35H 4P5TD 1H0DB 2C9AA 2XTLA 1JHLL 3P0VH 2A77L 4M6NH 3DX6B 4NNXA 5I2IA 2PO6B 4KI1A 2IALA 2FD6H 4PJGE 2FH6A 3RWJB 1BBJA 2ORBH 3SEPA 3GSQB 3MLWH 4UILL 3RY5A 3RGVD 5I1JL 4KJWD 3O8XD 3T1FB 4U0QB 2XWJA 3RWGA 3ETBF 4OLVL 5ALCH 4KMTH 3O8XA 1KXTB 4W4NA 1YNLH 5F7EH 3AROA 1NGWA 2J6EA 4AIOA 3UAJD 3DBXA 5EZJB 4OZ4B 4S1SH 5DEGA 3D0LA 3SE4C 5BS0E 3X17A 2PETA 3RWDA 2BY3A 1NCBL 2HT3C 1K4CB 5ID1A 3H8NA 3GKWH 5DHYA 2VABA 1IGCH 4BSVA 3NFNB 4KQ4L 1CGTA 4P5TA 4TSCL 1MY5A 3C5ZD 4K3GA 2I5YH 1HSBB 3TESA 4FP8L 3HR5B 4HLZG 3AS2A 4LF3A 4UTBL 3IS0X 3QCTH 3QNXA 5IMOA 4WW1A 2QSTA 2XA8H 3JTSA 3MQIA 1S9XB 3FB8B 1U8JB 4ODBD 1FL5A 3K3QA 4OGYH 3MOAH 5BVPL 4PJ9D 2G5BB 5IT2H 2Y6SD 1YNTA 2VIRA 1KPUA 3C60A 2PXYA 1IKFL 3KJ4B 3O3BB 4K2UL 5I6XB 1WV7T 1QUNA 3V4UH 4B50A 1TJGH 5DJCA 4JRYA 4X4MA 2A6IA 4Q6YA 4RFNB 4Y89A 4LCIL 1DBJL 4G8EA 2W9EH 3F58H 3OKKA 2MHAA 1I3GL 4XC1H 1K5NB 3S35X 1CDGA 1OY3B 2YR3A 3NFSL 1MCKA 4M8VA 1NC2A 3LEYL 5KOVC 1HINH 4I3GA 4PJIA 1CT8B 5HJ3A 4MMXC 3J7HA 3AGVA 4R7DB 1QQDB 4U3XA 4G6JH 3HE7C 4MDIA 1M71B 1V3LA 3X14B 1DFBL 1U8KB 3SDCC 1KJMA 3LDBC 4JDTL 3C2AL 4WTWA 3P40A 1DVFA 3SE9L 2N4IA 4DGVL 3EYFA 5EB9A 1XZ0B 4UIMA 1A6VH 1UM4L 4U33A 1OARL 5C9JB 3NCJH 4G5ZH 5EH1A 35C8L 1UQSB 1MCLA 2GUOB 1F3JB 4NWUL 4GO6B 2O61A 5JDJA 2HG5B 2NTFA 4X6EB 1A6WH 1RURL 2ARWA 5I30L 1MFCL 1U8QA 2JIXD 5E8NB 4NCC1 1NCDH 3PWNA 1IEHA 1RK0A 2GHWB 4QTIL 2EDQA 3SN6N 4XPBH 2YD7A 4FQXD 2CO6B 2FGZA 4GG8B 4NQVB 3DOSA 1S9KC 1T6VN 4QHNA 4MNQB 4UB0H 5F89A 4FQCL 3RVWC 3I6KB 1LO2H 5DURB 3S5LB 3HMXH 4LAQH 1A1MB 3P0YH 4PJCF 3GMPA 2PXYC 2ZP0T 3N85L 4JB9H 2VSDA 3QDMD 2VZSA 3G5VA 5DA4A 3SDDC 3NIFE 3FQXA 2DYPA 1I8KA 3ZMRA 1OQOA 3STZB 2AV7A 3LRSA 3VFRA 3WFDL 4AT6A 5KSVA 1VEMA 2AK4A 1IAKB 2V7NB 4NZTL 1FN4A 3C6SA 3ELAT 3CFJB 4Y4KA 5F21B 1ZT4B 4A2LA 1MQKL 1P6FA 4H88L 4M3KB 1Z9MA 3O9WC 3D3VB 3KJ6L 1LK2B 1BGXL 1YYLL 3EFFA 4Q74A 3C5ZA 3IRPX 4XBGA 1I4FA 4JG0L 1FE8L 5HGAA 3CVHH 1D9KD 3O0RH 3GO1H 1A5FH 2L7JA 5KVGH 2CDGA 5CINL 4BM7A 4JO3H 3DMMA 3VG9C 1ZHNA 2WAHA 4R90L 3IU4H 4OBSA 4HT1L 2ZUQB 3JXAA 5L9DL 1IGYB 3ZDZE 2AEWA 5F93C 4R4ND 5JLZA 5FXCH 2FATH 5FGSA 4A6YH 1U91B 2NPLX 1C7TA 1TTGA 4JM4L 1KFAH 4N8CL 4TVSa 1K8DB 5SWQA 2L4OA 1YJDC 5EBLB 1WVZA 4U0RB 1UJTA 1NFDA 4RIRA 3DV6B 1CDJA 1UM6L 3BZ4A 2O5XL 4J3WA 3IDJB 3VFTA 4NZUL 5JZ7C 5KOMC 3KYNA 2AV1B 1MCBA 4PJCA 1O0VA 3WXWH 1Q72L 3B9EA 4Y4FA 5I16A 1HHJB 4KTEL 4O2FB 2AVGA 3HTLX 5DUBB 3GJFH 1UWGL 4GAYA 1T5WB 4HWUA 4FQ2L 2VDNL 4LIQE 4Q6IA 2ZJSL 3T4AA 2H2SC 3K2UL 2W38A 4XBPA 2GTWA 2ZSWA 1CCZA 4AG4H 1YJDL 2WP3T 4HKBA 1MLBA 3VXQB 1RZFL 5MENB 5DO2C 1QSVA 3C8KB 3VWKB 1T5XB 3SDDD 4EQ3A 4XH2B 5BO1L 2MPAL 1DVFD 1AGFB 3K81A 4POZD 1N3NB 5IVOA 1FZKA 5DQ9A 3IDXL 4WWKC 2ARJA 4BFBD 2O26U 1LEIB 4ZXBC 5D1XD 1O5DT 1BX2B 1JV5A 1AJ7H 1OAXL 4LSTH 3RJQB 1CD8A 4QRTA 5FK9B 3MRJB 5DJ6A 5HGHA 1NGPL 2OTUA 4X4ME 5I1AA 1LE5A 5CZVH 1JGUL 1I9JH 2FBJH 3HG1B 5I0DA 4NKDA 3QEQD 4L4VE 2DJUA 4XNXL 1A7NL 1WAAF 2DQGL 3L3IB 3FT3B 5DD5H 2X89A 5GGUA 2OLDA 1CL7L 1OTTD 4NO5A 3H3KA 5A16B 3OXSB 1CE1L 2E27L 4KK8D 4ZSOE 1XGUA 3TN0D 5JIIA 1U3HA 3T77A 2HA1A 1RHHB 3NFPB 1QVOA 3OR6B 4YHYC 1TJIH 4LU5L 1HCVA 5E6ZA 3ARPA 3HZMB 3RWFB 4RWYH 1NJ9A 2BXZA 5JORB 2VE6B 4HC1L 5CIPH 2DIAA 4MJ6B 5C09A 3MV8B 3TA3B 5CCKH 3VWJA 4JJ5B 2O5ZH 1WZKA 4Z76B 1F45A 3HI5L 4JHAL 3CFKA 1MHCA 1QLRA 2M8XA 4L4TD 1KT2A 3C09C 4L9LB 3KPPA 4J6RL 3D85A 1XGQB 5E24E 4NBYB 2B39A 4XP6H 5CJ8A 5ICYA 5C07B 3D3VD 1ZT1A 1KG0A 1P5UA 5JHLH 5J6GA 4BFEA 1LNUB 1YEHH 2GCYB 1DE4B 5ACLA 1YEJH 3BIAX 1G6RB 4LVHB 4Y4KD 3V52L 5IMKB 2CGRH 2MCG1 2FX8L 4I48B 4KTYA 1KTKE 3F7YB 4XPHH 1WBZA 2ILLA 4L3EB 1A14H 3FN9A 2UZYB 5F9JB 1AGCA 5IQ9B 3PWLA 4MXWL 1IM3B 2H1PH 1CVRA 3FOLB 2CDEB 1FVCB 3MRPA 4IMKC 3ALPA 3MRRA 2DIJA 3ARGC 4JG1L 1EGJH 4CAGA 2R15A 5IV2A 1TNMA 3VFNA 3V6OC 3X3FL 1WEJH 1RJLA 3MFFA 1JGDB 3MV9E 5IB1A 1S7TA 4OD3L 1KIRB 3ZDXE 3TO2B 3CPLA 1G7QB 4XPGL 3BDXA 3SGDI 1J0JA 5MHSE 4U1SB 1S7XA 2V9QA 4PLJC 4EN3A 3WL9B 3GJFB 4OIBA 3PV6A 3QDJD 3PDOA 4GRLA 4PBVC 1CFQA 2GFBA 1JHTA 4M7JL 4NO0D 1BJ8A 3NCMA 2KH2B 1SEBB 1A7RL 4OI7A 3O6MH 2E9BA 4KVCL 5JMRA 5EU3B 5FYJU 3TVMC 5C0FB 3FHAA 2P8MB 5LAXA 4YBLB 5JOFB 2NY0B 3ULUL 1V7MH 3TJEH 1KELH 3ARRA 3D18A 4HKZA 5DR5H 1BD2D 4E0RA 2JB6B 3QHTC 1IGIL 4NKMB 2QHLA 4JGUA 1HH9B 3TFKD 5E94A 1S9XA 3UTTA 3MJ6A 1ZGLM 4RMRA 3TYFB 1QRKA 3SBWA 1IMHC 2YSSA 2NX5B 5DQDL 3ZE1F 4YGVB 1IM9A 4YHLH 5C6PB 4V1DD 1KLUA 1PGRB 1PSKH 4ZUTB 1Q8MA 1FIGH 1QTYT 1C5BH 5IT2L 3FOMA 1AKJD 3C60B 4EUPG 1GPOL 3LN4A 3ME0A 4GKNB 2H3NA 1DDHA 3QCVH 3TBSA 5L8JB 4Y5YA 1RUKL 2IPKA 3QWRD 1N6QH 1QBAA 2PTTA 3GIZL 4AL8L 2YD5A 4NYLA 3RTQC 1LILA 4LCWA 2V2TB 4JFXA 5INDB 3TT3L 4P59L 1C08B 2MHAB 3ZYZA 3QT2A 4QHMB 2DB8A 3Q6FA 5MERB 4M9PA 2YA2A 4PJXF 3B9DA 1FNSH 3FRUB 4M1GL 3VH8G 4GRWF 1I3RB 5L7XH 4KQ4H 4TSCH 4MD0B 5TH2B 3TPUB 4Y5VB 5E1AB 2GJ6E 2NYYC 1NDGA 4Y19A 5JUEL 2OK0L 1FP5A 3BJ91 4OF3A 4LSDA 3GMOB 1TMCB 3I3DA 3DXAD 3U82B 5HHXH 4JRXD 1LD9A 1MCIA 1T83A 1BFTA 2EZ0D 2DM7A 2E5EA 2EIZA 2F53D 5ANMA 3VXPA 4ZXBA 2UWEB 4KRPC 1J12A 3ABZA 3ULVC 2VLRD 5EU7E 2XZAL 1CG9A 3QPQC 4XPTL 1ZA3B 4GMTH 1SY6A 1ADQL 4NQVA 2P5EB 4G3YH 1IT9L 4IDJL 1RFDH 1RZ8B 4ZFGH 1HQ4B 2UY6A 2IFGA 3PP3H 2YEZB 3BKCH 5KG9B 4QHNB 3Q6GL 3VXUD 3MZTA 3DPBA 1KYOJ 3BN9C 3JWDH 1IT9H 2XFXA 3S5LA 1UEMA 2WUBL 3ZKXB 1KJ2B 2IANB 4PJHB 3W5MA 3L3DA 4JPWL 4D9QD 3K74B 5JXED 1PG7L 3TBWB 2AV7B 2PR4L 1WCBB 1P2CA 4JZJA 2DQEH 3VXMD 2AK4B 2V7NA 4GBXC 1J1PL 3QUXC 5F1SA 3ISWA 1H8OA 4HIIA 4JO1L 3GSRB 3UJIL 4WRLA 2P8LA 4L8DA 4R4FL 2LVEA 4JPVL 1VGEL 4R0LC 2J5LC 4FFWC 3F8UB 2GTZB 3C5ZB 4JY6A 2DMBA 1M05A 5E8EA 2IAMD 4JFHE 5KVEL 2DTML 3QQ9C 5AZEL 4OLWH 5IKCA 5D6DC 1H3GA 2CDGB 4KDWA 4LSSH 4JEGB 1EV2E 3LD8C 3BGFC 2R2EB 5FO7B 2BVEA 4GKSB 1U93B 2OI9B 3H6JA 5CAYB 4LASH 3FONB 1EMTH 1NPUA 3DRQB 4UTBH 1YMHB 4OCRH 4K23L 3WUWA 5CZXD 5KSBF 3QUYD 1KUMA 5AG9A 4PJAB 1CFVL 1X6LA 5F9DC 1V3JA 3JBG7 5FOBA 4X4YB 1RUKH 2BSED 3BMVA 1INQA 1JPGA 1KCKA 3WHE0 2X4NA 4WFHD 1NFDB 3ZL4L 1ZLSL 5EO9B 1CGXA 2FR4B 3GIVA 2DJSA 4GAJH 4MJ5B 4X7SL 1U3ZA 5TF1L 2AV1A 1A4KA 1K9TA 3EYUL 4W4OC 5L2KD 4KRPD 2B8OT 5J0BA 3RI5F 4NKIL 1DVFC 3UPAA 3QULB 5L88H 2UZXB 4KKAD 4ACPA 1W8OA 3THMH 1I8MA 3O2VH 5D2NB 1FG9C 1JGEA 3QUKB 4OFKA 3WEXB 1TCRA 1T21A 4GAYB 1NCDL 4ZUWB 5IEHA 3HNSL 3G5ZA 1F90L 5CMAA 5L88L 2BVOA 3DURB 3HRZB 1Q9LA 2BNRA 4PTTB 1DTUA 2XZCL 1EX0A 4LDOB 3GO1L 1CLZL 3PWPA 3IKCA 3RVVC 3VFOA 4JKMA 1QEWA 3HZKA 5CJQL 3KYAA 3WUWG 4ELKA 1WFTA 3P9WB 4X6CB 2HT2D 5FCUL 5F9OL 3S3PA 3BIBX 3U1SH 1MNUH 2IBZY 3LCYA 4JN2A 5J13B 5D6DA 1DL7L 4ZYKA 1B4JL 4KROC 4QRTB 5GISL 3CVHB 4Y88A 5EU4A 2EYSA 1MREL 3HG1A 4L29A 4JRXA 4U6HB 3SDXB 4LHUG 5IVXA 1MF2L 1I8LC 3VWJC 3MRKB 3UTQA 1MFAH 4CU7A 4PRDA 2CDFB 5FYKH 1TJHH 3QRGH 1ES0A 4NRZB 3O6FD 3QAZB 4XP9L 3OR6A 5B39G 3GM8A 4KK9D 2D9QB 2Y06H 5HYIA 4O51A 1MLCA 5BMFH 5I1EH 2Y07L 1B90A 5IHZA 5D7IA 5MEQB 1FFQA 3EDFA 3ZHDA 4PJ8A 4GKZB 4NNYA 2OM5A 4LCUB 4JJ5A 3GJEB 4P3DB 2YKLL 1TZGH 4UDUA 1MQKH 35C8H 5DJAA 1QLRB 4ISVA 2P8PA 3IJYA 4G42A 4N90E 1P5VA 4OUUB 2VN7A 1LE9B 3ZDZF 2HKHL 1KG0B 4NZJA 1A6TA 2HN7B 4XP4H 2E7MA 5F7WC 1MRDL 3K0WA 2VDKL 4QF1A 5KTEL 3O2WH 1L6XA 1NCCL 1X4ZA 4ZPVB 4WFEE 2K9UA 1EEUA 2AXJA 3PL6C 4RX4A 3BGMB 1JIBA 3DO3A 5DJXB 5KANI 1X5YA 5GS0D 4XB7A 1TENA 4DKAA 2BX5A 1T1WA 4KK5C 4Z7NF 5D96C 1IEAA 2CLVA 3UX9B 5FYLE 1KEGH 2BDNH 2CJUL 1KEMH 4KVNH 3ZSSA 2IAMB 3S97C 2X4UA 3BZDA 2YD9A 4IIQC 5B8CA 3HNTH 1I9RH 4PRNB 1R3KA 2HJKB 4TNVK 5J1TC 2AJ3A 4LGSB 3VFNB 3MRBB 4CN1A 4LOUC 3QDJA 1QFUH 3MGTB 4OQTA 3QWQB 3AFLA 3TO2A 2RB8A 1D5ZA 3C9NB 4KDTC 4Y16A 4PJCE 1KACB 4X98B 4OM0H 3TVMD 3KPNB 4NIKB 3KPSB 3MA9H 4LLVB 4YO0A 3MJGX 3PNWA 2F54E 2ATKA 4FNLL 1CK0L 4LKXA 1BOYA 3P77A 3LY6A 3WL9A 4XRCA 3RPKA 3MNZA 5FB8B 2YPVH 3TYGH 1CFNB 4H26B 4J3OC 4GRLB 4HEME 2BY1A 1U92B 3H0TA 3QWOA 4WTXA 4YHLL 4RNRA 2CKBL 5DMKB 5GGQL 1Z9OA 3QXDA 4FQ1L 3DX6A 4NNXB 3WJLC 3QZWG 3X11B 1C1EL 4QY8A 1FV1B 2A9MH 2W60B 4PV8B 5GGQH 4MSWB 2A83A 5HHME 5I17A 1ZGLB 3IB4A 4S1QL 5DR5L 5C6TH 3MRNA 5E6YA 2ICEA 1YY8B 1RIUL 5GRXG 5JIHA 4RSVA 2JB6A 4BZ1H 4Q58C 2ZPKH 2YUXA 2ZCHL 3DIFA 1MRCH 4OZ4A 5DEGB 2VDQL 2YSSB 3KLAA 5ETUB 3ROOB 3WLWC 4NFBA 4OD2B 1FNGA 5DHYB 3S37X 5CEYB 1FNEA 2CK0L 5J6HB 1MCWM 3NFNA 4HPYH 4P5TB 2B4CC 2HFEB 2J8OA 2IPKB 5FKPA 1E0OB 4KK5D 1NLDL 1MFEH 4NYLB 5E9DB 2ITCB 3IS1X 4JDTH 2J1KA 5BO1H 1Q9OA 2AXGB 4P2RA 3WDJA 3UJTH 4YZFE 4MZ2A 3MJ8B 1HH6B 3FZUD 4M1CD 3QB7C 3QNZA 1MCQA 4QHMA 3P4NA 4LEOB 4N1CA 3VFUA 3PGDA 4TOYL 1FL5B 5E8DH 4MD0A 2Q3AA 5E1AA 2CKBB 3ZKSD 1S7WB 1FE8H 3NOIA 1CDUA 3GMOA 1CLYL 5DTFA 5E5MA 5DHVH 5GRJH 4BZYA 2CH8A 1R3HA 1LD9B 3MUY1 4JRYB 3RWEA 1KENH 1GZQB 3KXFB 4EDXB 4G8EB 3ULUE 4YHMH 3ES6B 2B5IB 2I07B 4LPVA 5ANMB 3C8DA 4I0CC 2W59A 1BM3L 4HX1B 4KK6D 2QADC 3AS1A 3E3QC 3T0ED 6FABH 2H6PB 4HWBH 5C0BE 4N0CD 3WHE1 3AM8A 4Q0XL 1BIHA 1LO0H 3E8UH 4Y5XA 3KR3L 4RRPG 1ZA3A 5E8OB 2J5LB 3OPZH 4MCYA 1FBIH 4FQPA 3E6FA 1DFBH 1U8LB 3JWOH 3L3JB 4Y1AB 4Y4FC 4RISH 2GK0A 4RAVA 4NQTA 1K8IB 5C9JA 5I66A 1E4KC 1DLHA 4JHAH 5TQ2H 1F3JA 1KJ2A 2IANA 2OP4L 2IAMC 4G80A 1U8QB 3OF6A 4JKLA 1MFCH 1WCBA 1J7VR 4QXGH 1ORSA 4C56B 2DD8H 4AM0B 3Q3GA 2CUMA 4PJ9C 3DNKA 3VI3F 5SV3A 4JM2D 3NCBB 3KPSD 2VC2H 1JNJA 1HXYA 2IG2L 2UZIL 3QEQB 1YEFL 2DKMA 3KHQA 4XGZB 4EKXA 5F89B 3SE9H 4DGVH 1M05B 3GBMH 3NPZB 4HC1A 1ZHKA 5DT1H 3SO3C 5GS1C 4U1GC 3MBXL 3EYVA 4OZIA 5FGBA 3VFWA 1DLFL 3G5VB 2XPGA 3MROA 4RRPA 1FAKT 3W0WD 5HGDB 1I8KB 1MIEH 3STZA 3EO1B 4NKOA 3V7AG 3FONA 4AT6B 3OZ9L 4Y5YC 1RVFL 1YC7A 4JFFB 5FGCB 3RX5A 1INEL 2ATPA 2VLJE 1QFPA 4JDVB 3PE9A 4JANB 4LCWE 3BPNC 4Q9QL 1LK2A 5J3HD 1NCBH 5EU6A 3TV3H 2CJUH 4YHPA 3T08A 3RGVB 1BZQK 2H8PA 5JOEA 1RZIB 1IGML 1RJYA 2EE3A 2EXWC 3EYUH 4QGYA 1C5DB 1L0XA 4D3CL 3CH8A 5DJYA 2X4RA 1GHFH 1H3PH 4DKDC 4KKNA 3NACL 5C0DA 5D2NA 3QCTL 2CO7B 5HYJB 1TCRB 5IEHB 5JLZB 2XKNB 5E2TH 4FQHB 1F97A 2DYPD 5CMAB 1BZ9A 4PTTA 1JNHB 2OL3L 4FNLH 4K9EC 4YHZL 2NY2D 2EO1A 5SWQB 1ZV5A 2C3XA 2VH5L 3HFMH 3B83A 1T0NB 1PYWB 4ZFGL 1K4DA 2AKRB 1D6VL 2Y5TA 3OKLA 2BNRD 3FCTA 1VSCA 3MODH 3KYKH 3SKNA 1B0RB 3VFTB 4B0MM 4F7TB 3K8LA 4P3CH 2F58H 1VDGA 4UU9A 2J6EL 1CDBA 1AIFB 3HMWL 4L5FL 2LV4A 5SWSB 3MXWL 4PJDF 3GSNB 4OZIE 3HB3D 5I16B 4PGDA 1MJUH 5L9DH 5EZLA 2VOTA 4HZLA 5JMOC 4HZAA 1ZEAL 4YHIA 5IB2A 3U9UB 5EU4B 3CSGA 3CFIC 4YC2C 2VLRB 4L29B 2AABH 2BRRH 5HVHC 4XP5H 5CZVL 5MENA 4OJFL 1UZ8A 3MRKA 3UTQB 3GNMH 4X80L 1Q9WA 5DZOA 3SE8H 3PABA 3P9MA 5GGRB 4BSJA 2ZCLH 2IQ9H 4CVWA 1EUUA 3U4EA 3MV9D 1UG9A 1FNSL 3PUCA 1LP9F 4YX2L 3BD4A 1HHHA 2NCMA 4ZO8A 1QFHA 5H2BA 3MC0A 4MNHA 1MLCB 1NLDH 1T6WA 2R8SH 5MEQA 1RULL 2IBZX 5D7JA 4D94A 4FHBD 5I1AB 4DCQB 1YECH 5LGKA 1BQLH 2BNUB 5C0ND 1C7SA 4O2CA 2F19H 2VL5B 4WJ5B 1TQCC 1HHKB 4N90D 4ISVB 4J3SA 1URLA 4R96A 4P2QB 3LKQA 1MHPH 4NO5B 1DQJB 3SE3A 4HLJA 4OUUA 2OTWB 4Z0BH 3MPCA 4OUOA 4X6FA 4F37F 4HUUB 2J8UE 3FN3A 3M8OH 5I1CH 4MD5B 2VDKH 4JCLA 4QRQA 4FMKA 3BH8B 3C08H 5IW3A 2F8XC 4GMSL 1S78D 2XACC 5C0AE 2COQA 4R2GB 5JORA 2I24N 2UV3A 1I7RB 3VFMB 3QIWD 1C8PA 4AEIH 2HKFH 3VWJB 4X6BA 4Z76A 1NDMB 2PYEE 1G9ML 1BBDH 1S3KH 3L95B 4RQQA 1NMBL 6FABL 4ZUSA 5HD8D 3TH4T 4RBPH 3A67L 4LBEB 3O9WB 4GUPA 5INCA 3DX7B 2X9WA 5FA4A 5L6YL 2YD6A 5K9JH 1RQ5A 1FGVH 5I1EL 3L7FB 4ZXBD 1UCBL 1HNGA 4HK3J 1Y6MR 4G6AC 4O58L 5LVEA 3QUZB 2B4CH 3C9NA 3CFEB 3PWPE 3R0MA 5IMKA 3A6CL 4Y16B 3IFPA 2K3TA 4KHXL 3L9RA 4QRPD 1EERB 3KPSA 3V4PL 2B4CL 3L3HB 5F9JA 5IQ9A 4FABH 4LKXB 1RIHL 1KV3A 5C0CE 1IM3A 3ARFD 4QRRD 4ODWA 4WTZA 1J9CT 3MNZB 5FB8A 3IF1B 3BE1L 4MA3B 2MKLC 1FVCA 4NN5C 1CFNA 2WP3O 5ICZB 5HYQA 3EDEA 1VKXB 3FQWA 4K7PY 4KAQL 3G5YA 3LRGA 3I2CH 2ZOLB 5TDOA 5E70A 4XNXH 5HHVH 3LKNB 4C57C 4L9DA 1UH3A 4JREC 1KIRA 5EZIL 3FKUS 5FUOH 2Y6SC 4TPRL 4NBXB 5D71H 4HMEA 1HIML 2A83B 2JIXA 4D0CA 5HVWA 1SJEA 2V5YA 3LKRB 5AD0B 4E41A 3QUMA 2BVTA 1QSEB 3QXTA 4M43L 5BV7C 3V0WL 4GQ9L 5I1DA 1D6EA 4PR5A 3QUYC 1KFAL 4N8CH 1ZHLB 2KZ1B 3PV7A 3S36L 4ZO6A 1JI1A 3KS0H 3CC5A 5FYLL 3PDOB 8FABB 4M93B 3FZUC 2EDEA 4M1CC 3SDAA 4LASL 1KN4H 4B41A 1IGIH 3UTTD 4EN3D 1OP9A 3MMEA 1BF2A 3GRWH 3ULVH 2OR9H 3D48R 3ROOA 1FIEA 2GKIA 3PJSA 2HFGH 3VA2C 2G60H 3PWVB 4YR6B 2L0DA 3GEWB 5EU3A 3G6AA 4JRWA 3SOBL 4HXAH 1BQLL 3QI9C 4JLRA 2D03H 1IAIM 5LAXB 2FX7H 1FHGA 5FO9B 2OS7A 3EIFA 3CVHL 2AXGA 4P2RB 2WV3A 3LKPB 3EOAB 1J05B 5IBUG 2A1WH 4GXVH 5D1ZC 4NO2A 4OFYD 2QQKH 2DWEB 1PZUB 1OVZA 1OP3H 2V7HA 3PGDB 4WW2C 5HY9B 4PJ7A 3WS6C 1T7WA 4OQ1A 4JO2H 1CGWA 5KVFH 2W9LA 1DQTA 4NN7B 4LDEB 4OCSL 3ZKNC 3UTSB 5H37H 3VCLB 4P3WA 4RFNC 1OSZA 1CGSH 1LVEA 1NBYB 3KPMA 4LCWB 3KNBA 1C08A 3TNNA 5TE7L 4WY7L 3L5WB 1L7IL 4Z5RA 3EZ8A 1YQVL 5DYOA 4KROD 4OD3H 3S6CA 3S7GA 3HG1D 2GT9A 3RZCD 4P46C 5FUZL 1JYVA 4Y5XB 4FN0A 4FTVB 3NMEA 1DN2A 4HCRH 4K71C 4FQ2H 3PXJA 5DD1H 4I3RH 5EC2A 1LDSA 1W72L 2NNAA 4Y1AA 1I1AD 1KJ2L 5DUPH 1PD6A 3O9WD 4N8PA 5F97E 2M1KA 3BPLB 1T22A 3B9KC 1P4IL 2QQLL 3O81A 1EHNA 3X13B 3R0NA 1HCFX 1UENA 4KK9C 1MI5A 1HSAA 5KS9E 5D70H 1U8PB 1CXIA 1UH4A 4KUCF 3VXPB 4KRNA 1JF5A 2Y7QB 4NN6C 1FSKB 1ORQB 4J6RH 4LEXL 5BZWA 4Z77A 1VESA 1CG9B 3VD3A 4EI5C 2DL9A 4XVSL 4XP6L 3QEQA 1FZJA 1OAXH 4LSTL 1YPZB 2C1OA 1RZ7L 3BAEL 5DJ2B 1T0PB 1C16B 1A3QA 1FO0A 3MJ9H 4NQCE 3W39A 3S4SA 5B39B 5GJTL 1O7VA 3LPFA 1U3YA 4PJHA 1G0DA 4GXUM 1X9QA 5C0RL 5T1LA 2NY1D 5GXBB 1OL0A 4N8VG 2W0FB 2DM2A 4HUWB 5ADOL 1MIEL 1GIGL 1Z6JT 1IL1B 2KBGA 1BVKA 3INUL 2DQHH 4PJBB 3T3ME 4PS4H 4HIIB 3RX8A 1JPTH 3OTTA 3ZDYE 5B3JE 3U7YH 1E4XH 3WJLA 3O3DB 2X89D 2P8LB 4L8DB 4Z6AT 3FT2B 4OLZH 4JPVH 4RX4D 4XCFL 3MUHL 1NGPH 1OGAA 1YA5A 3HFML 3RVTD 5IW1A 3AC0A 2NZ9C 2PW2B 1CK0H 3GDBA 4MLIA 3U9PH 5C8JB 1C5DA 5I1IH 2FJHA 3FFCB 4LOUD 4GXVL 2EDHA 2FCBA 5FO7A 1PG7H 4PGEA 1U8OB 1EZVX 1QSZA 2QSQA 3BH9A 1EHXA 4JRYD 2UY7A 5IBLD 4MMZC 1R6VA 3PGFL 4NM8H 4CN4A 1RZFH 4PJHE 1JFQL 4EEEA 4UV7H 1JNHA 1RIHH 2J2ZA 3IDIA 4J2XA 4G6KL 1XH3A 1WGOA 2FATL 3HNSH 1INQB 5C92A 1CFTB 2AJVH 2XG5A 1GCFA 1T0NA 4N8VA 1ND0B 5EO1B 1N6VA 5E6IA 3SKNB 2B1AL 4L5FH 4UU9B 3VFPA 4X7SH 5EOCL 5TF1H 4QTHA 5F6HJ 3H3PH 3QUXD 4BH8B 3WBDA 4OF7A 4JG1H 3VRLE 1OAKL 3QDJE 1YMMA 1XEDA 2P5ED 3D39E 3G9VA 2HTKC 5L2JB 1MJJB 3QPXH 3AMLA 2B20A 3TV3L 1KNOB 3WXWL 4HWBL 4H20L 5KSBE 3QIBD 1S7SB 3V5DA 5D7KE 4J8RB 3WN5C 4XVTH 3MRCA 1F6LL 1R3JB 5HHMB 5EULV 4PP1C 5FM5M 5E2VH 3ZTJG 4Z7WA 5C0NC 3DLQR 4HKXA 3LQAC 1UM5L 4PJEE 3BRFA 2WINB 4MVBC 1U8MA 2D4FA 5FM8A 4OF6A 3IETB 2R29L 3AM8C 3TT3H 3ILQC 2LU4A 3FO1B 5IQ7H 1QSFE 1T04B 4PRAA 5HHMD 2D4DA 43C9A 1CD0A 3FT4B 4JFYB 3CVHA 3QISA 4DCQA 4KKLC 1KJVA 3KPSE 2NY3B 2I60H 4YJZL 4MJID 4L4TA 2VL5A 3TBVA 3I84A 1HHKA 3ARDC 3SO5A 5JTWA 4P2QA 4ORZC 4BSWA 4QEGA 2Z0BA 1A22B 4PRDB 5C0GB 3K1KC 4O4YH 4LRIA 2Q3ZA 4GLRI 1M6OA 3REWB 2GQHA 2O5YL 4HUUA 1ES0B 4HIEB 4NRZA 4MD5A 4O51B 3BDYL 4K94H 3HMXL 2OX5A 1TNNA 4PJ9B 3HAEG 1IGJB 3FQNA 4EXPX 4GKZA 1DCLA 3VH8A 2BZDA 2ZPKL 3FO2A 4DWHA 1MCDA 1Z3GL 2IPUG 3LN5B 1YEEL 5EN2B 1S7QB 4LLUA 1YEIH 4FXKA 5GJSH 5JW3L 1QLEL 3RWCA 3D87B 4PFEA 1MVUA 1WBXB 2HT2C 5FF6B 1BD2A 2DQCL 4X0KA 5D7LA 1DBAH 5FA4B 4OM1H 3WMSA 4EQ2A 5I15H 2XZCH 1U6AH 2R9HD 1HHIA 1T3FB 1TJHL 2HN7A 1LO5A 3MLPA 1QRNE 5GZOC 1S5HA 1JTTA 3OSKA 3QUZA 3CFDB 3STLA 4OZGA 3BGMA 4YXKH 3T0EB 5CP7A 3EHBD 4KJPD 1UXSB 1ZKAA 3RWIB 3HI6L 2BHUA 1IEAB 3V0WH 5JZ7D 3O6ML 3IF1A 1UM4H 4M4RA 4E41D 5ICZA 5HYQB 3ZE1E 4GSDL 3O6FC 1MCEA 5B8CB 3BP7B 2BMKA 3HAEA 1GGBL 1XF5B 1JGVH 3RVUD 3S3JA 5DD0H 4XCYA 3NIFF 1TFHA 1T66C 2AJSL 5FV2A 3I6LD 3JSSA 4I0PC 3MRIA 4JQVA 2EC9T 1HHGB 1IKNC 1CXKA 5CP3A 2JIXB 4D0CB 4MNGE 3WIFA 3SY0A 4GOSA 4E41B 5ESAA 1KGCD 4UIKH 3WN5B 2ATKB 3P9LA 2CLZA 2DQHL 2ZUXA 2F54D 4RFEA 3WO4C 5D5MF 3MLXL 3LKSB 1YPZE 3X3GH 3RBGA 3D25B 4I18C 2X1QA 5HHNA 3RQ3A 4BQ6A 1ERNA 1HEZA 2GAZB 2D3VA 1MSPA 5DMKA 1RV6X 1QA9A 3PWVA 4RA3A 3RIAF 2JB5L 4OD1L 2FIKA 3VMNA 3CXHJ 4JLRB 2KQNA 5ITBL 2FEEI 3BXNA 4YHNB 4XP1L 2NY0C 1SEQH 3MRNB 4PJFB 1G7JA 3LKPA 4J4PC 3EOAA 3C87A 5BJTA 4KTDL 1G9MH 1TVBB 4P23B 3PP4H 4DTGL 1YEGH 3V5KA 1OGTB 2LU3A 5K9QG 5HY9A 3ARSA 5GS1A 25C8H 1CVSC 1JN6B 3DX8B 2BXYA 3GMRA 4N0RA 4YHKH 5M94B 3AB0B 5E6ID 1FNGB 4P9HH 1JF1B 4XCNB 5HBBA 1X5FA 3HLAB 2HFEA 2DTSA 4LFHD 2IH3B 3QDMA 2A6JB 3ARFB 3IDYC 4ZODA 2HLFC 3U46B 4XP5L 4H5SB 3KPMB 2Z91A 3HB3C 1FQ9C 4DGIL 2Q8BH 1Q9OB 2AXFB 1V7NH 2EDWA 3PWJB 1WTGT 2DWDB 1Q38A 4TNWF 1XGPA 5D9SA 3VFUB 2N56A 5F70A 2MSPA 3AUVA 4RGNE 3GSOA 1H3TA 1UB5B 5CLTA 4HPOL 1A9EB 2P1YA 2VISB 1CU4L 4JY4A 5CUSH 4XMPH 4DN4L 4TULH 3CNKA 1D5BB 3FAWA 1JCKA 1IFHH 1N8ZA 4FFWD 4KV5F 1QYGH 5CEZL 4K3EH 2V5SA 3QDGE 3X13A 1AE6H 1D5MB 3CZJA 5FHBL 1A6ZA 6CGTA 1IE5A 3ES6A 3GUTB 2I07A 5C9KA 1VGEH 3NH7L 1A9BB 1CYGA 5E2TL 4XVUD 3FHQA 3P73A 4F7EA 5T1LD 4HXBH 4WEBL 1A7OH 2EC8A 4GW4B 1Z9LA 4FFZH 4QHKI 2WQRA 4JFDE 4FFVD 1E6JL 4EDWL 1FLRH 4YEEA 2C1OB 3SBWC 5EU5A 1YPZF 4P2QD 3BVNB 2VDRH 4H1LA 1C16A 4XP4L 1K8IA 3W39B 5B39A 5IR1A 3SKOA 1G7HB 3FQUB 3LQZA 4I0PB 3QJFB 3PXHA 3HI1B 2FJFB 3MCG1 2BK8A 4G80B 5ADPH 2R2BA 4ETYA 4HUVA 1Q0XL 1ZVHA 1AGBA 1KTDA 3MLWL 3OB0K 2P49B 4HV8B 4JJHA 2E7LC 3QQ4B 2X4SA 2MTPA 4DOHB 3UP1A 4Y2DD 3MA7A 1JZ2A 3RDTC 4U1IA 4YIQA 4V1DE 1NFDF 2EXYD 5D8JH 3MXVL 1DBKL 3NACH 5LWYH 4PGJA 3OJMB 4BK5A 4QRSB 5D93C 3I3BA 4OV6F 1PKQE 1T7XA 4WU7B 2W65B 1WT5A 4QOKE 5IW1B 3VFVA 1KCRH 3ULSB 1ZS8A 2K7PA 2PW2A 5ESVB 4FXGB 3EYVB 2FJHB 3FFCA 3LS4L 4CUCA 1UADC 2XN9A 5FYKU 4ZNCD 3V0VB 5HGDA 3TBYA 2VMFA 1MH5B 4OZFA 4RGNC 5EBWB 1NMCC 1U3HC 1VFBA 3Q5YA 4X9IA 3WNPA 1U8IA 2ZUVA 1MY7A 4JFFA 4YWGL 4C55A 1G9NL 5DQJA 3VE0A 2YUWA 1J1PH 3QI9A 4F57H 1DANT 4H25B 3O4LE 2HTKD 4KJYA 3MOAL 1CFBA 3UYPA 3IU3B 4R4NC 4UT7L 3QQNA 2MJWA 4RGOH 5EO1A 2H8PB 2PYEB 5K59F 3CSYA 4EIZC 1MFBH 5C3TA 5CSZA 4HK0B 3W9DB 4Y2DA 1FBIL 1JI2A 4G9FD 3S36H 3QH3A 5E00B 4Z7OF 4MQTB 2ZCHH 4KY1L 4BQCA 3C60C 4M5ZH 4YDJA 4UDTA 4QRPE 4E9LA 2XN9E 4JHWL 3WFEH 2BY2A 3PIQA 3RDTA 5A1AA 1R3JA 4OCXL 1MFDL 1CFVH 2V5MA 1K4DB 2AKRA 4HKXB 1MRFL 4DK3A 4Z78A 1BMGA 1YY9D 1B0RA 4OLVH 2DQUH 4NDMA 5ALCL 3QZWA 1AIFA 2EECA 1SMOA 5CBEB 4Y2DC 3DI3B 4DKEH 5E7BA 1H3VA 4JGJA 3VXME 4TTDD 5D7IF 3ET9F 3C5JB 3JUZA 5D7SH 4TYUA 1SVCP 2P44B 3BDBA 5D72H 2V6HA 3WSQL 5CGYC 3VG9B 1C12A 4GBXA 4JAMB 4K7PL 1WC7B 3RGVC 1QFWI 4W6YB 2ERJC 3U9UA 3PL6D 2BP3A 3EBAA 4XWGH 3QG7L 3MLYH 2R8SL 4L4TB 3CGTA 5T5NG 4HIHB 2EXWD 4ODHL 1CGSL 1E4WL 3QDGA 2A6DB 3UMTA 1CFSA 2UYLA 4BSWB 1NAKH 5KJRH 2JCCF 4NHUB 3PABB 5K9OB 4X9FA 1F3DH 4DAGL 2WWMC 3REWA 3MREA 2BSTA 4HIEA 5DK2A 2YPLD 4PY7A 3GI9L 1PW3A 2VO5A 3PQYB 3OGOE 1NC4B 4PJ9A 4M6MH 4OT1H 1U58B 4N5ED 2IJ0C 2BNUA 4G6MH 5DFVC 3RPIB 1Y18B 1AD0A 1X5GA 1KB5A 2O5ZL 1MWAB 3U2SA 1OAQL 1A0QL 5IESH 3WLBB 3UPRA 3HUJB 3J8F7 4FA8A 3LKQB 1JWMA 1GZPA 2EO9A 5IVZA 3FJTA 3FB5A 4Y1AD 4NQXA 5I15L 4JQIL 2EDFA 3ZE2E 4OV5A 2YPKB 2AJYH 1BFVH 2DQDH 5C3LD 5EOCH 5IFHH 5I8CA 1FGNL 4LSVL 3BH8A 4X7CC 1T1YA 5C0EB 4K7FB 1XMWA 2OQJB 3EKCA 3CFDA 5E4EC 3DUUB 1Q94B 2DLFL 3C2AH 1MWAL 2A38A 3MGAA 5CP7B 5EIIB 1HZHL 2F53B 3KWWA 4WHYH 3TWCH 3KYMA 4TUJA 4WU5A 2NY4D 3EOBB 2DRUA 4RQQB 4GW1B 4QO1A 2YXMA 4QNPF 1ZAGA 4Y4HB 4UUJA 4NUJB 4P5MB 4MQSB 3CCHA 1SHMA 4P4RA 4YGAB 1XGYL 3EOTH 5D6CB 4DZ8A 3BKMH 4HHAB 3EDKA 3WS3B 4G7YH 1OM3L 1N2RA 4XNQA 4XCFH 3KPRE 4W6XB 3AXLA 1RUAH 3X12A 4EI5B 4MXQC 1YUHB 4G7YL 3V5HA 5IF0B 3K2UH 5KSBA 4NC1E 1UACL 1SYVA 5CD5D 4L8BA 3IXAB 1FYTA 3DROB 5T5NF 5ADOH 4WWID 1B4RA 1DUZA 1UCBH 4LVNC 4KMQA 5FDYA 2VLLA 3WDIA 5D1QB 3QIWC 1ETZB 1FC2D 4UV7L 4MCZA 3ZHLA 2UWEF 3BISA 3MV7E 4YZFF 5IEKA 5TE6H 5I1LB 2ADGB 4CMHB 1UB6B 3H7BB 4IRJC 5IMMB 4MWFA 1OAZH 4UMGA 1CICD 5CEXB 5FKAB 3TZVB 3OG4B 1G7JB 2FH8A 3QUMB 4WVRA 4NPYA 4WI2A 5TF0A 1KIQA 2DQTH 2ZUSA 3QCUL 1QHOA 5IBTH 3C6LB 1ZHLA 4P23A 2X4OB 3VRLF 1HI6A 1JZ8A 3SDAB 1R3IH 4KK6C 3VG0H 3TP4A 3TFKC 3O41B 3MMEB 4KJQD 5C0BB 3MOBL 4CL7A 1JF1A 1UWEH 4XCNA 4XMLL 1VEPA 5D5MB 4TUOB 1MFAL 3QDMB 5DMGC 2WLYA 4G6ML 4HS3B 5EA0H 4KWUA 3BDYH 1HIMH 3REVB 4K3EL 2Z91B 5DD6B 4F9LC 1LDPL 2Q8BL 1QBML 1LO0L 3E8UL 5DURD 5B3NA 4PD4J 4PLKD 2ZNXA 4RGNB 5FYLD 4U2YA 3B8YA 3EW3B 3W2DH 2R0KL 2AQ2A 3SJVD 5JDSB 3QRFM 1QRNA 5BRZB 4WWKB 4YHOL 3T8XB 3EFDL 3PHOB 1EHAA 1EJOH 3TIEB 1Y0LB 1DQDH 4KRMB 1F3RB 2E9JA 2C5DC 2VISA 4CNIA 4EBQL 4P57A 4H0IA 1OB1B 4MJIB 4IIQA 2WBWB 1EJOL 3PWUA 3T0DA 5J56B 1RUPH 1T7ZA 3U0PA 3G6JB 5DK3A 2NY5H 3RU8H 3QQ3A 3UTSA 1N8ZB 2IALB 5LXGH 2I9TB 4A6YB 3KNBB 2LAGB 1RMFH 4NP4L 5D7SL 1KBGH 4Z5RB 3O2WL 3DJ9A 3QEUB 4U7MA 2XYCA 4U6YB 5KS9B 2ZG1A 3P30H 3DXAB 5M7QA 1QR1A 3SDCB 4N1EA 4HXBL 2IC2A 1X7QB 3IFOA 3TH2T 2RFXA 2F54B 1T0MA 3ARDD 1FG2A 1MJ8L 1I1YA 2G75B 3TA3C 3BKJL 4IDJH 1MNUL 5ID1B 4G7VL 7CGTA 3BVNA 4IRJD 3B3IA 2FBJL 4WV1C 1Q1JL 1G7HA 3WHXB 2BRQA 4NO3A 4ZD3H 1TXKA 2OCFD 1FZOB 2J7LA 2R2BB 3DVNA 4HUVB 1MI5B 1KTDB 1OD9A 3GHEH 2HTLC 3QNXB 5J1SC 4KI5E 4NWTH 2D0FA 3MA7B 2Y7QA 4PRIE 1AHWA 4X4XB 4JFDB 4U1IB 3MV11 3S98A 2ICWA 4N68A 1N0XH 2QKIB 3O6FB 2AJXH 1KCUH 2IAND 4X7TA 4PRPE 4Y16D 3STBA 4HT1H 4D3CH 1AY1L 4QRSA 3O6LH 3OBAA 3H42H 3MACL 2Z93B 4GRMB 1OTTC 5LBSL 1JZ3A 5DJ2A 3KPRA 4K9EH 5F7EL 3MRFB 2W65A 4NCDA 5HDQL 2ITDA 2XT1B 1X5AA 4EUPH 3QUZD 4JG0H 5HDQH 4IRJB 4X6CE 5D2NE 2WLZA 2VR4A 2F9BT 1MH5A 2GSIA 3ZYOA 2HRPH 2WWKO 4X6CF 2EYTB 5E1HB 4G8IA 4PJBA 3L5HA 1NC2B 4ONGL 5D1QC 4R7DA 3ARZA 3M07A 4X99B 1YEGL 1R0AL 3ALXA 4U6XB 3O3DA 3QI9B 3MLUL 4UNVA 2ARJQ 3SGEI 2OZ4L 1I3GH 4XC1L 1U8KA 4NHCH 4GG6F 3IU3A 2VDNH 3RI5K 3SDYH 3SGJC 3MLUH 2PYEA 4ODVL 1BQUA 1NSNH 2LAAA 1X4YA 4ZDHB 1SY6L 1FL3B 1T66D 2VKWA 4XVTL 1NUDA 5C0CD 5AG8A 1U8OA 4X6EA 5J89A 3BH9B 1KSRA 1EFQA 1MCOH 5IJVA 5E8NA 1RAMA 2OJEA 5C0AD 1JNNL 4WFHE 3KLHD 5JXAH 4KRLB 2J8HA 3IDIB 3TM6A 5EOCJ 1FH5H 4OBRA 1ZMYA 5JW3H 4BKLA 2GJ6D 3I50L 2DBLH 2E9IA 1KCSL 4MNQA 3ZT5A 4PY8I 4YAQB 4LEXH 5FUCC 2PF6A 3SJVE 2R4SH 3N0PB 3BE1H 5DVLA 5CBEA 4QTHB 5KVMC 3DI2B 4KHTL 1WZMA 4PREA 3FQXB 4Z8FL 4M7JH 4HS8H 5I73B 3LRSB 3EYQC 3BOVA 1TZHA 1IAKA 1NLBH 1CR9H 4QNPE 1C12B 4GBXB 1MJJA 2ED7A 1WC7A 1I1RA 1N5AA 5IVXF 3T65B 1KN2H 3BEWA 4PLJD 3SE4A 4JKPH 3N1QC 4J8RA 3UTPE 3HNVL 4D9RE 4HIHA 3EYOA 3JVGA 1GGIH 3PP3K 1RU9H 2QR0A 2WINA 1PKOA 4WV1B 3GK8L 1CTNA 2QV2A 2RGSA 4CRPA 1YEDB 5IBLC 1NEZG 2ZUWA 5D1QD 5GPRA 2CRIA 2QSVA 1A6AB 2IH1A 4X4ZA 2PCPB 3PQYA 3RNKB 1CWVA 3GSUB 2RBLA 1B2WL 5ICXA 3RIFK 3VXRD 5EC1B 4ZPTB 2DL2A 3LHPH 3BP4A 2X44D 3ZE0F 1Y18A 2D03L 4PB9L 5T1KD 3WIIL 5HHOE 2BOCA 4PRHB 3N1MC 3UPRB 2VSCA 4NJAH 3BT2H 3BZ4B 1A3LL 5IVZB 1P7QA 1RZJC 2QQKL 4LLYA 1W0WA 4OAWA 3KYNB 1C5CL 1LGVA 2LTQB 3LQAL 3NA4A 1CD9B 4O2FA 2WUCH 3FFCE 3C8HA 4OGXL 4H8WL 3FQNB 1BECA 1G9NC 5GSRA 5GS0H 1LO4H 3VXSE 1Q9KA 2Z8WC 2ZSWB 4PD4K 4IMLA 1TLKA 1UYWL 2J12B 2NY4B 1NEZA 1T2XA 4FXKB 4ODUA 5HHVL 4NBZB 1VFUA 5GGRY 4ESKA 4MXQD 4IRZH 3GMLA 1WBXA 1R5VB 3LIZL 1BD2B 1OP5H 4BFIB 1JUFA 2BHZA 2FD6L 4Y4HA 1I1AB 5D7LB 5FA3B 3O4OB 3DGGA 4JZNB 5E8PA 1HHIB 1N3NA 1CS6A 3QFJB 4P4RB 5HHPB 3U83A 5D6CA 4DZ8B 4F33A 3ZYIA 4KGLA 1CICA 3ARWA 2DOCA 5IFAL 1XF1A 3A6BL 5H35B 4POUB 4FQIL 1EFXA 3B2VH 4OZGB 4GW5B 2Q8AL 5T3ZE 1U3JA 3TPKA 3T0EA 1N2RB 5B22A 1ZANH 2ZWLT 4XNMA 2NY6B 2OTUB 4C59B 5EIVA 1YUHA 1P84J 3WFEL 4KDVA 3ULVD 4NQSA 3OX8B 3EJZC 4OLZL 1A4JB 4OZGF 1AKJB 5J12B 3OXSA 4LVOB 4L4JA 1JRHL 3FL7A 2BMKB 1EA9C 4HS8L 3W9EA 3HAEB 3UYOD 3VRJB 3MGOA 1CXEA 4AH2A 1NMCB 1U3HB 3A67H 1KXQE 2VQ1B 3RX7A 2NY6D 1DEDA 1ETZA 3CXHK 4MNGA 3HZMA 4F7CA 1N5YL 3MLVH 2D31B 1HHGA 2VE6A 1IQDA 1UB6A 3HE6C 3SY0B 5C09B 4MNQE 4M02A 3WN5A 4MXWH 1MHCB 3OAZH 1K2DA 5LGHH 1TZIB 2BCKB 2YXFA 3SDXF 3ZZ1A 5B38B 3U0WH 2X4OA 4L9LA 4NJ9L 3IGAA 4XPFH 5HHNB 3D85B 1XGQA 4NQED 1EAPB 4KZEH 1T83C 1MRCL 4KTDH 5C07A 5C0BA 4NGHH 3ULUC 3SHSA 1UA6L 2GITB 1KF9B 2AXHA 5FYLH 1MAKA 4M7LH 4LL9A 2JB5H 4LSUL 1RUMH 5F7HA 4I48A 1JHLH 2BERA 1ZLWK 1J0HA 1I8LA 1R3LB 5DD6A 1VB9A 4DN4H 1V5JA 4HUNB 3UBXI 4OZHA 4UT6L 5JDSA 1CGVA 2AGJL 5BRZA 3NZ8A 1H5BC 1TVBA 2R0KH 5J06A 1IAIL 1OGTA 1S7VB 5L2KA 1JYWA 1DUYA 1UH2A 3RA7L 3UO1L 3MRRB 5GS1B 4ZUVB 4POYA 3DHMA 1VACA 1OB1A 2VXUH 3GMRB 3QWRA 5D72L 2F19L 5JPMB 5KVDL 1WQVT 4YDLC 3JTTB 4NWUH 4NRYA 1MAJA 4H88H 3CSPA 4OSUL 2DQFA 3G6JA 3B9KA 5IB1B 5HHOD 3EYSH 4BQ8A 4YDKH 2R23A 2A6JA 3CPLB 2NY5L 3L3GA 3CVIL 3DSFH 4QCIA 1VEOA 5BVPH 4HFWB 2I9TA 1OTUC 3H9SB 2APFA 1OM3H 4YE4L 4NSKA 1UKQA 2JKXA 5C07E 3W81A 5IJKA 2LE9A 3MV9B 4D8PB 4XTRD 3QO0B 3V95A 3R8QA 3V7AE 4P46B 2WQ8A 3IDNB 4KI5F 3T0AA 5B3JF 5FDWB 2QTEA 2VLKB 1LO2L 4ORGB 1CFQB 4TSBL 3GBNL 3QNYA 4FQCH 4KVNL 4LLQB 1UB5A 4HIXL 3TCXA 4LPYA 3RTQA 1GPOH 5DRNB 1TQBC 3MLYL 1DR9A 4G3YL 4PP2B 2P8MA 3NA9H 1X4XA 4AMKL 4B53A 4P4KD 1D5MA 3IFNL 5E03A 3KPRD 2FL5B 4PJ8D 4E0RB 3DV4A 2OSLB 3CU1A 1NCUA 1A9BA 3TT1H 4R97C 2DQDL 3K8MA 4JFEA 4X4XA 5DLMH 2Y4SA 3HN3A 1DQLH 3QIBC 4KPHL 3WKNA 4PRPD 3TYFA 2WZPD 3O6FA 4M6AA 5J12C 4NQDE 1BOGB 1TQBB 4F7MA 1S8DB 4WW2F 3GB7A 3B5HA 1RIVL 1P7KA 2Z93A 4GRMA 4Z7UE 5T3ZH 4P23C 5L8LB 1XF2A 4JCMA 1DDHB 3TBSB 3UTSE 4PJGF 3GMQB 3R06A 3OKDA 3WV0A 4JQVC 3FQUA 2Z31B 2PUQT 1NSNL 5A2LH 3FO9A 4YHKL 5J4MA 5INDA 3MCKB 1EBPA 4PJHF 2WUCL 4LP4A 1VPOH 2X4SB 3MFGB 2GJZB 4U3CA 3Q6FB 1KB5L 4Z7VE 1OPGH 2YC1A 3FRUA 1I3RA 1GGBH 2C3GA 4Y5VA 4QHLA 4QT5B 3FAXA 4JY5H 3QI9D 5HYSB 5C08E 3AAZB 3MLTB 5BW7A 1NEUA 2Y5EA 1AGEB 1UCTA 3N9GL 3ULSA 1XFPA 4WW2B 4PB0L 4UINL 1SJHB 3KPOB 1PAMA 3W11C 3V0VA 1GGUA 2PKDA 4PJIE 1I9RL 3OHXB 1DQMH 4LGPB 5TE4L 3BPCA 1DQQB 1F3DJ 3EYQD 1WIOA 1T1ZB 2NXYC 4H25A 4RMSA 3GMNB 3NH7H 2EH7L 2YMXL 1WBYA 1EIBA 4YAQA 4YXLH 3CSYB 1YEEH 1RUQH 3PWPD 4WI6A 3FB6A 1RZJH 3MV8E 3CIQA 2QL1A 3DVGB 2NY2B 3ARVA 5JW4N 5MEPB 3L3DB 1CXLA 1HQRB 2AS5M 1QSFA 3RZCC 4TRPH 3RUGA 5EO0A 5JNYB 4E42A 4WDIA 5CINH 4JFPB 4ZS6C 3P30L 3GSRA 4P4KB 2NLJA 4LFHG 4OCWH 1DANU 1G9NH 3BEWB 4N0FB 4P23D 3RVXC 4WCYH 3L5JA 3RDTB 4JVWA 4CVXB 4R2GC 3SPVB 3PL6A 4X6DA 4PJ7F 1AY1H 2FZ3B 2QR0B 4KDTA 1F13A 5JO5B 4JFQB 2ICES 2X1XR 3VFGH 3WIHH 1DZBA 3PGCB 1YEDA 2Q7YB 2R2EA 1C5CH 2UVFA 5HPOA 1NGZB 3ECBA 2XQYK 4AJ0A 1OT2A 3GSUA 4EBQH 3NCEB 5F6IB 3NZHH 1INDH 3I6LE 1QLEH 1ZHBB 2BVQA 4PRID 4ZPTA 4PJAA 4PJ5B 1EVTC 4Q7DA 3F65A 3QG7H 1NBVH 1G0XA 5CKAA 4FOMA 4F2MA 3GMMB 2BOCB 5BZDA 4MXVE 5H94A 4PLNC 1CFSB 3QDME 4MQXD 2J3SA 2DICA 2DS4A 4Z8FH 3VFSB 5LGJB 4OLXL 5MP6L 4R97B 5CWSA 1W0WB 1N4XL 2ADFH 2DMCA 1A4KB 2KZWA 3T2OA 1WFUA 3MJ7A 3WSQH 1A1NB 1U8NA 1ZTXH 5BRZD 4ZUWA 3MNWA 4YBQD 4K8RH 1FLTX 4WEBH 4RMVA 4X7DC 1VGKA 5KSAB 3T2NH 3U2SB 4N9GB 4O2EB 1GJIA 3WLBA 1UZ6F 2Y36L 3HUJA 3IT8D 3SCMB 4M5ZL 3VFOB 3D69B 1GZPB 1ZXQA 3IDYB 4HIXH 1AQDB 2AEIT 4BFIA 4CDGC 3AU1A 2I5YL 4D9LH 4DQOH 5FA3A 3LMJH 2J4WL 5HVFB 2OJZL 4X6CA 5IM7B 3VRIB 3ZT6A 5B38G 2YPVL 5HD8C 4ZS6D 4K7FA 4KQ3L 2VAAB 5LJYH 3WXVL 1ZLWH 2VUOA 1NFKA 2F53A 5I8KH 3O45A 3C5SB 3VGBA 2P46B 3KYMB 2EYSB 3QIWB 4XMKL 3RVVD 4P2QE 3SDXA 4YXHH 5IVXB 4U3HA 5GZND 2Q76A 1FC1A 1VA9A 3HE6A 5FFLA 3GI8H 4NRXB 1RUAL 4Z7VA 2BNRE 3BYTA 2K1MA 1FL6A 3F7VA 3WFHB 5HI5D 4KAQH 4XWGL 3O3UN 1EO5A 3HI6H 3CCHB 2D7MA 4P2YA 2FHCA 4G9DB 3BKML 4MNGB 4KI5C 3TVMA 5GS0L 4WHTB 4EOWH 4JFED 1T20B 4LIQL 1UYWH 1NLBL 4JR9H 4L3AA 5C6WH 1QLFB 3WKML 4PJ8B 1SBSL 4NZRH 3X12B 3T0EE 1IC4L 3QDGD 5F3HB 2GSGA 3KLDA 3OGCA 4U6VL 1AFVL 3V5HB 3C6LC 1KN2L 2XNAB 2QHRL 1MCHA 5AWNH 1C5BL 4MX7A 2FX8H 1D5XB 3F6IA 1BFOA 1EZVY 3L3KA 5IROA 4RAHA 2BDNL 2YOCA 3DROA 3BT2L 2NYYD 4KZEL 3R8BB 4QXUL 5E7FA 4Y8AA 3BW9B 5SX5K 3F7QA 1XGRA 5BW7C 5IIEA 3TO4C 4L3ED 3BWAB 5GSVA 5MEOA 3CH1B 4MA8H 3S34H 5DVOA 1PZ5A 3HE7B 4APQD 5I1JH 4AENA 1P4BL 4ODXB 4ERSH 2FECL 1F4YH 1KCSH 1FYTD 2VDRL 3VI4F 1SM3L 5CEXA 2AEPH 3M45A 3RNQA 1JK8B 2IADA 1E27B 2HVKA 5I18H 3DYMA 3RDTD 5J7CC 3HPJA 2HRLA 4F58H 1QO3A 3AY4A 3OJDB 2EXYC 2E8ZA 2IAMA 3NTCL 5JHDE 1AXTL 2DLEA 1RMFL 2P47B 1R3IL 3MLVL 4MDJB 3IRZA 3LDBB 3CLEL 5D1XC 2BSSA 4YWGH 4J12A 1V8HA 4TUOA 4K3JH 4HS3A 3L3GB 1CDYA 4Y4HC 3U79A 3HNVH 3REVA 1G84A 1VADB 5J1AA 2HFFB 4K3DL 3KPNA 1I9EA 4LLVA 2BNQA 1HDMA 5IB3A 2J8UA 1IJ9A 2E7BA 3QO0A 4ZO7A 1A2YA 4AY0A 3NN8B 4R0LA 1GGCH 1LEKB 1V3KA 3E6HA 5FDWA 3C2SA 4H26A 3T8XA 5B4MD 1I3UA 3HZYA 5EDXA 1WFOA 4DZBB 4P57B 1EXUB 5A2FA 4MJIA 3GSXB 1HE7A 4Z9KB 5I8OL 1EHLH 4RWHA 3PWUB 2A0LC 5EU6E 3U0PB 4QHKJ 1KEGL 3S3SA 4I1NB 4QY8B 1YEKL 3C6LD 3IAQA 4P9ML 1TVHB 1XCTB 1U6AL 4A6YA 4FTVD 2H26A 4G8GA 1MCOL 4XNUH 4PYGA 2E7LA 4ZOCA 4G9FE 4BQBA 4HC1H 4M7KH 1KULA 1NAMA 4EUPA 1SJXA 3DXAA 2Q86B 4NO0B 1YYMH 4HFUL 1MQ8A 1GGTA 1U3HD 3BO8A 4TVPL 2WUBH 3HKFA 3IAGC 2F54A 3KLAB 5ETUA 4GT7A 3VXTA 4DUVA 4APQC 4G6FB 1FG2B 2G75A 4D9QE 4EI5D 1YN7A 3TJEL 5MHSD 5J6HA 2EDKA 2CXGA 3AVEA 2GJ6B 2IBBA 3GMQA 1JP5A 3F7PC 1IC4H 2C4XA 5CHNA 2VDMH 1CQKA 4HH9B 4G6JL 1S5IH 2QSCH 3NPSC 1G7PA 2YWYA 5IHLB 5TPWH 1J8HB 3UJJL 5A2KH 3MCKA 1JYNA 4QXWA 4FQ1H 3MJ8A 5CEZH 1ZT7A 4Y1AE 1P4LB 1OAYH 1QKZL 1BQHG 1YC8A 5IWLA 3NAAH 4RFOL 2ZOKB 4MGXA 2QQNH 4X7TB 3MLSH 1S9VB 5C0CA 5KSUA 4GRWB 1KYOK 3RKPA 2CKBA 4QHLB 2H1PL 4Y4HD 5E99H 1JWSB 4WI9A 3X3GL 3ULUF 2NXYD 2HT4C 4JKKA 1PQZB 4WW2A 1MF2H 3QUYA 4R4FH 4K23H 5F1IA 4C83B 5HXMA 3U48A 3RWEB 4W6WB 3KDMA 1H15B 1IZKA 1I8IA 2OMNA 2PYFA 3KXFA 5D7IE 2HLAB 4EDXA 4HAGA 5EOTA 5T3XE 3BPCB 2W0PA 4CADA 4UT6H 4KHTH 4GJTB 1AP2A 5DJZA 4NNPL 4DOHE 5IFAH 5DXWA 2YUVA 3UC0H 2PTUA 4M5YH 3KXFD 1W0VA 3BP6B 1MWAH 2RR3A 4MCYB 4UZGA 1DP0A 3E6FB 3L3JA 2HVJA 1QPXA 4MHHI 1OCWL 4HGWB 5FECB 4U1JB 1AI1L 5EZOH 3WNMA 3UYRL 4YXLL 3D2UB 5GHWH 3V52H 3VXSB 3VXOB 3B43A 4YXKL 2HJLB 4YDIH 2Y25A 5ACZB 5J11B 3DVGA 1FL3A 2CIKB 5LKNA 1PFCA 3V6OA 5MEPA 5F88B 1QSFB 5F8QC 4X83A 1A47A 5IJVB 3GM0A 2D7NA 3OB0H 4N1HB 2ADIB 4E42B 1FPTH 4WDIB 4AM0A 5CIPB 1QNZH 2UUDH 3UDWA 4F7PB 3KLSA 2QEJA 4JPKL 1HXYB 1V7NL 1ZLUH 2Q6WA 4WNQA 5FYKL 3PL6B 4XGZA 4X6DB 3EJYD 1R5WA 1CGUA 2FZ3A 1RJZB 1T1XB 5DFVD 3QP3A 1D3CA 2ESVD 2PO6C 3G9AB 2AW2A 1UC6A 1ZHKB 1B0GB 3KR3H 4H0GA 1Z5LB 4ZSOB 4NQDA 4NT6B 4ALAH 1Q0YL 3MROB 3RBSA 3ARYA 1FYTE 3ECBB 3NCYS 1MCFA 4JM2C 1F6AA 1TZHB 2AAVA 2R1WB 3JV4B 5E2VL 2YD8A 1ZHBA 2BVQB 1A7BA 4KKCD 4YPGA 3OXRB 3SKJH 2YUZA 1WICA 2ATPB 1Z0NA 1AXIB 4HCRA 3JWOC 5EU6B 3I50H 3QIUA 1X5HA 5L7XL 3H3BC 5HHQA 3U7AA 4EN3C 5DHVA 2HJFA 1OW0C 3MLRL 4HMCA 2CSPA 3HPLB 3TF7C 3LN9A 3QJHB 5DJYB 2ENYA 3MV01 2VR5A 15C8L 3OKOB 1FZMB 1A6AA 2IH1B 3R4DA 4PJXA 2HH0L 4U05A 1KLFA 1OF2B 1OTUD 1F42A 2IPTH 4FQHA 1NGQH 3MNWB 5IB2B 1BZ9B 3MUJA 3DVIA 5I2IB 4XXCA 3ARTA 3KGRA 3QYCA 4PY8J 1BBJB 4G7VH 4PRHA 3U4BL 1BEYL 2Y5TB 1KXVC 3OKLB 3RP1A 2E3VA 1XR8A 4PRPB 1AQDA 5JOPE 5SX5H 1JWUB 1P53A 1RFDL 4LLYB 1Q1JH 4M4PA 4YHZH 4OAWB 3I6GA 2R39A 4YFLI 1OAQH 5DUMH 1NGWB 5SWSA 3RAJL 3FFDA 3GBNH 2N7AA 3D0LB 5HI5C 2VAAA 2BOBA 1CLOH 4JO4L 5LQBH 2X10A 1UJ3C 2D0HA 4JR9L 3Q1SH 1FO0H 1BWMA 3Q0HA 5DFWH 4LLDB 1HSBA 2ZUTA 4DUWA 3NGBB 4KV5E 3V4PH 2VLKD 1JPFB 4LF3B 5ISZB 5KSAD 3HHRB 4JZNA 1WFNA 3MR9A 3RGHA 2VXQL 5MI0B 4WFFE 4G9DA 5JXEA 1HHHB 1MHHA 5H2BB 3RVUC 2G9HA 3OZ9H 5C7XH 2IANE 5DVKA 5KZCB 1N64L 4XNMB 3LB6C 2OR7A 2A2QT 4ONFH 5FUOL 1LP9E 2XTJE 2NW2A 2UZIH 1NMBH 1EGJL 4I0PD 1PX4A 4HDIA 4QRRE 3GBML 4XXDA 4R96B 2BSRA 2J88H 1A4JA 2JJVA 4LK4A 1X5ZA 3D39A 4G9FA 1PBYA 1T89A 5EA0L 1N7ML 3I9GL 1TIUA 5AAWA 5JW5B 2JCCE 4QRUA 3EAKA 3P0YL 4TTGA 1CBVH 1M71A 3CH1A 5IVXE 4F7CB 5FIEA 3HE7A 1LQSR 1F4YL 4JQXA 2R0LH 1KGCE 1H8NA 1NFDE 4ODXA 3X14A 4U1GB 1P4BH 4M61B 1I7RA 3VFMA 3ULVL 1SYSA 3EYFB 3P4OB 4M00A 4LMQI 1JNNH 2BVYA 3N50A 5CBAA 1OWWA 2CLRB 4HXAL 1CI5A 3LQAH 1B6DA 2R0LL 4MA1C 4ZD3L 4ZUUA 5ITFB 3V7MA 3K46A 4PUBL 4V2BA 3BKCL 2GUOA 2CUHA 1KIUA 2HFTA 1D9KA 4MQ7A 3IGAB 4NC1C 1FORH 1EAPA 3UTZA 3DX7A 3MA9L 2OL3A 2GEEA 2XWBA 1BVZA 4BZ1L 2NR6C 4KUZL 4M48H 5C08D 4PBXA 3LH2H 1KIPA 1SBSH 3TBTB 2NQCA 3L7EB 3MBED 1BM3H 3CFEA 1EEYB 1EJ6A 4GQPH 4EI6A 4ONOA 4JFOB 5DD3L 5KVFL 3L9RB 1AHWC 3MV7B 1DEEB 5KN5A 4YDKL 2J8UB 3LHPL 1A1MA 2XRAH 4ODWB 1LO3H 4M7ZC 4MA3A 4TSAL 3L5XL 1WWWX 2XY1A 5C0AB 2DLHA 3FQWB 1RZKL 1YQVH 2YPLA 3UO1H 3G5YB 1OTSD 3CX5J 1AGDA 1CF8H 3VGFA 5DSCB 5KSVB 4R26H 4K94C 2GIYA 5TDOB 3O11B 3S88H 3C6SB 2NY3C 3BD3A 1ZT4A 3EFDH 3QFJD 3AS0A 2PO6A 4JZOB 1E28A 1MUJA 2NY4C 1JRHH 2Z92A 4XHJC 1I85C 1IC1A 3LKRA 4XBGB 2H26B 1UM5H 2OMBA 4Q9RL 3PQYE 4PRIA 2X1WL 3MV9A 4D8PA 5I1DB 2XWJB 4IRSD 1CE6B 5CKGA 3V8OA 3LAFA 3O8XB 1WZ1L 3LS5H 3CLEH 3DMMB 3MYJB 2VLKA 4MHHG 4TVPH 3MRHA 2IQ9L 3KG5A 3RWDB 4AG4L 3VXTB 3MLSL 2DM4A 1K4CA 3PJSB 4BZ2H 3BRGC 1U91A 3RTQB 1NFIA 4K8RL 2MNUA 4MVBD 5DRNA 2EH8H 4I18A 4LQFH 1UZ6E 1T4KB 2F53E 3F7RA 1WIPA 5FO9A 4U4BA 4HH9A 1U36A 4IDLA 1G7PB 4TRPL 1J8HA 4RIRB 1S5IL 2QSCL 3WKMH 3F5WA 1GAFL 3ZKND 5ID0A 2XTJC 4G43B 4WGWB 3NIDF 3MXWH 4F3FB 4V2CB 1CZ8H 3FB8A 5HTSA 3H9SE 1IAMA 4ODVH 4PJ7B 2EE6A 4NWTL 1HHJA 3VD4A 1BOGA 1EO8H 3UPCA 1NQBA 4PRHD 4F7MB 4OZIF 1L0YA 2C3HA 5E56A 1DBKH 4S2SB 1MFEL 4I9WD 2WWKT 2ZUUA 3T4AB 4KZDL 2NX5D 3TYGL 4YHYB 3O3BA 3W5NA 3JV0A 4L3EE 3O3EA 4Z7VF 1OSZB 2RHEA 2Z31A 5I75C 1H15A 1I8IB 3KDMB 4HKBB 2HLAA 4OF8A 4X9GA 3O2DH 4ZOBA 4XCCH 1K3IA 4PJIB 5HJ3B 2YC1B 2GT9B 5ERWA 1ACYL 2MKWA 3SQBA 2HRPL 5CJ5A 4PJXE 4MDIB 4OLWL 2C4FU 1LEIA 3NCCB 2OXHA 2Y1VA 5EC2B 5HYSA 5IK3A 3UDWC 5FK9A 1UXWB 2VXSH 4U1JA 1Z0MA 1MELA 4G6KH 3VXSA 3OJVC 3I3EA 1WWCA 2ICWJ 4FFYL 5GJTH 3H42L 5LBSH 4ZMAT 1CD1A 1KCLA 3L3IA 5GGUB 2V17L 4MA7L 2P7TB 5HI3C 5A16A 3IAPA 5JQ6H 4ETQA 1BLNB 4BUGA 3BPNB 4EVNB 4F7PA 3E3QE 1FRGH 4TQEH 4DKFH 1HWHB 4I77H 1Q72H 4L4TE 1DN0A 1T1ZA 4CBPA 1NJ9B 5TE7H 3H9HA 5DMIL 3HZVB 3R1GL 4F15C 1O7SA 2WBKA 4N9OB 2HKFL 4JVUA 3N1GC 4ZTOL 3MRLB 1IBGH 3RKDC 3TA3A 3OQ3B 3KPTA 3FMGL 4G6FD 3FB6B 4ZFOL 3THML 5I18L 3MLXH 1Z5LA 4V1DB 4ZSOA 5I71B 4NQDB 1MCPL 5E4EB 5ENWA 4XP9H 2M2DA 4YQXL 2DD8L 4FTVE 4U1KB 4MB5A 3RUGB 2NTSP 3UTPD 1A7PH 1IARB 5BOPA 2IGFL 3SKUD 1VCAA 4TTDC 1KB9K 2D7TH 1MAML 2JJTA 4P4KA 4XVJL 1XF4B 5IB4B 5IMLA 4IJ3C 3FT2A 4CVXA 3QXUA 4DW2H 5IQ7L 2WBJD 3QIUB 4TOYH 2P5WE 3T3MF 4MS8D 4HJGA 1X5KA 3SOBH 4N0UE 5L0QC 1JL8A 4DTGH 1GXEA 4DAGH 5GRWA 2CDEA 4Z7QF 3SGJA 2QADD 3VJ6B 4JFEE 1GGCL 3MRPB 3VXNB 3OKOA 5E08L 1FZMA 4YE4H 1KLGA 2W1NA 4PJXB 1IGYA 1I7UB 4MAYB 1FFNA 2J4WH 1QSFD 5BQ7A 3S5LG 3UXFA 4JN1H 3S37L 1RJLB 3MFFB 5EUOA 5DMYA 2FO1A 2EKSA 5BZDB 2IMMA 1W72H 2FLBT 1MI5D 1XGTB 3DV6A 4QRPA 4GAGL 2XICA 5E6IB 1S7XB 4FZ8L 1PSKL 1E4XL 3G5XB 5TDNB 1ZK9A 3EJZD 4HJJL 4OLUH 1A02N 3WFCL 1TJIL 2KQMA 1A64A 3VXSD 4ODTH 3L1OH 3MX0A 4OLUL 2HLFD 4JFZH 5DUBA 5ALBL 4M6OL 1T5WA 2FJGB 4Q6IB 3E2HB 3M8OL 5I1CL 3F12A 2IEPA 4AQ1B 2WNGA 1J5OL 1TETH 1NCAL 3F6LA 3DO7A 1XIWD 5KAQF 1MLBB 4LIQH 4DGYH 3RU8L 2AJUH 3C8KA 3D69A 3NPSB 3VWKA 4M93C 3NIGF 3U36A 3AU1B 4JM4H 1BJ1J 5CFHA 1ODAA 4PG2A 1ZVSB 1J1OH 3IETA 5AZ2H 3UTTB 4H8WC 4I13B 2VXQH 5FM5O 2NX5A 4YGVA 3T3PF 1NAML 1KB5H 3FO1A 1KLUB 1EPFA 1BX2A 1JV5B 1JZ7A 43C9B 5K9KB 4S1QH 4WI8A 4U2ZA 5JW4Q 4U0RC 2FWOA 5DJ6B 5E9DE 3W82A 2H3NB 4D9RD 4WWKD 4QOKB 3DUHA 4XMKH 4OF5A 5JA8B 4NKDB 3ZLQC 2G5RA 4XVUC 2YN5A 3TBVB 2HFGL 5IUSA 3FT3A 4JFXB 4RAUB 3OR7B 3D39B 4WO4B 5C0GA 5DEZA 1XGUB 5J13C 2L7UA 1M6OB 3D5OF 3SJVB 2V2XB 4QRUB 4P99A 4Z95L 2AP2A 3RWFA 3OKEA 2PN5A 2XQYG 3MODL 3TPUA 2PNDA 4NFDA 5AYQA 2P42B 5K9JL 4F37K 4M61A 1J0ZA 1NDGB 1NUNB 1KPRA 3SDAD 2VNCA 2HAZA 5CBAB 2GSGB 3FO2B 1TPXC 3CXDL 2XNAA 3CFKB 3LN5A 5HI4D 5LCVL 1S7QA 1D9KB 1D5XA 4MQ7B 5DI8B 2VZ1A 3KPPB 3L3KB 5D70L 5FYKE 1BJMA 3QAZC 12E8L 2VXTH 3QDHA 1K85A 1J87A 5HDOA 3TNMA 4X0KB 4ZS7L 2ZG3A 1EVUA 4N0YH 1LNUA 3SDDB 3BN9D 4R90H 4NC0B 1CLYH 3OMZA 4FFYH 4QXGL 4WTZG 3STLB 3P11H 4EI6B 4ERSL 4BH7A 2H32H 4NZRL 4MA7H 4XNYL 4LSQH 3RL2B 1WBZB 5FUZH 5I8OH 1DEEA 4L3EA 1JK8A 3JWNC 1U41A 4GS7B 2KKQA 2HMIC 4RWYL 3HPJB 2EDTA 4WO4D 2G2RB 4AEHH 3DYOA 2MMXA 3MLZH 2RJMA 4IRSC 3BP7A 3ARBD 4OLXH 5MP6H 4I3SL 4MJ4A 5DSCA 3TIDB 1DLFH 3BESR 3MBEA 1IQWL 3GI8L 3ZE2F 3L3OB 3F58L 3UBXA 3DYPA 2YA1A 4JZOA 2YN3A 4K3JL 4WFED 3GKZA 2LVCA 3MRGA 1VADA 5J1AB 2HFFA 5E8EB 5BVJA 3BSZL 4PRIB 4OSUH 4PB0H 2CK2A 4UINH 4BJLA 2X09A 4IS6A 5FUCE 4EN3B 1RIVH 5F7NC 5EWIH 1MAMH 1GOHA 4R3SB 2R56H 3IDUA 4ZG1A 3MRHB 5ADPL 4Z7UF 1JHTB 1B3JA 1HEZB 5DGQA 2GAZA 4DQOL 1MOEA 4R9HA 1EXUA 1IAIH 3EGSA 4WFGD 5C0RH 1P1ZB 1I7TA 3W0WA 5A2IH 1NFIB 1XGYH 1YY9C 3EOTL 2N1KA