2XCMC

Complex of hsp90 n-terminal, sgt1 cs and rar1 chord2 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
AKYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLEHGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Assembly of Hsp90-Sgt1-Chord Protein Complexes: Implications for Chaperoning of Nlr Innate Immunity Receptors
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Chaperone/protein binding
molecule keywords CYTOSOLIC HEAT SHOCK PROTEIN 90
total genus 14
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xcmC00
4RZKA 3QORD 2XCMC 2BOLA 4M5TA 2K8QA 3Q9QA 4YLBA 5LUMA 3AACA 3VQLA 1WGVA 1WH0A 4YE0A 3AABA 3VQMA 2N0KA 1RL1A 2KLRA 1WFIA 1X5MA 3GUFA 3GT6A 2Y1YA 5DS2A 3L1EA 4JUSA 2RH0A 4MJHA 2MNWA 3GLAA 3Q9PA 2CG9X 3N3EA 3QORC 5DS1A 3W1ZA 3L1FA 4I88A 4YL9A 1EJFA 2JKIS 4JUTA 4PCKA 3EUDA 1SHSA 4ELDA 4ZJ9A 2N3JA 2O30A 2WJ5A 2Y22A 3QORB 3J07A 4YDZA 3L1GA 4PBDA 2CR0A 1GMEA 3QORA 2WJ7A 4FEIA 4YLCA 3IGFA 4M5SA 2KMWA 2Y1ZA
chains in the Genus database with same CATH superfamily
2GTQA 3MTRA 4M1GH 5IHWA 2X38A 3S37L 1A6UH 1GJWA 2ARJB 4RFNC 1HYSD 4M56A 5HY9B 2CK0H 3H3BC 1QG3A 1FZKB 5AOZA 1XFPA 1I8IB 1NBVL 3CPUA 3KXFE 4WO4C 2OZ4A 1FG2B 1N0LB 1NBYA 1IBGH 3STZA 2NW3B 5BO1H 1E0OB 1LQSR 3GHEL 5IFAH 4PTTA 3D4YA 1E2WA 2UZIH 4JM2D 3X14A 2I85A 1KIRA 3TWCH 3SKMA 3BJLA 1HHKA 2YD6A 3RDTA 4HUUA 5GRUL 2QPDB 2H9GB 2BVTA 2DD8H 5EU5A 4O02A 4KKLC 1CFQA 2YC1B 2BOLA 3BHBA 3F8UB 3K91A 4MXWL 4WJG3 1P5UA 3C6EA 3K6IA 1UWGH 2VJ0A 5T5FA 2GI0A 4KI1A 1NFDF 2OMYA 4OZHE 1BLNB 3DJSA 2QTVA 3MV9A 4Y2DB 3V6FA 1IM3D 4MZ3A 4H0LC 1G0XA 2FO4A 3BLPX 3PJLA 3QDGD 4JLRB 3WUWG 4N85A 3HG1E 3LHPH 1NGWB 3WS3B 3DETC 3INUH 4QY8A 4UTAA 3O4LE 1GGBH 25C8L 4FXKC 3VDAA 5MP6H 5C0GB 2XXFA 4NT6B 4MCZA 5KVFL 3V4VB 1ZOXA 1BZDA 4U1MA 4J6RL 2ZWNA 3RY6A 5CIPB 2NY2B 3EO9L 3T3ME 1PY9A 2ROYA 3AXIA 4POZD 1NFIA 1OANA 2R29L 1UXMA 4R90H 4K7PH 2COVD 1E5UI 3ARFD 1MG2C 4OIIH 1HNYA 1B90A 3B9KB 3L48A 2E75C 3WFBL 4BXVA 1E9PB 4X9FA 4BDVA 3OKMA 1JGUL 3X1GA 4L3ED 1ZEAL 1K5NA 2UX6A 3P30H 2GKIA 3IFNL 3LV3A 4NNXA 4L3AA 4R0LB 4X4ZA 4ZO7A 5BO0D 1MWAB 3EHBD 4QLWA 1N10A 4FL4B 2YAFA 1KFGA 4YOKA 2AXGA 3HVNA 4UV4H 3UGEA 1N5YH 3VFPA 3QZPA 1KCRL 2BFGA 4J7RA 1YEEH 2H6PA 4CKVX 3L08A 1FIGH 3SBRA 4K94L 1U8MA 2FB4H 5HGBA 2HPOA 1ECYA 4JE0A 4YGVB 3KPLA 2PXYB 4QCIB 4ZT1A 5HHOA 3T4YA 3NACH 1JD7A 4AENA 2Z92B 5D96B 2JKSA 3MPCA 1A9BB 5ABZA 3ZE2E 4I1PA 5E9AA 1A47A 4ODXA 1N0XL 2F5BH 1ZDSA 1MJUL 3VG9B 4CSTA 1N6QL 4L0YA 2A2QT 2WKGA 3MOBH 3CN4A 5DU7A 1AS8A 3OJDB 2VERN 4AG4H 1HH6A 3KDMB 4OQTH 4IBVA 4L8DA 1YZZA 3AQDA 5BMFL 3GK8L 1EVUA 2DWDB 4BZ2H 2QKSA 4R2GB 2YS4A 4H1LG 1KT2B 3QDME 1MI5E 4E9XA 1YN6A 4FQXD 1CYXA 5EULV 2CK0L 4IEFA 2EIZB 1TCMA 5BRZA 3ZRCC 2NXYC 3SPCA 1NL0H 3SQOL 5IVXA 4QXVA 5HYQA 2WXMA 4F7PA 2F0CA 1VZIA 3KYMB 4KXCA 2ID5A 2P49B 3FUHA 2CBPA 3PWJA 2Q8BL 3G04B 3G08A 1IC0A 3QT2A 3U46A 1QO3A 3RWHA 1NMBL 1S2EA 4H8WH 3P0YH 3Q2CA 4R3SA 5IVXF 2QVKA 2IGFL 3TP4A 2XA8H 3BH9A 3SPGA 5JZ7D 5DK0A 1NCTA 3G6JE 4PJCF 1HOEA 3DJZA 4AJ0A 2GTWA 3FOMB 1IRAY 2Q9OA 1EXUA 2W0KA 2N7AA 2XV2A 1DQTA 1AKJB 4WV1A 2WIIB 4G83A 1YEGH 4Y4KA 5DQDH 4X8GA 1H5BC 5HVGB 3TU6A 5AEAA 3TPKA 1RHHB 3GRGA 5EFIA 2C7UB 2R23A 3FFCD 5FOJA 5FW6A 4B9ZA 5TE7L 4ZMVA 1E9OB 4L5FH 4FMFA 5C0AD 4J6IA 5CJQH 2YEZB 3QORC 4BKLA 2PPEA 2ZSVB 3MBEC 1R3IH 1S46A 2CCWA 4QLRA 3WXWL 3WNPA 2QFPA 3POCA 2DIBA 3RIAK 4ZSOB 1K2DA 2PTVA 2UYLB 4DN3H 2MMXA 4F7TA 1UOKA 3VFRA 1TVHA 3LJ3A 2A1WH 3EJTA 4MNGB 1K6QL 1T5WA 3FU7A 4XBPB 1KGYE 3U1SH 1J5CA 2NX5E 1X5GA 3VXNA 5HHVH 4ZO6A 5EMYA 8FABB 3TBSA 1ZT7A 2OSLB 2GT9A 1PG7X 1CGVA 1X7SA 4Y1AB 4FULA 2WKOF 2ESVA 2OMXB 4X6DE 3MLSL 4NGHL 2X9YA 3QJTB 3VGEA 2APFA 2AJSH 3U1PA 4JRYD 4NCDA 1YY8A 1IO4C 2HH0L 1JWMB 1RMFH 1EWHA 3PP3K 4G8EB 3TBTB 1AZZC 5DVKA 3GMOB 4XOCA 3IBEA 4DO4A 5K5YA 4ZFOA 5HBBA 3ZE0E 6PAZA 3IPFA 5FHAL 1M05B 4NAMA 1KJMB 5DK3A 1D5BB 4X5XA 2IANE 3TA3D 5J1AB 1OAYL 1OAUL 1IAOB 2JB5H 1QASA 3P1VA 2C1OA 4MTMA 4C8XA 3VGHA 2VRAA 3S8WA 3TF7C 3DTUB 4GIPD 3PREA 4JDVB 3L5HA 4EI5B 5C8JA 2X5PA 3F84A 3QJRB 3FB7B 4OLUH 4R26L 5BZZA 1U8NA 3I02A 3BPCA 1CB4A 4RRPG 3QIBC 4N0FA 1F6LL 5CCKL 4CAGA 1HXMA 3Q8FA 2NY0C 5JW4N 1CL7H 1BIIA 3TCLA 1OT4A 4CN4A 2H0EA 3O45A 4G1EB 3ZKQD 3P9MA 4JPWH 1FH5H 2PNDA 5CEXA 1IIKA 3Q9PA 2Q86A 5DZVA 4PVBA 3N9GH 4I88A 2P5WD 1JZ2A 3QXDB 1HCZA 1N8ZB 4JAMB 4ZNCD 3DVNA 3O3DB 1SOKA 4C56A 4AYFA 1Z9NA 2DYPA 3HOGA 4P99A 4WUUE 3V5DB 5JNYA 5BOZG 2L7UA 1MCBA 1B4JH 1S7VB 4G6KL 3FFCB 4ZS7H 4BUQA 2LU3A 4H44C 2AJ3A 2C9RA 1A1NA 3VM7A 4YXKL 1X5HA 5EU7C 4IRZL 4JQVC 3QJHB 5E1IA 3WTUA 4BH8A 3CMGA 2DF3A 2VQ1A 5E99H 4Y5XC 2QKIB 3WKML 1H3WM 4D0DB 3OHMB 4J3OG 2YGVA 4JKPH 5J3HC 3MRNB 2ZX9A 3U2JA 3VXOB 4P2CG 1KJ2H 5MHSE 1P6WA 1A6VH 1NLBH 3U9PL 3OKDA 4GKSA 3AT0A 1LMIA 4QRPE 2DMCA 3A67L 3U2SB 1F00I 1I8AA 4PJ7F 2XWDA 2WBJD 1EHAA 2YAPA 1OSZA 2NY0D 5LBSH 4HKJA 2E9BA 3KDPB 4JFYA 4LPWA 3TO2A 4NQEA 4Y5YA 3V52H 4NUQA 2BINA 5F21B 1RIUL 3ARVA 3I50L 2ZKWA 3ZR6A 2YQGA 3KMDA 3FHAA 3K6SB 1VKXB 5ICXA 1QHPA 5BRZE 5DGRA 2XN1A 2DTML 4Z18A 5IVXE 4TF4A 1O5DT 1MUJB 4FQ2H 3FBQA 2IPKA 5IBUB 5JR1L 4FJ6A 1OCRB 4LDCA 1YQVL 1MAJA 4I7ZC 2IAMB 1IGIL 5CEYB 3V4PA 5IBUG 1PKOA 3CSYB 1I3UA 1HK6A 2LLNA 2EYRA 4FHKA 2ITCB 2G0KA 2PWGA 4OT1H 3OKDB 1KPUB 1DQLH 1T03H 1SY6A 1ID2A 3G6JB 3MRNA 3VXOA 3FU3A 4LARL 4D0DA 2XXGA 3M6DA 4PIBA 3TBCA 2WYIA 4BH8B 5ESAA 1YMMD 3ATAA 5I1HL 5KVEE 2A0LC 5D1QE 4JCWA 3F64A 2AK4B 1P84J 4JPKL 4WGVB 5FYJU 3IDJA 4LCYB 4F37K 5IB2B 4YL9A 3TFKC 3TO4D 2JCCF 1BFOB 4P57A 3UBHA 5JNYB 4HGWA 2FVNA 3P11L 5GGSB 2DYPB 3MGTA 2VSCA 4C56B 2I9LA 1IBZA 2CR0A 4Q6IC 3HPJB 3CFTA 4NO2B 2UWEB 4F2EA 5INDA 4JM2F 1K9TA 3KM1A 1BREA 3UBXG 3GTTA 5IBTL 5J13B 3L3IA 1UH4A 2Q86B 5IG7A 2FH6A 4K9EC 4P4RB 1MJUH 4PR5B 3GC3A 3FTVA 4Y2DC 3TXAA 5I6MA 5KBLA 3HI1A 3V5KA 1F6AA 2VW6A 3E0GA 3D3VA 3LRMA 3PV6A 4DKEL 4DO5A 1OZTG 5EU3A 3FOLB 4PWFA 3LQZA 5DDHB 3NSXA 2APWA 1OP3K 3ECBA 1BQHA 4FXLA 3WEBA 3VGAC 1NL0L 3O0RL 1A7OL 4DCQA 5JXEA 1KFAL 1OSYA 2ATKB 3QEQA 3S88L 1ADQL 3DSNB 1NCJA 1QMUA 4X5XB 3LNFA 2FX7H 3KL0A 5EIIA 4I8DA 2G0LA 4AMWA 5F7LB 3PL6D 4OZFG 3ARQA 2CAKA 3I6GA 3KLAA 3WKPA 4HOXA 5JXAL 1L9SA 2DKSA 1UYWH 1QBML 5IUCA 2EDFA 1SOQA 4HIIB 2WLMA 2JKJA 2WQVA 4NRXA 2GC7C 4WRLA 2XY1A 4G8EA 4Z7UA 1JWMA 5I8OH 4J3XA 4XPTL 3MRJB 2NZ1A 4TNWF 3B7YA 5E95B 1G1YA 4GMSL 4W4OA 3LZPA 4KHXL 5KYUA 2A9DA 2IJ0C 1ILSA 2J88H 2VSMB 4HWZB 1AR1C 5C0FA 4Y1AA 1GGIL 4GS7C 1LGVA 1E3FA 3PJNA 5LQBL 1QVOB 3VVWA 3MBEB 3FUFA 4JFHE 3MGOB 7FABL 2Y25A 3LNDA 2XUWA 1KTLA 2ICWI 4G8FB 5AB2A 5AAMA 1PY0A 5CGMA 4XMVA 3A22A 2BIHA 3N1QC 4F7TB 2UYLA 4AQ1B 1UD3A 3OR6B 3FTUA 3RVWD 5TDPB 2VXSL 2VGLM 3KXFA 1F41A 3NCEB 4PY7A 5EHFA 2AANA 1A4JB 3V0FA 2ZSVA 1KTRL 2BP8A 2JK5B 2R0ZL 1FLTX 5DC4B 1URZA 1UKSA 3G5VA 2R0KL 3ZTEA 1KG0A 1FVEB 4KV5E 3VG9C 4LIQL 3VXSD 3AG4B 4B9PA 2MCPL 3EYOA 4D9QD 3NEEA 5GSRA 1CDIA 4F33B 3V6OC 5AW7B 4OIIL 3QDJD 2HA1A 3IE9A 2XG5B 4EPSA 1A7PH 2X6UA 4XMZA 1DQKA 1CGSL 1EEQA 1RLWA 4FE9A 4F7EA 5E8PA 1NBVH 2G3ZA 1NGYA 4GB9A 4R4ND 2EE6A 2KDYA 5G4MA 4RGND 5DSCA 3QI9A 3G6DH 3W0WD 4ADIA 5BRQA 3GSRB 4B50A 4HALA 4AJVA 4ONGH 2YJLA 2C4FT 4PTUA 1IBFA 4B9GA 1LO4H 3NA4A 5FWRA 4DPCX 5MENB 1XH1A 3E6HB 2JXMA 3GSNB 3HI6L 2JKNA 2EIJB 2VERA 1U3HC 4P9HH 2IC2A 5EIVA 1PAZA 2OMUA 1KYOJ 4LDEB 5DJDB 4OV5A 1HESA 1ET5A 3MRGB 3RILA 1NDGA 2O5YL 2O6FA 2D2OA 3LRSB 1NZRA 1IZJA 4UQAA 2Y6SD 4ZUTA 3V55A 4B0MB 1ZGLP 1UWGL 1T0OA 4OM0L 2VL5B 3QCTH 1KN4H 5EEUA 4G6AD 5FA3A 2Z1KA 1LWHA 3GB7B 3B1UA 5B1CA 3CFCL 2DW5A 3EH5B 3A4DA 4I87A 3MV9E 1G43A 3D9AH 4UM9D 5L8LB 3MACL 4U1GC 2CPCA 4QT5B 2P8LB 1GYCA 4MS8D 5EUKA 4YH6A 1RUQH 3DARA 1QABA 3LQAL 1FVDA 4LU5H 1TENA 4XNQA 4MAYB 3QULB 1NAKH 3V6BR 1U42A 3N85H 4S1RL 1U8IB 2HTKD 1IM9B 5IW6A 4XPFH 2PYED 1FL5B 5BV7H 5DD3H 2WQSA 3QWRA 1XCQA 3HNVL 3SKJL 3V4PH 2A6JB 2H45A 4DTGH 1JN6A 5B1JA 5DHVB 4XPTH 3QZWA 2EYSA 3T4YB 5KAQG 3KPLB 2YXVA 2WBKA 1A8JH 4P9MH 4QCIA 4UT6L 3CU7A 1HCYA 4UZGA 1MJ7H 3EJCA 4HJ0C 4Y5VB 1J12A 1F4WL 2DH3A 1PZ5B 1XGUB 3FT3B 4PGZA 4QGTA 4OCWL 1EHLH 1W72A 3NP4A 4X80L 3UP1A 1GS6X 4XPAH 2YZ8A 4HJJH 1FJ1A 1VFAA 2EXYC 2EDLA 3QHZH 1MWAL 4FQHA 1B2YA 1ZSDA 3HHSA 1OALA 2P7TB 4LCWB 5BS0D 2VISA 5EU6E 1NCBL 1WJ3A 4WY7L 4FLRA 3NEOA 2E3VA 4PWJA 1BVLB 2OJEB 3FHQA 3ILEA 4OM1L 3T3PE 4UQ2A 3VXRA 4BHUI 3EJJX 5CILL 1Z7JA 1OCZB 2Q3XA 3FCTB 1OE3A 3AW5A 3CXHK 12E8L 3GNMH 2XTJC 4P8QA 3PNWB 3WFDL 2Q2LA 1YNLH 1TYJA 3D0LB 4E9YA 2YAOA 1SFDA 3CN1A 2BJML 4IOFD 3QUXB 4XB7A 5I17A 3QXAB 5DO2C 4AY0A 4XVSL 1F90H 3EJQA 4TSBL 5CIPA 2WMPB 5DC2A 5D7LA 1EGJL 4YZWA 3ARBD 3IJEB 3H7BA 5J57B 1H3PL 1KTJA 4L4TA 4UINH 4BSJA 4NT6A 1NC4D 2X1QA 5FYKU 3O41A 2XTJD 4KKCD 1ONQA 1NEZA 2HFEB 2JI3A 4W9LC 5D7EA 4ZD3H 5I1IH 3MRCB 5EIIG 1CUOA 2FO4B 2NY0B 3EBHA 3TZVC 1C1EH 3CQFA 1RURH 2OZ4H 4LXFA 1FNHA 2OMYB 4G2AA 1KEGH 3U4BH 1H3GA 2BNRB 1NMAH 3TNMA 4PREA 1SVCP 3TBVB 1KTDB 4YHNB 1Y18A 2W59A 4M3HA 1A6AB 2YC1A 3BHBB 4MHHI 5IVZA 3ARBC 4XVJL 3VTAA 4L4VA 4HUUB 4HGKC 5E6ZA 4O2CA 1CFTB 1BM3L 1FDLL 3QNZB 3TZVD 4LCWE 3FO0H 4ZMZA 3ZQXA 3X1NA 1THCA 4EIBA 3SEPA 1QKZH 2F7RA 2VDRL 3EH2A 3HFFA 4U2YA 5E8DL 5FYLD 5KEZA 3FQYA 4H88L 5D1XB 3STZB 3WNNA 2NTFB 5HYJA 5IW1B 1U58B 5MP6L 1G5AA 3OQRA 4EQ2A 2FJHA 5DJ8A 5LJYH 4O2FA 4XVSH 2ARJA 1T20A 1UKTA 1RY7B 4Q8BA 3RWEA 4FFYA 5EO1B 4FXGB 4HOZA 4N0YH 4GG6B 5DGQA 5L88L 5K9QI 2C3VB 2AQ3A 3D0VB 2HCZX 4PWKA 3S3PA 4XP1L 3MREA 5IOKA 4R97C 1R75A 2M83A 3HE6D 3H55A 4D8OA 4MA3A 1INDH 3VFOB 4Z7QB 5EWIL 1JHTB 3KLQA 2DBLL 4RSYA 3C6SA 3DMMB 5FO8A 3BX7C 5HJGA 5JPNC 4YDIH 3V8OA 4P3WA 5GRJL 1FI8C 2B14A 3QS3A 5AKTA 1HXYB 1WD9A 1E67A 4PLNC 3P40A 2AHIA 2F9BT 4G7QB 5AB0A 2KLSA 1JHTA 1TZAA 3G6JF 1VIWA 4MA3B 3RVXD 1GCFA 2UZXB 2ZOKA 3N41B 1ZJBA 4G9FA 4C54A 4J5VA 2GBTA 4KMQA 3EOBB 5DEFA 2WV3A 4N2GA 4FXGA 4YR6B 1TYRA 3GMMB 3FU9A 4M6ML 5CP7B 2IQAB 3BDBA 2VH5H 5IEHB 4NYLB 4KOBA 3BWZA 3R8BB 2CNZA 4M02A 3L45A 4J4PC 5D5ME 5E94B 1OAQH 1QEWB 1E7UA 4BK5A 1FNEA 4AG4L 1B3IA 5DWUH 3EFOA 5T1LB 3AU1A 4LDLB 2PN5A 2EH8H 3F5WB 4K3JL 3GK8H 1I1AB 1BP3B 3TOPA 4JZJC 3L95A 3QAQA 1QQDA 5K9OA 1UT2A 3IXTB 4O5LH 2KKQA 4KXZI 1TSRA 2R0ZH 3DURA 3MFFA 4A04A 3AVEA 1AC0A 3QE5A 2R27A 4LVOC 3L1OH 1CK0L 4PJEE 3TNMB 3ZTCC 1QSED 4BQBA 1OQOA 1NINA 1V27A 2P1YA 1OGTB 4BJLA 4K71B 2DWSA 5MHSD 5ANMB 5C0AB 4MS6A 4Z3HA 2QKIC 1FH2A 3ZL2A 4Q56A 3CVHA 1MDTA 1N26A 4J3TA 1U8CB 4GQQA 2VQTA 5JA9A 5AVYB 1WCQA 4MQXD 3F7LA 4UV4L 4A7GF 1OWRM 2K7PA 3I85A 2RACA 4L4TB 4GAYA 3GIZL 2ITEA 5F70A 3VGAB 3IU3A 3CFCH 43C9A 1CTNA 2R2BB 4K23H 2HKFH 5DO2D 5KYNA 4Z3FA 5I17B 3KG5A 5F6IB 3V6OE 5I15L 5BO1L 1ZLUH 6CGTA 5IWLC 3HEIB 2BVEA 2WM0A 1JPST 4YHIA 1F3RB 4JFDD 3K0YA 2QSCH 5DHYA 3DVFA 3VXRB 3HIZA 3WN5B 4KJWC 2PWFA 1RVFL 3UTPE 5DYFA 1QR1B 2Y7NA 2HRLA 3SE9H 1GS7A 3V7AE 1C5BH 2OV0A 2XBDA 1AG0A 2NT1A 3GSWB 3BEVA 2EIKB 3HAEB 2VISB 2C26A 2YKKA 4E41B 1UCBH 4LAJH 1J5HA 1VFAB 4EN3B 1U3ZA 4J6RH 4WHTB 3ZIMA 4GLRH 3NCBB 3DUUB 1CDYA 1PZ5A 1XGUA 2QGCA 3L4CA 4ACTA 1ZT1B 2DQHH 2L8AA 1QFWH 3CSTA 4NWTL 2ZCKH 3D4CA 3WY2A 4EOWH 3D18B 1ZV5A 1BSIA 5DHVA 3VFNA 4TYUA 4MJID 1ANUA 3V4UL 2Y4SA 1XGTB 1VGKA 4XBEL 2EH7L 1WZLA 2W07A 3LXCA 1FL5A 3D33A 1Z2KA 4L8SC 1SVBA 2ZXGA 1YA5A 3B3BA 3GUTB 3NCYS 1YECH 3UZVA 5CN1A 4PJAB 3EFFA 4PSRA 2ZP0T 2BVQB 3EO0A 3M7OA 3HJEA 1MHPL 5FYJD 2CO7B 2QLVB 1ZANL 5AOKA 4JQIA 5I5JA 2DEYX 4MQ7A 4PY8J 4KX9A 5HDRA 2JF1A 5FA3B 4OLZL 2EE0A 3KH3A 1JPGA 3ZHLA 1WQVT 4U1NB 2ORBL 1CDUA 1WISA 1FPTH 2G5BB 2MH4A 3ML8A 3LRSA 4Q2ZB 3QUZD 3QAZC 4FLSA 3H9SD 4KZDH 1XZ0B 1IBHA 1DE4B 3BZFA 2X9WA 5DMKB 1KIUA 3IFNH 1U6AH 2NW2B 3PPSA 2BP5M 4QRRB 2E7MA 5IJKC 1J8HB 5C9JA 1U8JB 4P23D 4UM8B 5C0AE 3ARFB 3MLWL 5F97E 4OF3A 4OGAD 2J6EA 2DMKA 5AG8A 2EDDA 1JGDB 2YKLL 1NC4B 3HMXH 1Z6JT 3JSSA 4M48H 4GW1A 4F7EB 1EK3A 2Q3AA 4QXWA 3HI5L 5CZKA 2XTJE 3LH9A 3OWRA 1G9MC 5D8JL 1CICA 3OAWA 4PP2B 4I3SL 3S5ZA 3TNNA 2VW7A 3EYUL 1ZVHA 2XN9B 2YD3A 3EYOB 3BUPA 4FQLL 4MAYC 4EIZC 5CAYB 5EEZA 1DL7H 2R59A 5DS2A 3BI9X 3QDGB 2WZAA 1JG9A 1ZVNA 3JUZA 5KBKA 1H8NA 5HI5C 2QHRH 1XGRA 3U4KA 2ADIB 3SGEI 4O00A 1YQVH 2D3NA 3HNSL 4HIHB 4TLSA 3FO9B 5BXFB 4GRMB 3GMLB 1E4XH 4PS4H 5EBMB 3O4OB 4L1SA 5B3SB 2FJGB 3WIHH 1QI3A 2VO8A 1BZOA 2IBZY 3DX1A 4WHDA 3KVPA 4XAKE 2EDOA 2XZCH 1A2YB 1M56B 3WENA 2OULB 3BVDB 4OFDA 4B9KC 3RPIB 4DP6X 4DKFL 5J6GA 2Z93B 1LO5A 1QR4A 3QISA 3BP5B 4PJ6A 3F83A 2HFGL 1U30A 2EC9U 5ISZD 4F5CE 3SDCA 1BHGA 3UAEA 3SYQA 5CZRA 1TFPA 5IMLB 3MRBB 3AGWA 5E1QA 4Z7UB 4NZTL 3QA3B 2QZQA 1XXFC 4JJOA 1G94A 3THMH 1Q0YH 3BZ4B 4ACPA 3L3HA 1JNLH 3WTXA 3GI9H 2A1WL 3KLAB 5E9DE 2PPFA 2A3TA 4Y19E 4UI2A 2YD9A 1YYML 1DUZB 4WJ5B 4Z7IA 4PS8A 1CFNB 3O6ML 4MLSA 2IMNA 3G7TA 3L7FB 1CGXA 3QUXC 3WE6A 3F7VA 1H8LA 3KVQA 2EDJA 4LVHC 3FQUB 3IJHB 5DZOA 5C09A 1PQZA 4LSSL 3B7SA 3QDGE 1VJSA 4Q58C 4Q7DA 1AE6H 3EYFA 4ZQTA 5DMGC 4R9HA 1AGFB 2NYKA 5GGRB 1LO3L 2JTYA 5D7SH 3V9EA 3ZDYE 5K9KB 3EHBB 4JHZA 2XC8A 4YDLB 1XL6A 2RHEA 3QCVL 5L4FA 4H0IA 2D3LA 2NT0A 4D0BB 1M4KA 4YWGH 2X4RB 3APFA 1R19A 1X5YA 2F19L 1YJDL 4Y9EA 3VX0A 2RJMA 4P5TA 2J6WA 3BAIA 1E3XA 4R7LA 4ZK8A 1JGEA 1BOGA 5SWSB 1HIML 5AOJA 5DD1H 3BLKA 1MXGA 3FCGA 3MGTB 1WF5A 2QTEA 3JQOB 4KXDA 2GC4C 5GGSA 4YLCA 5J8OA 1ZHNB 3GXNA 4NO3B 2WNKA 5MEOB 3FTGA 4PRPA 1J5OH 3GHPA 3IETA 4XMUA 2A74C 4ZOEA 2WXOA 1YDPB 2ZX5A 4WK2B 1A3ZA 1JYWA 2I5YH 4ODSL 1JFQH 1T21B 4CUCA 1E4JA 5FYKL 4Z7WF 3G6JA 2MPAL 3MROB 3MNVA 2Y7MA 2F58H 2NY2C 4KXZH 1F02I 5AL0A 2OA9A 1EGJA 3RPKA 4OCMC 1T3FB 3MR9A 1KBGL 1XWVA 2FAUA 3K71B 5FB8B 3B9AA 4ELMF 1TZ8A 5M7QA 3VXMB 3MA9L 5IMKA 1A22B 3SGJA 4D8PA 3BZEA 3KLKA 3HBPA 3ISRA 2DL9A 4JRXA 2IDQA 4JGJA 4L8BA 4IS6A 5BZDA 4HVBA 4JFYB 3TO2B 4JGMA 4L05A 4WCYL 2E0PA 2CIKB 4YIQA 2X05A 1OSZB 2PYFA 3BWAA 4JVPA 4M7LT 4LLDB 3K2KA 3KYKL 5HXMA 5C6TL 3LEYL 3QNXA 1Z3GL 3US0A 3KCWA 1C5DA 4OJCA 1EXHA 1NOAA 2ZUYA 1GCYA 2YEVB 5CLYA 4IBYA 1JCVA 2K6WA 4IK7A 4A68A 1P0SE 4R5XA 3CH1A 4I0PD 1G7MB 3F6JA 2P5PA 1UA6L 4QF1A 4NZTH 3B3IB 4FG4A 2W9DH 4HPYH 4JM0A 4JDTH 4WIQA 5GGUA 1NUGA 3BSGA 1MFEL 1AGDB 3OB8A 4V1DE 3V5DA 1VFBA 5GS1A 1BFVL 3DUHA 1EJOH 3EBIA 3ZRSA 3OKOB 4U2ZA 3VGDA 1KJ3L 1F3JA 5HJDA 3V4VL 1I7TA 4JAMA 5C0RH 4RAVB 1L7IH 3ARZA 5JW4M 4I5BA 3MNWB 2MTAA 3SGKA 3S37X 1FGNH 5L2JB 2DLFH 4BFNA 2XVKA 5DUJA 3WEXA 2HFTA 3TCLB 3FRUB 3KYOA 2MKWA 5J5EA 2C3HA 5JW5B 3F3HA 1JE6A 3MZTA 5GISH 4UTBL 5FO7A 4K3EH 4KVNL 3OHXC 4HFUH 4HLZG 4GT0A 3CJJA 2VKXA 3I02B 2VUKA 1LE5A 5D55A 1FO0B 2BHYA 3FB7A 3MNZB 4K2UL 2VABA 3K6NA 3DX9B 1R6VA 2FSDA 1MLBA 4Z9KB 1OAZL 4V11A 5SWZD 4AOFA 4KROD 3E80A 7TAAA 5D4IA 5TGBA 3CXHJ 3S0PA 2C1OB 3BRFA 4AVJA 2DJUA 2J25A 3RKDD 4R7DA 2Y07H 3RGVC 1GGIH 2ZCZA 2OMNA 2DB8A 3CFDA 4JRFA 4LHUA 4N0UB 3FRPA 5AOLA 1M05A 3RI5K 1EAPB 4N2IA 5TTRA 1RUPL 2A73B 3REVB 1MLCB 4WHYH 1HYSC 4Y5XB 1YVLA 4H26B 4JDZB 3EUDA 2QFRA 2NXZC 1Q9OB 4NZ8A 2AQTA 4XN9A 3RE0A 1YC8A 3VWJA 1D6EA 2CRYA 3NIFF 5I8CB 2BP0A 2K70A 3LDBC 5A2KH 1QW8A 2X0VA 5ENWB 3SBWA 2MNJB 1SJHB 4NQUA 1ADQH 3HG1A 3LRGA 3P3UA 2VDQB 3QG7H 3PWPA 2FL5A 1QSFB 4JB9L 4N9GB 5E5UB 2EVIA 1XGPB 3CVDA 1NCHA 4LKXA 1DDTA 1TMCB 5HPMA 2HN7A 4PGDB 3BDYL 4JCMA 5F7EL 2XIDA 1R3KA 4HFWB 5ICYA 3P4NB 4J3OD 4IBLT 1V5JA 2WCGA 3L7EA 4Q0XH 2VMJA 4TTDD 5FUZL 3D9AL 1AQDA 2HFGH 1K2DB 1G1KA 1TZIA 3QO0B 1I8UA 3UP6A 4OFPA 3PJSB 5HGAB 2Y06H 1VZHA 1QATA 3AY2A 4MNGE 5CZVH 5CNHA 5IMOA 4OQ1A 2GSGA 3C5ZA 2DRUA 3QUYB 4D0CA 3HZKA 1E9OA 3PXJA 2F61A 2EE3A 3DO3A 3HRZC 2LTQB 3HNTL 5D1QD 1JHKL 1RUPH 5HD8D 1A1MA 2DL2A 5I6OA 1UA3A 3CHPA 4PJ8C 3T8XA 1EDHA 4RMSA 4NQXB 1PZSA 4WU5B 1AG6A 1BGXH 1R5WB 3V79C 3U83A 2ZYRA 3KGTA 1A6WH 2CHWA 2NY3C 2O6EA 3N2JA 3CDFA 4K94H 4M29A 4MLIA 3SKNA 3O9WB 2GTWB 3FOMA 4WTWA 4G8GE 1V54B 1S3KH 1X5JA 4J2QA 4J3OC 1H8SA 5DK0B 3AZUA 3LVEA 5TDNB 2B0SH 1MFNA 4A2HA 2R7EB 5D7IE 1E6OL 4HIJB 3LOWA 5CMAB 4FXGC 1ZLWK 1IQDA 1BYOA 4QO1A 5I30H 3ZDZF 1MI5B 4JFZL 2MEJB 5C0CA 4D94A 3T0EA 2WANA 2Z0BA 1SJEA 4UQIM 1F6FB 5ACMA 1LNUA 2DQFA 3UJIL 2OR8A 3BWUC 4OFYA 3ARDC 4HWEH 1WRFA 1O7DE 2Z7ZA 5CJBA 2OMWB 1YEIH 1O9VA 4TNEA 3VNYA 2EQDA 4XN4A 4OZGB 3I9AA 1UYWL 1TJMA 5IY5B 4QHPA 2FO8A 1NC2B 3FSAA 1SEBB 3KCPA 4M8UA 2KERA 1F18A 2P3YA 3OX8A 1YPZF 1PDKB 1E4WH 3KS0J 5BZWB 1KYAA 3UYPB 4FQXA 2Z4QA 5C07B 3NACL 3GRWL 4LRIC 2Y07L 4HUVA 4ZYKB 3VSVA 5IHUL 4G80B 3L4XA 1LP9F 1ZWIA 3KJ6H 4BXSV 1SEQL 2FBRA 4MJ5B 3BGMB 4O9HL 3WKQA 1TOXA 5E99L 2JFCA 3I3EA 5A6IA 5A2BA 4UU9B 1NANH 2B1HL 2Z92A 5BJTA 1COBA 4DP1X 2YD1A 1YNLL 3RB5A 4NP9A 4L23A 2MCAA 2HJLA 5CJXA 3TT3H 4YFLI 1FVCB 3U6RB 2KHAA 4N9OB 4F8PA 4OZHF 2LABA 1RZKH 2L04A 2ZUUA 3QQNA 4OCNC 3GS4A 2LLLA 4I9XA 3L2NA 2HVKB 4X5RA 4F7MA 3V0DA 4NXSA 2P5ED 1KGCD 3OD3A 4OZIF 4FNUA 5DEJA 3RL2B 3DHJA 4LEOA 4YSOA 3FXIC 4W68A 2DQJH 3OMIB 1FORL 2ZG1A 3IRZA 5D2LE 2P8PA 1ZTXH 1XSKA 2BNQD 4WGWB 1HL8A 1Y6NR 2FQEA 4PJGE 4ISVB 1XV8A 2GIYA 1AY1L 4I0PC 1BFSA 4Y4HB 4APXB 3GDCA 3ETBF 1IBDA 1UM6H 1A6TB 1S9VB 5TF1L 3ZGIA 5AVTB 5CBAB 2V6HA 4HWBA 1MCWM 1W2KT 4W9IC 1TIUA 1KXQE 1YLBB 2MWCA 2OMVB 4P49A 5E5LA 4WCYH 5IESL 3W39B 1N19A 1WZ1L 2FWLB 2A6KB 3NGBC 1NGWA 1PLAA 1TITA 1XF4B 1T0PB 3WS3A 2D4DA 4N2CA 5B38G 3OJ2C 2NUTB 4ODUA 2ZXDA 4TVPL 3BD4A 3CV5A 2DI9A 4WW1A 5KYYB 4WSGA 5E2TH 2ESVD 2XG4A 5GXBB 2A6IA 1KMGA 3FQTA 3KLSA 5DC9B 1I85A 4NN6B 1CFQB 3IYLW 3BKCL 3RP1A 1JRHI 4QRTB 43CAB 1UC6A 1DDHB 1KCBA 3MRPA 4K2UH 4ZAKC 1HHKB 1B0RA 1A6VL 3FPYA 1P7HL 3QH3A 2RFXA 1I7RA 3ARDB 1HHHB 5J1TC 3RWFA 5FHAH 3OF6D 3U1SL 1JYVA 1FFOA 5EN2A 3QQXA 3K1KC 3CAFA 3MA7A 4Q89A 2QVMA 1FGNL 5KG9B 2Q6WB 1ZGLM 3F65A 5AKSA 5DHXB 4UOJA 5DQJA 1GW6A 5FYKE 1PYWA 3IRCA 5EUOF 1HAWA 3CUPA 4N0CC 5DVPA 2OMTB 1A8ZA 2NMSA 2DQCL 4XVTL 3MRKA 4P23B 1R3JB 5K59E 5AUMB 4N2LA 5T1MA 3OKLB 5F88B 3QPKA 4IOSA 3IWVA 4PRNB 5D1QB 3LQMA 2FYVA 1DVSA 5D7IF 5CKAA 3ISWA 1PPIA 3JTTA 3QCVH 5D7LD 1YMMA 1EEZB 2H3NB 1J48A 1BQSA 3FFDB 2CBOA 3MLRH 4Z7VA 3GQFA 1E4XL 4PS4L 3F01A 4KO6A 2BSTA 4C83A 2GEEA 1OAYH 3EG9A 4Y5VC 4M03A 5E8NA 5KYWB 1LHZA 4ZMLA 2Y2YA 1X5LA 1CLOH 1F4YH 1OAKL 2JELL 2VM4A 2BDNL 2B5IC 3P3TA 1GR7A 1UOLA 3NK3A 4HV8B 1FAIH 2VO5A 4RESB 1MVYA 4QXTB 1L4IA 4P3CH 1AGCB 1S7WA 2PWHA 2HTLC 4YDJB 3WD5L 4MMZC 4PV9B 3DROB 2W5PA 4IU2B 1VHPA 2NUPA 2O72A 1S5IL 5T3ZL 4PUBH 3TIEA 1V3MA 4LGPB 1FZJA 2NNAA 4JPWL 3QI9C 3QYNA 4NM4L 3BO8A 4W6YB 3RNKB 5C3LD 1S8DA 4JM2B 5CZXC 5I6NA 1P1ZB 4J8RB 2GG1A 3E8UL 4MA8H 8PAZA 5DRZA 4OLEA 4UB0H 4XWOD 3JVGA 3PHQA 4BV1A 2X4SA 4DPRA 5KVDH 4X6DA 3DKHA 1M7XA 3IKCA 4FOMA 5HYEA 5EBWA 4LO9A 5CSGA 3TS8A 3ET9F 3IJ9A 3V95A 1G6VK 1YEFH 2ZCLH 5D4JA 3FU5A 3T2OA 2NY5H 1LWRA 1PD6A 2UXVA 3NIGB 1UQSB 2XQBH 1UH2A 1OW0A 4GIOA 4TRPL 3VXTB 4YBQC 3QZLA 3X3GL 5HSFA 2EDMA 2A9ML 3NIDF 1ZHKA 1N59B 3M8OH 3TJEL 1YYLH 5F6HJ 4PJGA 4Z1PA 2OL3B 4LLUB 2QHRL 4RGOL 3LRHA 5GZND 2I26N 3WIHA 5I6PA 3X13B 2I9TA 2UUDH 4LLAA 5IKCA 2P8MA 3NA9L 3X2QB 1ZXQA 2CDEA 2OZ4L 2NZ9D 4XP6L 1RP9A 4OTXH 1RJLA 4Y9CA 5EC1B 1INQA 3B7TA 3HB3C 3KM2A 3PGFL 4RDBA 3SYOA 5I76A 1OTUD 4EDXA 4KKBC 3HI5H 5DD5L 2G2PA 1YC7A 1FYTD 4XODA 1OGAA 5MEQB 1B4RA 1MZYA 2VN6A 4L4VE 2QBWA 3ARED 1E8WA 1RIVH 5E6IA 5BOJA 4EI6A 4YMPA 2CKBH 4G42B 1FNSL 2CNYA 4YBQD 4UILH 3JWDL 4ZSOE 1H15A 2EDNA 4HUCA 3VFMA 3OAZH 3BSZH 3PGDB 4PAZA 2J2ZA 4P23C 4AW7A 4DW2H 5FYLL 3SE3A 4F9PA 3ROLA 3DO7A 3WUWB 1PIGA 2VXQA 1HSAA 5KVMC 3U9UB 4Z7OB 2WAQA 4HC1L 4I2XE 4K7FA 2I60L 3BH8A 3FL7A 4QHUA 4KHTL 2X09A 1DEEB 2P42B 2BNRD 3BIKB 3DXAE 4L3EB 2YD2A 4QYOB 3EGXA 3QZOA 2J1XA 1CGSH 3PG2A 5HDOA 3MLUH 1L7TL 1MRFL 3A0OA 5L2KD 2P24B 3KR3H 3CIQA 4FKKA 4AL8H 3K8LA 4NQDA 3PP4H 4YXHH 3KBHE 4MDJA 2EE2A 4HS3B 2ENJA 2WBXA 5IROA 3IPEA 1UTDA 1J1PL 3FKUS 3P4OA 1G7PA 5E23A 1JXJA 1XD0A 1BCIA 1HKFA 2WWKO 3TT3L 5B7MA 5IM7B 4TUJB 4XN2A 3VI3A 1VCAA 3SCMA 4S1QL 1IL1A 4ZUVA 4ZUWB 4WO4B 5ETUB 2C7FA 1J1XL 3BAKA 3UTTA 3OHXB 5BVPH 3MO1A 2J8HA 3ZR5A 1Q1JH 3VI4B 3ZDXF 4RRPA 1TU2B 4KTEL 2R15A 7FABH 4E9TA 2BNUB 1HSBA 1LDPH 3Q1SH 4Y4FA 5E6RB 5SWZA 5BV7B 4NQVA 5BCAA 5C70A 2FWOA 3HBZA 4LLMA 2IQ9L 5FUOH 1EVTC 3OC5A 4H20L 1A4CA 4RMTA 2GQHA 2JKLA 1MI5D 1KXTB 2APBA 4QKTA 4WEEA 4YBLB 2E46A 4GSQA 3L5WA 4ZOAA 1T1ZA 1ZSHA 3ARXA 4OZFB 1IKNC 2KQNA 4EDWH 2AAVA 4JFDB 1Q94A 3P9LB 3RJQB 4G43B 3WS6A 3IJSB 2AAAA 4GO9A 3AREC 3FUDA 4UZSA 1SHXA 1V3KA 2YSSA 3KGSA 1BXAA 1N6UA 4KTGA 1CXHA 4PVNA 2OSWA 3LKRB 3SDXA 4FQQB 3QJUB 3HB3B 2WQWA 3BAEH 1N7MH 1ZHBA 5JTWA 2B1AL 3ZYOA 2HSIA 2HG5B 3FQRB 1IEBB 1KELL 3GS7A 3OR7B 3IEAA 2J5LC 3WMQA 4I89A 5SV4A 2W65A 5GIRB 3BKYH 6FABH 1Q1JL 2J1WA 2Z8WC 2J71A 4PBWD 5GRXG 5D1XC 4URKA 1NWPA 1BA9A 2IDSA 4LP8A 2OBGA 4IU3B 1WAEA 5I16B 3TCXA 4G7YH 3I74A 1CBVL 3MUZ1 3TT1H 2ZUVA 1FAKT 1II4E 2ADJA 3F7RA 4LIQH 3CFEA 5JR1H 5I15H 3CLFH 2LQRA 4P2QB 4PI0A 1JRHH 3BMVA 4TVUA 1SDDB 2OJ1A 1E5AA 4MA1B 2OX5A 1ZLWH 5DHDA 1OTSD 3DBXA 4MNQA 1HHGB 3HC0B 4ORZC 1NKOA 5DJYA 3FTYA 2Z1PA 3RDJA 5L8KB 1MHEB 2J73A 3QWOA 1TKWA 3UO1L 2O4EA 3WOVA 1SXBA 2FRGP 4DF9A 5I1HH 3VRLF 4X98A 5B39A 4M5TA 2NX5D 1MFCL 4XX1E 1EAJA 4MCYA 2Z35A 4AITA 3ABZA 3BN3B 2Y7LA 5JOPD 1VSCA 1MHCA 4I48A 1QLRA 4LP5A 2FD6H 1JCKA 3ABGA 3DIVA 4PJEA 4MDRA 3BCDA 4PJDA 3RU8H 4LCUB 5DEGA 4Q52A 2CO6B 4Z7VE 3WXWH 1OTTC 3D2UD 3WFHB 4C55A 5T3ZE 1AAJA 3EUUA 4BA0A 2JQZA 1JHKH 1GA2A 4TS6A 5KSAD 1O6TA 3X1EA 5ILTH 3QJFA 4U0RB 5C3IA 3QPXL 1T1YA 4X0KA 1XGYL 3AG3B 4TULH 5KSUB 1NGXB 1JK8B 2ZUWA 3FUKA 3U36A 1BF2A 1Y6MR 4PB9L 4QHKJ 3HN8A 2QVIA 4JFEB 4OZ4A 4XPBH 4BQ6A 3GDBA 4JY5L 4OJEH 3BQUD 1YUHA 3D07A 3MLTB 3QAZB 3QR2A 4DZ8B 4HEMA 2UVEA 2HT3C 4HHGA 3O0RH 4G6ML 3GTVA 4MAZA 5EC2A 1OB0A 4KKNA 4TOYH 1AIFB 5A3ID 2PO6C 1DUYA 1UD4A 1G7QB 2WNXA 1QWNA 3SO5A 3LIZH 1T1XB 2XY2A 4LSSH 5GZOC 4HJTA 4PG2A 2BJMH 2C9QA 4ZO9A 2GEQA 2WBJB 5CFHA 1A7RH 1FNAA 3SY0B 2HRHA 5D1XD 3H9SB 4ZXBD 2VC2B 4JANA 3NUKA 2WQAA 2GJ6D 4TNGA 1OTUC 1QLFB 5GRJH 4AI7A 4E9RA 2NY5L 5FA4B 4JNXA 5C0RL 3QVAA 3N43F 2Q5BA 1TZOA 1K8IA 1T2XA 3PL6B 1Q0YL 2C9XA 1AHWA 4AT6B 5I1LA 3Q05A 2CR6A 2I69A 3W37A 3PABB 1I1FB 3WCYA 2YFNA 3HZVA 3W9DA 3DX7B 3QORB 4Z78A 4FTVA 1DJIA 1OCWH 1PU0A 4X7FC 4XAKD 3FQ4A 3VGFA 4A7VA 3TV8A 2XICA 5DJAA 1RSYA 3SDXF 3IDMA 2IALA 3O4OC 5AZ2H 3ILDA 3TA3A 5HTSA 2YUVA 2GJZA 1M57B 4DERA 4OCLC 4P2RA 1RFDL 4ZFOL 2BNQA 1CT8B 4A6YB 1HU8A 4FKEA 4XNUH 4K3HA 1L3NA 1AHMA 2V7HA 4CW1B 5IQ9B 4RX4D 5AW6B 3O2VL 3OAYH 4NEHB 4YLQT 4QRUB 3O2DA 1F97A 2VZ1A 1ZCRA 2CKBL 1EERB 2BRRL 4TVPE 2X7LB 4OBRA 4RDQF 1WS7A 3VFSA 5DK2A 1JUFB 5HHNB 4YDKL 1YYMH 3R8QA 4HBCH 1GRWA 5LNEA 3NJLA 2VR9A 4P46A 3WJMA 1QA9B 3BW9A 3IMUA 3RUGA 3GM0A 4UDUA 2UZYB 3BP4B 3SGDI 5DO8A 1X4XA 3T0WA 2AK4D 3L2MA 3JZ7A 1T4KA 2WUCL 2Q1EA 3LEVL 2OR9H 3MRQA 4MJ4A 2R2HA 3MFGB 3BWSA 1ACYH 1NAMH 3B83A 4GW5A 1QFPA 4XNXL 4A37A 1KCVH 3CHRA 3MU3A 2VITA 2DJMA 3QIUC 3JV5A 2WLKA 4NNPL 1QI5A 1L9PA 4AEIL 4Z95L 3N50A 5HGDB 2HXAA 1AD0B 1WUNT 2D0FA 4QRBA 1Z3GH 3WY4A 1C16B 2VDPB 3CZUB 3KLHD 3FB8B 1T89A 4UMSA 2J8UF 4HKXB 1NJ9B 5DR5H 5HHPB 5K1JA 5KN5A 5FF6B 2WY3B 3ZZ1A 3E9TA 3O3AA 1EEYB 1T66C 2CA4A 1TQCC 1W8NA 2NY1B 4YHOH 2A4CA 3II2A 3BUQA 4KITB 5IF0B 4Q6IB 4TQPA 3MXVL 3HA0A 3KWWA 2MIZA 5KW9H 4HW6A 2VDQL 1MCIA 1M1XA 1VFMA 5FGBC 4L8CA 2EKSB 4U3SA 1QNIA 3X3FL 3ZK0A 4PJFB 4C4KO 1JGVL 1LO0H 2UXGA 5CEZH 3AU0A 1XCTA 3LQAH 3FSZA 4TOYL 4WKZA 5FKPA 2BOCA 3DJRA 4X4KA 1MCLA 2QJDA 3EOAB 4PJGF 3MOAL 5KANI 2ZT9C 3GF8A 1WWWX 3O11A 4BKSC 3KPMA 4JFQB 3C08L 2Y1YA 4N8VA 2HX7A 4KQ3H 4JRWA 4G59C 3MYJB 4L3CB 3DOIA 4W9HC 1X5FA 3CN2A 3KHQA 3AREB 4XH2A 1WIPA 4CVXB 1E27B 5DD6B 5GRVK 4Y16C 3HZYB 3QNYB 1VEMA 3GTNA 4EBQL 4IGBC 2OXHB 4AIZB 1GZQB 2DI7A 2XKSA 1UB5A 4N86A 4O9HH 5BOPA 4AH2A 3SDAA 3MV8E 3QUKB 4G11A 3LSOB 1P7KB 4FFTA 5J9PA 3A5VA 2DIJA 3EW3B 4MMYA 2ZOTA 3QC5X 3SD5A 1O7VA 1NUDA 4WI0B 3T6QC 4G71B 1DBAL 1NIBA 3OAUH 1NGPL 3OGCB 3K8KA 2XWTA 4ABQA 2APXA 4I3GA 3M07A 3LKNB 2X1PA 2Q7YA 3BAYA 3ZTJG 5E24E 3DPBA 3L6FA 2R2CA 5EOQL 3T77A 5GRYA 3DYPA 4XNZC 3CZFB 2BC4A 1HN1A 1P5UC 4MKMA 3BUIA 4NKMB 4U6YA 3Q1EA 5I30L 2DKUA 1TFHA 3M1CA 1TO5A 4ELKA 3FT9A 2YO3A 4F7CB 4N1EA 2FD6L 4OIBA 4A6YH 2ADFL 4Z0XA 1Z1WA 3V5HA 4OCYH 5EUOE 2NR6A 4Q9BA 2QSVA 5CEZE 2CRZA 3D39D 3NCFB 3S4SA 2F8IA 2WTRB 5AB1A 3O6FD 2WTOA 1BLIA 2J6EL 2WQXA 1LEGA 1ZPUA 1GSMA 2ZCKL 1LVEA 2J20A 5GGVH 4AIOA 3RG1C 2PCFA 1H0DB 3PGCA 5IHLB 5J13C 4N2EA 3GRWH 1TETL 3CPLA 4Q9CA 3CDGA 3EYUH 4QRRD 4TL5A 3TYFA 1FFTB 3QHZL 3FN0H 5CSBA 4X5PA 2V9QA 3MCKB 3UBXB 4CGUB 1L9OA 3VMOA 2CUHA 4LLQB 2J44A 3PV7A 1CU4L 4GSUA 4OLVH 2VLRE 1GZPB 2AV1B 3VFTB 4WO4D 1DSYA 1LK3L 1YN7B 1BBJA 1HH9B 2Y1ZA 1E42A 1C12B 3ESOA 4CBPA 1JD9A 4JPKH 3MLXL 3MVSA 2W0LA 4EN3A 5LGYA 1IM3B 3NFSL 1M6OB 5ESQA 5FFOA 4CDGC 4QHMB 4HP5A 1RK0B 1QLEB 1J9SA 5IGXL 3LNGA 3K6FA 1AQHA 3VH8B 3ULVD 4FTDA 4J3OH 1OSEA 3BXNB 3NYKA 3QQ4B 1FFQA 1ZT4A 1KB5L 4U0QB 1U91B 2NCEA 2GY5A 2EEFA 1RI8A 3OJMB 5FCUH 4Z7QE 4BUGA 3QUZB 5EG6C 3D2UA 1ORSB 3BISA 5I75C 3ZQWA 2ICEA 2XWZA 3BUDA 4WAFA 1TVBA 1P7BA 3K7UA 3PUCA 5L9DH 2D7TH 1MCKA 3ZMRA 3M17A 1JMXA 4JY6B 3RFZA 1R47A 5EZIL 4HKBB 1BPVA 3GLDA 4Q9RL 3FCSA 2XA8L 2BVOB 1JF6A 2FSEB 4M8RA 3VXPB 4N2FA 4HX1B 4BFRA 1XMWA 2XIBA 1I4FA 3RZCD 2W60B 5ALBH 1KXVA 3A21A 4JG1H 1IKFH 4LASL 4CN1A 1J0KA 3CVHH 1XCXA 3TFKD 2YZ1A 1DSWA 2P28B 4YPGA 3EXLA 2XFXA 3HMXA 4NS0A 3FQNB 4KKAD 4W6WB 5CSZA 4JHWL 4HIQA 4M1GL 1DLHB 3V0HA 3E7JA 3VGGA 3BPLC 1DVYA 1R3HA 4LBAA 2HKHL 5B21A 1M9WA 1KBVA 4YUEH 5KBDA 1MRDL 1J9RA 3ILQD 4HPOH 3S35L 3U82B 3CWGA 2OW6A 3TTYA 1ZJAA 1DVQA 4AEIH 4M6AA 3QG6B 4HAKA 5D1ZC 1E5YA 3H56A 4JFZH 1ACXA 3I6KA 5LN4A 3ZZQA 4AQAB 3PLYA 1BFVH 5FYLE 3EO9H 5F96H 1HQRA 4H40A 4LEBA 4XCEB 1JWSB 4DN4L 2E8ZA 1FC2D 1LDPL 3Q1SL 3DX2A 5EU4A 5B4MC 5FYKD 1JZ8A 3C9NA 1UXSA 3NABL 3APMA 4ZUSA 3LMJH 3DBSA 4JJ5B 5DRWA 2VZTA 2ZXCA 3RTQC 4WFHE 5EPMB 2ZF8A 4EZKA 3FB5A 3MV8A 4UUJB 3MMEB 3HRZB 5DUBA 2BY0A 1G7IA 3KPRA 5I24A 4G8AC 4FNLL 5MEND 4DKTA 3OMZA 3R1GL 3MLRL 1OOWA 1GPOL 1NANI 2BP3A 1MDAA 1PLGL 4RQQA 2XWCA 4R5TA 5KYXB 1MXDA 1VGEL 3IDGB 2WVVA 2BPBA 4KXBA 3WDJA 3CX2A 5DJCA 4DVBA 1KXHA 4H25B 1IGFH 4PWEA 5FK9B 5DWUL 1INEH 3BPNB 3BEWA 2EAEA 3B34A 4LHUG 4XBMA 1LM8V 3X12A 1JI1A 5E0QA 5KOVC 5FV2A 3UZEC 2SEBA 2X6AA 3MRIB 4K9EL 4KVCH 1OT2A 3VSQA 3BQUA 2E7CA 3LNIA 3W11D 1KCUH 1MW2A 3C12A 3PS6A 1OHZA 3CVCA 4UDTB 3ZVVA 3C2AH 3MJ7B 4U3CA 4Y2DD 4BH7A 3WU1A 4RWYH 1A25A 5TDOA 1VEOA 3H6JA 2AJVL 1NWOA 3NVQA 1KGCE 3NCWA 2XFGB 3LDBB 1U2HA 1C7TA 3TBYA 5GS0L 1OF2B 1N68A 3HPLB 2D7PA 3GXMA 2FZ3A 1T83A 2AXJA 2VDLH 1JZGA 1KLUB 4K8RD 4JKNA 4TQEL 2P80D 3S98A 2D9QB 1AXSA 3GIVB 5KVGH 1GZHC 1KNOA 4P2AA 4R4NC 4YBLC 3T1WA 1FUNA 4FFYL 4FYTA 3R7RA 5A16B 2H4EA 1CDHA 4XVUD 4G7VH 5I71B 1UCTA 4MJIB 4XNMB 2PCPA 4HIEB 4X9YA 4TSCH 2XIIA 1FRGH 4HOMA 4G3YH 2R2EB 1QZ1A 3MOAH 5IQNA 1NLBL 1UZGA 4PV8B 4PJ9A 4QRRE 3UPCA 2AQRA 1D7BA 4MMZB 4PP1C 5D93B 3VE0B 4QOKD 2KMWA 2X1OA 5BS0A 4XXWA 4H0GA 1EHLL 1I1YA 1D5XA 1ADWA 4JVWA 4ODTH 5IBLC 4BWUA 5HP5A 1GOFA 1HKLL 2ZYIA 3ROOB 4CL7A 1ACZA 2IANA 1P84K 3GSXA 3K72A 3MKKA 1TQTA 4HWBL 4MASA 4DGYH 3K4AA 5FO9A 3N1FC 2FIKA 3LKQB 2QQKH 3PWLA 1MCHA 2ADGB 2F54A 4LQFH 3V6ZA 5A40E 4OUOA 2V9RA 5CGBA 1HDMB 4G9DA 2JKIS 2E6QA 3BKMH 5TH2A 4PJHE 3QO1A 2X42A 1FFPB 3A3YB 1NCDH 4LF3B 1RXLA 1QBLL 4OKVB 3M88A 4MJ6A 4LSPH 2XTJB 1AQKH 5IB3B 3DGDA 5INCB 4H5SB 5TFSL 4L29A 2HRPH 4HEME 1SUJA 2AQSA 4H1LB 3EDJA 4K71C 2IGTA 4G7VL 4X7TA 2GITA 1CVRA 1OD7A 3KPPB 2R69H 4RISL 4TSCL 2B4CH 5IROD 3D0AA 2EO7A 2XHNA 1BD2B 1JZ3A 3FUIA 5I74B 4FNRA 4C56D 5J0BA 4EKXA 3ZDYB 1CC3A 4MSWB 3W5MA 1SDYA 4JHUA 1RULH 4W9GC 5G4OA 3DXAD 3KYKH 4EVNA 4LRNH 4JPIB 2X4QA 4I18C 3HCVB 4E9VA 4NUJB 1DO6A 4FD0A 1S7RA 4R97B 1IEHA 1MRCH 2DS4A 4R7NB 3KPQB 4JHAL 4DGWC 3RIAF 4I77H 2OL3L 4P06A 3ZKSD 5KS9F 1P1VA 4GRLB 4DGUA 3QK0A 1JS4A 1KENH 4TUOA 4PJBB 1UWEH 3RVTD 1S9XB 1CXEA 3TBBA 3ARBB 3CFKB 3T04D 1LEKA 1IFHH 3MV7A 1SBSL 2JV6A 1BZ9B 3O6FB 2E7LA 3NCMA 4HSAC 3RWDA 5I75B 1DZ0A 3LQAC 1BEXA 1ZE3C 1MJJA 4J3BA 1G0DA 3LS4L 4PRHB 4P5KA 2Q8AL 4XPGH 4WUKL 4DH2A 3FO2A 3MNMA 5C0BA 1M7IA 2LTQC 5DQ9A 3DVIA 1G4MA 3LEXB 3FSOA 4M7ZC 1XSIA 1ZLVK 2BVUA 2J43A 3RPBA 4A55A 1ADQA 2DQMA 3IF1B 4NC2B 3IMVA 1E6OH 4LOFA 3AQXA 1AP2A 1YEHL 2ROXA 2PW1B 3MUHL 1VPOH 4L37A 2J56A 4MGXA 4TVSa 1BWMA 3WJLA 4Z7WE 3TT1L 1IC5H 2NY3B 4MMXA 1ZTXL 2YRPA 3VFGH 5ICZA 3UAAA 4U1LA 3EZ8A 3IGAB 3QIWB 2CK2A 3U0WL 3BIBX 3V0VA 3UZEA 5F0PB 2VDLB 4OH2A 2FGWH 2GFBA 1B0GB 3T6WA 2OCJA 2XJLA 4OZGE 5I26A 3SDXE 3D4ZA 5FR3A 1ES0A 4EXKA 2DQ6A 1F11A 4RMWA 5EO0A 3GSUA 3O0LA 1CD1B 1E4WL 1QUNB 1TEFA 1BJ1J 1URIA 2W0FA 3QEHA 4MAUL 1IEAB 2WLLB 1MF2H 3MV11 1U93A 3MBWB 4LFHG 1RQ5A 1UJ3C 1JZFA 2FYYA 1BVNP 3EYQC 1CE1H 5I73C 2AJUH 3GXDA 3H42L 3MX0B 3ATDA 1UZ8B 3SPVA 4JFPB 3BQVA 4I85A 4OSUH 4LVNC 2B8OT 5F7DA 2GAZB 4JJHA 1ML0A 2ZOUA 3L3DB 2ICCA 1PCXA 1WO2A 3QDJB 3T2PA 4DSYA 1S7QA 4GG8A 5F7EH 4X9BA 4HJ1A 5HYJD 2R8SL 3D08A 5KSVB 4JO3H 1UD5A 3H54A 1Q72H 3MAWA 4CVUA 4HC1A 1SHMA 2UV3A 1GGBL 25C8H 5F89B 2XYBA 3AM8A 3DRQB 3LKSA 3OKNA 5DMJB 4EI5C 2LU7A 2V7NA 4NRYB 3NJHA 3L1GA 4Z3EA 1H5BB 2BWIA 4OW6A 3JYBA 4HK0B 5SWQB 1AJ7H 2K45A 2MQ3A 4BRVA 4LVOB 4AM0Q 3BZDA 1Z5LA 3H2WA 5C08E 1NBZA 2OMZA 5DTFB 2JSFA 3F12B 1JWUA 3FH8A 3PHAA 5EZOH 1C8QA 4K7PL 5EORH 1GYWA 1I9JH 4ZPTA 5AQ0A 3C5ZD 4PQXA 1T5KA 3OF6A 2WP3T 3EKCA 1JK9A 1VGEH 1JYNA 2EXYD 1RIUH 5JO5B 4AK2A 1ZA6A 3QBTB 3TYGH 1B4TA 3GZPA 3NZHL 1OOAA 5DI8B 2KZ1B 5L7XH 2XETA 2WJ5A 1KEMH 1XF2B 5IEKA 3Q8AA 4B5EA 4PUBL 3N44B 4Q74A 2EO1A 2P5WA 1IBGL 4AXWA 2PYEB 4WO0A 1P7QD 1GKEA 4FFZL 1R9FA 4TNVF 4BFOA 1XF3B 2WYZA 4WFGD 4G8IA 4JRYE 5AD0A 3L13A 3S96A 3T0VA 3GFUA 2H1XA 2QGBA 1NUNB 2NNXA 4LAQL 1URLA 4OD1H 4EUPB 3WN5C 1IGJB 2ZYSA 4CU6A 1N5AA 3U0PA 1S9YA 3GBDA 5EO9A 3WGVB 1KB9J 2OTUA 3HHRB 2VLJB 4GFTB 5IK3B 5T8IA 3QUMH 1TYEB 4AV4A 2VIRA 4RFEB 4QHLA 3JUYA 4KROC 5SWSD 3FONA 3FQXA 4LNVA 2VN7A 1CZ8L 4N2NA 3UIZA 1DQDH 1ND0A 5JDSA 1C08B 1RZGB 3CNKA 3Q13A 1F42A 3VNZA 2P26A 3ILPB 4UQ3B 5HYSB 2XV6B 4IHOA 3UEQA 4U4BA 1ESOA 1JPFB 3OJVC 4HWUA 3WNOA 4BM7A 4QJ3B 4WWID 3WLWD 5KVFH 4ZDHA 4W1TA 2WZPD 2P80A 5A7BA 3CZJA 3BSHA 4Y16B 5TE4H 2R56L 1XAKA 2P5EA 3K80A 2C5DC 2HP4A 3BYTA 1EJFA 2APSA 3GLEA 4ETYA 3D5OF 4LBEA 5DFTA 4GS7B 2GSIB 4WWPA 3QIBB 4HCFA 1J5DA 4G7SB 2C3XA 1VLXA 5DVNA 4BELD 2WKOA 3FSVA 4WLCA 4U7SA 1RPUA 1W0VA 2GJ6B 3EYVA 2FBJH 5LG6A 4XHJD 4OKDA 4MXVF 2V4LA 2B9AA 3EZJB 1TDQA 4JBSA 4ZFZB 5FOBA 4XNUL 2DAVA 1G9EA 1FYTB 1SM3H 2ZPKL 3CMOH 4FQCH 4HZLA 4QXGH 3NAAL 2EVJA 4AE0A 4XP5L 2WCSA 3OQ3B 3WG7B 2F54E 1IILE 1BM7A 3GGWA 5JXAH 4YNYB 2R29H 1CDCA 2BSBA 3LZQA 4GKZB 1Z0NA 4AQ8C 4JL1A 5JOPE 2YGNA 5E5MA 5E9NA 1QBLH 5DFAA 4PJHA 4GY4A 3H9ZA 5IHZB 4ANXA 4A2FA 1D5MA 5EZLB 4FKHA 5DYOB 3MUGA 1OP3H 1LK2A 2B20A 3DX6A 4N2OA 4X8JB 5CFAA 2NY3D 1WIOA 1Q9KB 1D5MB 1OVZA 4KJYB 3PWVB 4YC2C 3WAJA 1U95B 4WFHD 3HBGA 1VACA 1J8HD 4HWBH 1OV8A 3VI3E 1BM3H 2OK0L 5IJVA 4GP8B 2AQNA 3RYMA 3SYCA 4N8PA 2ZKHH 3QRFM 1JZ4A 3I6LD 4L1DA 2CCVA 4X6EA 1CYWA 2DD8L 1HHIB 4KY2A 3QZNA 2PP9A 1F0LA 4MKTA 3OG4B 2ZXAA 3IS1X 4NDMB 5DZ9A 4JG1L 3SDAD 2DQUL 4LCVA 3BMWA 3E6FB 3EJUA 5EZJB 4QRPB 1TTGA 2DEWX 2J21A 2YOAA 2H2PD 3JXAA 4R26H 2CGZA 4X8CA 4B60A 4ZX4A 2ZKMX 1KC5L 1YMME 4HQQL 3OAYK 2MCMA 1T5XA 5T33H 1YNKL 4L2LA 1SHWA 1R24A 2NZIA 5L2KB 3D06A 3KWXA 2V2WB 3STLB 3LKOA 2K7QA 5DJ2B 1Z9LA 2PR4L 4BUHA 4Y16A 3QUZC 2AQQA 4Z7UF 4AGMA 2A77L 3B9KC 3CFJB 4ENZA 2P4AB 3MCYA 4IRJB 4N22A 5CCHE 1KGXA 4EZMA 4HMCA 1LO2L 2XN9E 3P0VL 4IHOB 5SV3A 2Z91A 3ABMB 4PJCB 2A7BA 5DUML 3GMPA 1TQUA 2H2PC 1WAAA 1B4JL 3DHUA 3HE7A 4G6KH 4CRPA 3F04A 4LVEA 5T1KA 2VN4A 2QQNL 1JXGA 5BV7C 1HEZA 4NQCD 3QFJE 4RFEA 2VIRB 1KPRB 2HJKA 4BCYA 4J1UA 3VXUB 2VLJA 2VDNH 3R4RA 4NKOA 1NCCH 1M2VA 2IV8A 1FL3B 1MFMA 1ZD6A 3ASOB 1C5CL 4MZIA 5DUPL 1GGCH 3KWUA 2AKRB 3OKEB 1SYVB 2EIBA 5HI3C 4K3GA 1Q0XH 2ARJQ 2IG2H 3RTLA 4X6FA 2J57A 1A9EB 4HBCL 1HOCA 2VTFA 4U1IA 4WFED 4I18B 3L1FA 4X4XB 5JDJA 3ARGA 3D39B 3V0WL 3W3BA 4GO8A 1DJHA 3B8SA 4PB0L 4KUZH 1HYRC 5EBGA 2QGEA 3HNSH 1U41A 3NCYP 3TF4A 1GMEA 1JNNH 2V2XB 3HR5A 1D9KD 1RH8A 4X50A 3UGXA 4Q6KA 1A7NL 3T09A 2F1BA 5F1IB 1OKEA 1G5GA 3QDMB 3O2DL 1KY7A 1JK9B 2JCCA 4NQSB 4OUUB 2H26B 4U1SA 3R06B 4GG6F 2N1TE 1C9SA 4ZXBB 1WGVA 1BOYA 3CFUA 3DC0A 3CDZB 4JUSA 2O5XH 2NNCA 1NBZB 4KUCD 1Z5LB 2K6ZA 4UOW1 2JKTM 3GBNH 2XWBB 5I1GL 1D9KC 4JO5A 1BXVA 3MUY1 5EDXA 4XXDB 4W9KC 4X80H 2N7SA 4LSPL 2DQTH 2JVUA 5F89A 3PUUA 1SOSA 3QJZA 4F20A 1IAKB 3QR1A 4BZ1L 3QFJB 5JW4Q 4ICWA 1NFDA 3DUSA 1S7QB 4GG8B 3ZT7A 4R84A 3BAWA 1NAMA 4NCC1 1UA7A 2OFQA 1OY3B 3V4PL 2V9TA 1YCSA 3GSNH 5C0IB 1J0IA 3G5YB 1S3RA 3S6CA 2K3HA 3SDDC 1OWWA 3MX0A 5EV7A 3ESMA 1GYAA 3MRFA 3EH4B 1N6VA 3PWUB 3L3KA 1XF5A 4AC2A 2FYYB 4HC1H 3UABA 4HIXL 2AV7B 2XACC 4MNQD 3K4DA 3UTSD 2PW2A 4AQEA 1N3NA 5I1DB 1JAEA 4XXCA 3TCTA 2R1WA 1R0AL 3NJKA 2C9PA 4JQIH 4UQEA 3JWNG 4BFGA 2VXTH 2OKMA 3CLWA 2HLAB 4NHUB 1LMKA 1RZKL 3K2UL 2XPZA 1G9NH 1RIVL 2C1PA 4ODWB 3VWJD 2G9KA 4L18A 1JGLL 4P5SA 4PJFF 3ESUF 2GTZA 5ESVB 2LAGB 4PEEA 4PRIE 2NY1C 4O02H 5HYSG 1QPXA 1QBAA 4RGNE 2G4GA 1CXLA 1PLBA 4IHBA 5ICZB 1OD9A 4YSDA 4N20A 2XDHA 3LHAA 2X10A 1CI3M 4EN3D 3RHWF 2ED6A 2VC2H 4UQCA 3J2PA 1AP2B 1WGOA 4M8QB 2PO6A 1NBCA 3HKZA 5IB5A 1ROCA 5CGTA 4ILDA 4P2QE 1JVKA 4DK6A 3C2AL 3L9YA 3DV4A 5HDQH 4B6ZA 4F8LA 3QQ3A 4Z76A 3S3JA 1LD9B 4LCIL 3GKZA 4LOEA 2X87A 4XP9L 1RZ8B 4L4JA 4N25A 2MOVA 9CGTA 3DVGA 1BF5A 1G84A 4UIKL 1I9EA 1TMQA 2AJZA 1AYRA 4KKQA 2Z31B 3OXRA 3NH7L 5EZPA 1QWUA 5D93C 1T04A 4IKNA 1AMXA 1GMIA 2KUTA 3X17A 1V7ML 3PDGA 4N87A 1D5ZA 4HKZB 5G5DA 3AY4A 2X4PB 3V9CA 2CDGA 3B7RL 2HKHH 3V52L 4PGBB 3O3EB 4O2EA 3HE6B 3JV4A 5E7BA 3JWNE 1RSFA 4ERSL 1SMAA 3DGCR 2DM3A 4F3FA 5EF1A 2O5XL 5D7JC 1IGML 1IFHL 1MELA 3CSPA 3RAJH 4A2MA 1JXFA 1YO4A 3GXUB 3ZQ9A 4I4WB 2B1AH 2QPFA 3MRDB 2VSKB 2JIXB 5DZPA 1X9RA 4Z3GA 4TXVB 3CSBA 3VQMA 2YQBA 1FNLA 3TPUB 4DN4H 3IXAB 2C8NA 3B2XA 3DLQR 3NIDB 2MHAB 5IHUH 5EEYA 1PMYA 4H1LA 1R5VB 1DQML 5B3NA 5KVEL 3VXME 3GBML 4CC4A 2IH1B 4RFOH 1JSYA 3FAWA 2X3AA 1FV1B 3CFQA 3QGVA 3NESA 1NDMB 3S48A 2EE9A 5A3IC 2W0PA 1L7IL 1GS8A 3WEMA 4FQIH 4AVKA 2FEDC 2VDPH 3PWLB 3QFJD 2Z0UA 2EH8L 1LYQA 3FU6A 4HJGA 4Q0XL 1WBYA 3B8YA 5E2VH 5IR1A 3MLPA 1CS6A 1L3WA 3H3KA 2YMXL 4I3RH 2ZUQC 1KFAH 3CHQA 5EU6B 1D5IL 4JHWH 2V33A 3RIFK 1D5XB 2VDMB 5D2NE 1USQA 5ID1B 1S9KC 1PF3A 1A1OB 1MFCH 4MQSB 3IKKA 3T3PB 2D03L 2FB4L 3MZGB 4P59H 1IGMH 1J9QA 5EBLB 1FBIH 2JTDA 2YA0A 2O5ZL 1K4CA 4NPYA 4QIRA 3C5SA 3DYOA 1QKZL 4EXPX 2CLRB 1I9IH 1NPUA 1S7UB 3VA2C 2R9HD 2UXFA 2GW5A 2XPGA 1R5IA 3VMNA 2X1WL 4YHLH 4ZI8A 2IAND 4PGCA 4R2GD 1GC1H 1KNOB 4I9WD 5DA4A 3VFVB 2VXQL 1G7JB 5C0EB 4LMQI 5AZEH 4RZCB 4RNRA 2G75B 4JE4B 2WWMD 2D7TL 2YQ3A 1U8PB 3UADA 4QNPE 5IIEA 4LCWD 1CFMA 4S2SA 2K3TA 2NY7L 2BSDA 4POYA 1I3RB 1HJBC 2O5NA 1UB6B 5CS7A 3APDA 3IFPA 5AYTA 2GBUA 4LNRB 4GBXA 2XBZA 3NJXA 1MSPA 1U8LA 1DBMH 3RUGE 1NCDL 5GRZA 2VLRD 3FQ2A 3ULVL 3IMBA 1T1WB 2FUQA 1AKPA 3EJZC 3Q5TA 1U8HB 2OCCB 4KK9C 2M1KA 1H9VA 3QEQD 2FQDA 2GB2A 1N9PA 3DTXB 2JE8A 1IM9D 5IROC 1F8TH 4WDIB 2E5EA 2R69L 2ZX8A 1LE9A 1XR9A 2IBGA 4YO0A 1JTTA 1MAKA 4RNRB 5GZNA 5ECJE 3DJTA 2JQAA 5FGCB 2GI7A 2R69A 4GSDL 3RVUD 3T4AB 1RULL 3D3VD 3BOVA 3LS4H 4Q14A 4F58L 4RQQB 3H2QA 4Y4KD 2H8PB 5KYXA 3ZKMC 3MUUA 4DUVA 4UV7H 3DOSB 2E7HA 3T6XA 3PQYB 1QHOA 5TQ2H 1OCWL 4WWKA 4U1HA 4Y0GA 5F9JB 2B7DT 3MMEA 2WK2A 4EQ3A 3VCLB 1M71A 2M8XA 3ELQA 1YY9D 2LLGA 5I1GH 1HL4A 1A66A 1U3HD 3DGGB 4H7VA 2EXWC 5TFSH 5E6ID 1UXSB 2ATPA 3UAJA 3VTTA 1NSNH 4MBOA 1CGUA 2FHCA 4MD4B 4N0YL 5EU4B 1VADB 4U7KA 5I1AB 3FTWA 1P7QB 2IADA 4QTFA 3QXVA 3O3UN 4DZBA 5IR1B 1F2XK 1T0NA 4FEMA 5C0JA 1F90L 4TSBH 3KJ4B 3TVMD 4LEXH 3SE4A 4KOCA 3I6KB 1B9ZA 5DT1L 1QSFD 4R7XA 4AGOA 4GW4B 1T22B 4NKDA 3C5JB 2W94A 1KN2L 3LN9A 4H8QA 2NY6C 4WHYG 4FADA 1KLFB 4YDVB 3UJJL 2NY2D 1RU9H 2RA1A 4LOUC 2JB6A 2C3GA 2FJFA 3VRLE 1UXWB 3QUHA 3PF2A 4MNQE 5HGHA 2Y6TE 3ZHNA 3RL1B 5JPMA 2KZWA 3IXAA 2VRKA 5L88H 1JTPA 2NCMA 4OM0H 1I8KA 2K4WA 1SBSH 3FZUC 4UTCA 5CCJA 1ZK5A 4ZUUB 1OW0C 3Q2WA 4JY4B 1Y07A 5FKAA 4YZFE 2ZF9A 1TLMA 5B22A 5LBSA 1IZKA 1K6QH 4LKCA 4NO0A 2F7IA 4LLWA 5LBGA 2NR6D 1U6AL 2A9BA 3SDYL 2AJXH 2B16A 3HZMB 1KCWA 1LILA 3PNRB 5BRZD 4KH2A 1PX3A 3CFNA 4KROB 3T2LA 2PR4H 3JVGC 3O6KL 3IDIA 4HKBA 4LDOB 5AW1B 1LJMA 1KYOK 3HE7C 4PD4J 2HX8A 2BZDA 2C3WA 3KWTA 4NO5A 3VD9A 4WNQB 3GI9L 3M17B 2G3NA 2VL4A 1U21A 4UT6A 3TVMB 2IGLA 2JLLA 3RJOA 2H32B 4ZAKB 3UO1H 1TVBB 1MPAH 2WXQA 2Z31A 3OXRB 1D7CA 4FL4C 4RIRB 4AGPA 1WBZB 2YAMA 2ZIDA 3DVGB 3QUZA 3EGSA 4JW3A 5ELIA 1BECA 5ITFB 1RZ8A 4BQ8A 4FRWA 3NJVA 1F58L 2A6DB 4PN6A 2R0WH 4XNZB 1SYSA 5C7ZA 5LXGH 4F92B 4BD4A 4F2FA 3LZOA 1U3HB 1V10A 5HVFB 1RV6X 2XWEA 5HJ3B 2D73A 4RA3A 3VH8A 4YHYC 4UINL 5I9QB 3RU8L 1ZAGA 5FGRA 1RK0A 1A3RH 1S5HA 2VLRB 1S7SB 2X4NA 4IKLA 4PPTA 4JM4L 1UM6L 4WU7A 3T0AA 2QELA 3X11A 1FF5A 1YQ2A 3KNBA 4GO6B 3LX9A 4C4BA 3CCHB 2DWEB 4ABUA 2A74B 4AYID 5AENA 5IB1B 5HHQB 5ESVA 3UBXA 1X6LA 1FH5L 1FFRA 2ZZUT 2FEDD 5D4HA 4J2XA 3LS5L 1QRNE 4KMTL 4NHUA 3WE1A 1GC1C 4AKPA 1I1RA 3LKPA 2EUWA 3SZKC 3D12B 1HVXA 1BZQK 2N0MA 3HR6A 1KLGB 5FDWB 1A9VA 4PGJA 1ETZA 2Z34A 1EUUA 1MPAL 3QIWC 3EGDA 1I8MA 2CO4A 4D7PA 1X3DA 5IV2B 4YXLH 4HF5H 5D2NC 4XWOC 1PLGH 4Y1AE 3D87B 3RGBA 1XD1A 3D09A 3UPRA 4UTAH 3ARGD 1N0XH 4AYMC 3UIYA 3HMWL 5HDWA 3O2WH 4UNVA 3L81A 1KWKA 2O5ZH 3V5HB 2PP7A 4G5ZH 5CD5C 3ME0A 5D7IA 4AUUA 1KACB 2Z6FA 2VDOB 1L9MA 3OZ9H 1UACH 3GJEA 1L9RA 3NN8B 4XMLL 4XMWA 5AVUB 2MQCA 3VAEA 4MB4A 4ELKB 5AFAA 1IVTA 3RAJL 1A4BA 1Z5HA 4ZPVB 4BZ1A 3S36H 2WLZA 3BUYA 1U4EA 3NIGF 2BC4B 5E51A 1CTOA 4E5XA 4XN5A 3U6XS 4ODHH 1D5IH 1HNFA 1GKOA 2FNBA 4L9LB 3T77B 2DM7A 2WSDA 4B0MM 4NKIH 3DI3B 1AGBA 4S0SD 4XXDA 2VM3A 3OL2A 4LL1A 1JPSH 5D9SB 2YHGA 4EF3A 3G5WA 4X4ME 3MDJA 1T7YA 4YE4L 1AO7A 2EYTB 2XVBA 1SN2A 3EFDH 5AKVA 5F3BA 4JMXA 4PRAB 4CVWA 3VX1A 5DHMC 3KJ4C 2J8UE 2X3BA 2RCSH 4HHAA 3I84A 1YPZB 1FFNB 4R4BB 3QUKA 1MW1A 4GUQA 2F1AA 2NLJB 1YMHA 3Q01A 2WTPA 4ZMOA 2Q7AA 4OUUA 2Q8AH 1QPKA 2DWTA 4P4KA 5EDSA 2LHAA 5JQ6H 4MNHB 5C09E 1DANU 4OVVA 4O51A 1KBBA 1P5VA 2X53A 2YGQA 1RJZB 1OSPH 5TE6H 5DD6A 2NX5B 4CADA 1PIFA 3U7YL 1YAIA 1E90A 5E56A 1HINL 5TPWH 4KKAC 5F1NB 1A9EA 4ZMYA 4P3CL 5ES4B 5D2NA 1PG7H 1ZS8A 4PHZA 2YAHA 4MB3A 1DBKL 4NWTH 3O11B 4ONHB 4N90E 1PBYA 2DLTA 5F8RC 3VB9A 1CG9B 1U8OA 2AKRA 2X0UA 3GBLA 3PQYD 4Y2NA 2ZJSL 5I2IB 4Z6AT 1XX9C 1SXZA 1FL3A 3QQ9D 1MIEL 2QL1A 4R83A 3C09C 1CU4H 3T9WA 5HHXH 3S36X 1L5GB 4PJFA 5BNXD 3NZHH 3GINA 4KK6D 4JX0A 1YECL 4N8CH 3Q7JA 5F1SA 3MRMA 1A6ZB 5DJ6B 1NLDL 2WB7A 4JCLA 5GRUH 3S5LB 1PFCA 4JO2L 3PDDA 2BRQA 5FEBA 3NJIA 4GG6E 3DDGA 2K0RA 3PYCA 4X5WB 4PJAF 1SJVA 3OGOE 4QMEA 3HI6H 2JNZA 3U79A 2K9UA 1KYFA 3FT4B 4ELMA 2YGPA 1AD0A 4PLKD 2QVFB 3CVIH 2IAMD 5FAAA 3LHPL 4JKKA 4ZJ9A 2NY5C 3PHSA 1ZA3B 3OLGA 1M3IA 2VITB 2XQYG 5FFLA 3SGDH 1DQLL 4I0KA 1T03L 4GRLD 4APQA 4IGBD 3KPSB 4BSWA 4DIXA 4R4FH 3IB4A 1OLZA 3MRQB 1W0WB 4LSQL 3NZ8B 2L3BA 2ZOWA 4U6XA 5GSVA 5F7FA 4DGIL 3WJJC 3VYNA 3SYAA 1YEFL 3UC0L 4EEEA 4NDMA 2BSSA 2Z8SA 3HHMA 4XCNA 4PRIA 4GXUM 4RGMB 1WS8A 1KY6A 2R83A 5T1DH 3TN0C 5DD5H 4N5UA 1QA9A 3BW9B 2D31B 2DLEA 1QYGH 3GJFB 3JV0A 4P0DA 1VB9A 2RGSA 4RFOL 2X7LA 1E30A 1WTLA 4OZHB 3BFQG 5F0LB 1O5PA 2IQ9H 5FUOL 3ZKXC 3DETD 1U95A 2V7HB 3SY6A 5E08L 1E5CA 2IDTA 2ZUXA 2RTTA 4PVMA 2BNQB 4WI7A 1AFVH 1OP4A 2VDOH 3ASNB 2BSRB 1NGPH 3VQLA 4BZYA 2YQ2A 2ZICA 4AYGA 2IXQB 1A7NH 5T3ZD 2J12B 4HS8L 4IDJL 2J1ZA 5HDBE 2XWXA 3I75B 1H3PH 4XVOA 1PTZA 5BQ7B 2CO3A 3GSNL 4TKWA 3F6LA 1IV8A 4PJXA 5D71H 1KB5B 2Y36H 3VSTA 2EC8A 2RAMA 4H88H 2HG0A 4GKZA 2V3EA 4FTVB 3WN6A 3JVFC 1BVKB 3BPLB 5JOFB 4D7BA 3GGWB 3BIAX 3HZVB 4YPJA 3W9DB 5GS2H 1I1FA 2Y5EA 3RWJB 4F37F 4AL8L 3PL6A 3WV0A 2TSBA 2K8QA 1FYTA 2YPKA 4KXAA 4YHPB 2VJ8A 3QUML 4JANB 4PRBA 5T5FH 4XMKH 1TEYA 1W0WA 5JXED 5EH1A 1MQKH 5LNGA 2QLYA 3L3OC 1WCBB 1JBJA 1CGTA 4APQB 3WNIA 5D7KE 3G5XB 5E1AA 1EFXB 4OF6A 2GSIA 1GYVA 2G60L 4YBHA 1Y0LA 1U92B 5J06A 4OLYL 4EI0A 1BAWA 1DUYB 1NCUA 3UTTD 1NH6A 1ZXKA 2WUBL 3CMOL 3KPNA 4ZFFB 1A65A 4M61A 4E36A 4LSVL 3FO1A 5JORA 2ZX7A 4X2UA 3MV7D 4GXVL 1NC2D 2AK4E 3LRKA 2F7PA 4UILL 5JIQA 1A7QL 3N43B 3P77B 4JQXC 2WHVA 4QWWC 3O6MH 2X2JA 1KJVB 1TJXA 4KVNH 3MLZH 1MREL 5K93A 3ILPA 4UQ3A 3U36B 4BFBD 4KUZL 1TTRA 3QJFB 1XEUA 5KSAC 4LSRH 3CC5A 4M7JL 3K2UH 4NUPA 3OV6A 5FIEA 2ZXEB 1A0QH 2OTUB 1BQKA 2XWJB 4LCUA 5DEGB 3V4VH 2IDFA 3HC3H 4PGEA 5D7JB 5F1KC 4W9FC 3RGVD 3AACA 1CG9A 1U8OB 1QLRB 3M45A 4WW2A 4YDMA 1P4LA 3ZMEA 4NRZA 4M7KH 4ONHA 5AD0B 3VWKB 4IRSC 4X98B 3OB0K 5I19H 1AGEA 3QDHA 5KS9B 5A2AA 3DK0A 1MHEA 2BIOA 5C0BD 4GOSA 5DJXA 1QACA 4O51B 4OV6F 4LESA 4DN3L 1HHGA 3HC0A 5B8CA 1GY1A 3MQIA 3P4LA 2F74B 4V1DB 5K33A 5C2BL 4P4KB 3HMWH 4ODBD 2XV0A 5DCCA 1TZHA 2W9LA 3N9GL 4WWOA 1FFNA 4HD5A 4R4BA 3WGUB 1BJ1H 4AVIA 5EEWA 2EVHA 1UEYA 3Q2LA 4AVHA 4RBPK 1VFUA 1NGZB 3BP7A 3P54A 4DKDC 1LTXA 2EYTA 4M43L 3UAJD 3AAZB 4CA4A 1C1EL 5I16A 3QPQD 1IJ9A 2AJSL 2H1PH 1UGKA 5I8KL 4ZRGA 3QHFL 4X6CB 5CBEA 3SJVB 3LN4B 4UF7C 4L9LA 3CZGA 1FE8L 2X4TB 4GMTH 2Y7QB 3PWNA 4LP4A 5HDBB 3BUYB 2EDQA 4FFYH 4E5XB 5K9QG 4K5LA 1NCAL 1Y1DA 4PJBE 4OJAA 5DVLA 2D7MA 3Q5OA 4OLXL 5JUEL 3QDJA 3SDXB 4QRPD 4AM0A 4LPYA 1DQJB 3IRPX 3NJGA 1B9KA 4OY9A 2CRMA 2BS9A 3BGFC 4BFEA 4JFPA 1I7UB 2XKUA 4PV1C 5E00B 3BT2L 3MN8A 1B2WL 2HT3D 4QRQB 1FCGA 2J1YA 2VQUA 1QSEE 5I0YA 4MZ2A 1PEZA 4CMMB 2DLGA 1I8MB 2CD0A 2WXKA 3EGDB 4RAHA 1F4AA 2F2HA 2DIEA 2W0FB 3QEHB 1SOXA 4MA8L 5D1ZI 1ZGLB 1KXTA 2MJWA 4DP9X 2CZNA 3CN3A 5EO0B 1F11B 2YWYA 3L4WA 5E1GA 4FLQA 3REWB 3RWCA 4ATTA 2Y7SA 4XN1A 5GJTL 5HDBF