3GHEL

Crystal structure of anti-hiv-1 fab 537-10d in complex with v3 peptide mn
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
214
Chain Sequence
QSALTQPASVSGSPGQSITISCTGTSTDVNGYNYVSWYQQYAGKAPKLIIFDVSKRPSGVSNRFSGSKSGDTASLTISGLQAEDEADYHCSSYTSSTPYVLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the cross-reactivity of genetically related human anti-HIV-1 mAbs: implications for design of V3-based immunogens
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab 537-10D, light chain
total genus 43
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheL02
4P2YA 3RRQA 2QR0B 1HZHL 3IXTA 4U1SB 4XPHH 3ARSA 5JOFB 2BXYA 4HFWA 4NJAL 5EBLB 2PR4H 2L0DA 4Y2DA 4P49A 1CE6A 3ZMRA 3IGAB 2AK4B 3BQUB 2AJUL 2QADC 3BZ4B 1KJ2L 3QFJB 4MS8C 4L5FL 4NDMA 3C6LB 3EJYD 3MOQA 2CDEB 4ZXBD 5DHVA 3C8KA 5FECB 1F90H 3DYOA 3MRJB 3VWKB 4EXKA 5MEPB 4KTDH 4YXHL 2HFGH 5D96B 5GGSA 4OI9A 2VLJD 3C08H 4UTAL 4LP5A 4NZJA 5D1XA 4U7SA 2I9LA 2IPUK 3QRFM 1J12A 4ELMB 1A6AB 2UYLB 1MWAB 3H9SD 3OKKA 4APQC 3NZ8B 4XPBL 4F80A 4H25B 4HIJB 1X44A 3MRNA 4PRHE 3G6JF 5C08D 1PDKA 5KS9B 2O5ZL 1A3RL 4OI7A 1NDMA 3TA3D 1GH7A 4LASH 4JAMB 3U7AA 4L3AA 4ETQA 5JIKA 3ARDA 1UWXH 3OKMA 1XGRB 3CFEA 4K8RL 1JNLH 1CDCA 1CLZH 5SV3A 1A1NA 3GSRB 1K2DA 3P4LA 1U2CA 2APBA 1H5BA 4R4FL 1I85A 4WTXA 4OGXH 2GJ6D 4P9HL 3KYAA 2D03H 2HFTA 4DK3A 3BKCH 3W11D 1MVFA 5ALCH 4GMTH 3CFJB 2XN9E 4PJ8D 4XVJL 2PO6C 4QRUB 2MPAH 4WVRA 4AQ1B 4FQCL 5FUZH 4F7TA 3G6JE 4WU7B 2B7DT 3WUZA 3MFFA 1M6OB 1AGBA 1FJ1A 3UZEA 2V7HB 4IMLA 4QXUH 1G6RH 4UBDD 5JDJA 4K3JL 4L3EA 3GMNA 3FFDA 4KDVA 2F53D 1AR2A 2UZIL 4LPYA 5J8OA 2EDJA 5SX5K 5TE6L 4M61B 4G43B 2FYYB 1HCVA 2YEZB 1YNKH 2X41A 3RVXD 3MJGX 3ES6B 1AE6H 3UZVB 1KCVL 1FE8L 3ET9F 4F2MA 3ELAT 5C0BE 3FCTA 3QUXA 1SY6A 4XRCA 5D7KE 4XH2B 1NEZG 4NC1E 2FR4A 3L3GA 4YE4H 3MLZL 2ZUXA 3RP1A 3LS5L 4DZBB 4PB9H 2Z91B 3V8CA 4GMTL 1VADB 4PG9B 3KJ6H 5CBAA 3LKQB 2WINA 3ZDXF 5EZOL 4PLOB 3UROR 3DXAA 1SYSB 1YJDC 5JXED 4QXTB 1NCUA 3P40A 4IOIB 1XGYH 2GK0B 3FB6A 3QT2A 1OAXL 4DFHA 3BXNA 3V6FA 1F4AA 5E6IC 1PJ9A 1OCWH 2BVEA 4M93B 2FDBP 1T1XA 4ZOBA 4QRRA 4Z7NF 3ULVC 1UG9A 5F96H 2NW2B 4FFWC 4EDXA 5J11B 3QI9D 3G04B 5FIEA 3OXRB 2KZ1B 3F5WA 1G7HA 5DJ8B 7FABL 5D9SA 3O2VL 4KMTH 4MA7H 1ZA3B 4JFEA 3QAZC 3RNKB 5E9DA 2D7TL 5JDSB 3FFCD 3ULSB 4YHKL 3ARBC 2FBJH 3MGTB 3MROB 5ANME 3PHOA 1PKQA 4Z7WA 4X83A 5DZNA 1FCGA 4PJXB 3CFIC 3BT2H 1D5BA 2QSCH 3KPRE 15C8L 4PJ8A 3RWCB 3UTPD 4CNIA 1IFHH 4Z7NE 1A02N 3B9KC 1U8NB 2X1PA 1BD2D 1JK8B 1ZKAA 3M1BB 5C9JA 3QEHB 4Y19B 3QBTB 1YPZB 4DTGH 3VCLA 4Y2OA 4PJCA 1D6VL 4JHBA 2VZVA 4HCRL 1XMWA 4W4OC 3EO9L 1A4KB 4OFYD 1SEQH 4Q9RH 5T1LA 4J3XA 5LWYH 3OR7B 1YJDH 4AK1A 4C56B 2FHBA 1JZ6A 3EIFA 3IJYB 2BRQA 3WFDH 5D72H 4UNVA 2ENYA 3MRQB 1HQRA 2X89D 5IV2B 3S96A 1IAOB 1PX3A 1PAMA 5FYKH 4KWUA 3QDAA 1PLGH 4Z0XA 4NQED 1DQQA 1UT9A 2GQHA 4Y4KD 2R4SH 1DN2A 1KEGL 4EQ2A 4PREB 4QOKB 2YRLA 5DD5H 5INDB 2EIEA 4HWBH 1TFHA 1N2RB 1MEXL 1A6TA 3AM8A 4PJGA 5ITFB 3N50A 4G8FA 2W9DL 1TENA 2A6IA 4J3UA 1P7QD 2JJUA 5D5MA 3UX9B 1BEYL 1OAQH 2EEDA 1PQZB 1WZKA 3HNSH 1OP5H 3VMNA 1TLKA 2WP3O 1QSFB 4MA3B 4YWGL 1IC7L 4LGPB 4U0QB 1INQB 5B3JF 1MCEA 4PTTB 4N0RA 1INEH 1Z9LA 4OD3H 4P2OB 4G8FB 1BEYH 3HI1B 2ZPKL 2WWKO 5H2BB 4XBEH 32C2B 2IANA 3QIBA 1F3RB 1H3VA 1LEGB 3B4NA 3VFOB 4KK9D 1OSPH 2W38A 3WO4B 5DMGD 2EKJA 3LN9A 3RX7A 4D9LL 1RUMH 1OTUC 2FL5B 2ICEB 1NEZA 3MRKA 5EO1A 1FZJB 4G6ML 3QFJE 1A0QH 4WUUA 4PJFA 5EU3A 4OCMC 3GI8H 4OB5H 1EZVX 1U3HA 2ESVD 3QDME 3UAJD 1BJMA 1YPZF 4HFUH 4HGWA 3HR6A 4UTBL 4LVNB 5GISL 3D39B 1FSKC 3HC0A 4KK6D 4N0FB 3KPOA 5T1DL 1ZA6A 3WIIH 5SWSE 4EI5D 3GGWB 1BP3B 4J6RH 3T3MF 3TJEH 4J4PD 1QRKA 4Y1AB 4X8XA 1YMHB 2FL5A 2J4WL 4OTXH 3S36X 4KKBC 1UQSA 12E8H 1HSAA 4ISVB 2GT9A 1GPOL 3GI9H 3V0WH 2BVUA 3IETB 4GS7B 3TPUB 1F6AB 1CXEA 1FFQA 1LP9A 4J6RL 3TJEL 1D9KC 1H3PL 1IGTB 3PWVA 2DQUL 5AYUL 3O3EA 1G6RB 1C1EH 2D7PA 5KN5B 5GHWH 2Z31B 3GIVB 4FFZH 4OM1L 1CVSC 3ALXA 3D3VA 3VFRB 1WZ1L 1P1ZA 2IPKB 4NM8H 4RQQB 1MJUH 4G6KH 1R24B 4NN5C 1IGYA 4MX7A 3HAEA 1KEMH 1MVUB 1JGVL 3F5WB 1IGTA 4IDLA 5HHOE 4XPTH 3VXQA 1M1SA 5GGVH 4HJJL 1G6RA 1L7TL 1H0DA 1MFDL 2FSEB 4FFZL 4N5EC 3CCHA 4LPCA 4G3YH 3JTSA 3SKMA 3WIIL 2UYLA 5DC0A 3LMJH 2VE6B 5I8CB 2EICA 3N9GH 5EB9A 4JM2D 3TYFB 2VXSH 1CU4H 5J12C 4AIOA 3LRSB 4XPAH 4P2QB 3BO8B 3ABZA 3CXDH 2ENSA 5E8DH 4WO4A 4U3HA 3MBXL 4XGZB 4HWZB 3V6OC 4GG8B 1UWEH 4GBXD 3VCLB 3PV6B 4IRSA 1RZ7H 4CN6A 4KKCD 4M02A 3E6FB 3LEYL 1R5VB 4TVPH 1CBVH 1DQLH 3VDAA 4DZBA 1X5AA 3MACL 1L9NA 5CJXC 5DVLA 4ACPA 4XCFL 4ZTOH 1U8OA 1N3NA 2ED9A 5D96C 4IRZL 3CFJA 4DAGL 4ZPVA 3MRQA 4BH8A 4GG8A 3R06A 3LPFA 5DRXB 4IRJB 3IF1A 3O4OC 3DX6A 3TN0C 4Y4FD 5C92A 1AGCA 1CE1H 3EO9H 3FO2B 1FN4A 5I74B 3JWNC 1C8PA 1ZHNB 3BQUC 1T1XB 1CS6A 1HXYB 1G7QB 1Q1JL 2BNRA 4ODVH 3L95B 4GAGH 2E9IA 5B8CC 1P6FA 1N2RA 1ZGLM 3RTQA 2AKRA 3FQXB 5B8CA 1FL6B 1HI6A 1MCKA 4HUVA 3GSUB 2XN9B 1OAKH 2GTWB 4K9EC 4ONHA 4L4VB 5C6WH 3K8MA 3RAJL 4LQ1A 3U1SL 3I2CL 3B3IB 3NFNA 1C08B 5GSRB 1H3XA 4F15B 1X5ZA 3L5XH 1Y0LA 5F6HJ 3TH3T 3ARUA 1HQ4B 3HAEG 4FQJL 1CXLA 4ODHL 1G7PB 1QRND 1TQBC 3MV8D 3MV7E 4PJ5D 4ONHB 4B50A 5GRVL 1AP2A 1FAIH 3OXSA 3MA7B 1CR9H 2V9RA 8FABB 2OMBA 1KB5B 5EU4B 1MCNA 3W9EA 4HS8H 3K8LA 1F4HA 1A6ZB 5DJCA 4LCUA 3IS1X 3M1BA 2HFEB 4WEUD 1I7TA 1ZGLB 3CNKA 2NXZD 4MSWA 3MLXH 1QVOB 1PZ5A 3D39A 4J3SA 3U9UB 1UKTA 3IT8D 4AZ8A 2IG2L 4JR9L 5FYJE 8FABA 4U1GB 1WBZB 1GZPA 4GW5A 4PRHD 3DRTB 4GXVL 4YPGB 4HC1A 5ACLA 3ILPB 1EFXD 1NQBA 1OAYL 3DUUB 3L6FA 1BM3L 4HK3N 4X99A 2GSGA 2GY5A 3B9KD 4G8IA 1YEHL 5JPMB 1JGDA 5J4MA 4YXLH 5EZJA 5CSBA 1A2YB 4IOFC 4DKDC 3QJHA 5C7XH 1TCRB 4YE4L 5DK3A 3ULSA 3VXPA 2V9TA 1YC7A 1KNOB 4FXLA 1NCTA 2DJSA 4MNQD 2NMSA 3V7AG 4WCYH 5J56B 3QQNA 2FCBA 3BRFA 4IOSD 1PY9A 3TBWB 3TGXA 3H7LA 4PJFE 3WV0A 2DQDH 3UMTA 4XNQB 4NZRL 4LPXA 5CAYB 1AGFA 5CLTA 2AJXH 5I1KL 4UDTB 3BJ91 3TM6A 2GEEA 2RIKA 5A2FA 1FNLA 2IFFL 3U7WH 2PXYD 5E2WH 4G80A 5DQ9B 1QQDB 3ULVD 1SBBA 2A74B 5HYQA 2Y36H 4YH6A 4G6AD 4I48A 2Z31D 2Z91A 5DK0B 5JIHA 3FONA 3PGDB 1DBJH 5FOBA 2APFA 3VRJB 1X5LA 1BD2E 2H3NB 4S1SL 5E6ID 3NIFE 1S9WA 5L8LB 3I6KB 1JTPA 1MFBH 2I60H 4L8CB 1FZJA 1OD7A 3ULUL 3EYSH 1FSKB 4PJCE 2F54A 2R2HB 1IL1A 3EFDL 4MHHG 4PRBA 1EJOH 4LHJB 5FK9A 4U1HA 3H9HA 4S1SH 1D5IL 5C08B 2G75A 1RFDL 3KDMB 3GSWB 5DRZA 4S1DC 2HMIC 3IS0X 4IDJL 2GI7A 5JPNB 2UWEA 5HYSB 1YEDB 5IHLB 4G42A 1FP5A 1TJHL 5IMKA 4KKAC 3QFJA 2ZKHH 4N0YH 4L9LA 4OCXL 1JGUH 5KJRH 1BD2B 5EDXA 4P2OC 2F8VA 3IFOB 1KCRH 1E4WH 4J3OC 5DD3L 3MUGB 4X4ME 5HHXH 2AK1L 3I3EA 3NIFF 4P57A 3FQUA 4N5UA 4EUPB 5FCSH 1W72H 4PTUA 1BJ1J 4QYOA 5HHOA 3UDWA 4YHNB 1F90L 3PXJA 4ZOEA 1KIQA 3WS3A 1UVQA 4GSDH 5I74C 3WN5C 4ODTL 4CDHA 4LHUA 2WBKA 3TH4T 4GKSA 4MXQD 4HF5H 4F3FA 4ALAL 2I26N 4B0MM 4D9QE 4WRLA 1KJ3H 3NOIA 4TNVF 3TO4D 1RHHB 3TT1L 1OTSC 1T21A 1LD9A 3OKMB 4G9DA 3IDYB 3D3VE 4X6CE 3TJHD 5F7NC 2NY0C 1R5WB 2YD7A 3O2VH 2BSRB 3NABH 2F5BH 3AS3A 1F8TL 1FIGL 3DNKA 4HKXB 1FZKA 2I9LB 1ETZA 1C5CH 1IGMH 2PYED 2NY1C 4HIJA 1IC5L 1K4DA 4QRUA 3RJQB 5D1XC 3VXME 3OGOE 1YEEL 3BGMB 3UTOA 1X5HA 1FZMA 5JA9A 4LEOA 1GZPB 4GW5B 2WAHA 4HKXA 2YHGA 2R56L 5C0BB 1JZ3A 2YUZA 5E99L 4X98A 2XKSA 2V2WA 4UUJA 3NFPB 4L8BA 4XT1C 3FB8A 1M4KA 3VH8G 5JXEC 3BDXA 1ZS8A 3FHAA 1UZ6E 5J3HD 5EU7E 3ULUC 3HCVA 5F7YC 4NYLB 2FX9H 3U4EB 5FO9A 4PV9B 2GKIA 1HXYA 2IAMD 1T2QH 2N56A 1NUNB 5F7DB 4LQFH 5M7QA 5AUMB 5T1KB 3EYQC 3DI2B 4BSWA 1S7XA 5ESVA 5B22A 1PY4A 3ALPA 1OLZA 3RNQB 2P5WD 3GJFH 2NY0B 4NFCA 3UTQA 2IWGA 2YD8A 2H32H 5I1HH 2OZ4H 2FZ3A 3FO9B 3ZDZF 4UTAH 3D18A 2DTMH 5EORH 3A6CL 1S3KH 3WIHL 4ZUWA 1CF8L 4IRZH 3E6FA 1L4IA 4JZJC 2FGWL 1ONQA 2A73A 4MNQB 3UBXB 4FN0A 4JVPA 1NGYA 1S7VA 3E8UH 1OW0C 1EVUA 1OT2A 2GJJA 5F1SA 5K59E 1TJIL 4KTEL 2H45A 1K3IA 2LAAA 1A7PH 4JY6B 4LSSH 3U0TB 4EOWL 3VFSA 3O6FA 4L8CA 4XPTL 5DDHB 4OD3L 4X5XB 3ILQC 3VGDA 5DRNB 4XCYB 5IB5A 5GS2D 3Q6GH 4L8SC 4X9HA 3HNTL 3OAUH 4P59L 3CH8A 1U91A 5FGCE 3WXWL 4NPYA 4Z8FL 2MSPA 3N9GL 5JDSA 1ES0B 3DO3A 4I0PC 1LEKA 4AIXA 1FO0B 1R24A 4PJIA 3QFDB 5JNYB 3W81A 1U36A 4PGCB 1RUPH 3JSSA 4LIQL 4RGOH 5I16B 1TZIB 3ARPA 4JQIL 5TQ0H 1Q0YL 4TVPE 3HTLX 3RU8H 1TIUA 2P5EE 4ODVL 2AJYH 2BCKB 1ZLUH 1QEWA 4OTXL 1S9YB 2C9AA 2DKMA 1W0VB 5BW7A 5IB4A 4Z7QE 5J1TC 1YMMA 4XXDB 4M5YH 5F3HA 3JWOH 1VEPA 1P5VA 1X6NA 1CZ8L 1GAFH 1LE5A 2C7UB 4CW1B 1GHFH 4Y5VC 2DD8L 2O5XH 3KYKL 4QF1B 5IEHA 3DARA 1WJ3A 3MYZA 4FTVA 2HT2D 2NYYC 4YQXH 3GB7A 1HYRC 3D25A 1MI5D 1J10A 1JWSA 2DICA 2Y07L 4MNGB 1FAIL 1XR9B 1D6EB 2ZUVA 2GTZA 4P2RA 1WQVT 1BVLB 1FL5B 2UUDK 1NEUA 2XN9D 4NC1C 1R3LA 3QB7C 4OLWH 4JKWA 3L5WA 2P24A 3KYMA 3IU4H 3O8XC 2AI0L 2AJYL 1M71B 2BNUB 3RHWF 3U9PL 2QQQA 2WBWB 1U8HB 35C8H 1ROWA 1CG9B 5IVXF 3SQOH 4WTWA 4PJHB 2WBJC 5CP7A 2BJMH 4TNWK 5T1DH 4AIZA 1SMAA 5FGBA 1IAKB 2R2BB 4HPYH 1B6DA 2C1PA 5KSAD 1KG0A 1JMXA 5INCB 4MA8H 5FAAA 3WNNA 2VL4A 2X10A 4HBCH 1F4YH 1MI5E 1Y6NR 3DMMC 4QOKA 2C4FU 1JNJA 3KYOB 5DD1L 3H6JA 1UM5H 1WFOA 4C4KO 1IJ9A 5HHPA 5JHLH 3H3BC 1JF1A 3L1OL 1DBAH 4MNHB 4JZNB 5GS3A 2XXCB 4K7FB 5EZLB 4NKQB 1WVZA 3P9LB 1NANH 2W60B 1I9RH 2XZCL 1FFNA 1U93A 1N5AA 2OLDA 2X44D 4M3KB 1FORL 3PP3H 3RWFA 3T0AA 3VFUB 5CEZE 1VFBA 4M6MH 3LCYA 5LGHH 3RVVC 3VXTA 4Q6YA 4U4BA 3DUSA 3L1OH 3RIFF 5C0ND 3O4OB 4D0BA 4X6CA 3D0LB 4OLEA 4K7PY 2B2XL 4MNHA 3HR5A 1LHZA 1TVDA 3MRPB 2ICCA 1RZGB 4PJXE 3OTTA 4ZSOB 4LMQI 3MV9D 4ORGB 4PY8I 3THML 2DWDA 2VDLL 3T3PE 4JFQB 3KNBA 3N85L 1T5WB 5F7KC 4Y16A 4ZO6A 1JGLH 4XP1H 1UM4H 3DUUA 3O6FB 2XOTA 3MRPA 4TUOB 4JKMA 4LLQA 3GHEL 3BPLC 1W2KT 2VH5L 3MJ8B 4L4TD 2PXYB 3INUH 3WN5B 2R39A 3BP5B 5IW1A 1YECH 3E8UL 5DR5L 1I4FA 3U46A 4KK5D 3B2VH 3B6SA 5C09D 5L0QC 1KPUB 2FEDC 2AXGB 3FOMA 3WFCH 1ZTXL 4JREB 2LU3A 1UVQB 4IRJD 1X5JA 5EU6D 5I1DA 3EDDA 1XGYL 3T0WA 5IVXB 4F3FB 5GGSY 2ICWJ 1MCOL 4Z7OE 5JORB 4R3SA 1UH2A 1VSCA 3G5XB 5E5MA 4X6BB 1MQKL 5EC1A 2XFXB 5HI5D 2EDRA 2DTSA 2ARJQ 1QSZA 3LHPL 1PG7H 3FT4B 5KVDH 1NC4A 5JR1H 4I4WB 2P43B 3BH8A 3O41A 3GMNB 2ADIB 4UB0H 1E4XH 1GGBH 1YNTA 3ARWA 4ZMAT 1JGEA 1RJLA 1KIPB 1OM3L 3EZ8A 3JWOL 5FFLA 4TOYL 1QSFD 4UBDC 3QZWG 3PJSA 1WFNA 5JHDA 4A2LA 5A1AA 3D85B 3BHBB 5IESL 2EH8H 3ARZA 3NIGF 5I8EB 2G9HA 2IBZX 3U48A 1XGRA 4P2OD 2WV3A 4HK0A 1IM3A 2H2SC 5T1MB 4RAVA 3SDYL 5IT2L 3SPVA 3TT1H 3GSNL 4FQ2L 4DZ8B 4CVZB 2H2PD 4K3HA 3QUMA 4Y5XA 2VSCA 1TTGA 3HG1E 4Q6IB 3SE3A 2HLAB 2G75B 3OKEB 1RUAL 3QRGH 5L88L 3KLHC 3BD4A 1G9MH 1QSEA 1D6EA 4XC1L 1RULH 4YHZL 5KVFH 3U36A 3PQYD 4BKLA 4GSDL 4KJPC 4B7LA 5FGSA 2QQKH 3PG2A 3GJEB 3MRHB 3I3BA 4P9MH 1PG7W 2H2PC 4F7TB 3PDGA 3RL1A 1YDPB 3VWJC 1H3PH 1M7DA 1H9VA 1CL7L 1QACA 4TQEH 3PWNA 4GLRI 5D1ZB 4L4VA 1ERNA 5SWSB 1RURL 2GK2A 3MRLB 1DQTA 3I75B 2Y72A 4WWID 1U3JA 5C07B 5DFVC 2VR5A 3T77B 1AGCB 5AZEL 3H2WA 3VD5A 4Z7VA 3RDTC 5I8OL 1I3VA 1CFTB 3KPLB 2QBWA 4PRPE 5FYKL 4NNXB 1QLFA 5HI5C 1I8LA 2ESVE 1KELH 5D2NB 5CJBA 4Z8FH 5CJXA 3VRIA 4MQTB 2VABB 5HI3C 1MCOH 4HLZH 4WI3A 1L7IL 2NY6D 1PKQB 4MA7L 3HNVL 3C5ZB 5E94A 3GBMH 4OCSL 2R0KL 3V6ZB 3S35X 4D0DA 3RWEB 3SCMA 1J8HB 4QHLB 5IHUH 3RI5K 3QDJE 3PDOA 5ANMB 1FZKB 4ELME 1KN4H 2L7UA 3C6SB 3ULUD 4MXQC 4HUKB 3LS4H 4JM2F 4OBRA 3BISA 2ATPA 1ZVSB 2R0ZH 4X99B 4TVSa 1OF2A 4NKMA 3VU2A 1BZ9B 2EIBA 2I27N 2I9TB 2HVKB 2IBGA 2QLVB 3VXUD 1XR8A 3O6MH 1NBZB 2CK0L 4PJDE 1FNGB 3WHXB 3UPAA 1NMBL 4G8GE 4JCLA 5E1AB 4MJ5A 5GRYA 1KFAH 2XA8H 2D9CA 2BSED 1A6UH 3LKNB 3EKCA 4PRID 3K80A 1Y6MR 5FA4A 1AGBB 1FJ1B 5GJSL 4TSAL 5LAXA 1CDIA 1ZT7A 3X14B 4JM2A 2GJZB 4GAYA 4U1MB 5IGXL 4I8DA 5FUZL 1G0DA 3D2UD 2IPTL 5CS7A 4YX2H 1S7QA 4LLWB 3MFGB 1HKFA 3X11A 1WAAA 2FECI 2XI9A 5FA4B 4ZS7L 1QKZH 3TYGH 5ALBH 1DUZA 3U0WL 4Y4HA 5EC1B 2W1NA 1NJ9B 3FQWB 4LBEB 3DWTA 3GJFK 4PGDA 5IF0B 4IS6A 4YX2L 1INDH 3NIDE 3O6ML 1CT8A 1QBLL 4I0PB 4MAYB 4X4ZA 2DLGA 2D3VA 4KK8D 3WKMH 3ARGC 2OZ4A 4JG1H 5HGGS 1DBKH 3HE7C 3F7VA 1CDYA 5C0RL 2ARWA 2BVPA 4FQHA 4YFLF 3IKKA 1CR9L 5TPWL 3WXVH 1YEJH 1FFNB 3MLZH 1MLBB 3FB5B 4Y4FA 5IT2H 3GBML 1JZ4A 4LAQL 3CPLA 2C1OB 4LCWA 1M05B 1T83A 3LN5B 3P9WB 5IHUL 2O26U 4MJID 3NACL 5BZDA 4P3DB 1IAIL 3X13A 5C0CD 4A6YB 2NR6C 4MJ2A 4UOW1 4X6DA 4F37F 3SGDI 4AIZB 4P5MB 4FQIL 1RJZA 2GT9B 4XNZB 3WCYA 2I25N 3L7EA 4GKZA 4XCNA 4ODSH 3EOTH 4KROC 3MOAH 5SWZD 4WUUD 1G7HB 1MCHA 5DJ8A 2IMMA 1MNUL 1SYVB 4AEEA 4LVEA 4QT5B 1JUFA 4NQEA 4ZO7A 4ESKA 1A14H 4X9GA 1OAZH 4R7DB 3WE6A 4OGZA 2LQRA 4PB0H 3FL7A 5B38G 4EI5A 5HGDB 3BIAX 4MDIB 4JFYA 2VNCA 4GXUN 3GO1L 5FKPB 5GGRY 5CHNB 1CGSL 1GGIH 4S1RH 4XAKE 3BAEH 1F45A 1HH6B 5EIIB 5BRZB 3VWJB 1DQDL 4G7VH 4ZO9A 2BC4B 5L2KB 4YDVA 3S34L 3BEWB 4ZSOE 2AQ3A 2H1PL 4OZFA 2ID5A 1JTTA 1H0DB 3G5XA 3QEQE 5C0NC 1UGNA 1I7UA 4XHJD 4Y5YA 3RZCA 1U8LB 1A6WL 3UCRA 3QA3A 4GOSA 2ZSWB 4O02L 1NAKH 4FFYH 4NIKB 1FYTA 3DECA 3KXFD 3V6OA 3PNWB 1SY6H 1TVHB 5HYIA 4LSDA 5C2UB 4Z76B 3DTXB 1J0JA 3U7YH 2G2RA 2P5WB 3AY4A 5DFWH 5AG9A 4QRRE 4KKCC 4B53A 1T83C 1N26A 2Y7QB 3G08B 1QBBA 5MEQA 4X98B 4OCLC 4I1NB 3ZSTA 1MHHB 4L1DA 1WCQA 3CXHK 4YO0B 4OB5L 1IILE 2YK1H 3N1FC 4LVOC 1OF2B 2BDNL 4WW1B 3ZT5A 1CD0A 1L0YA 1MFAH 4OQTL 2JB5L 3FO1A 5TH2A 4DK6A 5BJTA 4P23A 4NQTA 4UQ3A 2DI8A 1R3IL 1MQKH 3BDYH 3MCKA 2YRZA 3UDWC 4HIXH 4BSWB 4D3CL 5CMAB 1XAUA 4NWUL 4R3SB 5E5MB 3QXDA 3OWEA 3TLRA 1K9TA 2CQVA 5CGTA 1FN4B 4JO4H 2X4UB 4LLVB 4PTTA 3JWDC 2WWMC 1YY9D 4PFEA 4C83A 4AENB 2ZUUA 1MOEA 1XCQA 1QLEH 2WUCL 4ZTPL 4K7FA 3QO0A 5DMJB 4M7KL 3EGSB 1Y6KR 3IRPX 2AI0H 5HVGB 1F4WH 3U6RB 3AVEA 3UBXA 1TVBA 4WV1C 1N6VA 2LFGA 4PR5B 1Q0XL 2WINB 4F57L 1U8JA 1DEDA 2JIXD 3NVQA 5L8KB 3FFCB 1V8HA 4HWZA 4KPHH 4OJFL 5AUMA 4JG1L 5JW4Q 3RY5A 3VXRA 3UC0H 4M03A 1ZA6B 1OARH 2VDRH 5J57B 2FX8H 3LMJL 2CLVA 5I8OH 3QIBC 3V6ZA 3KPSA 1EFXA 1HOCB 1ACZA 4FQLL 3KYNA 3OR6A 4KUCD 5E9DE 5D1QA 4H0HB 4ZFFA 4KXZH 3QUYC 1MLBA 3FB5A 3O6LL 1AXTL 1IC1A 3F8UB 1JI2A 1T7VA 1S9XB 5KANG 3GMMB 5C0AE 3VA2C 1TITA 3L5HA 4XP6H 3UTSA 1C5BL 5DMGC 4XP4H 4YK4B 3MV9E 4E42B 3DURB 4R96A 3EHBC 3U4BH 3NGBB 1WBYB 2D7TH 1FNEB 4YGVA 1YEIL 1F97A 3GM8A 4PLKD 3KPTA 2W92A 4PB0L 1KT2B 5ESAA 3IB4A 3DVNB 3WIHA 1P7KA 2XFXA 3E6HA 2QTEA 4NQCE 4JFPB 3TN0B 5DEGA 2H8PA 4JRYE 1HXMB 4XPGL 4G9FE 4NM4L 4MVBC 4ORZC 5BMFH 1VKXB 1JPSH 1T89A 2F53A 35C8L 4YPJA 4JJHA 5LQBL 2ZCLH 2XQYK 2VISA 4ZAKB 3QQ4A 4APQB 4WUKH 4Q9QH 4JFHE 1VCAA 4LLUA 4MQXD 5LGJA 3N06B 2HFEA 3BPNC 2Q3ZA 5I1JL 5IB1B 1DFBL 3MBEA 2F53B 4PJDB 2VLKE 2DLFH 3KWWB 3O2DA 5IF0A 1BZ9A 5F6IB 4OZIA 4ODWB 1OB1B 1UM6L 4XVSH 1NGZA 5JW3L 4CVWA 5F89B 4Z77A 2JK5B 1QFWI 2IAMC 1S9WB 1ZE3C 3RDTB 3CFKB 4K55A 5GJSH 3DV6B 3OKYA 1RVFH 2XZAL 4M6AA 2YZ1A 5J6HB 3LKNA 1BVKB 5T5FL 3VFPA 4HKBA 5HHQA 5HPMA 2CXGA 4K7PX 4NWTH 3KJ4B 2VXTL 3SKUD 5FUCE 3PL6A 4LOUD 2X4SB 4RWHA 1PSKL 4H88H 2OTUB 1UENA 5E9DB 3CZJA 2PN5A 4HWUA 1JRHI 2NTFA 3E3QE 2R29H 4ZYKA 4PD4J 3HS0B 1BJ1H 1YUHB 3HE6A 2F54D 5CMAA 3GMLB 5F7WC 3RPKA 4RMUA 4OZGE 3BKYH 3PL6B 5JOFA 3LS4L 4UDUB 5CZKA 4O5LH 1DUYB 1RUAH 1S7TB 3QRGL 2DL2A 2OP4H 5FEBA 3ARFB 4Q9RL 1QQDA 2IALB 3OF6A 1A0QL 1HQ4A 4HKZB 3QI9C 4P9HH 4HGWB 3SKNB 4FFWD 2CK0H 4OKVB 2AK1H 4HHAA 3VXNB 3JV4B 1BWMA 2V5TA 5D8JH 1EGJH 1OAZL 2EEAA 4RA3A 1MQ8A 5IESH 5CGMA 3SDDD 1N64H 2AK4E 3GMOB 3BP7A 4MJ6A 4EBQH 4LL9A 5AAWA 2X6MA 1CZ8H 1GAFL 4J3WA 4R4BA 5F6IC 2VDPL 2ADGA 4YDIL 1O5DT 4PJBF 3LKPA 1JPGB 2W65A 3QIBB 5JTWA 1H8OA 2PO6D 5BS0E 4UIKH 3U9UA 2PYEE 1LD9B 2BOBA 3SBWC 1SJXA 4FQXB 5E2UH 3LHPH 5AZEH 3S8WA 3S34H 3VRLF 1VFAB 3LIZL 2P8LA 3FT3B 2VWEC 2OI9C 5GGUA 5J1SC 2D0HA 2DDQH 2ZUSA 3J7HA 3BP6B 4PJAB 2P46B 4O58H 3HC4H 3L6FB 3H0TB 1OSZA 4FRWA 2A6IB 5E2UL 2FB4L 3T2NL 1ZWIB 5KS9E 5I1IH 4Y1AA 1I8MB 1KC5L 4AG4L 4WW2F 4GRMA 5IMMB 5F96L 2CJUL 4ETYA 2XRAH 1HHJB 3BZFA 5TH2B 1GVIA 5CHNA 3FQRA 4NN6B 1I7ZA 1A6PA 3D39E 1EZVY 4QHKI 3SKOB 1KACB 2AJSH 5ELIA 2CDEA 5DJ0B 3NFPA 4L8BB 3HE6D 3H8NA 3TBTB 4EUPH 3BP5A 4GRLB 1AKJB 4L3CB 5D7IE 3QCTL 5BZWB 2Q8AH 3VRLE 2Q20A 2PR4L 4PRIE 2MKWA 5SWSD 2J6EH 4P9ML 4HKJB 3TVMB 4NRZA 5DD3H 4OF6A 5FGBC 1MJ8H 3CFDB 1CFSA 5CSZA 1L9MA 5TE4L 5B38A 4NO0D 4F9LC 3SPVB 1GIGH 5CILL 3W82A 4DKFH 3RI5F 1EHAA 2V5YA 2XICA 3HC0B 3VXQB 3J8F7 2OJZH 3VFMB 3ARBD 5LCVL 4QHNB 2NY6C 1IQDB 1BAFL 3ZKND 4YFDB 2R0WL 4NQXA 3O3BA 2C1OA 2HG5B 1LO0L 2JJTC 1I7RB 5IW6A 1YYLL 2CKNA 4XCCH 4EDWL 1A8JH 2YD3A 4ZDHB 1K8IB 3G5VB 3TN0D 4R0LC 3ESVF 2P44B 3MV8B 1T0PB 2RB8A 3CDFA 4XNXH 3FRUB 4CAGA 5I1CH 3FOLB 5C0JB 1XIWD 2P45B 3OL2A 3G5YA 2F58H 1J5OH 3DX7A 5FYLE 1FNSH 3N1MC 3ZTNL 3R0NA 4LLVA 4R26H 5GZNC 3X17A 3BGFB 5JZ7C 1T2XA 2ZUQB 4JKPL 4TSBL 5CEZL 4HXAL 3SDXF 2NZ9D 4OCRH 5JIIA 4L3EB 2AK4A 1TZGL 4FG6D 4YNYB 1A7NH 4XVTL 5J11C 5D7JB 1D9KB 5I1GH 1QTYT 4MD0B 1TQCC 3SE9H 1CGTA 2XRAL 1JZ5A 2JCCF 4YR6A 4GW1B 1N59A 5FECA 4C57C 5ESAB 1ZA3A 2Q76A 4XH2A 2MQ3A 5HPOA 1NLBL 3ROOA 1MI5A 1S7UA 5H35B 5GRJL 4ODTH 3ULVF 1X6LA 5KVDL 2GSIB 5CEXB 1HI6B 1GXEA 4WNQA 2IH1B 1EH9A 1NCAH 3MO1A 4M6NH 1MIEL 4TUKH 3UTSD 5D1QB 5DMIL 2X70A 3QUKB 2HFGL 5HXMA 2QQKL 1VEOA 3BIKB 4ZNCD 1KUMA 3WIFA 4JO3H 2MNUA 1TZHA 3VXRE 1NGWB 1S7WA 4PLJD 2Y06H 4BSJA 3IF1B 1JHTB 3MXVL 3HMXH 3RWEA 2G60L 5GRZA 3TT3H 3H3PH 1J0KA 5DD6B 1FL3B 4I2XA 5DQJA 2X1XR 2W0KA 5D2NE 1NGQL 1JHKH 3C87A 4ODBD 4PJGF 3BIKA 3NCFB 1VHPA 1KN2H 4ONFH 3S3JA 2RFXA 4Z0BH 2EDBA 4J1UA 3H0TA 4WI8A 5D9SB 5CBEA 4LEXL 4OZFG 5E95B 3NZHL 2OCFD 3OKLA 1FO0L 4OCNC 2B2XH 2FGZA 4ZS6C 1JNNH 1OGTA 5LKNA 1U8HA 1S9YA 1TQCB 4JFXB 4JN1H 4XNMB 3DRQB 1MUJA 1AQKL 3KPPA 1TTFA 2I07A 3MV01 5E1AA 1IBGL 1IGFH 4L8SA 4MGXA 3VFWA 4HZLB 3U82B 3VGFA 3QQ4B 4RFOH 4HJJH 3SDCC 2BVYA 4MYWB 1W72A 3FQTA 4PJIF 4M7ZB 1IM9A 4GBXC 4XP9L 3FONB 3PGDA 4TVPL 1CBVL 1P2CA 1Q94B 1IMHC 1A22B 5B39A 5DJYB 4GAYB 2VQ1B 2UWEE 1C5DB 4LSRL 1LDSA 1K5NA 3R1GL 2H26A 4U0RB 1J1OL 4KUZL 2HH0H 3KPRD 1M05A 3WYRA 1MHEB 2IALA 1QSED 4PY8J 4PJ7B 3UTPE 1W72B 3FN0H 3PQYA 3O45A 4PJ5A 4XNQA 4E41A 2W91A 3QPXH 2ITDA 4GLRH 3W2DH 4NP4H 1U93B 3GSWA 2Y23A 3BZEB 3LAFA 4JY6A 4WV1B 4X7TB 4YXLL 1DFBH 1RZ7L 4J3VA 3VGAC 1GHFL 2CD0A 1NCCL 3QHTC 5IMKB 2BDNH 3O45B 4PJ5B 1RUPL 1QZ1A 5GRXG 1PKQE 2NXYD 4PREA 2BOBB 4BFGA 4X6EA 5EZJB 5K9QG 3BZEA 4MNGE 2BNQE 3HC3L 3CPLB 4HG4J 2MJWA 5ID0A 1O7SA 1HYSD 2MCPH 3QXTA 4HQQL 3RZCD 3QEQB 1RZKH 2IJ0C 5JXAL 4AM0B 2CH8A 1A1MA 4LLMB 3ARFC 5BS0A 3OKOB 5C0AD 1SJVA 4KHXH 2IMNA 2WBJA 3MRJA 1RUKL 5JPNA 1GCFA 3HI1A 5H2BA 5TF0A 5CD5D 5KSBF 3IDIA 3RUGA 25C8H 1DBMH 3P11H 1LP9E 4JPKH 3ZE1E 1QFPA 4YWGH 1HKLH 3E2HB 2FECL 4R7DA 3WE6B 4OGAC 4CU7A 4U2ZA 4R4BB 2V2XB 4L9LC 2WZPD 5D71H 4KPHL 1VACB 1F4YL 4FHBD 1SY6L 4J8RB 1ETZB 3PWPB 1T66C 4WU5A 1KIQB 3NACH 4LPUA 3SEPA 4ZXBA 2EE3A 4UV7H 4AEIL 1S5IH 2YBRA 1MCQA 2X4OA 3DVIA 1EA9C 3QULB 1O0VA 3UTTA 2FATH 3NA9H 5D1QC 5C6TL 4Y16B 1N6UA 2ED8A 1KYOK 1MRDH 5KSBE 4P23B 2LVEA 3PWPA 4Z5RA 3IDXH 1G1CA 1W0WA 3QAZB 5DJXB 4HFUL 3AREC 3C8HA 3SDDA 5A43C 3EYFB 4JFFA 3GSOB 5C9KA 2AW2A 2VLKD 3RIFK 5T5NF 4YHML 2FIKB 2HJLB 1J05B 4JDZB 3QUMB 4TN9A 4O00A 3RWGB 3BEVA 4UZGA 4X5WA 5FHAL 25C8L 3TIDA 3BKJH 1DDHB 1HCFX 3O0RH 1GGIL 4FMKA 4A2MA 4ETQB 5TQ2L 4P4KB 3PUCA 5CD3B 3IGAA 1DBAL 1PQZA 2FIKA 5TDOA 2X4QB 1NDGA 4M1GH 3NPSB 3VXOA 5FUOL 2FSEA 1XF3A 3BKJL 2DQHL 3AGVA 4LEOB 5AYUH 2GITB 4E41E 2W59A 1AQKH 1T66D 2DM7A 3GBNH 4UQ3B 3F65A 5D1ZA 4CN1A 3SBWA 3CH1A 4PR5A 3AAZA 4KQ4L 5KVMC 2BK8A 1JF5A 1MEXH 2VLRD 3WL9B 4Z7WE 3TBSA 3I9GH 1ZLWK 5IJKA 3L3GB 2OZ4L 5E4EB 5TGBA 1ADQA 4OF0A 4HZLA 1Q0XH 4F57H 4WHTA 4EDWH 4I9WE 4HX1A 5IHZA 3S88L 1G0XA 4C83B 4BFIA 2EZ0D 1UB5B 4OZ4A 5CCKH 2Y36L 4HF5L 4N0FA 3EO1B 1R3KB 2ZOLB 3RGVA 5DMYA 4PJ8C 3V6OE 4HX1B 4YUEL 5IVNA 1YMHA 2PW1B 4XBPA 3RZCC 4WJ5B 3P0VL 4OF7A 4NBXB 4XB8A 2K3TA 4RCAA 2FZ3B 3FO9A 3RTQC 3CUPA 5JQ6H 4KRLB 4Z7WF 3BPCB 4JFDA 1YYLH 1EDQA 2R0KH 2OSLA 3HB3D 4XWOD 2YWYA 4M3JA 4OZHA 3W0WA 1C7TA 1REIA 1JNHB 1RZFH 5E00A 5SWQB 1S7VB 2EIZA 3MZTA 1WBZA 3ZKSD 1CK0L 1JPTL 3CC5A 4M4PA 1QHOA 3VFVB 3I50H 4N0UB 2JJVA 1IAMA 4PV9A 4KXZI 3KS0H 4BQ9A 3ZSSA 2R8SL 3MNZB 1KF9B 3RKDC 1F6FB 1YMMB 3ZYOA 3OF6D 4C55A 1RJYA 3KPLA 1P4LB 5C3LD 1ORQB 2VISB 4ZAKA 4P3CL 9CGTA 3OKLB 3OHXA 4F7EA 5IK3A 4ONGH 1ES0A 1PLGL 3UBXG 3HZKB 4MMZC 1MPAL 2A9NH 4LF3B 1KN2L 4ONFL 5EOTA 1V3LA 1G7PA 5C07E 4XMLH 5I8CA 1KPVA 1JYWA 3EJYC 5KSAB 3F7YB 1IGCH 4KHTL 5DT1H 4NT6B 3H9SA 1A7RH 4HS8L 2DLTA 2Y06L 5K9KA 3PL6D 4HEPG 4QXGH 4QRSA 5MI0C 1I1CA 3WIFB 5ICZB 1HINL 4LCCA 2W9EH 4CVZA 5DQ9A 2VLRA 1D5XB 3NCCB 1MLCB 1T03L 1UC6A 4JB9H 4LIQE 1H3UA 1MIEH 1WISA 1QPPA 4TUKL 2AEIT 1T20B 5BVJB 4XWOC 1A9BA 2OMNA 1KTDA 4AT6A 3DHMA 2ZPKH 4XC3L 1QBAA 1G7LB 2MHAB 5KG9A 2A83B 3FRPG 4GBXB 3WMSA 4WGVB 4PJBA 4JQVA 3BP4B 5ADOH 1CD1A 2Q7YB 3FMGH 1BIIB 4JN1L 3CU7A 4WDIB 3DX6B 4KK8C 4X4YA 1JGDB 4FABL 1W8NA 1NGPL 4U1IB 4MNGA 4R97B 1OT1A 1ZT4A 4EXPX 2F9BT 3P0YL 4CRPA 5JW5B 2FEEL 4QTHA 3MRFA 2DRUA 5GS0C 1S7TA 4WFHE 5IFJB 3MYJB 3WNLA 2EDQA 2XN9A 1FBIL 2AABH 4O5LL 5F6HI 3HRZB 4QT5A 2ATKB 3BH9A 3SHSA 4U7MA 3ETBF 1MCFA 1DQLL 3L9RA 4U3CA 1B0GA 3HUJF 1FAKT 4HJ0C 4M93C 4QYOB 4S11A 4RRPA 1LK3H 5DK2B 2YA0A 2FBJL 2ATKA 1KCRL 3BH9B 4N8CL 1EHNA 3GGWA 3I84A 4LNRB 5FGRA 1ZVHA 3KYOA 2AV1B 3CXDL 4JFQA 3MOBL 1ZLSH 3QWRA 4M1DH 1LO0H 1AXSB 2VSDA 4OV6F 1DR9A 4NOFA 4X0KA 5FYLL 1UCTA 1TZHB 1BF8A 3FQNB 4FQ1L 4TPRL 4J23A 5DK2A 4IBLT 1RFDH 3QDJB 5EOCL 4JG0H 4OIIH 3Q2CA 3V8OA 3A6OA 2ILLA 3NPSC 4KKLD 3HE6C 5D2LF 4NUJB 4JCMA 4X6FB 5GRWA 1OL0A 3GMPA 1KPUA 4U1KA 2CRYA 5EZIH 8CGTA 3OJVC 2DJUA 3D6GA 1CQKA 4N0CD 5E8EB 1PW3A 1WK0A 2ZUQC 3QUZA 1CGXA 1HKLL 4NCC2 1FZMB 4HSQA 3STLA 1G6RL 3RDTD 2LU7A 5GS0H 2HN7B 2FX9L 1V7NL 4TULL 4M48H 1EGJL 3DIFA 3PGCB 4NHUA 1JGEB 4WEBL 3ARGD 1RU9H 4X7SH 3V4UL 4EN3B 2JCCA 1P2CB 1JF6A 3QNZA 4F9PC 1MPAH 2A9NL 4JZJA 4P99A 2NW3B 3DX8A 2EH8L 2NXYB 1T21B 3UO1L 3MREB 4LF3A 1RI8A 2HWZH 2L4OA 1CDHA 4XGZA 4Y88A 1BAFH 4Y8AA 5BO1H 1MCIA 4NSKA 1RAMA 1QBML 5BZWA 2FX7L 2XWTB 5DTFA 5HHVL 3MSPA 1NKRA 1XT5A 4GG6E 1Q8MA 4OZFH 4Y4FB 3PE9A 1NUGA 5I66A 3ULUF 2X7LA 4MB4A 1S8DB 3UJTH 1CFBA 1JPFB 4XRCB 1AO7A 4LDLB 4ZUTA 1BQSA 1MREH 3KLAA 4KZDL 1A7PL 4LSSL 4XCEB 2WSKA 4Y1AE 1A7OL 1DLFH 1Q72H 3P4OA 4E5XA 1R3JA 1RK1A 4D8PA 1YNLH 3PWNB 1KENH 2EXYD 1AD0A 1MHPL 3F62A 1HOCA 1MH5A 1FNSL 4NO2B 2X09A 1E4JA 1BIIA 4B5EA 3V4PH 3QIBD 1IGJA 3CSYA 3QIWB 4Y5XB 4UU9B 3CK0H 1KJ2B 4X5XA 4NYLA 2VDKH 3PWPD 5CJQL 2VC2L 1BOYA 5EU7C 3C60B 5L9DH 3ULUE 2JB6A 4JDVA 4JHWH 1I1AB 2D7NA 1EEYB 1CDGA 1WF5A 1T5XB 3SE4C 1J88A 5DO2C 5DWUL 4NJAH 5DR5H 1CU4L 3LY6A 3V2AR 2WP3T 1M7DB 1U8MA 2AK4D 3C09C 1AGDB 4EI6B 3U4BL 3IDXL 1S9KC 2I5YH 1BREA 4NWUH 3ZO0A 1CK0H 1JPTH 1WSST 1U8LA 4KQ4H 5C09B 1QNZH 3SGKA 4ELMA 5C8JA 4Y4FC 1OVZA 3RTQB 5GGVL 4I2XE 3A6BL 3L3OA 4I9WD 2OTWA 4KY1H 4RFEB 4Z7WB 1A47A 1R6VA 4R0LA 5KOVC 2VLJB 5BCAA 1VADA 2FHCA 1EFXB 5H37H 5LGHL 1WZMA 3OAZK 2E6QA 3QUYD 2W0LA 1G1YA 4U6VL 3R0MA 3LN4A 3QH3A 3RVWD 3TVMD 4YHYB 5F3BB 3MXVH 3RIAK 1CXFA 3WHXA 3ZE0E 2QQNH 3MLRL 1JV5B 4DN3H 4UINH 2MMXA 3I02B 2X2YA 3MO1B 1IC7H 4Z7QF 4CMHB 4JDZA 3OXSB 2VLRB 2EIZB 4FXGA 2JLLA 1A4KA 3D3VD 4YFEA 3W9EB 4JO1L 4JJ5B 4Z77B 1Y18A 4I18B 5AZ2L 4YZFF 1ZT1B 3V7MA 2FRGP 4GKNA 2IADB 3VXOB 5FYJL 3QG7L 1QA9B 3F12A 1F4XL 4OLUH 2OYPA 4HUVB 1KLGB 4LHUG 4WFGD 1I8KB 3MLWL 3D48R 3I2CH 5E8EA 5HVWA 3T3ME 4UIMA 1CE1L 3P4NB 3V0AC 1NAMB 2VQ1A 4KROB 1ZT1A 1KCUL 3F6LA 5DHYB 1P4BH 2IANE 1PEWA 5IHZB 1FG2B 3MLRH 1UYWL 1MF2L 1B9ZA 1P84K 5BOZG 4Z9KB 2AJ3A 3CX5J 4LCYA 1YEJL 1JGUL 4PRDB 4PGEA 3PXHA 3D18B 2DIAA 5EC2A 2ZG1A 1OTTC 2FWOB 3EBAA 4L4JA 2DQCL 3VFGH 1IL1B 4O9HH 4G6JH 3TF7C 3IFPB 2R1XB 4JY4B 3WUWB 4LLYB 1LK2B 3JV4A 2ZCLL 1EEUA 1IARB 1TETH 4ZODA 4S10A 1F8TH 1FIGH 1I9JL 1MRFL 4ENEC 3BP7B 1JCKA 4MJ6B 4ZAKC 5GGTA 3QUXC 3WSQL 4YPGA 3NTCH 4PJEE 1AXSA 3SE4A 4L8DA 4DWHA 2VN4A 4V2CB 3D0LA 1NFDE 4HWNA 3EDFA 4XVUD 2B1HL 3O3DB 5C0DA 3TC9A 3UTSB 1UM4L 3W39B 1RZGA 3K4AA 2AXHA 1LDPL 4S1QL 1RK1B 1F58H 1W8OA 1H8SA 1JE6A 1JHKL 3DURA 2VDQL 1BPVA 5B21A 1DLHA 1YUHA 4LSPL 3RUGB 4R2GB 2LABA 3STBA 2DQHH 1LNUB 4N9GA 1ZWIA 4NNYB 2WIMA 1F11A 3AM8C 4M00A 4GKOA 1MFDH 1CXKA 2VDNH 4YHOL 1AC6A 2DAVA 1HHHA 4M5ZH 5I1AA 1IGIH 4PJEF 4M7JH 1TJIH 2CPCA 4KTEH 1A1MB 3JUZA 1ND0A 4HHAB 1MWAA 1VDGA 3UTSE 1I9JH 3VXNA 1FH5H 3TZVC 4MCZB 4LNRA 3QPXL 4RFOL 5HYQB 1ODAA 5DVOA 3UTTB 1E4KC 4JQXC 1AGDA 2R2EA 4QNPF 1XF5A 1NSNH 4EN3A 3QNXA 5DD1H 4DAGH 3QHZL 3HFML 4OFPA 1E4KA 2W65B 2QSCL 3MBEB 4X7CC 3VXSE 1DN0A 2P5ED 4NRYA 5IMLB 1A4JB 2JELL 4LCIL 1CFSB 5GS0D 4ZUUB 5HYJB 3QQ9C 4XAWH 5KSAC 1A9BB 3IVKA 4XX1E 2X4PB 2GTZB 3HHRB 4U1HB 5T33H 1G7MB 3PJSB 2F53E 1PYWB 1CQYA 4OFVA 5F3BA 1FLTX 1I3GH 2VR9A 3O9WA 3PP4L 5EUKA 4W6XB 4HKBB 4PG2A 3B9DA 5A3IC 5JW5A 1AE6L 5E56A 2X4PA 3LQAC 3O3EB 1D7FA 4QRPE 5HGBA 4YC2B 1G7JB 1KBGL 1T7XA 3OAUL 4XMPL 4Q6IA 4WU7A 4NQDD 4YFLI 2AAVA 3M17A 1CL7H 4RQQA 4MA1C 4RAUA 5IOPA 1Y18B 1U8IB 1UJ3A 4I18A 4KMLB 5BRZD 5I1DB 2YA1A 4KZDH 5E08L 1CN4A 3RWDA 2VOTA 1ZEAH 4OSUH 3RWGA 1IC5H 5D1ZC 1PD6A 1AC0A 4FQLH 3VD4A 4MDJA 1YZZA 4XC1H 4TSCL 4XP5H 4QTIH 5L0QB 5SV4A 4OZFB 3C5JB 1E6OH 3RZCB 3CVIH 4PS4H 3NCEB 3MJ7A 4OKVA 2A77H 3GSQB 2DB8A 3KXFB 5HJ3B 3T77A 3MNWB 1FYTB 1MREL 3T1FA 4YBLB 2JE8A 4F8TA 1XF2A 1M6OA 3LIZH 1BBDH 4HUXA 1N59B 4KQ3L 3DJ9A 5EZIL 5FO9B 1FPTL 4QCIA 4WW2B 1IT9H 1H3GA 4DVBB 3MRIA 1GPOH 4UT6L 3ZKXC 3FFDB 1QFHA 3DXAB 5D1XD 1KCKA 4LPTA 5T1KA 5DSCA 4NQUA 1EHLL 1X4ZA 2ZOKB 1T04B 3LZFH 3P4OB 3QDGA 2KBGA 5TPWH 3MJ9L 4TRPL 3AROA 3JWDL 3NFSH 5DRNA 2ESVB 1CICC 1ZANH 2CJUH 5T3XE 4X6FA 3O2DH 1OAXH 1T89C 4LPWA 3IETA 4WFFE 5LWYL 2WM0A 1DZBA 3OZ9H 5IP4A 3LSOA 1VGEH 3DYPA 3VFVA 1I75A 4O2EB 2EDYA 4X7SL 5DJCB 5HHXL 4UU9A 1U58B 3U0WH 2DBLL 5E8DL 3QFDA 4Z6AT 3FO0H 2A73B 2CLVB 4PYHA 5C3TA 1VFOA 5HYJE 3NN8A 4HV8B 2HVKA 2B5IB 4G6FD 5JLZA 1D9KA 4UAOC 1I7ZB 3B83A 4N8PA 4YDKH 1EX0A 3VFRA 4RFNC 1RZJL 2Y6SC 4FQPA 1IGYB 5EBMB 1JWMA 1WLHA 5HYSG 3W0WB 4OZIE 1XZ0A 5FYLH 2Z8WC 3HE7D 4PJCF 2GSGB 3NN8B 4G8IB 3GMQA 3PWLB 4GRWF 3TO2A 2Y6SD 2KUTA 3FMGL 4CL7A 1N7MH 3QWOB 2ZNXA 3ES6A 1F11B 4JPIB 4WI6A 5DVKA 4EDXB 1XGTA 1MFCH 1NMBH 3CFEB 4P46A 4BSVA 2Q8AL 4L8SB 1ADQL 2VXVL 4POUB 3V9FA 5DC9B 3W11C 1UXWA 3RVTC 2DLHA 2H1PH 1JHLH 2HKHH 5ANMA 1EAJA 4AT6B 3QIWD 5DGQA 3CSBA 2H8PB 4M1DL 2V6HA 1YC8A 4XCFH 4LCCC 2D0GA 3LEXB 3B9AA 1R0AH 4Y4HB 1KB5L 3HI5H 4HIHA 2P49B 4OIBA 4XC3H 1YJDL 4OUOA 1DANT 2X4TB 1ULVA 5HPMB 2NX5E 3D1MC 4JRYB 5EFIA 3QO1A 4NNPL 4CW1A 2QEJA 5EU5B 3H3KA 1OARL 2VDRL 3Q3GA 4QY8A 1LEIB 4TRPH 3G5YB 2OR9H 2A6KB 1FVEA 4DGVL 1R5IB 1WCBB 3OXRA 4FQIH 1NGZB 4PRBB 2J1KA 3JUYA 3MBED 1CTNA 1RUML 3R8QA 4OAWA 4JFXA 3HI6H 3MRLA 4X6CF 1V7ML 1TZIA 5F9WB 4AEIH 3CVHB 4HEME 4XPBH 4P0DA 1YEKH 1P53A 5IFAL 4N8VA 2R9HD 2VDPH 4YDIH 5ISZB 1Z2KA 3L3IB 5FF6B 3SDXB 3L9RB 1S9VA 3IDGB 4P5MA 2FJFB 3BPOB 4LCWE 1HHKA 5IOPB 3TCLA 1R5IA 1WCBA 3MODH 3QIWC 2IAMA 4HXAH 5T5NG 2VXUH 5I1JH 1WBXA 3ARRA 2ZSVA 4K3DL 4LFHG 3X3FH 1XCTB 1E4XI 1HHGB 3GFUA 4TSCH 5FYKE 1U3YA 4AJ0A 5GSRA 5CP7B 1KCSH 4JVWA 1QFWH 4X8JA 43C9A 3DMMD 3S97C 3INUL 5F7UA 5EN2A 1BOGA 3KHQA 1KG0B 4GRWB 5J89A 3HE6B 2GW5A 2EDDA 4FQHB 2BVPB 3BKCL 4OZIB 4NQDA 1JN6A 2IH3B 2VKXA 4LDOB 4V1DD 2Z35A 3GNMH 3MMEB 2E7MA 2XV6B 5B4MC 4IIQC 2Q3AA 2EYRA 1I7UB 1TPXC 4Q9QL 2AERT 2C4FT 3BWUC 4PP1C 3UXFA 3WNOA 1A4JA 1I1YA 2A77L 4YXKL 3P0YH 2NXYC 3X13B 4K3GA 4GMSL 1J9CT 4EZMA 3LOWA 2OQJB 1JWUB 2NXZB 1OQOA 3O6KL 2FD6H 4ZFZA 1WWCA 1S5HB 4M6ML 5EBGA 4EN3C 4UV7L 2AJZA 4WWKC 3WJJC 1DSFH 3WFEH 3SQBA 4JO2H 1WV7T 3BZDA 4KJYB 3DO7B 3EYUL 1NUDA 3DIFB 3PGCA 2FH8A 4NHUB 5MENB 1I8KA 5JUEH 2OK0L 2WK2A 5IVXA 5F88B 5FB8B 4KJWD 5AG8A 1K2DB 3CMOH 3WHE0 2XY1A 4JFYB 2ZCKH 1HSBA 4NM8L 4JM2B 3QEHA 1LWRA 3T0BA 5I18L 3D0VB 4HKJA 1D5MB 3LB6C 4NJ9H 2GIYA 1T2JA 4P2OA 2CKBB 3FB8B 3WD5L 2QSTA 4CMHC 5KBNC 2B5IC 2XTJC 3LQZB 3T4AB 1U95A 2APWA 2J88L 2J5LB 1YYML 5TQ2H 5JW4R 4F37K 4PLNC 2YSSA 3FQRB 4PRPB 1KPRA 5T33L 4M6OH 2A6JB 3VMPA 3RIAF 2EKSB 4PJFB 3OX8A 4UNUA 1RMFH 4G8EB 4H25A 4ZDHA 3QIUC 3GBLA 4KFZC 3VW3H 3THMH 2HT4D 2BZDA 3MNWA 5FYJH 1YY8A 3JV5A 5AD0A 2HA1A 2B1AL 4HK3J 4HH9A 4EIZC 1GOFA 1U8JB 2E3VA 3TA3A 1MJJB 2NR6D 1EJ6A 2LE9A 2NYYD 1OSZB 1FVCA 4YBHA 2V7NA 4LLQB 5TDPA 1SQ2N 1FGNL 3QWRD 5DRZB 1DVFB 3ZHLA 4XI5D 5FM5M 3QXWA 3VFNA 2XTJE 5C70A 4K07A 3DBXA 4JN2B 4QHUA 1LE9A 1IFHL 3U79A 1EEYA 7CGTA 2IFGA 4JM2C 4ELKB 4MXWL 2YXMA 3KS0J 1U8KA 3ECBA 1FNFA 4XNYL 3WJJA 1XF3B 2EXWD 5BS0B 4G7YH 3ME0A 3TO4B 5F97E 4MJIE 4YEEA 5EBLA 2QADB 2QHRL 3ZZ1A 3DSNA 5SWZB 4LVHB 3RU8L 3TBSB 3D69A 3GHEH 3O81A 4QRQB 2A1WL 2HTLC 4NO0B 4Q97A 2XT1B 1U8KB 3ECBB 1KTRL 4Q6IC 5CIPH 2YUWA 4BK4A 5DHVB 5HBBA 3U6RA 5F1NB 5MERB 5I0DA 3TESA 1ORQA 3D85D 5T5FH 2F8OA 2NQCA 3NPZB 1AO7E 1OGAA 5IK3B 4PUBH 2G9HB 3AY4C 2DJ4A 1BLNA 4H1LB 2ATPB 1YQVH 4HUWB 2ZJSH 4OLZL 3BE1L 4GRLD 3GNML 1JL8A 5CJOL 1KJ3L 1XGUB 4PJ8B 3WXVL 2K7PA 4PJ9C 5D7KD 5HDOA 4RAHA 2BSSA 4ZFFB 3B3IA 1EO8L 1CLZL 5F3HB 4K3EL 1U8NA 4WGWB 2AXJA 5CFHA 1Z0NA 4HIHB 4OM1H 1WT5C 2NX5A 1K4DB 3CK0L 4LGRB 4AYFA 2OR8A 3OB8A 4IRSD 4DOHE 3TFKD 1RZJC 1S3KL 2HLFC 5M95B 3PF2A 5FYJU 5T1KD 2B39A 3F6IA 4QLRA 4UT7H 3UYRL 1QSVA 1KENL 5TJWK 3TIEA 1JNNL 4YHIA 3IJYA 3G04A 4A6YL 4JO2L 3HUJA 3T08A 5JNYA 1HWHB 1EGJA 4RNRA 5I73C 1P4LA 1MY5A 3LH2L 3BIBX 3LRSA 4N1HB 5ITBH 2QL1A 4LAQH 4LRNL 4RMSA 3REVA 1QFWM 3IDJA 5I0ZA 1SVCP 4YK4C 2V7HA 1KIUA 1I3RA 1A9EB 3CDYA 4QRPD 1XGTB 2E8YA 1GGTA 1K85A 4PLJC 3MUY1 1WZLA 4NQDE 2R9HC 5IBTL 3QWQB 4J1UB 2VN7A 1W72L 1B0RB 1IZKA 2H9GA 4NKDB 5EA0H 1L0QA 5K93A 4HUXB 1YMME 5GGQL 1ZOXA 1FORH 4M6OL 3O4LE 4XNMA 2APVA 4E0RA 1G6VK 2PTTA 1J0YA 2YSSB 4K3JH 4PB9L 4XMPH 3TT3L 5DLML 5GRUL 5C0RH 1TJHH 1P7QB 4JM4H 2Z93B 5A16B 4MSWB 4U1LB 1J8HE 1DEEA 1YN7A 3VXUB 4LPVA 1ZHNA 1P4IL 4QO1A 4YAQA 3OMZA 1KJMA 2V2TB 3CXHJ 1U41A 4LBEA 4Z7OF 5ALBL 4W6YB 1I3UA 1BVKA 1KFAL 4K71B 2RFXB 4BQBA 3W5NA 4X9BA 2VL5A 4LIQH 5F1OB 3MJ6A 4U1JB 2EE2A 4ORGA 4W4NA 5D7LA 4PRHA 3BN9C 4MDIA 5D7SH 4LKCA 4DEPB 4J4PC 2CRMA 3SDDC 5EIIA 1F3JA 4LLDB 4YXKH 1JRHL 1BQLH 5E8NB 3MRRB 1JZ2A 2Z92A 1AGFB 4LCUB 1JF1B 1HSBB 3Q1SL 5EN2B 2OR7A 1EBPA 5IQ7H 2FBOJ 1DVFD 4NRYB 1MCWM 3AREB 1CICB 3ZYJA 3MLXL 1JN6B 3MOAL 3RBSA 4MX7B 3EYQD 3PP3K 3VFTA 4BZ2L 2AABL 2H6PA 3BPNB 3DROB 2ZG3A 4UIKL 2AVGA 3H42H 4PY7A 3RUGE 2VQTA 5L8JB 4QRPA 2NY2C 1OP3K 1V3JA 2EECA 1NC4B 1JWSB 3IYLW 3VI4E 1A7OH 5IB2B 5DUML 3EUUA 3LRHA 2QSVA 3FO1B 1LK3L 1VACA 4JFHD 4UV4H 1AJ7L 1HQRB 2A6KA 1S8DA 4HPOH 5C0BA 4RISL 2UWEB 5DD0H 4O4YH 2OX5A 3T2PA 5F7HA 3KPQA 1F2XK 2DL9A 4TSAH 4G8GB 1E28B 5HDBF 1K8DB 4KRPC 1A21A 2Y25A 1MFEH 4LLMA 4P5KA 2X4UA 2XNAB 3MUGA 3PWPE 5E8OA 2YD9A 3SKOA 1IGIL 4Z0BL 1T1ZB 1ZEAL 5IFJA 1BX2A 2IAND 3B8YA 2A74A 2VLLA 2NY0D 4PJEB 4BYHA 4XNZC 3VWJA 5EH1A 1C16A 5HYEA 2XNAA 3BUYA 1DUYA 1UZ8B 2VH5H 3KPMA 3UYOD 1B3JA 4MVBD 5GPRA 5I15L 4PJDF 1E6JH 1Q9OA 4S0TD 5CEYA 1FPTH 4KAQL 1AJ7H 3VJ6B 5AZ2H 3T1WA 1DQMH 2IH3A 1TVHA 1FE8H 3CX5K 4POYA 4G6AC 2VDLH 3KPSB 4WEMB 3BWAA 2F5AL 4OF8A 1EBAA 1H5BC 1B4RA 2X89A 4MLSA 4KGJA 3IFNH 2N7BA 1SYSA 1HDMB 2DLFL 3SDCA 5TGBB 2GHWB 3FB6B 1ED3A 5IM7B 1R5VA 1QUNA 3RPIA 2KQNA 4XCYA 3W0WE 1JWUA 3UTTD 1YEFL 3MA9L 4NUGH 4JFZL 2WLZA 1HH9A 1IQWL 3HZVA 3BKYL 5HD8C 1RUKH 1HDMA 3GJEA 3QDGD 4WUUE 5GRUH 2CDFB 4L4TA 1NFIA 2ZOLA 1I7TB 4M7LL 3REWB 2ESVA 1RJYB 3PABB 4FQ2H 1A5FL 2HT2C 2W0FA 5B39G 4FXGB 5EIVA 2R69H 5C86A 4CVXA 3TIEB 2J8UE 2NY2D 2OL3A 1N8ZB 1RZIA 2A38A 5EO0A 4GRLA 3MUZ1 4LSUH 4RWYH 4R4ND 1Z5LB 4RX4A 1X5KA 1IT9L 4UT6H 3L5XL 2Q8BL 4H1LG 1MI5B 1S7UB 5H35A 3FT4A 1Z9MA 2O5YH 4U6YB 5LAXB 4UIMB 1AI1H 5TF1H 4P4KD 3IU4L 5EBMA 4L29A 3S5LB 1KGCD 3WO3B 1TMCB 1OP5K 1DQJA 1QRNA 4QHLA 5FO8A 5I15H 5I76A 2VRAA 1KTDB 5I66B 2PW1A 1D5ZB 3ROLB 1E4XL 1GGBL 2GJ6A 2ZZUT 5CBAB 4NQVB 3TZVD 4IEFB 4E0RB 3MACH 1WIUA 4IOFD 1FVEB 5DUBB 1MF2H 1BFSA 2NY3C 1J0IA 4JQXA 2OSLB 2NY1B 2X42A 4PJ7A 1NCNA 2Z93A 3RWJA 1DQQB 4N90D 4D9RD 1J1PH 2Z0BA 3SN6N 3KVQA 4JEGB 4LARL 3K81A 3R06B 4LSTL 4L4VD 1CF8H 4GKNB 4F58L 4YHMH 2FJFA 5IVZA 4NCC1 4EI5C 3TO4A 3RWJB 2J12B 5EWIH 4JRXD 5E6IB 4PBVC 2HLFD 5E5RB 1FFOA 2Y5EA 3IDUA 4BQ8A 4RZCB 4AEHH 3T0VA 3HMWL 3T0ED 1W0VA 3ULUH 1CGVA 2P1YA 4QHMA 1H8NA 2VC2H 2CLRB 2VZOA 5IFHH 4Z7VB 4ZAKD 3P9LA 3GRWH 5FCUL 1IC4L 4UDTA 2YPKA 4DW2L 3PWJA 5ILTL 3L7FA 4HS6A 2OTUA 5HI4D 5SX4I 2Z92B 1P7QA 4YHYC 4U1NB 3QUZD 1JPGA 5IQ9A 3D9AH 1YMMD 2ZSVB 3V5HB 4ODWA 4ZOCA 1N6QH 2N1KA 2R2CA 4OD2B 4XP9H 3AS1A 3PDOB 4M5ZL 5C09E 1H15A 4XMKL 4LAJH 3EYVB 3B2UD 3LN5A 2H6PB 3MC0A 4LU5H 3VE0A 1U8QA 5IQ9B 2GFBB 1NGWA 1S7WB 2W9LA 3SOBH 2HTLD 5HD8D 5I75B 2JJWA 1B4JH 5C08A 2FEEI 3MV8E 2NTSP 1LP9F 3WN5A 1EEQA 3ZE1F 1UCBL 1KV3A 3VXSB 2D31A 3GZKA 1KXTB 3BESR 3GI9L 1MIML 4GAJL 5JR1L 2YPLA 2BHYA 4YDJA 4FZ8L 1WICA 5F71A 1P1ZB 1CFNA 2IPKA 4POZC 4U6TA 1AR1C 4FQXA 4M9PA 1SEBA 5HHME 2CR3A 2DQTH 3PHQB 3MRGA 3AXLB 2ERJB 1DANU 4MA3A 2D4FA 5FYJD 4EUPA 5HGBB 3MRDB 3P73A 4F8QA 1T6VN 5CEZD 4OLWL 2XXMB 1KLFA 4YDJB 3P11L 1EUUA 4MB3A 2UVEA 2NY3D 2ADIA 2V5SA 2DQIH 5LVEA 1RZIB 2YC1A 1RJLB 2BMKB 1BF2A 4Y4KB 4X80H 4MQ7B 4QKXB 3HCVB 4KMTL 1TJGH 2DYPA 1R3LB 3B6SB 2NY7H 4GO6B 3LPGA 2X7LB 2EH7L 5C0BD 4OGYH 4Y19E 3TBTA 3C8DA 4E41B 3OB0K 1DQJB 2F5BL 2YEZA 4CDGC 1OP3H 1SVZA 3SDAA 1AD9A 5KTEL 4H20L 4OD1H 3CVHL 1W0WB 3IKCA 3WKML 2P48B 1T5WA 4J2XA 1AI1L 4DVBA 1CTOA 2AQ1A 3BP6A 3L3JB 2NY4B 1NLDL 1OAUL 5IBLC 1BFOB 3KLSA 3QJFA 2GCYB 3QUMH 4O2CA 2OL3L 3EW3B 3GHBH 2VWEE 1D9KD 5AYQA 4UNTA 4P5KB 1V7NH 4NP4L 3BYTA 1A7RL 3K1KC 5D7JA 1G9MC 3T4YB 3VFSB 2X4QA 15C8H 4Z7VF 4KUZH 3QXDB 1U58A 3NAAL 3NH7L 3QDJD 5DHVH 3TZVB 2BSTA 1X3DA 3B43A 2VXQH 3REWA 3QCVL 2P8PA 5DGRA 4U6XA 4P46D 1QSFE 4U6VH 1EAPA 4WUUB 4D0BB 3SGJC 2XACC 1G9EA 3HMWH 1NFDA 4P3CH 2JB5H 5TQ0L 2F5AH 4YHNA 4J12A 2NCMA 4PJAE 3BFOA 3BH8B 2FJHA 3O41B 5KSVA 5D7IB 1FO0A 4GS7C 3T1FB 4Y89A 2J7LA 2EIDA 3C5SB 4LGSB 1T1WB 5DEFB 1KB9K 4RIRB 3DVNA 1EAPB 3PWLA 4JFFE 4IJ3C 5GISH 4CGTA 4R8WL 4G8GD 3OHXB 1LILA 4J8RA 1J1XL 1R3HA 1LO4L 4PY7B 5F7EH 5DEGB 2CK2A 1M7IA 1GGCH 2HG5A 4P2RE 3HZKA 2HRPH 5E2VL 3DVGB 1QVOA 3BYYA 3SE9L 4G3YL 1INDL 2DQGL 2VTFA 3HE7A 2UV3A 4P9HC 3MOBH 4NQSB 1T0NB 2ARJB 4HMEA 1FC2D 5ESQB 1D6VH 4ALAH 1MFNA 1XIWB 4PRIB 3VG0L 3SKJH 2C3VB 3T0EA 2J5LC 2HRPL 3G5ZA 5C9JB 4JZOA 2MQCA 1HIML 3DLQR 3GSOA 3MRBA 3HG1B 5CBEB 5JMRA 5JIPA 3K3QA 4U31A 4U6HB 2GUOB 3VWKC 3ZDYE 1YDPA 4JY5H 3JVGC 3MRMB 3B9KA 3BT2L 1XGQB 5GGTL 4N0CC 1IAIH 2HRLA 1T6WA 2CUMA 3SDYH 4XZUB 1NAMA 3L95A 4YNYA 5DMKA 2A0LD 1DQML 1UFUA 4OCXH 5KJRL 1OLLA 3MZGB 1VENA 1Q0YH 2E6JA 3FQXA 4P2RD 1C12B 4JFEB 5I9QC 4BM7A 4PRAA 5I6XB 3PHQA 5C7XL 2XWJA 4OT1H 1IGFL 5JW4M 3K46A 3S5LG 4DKFL 5EUOF 1DUZB 5JO5A 1IM3B 3O11A 5GS1C 3I50L 5ADOL 5FDWB 4MJ5B 2M2DA 4OSUL 4RNRB 1RUQL 5BQ7B 3CFCH 1OHQA 3IAPA 5FO8B 1JYXA 2CKBL 2D2OA 3LRGA 2AEPH 1A7NL 4XVTH 5I75C 3ZDYF 4LSQH 1RK0B 1MCRA 4PJ9A 5I1KH 1U8OB 1ZT7B 2BP3A 5ICZA 3VD9A 1EUTA 3ZL4L 2V5MA 4OLVH 1KB9J 1SHMA 3MV7B 1D5XA 2X4TA 3I6GA 4YJZL 4R90L 4WCYL 4ZS6D 3FQTB 2MWCA 3G9AB 1LQSR 4H5SA 5J3HC 5BZDB 2KKQA 1JHTA 3E1F1 5GRJH 4KJQD 2D7OA 4JFDE 3HB3C 4UV4L 2YPVL 1CD1B 4TYUA 4PGDB 2ICEA 2CRZA 2AJXL 3JV6B 4S1RL 3ARTA 4O4YL 3DUSB 3QUML 4FA8A 1Z3GH 3DGGB 5JA8B 1T7ZA 2D7QA 4YBQC 4I18C 3F7VB 4K2UL 3IRZA 4NNXA 4K8RH 4LKXA 1CFQA 3GK8H 1ZHBB 4KAQH 3WJLA 1GOHA 4WV1A 3HN3A 3QHZH 2NW2A 3C08L 3QXAB 1KELL 2IG2H 1LEKB 4JR9H 3X14A 4ZQKA 3P4NA 1J7VR 4Z7UE 3T4YA 1T22A 1ZAGA 1ND0B 3B2VL 1AY1H 1KT2A 3RFZC 4FQ1H 4TPRH 2E6PA 3EFFB 3UPCA 1S7QB 4LLWA 3R8BB 4JE4B 3UZQA 3T04D 3U83A 3ARDD 3JVGA 4FQCH 3U2SB 5E7FA 5MEPA 3C2AH 3Q5TA 1JGVH 1KTLB 3EJZD 1NFDB 4BK5A 2IANB 4DTGL 1CI5A 3BJLA 5HHMB 2P7TB 4I0PA 2FJHB 5KSVB 1RZKL 1N5AB 2X9YA 2CKBA 1ZLVH 2GYSA 4OM0L 5CZVH 3MRRA 5IROC 4P23C 2UY7A 4LLUB 5IG7A 3KJ6L 2HJKA 1JIBA 5EG6C 4Y4KA 3VE0B 4DCQA 3QEUA 5TDNA 3U1SH 4KKNA 4Y19A 2VXVH 1FRGH 4PJDA 1R3HB 4KRNA 5ACZA 5DLMH 5C2BL 4Z7UF 1T7WA 2O5ZH 2A2QT 1YNTB 2D0FA 4HWEH 5CIPB 4ZS7H 1VERA 3QJHB 3BEWA 3WEXA 4OCWH 2I24N 2JCCE 3I9GL 5IBUB 4MS8D 1A6VL 3DXAD 3O3BB 5HGHA 3IKCB 1CFNB 1L0XA 4MAUH 1X4YA 1CXIA 5ILTH 1OM3H 4RMQA 3VGHA 3QUZB 4FP8H 3MRDA 3P73B 3IFOA 4Z78B 2HLAA 3OKEA 3GM0A 5I1EL 3D0VA 4MDJB 1HE7A 4HUUB 4L1HA 4NBZB 5GJTL 5HGDA 4RZCA 1CT8B 3VG0H 1TJGL 1BJ8A 5D93B 2NLJA 3SDDB 3SE8L 1NLDH 1Q9OB 2WUBL 2W9EL 3HMXA 1NCWH 2XKNB 4Z18A 3IDMA 3OKDA 4DVRL 5ID1B 2D7MA 2ZKHL 4GKSB 4FXKA 2Z9TA 3GMRB 5IWLA 1EK3A 1A3LH 3NCJH 2P5EB 4U05A 3EOYG 5C07A 5TFSH 2CIKB 5EU6E 3VH8A 2HTKD 4XPGH 1DBBL 5D70L 4LARH 43CAB 1LEGA 4D2NA 1FLRL 3T0EE 5HYJA 2EC8A 4I77H 5I1LB 1EVTC 2B1HH 3ARFD 3RPIB 4W4OA 2AV1A 1KSRA 1NAML 2RJMA 1NGYB 4ODHH 1N4XL 2Q6WB 4JDTL 1I1FB 4Q0XH 3L7EB 4GKZB 1DBBH 2DS4A 4ENED 3M45A 3HR5B 1F3DH 1T1YA 5D8JL 4L9LB 4CUCA 1KULA 3LEVH 5B3JE 1A7QL 2QR0A 2GSIA 4ZOAA 1QG3A 3EYFA 4JFFB 3VXRD 3WDIA 2YXFA 2YD1A 4K7PL 4KTDL 1J05A 1J8KA 2ZCKL 4QRRB 4JN2A 1UH4A 4PJIE 5DXWA 1KB5A 2FJGA 2WUBH 5EU4A 2AJZB 2DWEA 3VDCA 3TWCH 3P77A 3RGVD 4IRJA 5MI0B 1T1YB 4N0UA 4TUOA 4MA8L 3BE1H 1EIBA 4M7JL 3TCXA 4JPWH 3MCKB 2BC4A 5L2KA 2IPUG 3KPRA 1GC1L 5EO0B 5HVHB 5CUSH 2FGWH 4MA1B 3N85H 5D93C 2Y9RT 4XI5C 3B5TA 3O8XD 2GAZB 3H9ZA 1IEBA 3CD4A 4JJ5A 3S37L 4FQQA 5DYOA 2R4RH 4PBXA 4ZQKB 2O93L 5H94A 4LHQB 1J1XH 3V0VA 4BFEA 1RJCA 3S7GA 2VXSL 2ZUTA 3UTZA 3GSQA 2XPGA 2JJSC 1ZHKB 5CINH 3K7UA 3U2SA 4CVXB 4HGKC 3WS6C 1EXUB 3SKMB 3MBXH 1PEZA 4Q58C 5GZOD 4MCYA 5EWIL 5IVXE 1PKOA 5GRVK 1D3CA 2KPNA 4YZFE 4Y8DC 3TBWA 2ZUWA 4OGAD 3L3KB 4MAYC 4Q9BA 2YD4A 4WO4B 3LKQA 2AXFA 4UINL 4HCRH 1U8PB 5FA3A 1JZ8A 3BKMH 3RDTA 1X7QB 2CUHA 3S5LA 4RMRA 1Q9WA 4XCEA 4L3ED 3WLWC 2FWOA 4OF3A 2V17L 3TP4A 5E08H 4HLJA 1F4WL 5J0BA 3HPJB 2ZJSL 2HKFL 3U30C 4M5YL 1YEFH 3MA9H 2E7BA 4WI4A 5IBLD 3QO0B 3KWWA 1Q9WB 4HQQH 4YIQB 4I0PD 4UAOB 3MGOA 2R0LL 3ZYIA 5DRWA 1KJ2A 3L5JA 3SGJA 1T20A 1PBYA 5INCA 3LVEA 1EMTL 1NBQA 3AMLA 4BZ1H 4YHPA 5FO7A 1G9NH 2XQBL 4Z78A 4EQ3A 5E2TH 2DI9A 4Y2DC 3TO4C 3RL2B 3UBXI 1ZSDA 3T8XB 3PQYE 1CFVH 2YN3A 3VFPB 4G42B 1HILA 1QPXA 1OY3B 3QEQA 4JKPH 4TSBH 2QHRH 5D2LA 3C5SA 1I1AD 1DTUA 3RVUC 4EI6A 4L3EE 1UXWB 4IHOA 4Z95L 4NHCL 2AJ3B 3CMGA 3U0TA 3OJMB 2EYTA 5E8NA 4R97C 3VRIB 4JLRA 1S9XA 2NY2B 2FO1A 4X6CB 2VDOL 5F8RC 1NPUA 4WNQB 1BLNB 2FB4H 3T2NH 1NBVL 2RR3A 4XMKH 3W0WD 3MLYH 3QQ3B 5DC4B 4EOWH 3HRZA 3QI9A 1P84J 4YBLC 2XZCH 1Q9LB 1MCDA 1MHCA 4JDTH 3W9DA 4HS3A 1S7SB 3FZUC 3H7BA 1XGPB 5E4EC 3F58H 2CMRL 5C0IB 4PRPD 43C9B 3O6KH 4FNLL 4JFED 3QEUB 4L8DB 1NCAL 4OCYH 1JHLL 4YBQD 5BOPA 1T7YA 3HI6L 2VKWA 3S9DB 3HG1A 1G9NL 4KY1L 4P3DA 1RZJH 3IJSA 5J6HA 5GXBB 5L2KD 1XF4A 1BGXL 3MRGB 3VXMD 1XGQA 1HXMA 4P5TC 1MCSA 1XGPA 2DYPD 1A6UL 4JANA 5TE7L 3STLB 4P4KC 4JQIH 3FOMB 2F19H 4K23L 1S9VB 4DEPC 3G6JB 4UOW0 2UZXB 1ZGLP 1IAKA 2NTFB 3E3QC 4HFWB 3C9NA 4TTDD 3B2UC 3QEGL 3L3DB 2CR6A 3L3HB 4CADA 1AKJA 4L3CA 4MAYD 3LQAH 4JANB 1HEZB 3UAJC 4MB5A 4R26L 1MJUL 4OQTA 3VMOA 3ZE2E 3TVMA 4FG6C 3BSZH 1DQDH 4HDIB 1TNNA 5E2JA 5JHDE 3SKJL 3OJDB 3T65A 5GZND 5FHBL 4MD5A 5GZOC 5DJZB 1KIPA 5BS0D 4WO4C 3MLVH 1IGML 4KROD 3SY0B 5IEKB 5IMMA 3S4SG 2X1WL 5L7XH 1BVLA 1FL5A 3V7AE 4Y5YB 3WDHA 1MFCL 3WBDA 2F74A 2BOCA 1OTSD 5IGXH 3OKKB 2LTQB 1U92B 2A0LC 3F7RA 3STZA 3KLAB 4KKLC 5ETUB 2E9JA 5D6CB 2EDOA 5C0EA 4JG0L 3UJTL 3KGRA 2R0WH 3O4LB 4IIQB 2OS7A 5A2JH 2DTML 2VLJE 3WDJA 3QEQD 3N1QC 1EEZB 2HT3D 5D5MF 2LTQC 2BFVH 4NFDA 3DX8B 3UTTE 3BWAB 4OT1L 5D2NC 1N0LA 5D5MB 5I71B 4UILH 3KXFE 2HAZA 2Z8RA 1ACYH 1K8DA 3C60D 2X9XA 4J3TA 4Y4KC 1KJVA 3CZFB 1I9EA 4M7LT 5MEND 1FFPB 4D9LH 4NNPH 1GGYA 3VXMA 2CXKA 4ZD3L 3BVNA 3LKSA 3DXAE 5KVGH 4WY7H 5T3ZE 5GS0L 5C6PB 4RAUB 4JFDD 4EKXA 2HKHL 3BD3A 4TULH 3MGAA 5J06A 4UQ2A 1SBSL 4ELMF 1L6XA 2Y5TA 2K7QA 2Y4SA 1NH6A 1NEZB 5EO1B 3WIHH 5IUSA 5D5ME 1VGKB 3A0OA 5EU3B 3T4AA 5ACMA 4R2GD 1BQHG 2OK0H 1VGEL 5TF1L 4D94A 2FLRT 5DD5L 1MCWW 3KHOA 3K2UH 4FQXC 2MCG1 3T09A 1XF5B 5SWZA 1UACL 2Q6WA 2X9WA 4DGVH 2KQMA 5L6YL 1P7KB 2VLKB 4HWBA 3V95A 1BIHA 1DN0B 1T3FB 3GUTA 4OGYL 1VKXA 1BM3H 4M4RA 4YLQT 1IEHA 1F00I 3U0PA 4GRMB 3S35H 3F7YA 4XBPB 4U6HA 4LRIC 1CD8A 4JVUA 3O6LH 3H42L 2DKSA 1BHGA 3MRMA 1KCLA 2RBLA 4YXHH 4RX4D 2DBLH 2OJEA 1JP5A 2C7UA 3EYOA 4N90E 3LEXA 5K9OA 4BKLB 3C2AL 4LSQL 3SCMC 2YMXL 2VDOH 4M43L 3HUJE 1WEJL 3IAGC 1T0NA 2ARJA 5F93C 3GEWB 5K9QI 4P2QD 4AY0A 1UEMA 5HI3D 2XWJB 4HUUA 5DD0L 5C08E 3QH3B 3ZKQD 1FV1A 5CLWA 4ZUVB 5KZCB 4LASL 3MLTB 4NKIH 1H3TA 5D6DA 2V2WB 4UUJB 2EDHA 4HIIA 2QV2A 2XA8L 4MQXC 5I16A 5BV7L 3EOAA 3O9WC 2YPLE 3CLFL 3BPLB 5ERWA 1FNHA 1V3KA 5J6GA 1ZK9A 4M62L 1RUQH 4IMLB 3P30H 1EHXA 4W68A 5DJ2A 2XZZA 1P9MC 1B4JL 4WFED 1QLFB 2P5EA 3ZTJH 5JOPD 5D2LE 5FHBH 5FUOH 5DA4A 4X6DE 1ZSDB 3T8XA 4DQOH 4B7IA 3ARYA 1A3RH 3RVXC 3ZT7A 4I5BA 3S3SA 5KW9H 2R1XA 1DEEB 3U7WL 3TNNB 1N6QL 4WWKA 1TPXB 1INQA 3QDMB 3OJ2C 3IU3A 3QISA 4P2QE 5JQ6L 3GRWA 4X7TA 1A64A 3JV6A 3EHBD 1IRAY 3RL1B 5I19L 1BOGB 5IJKC 5E2VH 1BQLL 1NC2A 2AJSL 5BMFL 4RGNB 5EU5A 4NHCH 3FN3A 5ICYB 2PTTB 5E4IA 4KRPD 3P77B 4PP2A 4CMMA 5ID0B 3IJHA 3AS2A 4FQJH 4CKVX 1U8QB 4URTB 3GSUA 2R23B 3RY6A 2XQYG 1T4KB 3BQUD 1ITBB 4DGYH 3S4SA 3WNKA 4PYGA 2ERJC 2IQ9H 5L2JA 2YUXA 1CG9A 1JRHH 1YQ2A 5JLZB 5E0QA 5D71L 4QWWC 3N0PB 2DOCA 1QLEL 5KOMC 5TE6H 1A9EA 2D31B 3DRQA 1HHIA 1PZUB 5I8KL 4WFFD 4H0IA 4ZYKB 3RAJH 1WAAE 2P7TA 1F42A 1S7RB 4HMDA 3VGBA 3G6DH 2BRRL 4M1GL 5IW1B 4PRHB 5HYJD 5KVGL 4ZPTB 3V5KB 1P5UA 5DJYA 5A2KH 3K4DA 2HJFA 2RHEA 3QXUA 2ADJB 1IAOA 4Q2ZA 4AL8L 1MHEA 4I2XB 5DQJB 2CDGB 3OJDA 4XBGA 1R5WA 1WWAX 2PW2B 4MXWH 1KCUH 4LLYA 4IRSC 2KL6A 3CMOL 1DE4B 3EOBA 5FA3B 4HT1L 2X1OA 3V5KA 1A7QH 2OXHA 3UEZA 4KVCH 1EHLH 1GZQA 5CSZB 3VXUE 2EKSA