3GHEL

Crystal structure of anti-hiv-1 fab 537-10d in complex with v3 peptide mn
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
214
Chain Sequence
QSALTQPASVSGSPGQSITISCTGTSTDVNGYNYVSWYQQYAGKAPKLIIFDVSKRPSGVSNRFSGSKSGDTASLTISGLQAEDEADYHCSSYTSSTPYVLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 537-10D, light chain
publication title Structural basis of the cross-reactivity of genetically related human anti-HIV-1 mAbs: implications for design of V3-based immunogens
pubmed doi rcsb
total genus 43
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheL02
5HHNA 5IUSA 4NCC2 4KRLB 4PJGA 1CLZH 2MTPA 3BWAB 4Y2OA 3VXPB 4GG6F 2VB5A 5L88L 5KZCD 2A1WL 2BHUA 2EIZB 5D96C 1I7TB 2AQ2A 4UAOB 4JZOA 2OJZH 3FQTB 3TZVB 1S5HA 1PLGH 2XN9A 4K3JH 4HLJA 4LAQL 1VFUA 1AE6H 1JNLL 4D8PB 1WFOA 1I1CA 1S9YA 4NN6B 4MCYA 1UXSA 4MAYB 1RHFA 4W6WB 5MENB 4NQXA 3RL1B 1IAIM 5T1MB 3O41B 1F6AA 4XPHH 1G9EA 5JLZA 1G7IB 1IC1A 3IDGB 1Z0NA 3NN8B 3QWRD 5L9DL 4CMHC 1E6OH 2HVKB 3LEXB 5ALCL 1YY8A 3JV5A 3B9KD 4OCMC 4GBXD 4KRPD 1ES0A 2R1YA 2PW2B 2CKBL 3DUHA 3DUSA 3FTGA 1I8LA 2Y5EA 3CSGA 3MRNA 5C0ND 2DI7A 4RFOH 4XGZB 4ZG1A 1B4JH 4L8BB 3UC0L 4C4KT 3HNVH 2FCBA 5EUOE 1RJCA 5TPWH 2YUXA 5T3XL 5IVXB 4X4MA 3ROLA 1DSFH 4HEPG 1U3HB 1KJ2L 3S35H 3CX5K 4FFZH 1MCIA 1MLBB 2XV6B 2PYED 4JRXB 4OTXH 3BKJL 4JZOB 3UTTB 1HWGB 3IVKB 1A1NA 1S5HB 4KK9D 2NTFA 4P5TB 3MRIA 1MFEH 2J8OA 3AROA 1RSFA 2FB4H 5D7IF 1CE6A 4OKVA 1DJSA 5B38B 1JL8A 5J1TC 2WINB 4XPTL 3SDYL 3BQUA 1OF2A 4GAJL 5DVOA 4G6AD 4HHAB 3OKOB 5T1KD 5JLZB 4JB9H 4WGVB 3CC5A 1N5AA 3NH7L 3T3MF 1FORL 4L9LC 3SOBH 3ET9F 4YDKL 5I30L 2MPAH 4PGJA 3E3QC 1YY8B 1QRNA 2FATL 4G80A 1HXYA 5I8CA 1NC2D 3OQ3B 1FL3A 3ZSSA 1U0QA 5DYOA 5IMLA 4OZHF 3QCTL 4ZFGL 3GJEA 1IQDB 1NEUA 5KS9A 3LN5A 2R2HA 1ZLWK 1BQLH 1F3DJ 1KB5H 4HC1H 3ROLB 1A7NL 3KLAB 4PJ8C 3CVHA 4EZMA 5HYSG 4Y88A 1CU4H 1N64L 3MC0A 3HB3D 5BQ7B 4X6CB 1OP5K 3WN5C 3OR7B 2VC2L 1ZVSA 1N6VA 2P44B 1MNUL 5IF0B 4CKVX 2XT1B 5D6DA 5C0JA 3WUWB 1AR1D 1CGYA 5CBEB 4WCYL 5F8QC 4CN4A 5FYKL 1UQSA 2V7HA 3BQUB 1YEEL 4R2GC 4JEGB 2YHGA 5C08A 3QSKB 1GL4B 5FGSA 3NABH 1S7UB 3OPZH 4QEGA 3T1FA 4TSBH 5F3BB 4MJ6B 4G80B 2R2CA 2D7MA 1BPVA 3TPKA 3PDOA 4LHUB 5IG7A 2A73A 3FMGH 4EEEA 3BUYA 1L7IL 3DRTB 4MNQA 4UT9H 5IMLB 3H3BC 1X5HA 5L2KA 1MJUL 1K8DA 3O2WL 3GJEB 4LLQA 5KJRL 2AXHA 2SEBB 1H8NA 1VGEL 3HPJB 5BW7C 1XGRA 3OKYA 4QCIB 3LN5B 5KS9B 3MV7E 2A2QT 4QHMA 1B0RA 3U6RA 3CVHB 1BZQK 4HUXA 3I75A 4ZFZA 4EN3B 3SQOH 1F3JB 3MSPA 4LOUD 4IDJL 43C9B 4X6BB 3VG9C 1LMKA 1MHCB 3WDJA 1ZVSB 1EUUA 4JO3H 4ZMAT 4YHPA 4MQXD 2VSCA 3A6OA 1ZANL 2UUDK 4NWUH 1IM9D 1BVKA 1NGYB 4OJFH 4LU5L 5D72H 1HEZB 4MDJB 5CLTA 4NQSB 1TNNA 1WWAX 2EDYA 5F9WB 4K3JL 1C1EL 1I3UA 2FNBA 3KXFA 1CFNA 2HFFA 1LD9B 4JRYB 5GRVK 4XC1H 1FNEB 4KHTH 4POZD 1SBSH 1Y18A 2A6JB 3KPSB 3TYFB 5JO5A 3QUZC 1LEIA 1WTLA 4AJ0A 3ULVL 3PDOB 4GSDL 2ED9A 3L7EA 3WS3B 2A73B 2X4OB 2ADGA 4FQLH 2A0LD 3O6KH 3SE3A 5DRXB 4F80A 3NAAL 5ACMA 4KTYA 3ARGD 5L2KB 1G9NC 4HZLA 4ORZC 1K8DB 3O4LA 5ILTL 4MZ2A 3DV6A 3ISWA 3SDCC 3LKOA 5E7FA 1LP9F 4TSCH 1FDLL 3UBXI 1JI1A 5JHDA 1RK0A 3QFJE 5D6CA 3I75B 3FB7A 2Z8SA 2GSIB 4RFNC 5ETUA 3OAYK 3VG0L 4OLUH 1I9IH 1DQML 5HPMB 1IGFH 4NZJA 3UROR 5TPWL 3ZSTA 2HJKB 3BHBA 1ZA6B 2NLJB 3CK0L 5CWSA 2ZCHH 4XCNA 5TQ0L 4FFZL 1AD9B 1BVKB 2J6EH 4XNQB 4OCNC 3BYTA 4CN1A 1SBBA 4JFXA 4LKCA 1UA6L 4FQ1L 4Z5RA 5C71A 4BZ2L 2YPLA 1FNHA 2MQCA 3WLWC 4NN7B 2VIRA 2ERJC 3KXFB 1CFNB 3N1GC 3MGAA 4MLSA 4PJ7E 3AM8C 1PJ9A 5T1DL 1KIPA 1PVHA 1Y18B 2BSRA 2BFVH 3TVMD 2MCG1 4HIJB 1LEIB 1T80A 3JV4A 1JJUA 1IM3B 3U7AA 4OFPA 3L7EB 2ADGB 3QDMD 3O9WB 4YHZH 3I6LE 3H9SE 4YEEA 4HZLB 2HVJA 3PQYA 4NJAH 2MPAL 1AXIB 4I77H 1AJ7L 5TDOA 1I3GH 5H35A 2EDHA 4OI9A 3QULA 4YPGA 5CJXA 4P9HH 5A2IH 1RK0B 4ISVB 4LLMB 1I7UA 5D6CB 2R1WB 3HZVB 1A4KB 4F37K 2JIXB 3EYSH 5F1IB 1OT2A 3WFBL 5EO0A 3N1FC 4ZUSB 2GAZA 2NY6D 3I50H 1DEEA 5IWLA 3C6SA 5ACZA 1K9TA 3SEPA 1DBAL 4UINH 3IKCA 2JB6A 3ARBC 1K2DA 3W0WD 5IW1A 5E6IC 2VZ3A 5FO9B 4JFYA 2VLRD 2YD4A 2BXYA 4U6XA 2OZ4H 2YPLB 3BDYL 3HMWL 2X44D 3RIFK 5SX5H 4UB0H 5EU6E 2NY0D 5CJ8A 5EUOB 3QEQD 1KIPB 2BSRB 4X80L 3W9DB 3U9UA 2RAMA 4P49A 1KJMB 2X4PA 5GS0H 3M07A 1QYGL 3JV4B 3LEYH 1I85C 4WJ5A 4U7SA 5LBSH 4H20H 3NABL 3OPZL 4FZ8H 4OCXH 4RAVA 1RZFL 4KJPD 4TSBL 1J12A 1F6FB 1FNAA 5DMKB 5TDOB 1I1AB 1T2XA 1MRFH 1Q94A 5C6TH 1Q38A 1FYHB 1X5JA 1ZHNA 1IAOA 4U3HA 1NCNA 3DYMA 1I7UB 1PG7L 4I3RH 4K3HA 4O2FB 5ANMA 3O2DH 3UXFA 3SKNA 3FO0H 2L4OA 4FQIH 4NO3A 2QV2A 3QHFH 1ACYH 1DUZA 2Y23A 5EO0B 2ESVE 5D71L 3BZEB 1JPTH 1Y6MR 1ZXQA 5EU5A 1FH5H 3C6SB 5ACZB 1MAJA 3GMQA 3OGCA 3IKCB 5JW4N 3VI3E 1XIWC 4PBVC 3S34H 5SWZA 3U0TA 4PRHD 4JO3L 1IL1A 3GK8L 4LBEA 3FN3A 1ADQA 4OF6A 3OKDA 3EDEA 4AL8L 5I1HH 4NM4L 4M02A 4PTTA 3C5ZC 1OARL 5CSZB 5EU3A 4JDTH 4AH2A 2YUVA 4KHTL 2J88L 1SBSL 4RAVB 3C60C 3BWUC 3V6OA 3O3AB 4XNMB 1U2CA 2WIIA 2FSEA 1RZJH 3MBED 1YC8A 3QDJA 2KKQA 3SBWA 1IAOB 3P77A 2HKFL 2HMID 2BJML 2F53D 4AQ1B 4NO3B 3G6AA 5AWNH 1DCLA 2FX8L 1BQUA 1DUZB 2NX5A 4QF1B 4HKZA 3NZ8B 2I24N 5C09D 2Y7QA 1UZ6E 3FRPA 5EWIL 1IE5A 3KPRE 2VLJE 2G5RA 3ALWA 4J1UB 3WFEH 5C86A 5GGUA 4TVPE 2FLRT 3ARDA 2F74B 1Z2KA 1T0PB 1JGLH 4FQXA 4FA8A 2P8PB 5KN5B 1L9MA 1GOFA 3U0TB 4PIRF 3BGFB 2IQ9L 5JDSB 1G7HA 1NAMA 1RZKC 3T08A 3L5HA 4JVUA 3G6DH 4NQTA 4M7KH 2FJHB 1QACA 4Z7VE 3S4SG 1U91A 3X17A 2Q3AA 3JVGA 4Y1AD 1FO0H 2D4FA 4ZOBA 4R90L 4NUGL 1AD0B 2YRLA 3IU3B 4AY0A 4UUJB 4LF3B 3L7FA 1D5IH 5EC1B 4PRID 2MOVA 2FSEB 4EUPG 2EDJA 3EOTH 3SDAB 4S1QH 3BKYL 2VH5L 3SCMC 3UMTA 2VISA 3DOSA 1R3IH 4NJAL 3G5XA 4WWID 3G6AB 4I77L 3HZKB 1I3GL 1CLYL 3FONA 4G6JH 3DJ9A 3LQAL 4HKZB 4PP1D 1OAKL 2BOBA 4X98B 4JKPH 5GGUB 4RQQA 4MQ7A 3U9PH 2A83A 4UQ3A 4FQXB 5F6HI 4YIQA 3E3QE 1S78C 5ISZE 4ODXA 3QEHB 4IRSB 1UVQA 4ZXBD 4XWOC 3QEUB 5I75C 2GW5A 3UJIH 1OAZL 2VXVH 2CK2A 3CDYA 1I9JH 2R8SH 2EH8L 3LRSB 2HT3D 3RGVD 4DAGL 3LB6D 4M1DH 3T0BA 5KSUB 4XTRD 5H94A 4DCQA 1J0KA 5BMFH 1U91B 4OUUA 1D6VH 3L3JA 1U93A 2QHRL 1LO3L 4UB0L 5LAXA 1KCVH 5JMOC 3V4PH 3GHBL 4XVSH 4JQXA 4S1RL 4M48L 4YDIL 3RBSA 3RRQA 3EHBC 1F4AA 5ITBL 1KPVA 1DLHB 3D0VA 1S3KH 3GSWB 4KRNA 4HMDA 3F7QA 3FQNA 4PJEA 3VW3L 1VA9A 5HHXH 3T77A 2AV1A 2PYFA 2VISB 1NCWH 3V0AC 2XKSA 4FQJL 4R26H 4YXHL 1CTNA 4RZCA 3HE6A 5HDOA 3OX8B 5J1SC 3MRBA 5MHSE 2VZ1A 3O2DL 4OFYA 1KLUA 4FQIL 4MQ7B 1N6UA 4UQ3B 3QAZB 2XA3A 3MV9E 2R1XA 3REWA 1QR4A 4OQTH 5F1SA 3H9SB 1FL6A 3HUJF 5HHMD 2OMNA 4KFZC 1G9MC 3C09B 2CUIA 1X7QB 1NMBH 4OGYH 4YHYC 4QRSA 2E8ZA 4HUWA 5FYJU 3S34L 4J2XA 2WM0A 3V8CA 3MRPB 5KOMC 3L1OH 4DCQB 4P59H 3WO4C 4XHQA 4NQDE 4OUUB 1EHAA 1A3LH 5J89A 5DJYA 5KANG 5F71A 1K4DB 1T1XA 5DJCB 4JFDD 1F4WL 4PJCB 1Q72H 3S88H 3AREC 4HQQH 1FGVL 1KPVB 1P84J 2P47B 1PYWA 3D0VB 3FB6A 1URLA 4YHLL 5JORB 5KSAB 1KYOJ 2BNQD 3T77B 1VFMA 1AHWC 2PYFB 4ZPVA 4ZUWB 1UWXK 3VXSE 3X14A 4TQEH 3NTCL 4ODVH 3SGKA 5KSBE 2P8LA 2QQLL 3RUGE 3PIQB 5EU6B 1KN4H 1U3JA 2G9HA 1HNGA 4N0UB 2O61A 3KYMA 5DUMH 2C7UB 4MVBD 5AWNL 3DIFA 4YE4H 2ZUUA 4GQ9H 5I1EL 1KIQB 25C8H 1Q8MA 2H32H 3TBSB 2ADJA 4Z0BH 1HDMA 4FFYH 4GMTH 4V1DA 4WUKL 5FYLE 4RGND 3IS0X 4QRSB 4XCCH 2AEPL 1ITBB 2ED7A 5EOTA 1RIVH 2W9EL 1J1PL 1IAIH 2BC4A 3HAEB 5DJYB 2DQTL 2ESVB 1KCRL 3F5WA 4JY6B 4MD0A 5AZ2L 1FSKB 4WDIA 4MLIA 4KVNL 4K8RD 2AERT 3HZYB 2QR0B 3VXQA 4N9OB 2VL5B 1KLGB 3WHE1 3TCLA 3WIIL 2E6QA 3O6FC 5I1CH 2ZSVA 4KROD 5DD0L 1WCBA 3MXVL 4CW1A 3GJFA 1FV1B 3ZHKA 1HCFX 5DURB 3OKMA 2P8LB 1S7WB 3P9WB 5IKCA 2FLBT 3CSPA 4WUUA 5I17A 1FZOA 2G9HB 1YMMA 3RNKB 2HWZH 5EPMA 2R69H 1IGMH 4WTWA 2VN4A 5IGXH 4G6JL 5IWLC 4PBXA 4Y5YC 4J3TA 1KCLA 4PJAA 1F13A 2EC8A 3MODH 3FFCA 5TDNB 3PDDA 3DRQB 1HDMB 2QQQA 4MS8D 2ZCKH 2P1YA 4V1DB 5I9QB 4QRRD 3S5LB 2N56A 1NLDL 2X4TB 3Q6FB 5EOTB 3VFMB 3GHEH 5JZ7C 1NCDL 1AFVH 3BIKA 4RMVA 5KVFH 2BC4B 4I0PC 1OSPH 2R8SL 3LY6A 4PJDE 4F57L 1JF1A 1YEDA 2P45B 3SKOA 4OLZL 3QHZL 3RI5F 4M1DL 2NXYC 5I1IL 3VXQB 4EVNA 4KHXL 3BH9B 3VJ6B 2GCYB 4CMHB 3RX7A 5F6IC 4FXLA 5A1AA 1F4YH 1N59A 3B5GA 1WCBB 5IR1A 4JFZL 4EOWL 3GJFB 1X5FA 4XVSL 2W0PA 1IAMA 3TIEB 4HKXA 2X41A 3OKMB 1F90H 1CD8A 8FABA 4PB9L 3I85A 1YMMB 2BCKB 1NCWL 4XXDA 1C5CH 1CTOA 5EPMB 3QB7C 4HFUL 4XAWH 4Z7VB 5E00A 3UZQA 4JFED 2VXQH 3FQUB 1D5MA 1GRWA 2Z8WC 1QHOA 4P57B 4GJTB 3IT8D 4LSQL 3MO1B 4DVBA 3B2UD 3FFCB 4WFEE 3WIFA 2R56H 2A6IB 1QFUL 3W9EB 1MRDL 4UTAH 5ADOH 1KUMA 3IFLH 1CD0A 2EDQA 4P9MH 3TF7C 3QNYA 1JZ4A 2HTKC 2LVCA 3BIKB 3X13B 3R0MA 5C6WH 5A2FA 5DJ2B 5CEZD 5T3ZD 2I60H 1YEIH 4XMKH 2D2OA 3FQWB 4OGYL 4PJGE 1I9RL 1J1OL 2OP4H 2WUCH 1GGBH 1RK1A 1EEYB 3Q1SL 5C0FA 5KVGH 3AU1A 1I1FA 2XFXB 5DJZB 1CFQA 3EO1B 3HNSH 1ND0A 5IEKA 4U0QB 5ISZB 4NC1C 5DS8B 3DHJA 4HKXB 4CDGC 2DRUA 5FK9B 5INDB 5F21B 1FE8L 5D7KE 1FBIH 2VKXA 1EUTA 3PP3H 1PG7X 5DD3L 1BZ7B 8FABB 2OQJA 3QPQC 3P0YH 5JIPA 1RUQL 3UYRH 4JKLA 3NOIA 4ODVL 5J1AB 2ZSWA 5D1QA 4PJ8B 3O8XD 5KTEH 4PRBB 5I71C 1KN4L 1UXWB 1KG0B 4DVBB 1JHLH 3WIFB 2C9AA 4DGIH 5DUML 1FC2D 5C0EB 4LFHG 4NZDA 4YE4L 2H2SD 4GQ9L 3Q6GL 4NNPH 4LVEA 3TNNB 3BH8A 3ZKND 3QNYB 2R4RH 1OAUL 1CDUA 4H8WL 4FFYL 4GMTL 1KCUH 3MRCA 1MLCA 2IANE 4R2GB 5DRWA 1HHGB 4J4PA 1Y0LA 4XVTH 2DWDA 1IARB 4HUUA 1SY6L 5DDHA 1LEKA 3DO7A 2ATPA 3H9HA 2QLVB 1PKQB 1T04B 3U4AA 4PP2B 2Y5TB 3MCLL 4S1SH 3NA4A 2FBJH 5ID0B 1TJIH 3SGEI 3CPLA 4U6YA 5D2NA 2OQJB 1SJXA 2F58L 2G5BA 1I1YA 4MA1C 3QUMB 1E28A 4X8JA 4NQDB 2Y6SD 4RAUA 3BXNB 1A5FL 2YC1B 3MLPA 1T2QH 2DF3A 3CIQA 4ELKA 1ZEAH 2CDFA 4HJJH 1H5BB 2HWZL 1F6LL 3G6JE 1AC6A 1F45A 2AXFB 5EC2A 5F9DC 4ZDHB 1I8IA 1TVHB 4HPYL 1BFTA 2J4WL 5BS0B 1BJ1H 4Y19A 1VGKB 1XR9B 5T33L 1O7SA 4X6EA 1TPXB 2ZPKH 1JGDA 5KSBB 3QXAA 2ZCKL 3JWDC 5DFTA 5F1KC 1MHPL 1PY9A 1G0DA 3EOAB 3HC4L 3RUGB 4JM4L 3QIUD 5DRWB 1Y0LB 4ZAKA 4EJ1C 2DWDB 3IFNH 4XVUC 4HUUB 1LEKB 4JQXC 2VKWA 1A47A 1WQVT 1IGJB 3QUZB 5F9JA 4TNVK 1NGPL 1OSPL 4OAWB 4TPRL 4QRPA 1HILA 4L3EE 4FQHA 4NIKB 3G08B 5K9KB 2P5WD 3OKLA 4XI5C 1NGZA 3NFNB 3CH1A 1I1YB 4YGVA 4L1DA 4PLKD 4X8JB 1UJ3C 4PJHF 5HYQB 4U33A 4ZO8A 3VWKA 2XRAL 3LKNA 3OAUL 5GRUL 4P2RB 3F8UB 1WC7A 2BSTB 4UNVA 2Z91A 2CDFB 3BO8A 4DN4L 1BECA 2PKDA 1A6TA 4LARH 5DMYA 2VUOA 5EBMA 1OGTA 2AJYH 2AK4D 3CZFA 3QI9A 5GXBB 3DLQR 4PRPA 2I5YH 4X6EB 5IMKB 4WNQB 3F58H 4NZTL 3AAZA 5L2JA 3DYOA 5E0QA 2YD3A 4DOHB 1M7DA 4PRNA 1MFAL 5JW3L 5DTFB 1U3ZA 5IVXF 3IFLL 1L6ZA 1KTDA 3LIZH 3MRKB 3P73B 1QTYT 3MA7A 1KB9J 5FECA 4B7LA 4XMKL 4CMMB 3PWNA 3RWDB 3EUUA 2OP4L 2WUCL 1GGBL 2CLRA 3DBXA 4PY7A 4N5UA 4NHUA 1RU9H 4BSVA 1MSPA 4NO0B 1O0VA 4JFFA 5I2IA 3TO4D 3UZVB 4KU1A 3CDCA 1CGUA 5HYEA 3PWPD 1J0HA 3VWKB 3C08L 4TVPH 2PR4H 3QIBD 1BJ8A 4MXQD 1PKOA 5LWYL 2APVA 3WSQH 1MFCH 2DI8A 3EYQC 4PB0H 2ARJA 1N4XL 5I73B 3E1F1 3VRLE 5EBMB 2QL1A 4RBPH 1YEFL 3PL6A 1P9MA 5DJ6B 2AV7B 3CZFB 2D03L 5JIHA 3D9AH 4PRPB 3B8YA 3O4LE 3MCKB 1NFDA 4DGIL 1TQBC 1NMAH 4XZUB 1T3FB 1ZLVK 5E2TL 5CIPH 5ESAB 5JHDE 1KTDB 4NKOB 2WP3T 3KJ4B 2R4RL 4CVZA 3FOMA 3MA7B 1L0XA 5DI8A 1HYRC 2XOTA 4JHWH 3W39A 1YEGL 3PWNB 4G9FD 5JPNB 1H3XA 4XVTL 5EOCJ 1KELH 4PY7B 1RJYA 3PGCA 5C70A 3CUPB 5E9DE 4XX1E 3SGJC 3NGBB 2OTUB 4JFFB 4WIQA 3K7UA 2R0ZH 1JPST 2R29H 4S1SL 4FQQB 4BUHA 3ZL4H 1VFAA 2NY3B 4HDIB 1CLOH 3X3GH 4ZTPH 1TJIL 2YD8A 4QTHB 2LABA 1CLCA 4DGYH 1MCOH 5T5FL 3MA9H 4MXWL 2H41A 2KQNA 4P2QD 2C1PA 3HR6A 4P23C 2AEQL 2EEBA 1UJTA 4N8CH 4APQD 1ETZA 4NQED 1OP5H 1XIWB 2CIIA 2OR7A 3GO1L 2GJJA 4U6VL 4HJJL 4WI8A 3KJ6H 3RU8H 4HWBH 4Z0XB 3GSNA 4KTEL 3MREA 5ICYA 1D6EA 3CVIL 1P5UA 4EDXA 4LDEB 5IMOA 4BFIA 4CVZB 1WICA 3ZTNL 2ZPKL 4JPWL 1V3JA 3KYOB 4LDOB 3PP4L 2DKUA 5IM7B 4O9HH 2DM4A 5DK2A 1CI5A 1EFXA 4HXAH 1FYTA 1X3DA 4N0CD 3IFNL 2XG5A 3MFFB 1A9BB 4ONHA 2CKNA 4JHAH 5CGTA 3SGEH 5I18H 3DV4A 2BVYA 3LZFH 1L7TH 3C2AH 3T65B 4LLYA 3H3PH 5C07E 5DLML 2EXYC 5DD5H 2I9LB 5EZOH 1ZTXH 3HMXL 1UWEH 2R4SH 3MR9B 4Q9CA 4N0FB 2QADC 4MCZA 2C1PB 2XZQL 1QFWM 4IEFB 2UVEA 3ZDZE 3QDGE 1CICA 1KC5H 3QWOA 4L4VD 4DVRL 2FIRT 3QUYC 4KI1A 1ETZB 3TESA 3HCVA 3KHQA 5AD0B 3IAGC 5HJ3A 3ULVD 2MCPL 3VXMD 3ZE0F 3EGSB 1N0XH 3B9KA 5ICZA 2AJYL 2YUWA 4GBXA 4WU7B 1FFPA 3GMMA 3MREB 4LPYA 5ICYB 2E7MA 1D6EB 2UUDH 1HI6A 3MGTB 3RWEB 3VFGH 4X6DA 4EDXB 2DS4A 5A2KH 2I5YL 4OZIF 1V5JA 2R9HC 3UO1L 3O11B 4DZBA 4NHCL 3VXUD 5J12B 2X1QA 1J0YA 1OTUC 5E8DL 5HDBE 1FYTB 2PO6A 3MLZH 1V05A 3C6LD 5T1LD 1NFIA 3BPCA 3MLYL 3DECA 2ZCLL 3FAWA 4JM2C 1A14L 3SJVD 3WS6A 3I9GH 3SCMB 1Z5LA 3N85L 3UPCA 4MA8H 3OZ9H 3QXUA 4HWNA 4YWGL 4QT5A 4EBQH 5FHBL 4M6MH 3VWJD 4KI5D 1HH6B 1HXMA 3R0NA 2PR4L 1CICB 5FYLH 1GAFL 3OAYH 1MCKA 1MFCL 3T0EC 3L3GA 4FN0A 1IEAB 2GFBB 2VXSH 3QZWA 4OLYH 3TFKD 2Z8VC 4NC1E 4L3EB 3M8OL 4Y2DA 4AT6B 4DW2L 1R3HA 3ETBF 5I6XB 5ICZB 3MLXL 5D1ZC 1ZSDB 1A6WH 1NC2A 2D7TH 2HKHH 1HI6B 4X6DB 1A3QA 3U7YH 3HI1B 1G7MA 1QP1A 1OGAE 2QTEA 4Q9QL 4W81A 2BSED 3TWCH 3L5WA 3D2UA 3M1BA 5HI4C 5IP4A 1KIRB 1CF8H 2CK0L 3BE1L 2Q87A 4N8VA 5CEXA 5HHVL 4QXGH 5DK0A 5DMJB 1MWAA 2JLLA 4MHHI 4KXZH 4JFHE 4AIZA 1D9KD 1RHHA 3MLSH 1NFIB 4AG4L 3BPCB 3ECBA 3EKCA 4JHWL 1IAKA 1CXKA 4XT1C 3D18B 1DN2A 3IS1X 1PFCA 3BGMB 1WT5C 2DB8A 5I1AA 3NIGE 1G1CA 2EKSB 2BOCB 3MLTA 4Y16C 3JTTB 5GGRA 4DTGL 5EUOF 4I3SH 5ELIA 1C8PA 3LRGA 5HI5C 3JXAA 3QR2A 1TNMA 2DDQH 5EU7C 1WFUA 3IDIB 3ZL4L 4IOFD 3D85D 1UCBL 1FQ9C 3X3GL 2Z35A 3VFPB 2WMPA 2YPKA 4TSAL 3L3GB 3RTQB 1SJEA 1P84K 5D70L 5I16B 3K8LA 4LPXA 2AJUL 2NY4C 4MQTB 4KUZH 1KYOK 1MFBH 5TE6H 3VMPA 4CRPA 3MJ7A 4JFOB 2ZNWA 4YHYB 1U8JA 3MBXH 3RIAK 2AABL 4JN2A 3D2UB 4AEIL 3K46A 3E2HB 5JXAL 1W72B 1YEHH 3G9AB 1I3RA 5CP3A 1I7ZB 1MVUA 4WO4D 4P46A 4PV9A 4GRWB 3TO2A 3T2QA 3AREB 4C58B 4XPFH 4PJFA 1AY1H 1W0YT 5I1AB 5JXED 1AHWB 3MLTB 5FM4A 3U48A 4G6MH 1IC5L 5L8JB 1INQB 3KPNB 5JIKA 1FP5A 5DUPL 2BMKB 3ILPA 4Z77A 1JZ6A 5I18L 2ZOLB 1P2CB 2WW8A 2RCSH 1EHNA 3S36L 5BRZE 1L7TL 4LHJB 2PTUA 4YO0B 1EDQA 2Z35B 1C5DA 4X6FB 4PY8I 1ZTXL 4L4TB 2EDEA 1UWEL 2YPKB 3QI9C 3IFPB 1UYWH 4JG0H 1EAJA 3JBG7 1OAXH 2OL3H 5E9DB 4YX2L 1KC5L 2HFGH 3BP6A 5E5MB 5D7JD 3MRDB 1A7QL 1A6VH 3EO9L 1HOCB 1U8JB 3ZE2E 4D0CA 3QUML 1KPUA 3TN0A 1ZT7A 5FKPA 4L5FH 4P5KA 4ZD3L 5IHUH 2JJSA 1FRGH 3ALPA 2F5BH 5IJVA 1MVUB 1UM6H 1RPQA 5KVDH 1X5KA 3TO2B 3MYJA 2PW1A 3EJYC 2DQUH 4DKFH 2C3VB 2XTLA 3P4OA 4QYOA 4M7JH 3O6FB 3NCMA 3HTLX 4NBYB 3MRLB 4LVOC 3V6FB 2EDRA 2KZWA 4ZOCA 5DMIH 4AENB 5IVZB 5HY9A 1I3VA 2FJGB 5GGSB 5BV7C 3TBYA 2ZUWA 3ILPB 5FA3B 3FZUC 2X42A 4MSWB 2EYTB 4AMKL 4C59B 4G8EB 4IRJC 2AXJA 2DL2A 1C5DB 1MY7A 1NBZB 1MIEH 4R4BB 1A22B 3QQNA 4Y5YB 4EBQL 3AFLA 3MGOA 4YAQB 4U1LB 2WIMA 1JZ3A 5GGTH 1JYVA 4Y4HA 1G9NL 3BP6B 4LRIC 3RVWC 1MFDH 4WWKA 3U7WH 3QDMA 3TZVD 2RFXA 3KNBA 4WTXA 4HV8B 3HC3H 2P46B 1R24A 1P7KB 2DTMH 1UACH 4RMSA 1W0WA 1KPUB 1TJGH 3TN0B 4PGCA 5FKPB 1G6RA 2HTLD 4P5KB 1A6WL 2D7TL 4HW6A 3UTSA 1DVFA 1Q0XH 4MAYD 4I0PB 5E99H 5FXCH 1NDMB 4LCYA 2AJXH 1CN4A 3GBNL 4XPBH 1HN1A 1J1XL 3QDGB 4LLWA 4KJQC 1T7VA 4KJYA 1OOAA 3HZMB 5HXMA 4JY4A 3HI5H 4WEUD 1GJIA 4EI5C 1RZKH 3FT2A 5LVEA 1GOHA 4CVXB 5EBWB 2F15A 4XBPA 3R1GH 2WBJC 3H7BA 4GW1B 3MLSL 4LPCA 1MEXH 2MFNA 4GMSL 1G7JB 3FB8B 3TBYB 2JK5A 4WFGD 2GJ6A 4R8WL 3SO5A 4HWEL 4GRMA 4U0RC 3UJJL 1PX3A 1OD7A 1T83C 4I3SL 5AUMA 1U8LB 3EZJB 3NZHL 5ERWB 2FR4B 2AKRA 2DDQL 3MGOB 1Q9LA 2FWOA 4NRXA 5CZVH 4Y4HB 4X5XA 4IMLA 1A2YB 3GMLA 3MV8A 4RX4A 5GJSL 2ICCA 1T66D 3KNBB 3ARPA 4HH9A 4P5TD 4F7CA 2NY5C 1U58A 2XN9D 1R24B 4NFCA 3SPVB 1PQZB 1W0WB 3T2OA 3WIHL 3U46B 4FFWC 3IF1A 3MACH 3X11B 4PJ7F 4M43H 5DFWH 1K3IA 3UTSB 2E7BA 4D0BA 5IOPA 1MFBL 1DVFB 4NRYA 1DL7L 1NAKH 3CLFL 2IPTH 3CAFA 4H0GA 4ONFL 4PRAA 2X70B 4S2SB 2HLFD 1EEZB 2GY5A 4JREC 3CFCH 3PE9A 5CJQL 2I07B 3QH3B 1YEHL 2YD5A 4P2OA 4JY4B 2ORBH 2FHFA 3FT2B 3P4LA 1RZIB 2Z4QB 3H7BB 3REVB 2CUMA 4U1IB 2OR9H 4XPFL 4XPGH 3WLBB 1AIFA 1BEYH 2JK5B 1AY1L 2DBLL 1XF2A 1OGAB 5BO1H 5EUKA 2IPUG 3HE7A 4XCEB 4KZDH 1J11A 5J06A 2AK1H 3F7VB 2CXKA 3EDDA 2RCSL 3G04A 5CILL 4X5XB 4IMLB 1H8SA 1BBDL 1SJHB 3MV8B 5I1KL 2LTQB 4LLUA 2YD7A 2K7PA 4ZQKB 3LKSA 2K3TA 5IJKC 3B9KC 4KRPC 5F3HB 3DVFA 3WKMH 1K4CA 4HCRA 3IF1B 3O2VH 1P7HL 4Y8DC 3OHXB 4UDTA 2EKJA 4NCDA 4D0BB 2OL3L 5IOPB 4FNLL 5DJ0A 4D9RE 5IROA 4OGAD 4KC3B 1CFVL 3FCTB 4OCYL 3BQUD 4HIHA 1FN4B 5EZLA 1DFBH 1YEKL 2VZUA 4K07A 5E1AB 2VDKH 4L5FL 5GGVL 3WFCH 2J8UA 4PV8A 3QIWA 2F5BL 5ADPH 5LXGH 1P7QA 5GHWH 2CIKA 15C8L 2W9LA 5EO9B 1QRND 3MJGX 1MUJB 4KK9C 3JV6A 4QRUB 4KKCD 1T21B 1GVIA 4DKFL 1MJJA 4TRPL 2UYLA 1DQTA 3PDGA 5JUEH 4PFEA 1AIFB 4FQCL 4RISL 1CXIA 4M7JL 5JIIA 4BQCA 1H3TA 4LSVL 5IHZA 3QXWA 1UWXH 3BJ91 2EE9A 5EUKB 4NQCA 5DMIL 3HE7B 5FYJE 1QBMH 3ARUA 1UM5H 4XMPL 4JR9H 3S97C 5FCUH 3BP5A 4G6AC 4KPHH 4HS3A 3G04B 2I9TA 1UB6A 2X89A 1BM3H 2WWMD 3NIDE 1TLKA 3T09A 1U6AH 3VI3F 1F2XK 4MJIA 4ZOAA 3LQZA 1KTKE 4R7DB 4ZO9A 3QEGL 5DC0A 5F97E 1KULA 1RJLA 1ONQB 3MNWB 2GJZA 1LE5A 3GRWA 1K4CB 4GG6A 3PXJA 5IHLB 1MIMH 1TZIA 5HYSB 5L6YH 3BIAX 5GGTL 2CDGB 2H2PD 1W0VB 3GSRA 3N1MC 1T0MB 5DJ0B 1MFDL 3U7WL 5EBGA 4U1SA 1HHKA 1S7SA 4PS4H 5E4EC 1UACL 4JPIB 5C08D 2VZTA 1DUYA 1FGNL 1JNNH 2C3XA 2FX7L 2GTZA 1YNKH 5IESH 4PV8B 3QIWB 1Q0XL 1HNFA 3B3IB 2A38A 4OBSA 3HB3C 5E99L 1RIUL 2ZG1A 1D5BA 3T0EE 2DYPB 2ZWLT 5JNYA 3GI9L 4MNQD 4U7KA 1AQKH 3LDBC 5L2KD 3IAQA 1AR1C 1FCCA 1NBYB 1RZKL 2EICA 3R1GL 4OM0H 1YUHA 1B90A 1E4WH 4IOIB 4AM0B 1MEXL 3GSOB 1BD2E 2VDQH 4Z7NE 2BNRE 4K3DH 1UZ6F 1EGJA 1HE7A 5E94A 5HDQL 3S8WA 2F5AH 3O81A 4HS3B 2I9TB 1FFRA 5I76B 1KB9K 1JRHI 1UB6B 4WFFE 4U05A 5MEQA 4JCMA 3HRPA 4JO2H 5EU4B 4MJIB 3BX7C 2VNCA 3IDXL 5TDPA 2GJZB 5IB3A 4GG6B 1P1ZA 5ESQA 4WI6A 5MP6H 1V3MA 3GSRB 2P7TA 1QSEB 2EYRB 5FOJA 1U8OA 5F44A 5IQ7L 4PLNC 4QWWD 2CMRH 1B6UA 3C2SA 4PJXE 4Z7VF 5EN2A 4M7ZC 3VD5A 3WD5L 3KXFD 1QEWB 4HBQA 5D1XA 3MACL 3JSSA 3IJSA 3EYFA 5EU7E 4YR6A 1DUYB 4M43L 2AJSH 5D7IA 4DN3L 1U8KA 3VFWA 2YK1H 1HZHH 4L3CA 2IPTL 4OCRL 1IT9H 3ZKXC 4LOUC 5JNYB 3C8KB 4D3CL 4HWZA 4MQXC 3DETD 4MNGA 2X2YA 3CFCL 1U92B 4TUJB 2Q76B 4MAUH 4PTUB 2FJFB 2XIDA 4XP5H 3RA7H 2DKSA 3OBAA 3A0OA 4PREB 4FFVD 4Q6YA 1VHPA 3GKWH 4Y4FA 3VFTA 2MHAB 2YPVL 2P5EA 3FQXA 4OZHA 3TT3H 4LGRB 2CO7B 4Z7WE 4POZC 2C1OA 1KSRA 1DP0A 3P0VH 5F6HJ 4OZFA 5IQ9A 1XF5A 4OM1L 4YDVB 5IB3B 2HFEB 2A0LC 5BXFA 1T7XA 5CUSL 5IT2H 3ARGC 4XC3L 4MWFA 5F96H 1J8HB 5C3TA 3W81A 4HJ0D 5DHVH 2KUTA 3MRRA 2YPLD 1B2WL 3IDMB 5E7BA 3IJYB 3WKML 5BZDA 5D1XB 1K8IA 3BZ4A 4YR6B 3WEXB 1BFVH 2IADB 1QKZH 3VFWB 3L3KA 4L3CB 1F3DH 1E4KA 1VFBA 3QA3A 1AO7E 1ADQH 3MNZB 4MNGB 3CCHA 5CLWA 4PG2A 4O02L 2VDKL 3ES6B 4HIXH 1M71A 1Y6NR 4JZJA 1G9ML 5ADPL 5LXGL 4MX7B 3PQYD 2ZUXA 3NPSC 5IFJA 1VB9A 4ONOA 1N2RA 1KENL 1XZ0B 2Q1EA 2AAVA 4ZUVA 1CD1A 2W0KA 4XRCA 1W72L 4DGVL 3S36X 4JKKA 3B2VL 3WFDH 4OZHB 1J87A 2WK2A 1LK3H 3IXAB 3FQRB 1MCNA 3BP4B 1CFSB 4R96A 3WFHA 3DO3A 1JK8B 1OB1A 1QBML 3TVMC 4GH7B 4YK4C 4NOBA 3WHXA 3U4BL 5IQ9B 4HUVB 3X3FL 1XF5B 1J05A 1DBBH 2J5LC 2PTTA 3VD7A 2F19H 2F8XC 2CJUL 2A9MH 5BXFB 2APFA 2BVQA 1H0DB 5DGQA 4MWFB 3VFSB 2EDOA 1SMOA 2BY0A 1IZKA 4WFHD 1K8IB 4K55A 5HHOB 4H5SB 1A6UL 2BERA 4Z76A 1EO5A 4ZNEA 4ERSL 1YY9D 5A16A 1FLRH 4HF5L 1M7IB 2ICES 5GZOD 3DXAA 1NAMH 1VFBB 3QA3B 1RURH 2NY6C 1VESA 2QBWA 1K3ZA 1XCQB 2GQHA 4XXCA 1DBJL 2XACC 3P0GB 1M71B 2E6JA 5E8EA 4G8GB 2UWEE 3M17B 3VD3A 2JB5L 1XH3A 4Y7MA 4A6YB 5KSBF 1RMFH 5EORH 1QSFE 3RUGF 1IGCH 2Y72A 5DJAA 4O00A 4OFDA 4KKAD 2QSCL 4ZUVB 4GW5B 1GGIL 4GS7C 3HNTH 1JF6A 1V7NH 2NY0C 1FL5A 4AQOA 3WFHB 2QADB 3UAJD 3MMEA 3T4AB 3WHXB 1LP9A 1RUAH 4K3DL 5HVHC 1T6WA 4G6KH 5J9PB 3QUYB 3QUKA 2VABA 2XA8H 2BVQB 1BGXH 2YN3A 2CXGA 3BSZL 4BELD 4KJPC 1BJ1J 5SWZD 1TJHH 5KAQG 1P6AB 5J13C 3QXTA 4A2LA 1U8PA 2VDMH 1KJVB 1S7VB 4ODTH 5DEGB 4QOKA 1LVEA 3RVTD 2LV4A 4NP4H 4NRZA 4Q0XH 1M1SA 3DXAB 4JFEA 4F9PC 4KV5E 1C7SA 5HYJA 1EHLH 5E8EB 2W07A 3JWDH 2DMCA 3QDHA 1NJ9B 1WEJL 1U8MA 1D5XA 1XH3B 3LKRA 4JM2B 1R3LA 4N0RA 3QDJD 4MB3A 5AG8A 3FB5B 3SDAD 1HHHA 3V4VH 1UM4L 1JGVL 4G8IA 1QLRA 2E27L 5HVGB 1RV6X 5C6PB 1T1YA 5B22A 5FO8B 5C0CE 1WBXA 2ADFL 1MOEA 4HJGA 3TBVA 1MCPH 2NX5D 4XP5L 1JRHH 3MMEB 4M6OH 5C0RL 2QKIB 3F65A 4U3XA 1JZ8A 4UI2A 1NEZG 3E6HA 5B39G 4JY5L 4PJBA 3QYCA 5DWUH 3T0EB 4P9HC 2C4XA 4HXBH 4F37F 5IW6B 1F4XL 4FQXD 5ALBL 4IRSD 3LVEA 5MI0C 4WI9A 5D1ZB 2VAAB 2I25N 3MBEC 1WIOA 1U8PB 5KW9H 4YBLB 3FL7A 3Q3GA 2ZJSH 1F2QA 3QNZA 3LV3A 2HMIC 5IT2L 2MQ0A 5F7EH 1BD2B 2D7QA 4PJDF 5IBLC 5JPMB 2YMXH 4JAMB 3SY0A 4F7MA 3DMMA 1MJ8L 4O4YH 4OZGE 4UMGA 5IIEA 5JHLH 1YEJL 1KEMH 1WWCA 3V6ZA 3RIFF 1R5VA 4HGMA 4YC2C 1C12B 3CFIC 1XR8A 4MD5A 3LKRB 5I8KH 3GIZH 3S4SB 1R3LB 3BPOB 3HRZB 4UOW1 4M8QA 3MUJA 5GS0C 4NN5C 1U8NA 2FGWL 3L5IA 4Y16B 4G8IB 4C83A 3NFPB 5DVLA 3DX9B 3VD4A 3WFZA 5SX5K 1S9VA 3H9YA 4EUPB 2KH2B 4GKZA 4P3CL 4RSVA 3S3PA 4CGTA 4XBGA 3E6HB 3U4EB 5FB8A 2BNUB 3KLDA 1JMXA 2PYEE 1SYVB 2LU3A 2O5YH 3SKMA 4ZO6A 1QFWL 4Y5XC 1KBGL 2NY4B 4HIEB 3GM8A 1DBBL 1GHFL 3MOAL 4JANA 1FVEA 3MRJA 2R0WH 4KTDL 3RPKA 4YDJA 4PJGF 1XF3A 1PX4A 4Q6IC 3L5XH 2W0LA 1FHGA 4NZUH 4F7MB 1CE1H 1NCBL 3KPMA 4PP1C 4K71C 5IIEB 1AGCA 1IGYA 4ODSL 4Z7WB 4WEMB 5L0QB 3FKUS 4OV6F 1ZHBB 2DM3A 1B0GA 1WSST 3MCG1 4OBRA 1MHEB 5EA0L 4NKQB 2UZXB 4MD5B 1JGUH 4NKDA 1YYMH 2B4CH 4XWGH 1RURL 3P9LA 4J6RH 4ZXBC 4AEHH 2EXWD 5EOQL 4JJHA 4QHNB 5KSAD 3ZTJH 3OG4B 2Q7YA 1BZ9A 3K4ZA 3VXRA 2Y06L 3CFDA 2XNAA 3NPZB 5BJTA 1RMFL 3N0PB 1A6AB 1FFNA 2HT3C 1FVDA 3HE6D 3RGVC 4OUOA 4GKZB 3ABZA 3RPIB 1KT2A 4XTRC 3DI2B 4NOFA 5KVEH 3GJFH 3HNTL 2PXYC 3QIUA 3QUXA 4OD2B 3DYPA 4XBGB 3I02B 3V5HB 1RZJC 1FZKA 1CS6A 4OFYD 1ZA3B 1IGTA 5FB8B 1AO7B 5JR1H 4K2UH 4HFWA 3SKMB 5D2LA 4JRWA 1B9ZA 3PJSA 2X4QB 1RUAL 4Z6AT 1D5ZA 3U2SB 3MUZ1 4G6KL 4G5ZL 2P8MB 5FUOH 4CN6A 1YQ2A 5AZEH 1BGXL 2B2XL 4O2EB 4UU9B 1BAFL 1NSNH 3RP1A 1JCKA 5IB1B 1F5WA 3BEWB 4LMQE 1KTLA 5DQDH 1IGYB 3UDWC 1WISA 3G5ZA 4K94C 1B0GB 43CAA 4CAGA 1F4HA 3FO1B 1SVZA 2DL9A 2GSGA 4LCIH 4HS8L 2VXTH 5AYUH 2XKNA 4M1GL 4OD1H 1KFAH 4ZNCD 2JJWA 3P9LB 1QBLL 2D31B 4AZ8A 2V5MA 2FH8A 5D5ME 5GIRA 1I75A 5ENWA 3R06B 2BK8A 4HGKC 4OLXL 1BZ9B 1FJ1B 2Q7YB 3JWDL 1NGXB 3VXRB 2XNAB 4M8VA 5DURD 1XGQA 3F7RA 5BJTB 2WWKO 5EZIH 3A6BL 4KK6D 2EE3A 4U1GC 2CKBA 1KT2B 4IRJB 5IB4B 3QUXB 4JO1H 1AQDA 5L8KB 3G6JF 4XMLH 5CJOL 4HFWB 5E2WH 4PJFE 5I1JH 1WIPA 4M6OL 3NA9H 3PUCA 2G2RB 1D5ZB 4LEOA 2UWEB 2CRIA 4UIKL 1T5XA 3EDFA 3K80A 2R0LH 5DWUL 1CIUA 1QSFB 3CFEA 4V1DD 1JYWA 2NYYD 3IDYC 5FGRA 4UILL 2YWYA 4F15C 1S7TB 5M7QA 3ZDXE 5F89B 4LLVA 5F7EL 2NXZC 43CAB 3KPTA 4LKXB 4MVBC 1TDQA 4U1MA 7FABH 4MJ5A 2YA0A 5CEYB 4PR5A 1VPOH 4EI5B 5GS2D 5GIRB 1EIBA 4N5ED 2GYSA 2BY3A 2IAMA 2WBJB 5JOFA 1Q9WA 3O6LH 1NBVH 1RY7B 3D25A 4RGNC 2YKLH 1JE6A 1XMWA 5L7XH 1UB5A 3SDXA 4HPOL 5CBAB 1YPZE 3ULUH 4U0RB 4WUUD 2BHZA 4OD3L 5TF1L 1YMMD 2YOCA 2BVEA 3QNXB 2K7QA 4YEFA 5SWSB 1ORQA 4QHLA 3TP4A 3P40A 3MLWH 3QO0A 1HSBA 4OSUH 5HVWA 4K8RC 3SKJL 1YNLH 4LEOB 4M5YH 4YBHA 1QFHA 1KJ2B 3FFCD 4KROC 5FF6B 2BRRL 4I0KA 4LQFL 1IILE 2VMFA 3CFEB 3NFSL 4TUOB 3MLUH 3DUUA 2V5SA 5DJDA 4HMCA 2O5YL 4XNYH 2XYCA 3TYGL 4YJZL 4PGEB 4NGHH 1CDCA 3FN0L 4R7NB 4LLVB 1RD6A 2XZAH 4NJ9H 2N7BA 3DX8B 4JREB 4MJ5B 1VEOA 3MRGB 4PR5B 5CS7A 2OJEA 3WV0A 4E41E 3UTZA 3QDME 5BCAA 4MS8C 4M6NL 3H0TB 3VFNA 4HK3J 4NQEA 3JTSA 2G75B 1OTTD 3AS1A 3V9FA 4UV7L 1YYML 1CGSL 1E6JH 1UH4A 1UB5B 4YHKL 3X12B 4AEHL 4J6RL 4LSRH 5CCKL 5IFAH 3ARTA 4JPKH 1KCSH 2W91A 2W65B 3VRLF 3FT4A 1IJ9A 1INEH 1Z9LA 1ORQB 3T0XA 3QO0B 1BLNA 4EQ3A 3WNLA 2B0SL 3B9EA 2Q8AL 4J3SA 5I74C 2DLGA 1CDHA 3VE0A 3BKML 4NDMB 3V5KB 4UT7H 1MCCA 4XCFH 2RR3A 2OK0L 5F1NB 4ZOEA 4JGMA 1NANI 3W0WE 4GXVL 3MJ8B 1EO8H 4BH7A 2DQGH 3DUUB 2VWEC 3RAJL 9CGTA 2VLRE 2XWBA 1VADB 3OXSA 3HUJB 5FUOL 5D93C 3WJJA 5AZEL 3RY5A 2AJVH 3QEQE 2DIJA 3MJ9L 5D9SA 1J7VR 2Y36L 2HT4D 3MYZA 1QLEH 5E08H 4RGOH 5DQDL 4X5LA 4QTIH 3FT3A 1I8KA 3B2UC 5J6HB 1BWMA 4D9LL 3ULUD 4NUJA 2MNUA 1F8TL 3VFNB 2GUOA 3JTSB 4F7EA 3TH3T 4MA7H 3NBNA 1KFAL 2ADIB 4KDTA 4O51B 4U1NB 3IDJB 2ARJQ 4I13B 1I4FB 5DHYA 3W11D 1BVLB 3U83A 3M45A 4UNTA 3TCXA 3RDTA 5C0AB 1BREA 4WW2C 5IVOA 5I1DA 5TJWK 1YECH 5IBUG 1AGFB 1TCMA 1CK0H 2B8OT 4XMLL 4I2XA 5BVJA 4A6YL 4KVCL 1Z9MA 4GUPB 2OSLA 4DKEL 5BS0D 4PRHE 1EH9A 1I7RA 1FZJA 2NR6D 3ZYJA 2IPUK 3SJVA 4GRLA 5GZNC 1LNUA 3JWOC 3V0WH 3VGBA 4MA3A 3TT1L 2Q86A 3NACH 2ITDB 4Z9KB 5E4EB 1NUGA 2AJZB 4J4PD 3LH2L 5EZJA 5HGAA 4JVWA 3O8XC 4YFDB 1JPGA 1JHKL 3FT3B 4MHHG 1NLBL 4YDLC 3QUZD 4M7LL 1MHHA 1GIGH 2GHWB 5I1LA 1ZE3C 3ME0A 1HH9A 1K5NA 3EOBA 1A7BA 3HG1E 1U8HA 3ZKNC 1VPOL 5FYJL 4D9QD 2D3VA 4JJ5A 3WJLC 2F53E 3O6LL 3JV0A 5BVPH 1KXTB 4OCWH 3ZDZF 4LNVA 3RDTB 4K7PH 4P2RD 3ARFB 2EDNA 5I1DB 4G7YL 2JKXA 2EE6A 5C09E 1C5BH 4Z7UE 4B0MM 4WV1C 3GB7A 1H3PL 1ZK9A 4GKSA 4I3GA 4GW4A 1EXUA 5ID1B 3T3PE 5D5MB 3TBTA 5E8OA 5F9OH 2D0FA 2DAVA 4D0DB 1DANT 2C3WA 2YD9A 3CFBA 3DURA 1JWUA 1YNTA 4GRLB 5IV2A 1IGIL 3W2DL 4MA3B 4LCWB 1CQKA 3U1SL 3EYUH 1TCRB 4LK4A 1TMCB 4HK0A 5F7KC 2Y6SC 1JI2A 5DFVD 5FUZH 5HDBF 35C8H 4U7MA 4YNYB 2X4RB 4NGHL 3PV6A 4HIIA 1R3KA 4H1LA 4Y1AE 3ZKXB 2ZUTA 3CXDH 1S7RB 5K9OB 3GSQB 3VRJA 4P5MA 1ZKAA 5I1LB 4QRPD 3KR3H 3BIBX 4YFLF 1QVOA 2V7NA 1K5NB 1NCAL 4AEEA 1IM9B 4PRIE 3C87A 3QXDB 4LGSB 4H26A 1J9CT 2JJTA 3CJJA 3CZJA 2DLIA 3E6FB 3G5YA 3P9MB 1HIML 1N8ZA 5LCVL 5C0IA 3HFMH 3VWKD 3D39A 1EV2E 4XH2A 1HINL 3THML 1JMZA 3KG5A 3KPLB 3DSFH 4K3EH 4KUCF 2ATKB 3GB7B 2VLKB 4PJ5A 4ZSOE 3N1QC 2Z93B 4X7DC 1EXUB 5ESVB 3KS0H 3P4MB 2X09A 5DMGD 3BZFA 2K1MA 2V5RA 4PRPD 1KB5B 1TZHB 4NWTL 1T5WB 2Y07L 1FZMA 1G7LA 3DURB 4UT7L 4XCFL 1J86A 3PGFL 4X7TB 1IKFH 2B1HL 4P3DB 4DFIA 4PLKC 2DN7A 2YEZB 1JNHA 4OB5H 1NCCL 1E4JA 1VENA 1RUPL 4HKJB 1GSMA 2Y25A 3O3EA 1YMHA 4XVJH 1A6ZA 3V4UH 4HIIB 1KGCD 5DGRA 2NY5H 3GSNH 4P5MB 2QSQA 4HBCL 3OR6B 2VO5A 2O5XL 4KMTL 3CMOH 4WFED 3NIGF 5E08L 2IH1B 4LCCA 4RGOL 3ZYIA 4XP9L 4H26B 4JFFD 5GS1A 3PABB 4POYA 3G5YB 3GI8H 3QQ9D 3RY6C 3OB0K 2IG2H 1QA9A 2NY3D 1T4KB 4XH2B 4W6XB 1DTUA 2YSSA 1ULVA 3RVXD 4X7FC 2A74A 3LMJL 2IQAA 3OAZK 1XT5A 4X0KB 2EO9A 4I18C 4C56A 3MRMB 4K9EH 2J5LB 2RGSA 5DT1H 1V8HA 2AVGA 4E41B 3RWGB 3BKCL 1RULH 2O26U 3IGAA 2V9QA 1XIWD 2P24A 5HHME 3UTQB 4G7VH 4LNRA 3TO4C 3KDMB 2VL4A 3EJZD 4Q74A 3I2CH 3LN9A 4Q9RH 2IH3B 1ZLSL 3QIBC 2YD6A 4MXQC 2NY2B 1A6ZB 1OAYL 1TENA 3NCYP 4L8SC 3CXHJ 3L9RA 2V2TB 4G9DA 4I8DA 5ITFB 4JFDE 1KPRB 3IDNB 3BWAA 5FAAA 3CDGB 3VXPA 1V7ML 5HGHB 3W0WB 1I7TA 2CLVA 1MF2H 1IC7H 2BNQE 4ZFFB 2VLRB 2QQNL 3FQTA 4TNVF 1N7MH 1EMTH 1S9WB 3MOQA 4GS7B 5C0BA 1GZQA 1A4JB 2D9CA 1HHIA 2YSSB 2NY0B 5E2UL 3V5DA 3QEQB 4PY8J 1CR9L 4LSPH 4MAYA 5GISH 2KZ1B 1CDGA 2HYMA 5MENA 3RL1A 4C56B 4OCWL 2RHEA 3GNML 4PJEF 3O41A 3UTPD 4M62H 2DQCH 4K7PL 1G7IA 1QLFA 1UEYA 3NN8A 3IGAB 4GAYA 2W9DL 1TIUA 1C5BL 2HVKA 3ZE2F 4U49A 5BV7L 3PV7A 1IKNC 4RGNE 4JQIH 1AXTL 5J13B 1UZ8B 2KL6A 2PW2A 1UT9A 2E9IA 4U4BA 2FO4A 5KG9B 2KPNA 3P11H 4XGZA 5FGCE 4G9DB 1V3KA 4L8BA 4JFQB 2YZ1A 5EO1B 5IVXA 1OSZA 1EFXD 1FYTD 1U3HA 4APQC 2CLVB 4JRXA 1MLBA 4CL7A 4U1JB 2GT9B 3UTTA 3IVKA 2IMNA 1HYSC 2NQCA 4P5TA 1MWAH 4PJ9A 2JF1A 5C0BB 1MPAH 1GZQB 5ICXB 1HHIB 1UCTA 4YHMH 4OGZA 1CDIA 3V5DB 4LCUB 2VITA 3L3OA 4YQXH 5B38A 6FABH 4RWYL 2WINA 1ED3B 5B21A 4PJHB 3HFML 3O4OB 4HHAA 4ZS7L 1CICD 3OKOA 2ZG2A 5E8NB 1QLFB 4N0CC 4GAYB 4FTVA 3QCVH 1PAMA 2EH7H 4R0LC 1SJVA 3O2DA 4R97B 3VRIB 4S0TD 5FM8A 5MI0B 3EFFB 3RWIB 3HG1B 3MBEB 1BIHA 1LO4H 4HD9A 4QRRE 3SGDI 3E8UL 3FJTA 3FRPG 1ZGLM 3U0PB 2FO4B 1DANU 4JN1H 2DQEH 2E7LA 4O5LH 1IQDA 1D3CA 1RZGB 2C4FT 4XNUL 2B5IC 5CINH 5C09B 3QP3A 2D4DA 4RNRB 1OSZB 2H8PB 4RBPK 4IMKC 2PO6D 3KLAA 4YC2B 1Z9OA 2XICA 4YXLL 5E6YA 1OP3K 1N5YL 3B83A 2NY5L 5BQ7A 4X6CA 3ULVC 3VD9A 3OR7A 3BN3B 4KDTC 4RMTA 5CP3H 2VWEE 1CL7L 3FO9B 4NN5B 4OLWH 3B4NA 3CFJB 3LHPH 4PJ9B 5IF0A 1UG9A 4ACPA 1W8NA 3WUWA 2VDOH 3DWTA 5CBEA 3DSNA 5AAMA 2VITB 4FZEH 5C2BH 3L3OB 2O93L 2Z92B 5IB2B 1NBQA 1OHQA 2X5PA 2EDFA 4L1HA 3TA3A 3VCLA 1XGPB 1S7UA 4FTVB 3C6LC 3RTQD 3VGAB 3FRUA 4P4RB 5EOCH 4Y2DD 4Y5XB 5F3BA 4MJ6A 1T7YA 4PRIB 4K7PY 4N0YL 4LHUA 1OW0C 3U0WL 4NNYA 4UBDD 3DRTA 3BW9B 3VFRA 5DRNB 4NZRH 4Q6IB 5CEZE 3Q48A 5T3ZE 3D2UD 4BFGA 2SEBA 3GUTA 3HPJA 4K71B 4PJAF 4URTB 4S11A 4FABH 3VWJC 4QCIA 1CBVH 5SV3A 4KI5C 4JO4H 4W4OC 3NCJH 4PJBE 4F3FA 4EN3A 4OIIL 3ARED 1F3JA 3TFKC 43C9A 4X6BA 4ZO7A 3V6BR 1MHCA 3BVNB 3CGTA 2OCFD 1X4XA 1XGYH 2APBA 4OT1L 4DUXA 5E95B 2FEEL 5JOEA 3LEVL 1NGYA 1RJZA 1RUML 2BP3A 2FL5B 2VDNH 1HEZA 2DQHL 4MDJA 4U6TA 3RGVB 4NQSA 3K8MA 3T2NL 4UTBL 2DQDH 1E4XH 2PXYB 5HHPA 3RFZC 1LD9A 4JRYA 1P53A 3TA3B 4L8CA 1FNEA 3VCLB 4L4TD 4TUKL 1D9KC 4LSPL 1RVFH 3FRUB 2A6JA 3KPSA 3TYFA 5IB5B 2VR9A 3U30C 1NFKA 2I27N 5F7UA 1ROWA 4ELME 3WS3A 2X4OA 4NNYB 4JPVL 5DRXA 3VFRB 4IIQC 1DQDL 1N3NA 1OWRM 3GUTB 1T89A 1ZOXA 4QGYA 3MRQB 2FX9L 2VDRL 5FOBB 1H9VA 4IOFC 3LSOA 2CDEB 1KOAA 1WUNT 4P46D 1OVZA 4LIQE 4F3FB 1OCWL 4OLVL 4OZIA 2GSIA 2VDPL 3QPXH 5KSVB 1G6RH 3D3VB 5HPMA 1CLZL 3O45B 1PSKH 2HJKA 1X9QA 1ZA6A 2NLJA 5F7NC 4EI6B 2CLZB 4NM8H 1DDHB 4YHOH 5J6GA 1AD9A 4XNQA 3K4DA 1FO0B 1RJZB 3NMEA 2OJZL 3OF6A 2VDLH 5I66B 1MRCH 3ARQA 1PLGL 4U1GB 4U2YA 4FG6D 5HHPB 3NIDF 3UJTH 2EDLA 1AE6L 2F54E 1FNSH 4WO4C 4L8CB 4QRTB 4JFDB 3GMOB 1A1MA 5DZLA 5A3IC 1CDJA 2EDDA 1FNGB 3OWEA 4HIJA 2VLLA 3DI3B 4JM2F 2ICEB 1IM3A 3MRHB 4XPHL 1FFOA 5JXEC 3QQ4A 2HRLA 2HRPH 3O9WA 5F93C 5CHNB 3IDYB 1E6OL 1WAAE 4F15B 5GRXG 1N3NB 1KN2H 4HX1B 3BRDA 3TN0D 4YZFE 1AGDA 2MJWA 3LSOB 1EZVY 3SE8H 2NXZB 4ISVA 4LLMA 5FFLA 1FVCB 2R1WA 3HZVA 2XTJD 1A4KA 4JN1L 4OZIB 4F58H 2JIXA 5F1IA 4RFOL 3QDGD 4O5LL 1B4JL 1FC1A 5ACLA 1TZGH 1WBZB 4LCCC 4ZUSA 4M03A 3HNVL 4KK5D 4BFEA 1DSFL 5D7JC 3S35L 1H15A 1MCFA 3VDCA 5J6GB 2P5WE 3O0RH 5FDYA 4OTXL 4Z7NF 2P48B 4ZYKB 3ELAT 5FO9A 3ZTJG 1N26A 2ZUQC 4J3OC 5ECJE 5JW4R 4RGMC 1MFEL 4PD4J 3PNWB 3GGWB 3AGVA 2FB4L 3OJDB 2VDOL 1A1MB 5EUOA 5K9JH 5C2BL 3W9DA 3V95A 1KJMA 1TVDA 2VLLB 2AK4E 4Y4HD 4MXVE 1FFOB 3QQ4B 1LK2B 4JB9L 4WWKD 4ORGB 3SOBL 1JPSH 4M61B 4PJXF 1DBKH 5EOCL 5DMKA 4Y0GA 1I1AA 5E8PB 1AGDB 4KAQH 4ZUTA 4F9LC 3UTSD 3D69B 4XP4H 1Y6KR 1DVFD 1CGXA 4R4ND 2H32A 5SX4I 4F8QA 1G7QB 4O2FA 3MLVH 3Q5OA 1EHXA 3MUY1 3RIAF 1DQLH 2FHBA 3ULSB 3BZEA 4FABL 2C4FU 5FO7B 1BQLL 1KB5L 1WZ1H 4HC1L 4OCSH 5D7LE 1H15B 1SY6A 3TZVC 1AXSA 3RQ3A 1CU4L 4F8TA 5GSRB 4ODHH 1YDPB 2HTLC 2GJ6D 3PWPE 1P4IH 4M4RA 1INDH 4OKDA 3TIDA 4Z7WF 4NN6C 4MAYC 5EDXA 1G0XA 2QEJA 1NMCC 3TNMB 3B6SA 2E8YA 2YWZA 3O6MH 3PWLB 5B8CA 1BX2A 1MI5E 2DQDL 5CSZA 4DZ8B 1EJOH 5I74B 3MV8D 4JQVC 4RX4D 2L7UA 2HAZA 3RJDA 4NO2B 3O3AA 4XNMA 4ZUTB 3SDXE 1GC1H 5GGRY 5DA4A 5D93B 3FMGL 4UT6H 4UT9L 1JZ2A 2H32B 4OZ4B 3GRWH 1XF4B 2NZ9D 5TQ2H 4OCLC 3UP1A 1WBYB 5GPRA 1XAUA 4QF1A 4WI5A 2ZKHH 3NZ8A 1CXHA 4G9FE 4P2OD 2J3SA 2BY1A 1T66C 1UWGH 1AXSB 2ICWA 1RAMA 4DJMA 4J1UA 1AGBB 4P5TC 3SQOL 2F74A 2X9WA 2P8PA 5KN5A 1RZ8A 2G60H 3TH2T 4I4WA 4L29A 5JDSA 3TIDB 2XPGA 3HE7D 4NWUL 3LRHA 5DR5H 3DGCR 4OJFL 3EW3B 5HYIA 3JZ7A 4P2YA 2HLFC 3CD4A 5D72L 3B6SB 2YN5A 1MRCL 2EYSA 4Y5VA 4YGAB 3LD8B 3MV7A 5LJYH 1BFOB 5B8CB 1BX2B 2FJHA 4P2QE 4X8XA 4K7PX 3UJTL 4XC1L 1FPTH 2GTWB 4YUEH 2I26N 5C0GB 1OM3H 1EGJH 2H3NA 1AD0A 4WI2A 1LQSR 2X4SB 3IU3A 4BZ1H 4UUJA 3IRPX 1I8LC 1TQCB 4LF3A 5EC1A 3OXRB 4UOW0 1A3RH 3DGGA 3SDAA 2JTDA 3KYKH 4FQLL 3O6KL 2HRPL 2AP2A 4H25A 1QG3A 3HZKA 1JTTA 2V2WB 3MNVB 3O8XB 4TSCL 2UWEF 3QIWD 4YDLB 1P7QD 3PWUB 4QRQA 3LN4B 3SE8L 2ICWB 4X98A 2DYPD 1ZS8B 4F58L 4FRWA 4ELMB 4OLUL 1I9IL 1RZ8B 1IGFL 1TZGL 3TBWB 4R3SA 1FG9C 3QEHA 4I4WB 4IRSA 1NL0H 4C57C 2DWEA 4K94H 4L29B 2CO6B 3QEUA 4Z78A 2ZCHL 2XPGB 4OGAC 4NQCD 2R2EB 1YQVH 1Q9OB 2J6EL 4B7IA 4CBPA 3KPQA 3BQUC 1U8QA 3STLB 3LRSA 5C3LD 1CXEA 2EYSB 4Y5VB 3QFJA 3MV7B 4G3YH 2UZIH 5KSUA 2X89D 4YH6A 1ACZA 4F7TB 4L4VE 4MJID 1U95B 2H3NB 2ID5A 5F7FA 3BD5A 1JF5A 2BFVL 3RX8A 3ULVE 5IK3B 3OJ2C 1HK6A 3VXME 1DLHA 1NDGA 3GSWA 5I8OH 3DGGB 1A9EA 1QSED 2VN7A 4OZFH 3A67H 4YHZL 4H25B 1WV7T 2R39A 3IU4H 3VXUE 4KAQL 2F54B 4KV5F 4OI8A 3K74B 2W0FB 3OX8A 3VMNA 3T1WA 4CU6A 4P9HL 2WWMC 2VUYA 4ETYA 4QRQB 1CQYA 1IC4H 1WF5A 5EIIB 1S9XB 3EYSL 2C3GA 3Q5YA 4Y4KA 2DLFH 4PJIE 3DX6A 1MQ8A 3BP7B 4R3SB 3GSVA 5D6DC 3S37H 1BWWA 3H9SA 4FQPA 2DWEB 4OCSL 4IHOB 2H2PC 3I50L 3SJVE 5TH2B 4Z78B 5FHAH 1BJMA 4UINL 2AGJH 3MX0A 1X7QA 5F9WC 3KPQB 2YUZA 3RZCA 2VLME 4P4KB 1U8QB 3GFUA 2DQJH 4RIRB 3STZB 3AS3A 3QFJB 3MRPA 2OZ4L 4EDWH 4ZTOH 4KI5E 3VGGA 4Y89A 3ILQC 4LQ1A 3MOBH 1K4DA 5DJCA 4KQ3H 4PJCA 2BDNH 2C26A 5GS0L 2WUBH 1IEBA 3I84A 1NDGB 3LKQA 5HHQB 5ABDE 3LEYL 4NQVB 5JORA 1A9EB 3RWJA 5IBTH 1J8HD 3DX7B 5LBSL 4H20L 5KSAA 4ZUWA 1CDYA 4FZ8L 4OCXL 4OZGF 2OBGA 4K8RH 4WY7H 5D1XD 5SX4H 1JGEB 1MRFL 3D48R 2CGRH 5D8JH 4PJ7B 3PIQA 5EU6A 5C6TL 2FEDC 3GBMH 4UT6L 3EBAA 2GITA 4I3RL 3ZDYE 4N0UA 3PGDB 1O7VA 5TQ2L 4C4KO 5IFHH 3C9NB 2N4IA 3FO0L 2AK4B 2C7UA 4Y4KB 3QHFL 1ACYL 3DX6B 4KZEH 2ZKHL 1GCFA 3EYOB 3GSVB 1JPTL 3HKFA 1KIQA 3WL9B 1FH5L 3TBSA 1UH2A 1A7OH 1X4YA 1UWGL 1DR9A 2ED8A 2GK2A 3K8KA 3RZCB 4NN7C 4H88H 3RWHB 4YHNB 3K81A 4Y4FD 2P5ED 3CXHK 4X9FA 4WHCA 3HAEA 1H8OA 4KY1H 2ESVA 3HMXA 5HI3D 5EIVA 2YBRB 4JY6A 4BUGA 1TTUA 1NQBA 3ZZ1A 5I1HL 1FCGA 1GGUA 5D7LB 3DETC 3QO1A 1IEBB 1R0AH 1QSZA 1ZVYA 3SE3C 1C16B 3HZYA 2QR0A 3LKQB 2B7DT 3UX9B 2VL5A 1KLGA 4JDTL 4M5ZH 3RWJB 3LPFA 4S1DD 2IFFH 1FV1A 4PPTA 4XNXH 1WIUA 2XQBH 4BZ1L 3ZT5A 2FZ3B 5HHOD 2JCCE 4FFVC 3SDDA 1S7WA 2P42B 4MMZC 1X6LA 1EPFA 1RZJL 5CGYD 1A3RL 4TOYH 3WNNA 1QFPA 1ZVHA 3RNKA 2GITB 3L3DB 1MI5B 3SHSA 1RQ5A 1EERB 3DTXA 1I1RA 1CL7I 1S8DB 4X7SH 2OR8A 4CADA 2DQIH 3K3QA 4G8GD 3I6KB 5TDNA 4M9PA 3KPOB 1NGQH 3DRQA 4GLRI 3O3BB 4HJ0C 3WFEL 5LG1A 4GAGH 1JGLL 1R5IB 3CLEH 3S5LA 5DJ8B 2X4TA 3Q6FA 3VFMA 1J8KA 1HQRB 4K94L 1P5VA 1RUKH 4RWHA 1JV5A 1J5OH 4G9FB 1X5ZA 3KLHD 4IM8A 1M05B 3G6DL 3QO1B 2H1PH 1MQKH 2VLJA 4M7KL 2UZIL 4FQ2H 3QUYD 3L5JA 4QXUH 5CEZH 3BH9A 4J7RA 5T3ZH 2GCYA 3VJ6A 2WNGA 1PEZA 5IEHB 3PWJB 3SKUD 1FO0L 4PG9A 2A6DA 2JELH 1T20A 3TIEA 2OXHA 5IMMA 3OKEB 5CJXC 4UQ2A 1J0ZA 3SDDB 1TVBB 4HKBB 1SEBB 1D5IL 4B50A 1II4E 3EOTL 3HI6H 2Z31B 4S1QL 2RIKA 2BCKA 2GK0A 1NC4A 1R3IL 3DXAD 4Z7VA 3DTXB 3TC9A 4LSUH 5D5MF 4X9BA 4DEPC 5D96B 5I15H 4APQB 3FQUA 4CADB 3BI9X 4P57A 4OFKA 6CGTA 3JWOH 3MO1A 3S35X 3C8HA 4NKMB 1P6FA 1FIGH 1T22B 2A6IA 2PETA 4JKPL 3U9PL 3W9EA 4UDUA 3S37L 4LRNH 4WU5B 2V9TA 4PYGA 4TVSa 1F58H 3X13A 5FHAL 2OX5A 5DJ2A 1YYLH 2E9BA 3UJIL 4EKXA 1U8IA 1JV5B 4PJFF 1OD9A 5J7CC 5EG6C 3WXWH 2VXVL 5GZOC 3FQWA 1I9JL 1EEYA 3T04D 5C8JA 3KPRB 2VLJB 2XFXA 4L9LA 5LQBH 4KKLD 5DJZA 5BMFL 3EO1A 5TF0A 3QCUH 1D6VL 2CR6A 4PG9B 5ISZA 1KCVL 3ZE1E 4Q58C 3V4PL 4KQ3L 1NEZA 2A6DB 2BDNL 5DS8A 5B39A 3ZDXF 1T20B 4KKAC 2WUBL 2ZUVA 5IMMB 4LIQH 4UQ2B 5FK9A 1S3KL 3F12A 3BISA 5INDA 2EO1A 4LASH 5HTSA 5HHXL 1BZ7A 4QOKD 2NMSA 2GK0B 3UAJC 1NC4B 2B5IB 4WY7L 2DIAA 5J1AA 5KOVC 1YN7B 4R26L 2DJSA 4Z95H 4L4VB 4PJ8A 3KYNA 5CIPB 5HYJD 2YA2A 4PRBA 4BSWB 1UXWA 3VFVB 3GBML 1KG0A 4MMXC 3WN5A 3VXMB 2EDKA 5IFHL 1L9NA 3FFDB 4RDQG 1YPZF 5C0EA 1A02N 4UDUB 5MEOB 5CJ5A 3TNNA 4OQTL 4WFGE 2R2BB 5HYFA 3FHQA 1BHGA 1QZ1A 3LKPB 3VXUB 1U8IB 4BFBD 4NNXB 5CSBA 1NMBL 4H88L 4KQ4H 3K2UH 1FLTX 1HHGA 3S6CA 5C8JB 3HHRB 4F2MB 4TULH 4L9LB 1NKRA 3L1OL 5T1LB 4P59L 4WENB 3BT2H 5CSGA 3KS0J 1A3LL 4KY1L 1PKQA 1T03H 1T04A 3V6OC 3FAXA 4PP2A 5LGKA 2NY4D 2Y5TA 3HPLB 4ONGH 1CGVA 1NEZB 1Q72L 5B39B 3S88L 2XN9E 1U42A 2EZ0D 4HQQL 5ID0A 3SBWC 1HSAA 3F12B 3OKKA 4XCYA 4LHQB 2EECA 3CSYA 3B9AA 5HD8D 3QZWG 5AAWA 3DMMD 5BW7A 4TQEL 3QRGH 5FUCC 3QUMA 2PTVA 4NQDA 3BXNA 3KYNB 2YC1A 2XQYK 3T0DA 3ARDC 4YBQD 4FQXC 1JN6A 4LAQH 3WN5B 1H5BA 1BBJB 2AXFA 1JNLH 3G5VA 4IRSC 5CD5C 4ZDHA 4N8VG 4HWUA 1VACA 1TVHA 5BS0A 2AI0H 3VXSA 25C8L 1VGKA 3Q2CA 1XR9A 1ZMYA 4Z0BL 5KSBA 1W2KT 3OB0H 5HGDB 3MQIA 3EOAA 3RUGA 5D7SH 5L9DH 4XCCL 1WITA 1L0QA 4X4ME 3JVGC 5ALCH 4HSQA 1RIVL 3S3JA 3OAZH 1AO7D 3WDIA 3P30H 1IGJA 3QUZA 1IAIL 2CKBH 3V8OA 3MV9B 4OAWA 1JWMB 4LLDB 4RFEB 2H1PL 3ARZA 1HSAB 3G08A 5K9KA 3OKKB 4XCYB 4IIQB 4M3KB 3UC0H 5T3ZL 5I1CL 1AH1A 1Q9KB 3CSYB 3NFNA 4ZPTB 2JELL 4JFPB 3BD3A 3D85B 4I9WD 5HYQA 3BKJH 5JW4Q 4P2RA 2BSTA 4S10A 1JN6B 3GMPB 4H0HB 1QRNE 1XCTB 2FYYA 2X9YA 3D5OF 4JLRB 2R69L 3VG9B 1IGML 3G5VB 1RI8A 4LSUL 5IGXL 5DXWA 1X4ZA 1VACB 3L3HA 3C09C 3VXSB 3JWOL 3VXRD 5T5NF 4XPTH 3MODL 3SDYH 4GAJH 5IMKA 4WNQA 1UH3A 2JCCB 3I6GB 1CG9B 2CRZA 5CD3A 2IF7A 3NH7H 4PRDB 5INCB 1J10A 1FORH 5KS9E 4YDKH 5I30H 3QUXD 5DTFA 4DUVA 2ZP0T 1GGTA 2XY2A 4WO4B 2VQ1B 3GHEL 3MRKA 2FATH 3P73A 3T0VA 3AM8A 4OIBA 1AFVL 2IPKA 1GYAA 3IKKA 1YYLL 5KVFL 2DJ4A 4CMMA 2IC2A 3RWDA 5DC9B 3T8XB 3QCTH 4ZFGH 2L7JA 2EXWC 4QY8B 3O3DB 5KSAC 2A6KB 3BZDA 4LP5A 4XBEH 2F8VA 3QCUL 4NO0A 1F4YL 5FM5M 5IVNA 3SDCB 1IFHH 3HE6C 1A7NH 4U6HB 4PD4K 1EJ6A 3WIHA 4LIQL 2AW2A 1N64H 4NBZB 5JMRA 5C08E 1F90L 5SV4A 2X40A 2VC2H 1LO0H 4LASL 4RFNB 1X5IA 1MNUH 2H6PA 5K59E 2FYYB 3WNPA 5I1GH 1C5CL 4XAWL 4KJWD 4G42B 2VXQL 5DJ6A 2AV7A 5D7JB 4MNQE 4WCYH 3ARBA 1T0NA 3L3HB 3RWFB 5L2KE 1TTFA 5E6IA 4NFDA 3MCKA 4NC0B 1EK3A 4X7EC 1YEEH 3I3EA 1R3JA 2EIEA 2R56L 5CD3B 4XZUA 1T3FA 4RGMB 3TH4T 3WKNA 5ADOL 4UTAL 2ERJB 5ESAA 1VCAA 4Z7UF 2BVOA 4NKOA 4P9ML 4JDZB 5SWSD 1FSKC 2IPKB 3T3PF 4Z8FH 4RAHA 2I60L 1YEIL 2ITCB 1L7IH 5K33A 5T3XD 1I85A 1MJUH 3AXLB 5JPNA 5E24E 3O2WH 5KVGL 5KJRH 2IBGA 1DE4B 2NY7H 4GG8B 1F42A 3BAEH 1VGEH 3HNSL 3BT2L 1AKJB 3CUPA 3SGKC 2H26B 1T03L 3E0GA 2OTUA 1G84A 2BVPB 4FQQA 3KXFE 2MQ3A 4W68A 4FXKB 4M93C 5FV2A 3V7AG 4HDIA 5CFHA 2OL3A 1FBIL 4H0IA 4IDJH 1XEDA 4QTHA 3BD4A 2CRYA 2DQFA 4PJDB 3P0YL 2H6PB 1YN6B 1EEQA 1ZANH 3UYRL 3QRGL 3BPLC 2BSSA 3WDHA 4LU5H 1T1WA 1OP3H 2IAMD 5KTEL 3ARBB 1A1OB 1T0NB 3CDFA 5E6IB 5I9QC 2NYYC 1JHLL 1C1EH 1XIWA 1R3JB 2DTSA 5J3HD 4Z0XA 4FXGB 2Z9TA 4CUCA 1T1ZB 4NNPL 2B4CC 3AC0A 2AI0L 4DFHA 2BVOB 2NY1C 3ULVH 1NMCB 2VTFA 3KYOA 4GSDH 3NCFB 1KCUL 3WO3B 3C5ZA 5IM7A 5D7SL 3NAAH 5ILTH 3BN9C 4N5EC 2Q8BH 3MFFA 1A9BA 3P30L 3C60A 1FDLH 1ORSA 2YPLE 3K1DA 3BFOA 2FBJL 2E5EA 1MJ7H 3VG0H 3VH8A 3T65A 5GGTA 1DQMH 2XXCB 1U41A 2OL3B 2VJXA 5HHNB 3GJFK 2IANA 2I9LA 2DQFB 4PJGB 4MYWB 5FYKD 3MR9A 4N0FA 2IBBA 3CK0H 5TQ0H 1JBJA 1X5AA 2BSSB 4IBLT 5C9KA 4Z7OE 1T1WB 3ZYOA 1UA6H 3N1PC 4FQ1H 4POUB 4WHYH 1T2QL 4BZ2H 3PQYE 1ZEAL 4LPUA 2XN9B 5AD0A 1CWVA 5T5NG 1JTOA 3EGSA 3EDKA 3F6IA 4WU7A 5T1DH 1S9YB 3MGTA 4MCYB 1UXSB 2JJVA 3RWEA 2BHYA 4NQXB 4S0SD 4X99A 5DVKA 1F6AB 1PZ5A 3EAKA 3O11A 5LKNA 3ZLQC 5C0AD 3C5ZB 5J8OA 1SEQH 4L3AA 1AJ7H 2DMBA 4BJLA 3G6JA 2DKMA 1ES0B 2EIBA 2R1YB 2V17H 3C60B 1ORSB 3DUSB 1OTTC 3FTGB 3MRNB 3WMSA 4WFHE 3ARYA 3VH8B 3R8QA 3SCMA 4XBEL 3WFBH 1FG2A 1QFOA 2IANB 4LFHD 5JOPD 1RIHH 4OF8A 1IFHL 1DBAH 1QQDA 2M1KA 2HN7A 1HH6A 1A1NB 2VSDA 1LO0L 2NTFB 3MRIB 1WZMA 2OXGA 1IEAA 2GFBA 3BDYH 3HMWH 5I1GL 4L3EA 3HA0A 4WW1A 4AT6A 4LARL 2EEAA 4H1LH 1CE6B 1ZSDA 4OKVB 3S37X 4X80H 1NCUA 3HI1A 4X99B 5ANME 1QYGH 1MCRA 1J0IA 1U3YA 1OF2B 3GZKA 1PZ5B 3F58L 3UTOA 3CC5B 1N5AB 3RDTD 2HT4C 1KIRA 3ARFD 2VQTA 4N90D 3J7HA 1RZFH 1NH6A 3LIZL 1QRNB 3ULUC 3G6JB 1HXYB 1REIA 5I8CB 4Z8FL 2Q3ZA 1FL3B 5SWZE 5DYOB 3D18A 1PG7H 3BGMA 4BQ6A 4DKAA 5IBUB 1J18A 4GRLD 2JJUA 2NY7L 2EKSA 3BAEL 1RU9L 2BOCA 5D71H 1FG2B 4LCWD 3W11C 3JTTA 2R2HB 3VXOA 1NUFA 5D1QC 3QJFA 5TE7H 1QQDB 3IDIA 1U2HA 2HN7B 1R5WA 4TVPL 3VFPA 1H5BC 4GXUM 3WSQL 3RTQA 4PB0L 5I16A 3GK8H 4KK8D 3V6OE 4WW1B 1G0YR 3VFUA 1MCWW 5C0JB 2LQRA 2XXMB 1DQQA 2NR6C 3QDJE 1TPXC 2EDXA 4QHUA 4AL8H 5I75B 4NM4H 1UQSB 3D9AL 2V7HB 2E3VA 4JFOA 1OARH 1J0JA 3MV01 4RMQA 3B9DA 1NMAL 4J4PC 5C08B 2NX5E 2F9BT 5FUCE 4ZFOL 2WLYA 4JHBA 2J88H 1W72A 3T1FB 3QISA 5LGJA 4M1CD 1I7ZA 2VR4A 3ARRA 2DICA 2VLKD 5A43C 3AREA 5IG7B 3BUYB 1YJDC 4MNQB 2HKFH 2BJMH 4LLQB 1KELL 2FX8H 5D2NC 2Q8BL 1AHWA 1XGRB 3EDJA 3VXOB 1INQA 3KPNA 5EWIH 3QXVA 2R0ZL 2BMKA 2R29L 3QJFB 4QHMB 1B0RB 3U6RB 1EBPA 1P2CA 2ZOLA 4HUXB 4ZFZB 4LSSH 1A64A 1MJ7L 5IHBA 4YO0A 1R5WB 1CLOL 3RJQB 4ZTPL 4X6FA 4L4TA 2IQ9H 4YHPB 4DGYL 1MCOL 3MA9L 3RKDD 3IFPA 3NIFE 3VFUB 4ENED 4ESKA 2R15A 1DQQB 4QHUB 5E9DA 2R23A 4N8CL 5E5MA 5GRZA 3MRDA 4JGUA 5E56A 4K3GA 4KKNA 1J88A 1HOCA 2HFFB 3KJ6L 3RU8L 3D39D 4HWBL 4ZAKC 5DFVC 4B53A 2D7NA 1H3VA 4R90H 4NUGH 3WO4B 5LGJB 1HKFA 5JO5B 4P2CG 4PJ5D 2V5YA 4E41D 4TNWF 2C3VA 4O9HL 3BKYH 2VH5H 2VR5A 1SEQL 4UV4H 5F7YC 3O6FA 3O4LB 1L6XA 2WLZA 4HXAL 3DV6B 1X5LA 3MRLA 1CLYH 1VEPA 3V6FA 3LKOB 3LQAH 4AENA 5IVZA 1A7PH 2V17L 1OAKH 4JHAL 2FJGA 5DA0B 4OZFG 5GGSA 5JHDB 3VWKC 5FA3A 3DVNA 2NY2D 4PJBF 4WW2F 1JTPA 5TFSH 4MSWA 1CT8A 3FB7B 3UBXG 2EYTA 3LZFL 1CCZA 5ETUB 5FA4A 3C2AL 4M7LT 3H3PL 4G8EA 5DD5L 5I73C 4D94A 1NBZA 5EZOL 4X4XA 4R4BA 2R4SL 1RIHL 4PJCE 3BHBB 4Y5YA 2A9NH 2R0KH 4XP1H 5CWSB 4XCNB 4X7CC 4PLJD 5DMGC 4YAQA 1OAZH 4GKOA 4U1LA 4JFXB 4PJEE 5J4MA 4XNZC 2R23B 4LKCB 3B9VA 1OTSD 2EH8H 4Z5RB 4DAGH 2VIRB 4HV8A 1JWSA 1P7KA 2HA1A 5C07A 1N0XL 3ARSA 2QHRH 1LO3H 3KJ4C 3GHBH 2IALA 4ZS6D 4S1RH 4M48H 4YDIH 3VFGL 4JDVA 5ITBH 4I0PA 1YZZA 4N0UE 2FDBP 1NDMA 4C56D 2WBKA 5J11C 2HJLA 3VW3H 3H9ZA 4ELMF 1IEHA 1BIIA 3QDGA 4IJ3C 3P4NA 5GRVL 4N9GA 3S7GA 2HVJB 3HZMA 3PQYB 4FQJH 3J8F7 1DBMH 1RFDH 3NGBC 4YXHH 1BP3B 5H35B 3MLZL 4J3VA 5EBWA 4CVXA 4GW1A 3GKZA 3QULB 1BOYA 3QQ9C 4YPGB 1G7JA 2NY3C 3FB8A 2D7OA 4O2CA 3DVNB 3RNQA 1CT8B 3RVXC 2VQUA 1AC0A 5FA4B 3I9GL 5B3JE 3GM0A 4MA8L 3OZ9L 5DVMA 4BZYA 4OFIA 2GAZB 1QSVA 4X4XB 5DHVA 2W38A 3PL6C 1P9MC 1U8LA 1DEEB 4DEPB 5ERWA 2FR4A 5TE7L 2JB6B 1K2DB 4M6ML 5IW1B 1OQOA 3QG7H 1A2YA 4Y8AA 5FYLL 4JFYB 2MMXA 4U6XB 1QPPA 3BDXA 3EJZC 4UZGA 2VXSL 4OLYL 4PGZA 1JWSB 5F7HA 5BZWA 3SPVA 5C0BD 1PQZA 5C07B 3U46A 3X11A 1F4WH 2HLAA 2HKHL 2IALB 3B8SA 4JDVB 3U9UB 3U7YL 2X4PB 1FGVH 5MEND 2ENYA 3BESR 1IAII 2X70A 4YHLH 2HJLB 4S2SA 2E6PA 4WJ5B 3TWCL 1BIIB 1EEZA 5F70A 1GZPA 3P4NB 2NXYB 1AGEA 1CF8L 1CXLA