2XCMC

Complex of hsp90 n-terminal, sgt1 cs and rar1 chord2 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
AKYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLEHGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYTOSOLIC HEAT SHOCK PROTEIN 90
publication title Structural Basis for Assembly of Hsp90-Sgt1-Chord Protein Complexes: Implications for Chaperoning of Nlr Innate Immunity Receptors
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Chaperone/protein binding
total genus 14
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xcmC00
1WFIA 1WGVA 2Y1ZA 2RH0A 4ELDA 4RZKA 2WJ7A 1RL1A 3J07A 4JUSA 1X5MA 3AACA 4YE0A 3W1ZA 2CG9X 3AABA 2XCMC 5LUMA 3EUDA 4JUTA 2N3JA 2CR0A 2KMWA 3L1EA 3Q9QA 4PBDA 4FEIA 2MNWA 4ZJ9A 3QORC 1WH0A 2O30A 3GT6A 4YDZA 3Q9PA 1GMEA 2BOLA 1EJFA 3QORB 4PCKA 3VQMA 2JKIS 3VQLA 4YLCA 2Y1YA 3L1FA 4YLBA 3GUFA 2K8QA 2WJ5A 4M5TA 2KLRA 3IGFA 4M5SA 4MJHA 2N0KA 4I88A 3N3EA 3QORD 3L1GA 5DS2A 3QORA 1SHSA 2Y22A 4YL9A 5DS1A 3GLAA
chains in the Genus database with same CATH superfamily
1U9KA 5B22A 2BY1A 3BH9B 3T0XA 1JGUL 4ODUB 2ED9A 3OKOB 4MCMA 2NR6A 4GRMA 5T3XL 2UXFA 4UM8A 1I8KB 1X5MA 4H0IA 4WNQA 1RUPL 1YECL 3TN0B 1MCKA 2YQ3A 1I9JH 3MOBH 2YXWA 3BRGC 1RJZB 4GO8A 4I48B 4X2UA 4LCUA 2QSVA 2YAOA 5I75C 1INEL 1YCSA 4G7SB 5D4IA 4GAYB 3AM8C 3RUGB 3PXJA 1L4IA 3BAEL 4M8VA 1KCLA 3MRQA 3X13A 3OG4B 5I66A 2ZKMX 4JFFB 3Q7JA 1U8IA 2AQQA 3BIKA 5HI3C 5I8OL 2P28B 4F33A 4H8UA 2FBOJ 3CVIL 4ESKA 1ZJAA 3VGHA 2XNAB 3NEEA 3Q8EA 1SBBA 3N1QC 3L3HB 1UC6A 2K1MA 1FE8H 1LXMA 4KXZH 4P2QB 5AZ2H 1WD9A 5ABAA 3BUTA 4B97A 3R7RA 2ZYHA 3RY4A 4EDWL 3AG3B 2JB5H 4E42A 1MRDL 3BZ4A 4X8JA 4YHNB 5FFLA 3G6AB 3HG2A 5DZPA 2YSSA 4ZS7L 3RKPA 4DSYA 4UT6A 3SPVB 1N5AB 2IBBA 3VRLF 3KPSB 4PJCB 5DURD 4XPBL 1O6TA 2Q20A 3MACH 1U30A 4XVTH 5JPNB 1G9NL 2L3BA 5F7UA 3NQIA 2O5NA 3BXNB 4KO7A 1LEKB 2B14A 3VXMD 5FS5A 1JZIA 2MJWA 3QXDB 4Y0GA 1J9TA 5D1QC 3B9AA 5DQDL 4X8GA 3BP4A 3FQNB 1T04B 1N8OE 3ARVA 3IFOA 4CADB 3HIZA 1H6EA 1FL6B 2B59A 2BNQD 1CUOA 2J6EA 4FLOA 1J9RA 3WENA 4FQ2H 5CO1A 5J1AA 5I17B 3HW7A 4PJGA 1FBIH 1N5YH 4PJEE 3UTTB 4C4KO 4PJBB 1UUNA 4ZUSB 4UYPA 3S37H 4OZ4A 2PO6B 3HE7C 4B9GA 4ELMF 3U6XA 2B9BA 3BPNB 1F2QA 4NHCL 1ZT7A 4KVCL 2Y9RT 4YUEL 4L0ZA 2BIMA 3LQZB 5I5IA 1QEWA 1FIGL 1MCLA 2YAEA 4HX1A 4PVNA 4HA1A 1H6UA 1VKXB 1JNNL 4L4TB 4C56B 3LKNA 4F80A 1TQBC 4OGAD 1IQDB 3QG7H 1U8QA 2WOYA 1TETH 4I0PA 4AQ8A 2ESVB 1WQVT 2PPFA 1UFUA 1QSED 3A4FA 4HKXA 1FCGA 4HIHB 1JCVA 1L3WA 3GO1H 4MMYA 3KPRD 3ZVVA 3BPOC 4ERSL 4R7VA 2XQYA 1S5IL 1QACA 1WH0A 3KEHA 3C5XA 3IAQA 2BSED 1B4JH 1L0PA 2GCYA 3B2MA 2L7UA 4F7PA 3DXAB 1FI8C 3AY2A 1U92A 1P6WA 4H40A 2PCPA 4MHHG 1LE9B 1JZEA 1RVFH 2NYYC 4LLWA 5IB3B 2DEWX 1CDIA 2OMUA 1DEEA 1F0LA 1MJ8L 1OK0A 1YHPA 1BAGA 2Y1ZA 1D5ZB 3D0AA 1U3HA 2NW3B 3ARPA 3Q1SL 1ETZB 5JHDD 1WLHA 1DQLL 4A63A 1FV1B 2OMWB 3IJYB 3H9SA 4HT1L 5IHHA 3SO5A 3ML8A 3UTSE 1D5MA 4RGMC 1NFAA 2XWRA 3FU8A 4XP4L 2BVYA 5C0JA 3AADB 1XVSA 4HS3B 4OZFA 3KLKA 1GR7A 1OAZL 2YPLE 3KGSA 4EUPA 3V8CA 2RTTA 1DLHB 4ZFOA 1SMDA 3TIDB 1D7CA 3VVWA 1P1ZA 3JQOB 4X7FC 5C0ND 1O9ZA 1AGBA 2G5BB 3LQMA 3DGDA 1TZGH 3DX1A 1AACA 3R0NA 2DS4A 1ZLEA 3KW7A 3SBPA 5IVXB 1EBPA 4P23B 2WXHA 4FQLH 1HH9A 3K6FA 1ZLVK 1I53A 2VZSA 1NCAH 2OMNA 1NFIB 2V7HB 1XBRA 4YSPA 1WIUA 1WITA 5J3HC 5EWIH 4I0KA 3U0TB 1AYOA 1EX0A 1N2RB 3RVWD 5JOPE 4LIQL 5DHYB 5T1KD 5J11C 1XGQA 2VXQH 4HFUH 1PLGL 3KYAA 2OSYA 1FL3A 4M8QA 1D9KC 2QHLA 4H8WH 2DQCL 2OXHB 3I3EA 1RJYA 3C5SA 3MUGA 5EH1A 2JJWA 2Y36H 3K72B 1J8KA 1HK6A 4PR5B 6PAZA 1A4BA 4IIZA 3DVIA 4M1GH 1MJ7H 4KUCD 3DTUB 4HS6B 3TN0D 2C3VB 5GS0C 2V3EA 1FNEA 2QELA 2Q3AA 4IK6A 3U1SL 3VDCA 2HT4D 4OCXL 4CGTA 2YC1B 4N2GA 4WW2B 3CXHJ 1JZ8A 2DQIL 2KC0A 4PRDA 1KEMH 3IS1X 1CR9L 2M83A 2HA1A 3O45B 4JE4B 4B9PA 3EYVB 5FCUL 2W0FB 4JQVA 4KJQD 3WFCL 1BXVA 4KOCA 1F56A 3CFCH 5CIPB 3U2IA 1FG2B 3MREA 5E2TL 1MCSA 3I84A 4L18A 4JFFD 4TN9A 4JHAL 3CBRA 2MWCA 5TH2B 4KMQA 3SJVA 1YPZE 2BJML 4O9HL 3DBXB 1JHTB 1RZ8A 2WWMC 3ARBC 5AD0A 2F7QA 3UYPB 4FZEH 5H35A 3LRMA 2AJSH 3QDJB 1C5BH 1XWVA 1A5FH 2AGJH 3ZHKA 4KKLC 4OIIL 4RWYL 5FA3B 4DOHB 1AHWA 3T0DA 3V8OA 3ZY7A 5EIQA 3S34H 3QJSB 2Y25A 2EYSA 4OJFL 1CLCA 1AGCB 4LFHG 4U6TA 5SX4I 3KPSD 4W93A 4ZTEA 4L3EE 4MNQA 4N4YB 5IG7B 5I16B 2H2SD 5I1JL 2RQ8A 3BH4A 2HVBA 1VB9A 1IEAB 3V0GA 1JGEB 2O5YH 4QWWD 4ALAL 1IM3A 5GGSY 4R2GC 3ZTCC 1JWMB 1BGXL 1NBYA 3Q2CA 3L9RA 1MRCH 3ZE0B 4QTFA 2X6AA 2E8ZA 3QZPA 5F1IA 2D7MA 4GKSB 4JY6B 4S2SB 4XN9A 3T65A 3DO7A 2XFXB 3L4XA 1HCFX 1W6LA 4TNEA 5IBTH 3GMMA 4MZ2A 4PS8A 3U36B 3FFDA 3AMLA 2AK4E 5GSRA 1B2WH 1CXEA 5HHOE 2D9QB 1HXMA 2ZOWA 5FOJA 3VI4B 1SOKA 1CLZL 1A4AA 2HFGH 2NUPB 3P0YH 4R83A 3WNKA 4RRPA 4HEME 1EEYA 4Z7UB 4PJXE 3VI3A 3H56A 4M1CD 4XRCB 5IMLB 3LZFH 3UTTD 5I1IH 3GDCA 3VWJA 1C1EL 1WEJH 3LQAL 2OJZH 2PO6D 2JSFA 3EDDA 2OZNA 5D6CB 5G4MA 4XCFL 2VR9A 3BUDA 4WSJA 4HWBA 4ABUA 2H6PA 3KPMA 3OAYH 1ROWA 2JKXA 2YLKA 3MNDA 3RURA 3GZPA 2B1OA 2OCJA 3BDXA 3EFOB 3D39B 4L4TD 3HLKA 4C56D 2R29A 3RU8L 3UBFA 5EEVA 2R1WB 4PMEA 3LKSA 2CIIA 2IEPA 1TTBA 4UQ3B 4MVBD 4FADA 2VISA 4ZS6C 3MNVB 3B7RL 2FO1A 3VD9A 1Q9OA 2NNRA 2VM9A 1R3LB 3IGAA 1FVDB 3IGLA 2WYZA 5HDLA 5AB2A 2GVYA 3ELQA 2D7PA 3VNYA 3BEVA 1I75A 2ZCHH 5KSBE 4JBSA 1MCIA 3DXAD 4N0YH 3EYSL 4MA1C 4O02A 4PEEA 5HYJA 2H3XC 4GFTB 5I1AB 2V5TA 2Q3XA 2F2HA 3V0WH 2NX5D 4ODTL 1WD8A 3MJ7B 3LXAA 4JN1L 2G2NA 2WWKT 5I26A 1TJMA 3EXJA 3WFDH 3CUPA 1I1AC 3AREA 1IT9H 2IALA 3QYMA 3FXIC 4JPQA 4NN7C 4Q7DA 1QI3A 3AQXA 1MCPH 2WZPA 1JUFA 2J72A 1OAXL 2Y3AA 1JI1A 3H7LA 1HOEA 5HHNA 1MCHA 5C07B 3IDGB 4MJ6A 4ES9A 1S9XB 3MA7B 5GIRA 5BO1L 5JW4Q 3UAJC 3CSYA 2QVKA 4XMTA 2XG4A 5TE6H 4WAFA 3QWRA 4PJGF 3VXPA 4ZMZA 4I3SH 4UT6H 1DVFA 3HUJE 2WLNA 1KDIA 2XZCL 1UA6L 5CEXB 1AO7A 1VZHA 1ES0A 2DI8A 4JY5L 4XCYB 4BZ2A 5EU6B 4F9LA 2WXLA 3T2NL 1HYSC 1RZFH 3TBVB 1BQSA 2X4NA 1S7UB 4JY4A 4ZXBB 2EDEA 3L1OL 4DTGH 4O2EB 3WIIL 3QG6B 4R4BB 5GGSA 4JPIA 4YX2L 3O6FD 5DWUL 5A2IH 3BJLA 2J20A 2P80A 2EDDA 2C5DC 3X3GH 3UPRA 4IBQA 2K9FB 3WV0A 1QTPA 2ITCB 4G7YH 4FFWD 4M1DH 1QFWM 4WKXA 3L4VA 3LY6A 4LPTA 5B39B 3ZDYF 5DQJB 2GABA 1J5IA 4LEBA 4YBLC 2J6EH 2XWJB 4ZPVA 2HJLA 3EYOA 5JZ7C 4QTIH 1GY2A 2E27L 2IDTA 2J2ZA 1VFOA 2BNUB 3TWYA 4XPFL 1MCNA 1XIWC 1QBBA 4FXKA 2MOQA 2WB7A 3BWSA 4X5RA 5L9DL 4RH4A 5DRNA 4IKIA 1D6VL 3B43A 1HXYB 3WL9A 5GZOA 1KCRL 2QTVA 2D7OA 3RVVD 3CIQA 3QNYB 5IW1A 3VRLE 1W72B 2Y22A 3DO4A 3LNDA 1NM9A 1UD3A 3GSWB 3EFFA 4HEPG 3T4YB 2ZXDA 4DCQB 3MRGA 5LGHL 1NBVH 2J8UB 2A6JA 2DTSA 2H0FA 4J39A 3DV6A 4MTMA 3BP6B 1PX3A 5ENWB 4JQXC 3GXDA 2J3SA 4PLJC 3L3JA 4HP5A 1U91A 3IJHB 4JO1H 3QUXC 1JV5A 4ZO9A 3MLWH 4Y16A 3AG2B 3U0PB 4DVRL 3OKEB 3QO1A 4AIZA 4OJYA 4TSBL 3P0GB 5TFSH 1YYLH 3KXFE 5D2NC 2ZAIA 3NH7H 4O4YH 5C0AA 4P4RB 3DIFA 3AB0B 4R96B 2XV2A 2CRYA 2X1QA 3RWJB 4W4NA 2VDQB 1B9KA 2OR8A 4OGYL 3TIEA 4XOBA 4GIPD 1ORQB 4G6ML 4FP8L 1LO2H 3DURB 4ELME 3ARGC 3KL3A 2YR3A 4OVUA 2FHFA 3UBXI 4HH8A 4N2LA 1U3YA 2AK1H 5BOPA 3MRFA 2A6KA 3O11A 2WUCL 2FLRT 4LDEB 2ZWYA 4JKMA 4LF3B 2VWEE 2JTYA 4WY7H 2Z34A 3AU1B 1ZLWH 3CMOL 3D4GA 2K9UA 4OZFH 3N3EA 2FE0A 4ZFZA 3B5TA 4U1MA 4F8PA 3ZN6A 1A14L 4W1TA 1QLRB 5H37G 1TJIL 3HB3B 5I1KL 4MXQC 4PMFA 1N0LA 2IH3A 4EZMA 3HG1B 3IXAA 3DJTA 3DVGA 3O3BA 3LKRA 2DQGH 3HPLB 2Z1KA 3B6SA 3CBKB 1KTDB 4NQEA 1E30A 4X0NA 3SQOL 4MQXD 1FO0B 1MFNA 2MCPL 5BRZE 1BQHG 2N7AA 2QTEA 5C09A 4BELD 5J06A 3E2HC 2VITB 5TDOA 1PNDA 4WU5A 3VQLA 5IV2A 1RZ7L 3NIGF 3N1GC 4OQ1A 5EUOA 1R3IH 3H3PL 3DROB 5EBLA 3OGCA 3TV3H 1NMCC 3PWLA 5DRWB 1DJYA 4IJTA 2BWDA 2A6DB 1N68A 5A16B 2E76C 2DQDH 2YGOA 3O9WA 4ZUTB 3J2PA 2LW3A 3VGAB 4PTTA 2AITA 3NMEA 4DGUA 2F53A 3BZFA 3P2TA 4LLQB 5ANME 5EZJB 4X7DC 1AE6L 3D39D 2E7LA 2Q7NA 4X6BB 1RMFL 4NI3A 4WO4C 3SOBL 3EGXA 5BUAA 4X6DA 4M5YH 4NQDA 3VXSD 5F3BB 5E70A 1J8HB 1NL0H 1ZAGA 3PGCA 4JKPH 4J3OD 1WK0A 2F8OA 4NYLB 4LLVA 3ZKQD 1J1PH 3MNZB 2KLTA 3GJFB 4AYEC 5F1SA 1SY6H 5DT1H 2EILB 4BSWB 4Z0XA 3EGDA 2BY3A 4MS8D 3E80A 3SGEH 3HC0A 1RUQL 4AGNA 1WYJA 2J4WL 1T22B 3G3LA 3OXSB 1DHKA 4HUVB 3X1EA 1D7FA 2C7UB 5DMKA 3T4AB 2NRDA 5DUJA 4MB5A 3TESA 3EZJB 2AJXL 2WLJA 3O81A 4J3BA 2VDLB 4NC0B 4HG4J 2PR4H 4Z7OB 1CE1L 2VZTA 2RCSL 2O5ZH 4YSTA 5C9JB 3HAEH 4FKKA 1FORH 3BFQG 1EEQA 1F13A 3L95B 3D4ZA 3IM1A 2WLHA 4JO4L 3HBPA 1OL0A 3HZVA 4JG1L 5C07D 1E42A 4PH8A 4BH7A 1XZ0A 3KM1A 5IJVA 4NM4H 3HZYA 1KJ3H 3GIZH 3MV7D 3VI3F 3EHBC 4RFNC 1HHHB 1T4KA 1QFPA 4B96A 3UJIL 2NT0A 3PYCA 1INQA 1DDHA 2XWTB 5EU6D 5CD5D 2O61B 1HX0A 2EC8A 4NGHH 3ET9F 1FPTH 1H5BC 3GLZA 3QFJB 1OPGH 3WHXB 2BSCA 2CPUA 1WICA 3HMXA 3INOA 4P5RA 4QRUA 5KS9A 4QRQB 1A4CA 4K5OA 3NN8A 4Z3EA 1CGSL 4RA0C 4BCXA 3NRPA 2Z1PA 3L2MA 4DEWA 1T1XB 1UXLA 1T7XA 2VUKA 3I50L 3TPUB 4KQ3L 3D0LB 5E8DH 2JIXA 3HE6B 2IH1B 1L3NA 2PABA 3IDNB 2BOCB 4FG6C 3ZL4H 1JPST 4ODWB 4PJ7F 4TULL 1RULH 1KJ2A 1LVEA 1SJVA 5C0RH 2DJ4A 2XBZA 3EOYG 1DTUA 1O7VA 1DJIA 3U1QA 5A1AA 5L2KA 3L5XL 1OB1A 4CSSA 1UGKA 4L5FH 1QFOA 5DJ8A 4NNPH 4F7KA 1BXUA 1EJOL 3L17A 2WTOA 2R29H 2GJZA 1EO8H 2JCCA 1CXIA 3CBJB 5ECGA 4JO2H 5I2IB 4XB7A 4WI2A 5ACZB 5FV1L 3QIWC 1JGLL 5C0DA 4OW6A 1IILE 5DVLA 1EJ6A 2I7OA 1AS6A 5AL8A 1TFPA 4DVBA 2NZ9D 5KAQG 3S97C 4ZMXA 4D0DB 4ZAKA 2PMZA 1F18A 1OCWH 4ANXA 3TP4A 2G3NA 5HHXL 1G9ML 5KJ7E 1AAJA 2G0KA 3ZKMC 1CFTB 2YD1A 4X4XA 2IQ9L 3UERA 2WXNA 1H0DB 1NIEA 3HNSL 1UWEL 2IGTA 3DRTA 4JPVH 2IWGA 4NO0A 4L37A 4MQ7B 5GQBA 1W72L 2BWQA 1A4KA 3MROA 3I3DA 1M4KA 4YEFA 3ARDC 5AL0A 2XXGA 4I3RL 3E3QE 2BO0A 1X9UA 2ZKHH 2VTFA 4NNXB 3F65A 4M7LL 2WGXA 2BWIA 3GRWA 1QBAA 2PCXA 4R8WH 1NCDH 4AV5A 5J5EA 3UP6A 4LDCA 4QRAA 1GL4B 2WO2B 1JDAA 4MASA 3KJ4B 2WJ7A 4YHIB 5EFIB 3FFOA 5FA4A 4WFFD 4DAGH 3HB3D 5JIIA 3QDMA 4HWZA 4WDIA 4A7SA 1IMHC 1XB3A 3HG1D 1LE5B 3NRQA 4N5UA 1T2XA 1XF1A 4W4OC 1FH2A 1NLBH 2PKDA 4M7ZB 5EO0A 2JLPA 2KERA 1P7QA 4BZ2H 2VDQL 5GGQH 4Z77B 1YN6A 4X0KA 1H8NA 4YLQT 5EF0A 3G5YB 1T6VN 5IJBC 2JXMA 1BQKA 1CTOA 3U9PH 1BVNP 2B7DT 1AJ7L 2JMRA 3O6KH 1WG3A 4RIRB 4Y1AB 4AG4H 3D08A 3DUUB 3BYYA 2F8XC 5KOMC 4BUQA 4FNLH 3ES6A 3NUKA 3ZU8A 3RDTA 1AD0A 4UAOB 3VW3L 3LEYL 5D7KE 5KYNA 4UCFA 2BS71 2ZG1A 4OQTL 3IXTB 1GSMA 1A6TB 2W9EL 3WTSA 1A2YB 1LO4L 1DANT 2YA1A 4W9FC 3U2SA 4HZAA 3HMWL 4PJGE 1FO0L 4UT7H 4XN2A 3B2XA 4RWHA 1J8HD 1A3RL 5A3ID 2AERT 2GJPA 3F7LA 1F1AA 2QR0B 3BKJL 5C6TH 2H6OA 4XH2A 4DJMA 1AQKH 1OWRM 1LK3H 3HG0A 3TBWA 4APQC 2OULB 5EU3A 1ZE3H 1YJDL 4HU8A 3BO8A 4XNYL 5I82A 4XVUC 3E6FB 3Q9PA 3ZKND 3CFDB 5FEBA 1CFNA 1BQUA 2NLJB 2Y5QA 2GYSA 3FB8B 3HVDA 4GG8A 4TPRH 1ZTXL 4L1BA 2R2EB 3BIBX 2Y1AA 3BC9A 2EH8L 1R5WA 1T2QL 4JM2F 5D1QB 3VRJB 2NDGA 5TPWH 3SCMB 3UX9B 1CGXA 2DTMH 3ZDYE 4D9RD 4EO5A 4TV3A 5DK2A 2WLYA 4HCGA 1S8DB 5DHVB 4JZOB 4U1KA 3WSQL 4KHTL 4BFKA 2EO9A 1DBJL 5KANI 2AS5M 1WZ1H 2R27A 4KK6D 3HTLX 4FZ8H 1OW0A 3LDBB 2ZUSA 1SYVB 3MRJB 4WUUB 2MHAA 3NJFA 3P30L 4AKPA 3ARWA 2EABA 4XCCH 3NRFA 3CN2A 4ZO8A 1O7DE 4QAMB 2V5RA 2Y07L 3IGFA 2NY5L 3ZIYA 5BPPA 3OR6A 5HYSG 2VXUL 4XC3H 5JORA 1XTMA 4TQEH 2WSKA 3H9SE 4EI5C 5FPIA 3NFPB 4GJTB 3TBSB 1HL5A 4ODSH 3WXWL 2DMGA 4ZFFA 3T2LA 2CBTA 2B1HH 2VDLL 3KPPA 4FABL 1SUHA 3S4SG 1PEWA 3QFJD 3B3BA 4TMPA 4Z1PA 2R0WH 1V3KA 1MJJA 3QQXA 4PB0L 2CO6B 2UZYB 2R0ZL 4HOWA 2ADJB 4X6DF 5D5MB 4G8EA 5A6MA 5HGBA 4M6ML 1ETB1 5C3LD 4HF5L 5FV2A 4QHLA 2WINA 2N56A 3F5WA 4JFWA 3MCLH 3VFTB 5FO8B 5A2CA 1S9WA 2IDUA 1ZSHA 3CZGA 2BFGA 3UH8A 4OAWA 1F1DA 4XODA 1G7HB 5GXBB 3CTTA 1MRFH 4WFHD 1B9ZA 4K07A 3E7JA 3LIZA 1PX4A 3PWPA 3F7KA 1Z3GH 1K2DA 1A4JB 2IVFC 2WIMA 5E6UB 4R7NA 3AW5A 4Q6IB 3OKLA 2AEWA 4FXGA 3JTTB 4PJIA 5IGXL 1XXDC 3BVNB 1OE2A 3MV9A 2HRLA 3KEDA 2Z91A 5I0VA 5DQ9A 1UOLA 3D25B 2DLHA 1RZKC 4FXTA 5IBLD 1A3LL 3OKNB 5I73B 4TSAH 1AZNA 3CVBA 2WXKA 3F8UB 4CMMA 4G83A 3TJHD 2IPUG 5DEZA 1AQDB 5HGDB 2XN9A 3TBYB 3ZZQA 1BIIA 2VAAB 1F42A 4HUMB 4IEFB 5J89A 2EC9U 1SDDA 2JWYA 1H3TA 1LK2B 3NIGE 5CJ5A 3DETD 1KMGA 2YJLA 1B0RB 3NFNB 3Q2NA 1MCRA 4X50A 1NEZG 1FGNL 5IW6B 1I3RB 1KN4H 1M2VB 5KS9F 5J11B 2FSEA 2FYYA 2YFOA 3L2NA 3ABKB 4QYOB 5I1HH 4U1IB 1PX8A 1BD2D 5F9DC 4D0CB 5MENB 4G8IA 1O9WA 5HD8D 4GKZB 1ZHBB 3CGTA 3SJVE 1EUTA 2ARJQ 2R23B 5KJ4A 5ID0B 5ERWB 2ZXQA 1ECZA 4WO0A 1L9RA 1TEGA 3VWKA 4RMBA 4B7IA 3BT2H 4MAUL 4A1RA 5CFAA 1VGKA 5L8LB 1A7QH 3GF8A 1JZHA 4OI9A 1YY9C 5JIMA 1CYXA 3OB0K 4JRFA 4OD1L 3LH2L 1HN1A 2HKFL 4HKJA 4MNQE 4EN2A 1ML0A 3O6MH 4Y88A 4EI0A 3RE0A 4UILL 4IBWA 1GA2A 4N2KA 5T1JA 1WFJA 4Y1AD 2JCCF 2YRBA 5I28A 3TBTB 3BZEB 1OD9A 4HSAC 4J1UB 1YUKB 3FT1A 2Y3NA 1YZZA 2XKNB 4CJ0A 4J3XA 3ZZLA 4NUGL 1WRFA 1YNLH 1FC1A 3OMIB 5FO7B 4UBDC 7FABL 4H8VA 3LOWA 1MXGA 1MFBH 4Y1SA 2IJ0C 5D72H 3H9ZA 4DUWA 5EZPA 3ARBB 3ZHLA 3L7FB 1XBDA 1GGCH 2IAMC 2BDNL 4A7GA 4LNVA 4EIUA 1OCOB 1RV6X 3AT9A 3P9WB 3NESA 5T1LB 4TL5A 3MRHB 3VI3E 2QT6A 5HVWA 1ZRUA 3FZUD 2CPCA 4OFYD 3AQYA 1JN6B 3B9VA 4FQXA 1UJ3A 3MKGA 4JB9L 4URKA 1L0QA 5AUMA 1WZKA 3IU4H 4XXCC 3D2UB 4Z7IA 3LNEA 1MWAA 3PRZA 4QTHA 1FFQA 2BVPA 1MCEA 3JUYA 4L5FE 1RUKL 3PE9A 4N9OB 3MUZ1 2BNRD 3SDXB 4PJDB 4DKFH 3F6LA 5I6KA 1XGYL 3DSNA 1Y1DA 3LKOB 1E6JH 4R2GB 3IF1A 2DOCA 2CO1A 3KL5A 2ZCLH 3GMNB 4FQCH 1I8AA 1A0QL 1X4YA 2I60H 5FYJD 1S9VB 1OSYA 3CLFL 1QLEH 4XI5C 1S5HA 4BFBD 2I9TA 1JFQL 4XPAL 3DHMA 4LDLB 2F61A 3C8HA 3SCMD 5BUGA 3QUZA 5DGQA 4DERA 4DWHA 2DEYX 2P5EB 5C0BA 3CFKB 3D48R 5I1GH 1CGUA 2ZOTA 1FFOB 4A38A 3EYQD 2AQPA 4WJ5A 4M43L 3OAUL 1X5GA 1KFAH 4XMLH 1TSRA 1KIQB 3MTRA 5HYJE 3V4PA 5I76A 1E4WH 4TVPD 5GS1B 1E6OH 5TF0A 3NJVA 1BVKA 1N64L 3HJEA 5F9WC 3BH8A 2AEPL 1BLNA 4PGEA 2Z8VC 2D31A 3BUBA 2ZKWA 5J57B 3Q8BA 3WBDA 5D1XA 5CLZA 3QE5A 2VLRB 2BPBA 4WI0A 2BP8A 1SFDA 5FGSA 4S0TD 5E7BA 1SOXA 4DO5A 1EDYA 5FYJL 4E9YA 4LVNB 2K70A 2DQEL 4GYBA 3W9EA 4MBRA 4OTXH 4J28A 1BIHA 4G1MB 2ZX7A 5TGBB 3MX0B 3Q3GA 4QI3A 4GRWE 1PIGA 2Q87A 4QCIA 4FEMA 2UX7A 2VERN 4POYA 5DO8A 2WD0A 4LCCC 4MAYC 4TVPL 1AO7E 4HKZA 1DL7L 2F5AL 1CK0H 3GTNA 4ICWA 4RMUA 5F44A 5L8JB 2WMPB 5EZIL 4MA1B 3P9LB 4KNUA 1T20A 4E0RB 1N6QL 2P52A 2WOBA 2X44D 1AY1L 1R3HB 3FT2A 1RZIA 1C8PA 2HPOA 4G9DA 4YR6A 2FX8H 4TOYL 5BQDA 2FH8A 4HISA 3WFBL 4XP6L 1YEDA 1B0GA 4I77L 4ORGB 3RGVA 4NUJB 2Z93A 1JD7A 3NJKA 3CXFA 4OUUB 3UBGA 4M61B 3KYMB 4X4YB 4FFZA 2V3DA 1LILA 1U8KB 1R75A 2GTZB 4N2MA 1ZGLM 4MDIB 1UQSA 2WKOA 4ZG1A 4OY9A 4ABWA 4ZPTA 1RIHH 5FF6A 2F08A 3GSNB 2CM6A 3NGBC 4PGJA 3B2UD 4L8SB 4HDIA 5AYQA 1KLGA 1FFPB 4Y2NA 1U8MA 4OZHB 5IMMB 2A1WL 1NPUA 1JHKL 4RAVB 3V4VL 3EDFA 3QAZC 2QQQA 1W9XA 2OMTA 4FFVD 5DJDA 4QOKA 1LNUA 5IF0A 2EXWC 4S1QH 3MRDB 3MYJB 4RZCB 2CDEB 1L7TH 2W9DH 4Y5YC 5FYKD 2IXQA 5JTWA 1M9WA 5EIVA 4POZC 5K93A 4MMZC 4L4VA 4HH9B 2YMXH 2EEDA 3L8QA 4J8RB 1NM4A 4AZUA 4HIJA 1WBXB 3WKMH 5MEND 4GAAA 4L8CA 1XCTB 1NC2B 3IEAA 3O41B 2OTUB 5ADPL 4HXAH 4JCLA 1IE4A 4XCNB 4BA0A 1XIWB 2EACA 5MEQB 1RFDL 1JTOA 2AP2A 5J9PB 1I1YA 1OVZA 2VKXA 2XZAL 3GJEB 4MDJB 2UXTA 4X6EB 2FSDA 4OSUL 3OWRA 4BRJA 3MLUH 3VCLB 4XBMA 5FYKL 1HQ4A 4PJIF 5I5JA 3LEVL 3G7TA 3H0TB 3QEGH 2FJHA 2PPEA 1B90A 4LHQB 1PG7X 4MQSB 3IAPA 4BDVA 1I9RL 5BW7A 1DQDH 4JG5A 5D7LB 2VLME 3BCDA 2AI0H 2ZWNA 3VM7A 2B4CL 4NQEE 1B4TA 2ED7A 1J9QA 4NENA 4J3VA 4OZGB 4N1EA 5C09E 5MEOA 1ZSDA 2Q86B 5J6HA 3QZMA 4N0FB 1KN2H 4IKLA 3RWFA 5EN2B 2HTLD 1HKLH 3LIZH 3G6JA 1FGVL 5EUOE 5T1LD 4NFDA 1KZQA 3IWVA 2AJ3A 4P2OB 3MFFB 1QHOA 2P43B 3TWCH 5DI8A 3HS9A 1TVDA 3EGSB 4XNQB 3KPNB 4ZD3H 2IPUK 4XBPB 2J7LA 3KLAB 3ULVF 5DD1L 1XD1A 3D2UD 4GB9A 1HILA 3D50A 3VDBA 1NKGA 4MNHA 4AYID 2WPGA 2H0PA 3OMZA 2F53E 1LD9A 3MBEB 4AH2A 4YXHH 4LLMB 2ZXGA 1NFDB 1NCJA 4R2GD 5TQ2L 1EXHA 3K6OA 3SDDC 2YPKA 5E9DB 4X6DE 4GLRI 2WBWB 5DJAB 4NQDE 4NZRH 1N12A 1ND0A 4YO0A 2VXSH 4F27A 4Q0XH 1DQMH 4MJ5B 3WFHA 3UC2A 2YAMA 5IEKB 2P5ED 2QSQA 2YD5A 2AEQL 1HYRC 4IDJH 2QPFA 2FT8A 3TO2A 3WE1A 3KWXA 1IQWL 3GS0A 4H2AA 4KMLB 3ZO0A 3LX9A 3FRPA 4Y4FA 5DO2D 3UEZA 3WXVH 3ULVH 4U6XB 2VDNH 4RAUB 3VAEA 4OUOA 2D2OA 1JPFA 1IARB 4A2DA 5F9JB 1XEDA 2P46B 4QMEA 4D0BA 2WBJB 2GTWB 4XAWL 2VLRD 2XN2A 1D5IH 1M6OB 4ZQKA 3TFKD 5F1OB 3ETBJ 5EPMA 4CC1A 2VLLA 4QHUA 5BZDA 4CVZB 2AXHA 1TJHL 4A7GF 4PRID 3BD3A 4JJ5B 1CXKA 1UHVA 4N3TA 5IMOA 4DP2X 1P5UA 4RFOH 3LV3A 1C5DA 3IETB 1I8MA 3MFGB 5GISH 3C12A 5I6OA 2OJEA 5DMIH 2ZPKL 1P4IL 4LEXH 3TVMA 4JR9H 1TO4A 4B41A 3OGOE 1TPXC 2K6YA 5I74C 4A68A 5LXVA 1OAUH 3BEWA 1WTLA 3IRZA 3NIFF 1UM5L 2FL5A 4K94C 2R9HC 4KMTL 1GH7A 3EH4B 1WWCA 3DMMC 3O3DB 4OJDH 1QKZL 1T0PB 4JFPA 5KS9E 4HWUA 4GAJH 4ODHL 5F3FA 4HLZH 3ZUCA 3LKQA 2HAZA 4OKVB 2ZWKA 1BQHB 5D70L 2ITDA 1U8NB 1UWXH 3QIUB 4NN6C 2J1XA 1UYWH 2GHWB 3C6LA 5KVEE 4M00A 3WN5C 2PWHA 4X9HA 1J5OH 3CFJA 4M4PA 2NY2B 2FVNA 4RISL 3C60A 4M93B 3HS0A 2LLLA 1DBBL 1HHIB 3EHBB 4M7JH 1G6RA 2CKBH 2X4UB 3CVHA 3FT3B 2DQFA 3PGDB 5MI0C 3Q6GL 4PG2C 3WKPA 1MWAH 3B3IB 2X1OA 3F7RA 3B2PA 3CAFA 1OM3L 3UBHA 5L2KE 3NFSH 1PLAA 1G7QA 4KKAC 1PG7H 2NY7L 1BF8A 1H5BB 3N85L 2JCCE 4Z7QF 2F1AA 4N0UA 4MMXC 1VPOL 1F41A 2V5SA 4G6KH 3ZDZB 1JZ6A 3SKJL 1KTKE 1L0XA 5FECA 2Z4TA 1KC5L 3BSZA 1BJ1H 4BBWA 3PAUA 2VWEC 5IROC 2H5UA 5TE7H 2BHZA 2EXTA 3H9HA 2N59A 4F7EB 4TLTA 3M17A 5KWYC 1NC2D 3GSNL 4LXFA 5JDJA 4K15A 5AAPA 4ENEC 3V4PH 1R17A 2YFNA 2P5WB 2VSCA 4OLZH 5IESH 2A7BA 1MH5B 4IMLB 3VFRA 4K7FB 1RZJL 3QNXA 3A22A 4DGYL 3ARFC 1C5CL 1NDMA 1PDKB 1W0WB 1OB0A 3D1MC 4FJ6A 2QADD 3QH3A 4YVNA 3CHXA 2GC7C 1F5WA 4TVSa 1IIIA 3QXVA 2PUQT 4LU5L 1PY9A 1D6EB 3FF7A 5HHVH 3REWB 3GMQB 3P02A 1YN7A 4H26A 3SDAB 1MHHA 2ITFA 4M03A 3OJDA 4P3CH 1KCUL 3QIWB 4MB1A 3BP5A 4JREC 1QUNB 4M48L 5FW6A 2WKOF 4RGOL 1F4YH 5CLXA 1EZVY 3A6CL 4MA3A 2B5IC 5GRWA 5D7LD 1S7WA 3QDME 4XMKH 1NOLA 2FR4B 4Y5VA 1NGWA 4LP8A 3ARYA 2CGYA 1IAOA 4MGXA 3T1FB 4S10A 5DD0L 2J5WA 1DJXA 4LHUA 1MPAL 2CLZB 3B9KC 2VQTA 4H8WC 4TUKH 1Q94A 1G4RA 5E6RB 3TO4A 1MW2A 3QS3A 4G7VL 1WHPA 3G08A 1QSZA 2JI2A 2YUZA 4P2OD 2P47B 4UQDA 2YIHA 1TR7A 3BPCB 4N26A 2EDBA 3MXWL 5HTSA 4G3YH 1EUUA 3QEUA 4HCRA 4MXWH 3ZT7A 3CX2A 4QJ3B 3L6FB 3ZQ9A 2VABA 4LLDB 4YHLH 5JXED 1UENA 4X7TB 2X41A 4FFZH 1JOIA 2Q3ZA 5CUSH 5KBPA 3MODL 2YD8A 3KG5A 7PCYA 4FFTA 3K8KA 4UNUA 3MBED 2ICEB 5KUMA 5EHFA 1SUJA 1GC1H 2A73B 1PLCA 3WTTA 2I27N 5E9DD 3OZKA 1CGWA 4PJFB 4ZUVA 1DJGA 3FFCA 2WO4A 1NSNH 3GINA 3QZWA 2DQMA 2OXGA 3D05A 3VRIA 2MTAA 4O51B 2DLFL 4I88A 4XMPL 4P5MA 3IRPX 1V3LA 4P5TC 1P1VA 4KDTC 3CSTA 3RPKA 5E99H 4U1HB 4EBQL 4XWOD 5LGKA 5C0AB 4RZKA 3L3IB 2ICWA 2R59A 4KKBC 1JWSA 2IQAB 3LKPA 3OC5A 1YSOA 5IQ9A 4OD2B 2WNKA 1MFVA 1MF2H 3TM6A 1FHGA 4XBEL 4GW1B 5DMJB 2Y2WA 1GGBH 2X0UA 4LZKA 1Z0MA 4A6YB 2WBJD 3EDEA 3PP3K 3EOTL 4GOSA 4Q9BA 5K59E 3F85A 2RA1A 1J7VR 4ZMPA 4TQIA 1PG7W 1CDUA 4LSPH 1DSFL 2AANA 3RY6C 3TONA 5JIQA 3G6JF 2JJTA 2OMXB 3FB7B 3SDCA 1VEPA 3HCVA 3TNMA 3VXUB 3GSUA 1NAML 4HJTA 2V2WB 5AENA 2HKHL 4XB8A 4F3FA 4GUQA 2ZUXA 4LP4A 3N42F 3DK0A 4APQB 4D9LL 1KB5B 5DC0A 2KPWA 2ZUVA 1L9TA 4LQFL 3ZIMA 2Z31B 3RL1B 4KVNH 4ZNCD 4XXDA 5HPOA 2A9NL 1FHNA 3N50A 5J6GB 2NY0C 1XR9A 2QLVB 4PJ8A 3QGVA 1YEJH 5KOVC 2DBLL 2BSTB 2R1XB 3V0IA 1UXMA 4LPVA 4PV1C 4U7SA 5E1HB 1A21A 1JGDA 2EDXA 5E5UB 5LBSA 3SE8L 3T6XA 3STLB 4P2RB 2VDMB 4OCNC 3QIUD 1TLMA 4L4JA 1BZEA 1H15B 1NBZA 1CFMA 4ZO7A 1E5ZA 1G94A 4HKBA 5E9NA 5L2JA 3O2DH 6FABH 1AXSA 2NY2D 1WFNA 1GS7A 1KGXA 3CHRA 1OP3K 4N2NA 3ABZA 3PWPE 2NR6C 4G80B 1K8DB 3MR9A 4H88H 2X3AA 1CZ8H 4BXSV 4HUXA 2OTWA 1MIEL 3FKUS 3DRQB 4EDXB 1MAJA 3PJSA 4JRYB 2CALA 1ACYH 5EEZA 4HMCA 4PRAA 1MI5B 4EI5B 1F4XH 2XXFA 3CPLB 1OT4A 4PJIE 2O93L 5ESVB 2OK0H 1FCCA 3MV9E 3WHE1 4L0YA 2FX9L 2BINA 3V52H 2OL3B 2NNCA 4FFYA 2BSDA 4HIIA 1UXWA 2APTA 4AM0A 4J6IA 1UM6L 2EE6A 3NSJA 4G6AD 3VXOB 2OR9L 1YDPB 3E3QC 4BK4A 1X5JA 1EJFA 1DVSA 3UMNA 1EEUA 4WEBH 3WUZA 4DN3L 2PYEB 5SWQA 5H2BA 2ZQKA 4XOAA 5AVTB 1U8JB 1QQDA 4YXKL 2XN9E 2QFRA 2Z64C 4BWUA 5EIIA 4P04A 1RHHA 2DWSA 2CNYA 4G43A 4XNMB 4G8GB 5B38A 1PQZA 5F88A 4RDQF 3LMJL 2P5WD 1SDAB 4KZCA 3OQRA 3G6DL 3MRCA 2X3CA 4ATTA 3W9DB 4XE5B 4OV5A 2WQ8A 4U31A 4LSTH 3RILA 3DUSB 3ZR6A 5BXFA 2PF6A 1MW1A 5KW9L 3M88A 5I30H 3BKYH 3ULVE 5AW4B 4PV9B 3IDJB 2QQNH 3EH2A 3OV6A 1S7RA 4J3SA 4ETQA 4X5PA 3QR1A 2PCYA 3GFUA 5F9AC 4IRZL 3ULUH 3VB9A 4LMQE 4JKKA 2AV1B 1Z66A 5SV4A 4RCAA 5T1DH 1EO5A 4AMKL 4LHJB 5TDPA 3SDAD 1SVBA 1N0XH 2EYRB 3PNRB 3IFNH 1P4BL 1G7PA 1ZHKB 2IH9A 1NKOA 5G4NA 1IKNA 1Y0LA 5B1CA 2ZTBA 1K4CA 4MJ2A 5HYSB 1T2JA 4PRHA 5LBGA 1QPPA 5B3NA 2X9ZA 2Q8BH 2WQVA 2XTSA 2Y6SD 3IBOA 2CUMA 4BK5A 1KGYE 1PKOA 4F8LA 1TZAA 3SQBA 3S4SB 1EFXA 3OPUA 2VR8A 1TU2B 2Z4QA 4OZFG 1LO0L 3VTAA 3RKDD 3S88H 3VSUA 2GQHA 4FERA 2YD6A 4J4PD 1U4EA 3DJSA 1SRDA 2FB4H 3C5JA 3GNML 5IIEB 1ZS2A 1K5NA 2YBRB 5JA8B 1J8SA 4WFGE 3GMOA 4Z5RB 4JDEA 1INDH 2QVIA 1UD4A 5DD6B 1ASOA 4TTDC 2XTJE 2YN5A 3R4RA 5I8CB 2EIJB 1OT2A 5T3ZD 4JS7A 2CXGA 4I0PC 3NA4A 1HHGB 4AQ8C 1HWWA 1I7ZB 5ETUA 1G6RH 3MV8A 1S6NA 3EO0A 5DK3A 3B7TA 3IGUA 3P3YA 5BRPA 4DP6X 1ODAA 1KB9J 1NIFA 1OF2A 4K9EC 1KTLB 5D93C 1Q9KA 1WBZA 3BMVA 4PHXA 4XVJL 2ZG3A 2HLAB 3HBQA 3MHZA 4OF0A 4XO3A 3NIFE 2A2QT 1UCBH 2VXTH 5T1MB 1DZBA 1N3NB 2CNZA 3MOAH 2P7TA 2R1YA 3GSVA 4I2XA 1W80A 4PV8A 4NWTL 1CIDA 4QRSA 1ZLUH 3V0EA 4PJHA 1ADQH 2FX7L 3BMWA 3K8LA 2VN7A 1O7DC 1U3HC 4X80H 1KENL 3UZVB 4JPWH 1FZKB 4FG0A 4HV8A 1EZVX 5HI5C 1TJGH 5F89B 5T3ZL 5BV7H 3GXIA 3F7YA 1CD1A 3B9EA 4PREA 4UDTA 2EIKB 3N40F 2EDKA 4MA7L 2QZ5A 5C0BE 1ZS8B 3C75A 3BKML 1T3FB 1CG9A 1BEYH 2ZICA 4MLIA 3FO2A 4YFLI 4WRLA 4X99B 5DJYB 3HZ3A 5EZLA 3MCKB 4YAQA 3QQ4A 2IAMB 5CXPA 4HJEA 4V1DA 4RDBA 2Z0UA 2OMZA 3GTTA 2AQRA 1OOWA 1YEIH 3RIKA 2YKLL 3T8VA 3AG4B 1JVOA 1IGIH 1NEZB 4Q9QL 2J1ZA 3VXNB 2Y0SA 4K71C 3VXUD 2IH8A 5CEYA 3NACH 4ABQA 3NP3A 4XNUH 5FDWB 4F7TA 3FO9A 4FNTA 4BHUA 3VQMA 4WJKB 4K2UH 1LQSR 4N0CD 2BRRL 3UO1L 5D1XE 2H8PB 3HAEG 15C8L 3RPIA 2XI9A 3RX5A 4C4KT 5TF1H 4HPYL 2Z31D 3VH8B 3ZDXE 3KCPB 4OGXL 4Z7QE 3FRUA 2V8MA 4X9IA 3SY0A 1NTDA 4KNTA 5AYTA 5DYOB 1MFCH 1NCBH 3KYOA 5DWPA 4Y19A 5L4IA 1PZ3A 2WWNA 5JOFB 1BFVL 4G42A 1ETJA 3LRSA 4YDVB 4F7MB 4ZOEA 1E28A 1ZGLA 1BFTA 3FO0H 2Q76B 3VFNA 2HXAA 2UX6A 1M2OA 1NMAH 1EFQA 1E5AA 5EULV 1UXSB 1DQQB 5DUPL 4PRPB 3VSVA 2CXKA 4GRLA 3O2WL 4ZO6A 2WV3A 4HCRH 3QZOA 4FYQA 1QWHA 1KB5L 4RSYA 5DHXB 1JK8B 1IC4H 3PAZA 5IHZB 5E51A 5AW3B 35C8L 2NNAA 2XN1A 1BBJA 4JRYD 4N9GA 1RZGB 4YPJA 5SWZA 3SSGA 2XX0A 3ZKXB 1MFEH 4NDMA 1A7BA 1DJZA 3MO1A 4K7PL 3D18A 5DK0B 4RRPG 1GGIH 4NM8H 3MRIB 3HRZA 5E4IA 3WUWA 3LS5L 4G9FD 2VDML 2FEEL 5GGUB 4UTAL 2LOEA 4UOJA 3P4NA 3L5WA 3MRKB 1SFHA 3GZOA 4LOEA 4PBWD 5K9KB 1CMOA 2PW1B 1Q1JH 4FHKA 5E8OB 3KPLB 3QWOA 4OIFA 4LAQH 2PYED 2PP9A 3GDBA 3MRPA 5IHUH 4MD5A 2ICES 3RBSA 4MAYB 3MNWB 3S3DB 5CINH 3D34A 1CL7L 2GSGA 3KLQA 4QOKE 5DJZA 5AOMA 1KBBA 2CR0A 4AL8H 1XSJA 4HU2A 4GY4A 3FN3A 4KK5D 2IF7A 4UV7H 4MNGA 5BRQA 4QXGL 4UIKL 5F9OH 5FHBL 1MUJB 3T3PB 4NPYB 1AHWC 1BA9A 4U3HA 4LOFA 1CB4A 2OBGA 5I1LB 2OQJB 3VGBA 4DKEH 1XSOA 5D7IB 1VCBC 4L4VE 2OL3L 1JXJA 1JCKA 2GK0A 3TT3H 2AAAA 3BGMA 3RI5K 1IKOP 2PCFA 4U2ZA 5E2WL 4B95C 1OXYA 2WW8A 2LT9A 4G6JL 2VB5A 1HQRA 1KCKA 3PU7A 4EOWH 3S7GA 3SD2A 4PSPA 3VNZA 4EKXA 5C0GB 5BOJA 1VDGA 2F58H 2FWOA 2YMTA 1HINH 5FO9B 2O26U 2FQEA 4I5BB 2WUBH 3VJ6B 4Q14A 1PZBA 3C2AL 1FDLL 3O2VL 5CFHA 2HCZX 2DYSB 4N8CL 4MQTB 3CH1B 3IMWA 4ZTOH 3BLBA 1VRSA 4Y2OB 5KYUB 4N2FA 2QV2A 1UWGH 4QAWA 1XL6A 3IDIB 3STZB 1MHPH 4DP0X 3FPXA 1O0VA 1HZHH 4Y5YB 1F8TH 4UNIA 3VWJC 5D7HA 5T33L 5H94B 5E2VL 5LBSH 2WP3T 4I4WB 1BJMA 3OHXB 3G5ZB 3SYPA 4CW1A 1JNLH 4ODVL 1FYTA 2E9BA 2RALA 3DOSB 3HG4A 1WBYB 4LPYA 4X9YA 5GRVK 5I1CH 2VSDA 3ZRSA 1BF5A 3L5IA 3QA3B 1KYOJ 1XCQA 4G11A 2CLRB 3F01A 3KLSA 5BS0A 2OR7A 2BCKA 4NT6A 4UTBL 3G6JE 2AXWA 1H3PL 1YUHB 2HJKB 2ENPA 3QUMA 1MZYA 2H32B 4HPOL 4C4BA 2Y5TB 1CN4A 4FCAA 3QI9A 2VDKB 4LGRB 3P77A 3V0VB 3DX7B 1A6ZA 1E9PA 3T8XA 4XPGL 3VXRB 2VDOB 2WIIB 2CCWA 4NCC1 5IB5B 4Q2ZB 1JVLA 1JPGA 4U05A 4E9XA 5EF1A 1I3GL 2R4RL 4P99A 4PJXB 1J1OL 4FFYH 1LLAA 1XGZA 3CMGA 3K4AA 4Z7WF 3NSXA 4NRXA 5JPMA 2RACA 2Z35A 3IDYC 3U0WL 5TDNA 4HJJL 2CGRL 3WGVB 4UMGA 4FMVA 3K91A 1Q9WB 3HNVH 3GZQA 5F3HB 4WHTA 3O4LA 5I6MA 3FUHA 2XQYK 3F7PC 5T5NF 4YHYC 4JEGB 1P9MA 2DQTL 2F5BL 4L3AA 4FA8A 3KS0H 4U0RB 3WO3B 3TYGH 1I7RA 4KZDL 4HOMA 3GIVB 2IAMD 5GRZA 3CZFA 5D1ZB 1KJMA 1CFSB 4FL4C 3KHQA 1I8UA 3B56A 3GBDA 1C16A 5AW5B 3RWDB 2GPZA 3AS3A 4XC1H 1MG2C 5DHDA 1Q0YL 3OM3B 2IG2H 2LAGB 1U95A 2ORBL 5BZWA 3U9UB 1F4WL 1CBVH 2GJ6A 1P5VA 3MV01 3CDGB 4CILA 4F9LC 5DR5H 5DTFB 1L9NA 3SE9L 5IBUG 4EIGB 4PSRA 5D2LB 3G5VB 3NCMA 5IUSA 2J73A 1XGPA 5IKCA 3P9MA 1ZLWK 5FM5M 1CE6B 3UPCA 5LNGA 5TJWK 3M8OL 4PJ5A 3IDXL 5KVFL 1JK9B 4OLVL 4OM1H 4RGNB 5D7JB 5HVHC 3QNZA 2NY6C 3EH1A 8PAZA 4TLKA 1C12A 2RR3A 4X83A 5IMKA 3C5ZA 4E9TA 3VXTA 4HFWB 4UMSA 4LRIA 3CFIC 1HHJA 1IX2A 3VFGL 3X12A 2PW2A 2G3XA 3TH2T 1I9IH 4LSDA 4P57A 1U8PA 4PRPD 3RVTD 1M7DA 1V5JA 4BE6A 5GZOC 2PR9A 3OZ9L 2ZOLB 1BZ8A 4NRYA 3NCFB 3MRLA 3R8BB 2GJJA 5B8CA 2AJYH 3TJEH 1N8ZA 1RK1B 1TVBA 3ECVA 4HBCL 1NBQA 4KXAA 4FHJA 5KVGL 4FQIL 3F83A 1PGRB 4AEHL 4NQCB 4TKWA 6TAAA 4XWGH 1ZT4A 5B1AB 5FOBB 1E27B 2W0KA 1TUPA 4Y16C 2H1PL 4G7QB 4ELKA 3L5HA 3QHFL 2KZ1B 4WF7A 1JL8A 3MRRB 2BH0A 5L88L 2GEQA 5E08L 4AQ1B 1ZVNA 5CCHE 5I0YA 1EVTC 4NKIH 5TE4L 3E1F1 2VYRE 4PAZA 2VJ8A 3HNTL 4JO5A 5I74B 4NCDA 4NQVB 4MCNA 2W0PA 4LSQH 1RPQA 2RD0A 4P5KB 5EBMA 3DMMB 1XO8A 2KHAA 1FL5A 3RZCD 2ED6A 1ZIBA 2PLTA 3MLRH 2VH5H 1GYVA 3NZHH 2WLLA 1KXTB 4EKJA 3ZTEA 4N2CA 3FF8A 3GB7B 1OCCB 3K4ZA 4NBYB 2X42A 4NN6B 3DNKA 1DBAH 3MLZL 3HLAA 5E5LA 4OR1A 1IC7L 1GZPB 4F57H 4GS7C 1IAII 1Q0XH 2WKLA 4QKXB 3VXMA 4GLRH 2E7DA 3WN5B 1CIUA 1NUFA 4JFYB 2AXFB 3T3MB 1JXFA 5AZEH 5LN4A 2MQ0A 4OLXL 1XSKA 5MI0B 1YLBB 4R3SA 3ZYZA 2QFPA 1BMGA 1Q0EA 1IL1A 3I2CL 3K0WA 4F7CB 4IS6A 1LM8V 3VTTA 1OCZB 2BNQA 5LQBL 2KDGA 3O0RH 2HUEA 3SBQA 3SZKC 3GQFA 3A6OA 5JA9A 4JDTH 4MMXB 2UYLA 1AD9A 5SWSB 3ZE1B 3JWOH 3NCBB 4QKTA 1E2ZA 1WZLA 3QEHA 3MRBA 3JV6A 4LOUC 1BBDH 1TKWA 4QUOA 2A38A 3HC4L 3O9WC 3GLEA 5LXGH 4ACPA 3RNKA 1U58A 5FB8A 2MCMA 4JFEB 2X4OB 4B9IA 4R4NC 1BPLB 3IFPB 2A74A 3ZO9A 4F1ZA 2LFGA 2E7LC 3EG9A 3LXCA 4TXVB 5IQ7L 2QL1A 3AAZB 3ZRFC 4QRPB 1VGEH 3ZYOA 2OMYB 5B7MA 1EEZB 2OMVB 1QSEA 2VM3A 2UWEA 1OSPL 4EQ2A 4JM4H 4FC3E 5INDA 4CA4A 5JOEA 1TTFA 4HHGA 4JKWA 5I15L 4X9FA 3KPRA 2HJFA 3FAWA 2P8LA 1BZ7B 3LNIA 3VXRD 4O58H 3WNNA 3DK2A 2I5YL 4L3CB 4ONFL 4PY8I 1YAZA 4YHKH 4WZ9A 4QR7A 2VW6A 5F1NA 4KJPC 1ZVYA 4P3DB 4MZIA 2HVJB 1HIML 2BERA 3JTSA 2HFEB 4KTDH 4JREB 5L7XL 1O5PA 3AVEA 2GT9A 1MIMH 2WYIA 3QRFM 5AZUA 2OP4H 5HI4D 5JHDA 3LJ3A 4YE0A 1X4XA 3DIDA 3FFCE 4DPAX 2L7JA 4PJAA 1KGJA 4ZMYA 2Z7YA 2X9WA 5J4MA 1CLOL 3PL6D 3B9KB 1BVLB 4AYGA 4YHZH 4R26H 1AKJD 4U3XA 2E75C 1HSBA 2VDKL 3ATEA 2BIOA 2JI1A 1BMZA 5FC9A 5D1ZD 3TCXA 3QSKB 4MJJA 2VL5B 2YK1H 5E94B 3OR7B 4PFEA 3R7QA 4GMTH 2BFVH 5I5RA 3VXQA 5CILL 4KROC 3OKKB 4W9IC 2MPAH 2X4SA 4JLRB 3EO1A 1HL8A 2XPYA 1AH1A 3OMNB 4OCRL 4U1NA 4A37A 4H44C 1GAFL 5KJRH 2R69L 5KTEH 2A83A 1HWGB 4GAGH 2CMRH 4QHNB 1L7IH 3DSFL 2X3BA 5D7JD 4RGND 1GTFA 2FATH 3FTZA 3GBLA 2F68X 5T1KA 2FJSA 1QWNA 4JZJA 5CHNB 2EE2A 3DKHA 3ZE2B 1D7DA 2AJZB 2FK9A 1IVTA 1FVCA 3R19A 3TT1L 3P4MB 4MX7A 5H4ZA 1ZEAL 3L4WA 1NH6A 3CZKA 1NGYB 4P5TB 2JKSA 1FP5A 2JKLA 2Y4SA 1A3QA 5HDQL 4FNQA 1M9SA 1HHKA 4DW2H 5ACLA 3CLWA 1ZPUA 3KGRA 3OJVC 4YDIH 3KLDA 3BH9A 4K8RD 4ODUA 4OV6F 3UYRL 3UJTH 1UUSA 1MVUB 3DOIA 3PCYA 1I9JL 1I8KA 2C4XA 3LTVA 3WEOA 2ODIA 2OAAA 3MOBL 3NQKA 3TN0A 5FIEA 2NT1A 4IOIB 5A2FA 3WNLA 2P3YA 2HFTA 4FI7A 1RJZA 2AQ1A 1CLYH 5FO2A 4P46B 3RWGB 2DQHH 2GBTA 2IGFL 1KJVA 1JZFA 1ZWIB 3RUGA 1KZYA 4NQCD 5GS0H 3QUMH 5F7DB 2J21A 1QUPA 4DO4A 3IJEB 1RCYA 3GSQB 3BAJA 3PV6B 3C8KB 3D0VB 4JFFA 5BNXD 4KTGA 5IUCA 1H19A 4YIQB 4ZAKC 4N2AA 1IGTA 3Q5OA 2YRLA 4PWFA 5CMAB 5AZ2L 1KTBA 1YEWA 4WHCA 2XNAA 4GPVA 1V7NH 2KLSA 4K8RL 3L3HA 4K23L 5JMRA 1LMIA 2VC2H 2JB5L 3MPCA 2MEJB 3UGEA 3TLRA 1U2YA 1HT6A 3OQ3B 3WY4A 1PFOA 3G6AA 2AAVA 4P0DA 3X1GA 3ZK0A 1OAYL 1N5AA 2VR4A 2DRUA 4BUHA 4XVTL 3I6LD 3KPSA 4PJCA 1BW8A 5AW9B 1JHLH 4MCYB 4HBQA 5JPNA 2W88A 4W70A 1A1OB 1VAHA 1UWFA 2BSBA 1I8IB 2VXVH 3D8MA 1IZKA 4KV5E 4U1GC 2WK2A 3BXNA 3NCYP 4HAKA 4RFEB 1LEKA 2ZP8A 3DUHA 2QMJA 3PQYD 3QXDA 5ISZD 1GJUA 5DS2A 3I02A 2HN7B 4UM8B 5E4EB 4DFHA 5T3XH 3FQNA 1T04A 1A9BA 1RIVH 3J27A 5GGRB 5AW6B 1RUPH 1YECH 2VIRB 2F15A 4CADA 1FBIL 4KH2A 4LCUB 3LXUX 1SHXA 2EDLA 1KBGL 5I17A 3S37L 4BXVA 3QS2A 2CGZA 4KK9D 1N7MH 1YO4A 5E1IA 3UTTA 4Q58C 4PJBA 3I9IA 4ZUSA 5SWSD 1INEH 5SX5H 1IBDA 2PO6A 3FH5A 3WS6A 3TH4T 3X13B 1RIUL 4J3WA 4JKLA 2BIIA 3QRGL 4M5SA 3RDTC 2R8SL 5FGCB 5DUML 2WQAA 2D03L 4I9WE 2AW2A 1H3VA 2RHEA 3BIKB 1ID5I 3LQZA 1ZT1B 4G8FB 1RJCA 3FSWA 4JFED 1VKXA 4PRHE 1FZJB 3QG7L 5I8OH 4L4TA 1DJSA 4C56A 3V6ZB 4A7UA 3SDYH 4GP5B 4H1LB 3GI9L 1GHFL 4KJYA 1JPSH 1RUAL 4QRPD 2ESVA 4LPCA 1OTTC 5IQLA 5LBVA 4KK8D 4X8JB 4L29B 4HIHA 4FQHB 2YRPA 2YSSB 1OAKH 3MUHL 4IRSB 4X42A 4EDWH 2WAHA 1NQBA 4PUBL 1MRDH 3MGTB 5GJTL 3T9WA 1PYWB 3Q2WA 3FUIA 3ZQXA 4UQBA 5JLZB 4WSGA 1RJLB 3KBFA 3DXAA 1RVFL 2WGNB 1TTAA 4TVUA 4FEIA 4XCEB 4XPBH 3FT4A 3WY1A 1WF5A 1XMWA 1LE9A 3DDFA 5IB3A 4P2CG 3ZHNA 2NX5A 4M8RA 3SKNB 3U1PA 2GUYA 4I1RA 4JPKL 4AC4A 4JUTA 4NKDB 4WEEA 1D5ZA 3VYPA 5IB1B 1E90A 3MV8E 3VFWB 1ETZA 1XF3B 3B5GA 3BP4B 1FV1A 2OMWA 3AY4A 2EYTB 3IJYA 1JZDC 1HOCB 3BAWA 4PIBA 2YKKA 1JZGA 3BUYB 1Z2KA 1U4FA 2Y7SA 4JG9A 4HHAB 5K1VA 2C4FT 1TQCB 4Y9FA 2XWEA 4HS3A 2ZUWA 1EHKB 1AYRA 1OW0C 1P7KB 1JPTH 1WSST 3TIDA 1KY6A 3EJRA 4OZ4B 1JERA 4Y4KD 4HULB 4I2XE 3ASWA 4NLHA 5EB9A 4Q9RH 2G5BA 1CT8B 4PJHE 4LEEA 3EJTA 4FQLL 1UA7A 1NCAL 5IVXA 1KB3A 4NHCH 4P23A 3JUZA 4YUEH 3ORJA 1FIGH 4IBYA 4IOFD 5EWIL 1OTSD 1NFIA 1JNNH 2HYMA 3O6FA 3U0TA 1T0OA 4PW4A 3K6SB 4V1DE 3FQUA 1N2RA 3CXDL 4HKXB 5E5MB 5DHYA 2UWEF 3ATDA 3GKWL 3ZDYB 4ZW6A 1Y7VA 1BZ9B 3Q0HA 4WEMB 5DJ0B 5CF3A 5K39B 3VG0H 1X7QB 2E86A 3HZKB 2ATKB 2G4EA 4ERSH 4P5TD 2P45B 1S5IH 2OXHA 1U92B 1NWPA 1YEKH 3WLWD 3HC2A 2Y2YA 1PZ5B 3RGHA 1NBCA 4NZDA 3CC5B 3JWNE 5ELIA 5GS2D 4DP5X 3N43F 4RNRB 1U3HB 5E1GA 1GOHA 5AVVB 4HS6A 4Y19E 2C3VA 2UZXB 4FMKA 4YGAB 1A7RL 1MJ8H 1BZOA 2K0RA 4FXGC 3K2UL 2YC1A 3Q1SH 2VNCA 1FIEA 2OZ4L 1DQLH 4PJAF 4P46D 5B1KA 2DYRB 4B9FA 3GBNL 4HT1H 1KOAA 4M9PA 3FONB 1WCQA 3CFCL 1S9YB 3O45A 2HVKB 2V8LA 4XP4H 1URLA 3VMNA 4B27A 3PHQB 1X6LA 2WTRB 4NIKB 5CIPA 1FG2A 1OAZH 5FX3A 2EKJA 4GI9A 4DK5A 5IB2B 1NIBA 3T09A 2F19L 2VQ1B 3NDZE 4HLZG 1A8ZA 1JGVH 5TH2A 1QX1A 4FZEL 3DBXA 1JHTA 5SWZE 1KIUB 1A5FL 4L9LB 5F6IC 1DQKA 3UYPA 2W91A 1X4ZA 1OALA 4GW4B 3WTYA 3KWWB 4CC4A 4AEIL 5FA3A 5DJCA 4PWEA 3ULVC 4YFDB 5LKNA 2EUZA 4IBLT 1MFMA 1AGCA 1XGQB 3QORB 4YHPB 5IG7A 1I3VA 2MCAA 4LIQH 1MOEA 3OKYA 4M7KL 4UANA 2J57A 4M8QB 5E00B 3NCWA 1SGKA 3R4DA 1IEAA 1JGEA 1O9VA 1EO7A 4J5VA 3SKMA 2ZWZA 3MV11 3QDGB 1JWMA 3REVA 1KYAA 4UTCA 4MNGE 1NOAA 3VWKC 3F05A 2BW4A 4S2SA 4GKSA 4JY6A 3W2DH 5IFJB 1FN4B 5A6IA 1GS6X 4KUCF 1PCSA 1ZVSB 3U36A 4R97B 2PNDA 4N8VA 3VI4A 4Z8FL 4DF9A 2YGPA 3LZFL 3F7QA 5I1IL 3U1SH 1A3ZA 1D2OA 4Z7UA 1G1YA 1WEJL 3KH3A 1MCWW 4YGVB 2OJZL 1ITCA 4XRCA 5IMLA 2DQIH 1ZV9A 1BX2B 1CR9H 4X5QA 4FX5A 3P3UA 4MYPA 1OD7A 2A4EA 2NYKA 5FCUH 5D6CA 3SO3C 1FFNA 5K1NA 5AYUL 1MW3A 5CWSB 5E2TH 3HAEB 1YEEH 1ZDSA 3MTXA 1WC7B 2XTJC 4JDZA 3ASNB 3EFOA 2R56H 1AGEB 3D39A 4XOEA 4YDZA 3H6AA 2FEDC 2R1WA 1LGVA 1OY3B 5C7ZA 3VXSA 2WZ6A 4UQ3A 4L1DA 3BDBA 3GHPA 3TYFB 2IFGA 4IRSD 4FQXC 1UJ3C 2AV7A 3LRKA 1FLRH 1R3LA 4QLWA 2ZCHL 1FVDA 1OEZW 1MSPA 1A6VL 1IC0A 3WY2A 1OP9A 3C6LD 1FYTE 2FH6A 4PJCF 1QR1B 4CJ1A 2V5YA 1FZOB 5I1JH 4DQAA 5IR1A 3FOLA 1A25A 3OKMA 4EEEA 1KACB 5FUZL 4N6RB 3WFDL 1KPRB 1HWHB 3MJ7A 5BS0E 4JAMB 1DUZA 3ECQA 4ALAH 2HLFD 2X1PA 5DJXB 2EUXA 1BGXH 1OZTG 3V6FB 1MCPL 5KSUA 4QEGA 3QUZC 4K5LA 4OU3A 3HI5L 3HVNA 4A7TA 1ZV5A 4AYDC 5C07A 5TE6L 3IDGA 1M71B 1S9XA 3MA7A 1CXFA 4AYFB 4I3SL 3C87A 1CLZH 5C97A 3MV7A 3CXHK 1LO5B 4PJBF 3UTPD 1LL1A 3OX8B 4NKQB 3MLXL 1CD8A 1C1EH 4O2FB 5CEXA 1R5IB 4HZ1A 4XCYA 5D1XC 3LRLA 5CGYC 5EU6A 3ME0A 5LHDA 3O4LE 1WIOA 4DTGL 2H6PB 4XCFH 3TBVA 4GBXB 1HH6A 2YLHA 1S7UA 5J12C 4WK0B 3JYCA 1EZUA 1YQVL 2NCMA 4FAAB 5MP6L 3ABGA 4O2EA 2XVKA 3QG6A 4R4BA 3QPQD 4H5SB 2J71A 4YSSA 3RU8H 4G7YL 4M1DL 3UG3A 4KDWA 5EZOH 3RVXC 5I9QC 1CXLA 3FOMB 2VW7A 2ITCA 4E2OA 2WANA 2XCMC 3N1PC 4K5NA 8FABB 4QTIL 3IGAB 4N5ED 3PDDA 1OAQL 3C6SB 2GJ6E 1JTTA 2XWJA 3DX0A 5AW7B 5T3XE 3EAKA 3MJ6A 5BMFH 4PJ7B 3S0PA 3J7HA 5HJGA 2BNUA 4A2LA 2N1KA 1BVOA 1MLBB 2BZDA 3FQXB 2EDNA 5FR3A 4PJ5E 3IDYB 5CN3A 1HXYA 2A4ZA 2XJKA 3FCSA 2QDVA 1F3DH 3QNYA 1W72A 1OM9A 2R2BB 3WNOA 4AW4A 4U7KA 4JN1H 1S9KC 3V6OA 4ODXB 4HUWB 4AEFA 3CDYA 3GSWA 4N24A 3T4YA 5CJXA 2J8UA 1J8RA 4W6YB 3S5ZA 4BH8B 3BP6A 3NCEB 5ENWA 2XN0A 4JO1L 4CN4A 5H4YA 1QFUL 1OAXH 3CSYB 4PCKA 3ATBA 3APCA 3MLWL 4A2FA 3IJHA 1VEMA 5IM7B 1GC1C 2FZ3A 3VXPB 2DM7A 5BO1H 5MEPB 3L54A 5GRUL 1K4DB 3U0PA 2E9IA 2Y1VA 4Y9EA 2YQGA 3NH7L 4HXBH 3K2IA 4O4YL 3LB6C 1Y1UA 5C08D 3SGKA 1AHMA 3BI9X 2BVQB 4P4RA 1JMZA 2XZCH 4JY5H 1GKOA 5IVXF 3RWJA 2WM0A 4F5CA 1LO2L 3NT0A 1I4FB 4IGBC 1PZAA 2ILLA 2VL4A 5BOZG 5ICYB 3CU1A 1TTCA 5C0EB 4KITB 1ORQA 4JPIB 1QPKA 3JWDC 1XB8A 2AK1L 3DURA 5B7FA 1E2VA 3CFQA 4NQQA 1ANUA 3WIIH 1SDYA 1JZJA 5DWUH 4WY7L 1GIGL 4W68A 4OCYH 4N22A 4QJ5B 3QORD 4LF3A 3MC0A 1H3GA 1OO2A 2ZXEB 3AU1A 1HL9A 3QJQB 4QF1B 4ZPVB 2C26A 5AB0A 1D2PA 3MRNA 4OQTA 2VUYA 3DGGA 2DQGL 3P2BA 3QDGD 2E27H 1QSFB 2ZUQB 3OB0H 3ABMB 3HG1A 5DRNB 3QWNA 4XPFH 5F6HI 5FGRA 3HPLA 1KTDA 4PS3A 5EEWA 4U6HB 1FO0A 1S3KL 1D6VH 3AS1A 5M7QA 1TQVA 1ID2A 2RFXB 1RP8A 3QVAA 1UB5B 4JFXB 4JGMA 2VITA 4DGVH 2NXYC 2A6JB 3TV3L 1Z9NA 1X9QA 5LGHH 3U6XS 3DROA 3FRPG 3VXME 4DIXA 4Z3FA 4JO8A 1R5VB 5BW7C 1BM3L 1EDQA 3F00A 1IBGL 2GITB 4XTRC 5DRWA 3AXIA 2E9WA 5DFVC 5F7LB 5A16A 4ZUUB 4ZUTA 1GZQB 3DJZA 5AEAA 5F0PB 2RQEA 4IRJB 4JFOB 5GHWH 1P53A 3SPGA 4IQHA 4TSBH 3V55A 5BJTB 5EZJA 2JB6B 2BNQE 2ZP0T 1G7JB 4X6BA 4ZODA 1ZIAA 1NL0L 3WAJA 1XF2B 5F3BA 2A9MH 1E50A 1J8HA 4EXPX 1SY6L 4NYLA 3MNZA 3GJFA 4FP8H 4YSUA 2A6KB 1A6AB 1S7VB 3D3VD 4BSWA 3BESR 1SF5A 4AKOA 4RDQG 2X0WA 1T22A 2QKIB 1ZV2A 2NY3B 3OXSA 4C47A 4HUVA 1HI6B 1HZKA 4ZFZB 4YDLC 1QSVA 2C7UA 3GUFA 3T4AA 4JM2B 4NAJA 4L23A 1N0LB 5DEJA 3V5KB 5DD3L 1QSEE 1A14H 2UWEE 4H2CA 3DVGB 2FLBT 4BSVB 5F7EL 5I1KH 2IANB 3S8WA 2ODHA 2NTFB 2ARJA 3KPRE 2JJUA 1QASA 4PVMA 4LKCB 2VDPL 1UD8A 2NXZB 5C09B 3BE1H 3DPBB 3SQOH 1IU1A 3ZT6A 3AACA 1AMYA 4NM4L 5J13C 4KY2A 4A2GA 1KJ3L 3GIZL 5F7AA 1M7XA 4Y4FC 4Z7UF 4YS4A 5D96B 5T8IA 3VD2A 1EHNA 1RZ7H 2HSIA 1HHHA 3H3PH 3VD3A 2AABH 2F7PA 4W81A 4NGHL 3H7BA 1LWRA 5JHDE 3LZPA 1FPTL 2O61A 3F2LA 3VU1A 4PJAE 1OPGL 5FUCE 1X7TA 3BSGA 1IGFL 4GBXD 2O6PA 3CZSA 4LIQE 4MD0B 3OF6A 2OW6A 3UROR 3QFJA 5KN5B 2X12A 3WHXA 2IWFA 3TEYA 1AHKA 3FHAA 2H0EA 1AE6H 3L4TA 1RMFH 4GW5B 3SOBH 4QRQA 2FBJL 2B77A 1BXXA 1CVSC 2E4TA 3QQDB 4J3OF 3I6KB 3KJ6L 1P5UC 4Y7MA 5E8DL 1RK0B 4A7QA 3TPUA 5AOKA 2ERJC 3D0LA 4F8NA 3KVQA 3TVMC 2IH1A 3EGDB 1RULL 3IDNA 3ILQD 3EBIA 4F20A 2PPCA 2BOCA 4ODWA 1A7PH 4U1JA 4LCYB 1RUQH 3FN9A 3C08H 5DMKB 3GPEA 1QVOB 1MCFA 3JVGA 4L1HA 3T0BA 1PZSA 3G5XB 1R47A 5EEXA 2AJXH 2IDSA 3V0HA 1EO8L 3INUH 4L2LA 1CE1H 1MJUL 1UEYA 2VLKB 3HR5A 2BP0B 2XIBA 2ROXA 2GB2A 5I2IA 2E6PA 5ACZA 4HW6A 4BH7B 1DBKL 3QJRB 1ZANH 4JO4H 4UDUA 4BFIB 4J3OH 4JG1H 3C60C 3HS0C 1LWHA 4WSKA 4N86A 5C8JB 5AQ0A 1JRHL 2O6CA 2A0LD 2RMNA 3QJUB 4GO9A 3AT8A 1E7UA 4D0DA 1UURA 4FRWA 3QFDA 5DC9B 3KAAA 1AG0A 4NO3A 4JO3H 4XGZA 3UJIH 5IVOA 3ZYIA 4LHUG 1CFTA 3BHBB 1H0DA 4GXFA 3GSXB 3BQVA 1MHCB 4MQ7A 1YYMH 2D7TH 3RUGE 1HJBC 4AJ0A 2DB8A 3SBRA 2ZAHA 2BXYA 4M56A 3NN8B 3NCYS 4NNXA 1IEBB 4Y2DC 1EANA 4EN3B 3CSGA 4JFFE 3KW8A 1NCDL 1BD2A 3QIBC 5F97E 5BV7C 1VFUA 1EAOA 5IB4A 3GPSA 2P5PA 4PJEF 4DAGL 5EA0H 5C71A 4O5LL 1E40A 4YHIA 2VR3A 5EFIA 4U0QB 3SBWA 1QSFD 1NLBL 4TULH 1LE5A 4G5ZH 4HC1H 3DTXB 3WCYA 5GGQL 1SXSA 3MJ9L 1U6AL 4RLDA 4WTXA 4YZFF 4JHUA 4Z77A 3KPSE 4EVNA 1NMBH 3G5YA 3L5XH 4PJCE 2WCSA 1UCTA 4FQPA 3A0OA 3FO1A 4RIRA 4Y1AA 1T1YA 1JG9A 1H9DA 3DUUA 1Z9PA 3IU3B 3NJIA 2HT2C 2CO7B 4R5VA 4KKQA 1WDAA 4TLUA 5D71L 1PIFA 2JNZA 1QLEB 4K3EH 3IMVA 4Z3IA 4Y5VC 3PNWB 1WZMA 4ZAKB 3IXTA 1CJYA 1KDJA 3GMRB 1A6TA 2DIBA 4IRJD 3V5HB 4FQJL 4GQQA 3DX8B 1SYSB 5I5MA 4BE5A 1K3ZA 5KBLA 3WTXA 2Y7NA 3KCWA 4YHML 4HHWA 4JJHA 5HHXH 5F96H 3TO4C 4L37B 5DZJA 1A7NH 4OFYA 4JQIL 3HNSH 1UWEH 2NY4C 4PJBE 3UTTE 2MH4A 4AK2A 1T1ZA 9PCYA 5M95B 1O6SB 2QR0A 3K1KC 1F45A 4I3RH 4WV1B 1DN2A 1UZ6F 2BNRA 4M7LH 1GJIA 4TPRL 3E6FA 2NY3D 4L4TE 3CFDA 4P5SA 4C56E 2NLJA 2Q0ZX 1PVHA 4X6FA 3IE4A 2HG5B 3IKCB 2R2EA 4JM2D 5TPWL 4APXB 1UH4A 4E9RA 2ESVE 4OCWH 4RA3A 4WDIB 5D1QA 3S5LG 4CBZA 2P49B 3CVDA 1GVIA 1IGYB 2GUOB 4LARL 5C3TA 3SCMA 2IAND 4A66A 2APWA 1QW8A 5EO0B 2PTUA 1TZIB 1S8DA 2NXZD 5DHVA 4JZOA 1YN6B 4X0KB 1SXBA 2TRHA 1NOFA 4FZ8L 3BT0A 4F92B 3D69B 2JXMB 3H2QA 5DZAA 3DXAE 1X5XA 5LGJA 8CGTA 4XMZA 3OLDA 3MRJA 5CP7B 3CZJA 4P4KB 2Y7OA 3PV7A 4G1EB 2NX5E 1T5KA 3ES6B 1SN0A 3M7OA 4A7VA 4DQOH 3RFZC 3WU1A 2A77L 4HIEA 2EDFA 2HTKD 3ESVF 4XT1C 2B1HL 3NFPA 3TBSA 3LEYH 2R0WL 2WXOA 3BX7C 4OQTH 4WIQA 5TK4A 1VZIA 2W9EH 3U2SB 4WKZB 3WO4C 3P69A 3RG1C 2CO6A 2UZYA 3HI1B 1LO4H 1N6UA 2ADJA 3KWTA 5D5MA 2JJTC 3BWAA 3SDCC 2WAQA 2XVGA 4JW3A 1FO0H 2WVVB 1IBHA 4UM9B 2EXYD 3GHBH 3VFTA 5FO8A 5C3IA 3JBG7 1OWWA 2BVTA 2PPAA 4LSUL 5ESQB 1MRFL 4XBGB 3IDMB 5KSAB 1CDHA 3BKJH 5EIIG 1G7HA 4E41B 4XB3A 5IVXE 2DW5A 1BYPA 4NJ9L 4KTEL 2E5EA 1Z3GL 3FSOA 3BFOA 3AROA 3V4VA 1UT2A 1YJDH 2OSWA 4PJ8C 1IAKB 4XNYH 1UVQA 4DPBX 4ZJ9A 1A4JA 5DFWH 3LN9A 3VUAA 2JTDA 1ZTXH 4Q6IA 1XT5A 1YPZF 2ED8A 4JCMA 1ICTA 2XVLA 2EH8H 1T2QH 3LSOB 2CD0A 3FB5B 3JTTA 4OLYH 4PBVC 1FC2D 3GC3A 4HLJA 5DK2B 2VLKD 3TTYA 3BVNA 2ITEA 2A9BA 4GT7A 4HZLB 4TSAL 3D25A 4QXUL 4UOW1 3T1WA 4MDRA 5DEFB 3OKNA 4PP1C 3WSQH 3WFEL 2EEAA 1OQOA 1REIA 4BCZA 2K3HA 4KY1L 2EINB 3ZUNC 2IBGA 5I8KL 1DANU 3ARUA 1QHQA 5CLTA 4KX7A 3FT9A 2EZ0C 1AQDA 2C9SA 4AIEA 5HGDA 3TBYA 1UD5A 5T5NG 3OR6B 4IEFA 4LOVA 5JORB 3PWVB 1JI2A 4AYMC 4BIKA 2Y07H 2NY5H 2R0LL 2VXUH 2K4AA 2YZ8A 1JV2B 3KPPB 1IFRA 1B0RA 3QJVB 3WIFB 1KN4L 2DF3A 4FABH 1NEUA 2X88A 4KRNA 4MZRA 5IW6A 1I3RA 1M2VA 4JJOA 4PB0H 43CAB 5I1HL 3MZGB 3WJLA 2I32A 4ZMAT 2XPGA 5EOCJ 4EN3D 3EJYD 4QYOA 4U1IA 4D0CA 5MENA 2C9QA 4KO9A 1EPFA 4GKZA 1ZHBA 2R23A 2QGCA 2V37A 1NAKL 1N26A 3C09C 3SODB 1N59B 5B4MC 2EO7A 5ID0A 1XSIA 1JXKA 3VU2A 5EU7E 1IAIM 4YL9A 1RURL 5ICXB 3PHOB 4DOHE 1ZLUK 4KC3B 1IFGA 1KIPA 1UJTA 4C83A 3O6ML 3C9NB 2V9UA 4FXGB 1F3RB 3CJJA 4TNGA 4AYBA 1BECA 5FFOA 2LAAA 1U41A 4NQSA 3NPSB 4BZ1H 3FCTA 4HJ0C 3TBTA 2E3VA 3W11C 2Y24A 4J1UA 2NSXA 3BZEA 4Y2LA 1G84A 1GYUA 2XKNA 4DKTA 5H8DA 1YNLL 2BSSB 4RMSA 1IKNC 3ZE0E 2VN3A 5D72L 3GHEH 4N87A 2BZCA 2CDGB 5BVPH 5KSBF 5IT2H 5FO7A 3UZEA 1Z5LB 1GGCL 3UAAA 4GKNB 3GLDA 2ZX5A 4B9YA 3L7FA 3VI4E 4BK5C 2G9HB 2YEZB 2X2IA 2CBOA 3BAIA 4Z7UE 4YK4B 5T1LA 2XPZA 4AUUA 3MRHA 2KZBA 1PD0A 1FQ9C 3DHJA 1JN6A 2XFGB 5C0IB 2AXGB 4QYAA 2VDNB 2DAVA 3X14A 1N4XL 2FSEB 4DKFL 2A9DA 3D2UA 1FGNH 5EG6C 2JQAA 1T5XB 2B1AH 4EIZC 1E6JL 5IK3B 4KGJA 4G8IB 3SDXA 5GRYA 2QQKH 3BAKA 1T0NB 2XIDA 3LKOA 2I60L 3CN4A 3D39E 6PCYA 3FTWA 1QLEL 3LPWA 1T21B 2K3TA 3GMNA 1CU4H 3OWEA 5EU4A 3UJJH 3HUJF 2X2YA 3VXSE 4JHBA 3QRBA 1HDMB 2UV3A 5AVUB 1VGKB 5I1GL 3S8GB 1KPUB 3FBQA 3BSHA 4P9HL 2P5EA 1KGWA 4BRVA 2O5XL 1FFOA 1CBJA 4YZWA 4IMKA 3KMDA 5ITBL 5F0MB 4GQRA 2V9RA 2NPLX 5IJDC 1KIQA 2CIKB 4NPKA 1OGAB 5HGHB 1YNTF 3Q5TA 3L3OB 4NJAL 5GS1A 4DGWC 4DESA 1WCBB 4P4KD 5CZXD 4BFOA 3NABH 3PG2A 3PP3H 4R5XA 3UP1A 3BIAX 3UBXB 1HEZB 3G9AB 1A1MB 4I18B 3RLSA 5I0DA 3O8XD 4C59B 2VLRA 5DA4A 3ZQWA 4BYHA 4NUGH 2B2XL 4LRNL 4OTXL 3VFPB 2V9TA 7FABH 3V9CA 1ESOA 5C07E 5FYLD 4AIXA 1E5YA 4PLKD 3EH5B 4EPSA 3NTCH 1YMMB 3R06A 3PXLA 4G1MA 4PRIA 5HY9B 3Q2LA 3WUWG 4IHOB 1THAA 5TGBA 4U6VL 3MV7E 3H85A 2AC0A 4K3JL 2VCOA 1YEHL 3GM0A 1UJ3B 4OCSL 2CKBB 3ZGHA 3LXBA 4UM9D 5KBDA 3HA0A 5K9QG 4JB9H 5KSAD 2LLGA 5EU6E 4E41D 2XHNA 5C7XH 1IUZA 3P9LA 2B39A 2RGSA 4QT5B 4TL4A 5I1EL 2Q9OA 1AR1C 4GXVL 4E0RA 1RUKH 4H8QA 3IF1B 2FX8L 3ECUA 3JWNC 1RPUA 3QXAB 1DVUA 5M94B 3JWOC 5E6IB 3CFMA 2BY0A 2X6BA 2I9TB 1A0QH 4PY8J 4GI6A 5ESAA 3CLFH 3QR2A 3QUZB 5JYLA 4NUJA 2VE6B 3H8NA 4OUUA 5FYLL 2B20A 1JFQH 5C0BB 1A64A 4K94H 2VQ4A 4M61A 1OP3H 4X4YA 5FWRA 4DEUA 3D4YA 1U8KA 2H2PD 2JF1A 2XG5B 4MDIA 4ZX5A 1FFTB 1FSKB 1UGNA 2WN3A 3SE6A 4M43H 3V4PB 4ANWA 5I76B 5JIKA 2MIZA 4ZT1A 1ETA1 1AZVA 2RJMA 3GSNA 4GRLC 1XX9C 4LESA 5DUBB 4L8SA 1N64H 3DYMA 4HLEA 1FFPA 1JYXA 5IMMA 4OZHA 12E8L 2W5PA 2XV0A 2DICA 2YWYA 4YZFE 2AEPH 1J1XL 1T83A 3QULB 3V9FA 5HHMB 1WAAA 3V6OE 3NAAH 4JFTA 3BN9C 4LSSL 2W9DL 3D85B 5J12B 5JQ6L 2J8UE 3MRDA 4X8XA 3MYJA 4RZCA 5A7BA 4M6OH 2CDEA 4HPHA 3HRZC 5FYJH 4XHJD 4HAFA 3TNNB 4KRPB 5IQOA 4N1CA 2DQEH 2YMXL 4Y9GA 1MFDH 5I9QB 4H8PA 1F6FB 2G4GA 2ZD0A 3WKML 5D5MF 4HH9A 4DZ8B 2G60L 2BXZA 5CN2A 5DHVH 3AWEA 4OF7A 4TNWF 1DLFL 4AE1A 1WBXA 1M05B 1OLLA 1XCTA 4ORZC 4FI8A 3A5VA 3WD5L 3RWEB 1NC2A 3O41A 5IQNA 2OTUA 4W9KC 4TVPH 2NSQA 3DWTA 2F5AH 1MEXL 4HJSA 4F5CE 4XCNA 1TO5A 2F9BT 1WGVA 3L3DA 4M3KB 1RZIB 4JHWL 5J9PA 1HEJC 5KYWB 2ZG2A 4ZMWA 3PHAA 5DVKA 1AY1H 3PWJA 3GJEA 2CJSA 4MDJA 3MLUL 4UU9B 3IK2A 1HNGA 3NPZB 3QEGL 2Z93B 4TOYH 1UZ6E 4CMHB 2WXRA 4URTB 2DDQH 3VCLA 3WFBH 3MA9L 1S7XB 3H0TA 4JVUA 2DWXA 2D3VA 4LVHB 1OHQA 4OM0H 3IPBA 4NHUB 2ZXWB 5DRXB 1DQVA 4HD5A 1PZ2A 4J12A 2V0AA 1I7UB 2AI0L 2JK5B 4N25A 4WFFE 5FF6B 4FULA 3GK8L 4XX1E 5D7LA 1SBSH 3HG1E 4YDMA 4X5XB 1K6QL 1TLKA 4GSDL 4OZGA 1F11B 3N40P 4CU6A 1W6WA 5F70A 1HKLL 5CSGA 2OMTB 4N0FA 2VLJD 3PF2A 4ISVA 3V4VH 1KUMA 5EN2A 1QBLH 4E9VA 4IGBB 4P2OA 3MFFA 3QYCA 2WLZA 3U2JA 4BWWA 3EGSA 4XNQA 2JQZA 2I9LA 5EBWB 4XBPA 3KLAA 1QTSA 1X5LA 5JXEA 2UY6A 3DI3B 1ZTXE 4JM0A 4FCHA 3A6BL