3GHEL

Crystal structure of anti-hiv-1 fab 537-10d in complex with v3 peptide mn
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
214
Chain Sequence
b'QSALTQPASVSGSPGQSITISCTGTSTDVNGYNYVSWYQQYAGKAPKLIIFDVSKRPSGVSNRFSGSKSGDTASLTISGLQAEDEADYHCSSYTSSTPYVLFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 537-10D, light chain
molecule tags Immune system
publication title Structural basis of the cross-reactivity of genetically related human anti-HIV-1 mAbs: implications for design of V3-based immunogens
pubmed doi rcsb
total genus 43
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheL02
4UINL 2PW1A 5H2BB 4P3CH 5C07A 1QBMH 3L3HB 1A21A 2OMBA 3CLEL 3ARXA 5DRWA 4I77H 3V6OA 1J8HD 1C5DA 1OCWH 1CLOL 3U82B 1OP5K 3IDMA 2YWYA 4RAUB 1B0WA 3BZEB 1J8KA 3AC0A 3KPPA 2DLEA 4HJJL 4HKJB 5D4QA 3GSWA 2GQHA 4NQSB 1WBZB 1Y0LB 2OI9B 4NHUB 1VACB 1J12A 1I1FA 1KTKE 4LVOC 1B9ZA 1MCQA 1U92B 4Q0XL 4WWID 3TV3H 3BPLB 4OUUB 3UTOA 2C4FU 3K2UH 4LL9A 2IANA 4R9HA 3PP3K 3Q1SL 3DRTB 1AO7A 2HKFL 1LE5A 5E2VL 1QFOA 1VB9A 4L3EE 5ESAA 2GJ6D 3L3KA 5FHAH 2I5YL 1R3KA 3O9WB 3UZVB 1IGTA 5DFTA 2VLJB 4KJPD 2XTJC 2NW3A 4NGHL 3DXAA 4NM8L 4MAUL 1T1YA 1U0QA 2R23A 4U05A 3U0PB 4JM4L 5I8CA 4MD5A 1KJ3L 4N8VB 4JANA 5IKCB 5IVZA 4G9DA 1HNFA 3KYNA 1UM5H 4G7VH 3A67H 4HIHB 4LCIL 3KJ6H 2C3HA 5F1IB 4BELD 5C0GB 1F4HA 3NFSH 5D1QC 2CK0L 5JXAL 2VDKH 4HS3B 4R96A 2YD2A 1UM6H 2FB4H 4PB9L 1JPSL 4Z7VE 5CHNA 3RGVA 1U8QB 4WW1A 4K3GA 4W6WB 1I9IH 1ZTXL 3WSQL 1ZS8A 4K8RC 3CZJA 1FGNH 3KHQA 2FH6A 5KN5B 1RHHA 1BFOA 3RIAK 4PRIE 1JGEB 3CPLA 5CJ8A 1VCAA 4Y19D 5C07B 2JELL 1DBAH 1NDGB 4YLQT 1DDHA 2A6DB 5D1XC 3W5NA 3VG0H 4OGYL 3DUHA 3VH8B 3VFOB 4DK3A 2XG5A 5JIPA 2AABL 5J9PB 1CBVH 3KPNA 3PF2A 2CDEA 3U1SL 2DQTL 2EDLA 1T20B 1FJ1B 2WUCH 2A83A 2R0ZH 4APQA 1HHIB 2XN9E 3VG9C 3IJSA 1R0AH 2Z8WC 4LRNH 5ITFA 3B9KC 3GB7A 5AWNL 5DMKA 4H8WC 1HIML 1WT5A 1BLNB 1LNUA 4LSTL 1IM9D 1NGXA 1MCPH 4GRLB 3SDYL 4Z77A 1VGKA 1YPZE 1ZEAL 4W4NA 5J6HA 3VFNA 1KIQA 1XCQB 4ZAKA 5TPWL 5MI0C 5GGRA 3TT3L 1JHLL 2R0WH 1Q9KB 2H2PC 4U1JA 4ZD3H 5TE4H 2YD5A 3QXUA 3KLSA 2JB6A 4RMTA 5MEOA 3B9KD 4YJZL 5EO0A 5I6XC 3S5LG 2DLFH 1UWEH 2DMCA 1U58A 2W91A 1KT2B 2IPUK 4HBCL 1Z0NA 4YHKH 2WQ8A 1WIUA 4K3EL 2OS7A 4M3KB 4NBZB 3G5ZB 2Y9RT 2VQ1A 4JFDA 1AQDB 3DTXB 4JFOA 3BD3A 3ARVA 5B38B 4O51A 2FX9L 4IDJH 5GXBB 2P7TB 3F6LA 4JB9H 3LQMA 1IEAB 3QUXB 4OLUH 3ARPA 4MCZB 5J89A 1MSPA 2HMIC 3CXDH 5I74C 1S3KL 2Y06L 4JKWA 4PD4K 3BAEL 5J12B 4IJ3B 3MJ7B 3JTTB 2XICA 4HWUA 3F6IA 4MXWH 3VGGA 2P43B 3MV9E 3KPTA 1G7JA 2M2DA 3DMMB 3F7YA 1CQKA 3FT3B 4K8RD 3RKPA 3MLPA 3U0WH 4G9FD 1FVEA 1OGAB 1QACA 5JHLL 5F70A 3MUY1 1BFVL 1LNUB 1AP2B 5J1TC 4ODWA 1C7SA 5DJ6A 1X4ZA 1KGCD 1CLCA 3SE8H 3QDJA 4XAWH 3R8QA 4HMDA 3QP3A 4HIIB 1HHHB 1OF2B 3VXMD 5EOTB 3NIFF 3C8HA 4I3SL 1ZA3A 1RU9L 2VTFA 3AU1A 3ULUE 4NKIL 2CDEB 4LCCB 1NC2D 2H1PL 1WWCA 5J9PA 2YD6A 2V7NA 5FCSH 1KTDB 4ZDHA 2HKFH 2Y7QB 4UBDD 1BWMA 1G1CA 1BJ1H 4NRXA 2AW2A 3QWQB 5IVNA 1AGFB 4JO4L 1U36A 4HX1B 4OZFG 3UTZA 2DQHH 4GQ9H 4JFFE 4PP1C 1LK3H 4KU1A 4LHUG 4D0CA 5KVEL 4C56D 4U2YA 3AB0B 5FYJE 2QSVA 5BVJB 3TZVA 4BSVA 5CZVH 4Q0XH 1RZGA 4GO6B 3THMH 3WNLA 1AH1A 4LGSB 4LCWE 4S1DD 2MSPA 5IW3A 1YJDH 3H42H 4GUPA 4XVSH 4D3CL 4YXHL 3KPRB 1S9VA 5C0IB 4XP4L 3EO0A 4NKOB 2DQJL 3ROLB 3ZKSD 1J1XL 4TUOB 1P7KA 4B7LA 1WVZA 2XPGA 2Z31B 1S7VA 4PJ9D 3C8KA 5CLWA 5HY9A 4OM1H 1D6VL 2NY2D 5CILH 3OKDA 5D1XA 1UACL 3V4VH 4U1MA 4JM2C 1EHLL 2DAVA 5J12C 4HIHA 3VI4E 4RMUA 5IR1A 3OKMB 4U1LB 3BHBA 1LO4H 1IC4L 3KPLA 1PG7L 4NUGL 1RIUL 4Z18A 5ACZB 5I66A 1F02I 3SKJH 4LVNB 1CLYH 1N6QH 2XQYG 3CUPB 3HRPA 1C08B 4MHHI 3UTSD 1IGTB 4GG6F 1NC4A 3GBNH 5KSAA 1R24B 1UCTA 3RDTA 1A5FH 2K7QA 4G6FB 3GSOA 4XVJH 1NQBA 2PF6A 2DMKA 3LB6C 1X7QA 3MNZA 3TBTA 2FJFB 3HUJA 2A1WH 5AG9A 2SEBB 3OXRB 1E27A 1SYVA 4HS8L 1MRCL 1CICC 4IS6B 4M1DL 4OKDA 2KUTA 1WBZA 2FIKB 5JORB 4U1IB 2XTLA 1F3DH 1T1WA 4GMTL 4JDTH 4K23L 3DRQA 3MR9A 3M17B 3H3KA 3QCUH 5ICYA 4Q2ZB 3AGVA 4WJ5A 3BEWA 4LEXH 3P0VL 2PYEB 3KG5A 3BP4B 1UVQB 5LXGL 3T8XA 4JRXE 3CIQA 1GC1C 2GKIA 1A6ZA 4KZDH 5GRUH 4XMLL 5CEZD 2YZ8A 2Y4SA 3CNKA 5C3LD 2VLLB 1BFTA 2B1HL 1I3GL 3W5MA 3IDYB 4BH7A 3QJFB 3MRKA 3MRJA 4LSTH 4EN3D 2EECA 3FO0H 4TULL 2X4RB 3QJHA 5EOQL 1PSKH 5I71B 1FZKB 1MAJA 3LQZA 4UV7H 1IAKA 2OP4H 4HKXA 3HNTH 3CLEH 4AM0A 1KYOJ 2QSQA 3VRJB 3AVEA 3MBXH 4ZFZA 3SQOH 4Y19E 3C2AH 1R6VA 5IVXB 4IIQB 4MD4A 2A74A 3CH8A 4LEOB 2R2BA 5C09A 3FQNB 15C8H 5CBEA 1XGYL 1T2JA 1GCFA 4RGOH 3QIUB 3V6ZA 4PRPD 4RSVA 3WXWL 3CFCH 3TVMC 3QQ4B 4JQXC 4MSWB 4IJ3C 1MCKA 5LBSH 5C08B 3BPNC 3FQXB 5HPOA 1MY7A 3S8WA 2A6JA 5CUSL 3UXFA 1SVZA 3ZDXF 1R5VB 3D48R 2F54D 6FABL 2VQTA 5HI3C 2R69L 4OIBA 2D31B 4EOWH 4LLMA 1IC5H 5DI8B 5EDXA 4MAYC 1UWXK 2DQIH 3MJ8A 4U0QB 4Z7WF 3BIBX 5B4MC 1FN4A 2EDKA 4Z7VA 1ERNA 4FZEL 4KUCF 3BXNB 3SGDI 5DVNA 1A1OB 1RK0B 4X8JB 4CADB 4ZO6A 2F8VA 2BY2A 1NMBL 4TVSa 3TO4B 1U42A 1UCBL 2P5ED 2VQUA 1MWAA 4PREA 4PRIA 3HG1A 5ERWB 3INUH 2OI9C 4I3SH 2AJXL 4XBPB 2VDRH 5FOBA 1E4WL 2VN4A 5D1QD 3HI6L 1QLFB 3DJ9A 5L2JB 4DVBA 4D8PA 5IVXE 1N59B 3I6KB 2B7DT 5DQDL 1A6WL 4P4KD 1FDLL 1SYSA 5F1OB 1ACYH 1J05A 4OM1L 3O3AB 3IDNA 1MCSA 3QFDB 3PDOB 4EDXB 4XCFH 1NUNB 1KJ2B 4PJBA 4N1HB 5F7EL 4HLJA 3D18A 4YXHH 5FKPB 4RRPA 1IAIL 4XVSL 3UAJC 2OJEA 2DMBA 1FRGH 1T5XB 4ODHH 1TENA 3TNMA 1CLOH 4ERSH 1QSFD 3ARUA 2CMRH 5D2NE 2UWEA 1NAKH 2Q3ZA 1IAMA 4BFGA 4K9EC 3PV6B 1RZIB 5EO9B 3QEUA 1HOCA 1RIHL 1I3RA 4R97B 3WJJA 1A4KA 5A3ID 4PJ5D 2I9LB 2BP3A 1SBSL 5IB2B 1X5AA 1FO0A 4Y7MA 1ED3A 5DJXA 3RNKA 3L7FB 3P2TA 1PY9A 2W65B 4F58L 1H3WM 4MNGB 5BV7B 2VSCA 5K9QG 2CRZA 5F7FA 1EZVX 1W0VB 3NGBC 1S7TB 4QXUL 3L3GA 5FYLL 5C0CD 4D2NA 2IF7A 1V7NL 3VCLB 5I17B 3WJJC 3S3SA 3HFML 2GSIA 3WL9A 2NY6B 2AKRB 2NYYD 1A14L 1B4RA 1T89C 1CU4L 5BW7C 4HXAH 3LCYA 3SKUD 1K4CB 1MI5D 3TIEA 4XPAL 3GSQA 1NCCL 5FO7B 3HR5B 3ULUL 5FA3B 1INEL 1XF4A 3M1BA 3SE9L 2BNQD 2HTKD 1U95B 4OLWL 3MRIA 1YN7B 4HZLB 1AGBA 5AAMA 5HDLA 3K46A 1CR9L 2ATKA 4LIQH 1RJYA 5AUMB 1PJ9A 1YNTB 5GGQL 5IT2H 4KTYA 2AJ3A 1A0QH 1KIRA 4KZDL 2X1PA 1JTPA 2YD9A 1LVEA 3H9SE 4QY8A 2CJUL 1RMFH 4PJIF 4TNVF 5JA9A 5HGHA 3EYQD 3CVHH 4DZ8B 4OT1L 1OP9A 2OXHA 4E42A 2CDGB 3QR2A 3R0MA 2I60L 2BVOA 4XNMB 3T3ME 5D7LD 3LZFH 5C0BB 4PV9B 1M7IA 1Q9LB 2UUDH 2HFFB 3B2VH 4WUKL 4DQOH 1EX0A 5L9DH 4X7SH 3REVB 4MAYB 4UU9B 1RK1A 1FLTX 2CDFB 3UPCA 1CI5A 1I8LA 5IHBA 4TNWK 4RZCA 2VKWA 1H5BB 2RCSH 3FOLA 4OZHB 5ID0A 2Z35A 3O6FD 1YYMH 5KVEH 3LN4B 3QDMB 3BKCL 3KLDA 2EH7H 3LRSB 3MV7D 3OKOB 4YHPA 4GSDH 3CH1B 1JPST 1N3NB 1SEQL 2RIKA 5F96H 4J4PA 2BERA 3IAQA 3PHQA 4HWEH 4XP4H 2IAMD 2RFXB 3VD5A 2CRYA 4XB7A 4EBQH 4KVCL 1JGLL 2QSCL 4ODUB 4X6CE 1JRHL 4ZUUA 4WV1C 2XKNB 1I3VA 3AREB 5HHVL 4P2QA 4OSUH 3KNBB 3PXJA 1TVHB 1VKXA 1IM9A 4X0KB 3EO1B 1KB9K 1DQJA 5EBLA 9CGTA 3V6OC 4OKVB 4X5WB 4POZC 5C8JA 3MUZ1 3QPXL 2OXGA 5IROA 4X4MA 1DANT 4YDVB 3EYSH 4N0UE 4M48H 4LCWB 3PDDA 1F6FB 4QXGL 1MFEH 3FQTB 4P2OD 2EXWD 4J1UA 2EYRB 3SDDB 4OKVA 4ORGB 1S8DA 4ALAH 4HULB 3RBSA 3MLWL 4PLKC 4YO0A 1SMAA 5EU4A 3QIWC 4GW1B 3CDCA 4K94H 4KMTL 5K59E 3S88H 1JFQL 2VDOL 3FRUA 5GISL 1LP9E 4UBDC 1OTUC 4XI5C 3QWRA 3BQUC 2XWBB 1JYNA 2AK4B 4NFCA 3P0YL 5DZLA 2Y5TA 2EDEA 2GK2A 4YQXL 4PJ8B 1I8LC 1KCRL 4LHUB 4KK6D 3O4LB 1X5GA 2MCPL 4YIQB 1QPPA 1T80A 3MCLH 1KTLA 1PQZA 5GQBA 3M8OH 4YHOL 4DZBB 4QHKJ 5BS0A 4ZNCD 1EXUA 5IFHH 3PGDA 3QUYD 4NQXA 3T2PA 1V3JA 4PD4J 4HT1L 2O5YH 3D39E 4Z8FH 3EJJX 4L8SC 4NJAL 4YNYB 4GBXB 2NY7H 4O2CB 5E2WL 2ADFL 2CDFA 5EWIH 2BNQE 3THML 3QXTA 4HF5L 4JY6A 1I8IA 4WEMB 3QDJD 1MEXH 2MOVA 2J5LB 3VXPB 3TNNA 2DKSA 4MDIB 1XCTA 4QHMB 3UJTL 5F6IB 3P9WB 5FKAB 2DQJH 3LD8B 5L0QC 4G80B 2BVOB 3QFJB 3FL7A 2KH2B 4HUWB 5T5FL 2AABH 4XRCB 1CBVL 5FM5M 1S5HA 2ORBH 4JQXA 5I16A 4JRYD 1N8ZA 4LLYB 2IFGA 3JXAA 4X98A 1AXIB 5HD8C 2X7LA 1NLBH 2HRLA 3IVKA 2Q76B 4Q9QH 1EPFA 3S36X 2ADIB 4ZYKB 2CIIA 4UDTB 2XZQH 3VG9B 2FR4A 4QF1A 5JDSA 4DGVH 5DDHB 3D3VD 3IJHA 4MA7L 5F7YC 4PJ5E 3LRHA 1TJGL 5HDQH 2DWDA 4LCUB 2HLFD 3QDGB 2YD1A 3VXMB 4M6AA 2FD6H 2J8UF 2EKJA 4U6XA 1NL0L 4JZJB 2DWEB 1CFNB 1A6VL 1CR9H 4YFLI 4NDMB 4RWHA 4KZEH 1YNLL 1AR1C 4XPHH 1F4YH 5L9DL 3BQUD 1NBVH 2BNRA 4MNHB 1EUTA 1CWVA 3PDGA 2VR9A 5I17A 3MRRB 3V5KA 2DQFA 3JV4B 1DBJH 3QNXB 1PLGL 1BIIB 4MXVE 5EO1B 4XPTH 1WEJH 5HVHC 2V7HA 4I0PC 5DEFB 4F3FB 4H8WL 1A47A 3T2NH 5BV7H 4DTGL 3L7FA 2CD0A 4JY5L 3CXDL 4LKCA 1A6AB 1ED3B 3INUL 2OJZH 4U6HA 1AC0A 3MJ9H 1A7PL 2DYPA 3MNWA 4ONHB 4DVRH 1G6RA 5LWYL 3EYOA 4EIZC 1YEFH 2A6KA 2AV7B 2CKBB 1QFWI 3KYMA 4NSKB 4HUXB 4NKDB 4RCAA 1GGCH 3O6KL 1I3RB 5DJCB 4ELME 4Y5VB 4I4WA 3WMSA 4Y1AE 1CF8H 4AZ8A 4S1QH 1I4FB 4Y0GA 1IAII 4KKAD 3I6LD 1QFPA 1NFIB 2C4FT 3QIWA 4PJHE 2HJLA 2FO1A 2OJEB 3S9DB 1BQLL 4JPIB 3NIFE 2X09A 3TVMD 1KACB 4PGDB 5I8KL 2V5RA 3NA9H 1GZQB 1E6OH 3HLAB 5JR1H 3RWDB 5KSVA 3GNML 1KB9J 2JCCE 5E2JA 4PR5B 4ZTOH 4OSUL 2FLRT 3LH2H 2VR5A 3NZ8B 3CVHB 3X14B 2Y07H 3U30B 4G42A 3QFJE 5HJ3A 1N59A 4N0YH 5GZND 1CCZA 5L2JA 4E41D 3NVQA 4L4VD 5BV7C 1I7ZA 3VFMA 2BNUB 1GGBL 1OSPL 4Z95L 1N26A 4H88L 3HRZA 2QEJA 2HLFC 4TSAL 3AREC 1NGZB 1J5OL 4QGYA 5E8DL 1QQDA 3WHE1 3PJSA 5AEAA 3MFFA 3QPQD 3IRPX 2Z92B 3E6FB 2WM0A 1QNZL 3QUKB 2EICA 1X5ZA 3VW3H 4PJGF 3D39B 5K59F 3KDMA 1BVKA 4CBPA 1LO2L 2P46B 4PJCE 1PFCA 3W81A 4PYHA 1WZ1L 4LLMB 4ZXBB 3V4VL 3CLFL 5J06A 5HDOA 3BH9B 2YMXH 2OR8A 3F7QA 5AYUL 1S9XA 2XTJB 5GGSY 3OB0H 3UTPD 3W9EB 2DQEH 5F9AC 1X6LA 4FFVC 4TSAH 3G04B 5IM7B 5D2LB 5D7IA 3FQXA 3S4SA 1LO0L 1IFHH 5K93A 2XQBH 3Q6FB 4OCMC 4PRBA 3BZ4B 2X4NB 3KJ6L 4PJCF 1DEEB 4UDUA 2XN9A 5I1KH 4S1RL 2LE9A 4YHIB 2ADFH 1IKFL 1QEWB 4IIQA 4MD4B 2IQ9H 3ULVH 5C0AA 4DW2H 4JZOB 3JWNC 3WS6C 4IOFD 4QHUA 4Y4KA 2ZOLB 1E4XL 1YMME 1CDJA 5EIIB 2BXYA 3KS0J 3PQYA 1F00I 4FFZL 3CFKA 1A6UH 2GK0B 5I19L 1FZKA 3HZYB 4ERSL 4G8GD 2W0KA 3TYFB 2DQGL 2Q8AL 5F1SA 3TO4C 2BY3A 3R1GH 3F65A 5CMAB 3MRKB 5C0JB 3OKKB 5F3HA 4I0PA 3QUYB 1K2DB 2AEPH 5DD1H 5C0JA 5E95B 5BRZA 3QNYB 4K9EL 2AAVA 2F54A 5CMAA 5C0EA 4WI2A 2K7PA 3HC3L 5F8RC 3LIZH 4OFDA 3VXOB 1A5FL 1OAUL 4U1HA 1U3HD 3FO0L 4FMFA 3VXNA 1PDKA 4KJQC 1A6UL 3AY4C 2ZOLA 4LPUA 1JRHI 4Y4HD 5D1ZA 1AE6L 4HKBA 5KAQG 4XB8A 4X6FB 4H0IA 1YNLH 3BIAX 4F7MA 4YPGB 4UDUB 1D5XB 1I7RB 1YQ2A 4JO2H 1QO3A 4P4KB 5F6HJ 5F71A 1X7QB 4HCRA 3TBTB 1BEYL 4ZTPL 2X9WA 1CF8L 1KJMA 3TPKA 1UWEL 1UH3A 1CGUA 4L29A 4EZMA 3OKEA 3L3JB 4KRLB 4DGIH 3D2UD 5FYJD 5C86A 4P23C 4RGND 4GRWE 1QSFA 5DD0H 3L95A 2LV4A 4Z9KB 3GRWL 1V7ML 4DKAA 3NZHH 1A7PH 1CTOA 5TDOA 2DD8L 1U8KB 3QAZB 3W82A 4NYLB 5KANI 1SJVA 4KKLC 1NBYA 2DM2A 2EIZA 3MV11 3IKKA 3D39A 4I3RL 2PXYC 4H26B 1IGML 4X7EC 2KZWA 5IK3A 3R8BB 2MPAL 4HQQL 4N8VG 3OPZL 3KLAA 3RUGA 3FCTB 5E8EB 3SE3C 1F58H 4ZUTB 5TE6L 1PG7X 3CFIC 4F9PA 1NGZA 2JIXA 3VFTA 2NY6C 3QDGE 3ROLA 2J6EA 5BJTB 3MV8A 3LPFA 5EZLB 2X9XA 4Z95H 4YHNB 2HT3C 3VRIB 2VO5A 2VUYA 2ICES 4PY7A 1JGDB 3QQ9C 4G42B 1NLDH 5FM8A 4YDJA 4G6MH 4NPYB 1PVHA 3RPIB 5I9QC 1WBXB 4L4TE 4MX7B 2NPLX 4YDLB 1JUFB 3SKOA 1BPVA 1QNZH 3LH2L 3KJ4B 1SJHA 3ARTA 4LKXB 4YHYB 1MFDH 5EIQA 5M95B 5C7XL 5KVDH 4LLVB 3PL6C 2ENSA 3UJIH 4JQIH 3U9UB 4LCCA 2H8PA 4LGPB 1KCLA 2IEPA 2VDKL 3B5TA 3QQ9D 3RFZC 2ZUVA 5B8CB 1I8MB 2B0SL 3UX9B 1P2CA 1OM3H 4ZQKA 2OR9L 4Y8DC 4FS0A 3FQRB 4Z5RA 2CKBH 3O6LH 1CL7I 4MMXC 3ALXA 5DRXB 3RTQB 4KROB 1BBDL 4BQCA 3BDBA 5F89A 3CMOL 3SJVB 3KLHC 2XKUA 4LMQI 3JWOL 5F9DC 2NY2C 4HH9A 4O9HL 4PJ8D 1I7TB 1KC5H 2AV7A 4LASL 5E2UL 2A6KB 2R29H 1FO0L 1T1ZB 2CSPA 5FO8A 1FL5B 2NCMA 3KHOA 4X9HA 4KAQL 1H3TA 5CSZB 1G7HA 4EIGB 2CLZB 4WUUE 5HHNB 3GMLB 2Y6SD 3LKPB 4JFPB 1EBPA 3EDDA 2Q20A 1HCFX 1BD2E 1DZBA 2EDOA 4ALAL 3WKMH 2G9HB 1CZ8H 1JYWA 1U91B 3SDXE 3GSVA 4IEFB 1UXSB 1H9VA 5GISH 1FL3A 4LF3B 5IMKB 3DI3B 1GYAA 4XC1H 3VFWB 4O5LH 4TTGA 1HCVA 1XGRB 1U58B 4J4PC 1TNMA 5DD5H 2C1PA 3T3PE 3VGHA 2V5MA 1DN0A 1T22B 5SWZA 3FB5B 2E27H 1LP9F 3BP7A 3L5XL 3QYCA 7CGTA 3HC4L 4BUGA 2CGRL 4KTEL 4YBLB 3WCYA 4L8SA 4ZUSA 4P59L 4PJCB 3QEHB 5J6HB 2CIIB 2ZUQC 4XHJC 5FUZH 2DICA 4DVRL 1CGWA 5CJOH 4WI7A 1YEFL 4WDIB 5DMKB 4XXDA 1A7NL 1JUFA 1YN6A 1IGIL 1RUQH 4AYFA 4LARH 5AZEL 4MX7A 1I1AB 2X70A 5AZ2L 3WFZA 4FOMA 3WLWC 3LIZL 1JHKL 2PCPB 4TTDC 4HUWA 1HHIA 1WZLA 3DSFH 1FJ1A 2Y06H 2QHLA 4G3YL 1K4DA 2ZCHH 3UTQB 3MV8B 3KAAA 3KPNB 1XIWB 2JF1A 3S37H 1P4IL 3TH3T 3UTTD 3EOBB 1WZKA 3EGSA 1DLFL 4TQEL 1J1OL 4U1NB 3JTSB 4PJXF 5K9KB 3MBEB 3QCVH 2ZJSL 2GAZA 1A14H 5IJVA 3JVGC 1UWXH 2F19L 1QA9B 3WE6A 2ZSWB 3S5LA 1OPGH 4H26A 4CDGC 3VU2A 3BKMH 3OJDA 5JW5A 3N1FC 4JO2L 1U8KA 1EEQA 4JFHE 2IAMC 1S5IL 1SJXA 2BRRL 4LLQB 3ULUC 4P57A 1HKLL 4JM2A 2EDRA 3LPGA 2H26A 3ZHKA 2NTFA 5F9WC 4NQCE 2Q6WB 3ES6A 4H88H 1UEYA 3SY0A 2WWKT 4MDJB 1A0QL 1A3RH 5IVOA 2OSLB 4XNXL 1F2QA 1D5BB 1HILA 3W0WA 2Q86B 1FFOB 3ZKXB 4HHAA 1I9RH 1NCUA 4LVHC 4IMLA 4OGAC 1BFSA 4YO0B 1CDYA 1KNOA 3AS2A 5CJBA 4KFZC 4PRNA 5KZCD 4GRLC 2PO6B 5T1DH 2W9EL 3O9WA 1R3KB 1AGEA 3MGAA 5ESAB 4QRPB 2V2XA 2Q7NA 5IW6A 4KDWA 3OAZH 3EO9H 4HBCH 4WHTB 4NZTH 1YMMA 1Z9MA 3ORJA 4HPOL 4KI5F 4RBPH 4K7PY 1YMMB 5EU7E 3TO2B 4Y2DB 3MRLA 3VE0A 3T0EE 3VGAB 1DL7H 4K7FA 1ZSDA 4BZ2H 3ZYJA 2F53A 5D70H 3QA3B 1CFSA 2VYRE 4NHUA 5I1GH 5DFWH 3CCHA 3MLWH 3OKKA 3K4AA 5IMMA 3VH8G 3NH7H 3TN0D 3GSUB 1KNOB 4TSBH 4PBWD 5HBBA 1EUUA 3VWJD 2VXSH 1AY1L 5IFJB 4M62H 4Q7DA 3TYFA 5KVMC 4LSQH 4ISVA 3TJEL 1MQKL 2R2EB 1DFBL 2DBLH 4XP9H 4M00A 5D72H 4AT6A 1E4XH 5DVLA 3P11H 2EC9U 5CSGA 4UNTA 2WINA 4YX2H 4IRZH 3P4NA 4X6EA 4G6AD 2EEAA 2X4SA 5ID0B 5JR1L 5T5NG 4JM4H 4YXLL 2ZCKH 3IDJB 5LGHH 3MYJB 2GITB 2ICWB 4YHIA 1H15A 1LEGA 2JJSC 5TFSL 3O8XC 3ZTNL 5T3ZE 1T0MB 2LVCA 3EYSL 3SGEH 2BFVH 2LFGA 2H45A 2VXSL 4XWOC 4AENA 4Y4HB 4LSQL 4M5ZL 4PG9B 3HA0A 4JG0L 1GAFH 3MLZH 1ZVSA 4BKLB 1GPOL 3I85A 4M5YH 1IRAY 5HHOA 3S35X 1L6ZA 4K94L 1KFAL 3BE1L 4NP4H 3OHXB 1FZMA 1MVUA 3WKML 1QZ1A 5FB8A 3ARDB 5IEHB 4NM4L 2KQMA 4PJDB 4M61B 1BZ7A 4QRTB 4HS6A 5AUMA 4FQJH 4Z0BL 2V5TA 1VADB 1AQKL 5LQBH 3NCYS 4XXDB 2X1QA 3ESVF 2VDLL 5LGJA 1EVTC 3DVGB 1I1RA 3DYPA 2AEIT 3E2HB 5IROC 4Z76A 4HJGB 1RVFH 2NX5B 1LMKA 1LQSR 5CP3A 1YEDA 5FK9A 1KCUL 4YHYC 1A1NA 5BO1H 1IFHL 4KXZH 3BP7B 1IC4H 5J6GB 3ARBA 2AS5M 3FB5A 5KVGH 4HF5H 1NL0H 1PYWB 5F7MC 4WUUD 3LEXB 3ARGB 1M1SA 1XZ0A 4R3SB 1U8LA 4FABH 2V9RA 1OP3K 4K07A 5HHPB 2ZNXA 5JZ7D 5FGBA 1MJ8L 2E9JA 3RI5F 5MHSD 1QR1B 4OI8A 3GSVB 1QBML 4N0CC 1F8TL 5TF1H 1L7IL 5SWQB 4G3YH 2X89A 1KCVL 5D7LA 3L3IB 1X4YA 3KXFD 3OX8A 4MZ2A 4Y5XB 1ZE3C 1PY4A 2GI7A 1WCQA 5F3BA 3Q6GH 5BV7L 4WEBL 1QLEH 4IRJC 2ZJSH 1G84A 1OQOA 4X83A 1IC1A 4OAWB 1OT2A 2A73A 4LSRL 1XGQA 2HVJA 2DDQL 4I4WB 5EA0L 1HHGA 5DO2C 2XZAH 4NSKA 5EORH 4HCRH 2JCCB 2GJZA 4JFDE 5F9JB 2BRRH 3SJVA 2VWEE 2KBGA 5IBUB 3WJLA 2WUBL 4QTIH 2ZUXA 3H9SD 5BMFH 4UTAL 3W39A 1U8NB 5I0DA 5HGDB 3WIHL 4EDXA 1I8MA 1E4KC 2DQFB 2M8XA 3PIQB 4NQTA 2HTKC 4IDLA 2VLRE 2GJ6E 4BK4A 2YPKB 4LPTA 5CWSB 4R26H 1TVBB 2HVKB 4MGXA 5T1LB 1SJEB 2R1XB 1EK3A 4APQD 1QSEB 2DB8A 2HT4C 4M9PA 1CFNA 1PZUB 1TCMA 2PO6D 5GPRA 4DTGH 1LP9A 2EZ0C 4U6XB 5LCVH 2Z8SA 5ERWA 1ZWIB 2VXTH 1KELH 3FB7A 1KN4H 3D0VA 1KF9B 2W0FA 5JO5B 5B4MD 3C8DA 5SWZE 3QG7H 4WI9A 1YDPA 2XFXB 2C5DC 4KI1A 2M26A 1Q8MA 1HH6A 3PQYD 4OF7A 4I0KA 4J7RA 1KEGL 2Q76A 4ZS6D 1LHZA 2VXQL 1D5MA 4TSBL 3DPBA 3RGVC 3TWCH 2HG5A 5D6CA 1T7YA 5I9QB 3MROA 3TJEH 2X44D 4PLJD 3ZL4L 4FTVB 5DUPL 1MH5B 4BKLA 2P47B 4OCLC 2R2CA 2VZSA 1AKJB 1FFNB 1ZHBB 4IRJD 4GKSA 3MLYH 1JPFB 4M1CC 3VXPA 1CGVA 1VDGA 4P2YA 2Q8BL 1RD6A 3L9RA 3L3JA 1NBQA 5F9OH 1UXWA 4TVPE 5FYJU 5C09B 2BOCA 3V7MA 5SWSD 4AK1A 3P0YH 4RFNB 5EBWB 1MHPL 1OTSD 1T6VN 3GJFH 5FV2A 1DQLL 4CU7A 1I7RA 4FXGA 1X5YA 4OGYH 4LSUH 4WW2C 4F7MB 3ULVL 2J8UA 1EXUB 1JHKH 4DZBA 1MHEB 1B0RB 1EFXD 4NC0B 4U1GB 4MLSA 5GHWH 5IB4A 1S9WA 3DBXB 2W38A 3GMQA 4I0CC 4O2FA 4LHUA 4M7ZB 4LBEA 3Q3GA 1IAOB 1MCIA 2AK4A 3MRJB 2X4UA 3QQNA 2A1WL 5GGQH 4JO3L 4KK8C 3BWAB 3BSZL 4MNQB 4NM4H 3VXOA 1MCEA 4L9LC 3ARSA 5DTFA 2X5PA 3GK8L 2EXWC 3GDBA 1A6ZB 4YHZL 3QUZC 3UJTH 3U4BH 1JBJA 2BNQB 3T8XB 1AQKH 1S8DB 3MJGX 2KKQA 32C2B 2EYRA 2FRGP 4GW4A 2I60H 1OAYL 5HGBA 4LLDB 3S3PA 4PJEE 2YA1A 1S3KH 3BEVB 3MR9B 4TSCH 4K2UL 4Y5XC 3QCTH 1S7RB 4GMSL 1ZGLM 4O2FB 1PZ5A 3MMEA 5C8JB 1IM3B 1G0YR 4XPGH 1OARL 4H5SB 4UIMA 2DRUA 5CBAB 1I3GH 5IB5A 3C6LD 4IMLB 1X5LA 3BT2H 3MACH 1FFOA 4M7JH 3AAZB 5EFIA 3W0WB 5EZOL 4HZAA 4RDQG 1JZ4A 4XCYB 4ZAKC 4WFFE 3DYMA 4Q6IB 2XKNA 2O61A 2J4WH 5IMLA 4Z6AT 3U83A 3IF1B 4HUVA 2XN9B 1R24A 5GRVL 3IYLW 2VITB 3M45A 4MQ7B 3U1SH 2X4NA 3PHQB 1MIEH 4YDIL 3O2WH 2AQ2A 5CEYB 4JM2B 4XMKL 1I1YB 2YN3A 3IETA 3LAFA 1ZA6A 3LS5L 3T0WA 4P59H 5D8JL 3PWLA 3CMGA 3UO1L 1BGXH 3MXVL 4ZOCA 2ZSVB 5I1LA 3U2SB 5FUZL 5DJYB 3A6OA 1F3JA 1NCWH 4HFUH 1HIMH 3ZHDA 1OAQH 3FOLB 4OZHA 5KSUA 5KS9E 2FECL 3SOBH 1PD6A 3QUMH 5I1DA 3QPXH 4HCRL 5C09E 5IUSA 3V4UL 1HH6B 3EOBA 3MRPA 5EU5A 5GS1C 3ZE1F 1KLUB 3V7AE 3PJSB 4NQDD 5FUOH 2Y1VA 3RRQA 4NCC2 2I07A 3QHTC 1RZGB 3KYAA 5I1JH 4X4XB 2WIIB 5EZJA 2ESVE 1KPRB 1WFTA 5CZVL 4FZEH 3MLXL 3MNVA 5GS2D 5MI0B 2QQKL 3NPSC 3LB6D 5HJ3B 4HMCA 4AEHL 3QEHA 2DN7A 1DQQB 3NACL 4HD9A 1JK8A 3MJ6A 1J1XH 5J11B 1K85A 4YXKL 3L1OH 2ARWA 3WFCL 1U8JB 5C0BE 2FBJL 1UH2A 3NABH 3LS4H 4JGMA 5D7IE 5GS1A 5I1JL 1KFAH 5IMKA 1QYGH 1U93A 1U2CA 2H2SD 3ZHLA 1OP3H 2Z4QB 4YBHA 1EJ6A 2Y6SC 3RUGF 1ETZA 1EFQA 3VWKC 1L0QA 5T33L 1DBKH 1NCAH 1S7TA 3FN3A 4PY8J 3RQ3A 5I30L 4JFYB 1MCFA 2C3XA 3JTTA 1YEKH 1KV3A 2BVPB 4WENB 1L0XA 2WLYA 1VA9A 1G7HB 2B1AH 3NFSL 4FQXD 3HPLA 4KV5E 1FFQA 3TC9A 1TTFA 2R9HC 4JO4H 3A6CL 1ODAA 5SWQA 4N0CD 5B38A 1RIHH 4OLXH 2VDNH 1MJ7H 5BO1L 4HH9B 1CXFA 3PWNA 1HOCB 1EZVY 1P9MA 2OZ4A 3IDXL 4KPHL 4HIXL 1PGRB 3ESUF 2CLVB 2P8PB 1ZLSH 2AK1L 2HN7A 2BNRB 4MNHA 2WSKA 4YH6A 3HZMA 4XC3H 2VABB 5DJDB 3NIDE 3QUXC 2JB6B 5D72L 2F5BH 3VXMA 1KXTB 4ZAKB 2GY5A 3TLRA 5EN2B 3RIFK 4TOYH 1N0XL 1VGKB 4BA8A 3C9NB 1JFQH 2VDOH 3U7WL 1QSVA 1J18A 3PDOA 4L3EA 1E4KA 5CEZH 3O3BA 2MQCA 5EOCJ 3O3AA 1A2YA 4K3HA 2LAGB 2W0PA 4OV5A 4Z78B 4WHYG 3QUXD 1MJJB 2VLRA 4YQXH 4YDJB 4NJ9L 4S0TD 1OSZB 5I19H 1B6UA 4YHNA 4PJDA 1U8OB 2OM5A 5BW7A 2N7BA 3E8UL 1G7MA 5IEHA 3D1MC 4MXQC 2YOCA 4RQQB 1MVUB 3C60C 4HUNB 1QFHA 3Q48A 2DIJA 4KKNA 1N8ZB 2A6DA 4QRPD 4ZUTA 4HH8A 3FCTA 1NMCC 3CPLB 4JM2F 2OL3H 3VGEA 4UTAH 5C9KA 4XHQA 3EJYD 4S0SD 4XPGL 4HK0B 3QDME 3ZE0F 5ICXB 4OJFL 4WW1B 4NO5B 1XIWC 4KQ3H 3GJFK 4OCWH 3LKNA 4MXQD 5FGRA 3ZYZA 4FXKA 2EDHA 4J3WA 4PGBA 2GITA 2ICWA 3IDJA 3G6AB 5TE4L 3T4AA 3VXUE 1MCWM 3HI5L 3G9VA 4EN3B 1NMBH 5C6TL 1ZVYA 1GGUA 3LZFL 4PPTA 1J87A 2BJMH 3OKEB 4WRLA 3QWRD 4QRSB 3PWLB 5F1KC 4TVPL 5JLZA 5FOJA 1J8HE 5SX4I 4EVNA 4EOWL 3V6ZB 4JKMA 1QO3B 5D7IF 4AG4L 2C7UA 2FJHA 4G9DB 2VITA 2VDPH 3STZB 1IKNC 3GSUA 4JAMB 3LQAC 3DVNA 4I8DA 1D3CA 3WYRA 3H9HA 4L4TA 4MA7H 2VLJA 1CFSB 2BSSB 2F53B 1Q9WB 4N0UB 4I2XE 4P2OC 2QQKH 5CGYC 3HI5H 5C6TH 3NA4A 4PRID 1ZLUH 4GW1A 4F80A 2P5EA 4ZSOA 4Y2DA 4JCLA 1QLRB 4G6KL 3PUCA 4JN1L 4D9RD 2J8UE 1IAKB 2L4OA 2X05A 3DIFB 3DMMD 4PJ7A 4JDZB 3BP5B 3LSOB 4TVPH 2ITCA 1S7RA 1OPGL 3K0WA 5C0EB 2P5WE 1HN1A 1T2QH 5E4EC 5C08E 5JXEA 4J3XA 2D4FA 4BH7B 2AK4E 1CIDA 5B21A 4ZFFB 1EFXB 4PJHB 3VDBA 3KPPB 4X0KA 1IM9B 3ZDXE 1V05A 4RAUA 1GL4B 4Y5YA 5DWUL 5HI4D 3EYVA 3JWDH 5DTFB 1KBGH 3O6FC 5CUSH 1NGWB 3BESR 4JPWH 3MRDB 3S6CA 1AY1H 4NC2B 4RFNC 4WJ5B 3PQYB 1C16B 5TGBA 1S7XB 1HZHH 1VEPA 4JKKA 1EEZA 4Y4KB 3V6FB 3Q3GB 4LVOB 4LBEB 1GGCL 2MWCA 3FO2B 1G6RL 3EDKA 4GQ9L 1LEKB 3B2UD 3IDIB 4ODBD 3PL6B 2EYTA 2VC2H 1EO8H 1V7NH 2B4CH 2BX5A 3FN0L 5IQ9A 4MJ6A 2HTLC 4Q9CA 3BPOB 4CVXB 4G8EA 4QRUA 5DD6B 3AMKA 4H1LH 1A7RH 1LO4L 3B9VA 3IFPB 4CVZA 3WE6B 4W4OC 4J8RB 2CIKA 1AD9A 1GHFH 5T3ZL 1IAIM 5LVEA 4L9DA 3HNSH 5IM7A 1YEKL 4LLUB 4R4FH 3JSSA 3F12B 3BJ91 5GS3A 3EGSB 2HFFA 1UG9A 3FRPA 3V95A 5HYSA 1C08A 1A3QA 5C2UB 2EDBA 4ZTOL 3H7LA 4D9QD 1G6RH 5IG7B 1RZFH 2WBJB 5E2UH 4J12A 2JJTC 4FTVA 2YA2A 4J3VA 4E42B 3P73A 4M1CD 3WS6A 3D25A 2VMFA 5EZOH 5D1ZD 1E4JA 3MLSL 3O4LE 1ZLVH 4MHHG 5KS9A 1LO5B 3EHBC 1RI8A 3MA7B 4TN9A 1C1EL 4OD3H 3TT3H 1CFVH 4IRZL 4KY1H 4ZD3L 3HRZB 1AR1D 1A7QH 5ACMA 1T21A 1D9KD 1ROWA 5I75C 5SWSA 3P0VH 1RJZB 4ELKA 3FB7B 3BGMA 2XTJE 3PP4L 4PIRF 4F2MB 4WEUD 5CGYD 1AD0B 4YHKL 4DJMA 3BN9D 3NZ8A 4ORZC 5L8KB 2FL5B 3MLTA 4UT7H 5E00B 3QG6A 4WTXA 1CGTA 2BVUA 3BIKB 3GMMB 3MUJA 3EFFA 3KPRE 2APXA 4K8RH 5LJYH 1DQLH 1FL3B 3GKZA 2H32H 4LF3A 4JY4B 1SJEA 2R1XA 2P44B 5D6DA 2R2HB 1X5HA 1IQWL 3VFVB 5EH1A 1IMHC 1LDSA 4DUWA 2P42B 1CXLA 5T3ZD 4MNGA 4MD0B 3W39B 4PJ5A 1BOGB 1FVDA 4NQCA 4XPHL 5CSZA 2NY5L 3GI8H 4LCYB 1KIUA 1RIVH 1QKZL 1AP2A 1P7QD 4GG6A 1RZ8B 4U49A 5FO8B 1CDUA 1T1ZA 1BZ9A 1EEUA 5JHLH 4OLZL 2XN9D 1CN4A 2D0FA 8FABB 2KPNA 2EE6A 1P84J 2VDMH 2HJKB 4GRWF 5D7JC 3F62A 4PRHB 2ZOKB 2FX8H 4AEHH 1XAUA 5DHVA 3HNTL 1AJ7L 5DRXA 2FSEB 1EO7A 1BQUA 3VI3E 2V7HB 5DEFA 3WIHA 3RHWF 4OZGF 3LN5B 5IBTL 4GAGL 5ENWA 1T1XA 1DE4B 5GJTH 3TJHC 3QI9A 1C5CH 2QQLL 1D5ZA 1JCKA 3U9UA 3EFDH 5C0CA 4L8CA 1X5JA 3MA9H 5FKPA 2FGWH 3FRPG 4NWTL 1MRDH 4QRPE 2QADB 1P84K 4IM8A 3RZCB 4CJ1A 1E6JL 1XR9A 1SJHB 1X5KA 4WW2A 5C7XH 1KLGB 5EZIH 2WNGA 4GKNB 5ETUB 4FQ1L 1MFNA 2FL5A 3MLTB 5EU6D 2EE2A 4N1CA 4OQTA 1S9YA 3VFSA 2DWDB 2ZCLL 4FNLL 5JUEL 1P5VA 3B3IB 4FQLH 4PJAB 3B2VL 4WUKH 4ODSH 5EZLA 3ZSSA 1XGUA 3NIGF 4LSRH 4ZO7A 1NUFA 5I8KH 1KIQB 3OR6A 1RZJH 4P3DA 5GSVA 1UYWL 3HG1B 1A7OH 5KW9H 4ZYKA 4XAKE 3KLAB 3RUGB 5L6YH 2XACC 3IVKB 5LGJB 1NFKA 1BHGA 2ZUYA 4V1DB 1Q94B 3D25B 4N0YL 4RIRA 3WUWA 5CD3B 4BZYA 3HCVB 3H7BA 2ICCA 2JB5L 3HAEG 4Z7VB 4QTIL 2EDQA 1KCRH 3F58H 3FTGA 1V3MA 1VFAB 5EPMA 3QFJA 4M61A 5BRZD 2LU7A 1E4WH 3HMXA 5E7FA 4MA1C 4OF8A 5JW4M 2FATL 1XCTB 2DLTA 4XX1G 4BZ2L 1BQHG 1G7LA 3VH8A 5HHOB 1R5VA 4Q97A 2AXGB 4PGCA 1CT8A 5FHAL 2ZKHH 1BFOB 1ZVSB 4LPYA 5K9QI 3PL6D 4L1DA 1XF1A 2DKUA 1H3PH 2NLJA 4L3CB 3GIVB 3IKCA 2E6QA 5C0DA 3JBG7 1OL0A 4PP1D 3SDAD 4DKDC 3C5SA 2XZZA 3MRCB 4B53A 2CQVA 2R0KH 4OGAD 4R96B 3GO1H 5DFVC 3PL6A 1VFBB 4HKBB 5D1ZB 1QFUL 2X4SB 4CNIB 4M93B 4QXGH 5GRJH 1I85A 3D69B 3ULVE 5L2KE 2XQBL 5TGBB 1M7DA 4AM0B 3HG1E 1HSAB 4ONGL 5KJRL 3W2DH 3DV4A 5T3XE 4I13B 2X4OB 1FNFA 3OG6B 3WDJA 3HE7A 4PJGA 2X4RA 3MTRA 5T1MB 1EFXA 1R5IB 3QJFA 4ZFFA 1VPOH 1WBYB 1JMZA 3I3BA 1R5WB 4F7TB 2AJUL 4WI6A 4WI8A 2BVYA 4O02H 4EXKA 4P5MB 4XPAH 2QKIA 3EDEA 3O6LL 1FZJA 3VG0L 5F7NC 4FFYL 3SDXB 4MS8D 4LNVA 3TA3C 5L8LB 4XBGA 4FZ8L 2GK0A 1ONQA 3UTTA 1MF2L 4XZUB 2Q1EA 3FJTA 3UJJH 4FA8A 5DD3L 5DMIH 3AFLA 3H3PH 4R8WH 1ZT7B 1TVHA 2N7AA 3BX7C 4RGNE 4WUUB 5F9WB 3H2WA 5DD1L 5IW1B 1KEMH 4C56A 1P7QB 1F11B 1L9MA 3GSWB 2WWMD 1HQ4A 1LO3H 1MRFL 1S7QA 4OZGA 1HILB 4ENED 1EHXA 3Q6FA 4RISL 3A0OA 3QWOB 3LRSA 2BZDA 4A2LA 4LU5L 2Q6WA 3X3FL 1DVFD 3WEXA 4W6YB 5HYIA 3I75B 2H26B 5FYJH 3FB6A 1XGPB 1S7UA 2FZ3A 1E6OL 5IBLC 2EEBA 3FZUC 1CE6B 2DI9A 1BEYH 2LQRA 4Z0XA 1DQDL 1IEBB 5CJ5A 2NY3B 5FYKL 2DJSA 4LCWD 5IR1B 4PV9A 1I75A 3VXQA 2XI9A 2JE8A 3T2OA 2DJUA 12E8H 4FN0A 4L4JA 2DM4A 3DWTA 3MBEA 3X3GL 4NNXB 3JTSA 2APWA 1Y6KR 2OL3L 1A6VH 5HGAB 1P7KB 2J1KA 35C8L 3BZFB 3TFKD 1JGLH 1N5YH 5D7JB 3ULUD 1T0PB 1ES0A 3TBSA 4NQEE 1U9KA 2BMKA 3JZ7A 1F6LL 3OKNB 2DIBA 2OYPA 1KOAA 3P0GB 4F33A 5KSAD 1RJYB 3ARFA 3UZQA 1CG9B 4FFWD 1LEIA 4GSDL 4V1DD 4M62L 1X3DA 1V5JA 4HUUB 5DZNA 4HX1A 5HVWA 2DQEL 5FA3A 2DQDL 4L1HA 4M1GL 3DUUB 3PHOB 1R3HA 4XGZA 4JQVC 4Y1AB 4JPIA 4XNQA 4KI5E 3ARED 5HHVH 3RVTD 3QUZB 3U7YH 3ZT7A 1EEYA 3EUUA 1QP1A 1OF2A 2QR0B 2EO1A 3U6RB 1DN0B 1T22A 3GMNA 4LHJB 5DUML 2EDYA 4JDVB 2HN7B 1LK3L 2IALB 3MUGA 4X5XB 3HZKB 2X89D 4Y5VA 4OFYD 4MQXC 4CUCA 2R9HD 1MCRA 3VD4A 3WXVL 2QADD 3RZCD 1P69B 5DQDH 3VXTB 1FIEA 2P24A 3GKWL 5EUOB 2ZPKH 2DM7A 3KS0H 2HA1A 3VJ6B 2R8SL 2IPTL 5TJWK 1C12A 2QJDA 4XXCC 4OLVH 4UQ2A 3RA7L 3C5ZA 3KPSD 2DS4A 3WFEL 2H3NB 2CLZA 5JQHC 4M6ML 1O0VA 5FHBL 3JV4A 2W9EH 4WI5A 1PKQE 4NUJB 1T0NB 2QADC 3RZCC 4NQDE 5IOPB 5FO9B 4GQPH 1I7TA 5LQBL 1BVLB 1CVSC 2H1PH 2WV3A 1MHCB 5ANMA 2WBJC 2DWEA 2JK5A 5J7CC 2DTMH 4F8TA 4S2SB 2O5YL 1K8IA 5DC0A 4KHTL 4Q6IC 3O8XD 3KPSA 5MEOB 1I1AC 4GRMB 5E2WH 3ARGD 3G9AB 1SY6L 1JK8B 2JCCF 2VISA 3ZMRA 3JWOC 3RWGB 2K9UA 4S1SH 4ZPVB 1XCQA 3DGGA 5HHOD 4BQ6A 3CLFH 1Z6JT 3LPWA 4XP9L 5CJQH 5JW3L 2JJVA 5JW4R 2VZ1A 1YEIL 4YEEA 2R0LL 3BRFA 3GB7B 3LQAL 4NFDA 4PJEF 1Z0MA 2FX8L 3HFMH 1JGDA 1MWAB 1HNGA 1MQ8A 5FECA 4YR6B 4PLJC 3QAZC 3O9WD 5CP7B 1AE6H 2HKHL 5E56A 4KKAC 4RNRA 3O6ML 5D1QA 3N85L 4YZFE 5BS0E 1JGVH 3QXVA 1MCDA 1AFVL 2ZNWA 4NWUH 3OMZA 2MJWA 5E94A 1DDHB 4KZEL 1NDGA 1W2KT 2HFEA 5L2KD 5B8CC 4YK4C 3PWPE 1UQSB 3WDIA 3UROR 3CU7A 5E4IA 4O2CA 2MHAB 1IZJA 3B9KB 4MMZC 1F3JB 1Q1JH 1M7XA 4WFED 3FT2A 5EOCL 2VH5H 1NBYB 1KB5H 4O4YL 2ENYA 1A7QL 4AEIH 1URLA 1M05B 5GRZA 2A9ML 4JGUA 5BS0B 3V0AC 4Q9RH 3MACL 4UIKL 3FFDA 3QIUA 4KJPC 1SEBB 4C58B 1A3LH 5HHMD 2C3WA 1JPGB 4U6VL 2YBRB 2QSTA 3L7EA 5DHYA 3OB0K 3IDYC 4LEOA 4RDQF 5IMLB 1DBJL 4G8IA 4DOHE 3C60A 4JLRA 3QO1B 4P4KA 1F58L 1YY8B 2W9DL 2XRAL 4JANB 3BN3B 3OG4B 4H5SA 1NCNA 2R23B 3DURB 3DX7B 4UIMB 5D7KD 5CBAA 4GH7B 4MJ2A 3X3GH 3VMPA 4JZNA 3R0NA 4ODTL 2IADA 1NCTA 1S7WB 3GGWA 3TCLB 1OM3L 2RCSL 3D2UB 1DBBH 3WD5L 3MSPA 2BY0A 3FAXA 5HI4C 1CXHA 3VWJC 3BVNA 2WBWB 4NT6B 5FGSA 4FFVD 3D85B 32C2A 4CMMB 2UVFA 2N4IA 3S88L 5ISZE 5T1DL 5F96L 2LVEA 4NHCH 1ZLWK 3VFRA 3C6LC 3LY6A 1YC8A 4P2QB 4LP5A 1MOEA 5A2JH 3BWAA 3VRLE 2O5XH 3OKLA 3T1FB 3REWB 2PETA 4P5TC 3Q6GL 4Q2ZA 3HNVL 2OL3B 1MCOL 3WFDH 2CKBL 4X4YA 2H6PA 4WV1A 3ZDZE 2IBBA 1T1WB 2YEZA 2LU4A 1S9WB 3OKLB 3MV9B 1MHEA 3KYKH 4J6RL 2DQUL 3S35H 2XZAL 4Z8FL 2J8UB 3K8KA 3G6DH 4HLZG 1M6OB 2W07A 3FQUA 3OXRA 3NACH 3TA3A 1MRDL 1WISA 3SCMD 4X4ZA 1RU9H 4IMKA 4F7EB 5JQ6H 3MNZB 4RZCB 3SO5A 1CD1B 1ZT1A 3ZYIA 4P9ML 4S1DC 3PWJA 3ZKMC 2BOCB 4CDHA 4L4VE 2UYLA 1DEEA 1FE8H 3HC0A 4NNYB 3B6SA 1TCRB 3C08L 2R8SH 3WFDL 1JPFA 3JV5A 4JZNB 2ZPKL 3GSRB 2FB4L 2RJMA 3G5YA 1F4WL 4DN3H 1JTTA 1EBAA 2IH3A 4XNMA 3I02A 3MLUL 3WFBL 5K9JH 4NQVA 1OW0A 5E2TL 4HWZA 3MUHL 1EH9A 1HHKB 2APFA 3C60B 1JWSB 4JLRB 5IWLA 3D9AL 1S9XB 1KCSH 5HGHB 4JM2D 2D7NA 1KBGL 1BBJB 4OM0L 4X99B 5EBMA 2I24N 4LARL 1Z2KA 4R90H 5AZ2H 4GKZB 3DSNA 2AVGA 4TNVK 4LSDA 3MRGA 5GZOD 2ATKB 5F72S 2NR6C 4M6OL 4U7KA 1TZHB 2X4QB 3RBGA 2B2XH 2UY6A 4KHTH 5GS0D 4HGKC 2CUHA 2IBZX 2J88H 1QQDB 5AWNH 4PJ9A 3HAEB 5EU7C 3QUYC 3GSQB 3TIEB 3FAWA 4CKVX 3UAJD 4XC3L 4FQIL 5JIHA 2V5YA 3MRMA 1RULH 1KTDA 3ZT6A 1CU4H 5DA4A 4PR5A 3N1GC 3VCLA 1D9KA 4Y5YC 3WLWD 1GZQA 1TVDA 1IGJA 3MV7A 3ILQD 3ARFC 4O4YH 3S3JA 3U36A 4EKXA 1ADQH 5DJXB 3FMGH 3RNKB 3RY6A 1AFVH 2UWEF 3EYUH 2E6PA 3L3OB 5F9JA 1OGAA 3MYZA 2F15A 1FHGA 3P4OB 4U6VH 5HDQL 4UQ3A 1TMCB 1NAMB 1OLLA 5E6ID 4AJ0A 4ZXBD 1N64L 1U8MB 1HHGB 5TF1L 3UZEA 3D6GA 2G5BB 1YUHA 4Z7UF 2GW5A 3QIBD 4HC1A 4NKDA 3S34H 3MLVH 2UWEB 5TQ0L 2CKBA 2B5IC 3NFNB 3X12A 1G6RB 3PNWB 4Y5XA 4OCSH 2JK5B 4WEBH 5BZDA 4OIAA 5D7LE 3ZE0E 1BOYA 4DQOL 2YZ1A 2PN5A 5E6IC 4GAJH 2PO6C 4PJ7E 3VGBA 5EU3B 3PG2A 5EC1A 4PJ9B 1OGTB 3G5ZA 4OZIA 2P5WA 2OP4L 3R06A 4X6BB 4XCNB 3SE9H 4LQFH 3CFBA 1KJ2H 1XZ0B 4R3SA 2A77H 1PKQA 1SYSB 2MPAH 3ARZA 3UC0L 2YPVH 5JZ7C 1FNEA 4NDMA 3O41B 4AG4H 5IT2L 3CJJA 4U1SB 1ULVA 4YFDB 1E28A 3FN9A 1DL7L 4U3CA 4W68A 1NGXB 1VGEH 3HE7D 3QO0A 3TZVD 3P30H 3V6BR 5I1AA 2HAZA 4NQEB 3PHSA 3CFJA 3K8MA 4J6RH 3S35L 1YJDL 1VEMA 4HQQH 4PJFA 4IOIB 2VR4A 4WO4C 3BYTA 1FYHB 1TCRA 2QR0A 2E7CA 5JOFA 3DNKA 2Y5EA 5DGRA 1DBML 4L5FH 2AJXH 3G08A 1INQA 4GRWH 2RHEA 1IJ9A 2YPLB 3GM8A 4F7EA 1S5HB 4GG8B 5I16B 1REIA 1GOFA 1VEOA 3FOMA 4MJIA 4NBXB 2FATH 3ZE2F 1QSFE 1NMAH 1QVOB 1YECH 5DRNB 1LEIB 5EUOE 3QQ4A 4MSWA 5E5MA 1GZPA 5JOPD 3TNNB 4D9RE 1YEJH 1GGBH 2CRIA 5HHME 1NFDB 5KOMC 3O2DA 4MCYA 2APVA 4JY6B 2VXUL 4FTVE 4AL8H 5CZXC 3Q1SH 3D3VA 5ELIA 2R29L 4ELMF 1FPTH 1WC7B 1F42A 5IVXA 5TE7H 3U0TA 3T65A 5ILTL 1JTOA 4NZDA 2F5BL 5AD0A 5DSCA 1UYWH 1ORQA 3C6SB 3O4LD 1FNLA 4OZ4B 3PGDB 4GXUM 5HHQB 3LQZB 4HS8H 5H37H 4D0BA 3RWCB 5CZXD 2LAAA 1T7ZA 4BFIB 1UM4L 1JGVL 4H25B 6CGTA 5IB1B 4NJ9H 4K9EH 4GMTH 4K23H 2NXZC 2QQQA 3CCHB 3VFUA 5C0NC 2FZ3B 2EH8H 3LHPH 1MJ8H 4CRPA 2CLRB 3E1F1 1JHTA 1DQML 1YY8A 3DRTA 4OFPA 5EU4B 3BO8A 3I2CL 1Q1JL 3QIUD 5BXFA 2E6JA 1CS6A 2YRLA 4BQBA 4YGVB 2ED9A 3BEWB 4J23A 2JJUA 1I9IL 3HE7C 4MWFB 4WHTA 1H8SA 1GGYA 4AEFA 2ICEA 3G5XB 3HUJF 1JPGA 1T66C 2DI7A 2Q87A 2DBJA 4OJFH 4WO4D 4JHAL 4RMRA 4RGMB 2ZUQB 2VKXA 5CIPB 1CXKA 1MUJA 1N6QL 5FDWB 1DBAL 5A2KH 4XCCH 2VN7A 3DXAE 4WU7A 4XP6L 1X5XA 3TVMA 4JREC 1ONQB 1UZ6E 2ADGB 2B5IB 4ONGH 3A6CH 4LRNL 4NBYB 1DTUA 1MAKA 3GSOB 3D85D 2VJXA 4D0DB 3K4DA 1JHTB 2HFEB 2G60L 2YK1H 5D5ME 5H2BA 4UT9L 5HTSA 2NTFB 1QR4A 1G1YA 2XWJB 1WBYA 4XTRC 1QRKA 1IC7L 4DKEL 4H25A 2AJUH 3OKOA 2JKXA 3KPLB 5FYJL 5C0CE 2GSGA 5FECB 1CD9B 4X9FA 4P3WA 2Z35B 2C3GA 2PR4H 2ZZUT 4U31A 3O0RL 1QA9A 2DYPD 4PJ9C 4EQ2A 3KR3L 3OKDB 3MOAL 1ZOXA 4P5TA 1FC1A 3T0EC 4JN1H 5HHMB 5AD0B 3UO1H 1AHWC 2ESVB 3H9SA 4WY7L 4TUOA 5AG8A 2UZIH 1T04B 5DMJB 3S7GA 1FAIL 3EO0B 4NKOA 5I15L 4MA8H 2NXYD 4KRPC 5ALCL 5GJSL 5CLTA 4ZUWB 1MY5A 3QXDA 4GUPB 3QEQE 1MCWW 1N7ML 3KPSB 2OMNA 4IBLT 5GGSB 4DZ8A 4DFHA 2FEDD 5BVJA 3CDFA 3T0AA 4D0CB 4G8FA 3WUZA 4X9BA 4YE4L 2X4PA 2G2RB 5KVDL 1JNNL 1KIRB 2HT4D 4QHNB 4Z7UE 5E24E 1GRWA 3JV6A 1INQB 5FO9A 4V1DE 3H9ZA 4KVCH 3AU1B 3U0WL 2BSTA 2WK2A 3VA6A 1UZ8A 5EPMB 1JE6A 1FDLH 3G6JF 3FKUS 5GGUB 5SWZB 2NY1D 1CD8A 1JWUB 4LSPL 3OAYK 5F9OL 4PP2B 2QTEA 3WUWB 1NMAL 5D2NC 3SE8L 1ZMYA 3LV3A 5DMGD 5T1LD 4YAQB 2GSIB 4MA3B 1KPUB 2FYYA 1RQ5A 2HMID 1FPTL 4ZG1A 1FBIH 1VFMA 4M6OH 3P11L 1M71A 4QCIA 4P9HL 1J11A 3UMTA 4CN6A 4DAGL 1L7TH 4JFED 2J88L 4GKNA 4UOW0 1ZHNB 4WW2B 1J9CT 2X40A 2IMMA 1ZHKB 1NCAL 5AAWA 3C2SA 4OIIL 1RZ7H 4PUBL 3MODL 3B8YA 1W0WA 1MFAL 1IGFH 43CAA 2X4TA 2MCPH 1MI5A 5ENWB 3ARGC 1FNGA 3CZFA 1LD9B 3CK0H 1R3JB 1A64A 1OQXA 2XYCA 2XA8H 4P5KA 3VFPB 3I9GH 3TH4T 3QXDB 4JKPH 1Q38A 3RL2A 1MFBH 3T0EB 1K3IA 4HIEB 2H8PB 4OGXH 43CAB 3O2DH 1Z9OA 3DROB 1MAML 1T04A 2VAJA 5I76B 1FORL 4H20L 3EOAB 1OSPH 1BAFH 1T5WB 5KSBF 3QIBA 3SKOB 2MCG1 1ZHNA 4JHAH 4PJIE 1EAJA 3PGFH 1INEH 5FFLA 3QULB 3DUSA 4WFFD 3ARRA 3LKRA 3ROOB 4OLVL 1A02N 5IV2B 3KPOB 1IEBA 5DO2D 4DVBB 2A83B 1U3YA 2EC8A 2YD3A 1MELA 3L5WB 3DO3A 4OZGE 3QQ3B 4RBPK 4XP6H 5SX5H 5A3IC 3VFVA 1KPUA 2I9TA 2Y23A 4PY8I 5DK0A 3OBAA 5DK2B 2JIXB 1WF5A 3VFTB 5MENB 1U6AL 2WQRA 1DUZA 1MEXL 3DLQR 2UZXB 4H20H 3EFFB 1RZKC 1FL6A 3BIKA 3GMMA 4D0DA 5KN5A 5E00A 3KXFA 3TVMB 3BXNA 4OCRL 3C87A 3JV0A 2XZCL 3VWJB 2IAMA 3HE6B 3SKMA 3TBWB 3CX5J 4S1RH 5HYQB 5IW1A 2YK1L 1JF6A 5JPNA 1QSED 3B83A 5I1EL 4BH8B 1V3KA 1FFPA 3M07A 1NCCH 2UV3A 4I48B 2A6IA 1JJUA 2YPLD 4NQVB 2GY7B 2NY3D 3FFCA 4MD5B 5JHDE 5JW4N 4N9GB 4YWGL 1OW0C 4RAHA 5D6DC 3WN5B 4C4KT 1MNUH 4ODXB 2WMPA 3V0VB 5IB1A 1JNNH 4NNYA 2UYLB 5DD0L 2M1KA 2IQAA 3VXNB 3BKYH 3RWCA 4U1HB 1P4LB 5HHQA 3L3DB 1B88A 1WAAA 3WIFA 2Y36L 1MJUL 1RZKH 3AM8C 1W72B 4UINH 1VACA 1KYOK 5F3HB 5KS9F 1LK2B 1TETH 5F7HA 1T3FA 2BCKA 2X1WL 3D3VB 3OPZH 4XMKH 4GOSA 4PRDA 5K9OA 3NOIA 4BJLA 3UYRL 1IE5A 4Z7WB 3RKDC 2RQ8A 2NLJB 4L3CA 2ZWLT 4CU8A 3U30C 4P2OA 4MQSB 3QHFH 4PG2A 2DQIL 5T1KB 4NZRL 3QFJD 5F21B 4J3SA 4M8QB 5C0RL 2GIYA 2A9NL 1CT8B 1P53A 2NY4D 3DRQB 5CIPA 5JORA 3V5DB 1RIUH 1AC6A 1A8JH 2NXYB 5I71C 1NEUA 4CMHB 3IJYB 3D2UA 4NQDA 3MV01 3VWJA 3N9GH 2E9IA 3BP5A 3LSOA 1G7PB 3U7YL 3WD5H 1F4AA 1OHQA 4PJFB 3NIGE 3LKQB 1F90L 3AS3A 4BZ1H 3N1MC 1A4JB 2EE3A 2JLLA 1QRNE 2EYSA 1F97A 3U7WH 1W0YT 4QHKI 4XWGL 5FYLD 2YXFA 3GSNB 1NJ9B 1NSNL 3OAUH 3UPRB 2W0LA 5DK0B 2DL9A 1MQKH 3DVNB 4JAMA 2FWOA 3MOQA 1CICD 3PGCA 4WIQA 3S96B 2HP4A 3BMVA 3L5WA 2GJ6A 3U46B 3TFKC 1I7UB 5IV2A 3LEYH 3BHBB 1HEZA 3NAAH 2RGSA 3GMOA 1S9YB 3CK0L 2W1NA 5INDB 3U7AA 4QRRB 3CFBB 4OBSA 4H0HB 1WGOA 3WHE0 4OZFH 4TOYL 3QIBB 3C8KB 3RZCA 2XPGB 2Z31A 4NC1E 4PJ7F 3EOAA 5LXGH 4PJAF 5GGVH 2MHAA 4W81A 4FQ2H 1WC7A 3BD4A 4LIQE 1YC7A 3QRGH 4NKMB 1DE4A 5ALBH 3F5WA 5MEPA 2JTDA 3EJZC 5C07E 5FXCH 5C92A 4HK0A 4XC1L 5DUBA 5I8EA 3BUYA 2MKWA 3TBVA 4JRXB 1J86A 1KG0A 5EUOF 3BYYA 4NM8H 1CFVL 4KY1L 4EDWL 5LGKA 4KK8D 1JI2A 4E5XA 4PBVC 1WIOA 4Z7UA 5D71L 1UACH 3SQOL 3DMMC 1AXTL 1ZT4A 3O3EA 1A6TB 2UZYB 4K3DL 4LAQH 3EZJB 1QLEL 4OFIA 5MEQA 5F7DB 4UT7L 4KGJA 5C70A 1NFIA 5J13B 4QOKA 1BOGA 4NQCB 3EJYC 3PQYE 1MJJA 2VLRB 2V2TA 4CN1A 4MD0A 5CJOL 5IJKA 1CXEA 1VHPA 1BJ1J 5IP4A 2W92A 4OCXL 4D9LH 5I1AB 1HI6A 2RBLA 3QDAA 1SMOA 4NNPL 5DJCA 3TGXA 2DI8A 2B2XL 1HDMA 5F7KC 4NO0D 3EIFA 2B20A 4HDIB 5E8OB 1V8HA 5D1ZC 4JFQB 4YE4H 1Z9LA 5EBGA 1A6AA 4U6HB 3KPRD 3QH3B 5BRZE 3QXWA 3FONA 4A6YH 1QSZA 4UNUA 3V9FA 3IAPA 4XVTL 1J1OH 1BVLA 1MFCL 2QLVB 5I1EH 1IBGH 2F5AH 4MAYD 5EO1A 1F8TH 4S11A 4X6BA 2DLHA 4GAJL 1UADC 1KSRA 4OI9A 2X4QA 2F74B 3BKML 4JFOB 2ZG2A 1U3JA 1UKSA 2VQ1B 2VDQL 3PABA 4K3JL 2V6HA 3VXRE 2X1XR 1MF2H 4KI5C 4JZJA 3H3BC 4KV5F 3K81A 4JPWL 4XXCA 3UC0H 1NH6A 1WTLA 5DEGB 3J7HA 4HDIA 4ETYA 4OTXL 4R97C 2E7HA 4MA1B 2DL2A 1MCNA 5A2LH 2B1HH 4NWTH 1HXMA 3MA9L 5HYJB 1ETZB 3BKCH 5LAXB 2VC2L 3G5YB 4L3ED 2V5SA 2Z4QA 5F7WC 3QXAB 4UDTA 5HYSB 1AGDB 4QOKB 4FQXC 5CEXA 2NNAA 3IXAA 2J8HA 3F12A 3O3UN 4HV8B 4ODTH 4QYOB 1GSMA 5GS1B 1CFQA 4N0FB 1CE1H 1IGFL 5DYOA 4X98B 1ZT1B 3U36B 3MCG1 4LLYA 4E5XB 4CVZB 5HI5C 5FUOL 1KN2L 2NY6D 1TQCB 3ZDYE 2NQCA 1OWRM 3GZKA 1A7OL 2COQA 2OTWA 3C5ZD 3MLYL 3VA2C 3SKNA 4NZRH 1U3HA 4BYHA 1WAAF 1CIUA 4M6MH 5J1AB 2AXFA 1OY3B 3ARFB 2XWJA 2IFFH 5MEPB 3O2DL 4QHLB 1AGCA 3MV8E 4LCIH 4MVBC 3ZLQC 2D03H 2D7TL 3REWA 5I1CL 1YEGL 4X6DB 4GBXA 5HVFB 1A3RL 3C09B 4NNXA 5JHDD 2YHGA 2ZUUA 1FG2A 2GUOA 3VWKA 4NQXB 4CMMA 4KMTH 3MRPB 5JDJA 4YX2L 1HEZB 3ALWA 1U41A 3TWCL 4LSSL 4G5ZH 4MVBD 4Y16B 3PWVB 3TYGH 5CZKA 4P9MH 1S7WA 5EBMB 1LWRA 5FIEA 5DRZA 1EMTL 3FB6B 3MFGB 4F57L 3GO1L 2EYSB 4R4NC 2DQDH 1FLRH 1F3DJ 1WLHA 4G7YL 1ZGLB 2AQ3A 2P4AB 4N8VA 4QRQB 4X6CA 5I8CB 4DN3L 1ZGLA 1F5WA 1K9TA 4JJ5B 3QNZA 4N0UA 1T66D 5C3TA 2E9WA 1GAFL 3FQTA 1K6QL 2VE6B 1KCSL 1L7TL 2FGZA 4HUVB 3STZA 3JUZA 4KVNL 5I73C 2AJSL 1SEBA 4LSUL 2EDNA 1TFHA 3B4NA 3RWFB 1X5FA 3RWIB 4X4ME 3T0DA 1ZLSL 5GS0L 4KI5D 5JXAH 2IBGA 4WUUA 3D0LA 2CO7B 5F8QC 4HXBL 1FG2B 4KDTA 5I75B 3GSXA 3CVHL 5FYLE 4G7YH 4M7ZC 2H9GA 1B90A 2K3TA 3MV9A 4X6DA 1RPQA 4UB0H 3T4YA 4JJHA 4KKBD 3V2AR 4ZUUB 3T77B 2CMRL 3E8UH 4HKJA 2GYSA 4Y4FD 3HS0A 4FZ8H 4MCYB 4TPRL 2HT3D 4NO5A 4C57C 1UEMA 4NZUL 5CINL 1RFDH 4YHLH 1N3NA 4UV4L 2AXFB 4JHBA 5I0ZA 5J1AA 2QQLH 5CP7A 2VOTA 4HIJA 4QXTB 3S97C 5E99H 2IGFH 4LHQB 3WBDA 4EUPA 1IC7H 3V52L 2EH7L 4LAJH 4NO3A 4WW2F 4LSVL 4FQ1H 3ZKNC 4CJ0A 3AS1A 3NBNA 3HB3D 2XY1A 4ZNEE 3IXAB 1F45A 2FD6L 1OSZA 2PR4L 3D69A 5A43C 3GGWB 1V7MH 4EI5D 1Q9LA 3N1QC 1KCVH 3ME0A 1QUNA 4WVRA 5KSAC 5LAXA 4S10A 3RWGA 1AI1H 1XH3A 1HXMB 3SCMA 2NR6D 2AEPL 3VXME 4B41A 1MFCH 2VIRA 2R0WL 3O3DA 1GH7A 3IKCB 1U3HC 4I48A 4UZGA 1YPZB 2VDLH 4RFOL 1E28B 2MMXA 3MRNB 3HC3H 3FHAA 2XOTA 1NMCB 5JPNB 3DX8A 1X44A 3PABB 3RVTC 4KUZL 5DJDA 3QCVL 5MP6H 1G7LB 3HNVH 5IOPA 1XFPA 2F74A 2P8PA 1AGBB 1CK0L 5E08H 3VGAC 4LIQL 1SVCP 5B3NA 1MH5A 5I18H 1NCBH 1ADQA 4G9FA 3ARDC 5SV4A 1MWAL 5FUCE 4AQ1B 1NGQH 1EVUA 5DHXB 3HCVA 1ZLVK 3VXUD 4IOFC 4BUHA 4P2QD 1K4CA 3BAEH 4QRRD 3FONB 3MRHA 1VFOA 1XF5B 1M4KA 1CLZL 2P24B 4XMPH 5EUOA 3WNPA 3WNNA 1DUZB 2IFFL 3VXTA 1A9EB 3NFNA 4KKBC 1DR9A 4RRPG 4X80H 4M1GH 4Y4FC 1FIGL 1YDPB 2WP3O 3ARDD 3H8NA 3VXRB 1HI6B 4PJAA 4LFHG 4NGHH 3W0WE 4I9WE 4A6YB 3NA9L 3L5IA 3VFSB 3FO1A 3P4OA 3DUSB 3TA3D 3O6FA 4Z7QF 4NN6B 4LOUD 1U93B 4RGOL 1Q0YH 4P99A 3ZTJG 3TN0B 4XNQB 3HG1D 1R3HB 2OX5A 2EEDA 4JHZA 3BDYL 5I76A 3MV7B 4QOKE 4HLZH 4HIXH 4Y4KC 1KG0B 4TUJB 4JRXA 4LPXA 3VFPA 1QRND 2CUMA 4LOUC 3DETD 1KUMA 5BOPA 4HGWB 2QSCH 1LD9A 4ELMA 2FSEA 1JN6A 1G9EA 1X5IA 4G6ML 3SN6N 3MXWL 2Q7YB 1KXQE 1MHCA 1PX4A 4G5ZL 5ANMB 2MKLC 3BZFA 3DOSA 4ZODA 4HUMB 2JCCA 4Y8AA 2P8LA 2GTZB 5IJKC 2CUIA 4U0RC 1KLUA 1OAKL 2BXZA 1VPOL 2HVJB 4EI5C 5KZCB 1DSFL 4OB5H 1UJ3C 4EEEA 2QHRH 2H3NA 2LU3A 2NXZD 2YUVA 4F37F 3RVUC 2FCBA 5E9DE 1G0DA 1R0AL 1C12B 4X7CC 1ACYL 1YMHB 3PWUA 4Z0XB 2KDGA 4W6XB 4E41E 4F58H 3PGCB 5D7LB 4U4BA 1F4XH 5FOBB 7FABL 1EHAA 4KPHH 4MJ5A 4YAQA 3GJEA 3OQ3B 3LV3B 2ATPB 2VB5A 1KC5L 4LASH 4LRIC 3N1PC 1KEML 3AM8A 4S1SL 3HZKA 4X5XA 4FG6C 2J5LC 5ESVA 3GBML 5E2VH 1BREA 4X5LA 3IETB 5DURD 4M43H 1JWUA 4O58H 4TULH 5CJQL 4J3TA 3LEYL 5J6GA 3MRFA 5E5UB 2XA8L 3GFUA 1KJVB 1T21B 1NC2A 2Z31C 4R2GD 4X8XA 4YPJA 1P7QA 4NQUA 4X6CF 3BH8B 3TT1L 4Q74A 2GTWA 3B9AA 3MRBB 3DUUA 4FQPA 4Q6YA 4OQTH 1FORH 3AAZA 5EFIB 3D5OF 3MA7A 5FF6B 4I9WD 3FQUB 4MB5A 4PB0H 3C2AL 3Q5YA 1XF2A 1RFDL 4YHLL 4IRSD 4XVUC 2VLJD 3BOVA 4P2OB 1NDMB 4P23D 4RGNC 5ID1B 3RWJA 1OAUH 4LSVH 2BC4B 2OL3A 5K33A 3BP6A 3WXWH 3ALPA 5D7JA 3V52H 4HG4J 1T3FB 2BCKB 3SE3A 2NY2B 4AEIL 4MXVF 3WLBA 1I9EA 2A9MH 2GFBA 2IJ0C 4U1KB 1B0GB 4XVUD 2B39A 4LHUD 1UB6A 5C2BH 2CIKB 4PG9A 4HKXB 4U3XA 3DV4B 3G5VA 3RDTD 1G9ML 4KQ4H 2GSGB 2IQAB 4CVXA 5CS7A 3UBXB 1OAQL 3V6OE 1PEZA 1AHWA 3KPQB 4KTDL 5IB4B 1LDPL 3RKDD 4L8DB 1VFBA 4RX4A 3DI2B 4KUZH 1P4IH 4ZFGL 4X6EB 3QHZL 4OLEA 1QD0A 4FXGB 2IG2L 3IFNH 4NRZB 5E8DH 5I2IB 3QWOA 5D1XD 1HK6A 2AEWA 4BH8A 2R1YB 4KJWD 5JW4Q 3HI1B 4WFGD 3L7EB 5DHYB 3BW9A 4FG6D 2PTTB 4L9LB 3K8LA 4P3CL 3BQUB 2L7UA 1EO8L 4NN7C 1F11A 2IANE 3EDJA 5LKNA 5E0QA 4JPKH 3U4EB 2E8YA 4GS7C 4I2XB 3G5XA 5ISZA 2VLKE 1NAML 4MWFA 3FT2B 4HC1L 4X80L 3KYOB 5KG9A 3MROB 4YGVA 3H7BB 1YYLH 3OXSA 4XBGB 5HDBF 2H2SC 3KXFB 3MCKA 2DTML 4FQHA 4YBQD 5E8NB 4X6DE 4NN7B 3O8XA 5EIVA 2WP3T 3G6DL 4URTB 4Y16D 3IRZA 1JF1B 2B4CC 3OWEA 4QO1A 4KROD 5HDBE 4FRWA 5T1MA 4PRNB 4XP1L 2AJSH 1O7SA 2DM3A 5GZOC 4V2CB 4LMQE 1FCCA 1HYSD 2W0FB 4GXUN 4R7DB 1H3PL 3D0VB 3VXUB 1ZWIA 1DVFB 1FBIL 3BPCA 5JW3H 4G6JH 5F7UA 1FNSL 2FX7L 3JWDC 5ETUA 4MDJA 3I2CH 4QRSA 4YC2B 2B0SH 2BHYA 3X17A 4W70A 3OSKA 3NCJL 3O45A 1C5BH 3DHMA 4P4RA 1BQHA 3RL1B 5HYSG 1TVBA 2HVKA 5T1LA 4EN3A 5C0RH 2DKMA 1SY6H 3MLUH 3DROA 2XKSA 3MREA 5DT1L 4TPRH 1F4XL 1RZ7L 4PUBH 3SGDH 3PIQA 1GJIA 5B3JF 2P45B 4GRMA 5FGCE 1W72H 1NFDA 1MLBA 1U8NA 3BKJH 3UYPA 2YRPA 4JEGB 2J7LA 2NY1C 3CZFB 2IGFL 2HTLD 1FNGB 5TDPB 2VAAB 4L4TD 1QOKA 3SCMC 4PRHA 1TZIA 3S36L 5GRJL 3LS4L 4PJXE 4WHCA 2VH5L 4GG8A 1ZLWH 1TDQA 2DQHL 2PYFB 1TJIH 4N8CL 1NCDL 5BCAA 2R39A 43C9A 1K4DB 4UT9H 4R2GB 1K5NB 1RZ8A 1ZA3B 4JR9H 5IIEB 3G6JE 4L8BB 3L5HA 1HHHA 2XG4A 3VXSB 5IMOB 4YDLC 4U7MA 3GUTA 4OAWA 4FQIH 4XNZB 4O5LL 4D3CH 4K55A 2BOBA 3UBXI 3RVWD 5H94A 1A2YB 4UQ2B 5J1SC 5EOQH 5GIRA 1JYXA 3ILPB 1Q94A 4I1NB 4RIRB 4CVUA 1YN6B 2YSSB 2FYYB 5DEZA 3QUZD 5DQJB 4Y4FB 2R2HA 5EOCH 4JN2B 2VZUA 3C9NA 4M5YL 5HD8D 5EN2A 2W9DH 5H35B 3L5XH 3V5HA 4JY4A 3CC5A 3R4DA 4QT5A 1G7JB 3DMMA 2CR6A 4P5TD 1RHFA 5IBUG 1AXSB 3B3IA 2IALA 1MPAL 3KPMA 2VABA 1NEZA 3HZMB 3GSNH 4Z7NE 4Y19B 5ALBL 5C07D 5ALCH 1OTTC 3IXTB 4E0RA 1AR2A 5GS0C 4LQ1A 5C0AD 1OAYH 1KLGA 2P7TA 2JIXD 1N6UA 2BDNL 1YYML 2YXMA 5EC1B 4XT1C 5A16B 1SBBA 2PYEE 5T5FH 1D5ZB 5L2KB 5TE6H 4KTDH 4Y16C 1N0XH 2X4PB 3PE9A 5KS9B 2DLFL 3WV0A 2NY5H 3GI8L 3ILPA 4K7PL 2DQGH 3X12B 4PS4H 3I6LE 4K3EH 1DJSA 4HUKB 4ONFH 5TDNA 5JIIA 3V4PL 1XF3B 4GRLD 5CGTA 1YUHB 5CSBA 5DHVB 4ZUWA 3MGOA 1DLHB 1VSCA 4XPFH 5E03A 5IIEA 1RZJL 1K5NA 2VDML 3CFEB 4JDTL 4WFHD 5GGRB 1NAMA 3QIUC 4JCMA 3OHXA 4NNPH 4HJ0C 1HKLH 3WFHA 1S5IH 1CGSH 1P7HL 1XEDA 1L9NA 4LRIA 4RWYH 2VAAA 4LCYA 2FBOJ 5TDPA 3ISWA 4MXWL 3SJVD 1NEZG 3TM6A 2EDXA 2BSRA 2ITDA 3AMLA 1UGNA 3NFPA 3FFCD 4M48L 3AUVA 3I6GA 3IFNL 4JFFA 4AQOA 4ONFL 2FGWL 5B8CA 5E9DA 4KK9C 5IQ9B 1BFVH 1ZKAA 4ZS7H 4E41A 5EZIL 4NO2A 3IDIA 3VFOA 1NANI 1XGPA 1I9RL 1NGYB 5JPMA 3I75A 3WEXB 1PAMA 1B3JA 1T2QL 1G0XA 2ZCLH 1JF5A 4O9HH 1RHHB 5KBNC 4H1LG 2NY0C 2IAND 4FQXB 4UILL 3RGHA 4K3JH 3MRDA 4QNPE 5IF0B 3BPCB 1AD0A 1WICA 2WUBH 3HAEA 5HYJE 4ODHL 4J3UA 4GKOA 4WU7B 1JRHH 3SDAC 2FHBA 4PG2C 3HMXH 4OZGB 3WFCH 4OF6A 1OGAD 1HH9B 3IAGC 3ZKMD 2FLBT 4J4PD 2N1KA 1MUJB 5BJTA 4HS3A 3A6BL 5GJSH 2A9NH 1XT5A 1MFBL 1QG3A 5DJ8A 3QZWB 2C3VA 3HUJE 7FABH 1ZT7A 1ZSDB 1YEJL 3X11B 4K7FB 5LBSL 4LLAA 1UKTA 2ICWI 2ITCB 5C0GA 5E8NA 4JHWH 4U6YA 3T0VA 5IK3B 1LO2H 5F1IA 3OXSB 3DIFA 1UWGH 3MPCA 2PTUA 4XHJD 5C0BD 1J0HA 2WBKA 1QLRA 5KG9B 5DJYA 4DUXA 2HH0L 2FJGA 1FZJB 4HBQA 4IRSC 1YQVH 5E70A 3BKJL 2WBJA 2CLRA 1ZHLA 4GLRI 4P5MA 5IG7A 1T1YB 2RAMA 1F2XK 3DXAB 4L4TB 2NW3B 5H8DA 1MCJA 5T3ZH 3B6SB 1G9NH 3CXHJ 3HC0B 4JZJC 1F13A 2BNRE 4HWBA 4JFHD 4L29B 5E1HB 1FC2D 3ZE2E 5FHBH 3UCRA 1K6QH 1BF8A 4PB0L 3SPVB 5I2IA 1RUQL 1TIUA 3RY4A 1N4XH 1QFUH 4NRYB 1M6OA 3QUMA 5IB5B 2IQ9L 1Z3GH 4JO1L 5TF0A 3ZL4H 4X6FA 1N5AB 4M7LT 3T65B 1CXIA 3TPUB 4R6UA 3FB8B 3WKNA 1LEKA 3T4AB 5D93B 4PRPA 2YN5A 3KPQA 4FXKB 1AHWB 1YEIH 2H6PB 4KDVA 3S36H 3BEVA 4MYWB 5C0DB 1O5DT 2XNAA 3J8F7 3P4LA 3P40A 4GXVH 5HGBB 5ICXA 3TYGL 3G5VB 1NGWA 2IC2A 3UYOD 5DRNA 5DRWB 3ILQC 3EYVB 2VLMD 1U8PB 2EDJA 4MB4A 4JFEA 4G6AC 1ZEAH 4PJHA 4UTBH 3IFOB 3H0TA 1D6EB 2HJFA 4YUEL 5EU6A 2AEQL 4I0PB 1WCBA 2V2WA 3FZUD 5TH2B 3G08B 2X2YA 4OD1H 4DWHA 1UJTA 3W11D 3BP6B 1IAOA 1LDPH 3O2WL 1KCUH 3TCLA 4XWOD 3SGJC 1TQBB 1CFTA 1QFWL 4HSQA 4IOIA 4JY5H 5HHOE 3ULSB 1TJHH 4PJDF 1J0KA 2R56H 3CFKB 4OV5B 3CFJB 3DX7A 3O3BB 3V7AG 1RUKL 4XP5H 2IMNA 5DVOA 4EI6B 4HFWB 1CGXA 4X9GA 1BJ8A 4DGVL 4FABL 1ITBB 4Z7NF 5CD5C 1CDBA 4P3DB 5GSVB 1QKZH 3GRWA 4U1SA 3VXSD 1UXWB 3VGDA 2YBRA 4R4BB 5A1AA 5BVPH 4OD1L 2J6EH 3KR3H 4FFWC 2MNUA 2C1PB 2CLVA 3CSYB 3QEGH 1TITA 1ITCA 4N5UA 1II4E 3BGFB 3SDDC 5MERA 3B9KA 5D6CB 4OFVA 2L7JA 5GJTL 3G6AA 5C0CB 4WWKB 2PUQT 4G8GE 2XV6B 5BZDB 3HPLB 4JFPA 3LN5A 3LKPA 5ICZB 2D9CA 5CAYB 4EN3C 2C26A 4PJBE 3VDAA 4Q9BA 1JZ6A 4D9QE 5GRWA 4NZJA 2G5BA 5DLMH 2I25N 4Z7OF 3B9DA 3QEGL 4WU5B 4F15B 4POYA 5CGMA 4HWBL 4HEPG 4UI2A 1ORSB 1HXYB 4RQQA 4HJJH 2UWEE 3U9PL 2JJTA 4OT1H 2Q7YA 4KQ4L 1JNLH 4KH2A