2XCMC

Complex of hsp90 n-terminal, sgt1 cs and rar1 chord2 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
AKYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLEHGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYTOSOLIC HEAT SHOCK PROTEIN 90
publication title Structural Basis for Assembly of Hsp90-Sgt1-Chord Protein Complexes: Implications for Chaperoning of Nlr Innate Immunity Receptors
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Chaperone/protein binding
total genus 14
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xcmC00
1RL1A 2K8QA 3IGFA 4PBDA 4RZKA 2Y22A 2CR0A 4PCKA 4YL9A 1WH0A 3L1FA 1EJFA 3L1EA 3Q9PA 2WJ7A 4JUSA 2O30A 3EUDA 3N3EA 3Q9QA 3AABA 3VQMA 1WGVA 5LUMA 2CG9X 5DS2A 2JKIS 4MJHA 2WJ5A 3QORD 2Y1YA 3AACA 3GLAA 2XCMC 4FEIA 4YLBA 3VQLA 2N0KA 2KMWA 1GMEA 1SHSA 2Y1ZA 4JUTA 4ELDA 3GT6A 2BOLA 4I88A 4YE0A 4ZJ9A 3GUFA 4YLCA 2N3JA 3QORB 3QORC 2KLRA 1WFIA 2RH0A 2MNWA 3L1GA 3J07A 3QORA 4M5SA 4YDZA 4M5TA 5DS1A 3W1ZA 1X5MA
chains in the Genus database with same CATH superfamily
3MCG1 1JZ8A 4NNXB 3RWEB 1VRSA 1PX4A 3GRWH 3L3OB 3N41B 1H3PH 3ARGA 4IJTA 1BBJA 4JFED 2VR5A 2F6AA 4HIEA 4H88L 1X5FA 2HN7B 4OGZA 2V2WB 4Q2ZB 3PU7A 5DD1H 2XIIA 2AKRB 2ENJA 3P4NB 4MMXB 3NH7H 5F8RC 4X4ZA 4CADA 2VB5A 4JFQA 2YA1A 3S3DB 2MJWA 3IJHA 4X7CC 3ILEA 4R84A 3N91A 4U6TA 3EZJB 3PABA 5E6IA 3RVXC 1TSHA 5E2JA 1RP8A 1AGFA 5KVMC 5AENA 2X6AA 4HAGA 1F86A 3UEZA 3PQYD 1BF5A 3VI3A 1YY8A 3DYOA 1G9HA 1YEFH 4JO1L 4XX5A 2XVBA 3EO1B 3LB6C 1CGSH 1KIQA 3J8F7 4GY4A 1BZOA 5AAWC 1IGMH 4L8DA 4MAYD 2PCXA 4OFIA 4X7FC 4XH2A 1AKJD 3ULVE 2UY7B 1A6AB 5IR1B 5SWSA 2A9BA 4MKMA 2LOEA 3FQRA 1LXMA 4OH2A 5CHNB 2XG4A 4RISH 4U31A 5CILL 1WIUA 1ZSDB 2VDKL 3EYOA 4DF9A 1MCIA 1AD0A 1E90A 2Q8BH 4R6UA 1T0NB 3LZNA 4LU5L 1MAJA 1QBBA 4UOW0 5CP3H 3P77A 4QRTB 4H0IA 5FR3A 4L4TD 3THML 2FHBA 1UQSB 3P30H 2D3JA 3E9TA 5DJ6B 1L7IH 1X44A 1L9PA 2I60L 3OHXB 1V3LA 5HYQB 5MHSD 1A7NH 1AGCB 3BPCB 4D0CB 3OBAA 4PTTA 2J1XA 4JN1H 2BVPB 3FB7B 4K7PH 2HWZL 5DWUL 3O2VH 3ZYIA 2ZUUA 3QUYA 1KYDA 4HALA 4TNWK 3KLKA 2G9KA 3K80A 3MAWA 3CU7A 4W68A 3OLIA 1VA9A 2QSCL 1TFPA 3FQNA 3OMAB 1SGKA 1IGTA 5E7FA 1UKSA 2VUKA 3QIBC 3CIQA 4WZ9A 2F5BH 3SDCC 3OXSB 1MFBL 1Q9LA 2GW5A 3S2CA 3I9PA 2OMUB 3IDJA 5CUSL 1KC5H 5GJSL 2Y3AA 2VIRB 3UYRH 5I74B 5ICYA 1K5NA 3SO5A 1RZPA 3VXSD 4XP5H 5J57B 4CSSA 5C0GA 2DWYA 2VRQA 4GRWH 3UO1H 3IDXH 4HJGB 3F3HA 3FO9A 1ACYL 4M1GH 5TTRA 1IT9H 2CKBA 3IWUA 2VLKB 3IB4A 2EDRA 2UVEA 4DGVH 3DIFB 3AY4A 4NBXB 4U2YA 2HG5A 1JK9B 3EO9L 2AZUA 4EZLA 4IOFC 1TOXA 4FZEH 1T2QH 4LVOB 1BJ8A 5D7JA 4X7SL 1OD9A 5D1ZI 2ZSVB 4YX2H 2B5IC 1D7FA 3D69B 3PGDB 2YPLA 3FQ4A 4GMTH 3R1GH 3U1PA 1QYGH 4HLJA 4U1SB 1OD7A 3VTTA 5KVFH 1I8LC 4ODUB 1DQDL 1HL5A 1Y6NR 4B7LA 1A47A 3SDDB 1UD2A 1T1YB 3D2UA 3H42H 4OFKA 5M95B 3RBGA 4UTBA 5EUKB 4EN3A 4BXSV 5EIIA 3AABA 1JWSA 3Q1SL 5LNEA 3TNNA 4J5VA 1AQMA 1G7QB 4N2HA 3ZL2A 1EFQA 3RGVA 4YXKL 3F58H 1PZAA 1HU8A 1X4ZA 1I1CA 3TN0C 4BINA 4D0BA 2VAAB 4NP9A 3ZDWA 3KBFA 2JCCB 2X28A 2CUAA 1GS8A 2GJRA 4B9YA 4DKAA 2Q9OA 1C5BL 5AVZB 1CN4A 5D6CB 4HKZA 4X2UA 4GIPD 1QFWM 5CJXC 3TC9A 3UDWC 5IVZA 4K07A 4YL9A 3QUZD 4CL7A 1UYWH 5GISL 4ELKA 3RFZB 4Z3GA 4MB3A 4QYAA 1F4AA 1QSVA 3U4EB 1LWHA 2G9HA 1H8NA 4WKZB 4IMKC 3S3PA 5IUCA 1F6LL 3INUL 1THAA 1CLOH 3AMLA 3QCTL 3P0VH 2PCFA 1CXFA 3QH3B 3RBSA 1SBSH 2BWIA 2P44B 1BZ7A 2NW3A 2MEJB 5LBSL 3RJDA 1KXVA 1FYTB 3RTQB 1XF5B 1S9YB 4YZFE 2QADC 3HAEG 3VMOA 3EFDL 3S88L 4NRZA 4EBQL 3L95B 4LIQE 4RRPM 4QYOA 3S96A 4EI5A 4PY8J 4FCAA 3TO2B 4YHZH 2DMHA 4ODBD 4FHKA 1FSKB 3T1FA 2RD0A 2L0DA 2APFA 2NY6B 1OL0A 2FIKA 4WF7A 3AWFA 1JFHA 1OPGL 1TZOA 4NNXA 3LH9A 4OCYH 5AVXB 4NAQA 5CZVH 3L3OA 2XVLA 4UOQA 1FZMB 1OW0C 2D31B 3B7TA 1OM3H 2NNXA 3T2NH 3ZDYB 2NZ1A 2ZX7A 3AADB 1YMMB 2GK2A 3FUDA 2HN7A 3BGFC 1UEYA 2V2WA 3ARFD 3FUIA 3GINA 4Q2ZA 4XXWC 4YHKH 3TV8A 4F2FA 2AKRA 2R69A 3L45A 2BOCB 3P4NA 4MMXA 1E3ZA 2IV8A 5EWIH 2XETA 1OCZB 1BYOA 1EDYA 2PYEE 3BKML 4IU2B 1TCRB 2PNDA 2ZCLH 3JZYA 5B22A 2X88A 3HG1D 2F5AH 2VXQA 2H6PB 4Q9BA 4XRCB 5EH1A 5IF0B 3V4PH 4ZFOL 1U33A 2H2SD 4W1TA 3QUKB 1PYWB 3FQWB 3CU1A 1JZIA 3IU4H 2DW5A 4MA8L 3NYKA 4Z7WE 3MLZL 3V0VB 3TA3A 1EHLH 3EO1A 1MHPL 2YEZA 3NZHH 1NEUA 1RUKL 4K7PX 1ZLVK 2F1BA 1DJSA 4PLKD 3NZUA 2UY7A 4PRBB 1A6AA 5IR1A 2D7TH 3GSUB 1ITCA 3SBWC 2OI9B 1ZSDA 4WU7B 1OP5K 1T0NA 3MO1B 2ADFH 4FLRA 1T83A 1KTJA 4QRTA 2NY7H 3I75B 4NN7B 1UQSA 4NWUL 1YZZA 2BXZA 1VJSA 2IAMD 5DJ6A 2AXJA 4K55A 4U1KB 3OHXA 4YHYC 1FG9C 5HYQA 1D9KC 3LZLA 1RVFL 3BPCA 1AGCA 5FYLE 4C54A 4PJGF 3SJVD 4D0CA 5ICZB 2RALA 3QEQB 3CFCL 3I50L 2SODB 1CFSB 2BVPA 2ZX9A 1OZTG 3T08A 3FB7A 4HWZB 3DTUB 4MYPA 3L08A 1P7QD 3RWCB 5DLLA 3UCRA 5ISZE 4Q97A 4HPYL 2NUPB 3FOMB 1ILUA 4J3OC 2GTWA 2IWGA 2IPTL 1AGEB 3S7GA 1YMHB 2AEPH 4OAWA 4I77L 1P4LA 2F7OA 1BIHA 5C0BD 5DQDH 1IB5A 2NY4D 4NQCB 1W0VB 5ADOH 3IJ7A 4QRRB 5AW1B 3OXSA 4I88A 1IC4H 4IBTA 2OMUA 3OSVA 2NY1D 1VFUA 1KBBA 2VIRA 2F58L 2RH0A 3CHXA 4K3EH 2G60L 4KJPC 2JKSA 2V6HA 5BCAA 5IMLA 1NLDH 2H45A 5I1LB 1P4BL 2F7IA 5HJDA 4JEGB 2B1OA 3V4UH 2CLRB 1U8JB 4HJGA 3TPUB 3B8SA 4M6NH 5HHOA 3IGKA 5DYFA 2XU9A 3ZE1B 3AQZA 1T7XA 3OTTA 1JMXA 3LPWA 4JM2D 1P6WA 3SGJC 5B7EA 2GI7A 4TVPD 2VLKA 2NW2B 4DKFL 1GC1H 2WY3B 2KZBA 4APQD 3FL7A 1JK9A 2NY5C 5J6SA 1XDTT 5DR5L 2UZIH 4AMKL 3DBSA 4EVNB 3R4RA 4M5YL 5AW2B 4GKNB 3AS3A 1ED3B 2ZSVA 5H37A 3BIBX 4XOAA 1W80A 4PJXB 3D69A 1RLWA 4QTIH 2OZ4L 2V7HB 3EH2A 4U1SA 3C60B 2J25A 4Z8FL 2Q7YB 2BP3A 4JFEE 4ODUA 4ZMTA 2DQCH 5LG6A 3SDDA 2VNCA 1ORQB 1T1YA 2P1YA 2ZYSA 3OVUB 3RILA 4W4OA 3EYFB 1G7QA 2ZXQA 3E38A 2ZPKH 4RLDA 4P99A 5DMGD 1IBBA 2VAAA 2RAMA 3N1GC 4FI7A 2ZUXA 2JCCA 1CU4L 5FW8A 3IS0X 5D6CA 3GDBA 4N2AA 1TJIH 4MQXD 3QIUC 2IO5A 1KV3A 1JVKA 2YK1L 3RHWF 1QHQA 5HYIA 4YK4C 1YJDL 3MQIA 3RFZA 4JO3L 1PS3A 4WKZA 3S35L 1K6QH 2OR7A 3RNKB 2F61A 1PLGL 2FATH 3QH3A 5FGBC 4NZJA 5DD5H 2X3BA 4GXUN 3MDJA 5I15H 4L29A 5TK2A 3RTQA 1XF5A 1S9YA 1QATA 3M86A 4PGBB 3VI4E 3PUCA 4L4TE 4KITB 5EF1A 4C4KO 3GO1L 3L95A 1LMKA 3QJSB 4LEXH 5DS8B 2IFFH 3TO2A 1E8YA 4BGLA 3O4LE 3B2VL 1H6UA 4MA1B 3CSGA 2WXLA 3NCBB 4AZ8A 4KKZA 2MQGA 5MHSE 4MD5B 4ES8A 4N6QA 4GAYB 4DP0X 1OARH 3MFGB 2V3DA 1NCHA 3ARED 5EBLB 1H19A 1FZMA 1WGOA 2D31A 3BAWA 4WDIB 3VGDA 4KO6A 1E50A 1CE1H 4WGVB 3NJNA 5A3IC 2UZYA 2BOCA 2XY1A 3SOBH 3QBTB 4RESB 1PDKB 4NRXB 3TCXA 3PPEA 1TCRA 3BGAA 1CZ8L 3SPCA 1JZ5A 2H6PA 1KCVH 5IF0A 5KVDH 2YAPA 2HJFB 3ZTCC 3QUKA 5I1IH 3FQWA 3EJRA 4GRLC 1FNLA 2V5TA 3MRKB 3VXSE 5DLMH 4RGOH 3D25B 4X6DF 3V0VA 4Y9BA 3P4OB 4X8XA 1ZV2A 2VDRB 2PW2B 1F56A 1RZKH 4WGKA 2EILB 3H3BC 2QQLL 3DSFL 3P1VA 4PRBA 1KCSL 3GSUA 1TMCB 4R5TA 3GSQA 4E9YA 5AVRB 2A6JB 4WFHD 6CGTA 3BAEL 43CAB 5IHUH 3I02B 2XBDA 4W9IC 2FEDD 3MO1A 2NR6D 6TAAA 2OSYA 1AHKA 3UTSD 3BLPX 5BUGA 2CGRL 4WTZG 2RA1A 3I75A 4JY6B 1UT9A 4ZS7L 5D1XC 4NCC2 1J8HB 3G6JA 1VERA 3MRGB 4Y19A 1AZRA 4U1KA 1ZXQA 4G6ML 1DHKA 1DQVA 4TL4A 4KKLC 1FGVH 4FQ2H 5ICZA 32C2A 5DVNA 2AP2A 3MNWB 3QEQA 3BPOC 3TBCA 5IBUB 1CFSA 1G9NL 3LKRB 4FTVA 4OB5H 3MNDA 4P5RA 1ADQH 3TBBA 3WKQA 2BVTA 3MODL 4HWZA 2Y22A 2E9JA 4XPTH 2AV7B 3RWCA 3WIIL 4IIQB 4DAGH 1P5UB 1JGLL 3ALPA 2IBZY 4OIIL 2NUPA 3FOMA 3Q9QA 5ACMA 3PP4L 1AS8A 2X7LB 1FFQA 1DSYA 3D9AL 1AGEA 2QDWA 4M29A 2Y06H 2ZUQB 3QUXA 4NQCA 3SCMA 1W0VA 2KDGA 5DEZA 1BEXA 3U7WL 4QRRA 3TEWA 1UCBL 1F02I 2ZKWA 4XTRC 3BE1L 3CQFA 4XMUA 2FUTA 2VKXA 1RK7A 3IJ8A 5IB5A 3QHZH 4PRHB 4G80B 3EIFA 3LKQB 3UG5A 5I1LA 2CXKA 2F0CA 3ULVF 3RZWA 3VVVA 2CLRA 2HX8A 3QEGH 1E4HA 3GXTA 4KY1L 1LD9B 3QG6B 3RI5K 2VLLA 3TPUA 4AENB 4DHLA 1T20B 2YMTA 3EJYC 4JQVA 4BZYA 1INDH 1QRNB 1WWWX 4J3VA 2NW2A 3ALXA 4YE0A 4OF8A 4XMWA 1EGJL 4UQ9A 4UCFA 4HK3J 1UD4A 4QHLB 2IDSA 1WBXB 1T2JA 3KYKH 4GW5B 3B9EA 4J23A 2I27N 3DTXA 4NO2B 2HFGH 4OLXL 1YQVH 4GKNA 5AOMA 3WY1A 1ED3A 1SMDA 1LO4L 1NQBA 1HIML 2LU3A 5JR1H 4PJXA 2V7HA 3C60A 3RUGA 4K8RC 4HOMA 4QRSB 2Q7YA 1QPPA 3U46B 4W9EC 1O5DT 4P8QA 2VDQH 4PJ9B 4UZGA 2K3TA 4N8CL 4QXGH 3PE9A 4XWOD 4DIXA 1A7OL 5CSZB 2CNZA 3W81A 2CHNA 2WUBH 3D3VD 3QORC 4LHUB 1FLRL 2VMEA 4PI2A 1DQQB 3QNYB 4ATTA 4U1GC 4FA7B 5GXBB 1XH2A 2IANB 4Q9QL 1CLZL 4Q0XH 3HG1E 5DZJA 4FG6C 4AE0A 2X41A 1HXMA 1FH5L 1AR1C 3MRPB 3ROLB 4EKJA 1T4KB 1JRHL 2D7OA 4CVXB 1A25A 1MRDL 3VG0H 3V4VL 5TDNB 4D7PA 4FQXA 5I18H 3LQAC 3A6OA 1OV8A 1BXAA 1I9IL 2ED6A 3AM8A 3VXUD 5DQJB 1JXJA 4DP4X 4NXSA 1YEIL 3RNKA 2WO3B 3LXUX 3VYPA 1YNTF 4ZDHB 1D6VL 4ICWA 3ETSA 3NTCL 5LAPA 1IO4C 3TCTA 4L4VA 1A02N 1A0QH 1NCNA 4RGNB 4Y5XB 1DJYA 2DJMA 4X9YA 4PJ5B 4IRZL 1IC5L 2WQVA 4HSAC 5I0WA 2XJLA 4AQ8C 2XA3A 2HT3D 4J3SA 1YPZB 3ZKNC 4MD5A 2C4FT 4NC2B 3QULB 1N0LB 1NPUA 1TPXB 2R29A 4GAYA 3SJVE 1ZSHA 2NY2D 1IQDB 2AXFB 5EBLA 5AZ2L 4OZFB 1NAKL 1U3JA 3HS0C 5F6HI 3UZVB 4BZ2L 1EQWA 2X6CA 3G3LA 4BBWA 1UGKA 3DK2A 1RMFL 3IK2A 3MV8A 3TVMD 4DN4H 4M6MH 3FQXB 3LDBB 4IJ3C 1Z9OA 2H7WA 1TKWB 2EO1A 1CFNA 1H3TA 4XMPL 1IBGL 5C0BE 4TUUA 2B20A 3V6ZB 2H0FA 4M03A 1NGPL 1GW6A 4RETB 5F0MB 3CX5K 3A6BL 3HRZB 4P2OB 5GZOC 4JNXA 1ECYA 2HJFA 1A1MB 3C6EA 1JD7A 2JCWA 4MD4B 5FECA 3MRKA 1T5XA 2CRMA 3BJLA 4CC4A 3KWVA 3BZFB 4KK8D 3D25A 1YEJH 4PVBA 1E3FA 3P4OA 2PPAA 4M3HA 1CK0L 3VWKB 1S3KH 2YA0A 2PW2A 4NKQB 4ODSH 4BKTC 3L3HB 2XKUA 1FA4A 1FC2D 5EDSA 3R7QA 5I1KL 2CUHA 1SLVA 4YZFF 2A6JA 2CHWA 4TVPE 3X13B 1V55B 4RAHA 3I02A 4Q9RL 4QNPE 2E7BA 4KWUA 3BUIA 3JT0A 3WJLC 2JKIS 3WJJC 2R8SH 1FCGA 1FF5A 3R0MA 4IOSA 1NOLA 1N0XL 4DCQB 4JFUA 2BX5A 1WT5A 3EJQA 4PJ8D 4PWKA 1F3DH 3MV9D 4OCLC 1J8HA 4MXWH 1GPOL 3CCHB 3FHAA 3MRGA 1R3LB 3LZFH 3ASWA 2HRPH 3HUJB 4LMQI 1AC6A 3D39D 3KEHA 4KV5E 2YUVA 1IAIM 4FYRA 1AO7E 1H8OA 2X1XR 3ZT5A 3MNWA 1QFUH 3STZB 2AJVL 4HJIA 3LKRA 4R2GC 3RIAK 4JE4B 1F58L 2XTLA 2ROYA 1NCWH 4D2NA 2AV7A 1JZ3A 3ZE2E 5HVHC 1WBYB 2HB0A 1P5UA 4WWPA 3WENA 4ODHH 5J8OA 5TQ2L 2X1QA 2X6BA 1BVOA 1MCCA 3RU8H 5B3NA 2X7LA 5DUPL 3GMNB 2F74B 2HA1A 4E5XG 4ZSOE 2XHNA 4FZ8L 3F5WB 3ISRA 2OTPA 4CJ0A 3GBLA 5T5FA 2EDLA 3MXVL 3B5TA 2A0LC 2M26A 4HWBA 4M9OA 3SYQA 3QQDB 3EJSA 4G11A 4XVSH 2LU7A 1CLYH 4Z7WF 3M8OL 3PWJB 1X5GA 2XXGA 3SD5A 4PRHA 4DQOL 2YJLA 3O3BA 3QWRA 4HQQL 3LKQA 3H2QA 4OFVA 3ZZLA 4DO6A 3ENEA 1WFUA 5HY9A 2J1ZA 1LD9A 3QG6A 4TM9A 5D2LE 2XDHA 1T20A 3UG3A 5BV7H 2YKLL 5F88B 5HI4D 2BIMA 4ZOEA 5EZIL 4AEIH 4PRIB 1F8TH 1QRNA 1XCXA 3ELAT 3LRLA 1C8QA 3BZ5A 3C6SB 4AGOA 2PO6D 4K9EL 1NBZB 2GIXA 4FLSA 4QHLA 1WBXA 3FU0A 3GJEB 4D9LL 4GW5A 4E42A 1SLWA 3G6AB 5GZNA 3WHXA 3ASOB 3PHQB 2P49B 4HJ0D 2V5SA 4PJEB 4TN9A 3WSQH 3E2HC 3LNEA 3ZMNA 5ILTL 1AYOA 1F4YL 2CK2A 5KVGE 1ASQA 4IGBC 2EDEA 3FC8A 4P46B 1IC7L 4U0RB 2IH3B 4WHTB 4FNRA 1OGPA 4OZGE 4QRSA 2NYYD 1IAIL 1K9TA 2HLFC 1B4JL 3H9SD 4OR1A 4XN8A 3U46A 5CEXB 3ZHKA 1TVBB 5E08L 1IILE 3HN5A 4WJG3 4KMTH 4ETQB 2ED7A 1JNLH 4HD5A 3H2PA 4HEME 2FJHB 4PJ9A 4EDWL 3FB5B 5D71H 3EJZD 5I8KH 2PXYB 1HQ4B 4OLYH 3AWGA 4LHUA 5CN2A 4ZOAA 1Z0NA 3WIAA 2IANA 2VDPB 5DEJA 3H9YA 2EH8L 5CINH 3BUYB 1Y7VA 2VC2L 3MJ8B 1WK0A 4XODA 5CZXC 4N20A 4YBHA 3ROLA 1QG3A 1EXUA 5CR8A 2IH9A 4J4PC 1T4KA 4CVXA 5FKAB 1NFDE 5KYWA 4GAAA 5L2KB 5DK3A 4M7ZB 3L2LA 1E4XL 3S5LG 5JHMA 1CIUA 1S7WB 1LP9E 3O11A 3ROOB 4EIUA 4OI9A 1EDQA 5HGHB 4Y2NA 1EHNA 3Q48A 4WFHE 2CA4A 2W88A 2X9ZA 4GUQA 4RA0C 5MEOB 3B43A 4Y5XA 1R0AH 3UTSE 4E9LA 4Q6IC 3SYCA 3A4AA 3BN9C 1JYWA 4PJ5A 4X6BB 1PBYA 2YPVH 3U48A 2CO6B 4MX7B 2X4NB 5MP6L 3FRUB 1E7UA 4LSSL 5E5MB 1PVHA 4TQIA 5EV7A 4GUPB 1U2YA 1YPZA 3JWNC 5A7BA 4KVPA 3QULA 4NM4H 3O9WB 2CU9A 3P4MB 1KNOB 5EOTA 3APCA 1J10A 5DUML 1IQDA 3D0AA 2AXFA 2LU5A 2WZ5A 1DVXA 1RIUL 3FFCB 4OZFA 2B2XL 3W0WD 2RCSH 3UZVA 4DW2H 4AWJC 2P5WD 4JB9H 1TETL 3FQXA 3TH4T 3TJPA 5E6UB 1TKWA 4TL5A 4F7KA 5FC9A 1MJ8L 1WEJH 4PYHA 1WTGT 2VM4A 1UZGA 4TQEH 3V6ZA 2G4EA 2R1YA 3GKWH 1S9VB 4HCRH 4KVNL 4Q14A 2WVTA 1BFOA 3PGFL 3HRZA 2V0AA 4Q6YA 3LS5H 2O6EA 1F18A 1J88A 3ME0B 4IHOB 5IHBA 4MD4A 4HGWA 1CTMA 4P23D 2FBRA 3QQ3B 4I18C 1VENA 1PD6A 3BZFA 4HHAB 4FOMA 2XN9A 4FNTA 3RWFB 1BQSA 2JQZA 1S8DB 1O7DE 3QJTB 5EUOE 3F7YB 4UT7H 3CN0A 2DF3A 2BSBA 3GGWB 1NCAL 3NCYS 3L3HA 4LCUB 4Y5VC 3N40P 5KJ4A 5L4IA 3T3MB 3WTXA 4XPHL 3KPOB 1INQB 4G8GD 3X13A 3U6RA 3RP1A 4JO1H 3VI4F 1Q9OA 1EFXD 1DSWA 1PJ9A 4PEEA 4DCQA 1I1YB 4LF3B 1R19A 3KR3H 2ZQKA 1KYOK 1DQJB 2HT2C 3AUVA 3BAIA 2BDNH 2G3ZA 3HRPA 3JYCA 5E9DD 2HJLB 3WY4A 3HE6B 2VDOL 3HUJA 3EOBA 4N4YB 4L3EB 1HEHC 4RVBA 2H47C 1ZDSA 4P2RD 4LRIC 2EDWA 1NC4D 1YUKB 3HAEB 3STZA 1MFAH 1W15A 3HS8A 2Q1EA 5L0QB 2WLNA 1A7BA 2WWMC 1YYCA 2N1KA 2DJ4A 1WBYA 1PIGA 2GSIB 3D3VE 4DUVA 5KSBE 3HC4L 3BQUD 1SQ2N 2VN7A 3VFRB 3GMNA 2F74A 3KBHE 1G87A 4YPJA 3KLLA 1O5PA 4MAYC 1MWAA 1CS6A 1IM3B 3QDJD 2JI1A 4L0ZA 5EB9A 5FGRA 3PAUA 2W9DL 4XB8A 1HCZA 3QQDA 1KYAA 4HBCH 1ODUA 3N0AA 2DIJA 1AXSB 5LBVA 1P53A 2UV3A 3FTZA 5EN2B 3O6FA 3LN9A 1B9KA 2GJPA 3IDMA 3OF6A 1F1GA 5DHYA 3S36L 2EEAA 2FQGA 4UV7L 1YECH 5JPMB 5JQ6H 4PRIA 4FADA 4F8LA 2FNBA 5GS1B 5E2TH 1JPST 3H4FA 4I2XB 2ZWNA 3GJEA 4QRPE 4ZUWB 4CMHB 2P24B 1NC2D 4L8SB 3O6ML 1JNNL 3G6AA 3VGGA 4ZTOL 3PHQA 4WFGD 2QMJA 3KPNA 4PJEA 5FYKL 3VD4A 2Z91B 3RQ3A 4P46A 5DC4B 4A6YL 1DANU 2IH3A 3PL6B 5CEXA 2E0PA 5L6YH 4G43B 1TVBA 4FKHA 4NBZB 4UF7C 4ETQA 4RAUA 4X7TB 1Z9MA 2FJHA 2C4XA 3E6FB 1Z7JA 1CMOA 3FB5A 5TD4A 1HQ4A 4K15A 4GG6A 4OZIB 5E95B 2FQDA 1JGVL 2DWEB 3T8XA 5F96L 4UQ2B 3KPMB 4YE4H 1TIUA 4B27A 3DO7B 1KGYE 2PW1B 3BUYA 3CVBA 3UAFA 1LEIB 2MQCA 1AVAA 4XBEL 1K8IB 4OUOA 1BYPA 3ECQA 4JVWA 1RCYA 5E4EC 5FKAA 2H1PH 5L2KA 4BK8A 4FYQA 1QFWI 4JJOA 4K73A 3DA0A 2VQ4A 6PAZA 5A40E 4AXWB 4RMBA 1C5BH 3PG2A 4HA1A 3ZTJG 1SQMA 2F19H 5HGHA 1J5OL 2WTRB 3GK8L 3QNXB 1ADWA 1J5CA 3LSOA 4G7VH 4CVZB 2DDQL 5MEOA 3KZ8A 1XTLA 1PD1A 5I9QB 2ED9A 3MV9E 4XN5A 2CO6A 4MX7A 1WFTA 3TYGL 2X4NA 3UJJH 5ACLA 3FRUA 4ADIA 5E5MA 1I7RA 2YZ8A 2FDBP 4GUPA 3D39E 2DD8H 4EN2A 3D0VB 5DC2A 4F24A 4OT1L 1KNOA 1ZEAH 1FJ1B 3NAAL 3K2KA 2HT4D 3QNZB 4M5TA 3U0WL 4EIZC 3NA4A 2ICEC 4KTGA 1A6ZB 1QPXA 1WHPA 5EEUA 3FT2A 4D8PB 2YSSB 1IARB 2XFXB 3WFCL 3HZVA 2FX7L 1KPRA 4HKXB 1TZAA 3QUZC 2NX5E 3DOIA 3MUJA 2FLBT 3L4ZA 5F7NC 3NVQA 5D72H 3US0A 1S9VA 2BINA 2BY2A 4TSBH 5LCVA 2R2BB 1MCBA 3FT3B 4G8EB 1KELH 4AJ0A 2J57A 5BVJB 3ME0A 3PXHA 1D5IL 4IHOA 4N8VA 4GQQA 2AK4D 5F9WB 3GTTA 2ERJC 3QQ3A 4K7PY 1Q9WB 1Z3GH 3BWUF 4HHAA 3F04A 3RWFA 2WCSA 4CDHA 1S8DA 4ZMXA 2Y1VA 4NZRL 1H8SA 3ZKSD 2IQAB 1UM6H 5JA9A 3D07A 2BVYA 3GLEA 3GGWA 4NLHA 1C5CL 3FULA 3IAGC 4LCUA 5DHXB 3GSOB 5F9OH 1EXHA 3MRRB 3MNZA 3BDXA 1J8SA 3DJRA 3KPOA 1INQA 1QFWH 4ODTH 5F89A 4F9LA 1U58A 3HIZA 2Y7OA 3OMNB 4LDLB 4LLVB 2YQ3A 4W9JC 5SV4A 5IB2B 3TM6A 2X9YA 4QOKD 4ZTPL 4YMPA 3ATEA 5BRPA 1I1YA 4N22A 5LKNA 2Y07H 1L9RA 3F7VB 1HH9B 3ARFC 4LLQA 1DQJA 1WWBX 5EG6C 2JJSA 2HJLA 1JHTA 1BDYA 2WYTA 1A7PH 4BSVA 3B7YA 2A1WL 2ZF8A 1AANA 2ZP8A 3L48A 4L3EA 4QMEA 5D6DC 1HINH 1XZWA 5E4OA 5GSVB 5HGDA 3H9SE 1EAQA 4EQ3A 1QI4A 3HAEA 4OV6F 4UTAL 1Z5LA 3IBOA 4Z95H 2QVFB 2PR9A 1UTDA 3VDCA 1PG7H 5KW9H 3NN8B 4F7EA 1XL6A 2ENYA 4I0PC 2GSIA 2JKTM 1RVFH 2ZX5A 1EXGA 3VFRA 2Q8AL 4NQDB 3SE4C 4XZUB 2L4OA 3CGTA 1I7TB 4PLKC 5C9JB 3Q5TA 3C09C 1IM3A 1F90L 1GSMA 4F1SA 1MSPA 4XPFL 4YHLH 1TTFA 4OSUH 3LTVA 3LQMA 3QPKA 5T3XH 3TEZA 1UXWB 1AXSA 3SDXE 1KGCD 5EN2A 3JXAA 1LO5B 3MACH 1WZKA 3ATBA 4JG5A 3RPIB 2P80A 1OP9A 4Y2DA 4TUOB 4HIJB 3UAAA 2IAMC 4JM2F 4CKQA 3HMWH 3L5JA 1JMZA 3BKYH 4NIYE 5FM4A 2ZJSL 5JPMA 1IQWH 2F58H 4QNPF 1AHMA 1NINA 4DOHE 1HQRB 3OKOB 5GS1A 3L17A 3PXLA 1URIA 4KJYB 5T1KD 4K71C 3WGVB 4Z0BH 5D70L 4QEGA 4ZUWA 2P24A 4QHKI 3EBGA 4FNLH 2IDTA 4LFHD 3WN6A 4U3SB 3QIBB 4ZUSB 4G72B 4ZO7A 5KJRL 1N68A 3SDCB 4KV5F 4YLBA 1UWGL 1QLFB 4M48L 4YS4A 2ZOKB 5AW5B 3PL6A 3W0WE 4G43A 1IX2A 1DSFH 3OR7A 3SIKA 3ZE2F 2P5WE 2Y36H 3HEIB 3A4EA 1R3KB 5D9SB 3TBVB 4DFHA 5D5ME 9CGTA 1CG9B 2HCZX 3E6FA 2EDHA 4I13B 4ABVA 4PBDA 2C9VA 2ATAA 3ESOA 4OZIA 4QPEA 1UH3A 2LLNA 4Z8FH 2DWEA 4GT7A 2A9NH 4UQ2A 3KPMA 1JHKH 3KWWB 5C86A 2PW1A 4MA7H 4Y7MA 3QO1B 1LEIA 2Y1ZA 1I8IB 2WBJC 2Y69B 2DYRB 1YEHL 4YWGL 5ALCH 2FLMA 3LMJH 2R29L 4RMVA 3T5WA 2VR6A 4APQC 3NP4A 4IU3B 1CU4H 3KL3A 4AXWA 5D2LF 4HUCA 5KVFE 4KUZL 1IAOB 5FOJA 2WTRA 1HHJB 1J1OL 2ZUYA 4G8GE 3QNXA 3FMGL 3HFML 4CVZA 3I3BA 1BAWA 1VHPA 1JOIA 3ULVL 4HJJH 1EJOH 3EGDB 3HBGA 3JTTB 3WEOA 4P9HL 3VB9A 4LSVH 3DC0A 4LEOB 5DMKB 3R06A 3MOBL 1S7TB 1J18A 3FUFA 4GP5B 4JVPA 5I30L 4HLZH 5E9DE 4EMZA 3N6YA 4GQPH 1DO5A 4F2ME 3KLHD 1PNDA 2ADGB 3OMIB 2H8PB 1H6FA 5DMGC 4OZGF 1BOGA 4P2RE 1SN5A 3T2QA 1AZUA 1FIGH 1FJ1A 4NZTH 3HOGA 3O0RL 4S1RH 3HW7A 2PWFA 3M6DA 1A6ZA 2PN5A 3WV0A 1ANUA 3IRCA 2A4CA 2CAKA 4D8PA 2YSSA 4MQXC 2XFXA 5D7IE 5LAXB 5CCGE 4XCYB 4HKXA 1AOZA 3ISYA 1CYWA 4K3HA 4PJIE 2EDJA 2QADB 1T89C 2GY7B 3QDJE 1N2RB 1KJ2B 3OHMB 1BQLL 1HSAA 1X5YA 2R2BA 3FT3A 4X7EC 1BD2D 2EIJB 4G8EA 1M6UA 3IAQA 4PLJD 5BVJA 5IZ7A 2YJQA 3SE8H 1NFDF 1DBJH 1Q9WA 3L1FA 4JQIL 4Z7VB 1DBKH 1LP9F 4H13C 2WXQA 3N3EA 3FTXA 2IQAA 1RUAL 4PP1C 1PG7X 3B2MA 2X2YA 4XMLH 4ZX5A 4CRPA 2NQ3A 3FRPB 1AE6H 5ID1A 2ZXBA 3ARRA 3E1ZA 3GSOA 1Q1JH 1SXSA 4EF3A 2DQHH 1SHMA 3MRRA 3VX0A 3RZCB 5IVXB 5D93C 3BGFB 1ICTA 1KPUB 3MCKB 2ZWYA 1BSIA 4FQQB 4UQCA 4NZUL 5E23A 3RWGB 2O61B 2JELL 4LLVA 1WV7T 3AREC 2ARJQ 1Q1PA 2WKLA 1RZ7H 5IB2A 1KCSH 1V3MA 3DI3B 4XBMA 5T5FL 3FT1A 3SE9L 3VFWA 4FXGC 2ZWLT 1HH9A 2XWTB 3F7VA 3K5SA 3DURB 1ZCRA 4NZFA 3QDGB 4TVSa 2AS5M 4FABL 4ALAH 4NGHH 4Z3TA 2EYSB 5FX3A 2VITA 3LVEA 4JO2H 1AZNA 3GQFA 3NN8A 5A2JH 2E47A 3HG5A 4HISA 4C59B 4LOUD 2OMTA 3C5SB 2XWBA 2B1AL 1N64H 3A5VA 4HK3N 1LM8V 1H6EA 2UXFA 4XT1C 4H20H 5L7XH 3EJUA 4XZUA 1I7TA 5C9JA 1F3JB 1CICA 2J8UB 2ZXEB 3IF1B 3ARXA 1TJXA 2V5RA 3NCJH 3V9CA 4WEUD 2ZUTA 3KEDA 5I75C 2NT0A 2EDQA 1UXWA 3LXCA 3PP4H 2DQIL 2J5LC 2FEDC 3N43F 4YHYB 2NR6C 1LO5A 1R5VB 4JM0A 1VCAA 1D9KB 5EUOF 3ZZSA 4BWTA 2DOCA 1KBGL 4HIJA 1KEGH 4HPOL 4QO1B 1UCBH 3FO1B 1X3DA 4HGMA 3CBKB 4H0LC 2W94A 4UT9H 3BDYL 1AXIB 3I3EA 1HQRA 5FHBH 3OKOA 2E7HA 3RHWK 4KXBA 2QSQA 5DGQA 4KJYA 5HHNA 5DJXB 3HMXL 3TEYA 4NEHB 1L0PA 1OP3H 3JWDH 4KQ4L 5J06A 2M1KA 4U3SA 2AI0H 3QIBA 4TNVK 2L7JA 4ZUSA 1DJZA 5T1JA 3MV11 4JGNA 3SDCA 1N6VA 2HFEB 2Y5EA 4L1SA 2B9AA 1KCRL 3UJTH 4GKZB 2NY0D 1IGYB 2X40A 2ZOKA 3D33A 2R4SH 5HYEA 1R3KA 3QCVL 5D9SA 3TBVA 3TT1L 4Z7AA 5KSBF 3GWJA 3X17A 1TYRA 1H3UA 1PSKL 2E6JA 2ZWZA 3FAWA 4HOXA 5LGHL 3C8KB 2XQYG 1X5AA 2ORBL 4UV4H 2XWJB 2WB7A 2APTA 4TSCH 4RMTA 4I3SH 4N8PA 1R3HA 3ML9A 1CT8B 3FONB 1CYGA 4M1DL 4N8CH 4TQHA 3QO1A 3N1QC 2J8OA 1I8IA 2AK4E 5C6WH 3TTYA 1CGXA 2IDCA 2M8XA 1KFAL 3IJEA 1AP2B 5G5DB 4IU3A 4R7XA 4U6VH 3F7RA 1PZDA 2B3IA 2X6UA 3D06A 5B4MD 1A6TB 5GGTL 4LGSB 1I8LA 1BVNT 4MQTB 1IAOA 2WUCH 4DQAA 1HHJA 2W9EH 2APWA 2JSFA 4N0RA 3RL2B 1SHXA 2JKRM 3F01A 4CU7A 3UTQB 3EGDA 3JTTA 3L4UA 4QOKE 5T1LD 4KZEL 2HKHH 3B7RL 1BAFL 2IPUG 3P2TA 4LEOA 4R8WH 5DMKA 3VFSB 1S7TA 1HT6A 4AGNA 2GIMA 1SY6A 3EDFA 2BHZA 3REWB 3BCDA 1M1XB 5EIQA 3QDHA 2ADGA 3CLFH 2ZAHA 3U7AA 2H8PA 1OGAD 3AT8A 1UACL 5CJXA 3QIUB 4LCWA 3UDWA 1FP5A 5FPIA 1HNFA 4YK4B 2AERT 3QC5X 4BJLA 5FYLL 4OTXL 3VH8B 3FH7A 5DT1H 4Y16A 4XCYA 3SKMB 1BJ1H 1GHFH 2EADA 3DOHA 3RURA 4HOWA 4BH7B 3LHPH 1NAKH 1QLEH 3BIAX 3CK0L 3CSTA 1N2RA 1KJ2A 1PZSA 5DRWB 1RERA 4XP4L 3GS0A 2WQWA 3LIZA 1B0RB 1KGCE 4JR9L 3KPSB 3IJYA 4Z7VA 4Y0GA 4ZUUB 5FGCB 1TJGL 1NFIA 1NGPH 3OPZL 3LY6A 3FRPA 1OW0A 3SBRA 2HT3C 4KTEL 2MFNA 1Z9PA 2ZCKH 4WTXA 5E6ZA 3LVTA 5IVXA 3RZCA 1KPUA 3MCKA 1FVDA 4FQQA 5GRUL 3RWGA 2NY2C 1QEWB 2O61A 2IDUA 1FDLH 5L8LB 4YSQA 3MA9H 1MWAL 3S5LB 3CVDA 3U6XA 2R51A 4S1SH 1RXLA 3D09A 2XWTA 4UNUA 3SKOB 1T3FB 2QR0B 4AQ1C 1IRAY 3R7RA 2G5UA 4AYBA 3DDFA 5KVDE 3TJEH 1P1ZB 3WHE0 4GRLB 5I0ZA 3O6KL 1FO0B 3WUWB 1I82A 2EYSA 3ARDD 5IG7B 4DSYA 4J7RA 4LPUA 1GGBH 4L1HA 3OD3A 1NBYA 2AEOA 4X9FA 3W39B 3UTTB 4JO5A 3P0GB 4KK8C 4MCNA 1A3LH 1MOEA 3SBWA 3NCFB 1FFPB 5AWNL 1KFGA 4AUJA 2BIIA 3OKNB 1XHHA 5FV1L 3RG1C 2VLRB 2QV4A 1X5KA 1I1AD 2Z4TA 4NBYB 1F3JA 2J8UA 2BFVL 2EC9T 2H9GA 4X4XB 3N2JA 4XO4A 2CKBH 5D1XB 2ZTBA 4P4KD 3B2DC 2AEIT 2UUDK 4I3GA 3EDKA 1KWGA 1MCOH 1R17A 3BCFA 3KGUA 1R5VA 2NNCA 1D9KA 1OTSD 4NC0B 2C9AA 4ONOA 2C8NA 3D87B 4PAZA 5C9KA 3C5ZB 2DQUH 3JWOL 3GZPA 4QO1A 3FO1A 1N26A 4M61A 2FGZA 4JL1A 1UWEL 1FNFA 2R2CA 3TEXA 1LO3H 4H0HB 3UXFA 3V52L 1RJZB 2XXFA 2LVCA 2BS9A 3ABMB 4KI5D 5DJXA 3BKCH 5GRVL 4IBLT 5JW3L 4UOZA 1CE6A 4UTBH 4RX4D 4ZZFA 2WLHA 3WD5L 4ZMPA 15C8H 4QI3A 4CN6A 3CZUB 4R26H 3MBXL 4RFOH 5JIIA 4FQPA 4WW1B 4G9FA 2QVKA 3KYMA 4MB4A 1Y07A 4GKZA 1WUNT 3TEUA 3FHQA 1IGYA 2IQ9H 5KS9E 3N06B 3N42B 4HJUA 1UJ3A 2VXUH 1NBVH 4QUOA 1JTPA 1WSST 2OK0H 3BMWA 1V5JA 1TJHL 2OTWB 2APXA 2EDFA 1MRCL 1F4YH 1A7RH 5INCB 1CXKA 2CDGB 5EF2A 3C8KA 1M7DA 5E08H 1B4JH 2XWJA 3QNFA 2VUOA 4PVNA 1IGIL 4UNTA 5GQBA 5EOCL 3SQRA 4EDWH 1BD2E 4LGRB 5C08D 2KLRA 5HI4C 1A8ZA 5JXAH 2WMPA 5DEFA 3SDXF 3C12A 2BWDA 3CVIL 3PWUA 2PO6C 2XV2A 5E8OB 2X0UA 3O8XD 1AP2A 3I9AA 3AXHA 1JZ2A 3NDZE 5G5DA 2CIKB 5ICUA 2EH8H 1O9ZA 4WI7A 3LRSB 4GAJL 2JJTC 1T1ZB 2X09A 4K5MA 5C0IA 3EZ8A 3MLVH 5F1NB 1A6TA 5I1CH 1ITBB 5E8PA 4HJ0C 1NOFA 4JG9A 1RIHH 2X9WA 1WAPA 5JUEL 5I5MA 3RL2A 4ODXB 4QT5B 1I85C 3UTQA 5D7LB 2NYYC 1W9XA 5D1QC 1CD1B 1CD9B 1EMTL 3FCGA 4OVUA 3WTUA 3IU3B 4U1GB 3VFSA 1FIEA 3M17B 3REWA 3X3GL 5MEND 3IXAA 1OANA 3ZL4H 1L9MA 3EJZC 1M1XA 2R69H 1HEZB 3FNKA 1BXVA 4RMRA 2QDVA 3AQDA 1OCWH 2WXPA 5AW0B 1MFMA 2R0WL 1WHOA 2DM4A 3V7AE 3EJTA 2AABL 2VXQH 3F84A 4PWEA 4LSSH 5D5MF 1QACA 1UURA 1TQCC 5DHVB 4QXWA 2XT1B 3VH8A 3BVNB 4KFMA 1NDGB 1S6NA 3VD9A 5FGBA 3SKMA 4N3UA 5IMOB 4XPAL 1RIUH 4BH7A 2CGYA 4L2YA 5H35B 5C0AD 1RV6X 3HNTL 3STBA 4YSEA 3PDDA 3NFPA 4C4KT 1C16B 5DRWA 2Y7SA 4HIQA 4BXVA 4UM9B 1KIPB 3ATDA 1B0RA 4IRSD 4EZMA 1OO2A 4WJ5B 2NCEA 4WV1B 3KPSA 2DYPB 3Q06A 1LEKB 2GIYA 2K8MA 1RH8A 4N2CA 3HA0A 1T03H 2FB4L 4H1LB 3QUML 4FQLL 5TE4L 5I1DB 4ZUUA 2A7BA 4OJCA 4KVNH 1SFDA 1OAJA 5JHLA 5E2VL 1JFQL 4I0CC 2Q76B 3LQZB 3A67H 5L4MA 1HH6B 2HVJB 4XNBA 3MLSL 4M62H 1U3ZA 1QEWA 3M1CA 3KVDD 2WGNB 4AJWA 1DUYA 4GIAA 4A2EA 3FHEA 3VXRD 3GIZL 4WSJA 1C1EH 5K9JL 1YAZA 3FPYA 1P84K 1X5JA 1MCKA 1RQ5A 3I85A 3SKOA 1T3FA 2QR0A 2ZKXA 4XPHH 5IQLA 1XV8A 3NCWA 1P1ZA 4JGMA 4GRLA 1X5XA 1MKFA 2DQEL 1YNTB 5I26A 3WUWA 4JZOA 4U3XA 3QJXA 4O58L 2J6EA 1I3VA 2CRYA 3U4BL 1CYXA 2RQEA 3QDMD 4U1IB 3QFJD 2CR6A 5D7IF 1QRKA 3O3AB 4JDTL 4RMWA 4ERSH 2WIIB 2WW8A 3UTTA 3IKCB 4O2FB 2E7CA 2D3VA 5IQ7H 1FFPA 4Z7NE 2O30A 1TQSA 4PHXA 2CWRA 3OKNA 1KB5L 2VLRA 3QA3B 1CFMA 4Q74A 5HVWA 4K0OA 1CB4A 4OF5A 2KHAA 4BZ1H 3NPSC 1U21A 5DJ8B 1YNLL 4X4XA 2CJUH 1UWFA 3HE7B 1RY7B 3HC4H 3L7EB 3F64A 2EVFA 2ESVB 1FAIL 4W9DC 3D85D 4P2QD 1JDDA 4FQ1L 7FABH 1BQHG 2E7DA 2IMNA 3JV5A 4U1HB 3C5ZA 1L3NA 5K9QG 1MG3C 2AHIA 4R2GB 4YSOA 4J28A 3ABZA 5HVHB 4ZYKB 1RJZA 1WWAX 3WS6A 4P5TD 4J8RB 5ABZA 2XNAA 2G5BB 1WZLA 3V6OC 2H32B 4JHVA 1A6WL 4OCWH 4Z23A 3L9EA 5DHMC 1RZJC 2KPNA 1YYLL 1PNCA 4JO4L 3HB3D 3DARA 4YIQB 3AB0B 2LAGB 4U4IA 2GBUA 1I9RL 1OGAE 2LT9A 5GHWH 3UBFA 1JHLH 4WW1A 3T0BA 3ZE0E 1ULVA 2DLEA 3RAJH 1HHIB 4A7UA 1YN7B 3ZTNH 1NEZG 1JNNH 2VGLM 4X8GA 3MUY1 4ZTOH 5CWSB 4OZHE 3ISWA 3QRBA 5F7FA 5FYKH 4UYPA 5INCA 4ZI8A 1GZHC 2CDGA 1WTLA 1ZVYA 3OLDA 4HUMB 2ROXA 4YSCA 5BVPH 1FRGH 5C0RL 1IFRA 1U93B 1UM4L 1IZJA 4WUUB 4JFPA 1M6OB 3ZK0A 4X4YB 3E2HB 2QLYA 1QTYT 4F15B 4BFGA 2CBTA 2CIKA 4IGBB 1NCUA 1ZHNB 3LRSA 1T1ZA 2TAAA 3KL0A 5F1NA 1XF1A 2PP9A 2DQGL 3U7YH 2YMXL 2AJYL 1F45A 2HYMA 2GK0B 1KACB 3DVIA 4Y8DC 4ODXA 3WFEL 3M46A 4QT5A 3CSFA 3MCLH 4O51B 5J1TC 5D7LA 5LJYH 4J6IA 1CD1A 1ZHLB 2I9LB 1TZGL 4MJIB 3IU3A 4TVPL 2P48B 3FSVA 2GTZB 4DP5X 1AMXA 4P0DA 3M17A 1GGUA 3ZKMC 5GRVK 4GMSH 3UBXB 4HYTB 1HEZA 1JXKA 3NABH 4PG2A 1CF1A 3WFHB 1NGYB 4HT1H 3HG2A 1Q0YH 2OP4L 5TF0A 4H26B 5DHVA 5A6MA 4ZMOA 2FWUA 1E9QB 3BVNA 3DRTB 5ABDE 3KS0H 4BWUA 1NDGA 1RU9L 1P6AB 2GT9B 2QQKL 3AT0A 3VGFA 2XPGB 2OULB 2PTTB 5F2FA 5IMOA 2OSXA 3F00A 3OAUL 3N55A 4K23L 4Q6IB 5H35A 4OD3L 4FQCL 2IG2L 1C16A 4X98B 1GJUA 5HP5A 4UM9A 1KB3A 1KIPA 3GSNB 1B3JA 1A3RL 3NSFA 4WJ5A 4XVJL 5K9KB 4WV1A 4M7KH 3NSYA 2DYPA 3HZMB 1LEKA 2BNQA 1E6JL 4R4FL 5C92A 4H1LA 4PJCE 4AL8H 1IEBB 5I1DA 4ZXBA 3IMBA 3V79C 2K4AA 2A6KB 4KJWD 3V4PA 1DLFL 3TBTB 3UFIA 3H85A 3I6LD 3LQZA 3QIWD 4A2GA 4NJAH 5E2UH 1QTPA 1HH6A 1NMAL 3RPKA 2HVJA 5MERA 3MI6A 2H26B 2BM3A 3A22A 3JVGC 5I71C 4MKTA 3BP4B 4KI5E 2HT4C 2OKMA 4OFQA 1XEUA 5I0YA 1T22B 3IMWA 5I1HL 3EYVB 2HKFH 5IY5B 1K5WA 5GZOA 1X9QA 1Q9KB 4KHTH 1A6UH 1MFCL 2ATPB 1YNTA 1CVSC 4I18B 1MI5D 4LDCA 1WA0X 4EXPX 3ASNB 1YEKL 3PWPD 5DURD 3VXMB 2OXGB 5I0DA 1ML0A 3ESNA 4U1IA 4HOZA 1CF8H 2X4RA 1LMIA 3O3AA 4Y5VB 1BM7A 2FO8A 4YSAA 5F0LB 1EV2E 2SEBA 3IKCA 3KVQA 4GXUM 4DN3L 3QZOA 3HNSH 1FNGA 2VR9A 2WSPA 4WI6A 1MCJA 3B5HA 3RB7A 1C5DB 1QKZH 2BRRL 2AQQA 3QA3A 1N5AB 4FNPA 2K7PA 5C08E 2BP0B 4ELMB 1E0OB 3UBHA 5DJ8A 1Q72L 3M88A 2JKNA 5B1JA 5I8CB 4QHPA 5I6KA 4NM8H 4BFEA 1FBIH 2XQYK 3HE7A 4JVUA 4MTMA 3L7EA 4V1DB 4JRYB 2KZ1B 4XAWL 2NNFA 4QRUB 2ESVA 2Q8AH 5BOZG 4QRQB 1KTCA 2XQBL 2CQVA 4EDXA 3IKKA 2NSQA 4XHQA 1T66D 4U1HA 4NO0A 5D7SH 4IBVA 3RB5A 4AGLA 1G7JB 1NM4A 4GKSB 3MJ7B 2WJ5A 3PQYB 2JJWA 4ZYKA 2YAMA 1DQTA 4PJHB 4IEFA 4J8RA 2G5BA 4O02L 4AGMA 1QWNA 2FWLB 1SN2A 4X8JB 2H32A 5TQ0L 4AC2A 4DFIA 4CAGA 1OAUH 1SOSA 4MAYB 5MENE 3F85A 1AKJB 4NWTL 1BF2A 3QG7H 4YIQA 1ZLEA 2KDYA 4GQ9L 2P26A 1MIEL 3CFUA 4HS3B 5B3JE 1P4IH 3K6DA 4LDEB 5HHVL 2CCLA 1RP9A 1FLTX 2E59A 1HHIA 5F7BA 3O6LH 3T2LA 1JZDC 1JF1B 3TFBA 4L4TB 5CWSA 1CDBA 1RURH 5FKPB 1J9QA 4X0NA 1K3ZA 1BVZA 4ZUVB 2FX9H 3AQXA 3ARBC 4QHNB 3OAZK 3H3PL 2Z1KA 2WNKA 35C8H 4Y4KD 3W56A 5A7EA 1L7TL 1OPOA 4NPYB 2A6DB 1UOKA 4S1DC 5C0AE 5ABAA 4YDMA 5E94A 5H8DA 1IBHA 1V3JA 1SY6L 4L3AA 2TSAA 1RAMA 1U93A 4XP9H 2J1YA 1HKLH 3SZKC 2DMKA 2BZ7A 2DAVA 4W9GC 2Y24A 4WUUA 2D03L 4GAFB 1M6OA 5G2NA 1E2VA 2LAAA 2LVEA 1GY1A 4K3GA 3SODB 4DERA 5C70A 1JYXA 4IGBA 1ZHNA 1ET5A 3G7TA 2ENPA 4YR6B 5HJ3B 5AKVA 3H3KA 1MFEL 3PY9A 3UC0L 2X42A 4IQHA 5F3FA 5GJTL 4AYMC 1KJVB 4OGYL 1JTTA 1WWCA 4KXZI 4F7MB 1INEL 3OPUA 2A74A 3PWLB 4H7VA 3DXAB 4QAWA 4FXKB 4O51A 3H7LA 3KXFD 1E5ZA 3ARZA 3VXSB 3VXRE 4ENEC 1ZHLA 2YR3A 1MEXH 4MJIA 3ATAA 3CBRA 5CZKA 5G55A 2GTZA 3VXNB 4G8FB 3T6QC 3CDCA 5ETUB 3HFMH 3UBXA 2XPZA 3LIZL 3HBZA 3BEVB 5I28A 5E4EB 2D4FA 2WKGA 5KS9F 5DO2C 3WFHA 4NQED 1W0WB 4GBXC 1NGYA 4BFFA 2Z65C 3K1KC 1BX2B 1QBML 2OJEB 3H6JA 3DX8A 1XR8B 2O5XH 4Z3IA 4G6FD 5GRJL 1BEYL 3QDME 5FUCE 5B1AB 3QFJE 4UT6L 4WI9A 2P8LB 3DRTA 1E9QA 4OFPA 6FABL 4H8QA 4FXTA 3P9LB 2XPGA 2PTTA 2WVUA 5FCUH 2EQDA 5FFGA 1A14H 4E9SA 1EPFA 2VDRH 3GZKA 1IGFH 1OAQL 1ETZA 3H1ZA 2IALB 2VL4A 3GMPB 2C1OB 4Q6IA 5KVEL 1K8DB 3EBIA 1HHGB 3IFNH 4LCVA 4KZDL 1H9VA 2DWSA 1QHPA 4ZO8A 5C0ND 4MMZC 3U2SB 4G1MB 4KFZC 4X98A 4FJZA 1P7KB 2B4CH 1EERB 3SE3C 4O9HH 5I1EL 3GSNA 4PJFA 2HJKA 4J3WA 5K9KA 2IFGA 4JG1H 4HXBL 3HZMA 2HVKA 2KYIA 4P2QE 3VACA 1UA6H 3HG3A 3ESUF 1IEBA 4F7TB 4R5XA 1XIWC 2A6KA 4EZJA 3UAJA 1IKNA 3TBTA 3BSZL 3VD3A 2ICEB 1GY2A 3KLHC 3WJMB 4MQSB 2FSDA 3WIHL 4LAJH 2ICWJ 1DBML 3BP4A 1N6UA 3ZQXA 3QUZB 1RUAH 3WLWD 2E56A 3G5YB 5B39B 4ZG1A 3V9EA 4KXZH 1FVCB 2NYKA 3CVHB 3F7PC 3OKMB 1HOEA 3HHSB 3KW7A 1GYAA 5GGRB 3BH4A 3QZBA 4JDVB 3RNQA 2AQRA 3ZVVA 3N50A 1Q9KA 4IRJB 3MRBB 1G6RB 2ATPA 4I18A 2ERJB 3DX9A 1T6BX 4ADJA 1NCBH 1B0GB 2PYFB 2WXGA 2DQTH 3VXMA 4ZW3A 4HWBH 3I2CL 1CGTA 2OXGA 4Y4HD 4XCNB 5M7QA 2QV2A 1OWWA 4Y5VA 5AVSB 2PKDA 2I24N 1FNHA 1U91B 1V7ML 3OZ9L 5T8IA 2OYPA 2BOLA 1DVSA 4XNXH 3I9GH 5HDRA 1C5DA 1ILSA 3B7UX 3ESMA 4HUKB 2BP0A 2YRZA 5HDBE 3VB8A 4ELMA 4JHBA 5A2IH 5I8CA 3ARGD 4J6RH 1MF2H 1QR4A 4V1DA 1G1CA 3FO0L 5EORH 3H9HB 3CXDL 4JRYA 3WMPA 3PJSB 4GI9A 1WCQA 1XZ0B 4N28A 4QRUA 2ZXGA 1R75A 1CGUA 4XNUL 1KCBA 1ZMYA 1OAXH 2XV6B 4H8PA 4QRQA 3Q9PA 4WGWB 5AAMC 3LNDA 3LNGA 2BIPA 5LNGA 1TQBC 1TT6A 4LRIA 3GBDA 3HG1B 1J0IA 3HLAB 1PW3A 1G7JA 5JIKA 2FGWL 3KYAA 3WDJA 2UYLB 3ZN6A 5E6ID 4GKSA 3MJ7A 4PLOB 5I1JL 4JDZB 2DLFH 3FU3A 3PQYA 4C4UA 5EU5B 5IB1B 1IVTA 5KBLA 2E86A 4I0PB 4PJHA 2HH0L 3K5RA 3KMDA 4YUEL 1B0IA 4HC1H 2FHFA 1TNMA 4KRMB 4HG4K 4KXDA 4X8JA 5AUMB 3VNZA 1FZKB 2ICCA 3O3UN 4IDLA 5FYJL 2APVA 1VPOH 5FO7B 5J56B 4TNWF 1AKJA 3QZNA 1ZTXH 4GSDL 4LOUC 2PTUA 4HS3A 2YGPA 3NRQA 4J2QA 4M43H 4AEEA 4K4KA 4MNGE 4X8CA 5BQ7A 4LP5A 3IN2A 2WLZA 1D7BA 3MSPA 4UIKH 3VE0B 2NSMA 1N6QH 1JF1A 1JPGB 1BLNB 2ARJA 3C08L 3DYPA 1II4E 2AJSL 4QHNA 1U6AH 1KIRB 4M3JA 4Z7NF 2IGFL 3MXWL 2MNWA 2XWEA 1U30A 3VRLE 3HZYB 5DD6B 3NGBC 2Z31D 4OJFL 5C0FA 1GGCL 4MNQA 2I9TB 3SJVB 4NPYA 1G43A 2A6DA 3WKMH 4AZUA 2VSMB 3DGGA 4HFWB 4K71B 1G9ML 5IESL 3FF7A 3CC5B 1P7QB 2VSKB 4F9PA 1KSRA 1E9OB 4WEBL 5IROD 1YRKA 4QJ5B 4AQZA 1LDPL 1ONQB 3QUYD 4JRXB 3L6FB 2GSGB 1X4YA 3LH2L 4AM0Q 3PNRB 4WWKC 4YR6A 1NCCH 4N0CD 5HJ3A 1YO4A 3I6LE 4YGVB 4TLSA 3WY3A 1PD0A 1KJVA 1CDUA 4OLVH 3APFA 1ETA1 1R3JB 1C12B 3MRNB 4QTFA 4F7MA 1V05A 2OPCA 3MOAH 3MRIB 3DXAA 3TBSB 2NY0C 3CHPA 1TQUA 3GRWL 4FXKA 3RVWC 4OW6A 1H3PL 1MFVA 4OZFH 5ENWB 2OAAA 1M9WA 1SPDA 3VXNA 3CX5J 4G8FA 2BJMH 5DD1L 5ETUA 4XPBH 3NH7L 1DYZA 4H8WH 1MPAH 4M1CD 3DV6A 3ZE0F 3BEVA 3LXBA 4HWNA 4M5ZH 2WBJB 4GXVL 1MI5E 4BEIA 1CXIA 1W0WA 2M83A 3PWPE 1J8RA 1UWXK 1BX2A 2OJEA 2WWKO 1GAFH 4APQB 4OZHF 2V37A 1AGBB 3K8KA 4M9PA 1KENH 2KKQA 1J0JA 2NXYD 2P8LA 3VFGH 3DI2B 2X44D 4IBZA 1W8OA 1YEFL 5D7JD 4DGWC 1UB5B 3P9LA 1CGSL 3FU5A 5BRZB 1MAKA 1IGML 2YPLD 3I3DA 5B4MC 2IALA 3L3GB 4FA8A 3GMPA 1KCUH 1K8DA 4UDUB 1HHGA 3R8QA 3SYOA 5AYQA 4YDKH 2EXWD 4RISL 4K94L 4CDGC 3U2SA 4G1MA 1E2WA 3MLRH 1P7KA 4UANA 2Q8BL 3D2UD 3U9UA 4EN3D 1MJJB 5I8OH 4ANUA 1QLRB 1V27A 1CJYA 2W0PA 4L5FH 5IBLC 1IBYA 2ZKMX 4GG8B 3RGVD 3P30L 2A5UA 3C2AH 1FHNA 1V10A 1PZ2A 5D4JA 1L7IL 2I7SA 2FUQA 2FRGP 3PP3K 3MN8A 2ICEA 3GMLA 3WJMA 5J5EA 3VXPA 5JZ7C 1F1AA 2HPTA 1A7NL 5CEZH 3ULUH 1BM3H 2G0KA 4HBQA 1NGZA 2I5YH 1MNUH 4JN1L 3PGCB 1IIKA 3QUZA 4K7PL 3G5YA 1SEBB 2WZ0A 2BSDA 5B39A 3UAEA 1FL5B 3O2VL 1FVCA 3CVHA 3OKMA 1OCRB 4U7SA 1FFOB 3T4AC 5CJOH 3DIDA 2XG5B 2XV3A 4JDVA 4I48B 3QSKB 4U7MA 4WO4C 5BO0D 3WN5B 1NANI 4IRJA 1Q0XH 1G6RA 2MCPH 2OMYB 4JPVH 5CLWA 3QQ4B 2GBAA 2PYFA 2XXCB 1YLBB 4FJ6A 2LTQC 2F5BL 4MCZB 4E9RA 3QYNA 4HJEA 5TE6L 1FL6B 3QJQB 1KC5L 1MDAA 3JTSB 3UYRL 2XYCA 4G1EB 2DEWX 4EI5D 1XR9B 2X53A 1AOHA 4XP5L 3Q5YA 1U91A 3VM5A 1EO8L 1SVBA 3UO1L 1S7RB 2E76C 3IDXL 1O0VA 3AREB 5FO9B 1J1XL 2XQ0A 5JXEC 4ZAKD 4M1GL 1MXDA 1UKQA 5IW1A 1G0YR 5D4IA 2Q7NA 1IT9L 4FXGB 5B1BB 3H9HA 5SV3A 4DGVL 4DP7X 2FSEB 1OEZW 1ZE3C 3PJSA 1XZ0A 4PJCF 4XWGH 4N0FB 4OFDA 4MNHB 5D6DA 1U92B 5C0CB 1T2QL 1AQHA 4Z5RB 3Q0HA 3HG1A 3ERXA 3HLAA 5KUMA 4FLHA 1NM9A 3CZKA 3IM1A 4YX2L 1HS6A 5IT2H 2UYLA 4WCYH 3R1GL 1QYGL 5IB1A 3OL2A 1BIIB 4KI5F 2YAFA 2AJZA 3KXFE 3Q2NA 4I0PA 1J1PH 1YDPA 3ARDC 4OVVA 5ICXB 3SGKA 5IOKA 3QXTA 5KVFL 1L0YA 5T5NF 2WM0A 3T3PE 3H42L 5AUMA 2OTUB 1FZKA 1NJ9B 4LFHG 1LP9B 3SE4A 3TA3D 1UWEH 2VZOA 3MTRA 4AG4H 3K1DA 3MBEB 4HSQA 1IL1B 5CSBA 3F58L 1DVYA 5I75B 4NQEE 2VDPH 4XC1H 5IHZA 2J5LB 3GHEH 1MCWW 2H0EA 1A7QH 3UTSB 1KCLA 1UT1A 5LGYA 1NCTA 1BLNA 1JPGA 1NANH 3OX8B 1E8ZA 4L37B 4ODWB 1U2CA 2JXMB 5AYUH 2ADJA 5C3LD 4H25B 1USQA 5E9AA 1I8MB 1UYWL 3WIFB 3HZYA 5B38B 1GIGH 5DD6A 2I9TA 4OF7A 2LU4A 3IJ9A 1HE8A 1URLA 4N0UA 4TTDC 2FH6A 3QK0A 5FOBB 1CLOL 3EFOB 3P0VL 4HFWA 1SBSL 4CGTA 3WNLA 1P7QA 1Y1DA 2J55A 1BP3B 1R47A 2H3NA 1A8JH 3GM0A 2VXSL 2GJZB 1ONQA 4KH2A 4JRXA 1M1SA 2KQNA 3TBYB 4YDVB 4FKKA 1UCTA 1MJ7H 4YHZL 1PZ5B 4YGVA 4ZX6A 2XKNB 1PPIA 3K4ZA 2VOTA 3IWVA 3CVIH 2M2DA 1C12A 3DMMD 1MG2C 1RSFA 1XBDA 3ESVF 4OCYL 1FHGA 1YHPA 3AGVA 3TBSA 1U3HA 2YXWA 1JN6B 1HNYA 3Q2CA 2ZAIA 4XXDB 3V5HB 1OM3L 3T2NL 1H3XA 1DFBH 1HCFX 3OGOE 5GGUA 2Q0ZX 2XBTA 2PPEA 1IEAB 4YHKL 4R4NC 4U3HA 3H8NA 1CR9H 5B3JF 3B34A 2Y9RT 3MLYL 4HXAH 4DZ8B 2IGTA 5EWIL 4MFHA 2C7UB 2QT6A 4N6RB 5HHOD 2WBJA 4JFDB 3ZZ1A 3GUTA 2YUWA 4AYDC 2ZCLL 4NHUB 2F5AL 5IB5B 2EEFA 2VLKD 5LCVH 4O2EB 3IFPB 4PY7B 1BZDA 1AGBA 3V4PL 2VAJA 4APQA 2V9RA 1LILA 3I6GB 3SBPA 4PLNC 3DV4B 4X6CB 2EECA 2W1NA 3NEXA 1KG0B 3IU4L 1U95B 3EUDA 2CJSA 4ZODA 1UB5A 3O8XC 4EUPG 1TTCA 5BRZA 3NZHL 1LL1A 4G5ZH 5DZPA 5EC1B 1DO6A 2CALA 3UC2A 1MQKH 3LKPB 1D7CA 2J88L 2D7TL 3D18A 1NEZB 1KYOJ 3HG4A 5MEPB 4NUPA 3S4SA 3SDDD 2IDFA 1JPFB 4V33A 1NUGA 1TEYA 4XPAH 2ADFL 2A73B 2FBOJ 3OKYA 4XOBA 1MJJA 5KSBB 4UUJB 3L1OH 1NPNA 1N4XH 2NY7L 2E9IA 2MOVA 2C9XA 4GG8A 3MLXH 5HGBA 3MX0A 2ZWSA 2AQNA 3V0AC 4AYID 1GZPA 4WQOA 3V6FB 4NPKA 3ZSSA 3GLAA 3ZTEA 4B3VA 4YH6A 3VI3E 3IDGB 3FT4B 1OLZA 2FB4H 3A47A 3RLSA 5FYKD 1FN4B 3HAEH 2I26N 5AB0A 2AJ3B 1IBZA 4NLAA 5DUBB 4BFJA 2EIMB 4QKXB 1FL5A 3EW3B 3VXUB 1FFOA 3W2DH 2UWEB 4KBPA 5EC2A 2XG5A 3CDYA 3WKYA 4ZFZB 2CK0H 2OL3B 3VCLB 1LHZA 1P0SE 3WN5A 4XC3L 5ESVA 2AEPL 1XH3B 3X1GA 2P8MB 1DR9A 2OMYA 4N2FA 3V7AG 5DQDL 4E41A 5C1MB 3QQ4A 3RTQD 5ADOL 4MCZA 3FSZA 5AZUA 4DKEH 2D7MA 3WHE1 1IC4L 2ITFA 1FL6A 1R46A 4RMUA 3JTSA 1H3VA 4G1EA 4HCFA 4K3EL 1NLDL 4F5CA 2BCKB 5F7KC 2WZPA 2NY6D 4NJ9H 1PFCA 3V4UL 2EUWA 1S7RA 2NY2B 5F1OB 3UZQA 4ANKA 2XFGB 5EO1A 2ZAGA 5FO9A 4M6NL 5C07D 1EX0A 3CH1B 5DI8B 2EYRB 4JDTH 4JPQA 2GVYA 4OCMC 4FXGA 2BVUA 1J0HA 1F4WH 1GC1L 4AQ1B 4QY8A 2FSEA 5F7LB 4LL1A 4N0FA 4P49A 2MSPA 5F1SA 4MNHA 2UZIL 1U92A 3QYCA 4OJDH 5DJDB 5A2KH 1Z9SA 5C0CA 4AYSA 4Z5RA 2VCOA 1N59B 1VGKB 1MW1A 4WI5A 4QTIL 1OAKH 5J12C 1FAIH 1ZHBB 2ATKB 4XZ4A 5ICXA 1NKGA 4FQ1H 1SYSB 2DQCL 3KPTA 1DVUA 4OLUH 2X2HA 4URTB 1N5YH 2N7SA 4LLYB 3SN6N 1NJ9A 3H6AA 2XY2A 1PLBA 4GKLA 1L9QA 3UYPB 3MBEA 1XO8A 1IL1A 1NSNH 2Y6SD 2ZPKL 4KKCC 4LCCC 2WXJA 5TDPB 4WJKB 2NR6A 3FUHA 5L4FA 5SWQB 5EEVA 3L1GA 5FFOA 1NEPA 5GS0H 2EINB 1TJIL 1Z9NA 4JX0A 2KERA 3X14A 3OX8A 4L37A 4ODWA 1GMIA 2JXMA 3EGSB 2IH8A 3RGHA 1PFOA 2O6PA 3QUHA 3WIFA 4Y19D 5B38A 3D39B 5HHXH 2YPLE 5LN8A 3EYQD 1DJHA 1RUQL 5HDBF 1NAMB 4W9ZA 4PGDB 1K6QL 3HNVH 3EFOA 2R59A 2FATL 2F1AA 3NBNA 3EGXA 1UATA 2BP5M 3QEQD 3QVAA 4AW7A 3DRQB 2GCYB 5DD5L 5A6IA 4HDIB 5DSCB 5I15L 4FTVD 1FYHB 1MRFH 2R1WA 2MCMA 4CJ1A 5LHDA 4NNPH 4DEWA 2GJZA 4P5TC 3HKZA 1PAZA 4DTGH 5EHFA 4NQTA 2Y7MA 1RD6A 1QBLH 3TBYA 4LEXL 3OKDA 1RK0B 4JKPH 4M8VA 4YDVA 3SY0B 3U25A 2OYKA 4L05A 1HOCA 1CTOA 4HWEH 1PZ5A 2HXAA 2XKNA 4JCWA 4JMXA 1ZWIB 3QUXD 2WJ7A 4NQCD 3SCMD 1OARL 1OZUA 3HR6A 4GP4B 2CG9X 3BT0A 2GPZA 1JN6A 1WQVT 2CJ3A 4XXDA 1AMYA 4JUTA 2VL5B 3N44F 2D9CA 4KJQD 3LRGA 1YA5A 1CE1L 1IEAA 5E5LA 3GSWB 4DZ8A 1SDDB 3SOBL 3GSNL 1R24B 2C7UA 4LARH 4N6RA 4JFDA 5C2UB 3GIVB 2OJZL 1B3IA 2E5EA 2PO6B 4NHUA 4WUKH 5TF1H 4G9DB 2E7MA 4O2EA 5KVDL 4PY7A 3FDWA 5I1IL 3I6GA 3DV4A 4X6CA 3V9FA 2D0FA 3QXDB 2VXVH 4RGOL 1U95A 5DLML 3VRLF 3QRFM 4L48A 1LEGA 5F7HA 4Y7OC 3NIFE 5IKCB 9PCYA 3T65B 5BRQA 5EC1A 1RZKL 2Z8WC 3TZVD 5D1QB 3LKPA 3O81A 1NEZA 1H3GA 1UM5H 3QZWB 4HVBA 3NOIA 4Y2OB 2BNUB 1JCVA 2VDNB 2N7BA 5IHUL 3B37A 5MEPA 4F33A 1WD8A 4KVCH 3DETD 4DO4A 3VRIB 3L3JB 4PS4H 5KSBA 3X3FH 4R4BB 4QRAA 2GJ6B 5JOPE 1VGEH 3AT9A 5IIEB 1SYVB 4MSWA 2XC8A 3V6FA 1TQCB 3DVNB 4D94A 1FGVL 4FQ2L 3IDGA 4B95C 5CCKH 3FZUD 4PJBB 1FN4A 3NZSA 4XNAA 3BRGC 3KPPB 1S9XB 2AJ3A 4OB5L 4XMXA 1ADQL 4YLQT 4XPTL 5DUBA 5FB8B 4FQXD 4Z9KB 4DAGL 3VXUA 2UWEA 3SOTA 1HVXA 2OYLA 3V0HA 4ZFZA 5IMKB 2DIBA 2OL3A 1KTDB 1OAZL 3VCLA 5KN5B 1SJMA 1NDMB 1XH3A 1XVSA 2P8MA 5CD3B 2Y06L 1U8IB 4X5WB 2DWTA 4L4VD 2OMWB 5BNXD 4B3EA 3BRFA 4F27A 5IBTH 4KZCA 1AZZC 2NDFA 3AWEA 3O3DA 4S11A 4LLAA 3Q8BA 2CBOA 2B15A 5C6PB 4P5KB 4XOCA 3QEGL 4LSRL 2CR0A 1MCLA 2EEDA 5AW9B 4OJAA 5IMMB 2R15A 4KRNA 2FEJA 3CH1A 5DI8A 2EYRA 4HIHB 3W0WB 3QIWC 4GSQA 1INDL 5IEKA 3F7LA 4AQ1A 5C7ZA 3TESA 2K7QA 2N0KA 3UO8B 1FV1B 3MV8D 3ZKXC 3KYKL 2H5UA 5KYYB 5DJDA 2VN4A 1OOWA 5AL0A 2HFGL 1YQVL 3ZDZB 4LO9A 1BREA 1N59A 1VGKA 2VDMB 5JR1L 2JV6A 5CNHA 4LLDB 2ATKA 4PRDB 3V0DA 1ZVSB 5LWYH 1SYSA 4PVLA 3T0DA 4JFWA 5T5NG 4ZW7A 4LLYA 2VDQL 5C2BH 4QXGL 3VJ6B 5IGXH 5C6TH 4M02A 4XXCC 3UYPA 3NPSB 2WUBL 3KCPB 5HHOE 1KT2A 1UUNA 2O6FA 4Q0XL 2X5PA 5TDPA 2VLKE 5TQ0H 3ZRFC 3P2BA 4G7SB 4N3TA 4AYFB 4UDTA 4UQAA 1F6FB 1YJDC 2OMXB 5SWQA 5C7XH 1F4HA 4IOSD 1ODAA 3EGSA 2NOYA 2FEEI 5E9DB 2AQTA 3VG0L 4F2MB 1J8HD 1KBKA 5I18L 3TNMB 1NLBH 3U9PL 3MUGA 4ODVH 2HX7A 1T66C 3M45A 1NAMA 3GSRB 4PGDA 3ULAB 3OKKB 4UQDA 1O7SA 4AMWA 1JV5B 2GCYA 4KKPA 3EBHA 4HDIA 2CM6A 1CXHA 4NFCA 5DSCA 4ZW6A 3VFTB 3WMSA 1E65A 1U36A 1EA9C 4UAOB 1A0QL 2FZ3B 3HC2A 3WEBA 3WNOA 4HIIB 1I3GH 3OC8A 4PREB 1NGQH 3PDGA 1YUHA 3SY0A 1RK0A 1B4TA 1U8MB 3NK3A 3V0EA 1MREH 2JCCE 3QJRB 3AFLA 1ZWIA 4UMSA 3I6SA 3Q7JA 3D8MA 3LYRA 5F0JB 4FX5A 5FYKE 2KQMA 3T3PF 4YFLF 1FH2A 2EYTB 2MCG1 2ZYHA 1XCTB 5CIPB 3QWRD 4EXKA 2EUZA 4DN4L 2OR9L 4M6ML 3GSWA 1MVUB 3LZRA 5F3HB 1INEH 2E8ZA 5DC0A 5HJBA 1R24A 1XB8A 5CSGA 4Y4KC 5HDLA 1MFNA 3DROA 3GIVA 3GMRA 2QKIC 2PO6A 1OT1A 2P42B 3MRJA 2FJUB 2E9BA 3WCYA 1E4WL 4G9DA 5FWRA 3EHBB 1KJ2H 3CZNA 3QPXH 3ILPB 1EEZB 1VACB 5DTFA 3FCBA 1NC2B 3CLEH 4ZO9A 5E1GA 2ZIDA 4BCXA 2TSBA 3QXDA 1JNJA 4KTYA 2QPUA 4HHWA 3GJFB 1YEJL 2C26A 1S3KL 3T65A 3A4FA 4ODSL 3L54A 5C07E 4PGCA 3CTTA 5J3HD 1KLGB 5D1QA 4UMGA 3BSHA 3FTUA 3CVHL 1QW9A 3QZWA 4HS8H 4GXFA 3BP6A 3ZDYE 2BNUA 4HKJB 2YQ2A 1UA3A 3MZGB 4PJ9D 1SJXA 3VRIA 2X1WL 3L3JA 1OAQH 3DHUA 2R8SL 1KY7A 2GJ6A 3P73B 4LHUD 1CUOA 4MXWL 2IAND 4BFBD 5IIEA 1SYVA 5KJ7E 3VFUB 1G9NC 3LZFL 5KG9B 1T21B 1I9JH 2HRPL 3DWTA 2ZICA 3EH1A 4U33A 1U8PA 1G84A 3DVNA 5ANME 1J7VR 3NSDA 4OCSH 1G7MA 2A9AA 1YEEH 4PJBA 2F54B 4LP4A 3KPPA 1LGVA 1S9XA 3GXNA 1ZA3B 3CFMA 4LQFH 1NCWL 5FB8A 4DGIL 1P7HL 1FQ9C 2FJFB 4WLCA 1J9TA 4ODHL 2P4AB 3TFKC 4AM0B 4MMYB 5DRZB 5IMKA 2B39A 3RU8L 1KTDA 2QGBA 3LZQA 5D55A 1NMBL 1B88A 5HHPB 3BH9B 2W92A 1QTSA 5F6IC 1SM3H 2D0HA 1I75A 4X5WA 4XO8A 2G3XA 2OMWA 2YEVB 4RGND 3WS3A 5C0NC 5CEYA 5KZCB 3DX3A 4LBAA 1VZHA 4XVSL 4YHIA 2CHDA 5EOQH 3ZGIA 1KMGA 1JG9A 4PJ5D 3B9VA 3G6JE 4Y19E 5EZOH 2Z7YA 2ZX6A 2JB6B 2CMRH 2MKLC 3PWNB 4GEJA 1VFMA 4PCYA 4ANXA 5I71B 5IMMA 2ZF9A 3QEQE 4EZKA 4HIHA 5BV7L 4JRLA 4U1LB 3KHQA 4FTVE 4AEIL 3WTVA 1F8TL 3IE9A 4WK4B 1PF3A 2VR7A 5DHEA 2D2OA 1UXMA 2OSLB 1FV1A 2HVBA 3BWSA 3WLWC 4J3OH 2CCWA 3Q6GH 5KYYA 4WI0B 4HEPG 5EF0A 4K5LA 4F3FA 4F57L 1A1OB 3KYNA 4G42A 1A4JA 4R0LA 4U3CA 4ZD3H 2V3EA 1BYNA 5TFSH 2CPUA 3WSQL 4NQCE 2JLLA 3FO0H 3VI3F 4QRRE 4QCIB 1IM9B 4RQQB 4PV8B 4NKDB 1ZLSH 2FT6A 5JMOC 5I2IB 3QRLA 4PRDA 5F72S 4A1RA 1ZVSA 3CV5A 1PY4A 2C3HA 4YXHH 2DMCA 4KMTL 4FTDA 4WWNA 1JNLL 2XN9D 1EUTA 4ZFQA 3SGEI 2W9LA 4Y4HC 4KKQA 5D71L 5I8KL 4KAQH 5E1HB 4OLYL 2HUEA 4PWGA 4Q4IA 1XB6A 4LPYA 1B9ZA 4JE0A 3ZE1E 1GTFA 4JRFA 4ZFGH 4YUEH 1HWHB 2Z35B 5HJGA 5HI3C 3WNMA 1JWMA 2V2XB 5CINL 4LVEA 1RIVH 3ZXAC 4CU8A 4AYFA 2L04A 1FFNB 2NY5H 1ZKAA 4QOKB 2OMXA 1KTRL 2H41A 4GSDH 2JQAA 2ENQA 4JO8A 1I8KB 3FOLA 2V2TB 3CSPA 2N56A 4LSUH 3X1FA 1AQKH 3QAZC 2XV0A 3TNMA 4PJXE 3SQOH 2FYYB 3B2XA 4I9WD 4DZBB 3E8UH 3RUGE 4L0YA 2UXTA 3OKKA 1XT5A 1TR7A 4NT6B 2JIXD 2UVFA 4HLEA 3V6OA 3VW3H 4MXQD 3BGMB 4HX1B 4LRNH 3VFTA 4KKAD 1F97A 2B8OT 2GHWB 4OIBA 2FZ3A 2IBBA 3CDFA 4CC1A 1R0AL 4HIIA 4PREA 2OCJA 3HHRB 1MXGA 1P2CB 3V8OA 2YPVL 3HPLB 1U8MA 3MROB 2WIMA 1H0DB 5AD0B 2EUVA 3LN5A 1OM9A 1QNZL 3IDYC 2NQDA 3HBQA 1BOYA 3EJPA 4G2AA 4NM4L 4RRPG 3ARBB 5FM8A 3FBQA 4KO9A 4RZCB 1CLCA 3PWVA 1GZHA 3BUTA 2EYTA 2RCSL 4DW2L 3O6FD 1XCTA 5GRXG 1DQKA 2YC1B 3SE6A 1TYJA 3OF6D 5ALBH 4PCKA 3VRJB 3FFOA 1WEJL 2Z31C 2HTKC 5FAAA 4DP6X 3V95A 4PRID 4TQEL 3SGEH 4L4VE 3TBWB 3A3YB 1D5BB 3GKWL 4HCRL 3D50A 3U9WA 3WL9B 1WP6A 5HYJD 3ILPA 1EEZA 1VACA 3LS5L 2DM3A 1NC2A 4JREC 3CFBB 5IROC 4GXVH 3FUEA 3QUYC 3BYTA 4JPIB 3GJFA 3HFFA 5J0BA 5FM5O 4UT7L 1U8OB 5JHLH 3BDBA 4N0CC 2K9UA 2WXFA 4PJDB 1J5DA 1KLGA 2WTOA 4WKXA 1TVHA 1A2YB 3V5DB 5C0EA 1M3IA 4NC1E 4S1QH 5AG9A 4HKJA 1WBZB 2IOIA 4RAVB 3MV8E 3UBGA 3ZQWA 1BMWA 4PW9A 3K6SB 4HUNB 4OI8A 2GJJA 3AITA 1FZJA 3KR3L 3P73A 2CNYA 3KPRB 4GBXB 4LVHC 4K94H 2BDNL 3VFUA 1GGIH 1LK2B 5DMYA 4KKRA 3B6SB 3KLDA 3KW8A 3N1MC 4XHJC 1FO0H 3SBQA 2OFQA 3CFKB 5DJ2B 3MGAA 2F54A 1MFAL 25C8H 3HC3H 2J6EH 4DUXA 4X9GA 2X6VA 1ZA3A 3DHJA 5L2KD 3O4LD 2DEYX 2NXYC 2D7NA 4P57A 3KNBB 2FJFA 1TEFA 4QHUB 2FR4B 2G30A 5D7JC 2D4DA 4MMYA 4AM0A 4MMZB 5DRZA 1SLUA 2RGSA 4YAQB 1QD0A 3QR0A 5HHPA 2R39A 3BH9A 4WU5A 2NDGA 2IVFC 5TE7H 3FU7B 5ITBH 5GGVH 2CO1A 4L1DA 1P6FA 2EXWC 1JVLA 2GABA 1XIWB 2GEEA 3DJZA 4HBCL 5I0XA 2J3SA 1J8HE 3CZLA 3NIFF 2Q2LA 3FTSA 4EN3C 2CDEB 3MU3A 5BW7C 4LHJB 4YHOH 2V9QA 3IRZA 3VWJA 3RGVC 3PLYA 3VG9C 2AQ1A 2JB6A 3JVGA 3N41F 3PWNA 4K9EC 4PRPB 5TE6H 2BNRD 3CPUA 1YECL 1QSFD 3ZYZA 5KS9B 5JQ6L 3QEUA 4U1LA 3RWIA 1AQDA 5FF6B 2MWCA 3W9EB 3D48R 1R33A 5E2TL 1V8HA 3DX2A 1EO8H 2DBLH 2ZD0A 2OSLA 2Y4SA 2H2PD 4NZDA 4ADGA 4AQAB 4EUPB 4WI0A 2OMVA 1J1XH 4CKVX 1CPUA 1A1OA 2YHGA 5F7DB 4F37F 1HCYA 1W72B 4K3JH 2VLJB 1ZLUH 4AJVA 2ZXAA 1BD2B 1DBBH 4PCSA 3B9KD 1IM9A 3L3KB 4RQQA 4PV8A 1JXFA 1Y18B 5DS2A 3WG7B 1ZANH 4TF4A 5L6YL 1LE9A 5JW5B 2Q3XA 1MELA 3L4YA 3D4YA 4GFXA 1UA7A 4YPGA 3U36B 3K6FA 1V54B 1NDTA 3OWRA 4NHCH 5DK0A 1J48A 1O6SB 2D7PA 3P3YA 4YE4L 4TLTA 2WQXA 5KSAD 4IKIA 1OLLA 4LNVA 2CO3A 1NKRA 2HAZA 2PLTA 2WCPA 1AD9B 2E6PA 4MRCA 4ZAKC 4BFOA 4L1BA 1EAJA 5ANHA 1VAHA 2V2TA 1DE4B 5IFHH 2H1PL 5F8QC 1IE4A 2EXTA 2YQBA 3PFQA 1BVNP 2NXZB 2FYYA 2X4QB 2YS4A 2OCCB 4MMXC 4K8RH 4DZBA 1ACZA 2DQFB 2BY0A 2F19L 1CGWA 4JFZH 3IDNB 1G6VK 1FFTB 4NT6A 1BFSA 4Q7DA 4ABWA 1TZ8A 4G7VL 4HX1A 2NNRA 4HSCX 2CRZA 3ECBB 1M9SA 2F68X 5LGJA 3OMZA 1PJWA 2EUXA 1Q38A 1TU2B 2IANE 3HPLA 3TA3C 3UJJL 1LNUB 3MROA 1QZ1A 1H0DA 3VTAA 4BIKA 3EOYG 5IOPB 1J5IA 4B9JA 1CI5A 5DJYB 2DD8L 2VXSH 2G3NA 2VZ3A 3IFLH 5LVEA 3PYCA 3ARBA 1ZEAL 2ZXWB 3EH3B 4RZCA 5DMIH 2C4FU 2XA8L 1HE7A 3DUUB 3HI1B 3LQAH 3PV6B 5C8JB 1T83C 2ZOWA 5DHVH 2YC1A 4E9QA 2JWYA 2P80D 1FNSH 4Y2DD 5FM5M 1A9EB 3RWEA 2P52A 3VRJA 3G6DH 2CUMA 1W16A 2VM9A 4BQCA 5AEAA 3OHXC 4JGUA 4LL4A 4YBLC 2DH3A 5CM1A 1HYRC 1TQWA