2XCMC

Complex of hsp90 n-terminal, sgt1 cs and rar1 chord2 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
b'AKYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLEHGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYTOSOLIC HEAT SHOCK PROTEIN 90
publication title Structural Basis for Assembly of Hsp90-Sgt1-Chord Protein Complexes: Implications for Chaperoning of Nlr Innate Immunity Receptors
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Chaperone/protein binding
total genus 14
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xcmC00
1RL1A 2Y22A 1WH0A 3J07A 4MJHA 1GMEA 2WJ5A 2MNWA 2Y1YA 3VQMA 4YLCA 3L1FA 4YL9A 4I88A 1X5MA 1WGVA 3AABA 2K8QA 2XCMC 5LUMA 5DS1A 4ELDA 2Y1ZA 3QORB 3GUFA 4RZKA 4YLBA 2KLRA 2WJ7A 3L1GA 1WFIA 3EUDA 1SHSA 3GT6A 4JUTA 2RH0A 3IGFA 2N0KA 3VQLA 2N3JA 3N3EA 3Q9PA 3GLAA 3L1EA 4M5SA 4M5TA 4YE0A 2O30A 4YDZA 3Q9QA 4PCKA 2KMWA 5DS2A 4PBDA 2JKIS 3QORC 3QORA 2CG9X 3QORD 2BOLA 4JUSA 4ZJ9A 3W1ZA 3AACA 2CR0A 1EJFA 4FEIA
chains in the Genus database with same CATH superfamily
2XN2A 1U8KB 4JKLA 4UV7L 5F71A 2ZT9C 4KV5F 5C6TH 1T0MB 4PYGA 4TOYL 1E90A 4OAWA 1MHEB 1T0NB 1QACA 1OAUH 4XNQB 3TJHC 1KSRA 1XCQB 4ODUA 5JHBA 4EO5A 2CSPA 4YUEL 1T83A 1JHTB 5AZ2L 3TEYA 1YMME 1LO3L 1OTTD 1TZOA 2WWOA 1ZLEA 1MUJA 2ZOLA 4GS7C 3V52H 2BC4B 1QLEL 3M8OL 3Q9QA 4D9RD 1AP2A 2HLAA 1NGQH 1DVSA 1P9MC 4NUMA 3EXLA 4LRNL 2Q7YB 4PJBA 1Q0YL 5D1ZB 1Y18B 4GAFB 4XP1H 3II1A 4G9FB 2EO9A 4PJEE 1X9RA 2UX7A 4Y7OC 4PTUB 1B3JA 2J8HA 4HPYL 2XUWA 4MMXB 1P5UC 5C0ND 4S2SB 1EJ8A 2UYLA 2BVYA 3GI8H 4MA7H 4OQTL 3C8KB 2CLRB 1MREL 3DIVA 1SN5A 3CHSA 3D3VE 4YSCA 2IG2H 1XH3A 5F21B 3FO9A 4KJQC 2KC0A 3D39D 3M17A 4Y88A 5DURB 2V2TB 5DRXA 2VLKD 3EKCA 5IOPB 5EC1B 2NDGA 2DLIA 3K5RA 4POZD 2X12A 4FXTA 3KWTA 1MCRA 4A2DA 5KVDL 4MD0B 4D9LL 2J73A 2YKLH 4HG4K 1LMKA 3RKDC 5CWSB 4KZDH 4JVPA 5EIIB 5DURD 5HI3D 5F8QC 3TZVC 5JIPA 4G42B 4PUBL 2CO7A 3X1GA 4MMZC 1HHGB 1HXMA 3MAWA 1NIFA 3R4DA 4GAGL 4KFMA 4G8FB 1NLBL 3TVMC 4AJ0A 2G0KA 4UOQA 4E36A 2OYKA 1F11A 2KZ1B 3VFSA 2AQNA 3FFDB 3MJGX 1N4XL 2IDTA 2XN1A 5DS8A 4XBGB 4CADA 3AU1B 4YHZL 1G84A 1NBQA 1PMYA 2JI1A 5BNXD 4B9YA 1Z9MA 3CLFL 4BH8A 1HH6A 2HG0A 3GSOA 4H1LB 1OSEA 1B9ZA 2MNWA 5CBEA 2ADGB 5DEZA 4GAYA 4QD2E 3DMMA 4D0DB 1I82A 4LSUH 4DGVH 4LFHD 1S8DA 3RWGA 4EXKA 1RU9L 2DQUL 2X4OB 4O51B 4UM8B 2FHFA 4QYAA 2CJ3A 3GXIA 3QEHB 3P02A 4PBXA 2HYMA 2V7NB 4QKXB 3QEGL 3FT2A 3PWJA 1BQHB 4PJ8A 4MD5B 1SHWA 4Q9RL 1FG2B 1JZHA 2W65B 3B5GA 4UILH 1NBVH 3CTTA 5J11B 1FL6A 2R56H 1CLOL 4M7ZB 4OGZA 5AEAA 3T0AA 3N85H 3TN0D 1GJUA 4BZ1L 2R0KH 5MI0B 2WLYA 3T3PE 3WHE0 4LL1A 2R1WB 1JPGB 1ZHNA 3HKZA 5DC2A 3VFOA 1MVFA 4PI2A 4YIQB 3WHXB 3LRSA 4HAKA 4NI6A 5CEYA 1CI5A 3EYQD 1D9KB 2WCGA 4DGUA 5GGRB 4ZYKA 1I7RB 1X5ZA 3EF4A 1MCPH 2XSKA 3GTVA 4GLRH 3EDKA 1WBZB 2K6WA 3DI2B 3DXAE 2CHXA 3QZLA 4YDVA 5ISZE 4PBVC 1D9KD 2LT9A 3F5WB 4J8RA 4X50A 4RFOH 3RBGA 1D6VL 2IOMA 4TLUA 1EWHA 2H6UA 5KVGH 5ADPL 5BS0A 1CJYA 4X4ZA 2GC7C 5FOJA 3QDJE 1JWMA 2OS7A 3C5ZC 2B1OA 1UH3A 1OTUD 1UOWA 5FUOL 1QSEB 2A9ML 4ONOA 4FG0A 3QGVA 3GMLB 3D2UA 2YAPA 4KI5F 3QG7H 3S8GB 3V6FB 4YLCA 1HAUA 3S5LA 4YPGA 4R83A 3EYUL 4H5SB 1KBPA 2NX5D 2CM6A 3PAYA 1TFHA 4HQQL 1T1ZA 2OSLA 1TJXA 4X4ME 1SOXA 4RFNC 1CXHA 1KY7A 1YEIH 3FOLA 3KGRA 4M5YL 4CW1B 1XIWC 3QO0A 2IDUA 3TTSA 3BPNB 1O7VA 1I7TB 3U79A 5L88L 4BZ2H 1NKGA 1KY6A 4JNXA 2EKSA 4QF1A 3NCCB 3LSOB 2A1WL 3QNZB 3WNKA 5KG9B 1ZHBB 4L37A 3QCVL 3O3EA 2DQEH 2XTSA 4JEGB 4MQXC 5K93A 1K4DA 3U36A 1KJVB 5T3XE 2VM3A 5KYUA 3DJSA 2WNGA 1CIUA 2BS8A 3STLB 2IJ0C 3GRWA 1MWOA 2YAHA 2DEWX 2IDSA 3B9EA 4LESA 4Z7VE 6PAZA 1NMAL 5C9JA 2ZXQA 4N0CD 2OR9H 9CGTA 4KVNL 4U6YA 2QT6A 2Z31B 3BGMA 4FABH 1JZIA 1HQRB 2I7OA 1KEGH 3RI5F 2Y7QB 3GLDA 1FFTB 4A39A 2G9HA 1E7UA 4NSKA 1LO2L 2H3KA 3ME0B 3B7UX 3BAYA 4QAWA 4TXVB 2LFEA 4N0FA 3G5YA 1Z5LB 4U1LB 3V2AR 2FX8H 6TAAA 3VJ6B 1KN4H 3NPSB 4GSDL 3BKCH 2JQZA 3V0EA 1JNJA 3EO0A 2ZAHA 2DRUA 3IYLW 5L9DL 1WA2X 1J7VR 5AW8B 5GZOC 3T8XA 2L7JA 3ZYOA 4H0HB 4X5RA 3ZRFC 1IC5H 1NFDE 3EDFA 3O81A 3OB0K 2OV0A 3NK4A 1OGAB 4LGPB 5DZ9A 3GS7A 3CFQA 1R17A 4O2EB 5ITBL 5DVOA 3RX7A 3ET9F 3HN5A 3WYRA 3WEBA 4NNXB 4RBPK 4Z0BH 3J07A 3NIDB 5F7FA 3W39B 4PFEA 3UAJA 5I1EL 2XQBH 2E46A 3GSRA 3RU8H 1KBVA 1T4WA 4K07A 4Q4IA 5E1AB 4YO0A 3TPUA 3UBGA 1N0LA 1UWEH 3G04A 3MI6A 4PP1C 5EORL 4N68A 3BE1H 1KXQE 5AZUA 3B5TA 2ICWB 1QR1B 2FEDD 5DMIL 3ZHFA 2ZUWA 1OE2A 4IHOA 2HKAA 4ZFZB 5FAAA 1H6UA 2Z91B 5CJOH 2E7MA 2OTWB 1VA9A 1R3LB 2GITB 2K6ZA 3VRJA 4NZRL 3NFNA 3ELQA 2Y6TE 2Z4TA 4KGLA 4Z95L 2ZX8A 3ZTJG 3S5LG 5DWUH 3A67H 3NAAL 1THCA 3VX0A 2VNCA 3RDJA 2X89A 4IOFC 5LAXA 3GM8A 4OGXH 5GGQL 2H3NA 4GSRA 2YSSA 4ANXA 3N9GH 4RLDA 4ZDHA 2CHDA 3UC0H 4PJ7A 1XF4B 1IBFA 1EXUB 4NN5C 4FZEH 3HUJA 5C0CE 2ZOUA 3MNMA 2VMJA 4IMKA 5IEKA 5G2NA 3T2NL 3PHQB 4MAYA 5I8EB 1NCCL 4LDLB 4OCRH 2N7AA 4NUQA 5I16A 5IUSA 4PREA 3DSFH 1QEXA 1GZQA 4OT1H 2EVJA 3BUPA 4LLYB 1O5DT 2AXGA 4X9IA 2GK2A 4HFWB 5DMJB 3PWLB 1OOAA 2JK5A 3KLAB 5ABAA 1E2VA 4GRWB 4L4VB 3VA2C 4BSVA 2OA9A 3EW3B 4QLRA 5C08A 5DHEA 5C0JB 5HPMA 3FN3A 2UWEF 4G6AD 5EO0B 3VDAA 2H6OA 4FG4A 5JPNC 3MV8B 3NIDF 4F15C 4L4VD 3PQYA 4BUGA 4ODSH 2VL5B 4YHPA 4QCIB 4FZ8H 2GHWB 2WYIA 1VRSA 2HN7A 4R5XA 1N5YL 2VDMB 3G6DH 3ISRA 4JQIL 1KGYE 3MYJB 4XVTH 1JGEA 3S37L 3TJEL 3VNYA 1GYWA 1U8LA 3APMA 4HIEB 4POYA 1OANA 4GPVA 4U49A 3BOVA 4LCCC 4LDOB 4KKBD 4XP5H 5ESQB 3RGVB 4APQC 1YMMB 4HZLA 2CCWA 3V5KB 1AKPA 1A6ZB 4XMPL 1H0DA 4JHZA 4J2XA 3NH7L 4LLAA 2JJVA 2H9GB 4BHUA 2A73B 4WI9A 3C08H 4L0ZA 2Q6WB 3ILQC 5F7BA 1YMMD 1CXFA 2GTZB 4QTIH 1QPXA 3BD3A 1D7BA 4HS6A 1U3HC 3ECVA 3T0WA 4PJEB 1AGFA 4OF7A 3U7WL 4YXHL 1WD8A 2QQQA 4KHTL 2EE6A 3D09A 3RWEB 3IXTA 3EJUA 3DROB 2DMBA 2N1TE 2CUIA 2V37A 5EF3A 3UJIH 2CR6A 1TYEB 3PWNA 5KVFH 2GEQA 3O6FA 3IRCA 4AQEB 2OSYA 3SJVA 1KCSH 4XR8C 2HFFB 2F54E 1EDHA 2C9UA 1F0LA 1NFIB 5FYLD 3MO1A 1TF4A 3UTQB 4X9FA 5TE7L 3F7PC 5FYJE 1J9SA 2ZSVA 2NYYD 2OMNA 3U7YL 1KB5L 3C12A 4GRWF 3D3VD 5E6IA 3F6LA 4KROD 2R4RL 4IOIB 3ROLB 3WUWB 2CMRH 1FNEB 2C7UB 3ZR5A 1ADQA 1A6UH 1NUDA 5MP6H 2CPCA 4ZTEA 2DQHL 5DEGA 5F3FA 1KUMA 3HMXL 3BXNB 3K46A 3HS0A 5D8JL 1IFHH 4I8DA 3K4DA 3C6LC 2HRPL 5H37H 1EHKB 1A1MB 3FUDA 5TE6L 3BKJL 4HJSA 1MRDH 1TT6A 2VLRE 5F7EH 3U2IA 2EIMB 4S1QL 1DLFH 3CN3A 5IBLD 5KANG 3CVHH 2JFCA 2C7FA 4W9FC 2YD7A 4KNQA 5TQ0H 1I1FA 4MX7A 3BPOC 1PDKB 1SVZA 4ZS7L 3VQLA 5LXVA 3T4YA 1L9NA 3GHBL 4NKDB 4OIBA 4KDTA 2I07A 3LVEA 3OPUA 3QEUB 3H9HB 2ARJQ 3IE4A 4ZW6A 3OMAB 1RUAH 3FSVA 2FH6A 3DVNB 4L4JA 4TPRL 3FONA 3L4ZA 4NQCA 3RWJB 2G3MA 1FVDA 1W6WA 4LK4A 4LSDA 3FO2B 3OR6A 1VAHA 3ATBA 5I74B 4KMLB 1P7QA 4JRXE 3SDCA 4EQ2A 5IUCA 4PB9H 4WGWB 3CVBA 4E9WA 3T3PB 2D3LA 1R5IB 1SYSB 3PWPE 1P5UB 3DOIA 1A2YA 4MXWH 5DTFA 4TVPE 5H2BA 1RJCA 2WGXA 5FLVA 1XV8A 4G43A 3R7RA 1BPVA 5HJGA 5LCVL 3SBWC 4BGLA 4BRVA 4N25A 2XWCA 1ZJBA 1EHLL 1UZ8B 1WAPA 4UT7L 3L3GB 1GHFL 2H47C 3O3AA 2FO1A 1B2WL 4WTXA 3DXAB 5ISZB 1BVLA 2Y7NA 3U4BL 1RZKL 1S5IH 2WXJA 3SB3A 5DJYB 5DK0A 5ESAA 4Z76B 2K78A 4UOJA 4P46C 5GJTH 1M6OA 1Q38A 1DBBH 4I7ZC 4HD5A 2M83A 5IHBA 1FE8L 1XGQA 2ENJA 3DXAD 4ZBJA 4MZRA 5ISZD 1NCDL 2W9EH 3NSCA 1ZDSA 1ZDQA 1UCTA 4PPTA 4QHKJ 1YVLA 5K9QI 3QDJB 4PS7A 3P0VL 3SGDI 1JYXA 1V7NL 3MPCA 3GMOA 3ZL2A 1L6XA 5DJ6A 3EUUA 3FCTB 1DUYB 1SLWA 4RVBA 2W80C 1ZWIB 3KWXA 5DQJA 1D5ZB 4L3FA 3SQBA 1R4XA 3CQQA 5LBSL 1TOXA 1RHHA 3FQ2A 3RTQD 3L4CA 3QDJD 4L3CA 3DURB 3X3GH 3II2A 5L2KD 2X0VA 1OAYL 4G7YH 4A2FA 3SPJA 1FNAA 3MCKB 4HT1H 4OKVB 4GUCA 3NTCL 3HRZB 2RCSH 4QHLB 4XZUB 5KBKA 3ATDA 3J2PA 4TSCH 1MWAH 3F01A 4PJXE 3LPGA 2QPUA 2RQEA 4HALA 3UYPB 5HYSA 2NW2A 3L1OL 1ZV9A 1I7UB 4B9FA 5ID1A 1KCUH 3JWOH 1XGUB 3C6SB 3C09C 4M7JL 1BZ7B 4ETQB 4ZXBA 1JNHA 2AAAA 2VZUA 3BQVA 3QCTL 4BQ6A 4MJ4A 3CQFA 1UD8A 4UOW0 1HWGB 2D7NA 4JMXA 5DF0A 2N3JA 3JWDC 3P2DA 1Z9SB 5EZIL 4Z7VB 4IRJA 1VERA 2CGRL 4R2GD 4AQAB 3U6XS 1K72A 2CRMA 3INUL 5T3XD 3A5VA 4PIBA 1TZAA 1FC2D 1Y1UA 4BSWB 4XNXH 3MLSH 3UJTL 4BCXA 3H3PL 4K5OA 2PXYA 1PZ5A 1GY1A 3EGSB 2NR6C 2YRZA 4GSUA 5DC4B 1KCWA 2QDVA 1SY6H 1BLNA 12E8H 1T7WA 4R9HA 1F2XK 3UZVA 1MPAL 1PS3A 3MUZ1 2VDQH 2WY3B 5EBWA 1ORSB 2NW3B 3IMSA 4YFLI 1YEKH 2HMID 5HHXH 3DV6A 4UYPA 2R0LL 2LVEA 5E7FA 2X4NA 3QA3B 1EFXA 3PYCA 5I1KL 3O6LL 2E74C 2FYVA 4I18C 4JM4H 5E23A 3ARRA 4ANKA 1NFDB 4HUWB 5DZJA 3WMPA 4IJ3C 2V6HA 1J05B 4R96A 3B2XA 4X9HA 3GSUA 3ULUE 5DZAA 4HBQA 4L8CA 1L7IL 4NP4H 1KB3A 3CK0H 4OD3H 4XNYH 2BO0A 4XN4A 3BFQG 5EHFA 3WE6A 3QUKA 1PQZB 4AMKH 4WF7A 1FGNH 5EU6E 4HBCL 1T2JA 4UBDC 2NY0D 4GQQA 3L3KB 3A6CL 1IU1A 1RQ5A 4ZFOB 4V1DE 3BWSA 3MJ9L 1RZJC 4LGRB 1PFCA 4D94A 4NFBA 1JZ2A 2QQKH 3CLEH 3SCMD 5EU7E 3CZJA 1X9UA 3L4XA 4RDQF 3KH4A 1XIWB 1WRFA 3TH3T 3ZO0A 4AH2A 4I5BA 1TO4A 1IV8A 3BX7C 1RJYA 2NTFA 1UM5L 3BN3B 4FFZA 4HXBL 4RX4D 1WK0A 1DVTA 1K8IB 1NCBL 2D0GA 4HGWA 4LEOA 1FV1B 3ZTNH 5FHBH 1J86A 2VR9A 3VRLF 4N0UA 2GAZA 3GT6A 4XCNB 2D8KA 5JA8B 3Q1SL 1NL0H 1FPTL 1N5AA 1W72B 2BSSA 2WN2A 3O4LA 2ATKB 4XPGL 5AFAA 5HYSG 1FBIH 1KXHA 2CAKA 4QRTB 4AXWA 3QORD 5B8CC 4KK9C 4Y2NA 4XCCH 2ZUXA 5L8LB 5JIHA 3JVGC 1M56B 3N41F 5C0CB 3RAJL 3DX4A 1JGVH 1PZSA 3MNVB 3EOTL 2OR7A 1OF2A 4KJYA 1NIAA 1T89A 4FLQA 4KPHH 1KLFA 1CYGA 1UJ3A 4S10A 5ABDE 1NIBA 1I8LA 4Z3HA 4J23A 4LZKA 1ICTA 3QFDB 2FX9L 4DGYL 5C0CD 2VN4A 3VI4A 1LE9A 3SN6N 1OSPL 5K39B 3ZO9A 5CJXA 2BHYA 1YN7B 2QR0A 2WWMC 4ZUSB 1UVQB 4ZUTB 2ZKYA 3KPSE 5L4IA 3MV9E 4P3CL 3KWVA 2DI8A 3NJNA 3FUEA 1XCXA 3K74B 1M4KA 3MLXL 4TUKL 1F2QA 4IBTA 1D7FA 4X5LA 5DYFA 5F7MC 3C2AL 3CFBA 4FXGC 3FQYA 1WBYA 3ATFA 2OSXA 4KK6D 3EJSA 1RD6A 5BXFB 3DK2A 3L3DA 2EKJA 2YMXL 5DQ9B 4HJJL 3QXVA 5E8OB 3EJPA 2Y25A 1P1ZB 2JB5L 3MGTA 1UZGA 2DOCA 2VJXA 1U91A 4ZTPH 2BZ7A 4EDWL 4WSJA 1LEKA 3CAFA 4DP6X 1JF5A 1OM3H 2XG5B 2BOLA 4ODWA 1AXSB 2Y6SD 3DOSA 4M62L 5D1QA 2DH2A 1UXLA 5MEQA 4ICWA 1MCBA 1NUNB 4N8VA 3GUTB 4LASH 1OALA 2LV4A 1NCAH 4MNQA 4NRXB 4OCWL 1U4FA 2XNAA 3AXIA 1XGRA 3I6GA 2BPBA 3T0EA 1G9NL 1J0HA 3QUXB 3LZFL 43CAA 3MRPB 1IC1A 4RIRA 5D2LA 2ICWJ 5IJKC 3KYNA 4YGAB 2X88A 5T3ZL 3ZMRA 4FHKA 1IQDB 3QUXD 1R34A 3SPIA 2B5IB 3IJ7A 3PIQA 2EYSA 4FEIA 4HEMA 4ZD3H 1FWXA 2QEJA 1CF8H 2FB4H 3K4AA 2CBQA 3VXNB 5KJRH 4DK3A 4WQOA 2NNFA 2VDKB 2F54B 4WW1B 4D0BA 1KGXA 3NJMA 1DQQB 2FX7L 3NDZE 5CJQL 5EU4B 3QEQD 4KC3B 2PCFB 1OGTA 3QXAA 5HVHB 1G6RB 2WNKA 2XA8L 4CSSA 2DQCL 2EIDA 3M1BA 3JV4B 1BQKA 2BHZA 1ZSDA 4YE0A 5IY5B 1I9JL 1A4KA 3IETA 2F54D 4F27A 5FM5O 3BPCB 4PI0A 4EN2A 1JD7A 1JXKA 3KPOA 1IGYA 3P1VA 1U58A 4FKKA 1FO0B 4PJIA 2F5BL 5FYJD 1NAMB 3VXSE 2FYYB 5F1OB 3TBVA 3X3FL 4XXCC 1IAIH 5CINH 5KBNC 2J5LC 2GI0A 3GZQA 3P9WB 4K9EC 3REVB 1IC7L 3MLYH 3FKUS 5DHMC 4HG4J 4D2NA 2DWDA 2VLRB 4H40A 4ZAKD 2PUQT 3N1FC 2VISB 1X7QB 1U0QA 1T04A 5JOEA 4HJEA 3ULVE 1SBSL 2Q8AL 2R2EA 1T6BX 1OT2A 3ESPA 3IGAB 3JZ7A 4UANA 2DQJL 4WHDA 3V6ZB 2VLRD 3BRFA 4QRQB 3C87A 1KIQB 1BJ1J 4JZJA 3NCYP 1GRWA 3D0LA 2PYEA 4LCCB 4QGTA 5GRUH 2Q8BH 3CXDL 1ZS8B 1SJHA 3LB6D 4GG6E 1RP8A 2BFVL 1KXVC 2B1AH 1P4LB 4O2CB 3MRNA 1IVLA 4PB0H 1W2KT 4WDIB 4KVPA 4X9BA 2F0CA 4AYDC 1WYJA 3LNGA 2B2XL 4ES8A 3WO4B 4JRXB 1FFPA 3MACL 5E08L 5C0DA 2ICEA 2JQAA 1KGWA 2PP9A 4X7DC 3ZL4L 5KW9H 3HPJB 1U3HB 4MCNA 3WLBB 4IJTA 3L5JA 4N8VG 4KX9A 1K5NB 3PWPB 2E4TA 4FQXA 4KWUA 4EMZA 5FXCH 4AV5A 4JRXD 1TQWA 3ZDYF 1Z0MA 5IW1A 1SMAA 2X6MA 2HJFA 5IF0A 2WGNB 1D6EA 4PW3A 3DTDA 3P4OB 4F9PC 2ZCLH 1DBMH 1NOFA 1OPOA 2G30A 2OULB 2C3XA 3II3A 3WTUA 3PWPD 4QRRE 4FQQB 1J9TA 2V9TA 3QHZH 5EFIB 2OLDA 1CZ8L 1X3DA 4DQOH 1H3PL 3EADA 3VWJC 2YOCA 2CA4A 4Y19E 4Z78A 3L2NA 1HK6A 2YAQA 5EN3A 3U6RB 5LNEA 4Q56A 1HYSD 4NC1C 2FR4A 3V4PB 4HF5L 3KL0A 4P5TB 4WIQA 1NLDH 5FUCE 3S36X 1XGYH 3IGKA 3C60C 4AY0A 1L9MA 3HC2A 3NIGE 1FJ1B 1HKFA 4KTEL 3AB0C 3HC3H 5DDHB 4M7LL 3HLAA 1VADA 1EAOA 1CDYA 2IBZY 3C5SA 2WP3T 4JPKL 4P5TD 1CL7I 5IJDC 1UM6H 4Y5VC 5KYYA 1QLRB 2VR8A 3ERXA 1NC4A 4P5SA 3GRWH 4ZMOA 3RFZA 2PETA 3HW7A 2ADJB 1CFTB 3BPOB 3IDYB 4HKBB 4E42A 2O5NA 1JF1A 4N6QA 4Q2ZA 5E9DA 3GSWA 4AK2A 4PJXB 3MJ8B 4M4RA 1JZJA 3VDBA 3QQ3B 4JR9L 4LL4A 3S35X 5CP3H 1R3HA 5CU9A 1K6QL 3MRDB 4HXAL 1T66C 5KWYC 1A6VH 3P73A 4Q6KA 3WJJC 4KUCD 3WL9A 1JYNA 2XRAH 1E4KC 2MIZA 3NFSL 3V0FA 1NDMB 5DRWA 5AUMA 3QNFA 3H7BB 4KZEL 2DW5A 3BW9A 5D4IA 4B9JA 2EDXA 5GS1A 1FNLA 4M8RA 4DVRL 6FABL 1F13A 4QT5B 2IDQA 5IQ9A 1XGPB 3IMWA 4UTAA 1YEEH 3HVNA 5FK9B 3RPBA 1INDL 3MRGB 2BSEA 1TMCB 2RACA 4OFVA 5E1GA 4Q9QH 2JIXA 3WY2A 1GGBL 4U0RB 3HB3C 2NY4D 2Z8VC 3V7AG 5DD6B 2TRYA 4U1MA 5GGSY 2NCMA 4JG0L 5HDBE 2FD6H 3BUTA 4HZAA 7TAAA 3LH9A 1ZHKB 3A23A 3FO1A 2P26A 1JCKA 3E6HA 4W4NA 5B3NA 1LE5B 3RZCA 1PTZA 4HIPA 4PY8I 4FP8L 4KKPA 4J4PA 4FNPA 2N1KA 2VAAA 3L6FB 5IB1B 1G1OA 4GIOA 1QBMH 4AQZA 1MQKL 5BQ7B 3CZEA 5IHUH 3PJSA 4JPWH 3WKYA 3TO4D 2K9UA 4P46B 5AD0A 5GXBB 2PP8A 3LKRB 3FRUA 4NC1E 5AVXB 4IS6A 2VSMB 2A74B 5BW7A 4XOAA 1IGJA 5J0BA 3ARDC 1D5BA 3EJZD 1JK9A 2BINA 3PP4L 3DHPA 4HMCA 4WKZA 1R75A 1JF6A 4LCWE 5MEPA 5HDWA 1KT2B 4ICXA 2YMOA 4LP8A 5IFAH 1QHOA 4Y2OB 1U8JB 3KGUA 5EU6B 4BXVA 5GZND 1F3DJ 2G3NA 3KGSA 5AL0A 3ULUD 5A3IC 3SGJC 4OBSA 3F64A 3M1CA 4IM8A 3W0WA 1KC5H 3E80A 3G6JE 1JG9A 1OCRB 1OSZA 4HKXA 2WLIA 5EU6D 1KJ2L 2VDOH 1OGSA 3HNVH 3HRPA 2HRLA 3FTGA 5C6TL 5EZJB 4LLWA 3VE0B 5IEHB 2BRQA 2YUVA 4GP5B 4V1DD 1UOKA 3C09B 1KLUA 32C2B 3T1FA 4TS6A 3OLIA 4WNJA 3CFUA 1JVOA 5I8CB 2DIEA 4JO1H 3VM5A 4AE1A 5CHNB 5EMYA 3VI3A 3SE3C 2QLYA 4C58B 3ECBB 3BISA 1XCTB 1YMHA 3EJTA 4RMSA 2ATPB 1NIDA 3UG5A 4KMTL 3R1GL 4XPBL 1HHHA 3AGVA 1QNZH 3VGDA 2XIBA 3HAEA 1NGQL 4ZZFA 5JHLH 5D7SH 2AQQA 4PSRA 3GSNB 5EH1A 2HRHA 5CEXA 3BT2H 1INEH 3WKMH 2BH0A 3D06A 3MV01 3KLKA 4JN2A 4U33A 3S88L 4ZMPA 1VF5C 3GI8L 4LAJH 4MA7L 3VD4A 4EZLA 2K8MA 2D73A 4UNVA 2VMDA 3S97C 3KPSB 4GXUN 2DICA 4G71B 3MV9B 2X2HA 2PPCA 4PD4J 1P1VA 1XH1A 5DT1L 1AKJD 4FQHA 4JHWL 5MEND 4Y4KD 3BCDA 4FE9A 4A67A 4JAMB 3MRRB 3V4UH 3LV3A 3U46A 5A2KH 4I18B 3SE9H 3AM8A 1MW0A 3MRQB 4HIJA 5KVDE 4L9LC 1S2EA 3KPSD 1SEQL 1EVTC 1TJGL 2LLLA 3MV9D 4G1EA 3RGBA 5C3LD 2P43B 2BW5A 3H9ZA 4A1RA 1BBJA 1KYUA 3IKCB 4R0LA 2DQGH 1RAMA 2AJXH 1KTDA 5AG9A 2ENQA 4UQIM 2ZUUA 4LCUB 4P3WA 4YMPA 1PF3A 4KHXH 3UBXI 2O6PA 1IX2A 4ODBD 4PMFA 3EYFB 4EOWH 5JHDA 4NO2A 1YUHA 2AF2A 2YJLA 2BOCB 2C1PA 1SUHA 4OFYD 1ZK9A 1BWWA 2JB6A 5DZNA 1E9PA 3LAFA 1OT1A 3FCSB 5E7BA 2GJRA 1A64A 4ZODA 2FWSA 3D4YA 3QUMA 5E1QA 3D05A 2FATH 3OKDB 4DGVL 1UZ6E 4TQIA 4Z7WE 3Q3GA 2ODHA 1BJ1H 2APVA 3IJHB 1YAIA 2MH4A 3KYMB 4BE5A 1QATA 4N1CA 4W4OA 5E2TH 4Z7UF 5E8PA 1OHZA 4FFYH 1ADQH 2LHAA 1YLBB 2IV9A 2XWDA 5GGUA 5I75C 3AABA 5DEJA 4E9VA 4O02A 4UNIA 3NCXA 4E9RA 1X5AA 4UILL 4FQJL 4J3OC 4WI3A 5B8CB 1NBVL 5I8KH 4KY1L 4JM2C 4F9LA 3IDGA 1BEYH 2WXIA 3AY4A 5IQ7H 4PJFE 5KAQF 4X6EA 3TV3H 1E4WL 3AAZB 4DKTA 1A3RH 2VMCA 3UZQB 3GMPA 2OQJA 2Z64C 1XAUA 1E5UI 2OMVA 4EPSA 2G2PA 1NGWB 2W91A 4LOFA 1S9WA 3HI6L 1HXYB 2J25A 3CDZA 1JZ8A 1CFVH 4HX1B 4I77L 3K6SB 3QIBD 4AIZA 1GPOH 4P2RE 3HAEG 2VH5H 4NLHA 4PGZA 2HP4A 1JRHH 1BW8A 1IQWH 1OAQH 3VXSB 1CFSB 4JFEE 3JXAA 4J3UA 4TSAH 1YECL 2WUBL 3FT9A 1AD0B 4GEIA 1HEJC 2CO2A 5GPRA 5IB4A 3ZE1F 3MBEA 1J87A 2N0KA 2VDNB 8PAZA 4UM9B 2D7TL 4LLVB 5HBBA 3VXSD 3LIZA 1FQ9C 4CUCA 4U4IA 1KJMB 2YPLE 5KVGL 3PDOB 5K5YA 1R3JB 3QJXA 3BHBB 4EN3D 5GS2H 4I89A 4BFEA 1UB6A 5HJ3A 5BUGA 4AENA 1DQMH 1DR9A 3BUDA 2DLFH 1U8IB 2J8UA 2JXMA 2BK8A 5HYQA 3PG2A 2YWYA 4DP1X 2FJUB 3EBIA 2WXPA 1WZMA 2A6DB 3ULVD 1CPUA 3W9DA 3QG7L 5FEBA 3KXFA 2G60H 4GG6B 1F6LL 3H9SA 3HE6A 4IDJH 1Z9LA 5C8JA 3RHWK 3DBXA 3GLAA 3QI9A 4FG6D 1DJWA 3QR0A 3PGDB 3B3IB 2NUPB 3ZLQC 5HGAA 4F1SA 1MVUA 3AITA 1ZPUA 4EIBA 1LD9B 3V6OE 1UKQA 3LHPH 3QH3B 4JQXC 2DTMH 3P30H 2P24A 4FQ2H 3B2MA 3O8XC 3CIAA 1RLWA 3GPSA 4YSAA 4GBXD 5C0AE 3IXAA 4U6VL 4X5WA 1IJNA 3WS3B 3GMNB 4P99A 1BGXL 4GW1A 2A6KA 2ZSWA 3DRTA 5DO2D 2VZVA 3QIWC 3X14B 4P2YA 3PL6C 4QRRB 1ITCA 2BS9A 4PBDA 4NBYB 2OMWA 2CBPA 3UTTA 1IC0A 4LVOC 5CMAB 4Y19B 2WK2A 4UT6L 1KEGL 5AVZB 5F97E 3S2AA 4NCDA 4X6DA 4QRRD 2H3XC 1KCVL 4RNRB 5HI5C 3ZIYA 3NIGB 5TE4L 1UKSA 3BWUF 4Y19D 5DFAA 1KULA 4X98A 2DQTH 3ARGA 1KN4L 1MFAH 3CZLA 4N86A 3NABL 4A2MA 4JDEB 4N5EC 5CS7A 3IDMB 4LLMA 2ZAGA 2E27H 3DTXA 2XVBA 2YWZA 4WNQA 5F88B 4FKHA 2BVTA 3ARBC 4PJDF 3HC0B 1JDDA 3BCFA 1MHPH 3AS2A 2ZKHH 5A2AA 1RVFH 2BCKA 5J56B 4P3DB 4UAOB 5DJAB 2VR5A 1BVZA 4X99B 2CLVA 2IBBA 2QVKA 3HG1A 2DQDL 5AVTB 5BQDA 3QR1A 3V7MA 1F6AA 3VXPA 4MA8L 3KJ6H 2XQBL 5TQ2L 3VXQA 3RU8L 2UXGA 2M26A 4ZUUA 4LPYA 1RIVL 3V0WH 1QBAA 1CL7L 5E8NB 1UWEL 3CFKA 4UNTA 4W9CC 4CN1A 1KLGA 3OXSB 1F3DH 1IAKA 3OB0H 4PJHE 3ZYJA 1CDGA 5AZEH 2F7QA 1VCBC 5SV4A 4U1SB 3WNMA 2ITFA 4B9IA 3P9LB 3BIKA 1CURA 4PHZA 2VXUL 1J8HE 4M3KB 1WWWX 1S7VA 4OZIE 2RD0A 3JTSB 1WBXB 5GS0H 2FBJL 4JRLA 4J1UA 3NCJH 4XVUD 2YEZB 3CLWA 2AEPH 1MIEH 1F18A 3A67L 4M48H 4GRLB 4UDUB 1QZNA 4K9JA 4L29A 1T0MA 1E42A 5L4JA 5HDBB 3N40F 3T77B 2Q2LA 1KPUB 2ZJSH 3E6FA 4OGXL 3JV0A 1OO2A 4DFIA 1WE5A 4P9MH 2ZWSA 1T0NA 1W0VB 3OMIB 5TK4A 3UC0L 3F7KA 1RCYA 4HUVB 1KXTA 1JHTA 2I5YL 2QADB 4GRLD 5SX4I 4FYRA 2JKNA 5B1KA 5F7HA 4KRPD 5GRJH 4M4PA 3ECQA 4PRAB 4FRWA 2BC4A 3EDDA 3K71A 1E40A 4OCRL 4X5XB 4Y4HC 5SX5H 2QADD 3LEYH 3DSFL 2VDPB 3TT1H 2GT9B 1AHWC 3VB9A 4ZG1A 1DJSA 5D1ZA 5DSCB 1Y18A 4EF3A 3QJZA 4FFZH 3HBGA 4G9FA 4GIAA 4LDCA 1NIEA 4LCWB 4DJMA 2DQFB 1KTLB 1YSOA 2E6PA 2NY6B 3DUHA 1V54B 4IW4C 4AYBA 4S2SA 5L0QB 3QZPA 5INCB 1NCTA 3OQRA 4Y5VB 3SGKC 1Q72L 3IAGC 4BK5C 5AB1A 3IJ9A 5C6PB 4NBZB 1C1EL 2CLRA 2VE6B 2B4CL 3QUZB 4ANWA 1TEYA 4JDTH 2DTSA 4APXB 4LCWD 1M1SA 1TSHA 4QXUL 4R7XA 2NY6D 4WTWA 3I50H 4F20A 1EO8H 2WLMA 3OZ9H 2AQTA 1LEIB 2V2TA 4ODSL 5BZDB 1N19A 2D7QA 3G6JB 2IADB 4FZ8L 1JIBA 4ENED 3QUZD 3O2WL 3L7EB 5CFHA 1J9RA 5EIIA 1LP9E 4N5UA 2WIIA 3IVKB 2ZP8A 3FU6A 4HPOH 3KG5A 1HHGA 2UY7A 4XP5L 4K94H 4M9PA 3UH8A 4G8FA 2B59B 1UXWB 3N2JA 5KZCD 4Z7AA 5A43C 5JXAL 3N44B 5EUOE 5ETUB 1T66D 3AU1A 4JG1H 1QLEB 1S5HB 2IQ9H 43C9B 1ZVNA 1HL4A 1XBDA 1KG0B 3H3BC 1YPZE 2B9AA 3C08L 3EFFA 4MJ5B 4NM4H 4QPEA 3AREA 5SWSD 1L0QA 1H9DA 1EHAA 2NY5H 3HB3B 3IF1B 3RVWC 3S8FB 3EO9H 4DP0X 1J5IA 5IP4A 4D0DA 4HIQA 4TYUA 4P5KB 3MLWL 4OFKA 1XD1A 1JZ7A 1JGIA 2X4OA 1W0WB 5ALBH 3N42F 4FNUA 4UM8A 2WZ6A 3QEHA 3UZEC 1JWUB 2VR7A 2MOQA 4N2CA 3O0RL 3G9VA 5AOZA 3UJIL 4R8WH 4CBZA 2V7NA 4LSPL 4KXDA 5LG1A 1IAII 5KVFL 1H6FA 3FU3A 4B9CA 2ZAIA 4E68A 4BRJA 2RA1A 3SY0A 5EF0A 2DY2A 4JFYA 1CBVH 4QO1A 4DAGH 2NY2C 4GRMB 1X5HA 3D33A 4ISVB 1WAAE 5JORB 3VFGH 1RZKC 3EJQA 2NXYC 1II4E 3GFUA 1XB3A 3QE5A 4JFFE 2CBMA 4M5TA 5CSZA 3ZBMA 3IDIB 3TLRA 4P4RB 4IKKA 3H54A 4Q0XH 4NT6B 4QHKI 4E5XB 1JPGA 3IFOB 4KJWC 4OJCA 1P6AB 2ZUYA 3IE9A 2BWQA 1JTPA 4ZX5A 1O6SB 4YIQA 3VTMA 2AGJH 4IMLA 4P4KA 2WAHA 1IAOA 1KCRH 4WUUA 5FA4B 5GGRA 3DYMA 2AV7A 1I7RA 1FFQA 1BPLB 3MJ7B 3IMUA 3FF7A 4PLJC 1MRDL 1PEWA 2RJMA 3MXVH 1WBZA 2W0FA 4PLKC 1EA9C 3N5AA 1VFAB 3F5WA 5AW0B 1IGTB 2BNQE 3L2MA 1G7HA 5TQ0L 3UAEA 4WI5A 3G5VB 4NUJB 1FYTA 4IIQC 5FYKL 2E86A 4M1CD 5D71L 1G0XA 4FEMA 4PRIA 4NGHH 2VM4A 2J71A 5E94B 1FZKB 1MLCA 4EAEA 3UGEA 3QDGD 1GS8A 4TQHA 1UFGA 1C5DB 3ATAA 1RUAL 1F45A 1QSEA 3RA7H 4F2ME 3VWKD 1A3QA 4NM8H 3GMLA 2YOAA 3QNXB 2XPGA 1IGFL 1ASQA 1UXSB 4MNGA 3CCHB 3V6FA 4K7FB 2XXFA 3BGFC 3IMVA 2EEXA 2Q2EB 3MOBH 1RUKL 1R3IL 4FXLA 2GUYA 4K7PX 2R69A 4WO4A 5EIIG 4LU5L 2ITCB 5FIEA 2GW5A 1FZJB 4PV1C 2IAMB 1AI1L 3SE6A 1LJMA 2DI7A 1NCWH 4CW1A 1RPKA 1MFBH 1SMOA 2D7OA 4JDZB 1I7TA 1WG3A 5DQDH 5K59E 5ANHA 4NN6C 1BD2E 5D7JB 1LXMA 4LFHG 2C4FT 3DTUB 4P2RB 2IAMD 3I02A 4BUQA 3LSOA 4V11A 2WQSA 2VLJB 3QNZA 5AYUH 5AW9B 1ZHBA 4JFEB 1JZFA 1KJVA 4I0CC 4Y5YA 2WZPA 4DGIH 3U1QA 2OL3H 1XO8A 1GZHC 1TZHB 1R5WB 5D7JD 3STLA 1S5IL 1UFUA 2DV6A 4P2RD 2CZNA 5I6KA 1G9MH 2WCSA 5AYTA 5GJTL 5FV2A 4L9LB 1DBBL 2YPLB 4Q4EA 1GS7A 1BFSA 2Z31A 2EDKA 4QXTA 4HOXA 1HQRA 3ULSB 1REIA 4FNTA 2V8MA 2ICES 3E0GA 5L2JB 1H6EA 3DC0A 2F19H 3T2PA 3FC8A 4GXUM 2YPLD 3ME0A 4UMSA 1KELH 5HHOA 1SVCP 3GBML 1BX2B 1RK0B 1ZA6B 2WSDA 1E9OB 2QLVB 3VD9A 1HINH 2GCYB 4K8RD 4F7CB 4EIGB 3AQDA 2EDBA 1Z5LA 3M1OA 4U1LA 4GXVH 3VJ6A 1A7PL 4G7YL 1Q0XH 4Z0XA 1SOKA 4JKPH 4HT1L 2OXHB 2XXCB 2GFBB 2HT3C 5DUPH 1JAEA 1Z3GH 4EVNB 2O6FA 4TSCL 1MWAL 3SYOA 4CSTA 1MCOL 3NBNA 5ES4B 3MSPA 1OGAA 4WI8A 4RMUA 4AQ8C 3JWOL 2UWEA 4O2EA 3L95B 3HHSA 1BFTA 4NNXA 4OZGF 3ZE0E 5D9SB 4AL8H 5I6NA 3B43A 4Z7OF 4ZQKB 5I75B 3DGGB 4M93B 1T22A 4HUUA 4G8GE 5C0AB 1QNIA 2BZDA 4HPHA 5E1AA 1AMYA 1V7ML 1VFBA 2FT8A 4JM2B 3WI9A 2UY6A 1QWHA 2A77L 3STBA 5LLIC 2WBJA 1QR1A 1QUNB 1LO5B 5HHPB 4Z3GA 2Z91A 2OTWA 3SDDC 4YN3A 2CQVA 4XNXL 4L3ED 1M71B 3FFCE 5GJSH 5D7IE 1VKXB 3OMNB 3S96B 1MI5D 1SY6L 5E6ZA 12E8L 4GKSB 2EIKB 4ZFGH 2VDQL 1IM9A 4PH8A 1LK3H 2HKFL 2EDEA 1N70A 4FD0A 5AW2B 2FBOJ 5BV7B 3CVDA 2OXGB 2O5ZH 1XF4A 2AK1H 1EXUA 5FYJU 1BMZA 1IBZA 2UUDK 1DQIA 2F7PA 3GIVB 1S7TB 4NAQA 4PJAF 2Q9OA 4LPVA 3VXTB 1H8LA 3PHQA 3PJNA 3QFJA 3SDYH 4UTAH 5I8EA 4UZUA 1MJJA 1TTFA 3F62A 3D0VB 3A21A 4LO9A 4IBZA 1VGEH 3C5JB 1WICA 4NP4L 3BUYB 1ECZA 2HTLC 4AMKL 3BMWA 4DPAX 3DPBB 3PWLA 4WI6A 4DVBB 3KLAA 2XBDA 4PJ9C 5TH2B 1TR7A 2XQYA 4PJHB 4MWFB 1ECYA 2KZBA 4N2LA 5C0JA 4QY8A 3ZPDA 1IKNA 4LSVL 3AWFA 5EO0A 2J1XA 1J8HB 1F4YH 3MV8A 2K4WA 4OZIB 2VN7A 3HZVB 4GP4B 4MA3B 2ICWI 2L04A 1F4HA 3DUUA 4IGBD 3HA0A 2HSIA 1QFUH 1I9RH 3GDBA 3ZTNL 2IH3B 1C9SA 4NPYB 1CLYH 1ZLWK 2DMHA 4N26A 2QPEB 3O8XB 1I8IB 1E5BA 4EI5A 3QWRA 1J8HD 2MQGA 3IU4H 4I0PA 4L9DA 1NL0L 3MVSA 3KDMB 3MA9H 1CXLA 1FBIL 5ESQA 2YXFA 3RGVA 3TL5A 5I1IH 4HWNA 1JP5A 3EIFA 3PWVB 4U31A 2IWEA 3PF2A 4MZ2A 3NCYS 2ROYA 3TIEA 5CEZE 1LWJA 3T0XA 1UURA 2H9GA 2A73A 1GTFA 1XAKA 1G1YA 1PKQE 3VFWA 4GW4B 2GTZA 5DJZB 4H25B 4P2OB 5TDOB 2QDWA 1QPPA 3MKGA 1QYGH 3ETSA 4B3EA 3Q7JA 2PW1B 2F9BT 3RWEA 5E8DH 2VZOA 4WWKD 2NRDA 5D7LE 3OMZA 5D96B 3DROA 4LMQI 2ZNWA 5I5MA 2PO6D 4P2OD 3PDDA 5JXED 3ARBB 3DDGA 1XF5B 1BWMA 4O4YH 5CAYB 3MBXL 1M05B 1MY7A 1ID2A 2HFFA 5KSBE 5F96H 3GC3A 3V0AC 2IH9A 1PJ9A 3D18A 3HAEH 3UTQA 2GJ6E 3U25A 1L5GA 2W5PA 4JO4H 2RAMA 2EYRB 5FUZL 3ROLA 5L8KB 3VU1A 3WUWA 4C54A 1FNEA 2C7UA 2X41A 5FDYA 4ZTPL 1LP9B 1OM3L 3APNA 2VTFA 1HC1A 1VFOA 1NCUA 1VEOA 4P9HL 4CNIB 3HNSL 1YYCA 2F8IA 4K3DH 1PYWA 1E5ZA 2CIIB 3L9EA 2JWYA 4ODVH 4Q6IC 5FFLA 5JZ7D 3SQOH 4JQVA 3QNYA 5EUOB 1P5VB 4HS3B 1NCAL 1FIEA 2ZCHH 3ZSTA 2BM3A 2I27N 5T1KB 4M8QA 1CXEA 2A9NH 2E7LC 5FW8A 1WT5A 1U36A 1YPZB 3GEWB 1NM4A 2FRGP 3BQUB 5I6MA 1JPSH 2XQYG 3U9UA 2E7HA 1PDKA 3NOIA 5T3ZE 4OGQC 1KGUA 3ZT5A 5IJBC 1MLBB 4H8QA 2J6EA 1I8UA 4NKDA 1PCSA 1S7XB 3FQUB 2EECA 4ZW7A 3BQUD 4TULL 2DYPB 4ZD3L 3QEUA 3H9HA 3ZDXE 4A7GA 3DRQB 3TF7C 2FB4L 2VIRB 3PAVA 4I9WE 4F3FB 5KJRL 5DJXB 4GXFA 1DO5A 3WEAA 5KSUB 1CYWA 5KTEH 3V0GA 3FO2A 1UTDA 3JUZA 2MPAH 4Y4HB 5I0XA 5D6CA 1P9MA 4JFFB 2VSKB 1EXHA 3EHBC 4GSQA 1KB5B 3TNMB 1LK2A 3VYOA 1I1AD 1MIMH 3GK8H 1ZT7B 2VXSH 3QUMH 4B5ZA 4G8IA 3WXWH 3JT2A 2ZKMX 3ZMNA 1SPDA 4M43L 5DJ8B 1JHLH 1JI2A 2ROXA 3KYAA 3L16A 4AW7A 1R5IA 1SYSA 2ESVE 2V3DA 4HJ0C 1P5UA 2WANA 4Y4HD 4JFFD 5E51A 1GXEA 1IAIL 2XACC 5CINL 3GGWB 3QJRB 1UZ8A 4G6JL 2K7QA 3L3GA 4OCYH 4CILA 3HBPA 4O02H 4M1GL 1KYOK 3DXAA 1B4RA 1ZD6A 5FCUL 2HX9A 3H0TA 4YR6A 3VFMA 5DJYA 1HKLH 1CDHA 2BNQB 2NQ3A 2Q7NA 3O4OC 5CGYD 4Z76A 4NCC2 3GHEH 2LGNA 3HE7C 5HHME 2YZ1A 5AOMA 1A7BA 4PJ5E 1CK0H 5ABZA 1H3WM 4R90L 2X5PA 3TZVA 2FDBP 2HH0H 1XH2A 2DZEA 1F58H 1PG7L 1YQVH 2Y06L 5BVJB 4QWWC 2BWIA 4R84A 3GMQB 1YEHH 4MMZA 4FCHA 2IDCA 4R26H 5IKCA 1SEBA 4LIQH 3TVMA 4AT6A 3G9AB 2ZNXA 5I1JL 1DUYA 4F2MB 5BVPH 1ZWIA 3DLQR 4PB0L 1ZLSL 4NPJA 3WUWG 3U0PA 5J8OA 3FH7A 3DURA 1EJFA 1S6NA 5DA4A 1F8TL 4OLXL 1RURL 4C56A 4O9HL 3V95A 2YPKA 3LIZH 3HRZA 4FFTA 5KW9L 1E5CA 4QHLA 1CU4H 5AAPA 2Z7YA 3OJDB 5LN8A 4H26A 2MKLC 4OW6A 2I60L 1BD2B 1E8WA 3MU3A 1CLVA 5CD5C 1OK8A 4G6KH 4N85A 1U42A 2YQ2A 4WNSA 1BZ7A 4ETQA 4I13B 2ZCLL 1DBML 1HAWA 2F1AA 4NUPA 4C47A 4HZ1A 3P3TA 4I4WB 2MCPH 3TFKD 5CJ8A 3TT3H 5I30H 5E4AA 3G7TA 3WNPA 1DCEA 3VB8A 2E9GA 4OGYH 4YVUA 1XGTB 4MJIE 1SVBA 3MV7E 4Y2DB 1DP0A 1Z9SA 2H41A 4Z7VA 1INQA 2IANE 4KKLC 3HG3A 4AQAA 4N22A 5TGBB 4JFZH 1NLDL 3O2VL 1A7RH 2Q3AA 3KNBA 4OF5A 2YSTA 1S7QA 3DHMA 3IFPA 4MS8C 4Y2DD 3L8QA 1S7UB 4U05A 4K3EL 3EGSA 2VN3A 5J4MA 4PCKA 5C0GB 3LD8C 3V10A 1WZ1L 2PR4L 1E28B 5I1HH 5LJYH 3RL2B 3BKMH 4F80A 2EACA 1FHNA 1C12B 4JFQB 4MQ7B 3HFFA 1WHPA 4XP6H 2FSEA 3GSVB 3IAQA 3QA3A 4HKZB 5EU5B 1NEUA 4YHNB 1U3NA 1B6DA 4OLUH 1XZ0B 4IIQB 4EZJA 3DPDA 1XXFC 1GZPB 1YRKA 4XXWC 4UB0L 2GTQA 2QV4A 4PLKD 1A4CA 1J05A 2D03L 4JFDE 1W8EA 2NT1A 4ORZC 1YDPB 5F3BB 2W92A 3ZE0B 2J5WA 4JMNA 5ENWA 2XRAL 1PQZA 2MQ3A 3LQAL 4G8GB 1OAKH 1SM3H 4Y1AE 5E5UB 1U95B 3SO3C 4EIZC 3AMKA 4NS0A 4OFQA 4RX4A 2VUYA 3L3KA 4XTRC 1R47A 5T5FA 3SY6A 4ZFOA 4GI9A 4L1BA 4FL4B 4PJBF 4F37F 1YEEL 2QGCA 4OJFH 4XGZA 4OCSH 4IU2B 4G8GD 4WW2C 5HD8D 1S7SB 2XWEA 1XIWA 2V9QA 4Q9QL 1LYQA 1UWXH 3LX9A 3UTSE 4WEBH 3FFCB 3TJPA 2WLHA 1AE6L 3SE4A 4AVJA 2NY1D 4NN6B 5D7IB 1K8IA 3ETTA 2HT2D 5LGHL 2YBRA 1FV1A 2HZHA 5HGBB 1QAWA 1A1OA 1F5WA 1JS4A 3CVIL 4LHUB 4IK6A 3QPKA 3KR3H 2Y72A 4XCNA 3ZTCC 15C8H 1N64H 3FFCD 4OI9A 1LDPH 4R7DB 4UQ3B 3IDXL 1W72A 2HJKB 2KDGA 3IPFA 1L6ZA 1BDYA 3QO1A 4CA4A 5DR5H 2WIMA 4QRTA 3W11D 5IHUL 2KPNA 4QXGH 3L4VA 3S3CB 1FVEB 1DQLL 3REWB 4ADGA 3Q05A 4KDVA 2R23A 2JJSC 3ZKMD 1BQSA 4UYQA 5GRVK 5F7LB 3QVAA 4DPRA 1MCEA 1U41A 1JPST 3DX9A 3R0MA 3F65A 4I1NB 3HZYB 1P6FA 2E9WA 5ILTH 2MCMA 4GT7A 5IB5A 3WAKA 3UABA 4H8WH 2EAEA 3WN5C 3D7PA 4ZUTA 1URIA 1W80A 4P23B 4TTDD 3PGFH 3WENA 1SN0A 2EE3A 4NDMB 3LIUA 4ZPTB 4MA1C 5GZOA 4EBQH 1P0SE 2AVFA 1IEAB 1J88A 2VDOL 3NEOA 1SMDA 4OLWH 4P23D 2X2YA 3KM1A 5I71B 3VFTB 3WMQA 1RUML 3CFDB 1G4RA 3W56A 5DQ9A 1YEJH 5C09D 5E8OA 4ODXB 1P1ZA 2K9FB 4JO1L 4Z7QF 4YL9A 3CN4A 3GBLA 2OX5B 5IQMA 3RDTB 3CH1B 4G70B 1OL0A 4FQ1L 4EZMA 1S78C 2XG5A 4ZW5A 4HJ1A 4AZ8A 1AXSA 1FCCA 1VZHA 3F00A 4ZOCA 3RNQA 4DUXA 1H9VA 4FYSA 4XE5B 1D2OA 4G59C 3RKPA 5JHLL 3ZX1A 3GUTA 4ZOBA 4QTHB 3RDTD 2ZUQB 2FUQA 1PPIA 4NRXA 4JREB 3SDDB 4UAHA 3PHOB 2X6CA 4GUQA 1CYXA 4PJDE 1M53A 3BN9D 4C4KT 5A40E 2EC9T 4NUGH 3BT2L 5G4OA 3W9EB 4IBYA 3SGEI 1HZLA 1LEGB 3FNKA 2GQHA 4NZ8A 1VJSA 3AU0A 2PMZA 1YYLH 4GO8A 4J39A 1ID5I 3SDDD 2R1YB 2B9BA 5CEZD 3P11H 1MY5A 1DVFC 1IQDA 1VFMA 3OHXB 4TQPA 2OZNA 3SDXE 1SN2A 5D7LB 3RQ3A 1MVYA 3K1DA 3LQZB 3O9WD 4JY5H 4LOEA 1BVNP 4LAQL 3VXNA 3FU0A 1FNGA 3FTUA 2CIKA 4B5EA 4HWBA 5KSBB 2F54A 1Z5HA 4WW1A 3HI5H 3GRBA 4W70A 1OZTG 1BYOA 4QJ5B 1DQQA 5D7LD 5EU4A 5IROD 5AAMC 2GJ6B 1DYZA 5K9KB 1DJXA 4UQBA 1L4IA 2QMKA 2DQGL 1XEUA 3ARSA 4NNPL 3RB5A 2QGEA 1TZGH 1EDYA 2ZP9A 3B7RL 2X4PB 3JV4A 1YEWA 3NDYE 4KHXL 1DFBL 2QPDB 1IC4L 3APFA 3BPCA 3IU3B 3ZW3A 2HUEA 2GJ6D 3UROR 1NAMA 2FYYA 2YD6A 1VIWA 3MZGB 4JFPB 2GY7B 4TNWF 4XVJL 1HCYA 1HL8A 4YHLH 5JPNA 1JWSB 2EXYC 3HS9A 3Q0HA 4I85A 4W9GC 5JOPE 2J2ZA 1H3XA 1X7QA 2VISA 5K1VA 4QRAA 4HV8B 4ENZA 1FSKC 4LBEB 3L1FA 3NZSA 4R3SB 4W9HC 5EBMB 4XH2B 3IGAA 3V6ZA 2G5BA 2EDLA 4OGAC 4FFYL 3GQFA 4ELME 4QRQA 1KIQA 4N8UA 3TXAA 4AV4A 4IBWA 1UGKA 4C8XA 1DL7H 3TPKA 3LXAA 4WCYH 4LCCA 4N28A 3ZDXB 1I9IL 2WQWA 2MFNA 2Q76A 4KO9A 1ITBB 5C9KA 3PUCA 2DLGA 5T3ZD 1P4LA 4M6ML 5DUML 3TCLB 4AM0A 1BSIA 4WDIA 5IQ7L 2F08A 5FM4A 4FQIH 2KL6A 1A22B 3TV3L 2IQAB 4NO0D 1A3RL 2J6WA 4JX0A 3WDHA 4XHJD 3IKKA 1WFNA 2C26A 1Q9OB 4Q58C 3VW3H 3E9UA 4I9WD 3QHFH 4KXZH 4F24A 5FKPB 2D3NA 4FC3E 5EOQH 3V0HA 2OW7A 4KQ4H 1GPOL 4J27A 1U3HA 3L7FB 5LB1A 3WLBA 1BQUA 4KKCD 4Q9BA 1XB6A 1ANUA 1JRHL 4YXKL 3WNLA 1IQWL 1OAQL 2ESVB 5F7DB 2DLTA 5EOTA 4ZOAA 5BCAA 3VFRA 4XE0A 5FO7B 3NCWA 3P4OA 2JCCF 4Y16C 3A4AA 4GW5B 5FYLL 3RPIB 1SYVA 4HETA 3QQXA 4F57L 3PNRB 4FQQA 5HXMA 4B6ZA 4OV5B 2VN5A 5EBLB 4UV4L 5KVGE 1FNFA 3P4NA 2CXGA 2R69H 4OB5L 5DHVB 3X1BA 2VRKA 4PGBA 3FB7A 2UV3A 3A4FA 2F15A 4EI6A 5E24E 4MRCA 4X6CF 3KL3A 2KBGA 1KBGH 3BIBX 4OF6A 4UQEA 5HHMB 4PJ5B 3V4PA 4P5TA 1QZ1A 5B4MC 5LG6A 4MSWB 1SJMA 5F89B 2EC8A 4ODTH 5BRZE 3JWNH 4Y7MA 3LRGA 4NQUA 1FJ1A 2G60L 4HP5A 3CXHK 5DDHA 5F7KC 4DKEH 4IDJL 3C6LA 5HHMD 1FI8C 1GKEA 3BFOA 1KCLA 4PJ5D 3SOBH 4ATWA 2YR3A 4Q6IB 1OB1B 4GQRA 5E99H 1HILB 5LGKA 2P47B 1E2ZA 3OGCB 4ODHL 3WY1A 2XOTA 4EQ3A 1ZMYA 3L5WB 1G0DA 2ADJA 1CFTA 4ZPVA 3OAWA 5JW4Q 2X2JA 2F74B 4HKBA 4MYPA 4ELKB 3LHPL 2G3XA 1HSAB 1N68A 1DSYA 4PJXA 2F7IA 3MJ8A 5D2NC 1TXKA 3QQ3A 3GBNL 1BFOB 3K6OA 4PJ7F 1U3YA 3CFCL 4I1PA 1QLFA 4WTZA 1QR4A 4TVUA 1KV7A 2C1OB 4PRPB 4MXQD 1NDMA 2R15A 4PRNB 3U1SH 5J12C 2O93L 4YK4C 2QSCL 3VVVA 1DJHA 4MJIB 1ED3B 3CX2A 2CLZB 3MV7B 4QT5A 2P1YA 2H2SC 3EHBB 3H42H 4L4TD 2XETA 5FK9A 4U0QB 3MRGA 5ADOH 3NSYA 4DF9A 1N6QH 3CSYB 2XY2A 1I1YB 1OB0A 4LQFL 4MJID 5DD6A 3MV7D 4LXFA 3VO0A 2KYIA 5F0LB 1ZHKA 4OLVH 3SBWA 1MFAL 2IAND 3TBTB 1LE5A 3IBOA 2YLKA 1X6NA 3QJUB 3L6FA 1UD2A 1A02N 2J1YA 2B4CC 4KQ3H 2VOTA 3P0YH 1IVTA 5BQ7A 2HLFC 5DUBA 3O4OB 4XO5A 3WFDH 1ZXQA 3RVVC 3NT0A 4P46A 3PY9A 3SYQA 5BMFH 3LKRA 3VSTA 1JDCA 4XBPA 3HE7B 4TL5A 4IU3B 3V0JA 2W9LA 3L3HB 2OJEB 4TQEH 1HWHB 4Z5RB 4JANB 3QRBA 3KJ6L 1D5IL 2CNZA 4X8CA 4JFDB 3B6SB 5CCJA 5IMOB 3V0WL 1RXLA 3ZL1A 2WWKO 5K33A 4CAGA 3C2SA 5AZEL 1N0XL 3VH8B 1AZCA 5EEVA 1AQHA 4Y1AB 4JFDD 3DSNB 2ZG2A 3B37A 3S37X 1BAWA 1T4KB 1ZANH 4MBOA 5FO9A 3IPBA 5IK3B 2WQXA 3RBSA 5GS0L 2HTKD 3HNTH 5JPMC 5HP5A 3D4ZA 4ZSOE 4DN4H 4Y1AD 2AEPL 2BIQA 2HFGL 1DANT 2D31B 1J0ZA 2UZIL 4KO7A 5D2NE 3UTSB 3MROA 2GJJA 5LGJB 4ABUA 5EZJA 5C86A 5IEHA 5I82A 2J4WH 3LXBA 3HR6A 32C2A 4X0KA 4P9ML 3T3MF 3T08A 3F7YB 4FFWC 3U0TB 5CF3A 5I8CA 5CHNA 2IPKA 1M1XA 1J0JA 5I9QB 3TCTA 5IW3A 4GRWH 4F7EB 3L9RA 5G5DB 1OSYA 2YPVH 1U2HA 4DKFH 5T3XL 3V5DB 4J3BA 3P3YA 4OD1H 5C0FB 3ARUA 4WTZG 4G8AC 1T03H 3TT1L 3S35H 3FH8A 3GSNA 1QWUA 2BFGA 5DFVC 4ZK8A 4ZW3A 1FN4A 3I2CL 4FFZL 5D1XD 4IRSC 4A7UA 3BVXA 4Q52A 5INDB 3QT2A 2NR6A 4W93A 5PAZA 5LQBH 1SXAA 4O5LL 2NZ9D 4QUOA 1AXIB 1EGJA 2EDMA 3LS4H 2VDMH 1C16B 1DQDH 4ESKA 4F5CE 3KPSA 4Z18A 5AB2A 2X3BA 3TOPA 1NBYB 1FL5B 4A68A 3QQ9D 2IMMA 3I50L 1MN4A 4HSQA 1ZEAL 3KBFA 3MRRA 4JAMA 1BAFL 4UT9H 3LZLA 4E41E 2CUHA 4I18A 3MRQA 4FNSA 1FYHB 4LPWA 1R5VB 3VG9C 5DHDA 2BIHA 2O5XH 2ERJC 5BO0D 2GYSA 2WN3A 4A7SA 5C97A 4Y4FC 4LCUA 2ZUSA 2DBLL 2NY3C 1BXXA 4LSRH 3MYZA 3EDJA 4BFFA 1E5AA 4R4FH 4JFUA 2Z7ZA 1N8ZB 2FGWH 2Y1AA 1NCHA 4J3SA 2BOCA 3RVTC 3RGHA 3FQRA 2GKIA 2VXQL 4NZUH 1V55B 4ZJ9A 3ULAB 5SWZB 3Q8BA 3FCSA 4BK8A 1V3MA 4NXKA 2NY5L 2R9HC 2YEQA 3MRCA 5EBGA 1QTSA 3KW7A 1K2DB 3FU8A 3OKDA 3F7QA 1SGKA 3ZRCC 4F8OA 2ALWA 5ALBL 1DVYA 2R1XB 3PXJA 3K72B 4P2QE 3G6AB 3HC4L 4XCYB 1DDHB 1OAXH 5KVFE 1V8HA 2XVLA 4XO9A 3SDXB 4A7QA 3MGOB 3TM6A 3PHSA 4ZFFB 4CL7A 2MQ0A 3HEIB 4XNUL 5I6LA 5B8CA 1LO0L 1J8RA 4PVMA 1OTSD 3AGWA 5JW5A 3JVGA 2Y36H 3CSBA 3FRPB 3OC5A 3ALWA 2Y3AA 3AAZA 1CO1A 1I8MB 3PV6B 1WGVA 4XMUA 4OUOA 3CSFA 1NGWA 4HHAB 2COQA 4K71C 1JJUA 4XODA 4XWOC 4HX1A 3K6SA 4CDHA 1FVCB 1IE4A 2J6EH 2X4UA 3WN5B 3CDGB 3FUKA 2BNRA 2CXKA 1J12A 4WJ5B 4PQXA 4OFPA 1Y0LA 1JUFA 1AD0A 2B7DT 1BQLL 2BJML 1CG9A 2BY1A 5DGRA 3SKNB 1P7HL 3LMJH 4MDIA 3D30A 5KAQG 1IM3A 4UM9A 3D4CA 3Q2CA 3C9NA 2XYBA 4H2CA 2Q3ZA 2Z35A 4HFUH 4FXGA 2LE9A 4N4YB 3UDWC 1CLZH 3PDOA 5DGQA 1AZRA 3ZDWA 1SBBA 1R3JA 4QIRA 2EXTA 4H8PA 2WLLB 3JWOC 3N1PC 5FOBB 3FN0H 2YMTA 1U8IA 5TF0A 4ELMB 3FB6A 1T20A 1TETH 4PP2B 2FWOB 3L3JB 3RA7L 2JH2A 4KVCL 4GIPD 1PNCA 4WW2F 3DX6B 4MXVF 3VQ1C 1R0AH 3KBHE 3NZUA 1FGVL 2C5DC 4L05A 1BVKA 2WOBA 1QFPA 2APSA 2MJWA 5EPMB 3QPQD 3LN9A 1EEYB 1E5YA 2WTOA 2XWZA 3ZGIA 3PGDA 1HX0A 3B3IA 4YE4H 1GVIA 1A3LH 4WFFE 4YDLC 1XTMA 1F6FB 4NZJA 5DQDL 2WXKA 5IJKA 5KBDA 4HUKB 1Z66A 3KH3A 2WZAA 3QH3A 4RA0C 3UG3A 1WFTA 3MRJB 3DIFA 8FABB 1DVFB 5E2WH 5AYUL 3W1ZA 3PABA 1CD1B 1VLXA 2K0RA 4E9QA 4XMLH 2LU3A 4RMWA 3B34A 3WS3A 2Y22A 5FGBC 2F6AA 2OMYA 3D25A 3HPLB 4DGIL 2OL3L 3BVVA 3GMNA 3QZOA 1YY9C 1ZA3B 1WEJH 3NZHH 1XSIA 3TA3C 2OMTA 3RZWA 1KN2L 1RIHH 3PGCB 4N6RB 4KXBA 1B0RA 3FT3B 4HJUA 4FLRA 4F8LA 4X2UA 1RH8A 4XCEB 1MJUH 5E00B 1JGLH 2R29A 2GABA 2ZP0T 5BRPA 5CR8A 4F7TB 2CUAA 2P5EA 2QKIC 5FYJL 1EXGA 4YSDA 1ILUA 4RNRA 1G6RL 3TV8A 1FDLL 4L5FH 1VEMA 1C8PA 5BRZB 3TP4A 1KYOJ 1HINL 3BD4A 3LCYA 3ABGA 3AG3B 4XXCA 1FP5A 4GXVL 1KIPB 2B77A 1KFAH 2NXZC 3FT0A 3EOBB 1FO0L 4GH7B 4JDEA 5KSAB 2PWGA 2Y07L 1J9QA 4ZTOH 5F88A 3A24A 3VXUE 4AYMC 3A6BH 4L0YA 3ZVVA 5JIMA 3RWIB 1YEGH 2FJHB 5C2BH 1BP3B 2NNCA 3ZE2F 1FSKB 5DJAA 3VFVB 35C8L 2MOGA 5KSAD 2EZ0C 2GSGB 3THML 3KL5A 2IF7A 2E8YA 3D9AH 1EZUA 4GKNB 3B2UD 3SDAD 2ZYSA 4CSPA 4HKJA 5I5IA 4KK8D 3SKMA 3MLTB 4G6ML 1JXJA 4ZI8A 1Z7JA 1RJZB 3ML8A 3ABLB 1PY4A 2RFXA 4X6BB 3SQRA 1KXVA 3K5SA 4AVHA 1KGJA 3OXSA 4IRZA 4OF8A 3FQWB 4PRHE 3LKSB 2A0LD 2X70B 1MFDH 3OVUB 4U1SA 4JHUA 4YX2H 1NA8A 2XIDA 1NGXB 3P9LA 4FQLH 3G08B 3QUYB 4NO3B 3SPGA 3O41B 1PCXA 1MH5A 2V4LA 1CCZA 4F8TA 3ZY7A 5IVNA 1BHGA 2Y1VA 3BVTA 5I8OL 2X6UA 2P48B 3JTSA 3S3PA 4Q14A 5SV3A 1USQA 1IFGA 1AANA 5CUSL 3QUYD 3UO1L 1AGCB 4GRLA 4UDUA 1TEFA 4LCIL 4PN6A 4ZFGL 3T77A 1IBHA 3GO1L 2EDDA 3OAUH 4Y16B 4B9KC 4F9PA 1W0VA 1NWOA 1G7LB 4EUPA 2AK1L 3ARFB 4XB7A 4HUVA 1A7NH 2M1KA 2P8MB 2X9XA 2AJYH 3GNMH 5T1MB 1OP3H 1ZXKA 1ROCA 4DN3H 1ET8A 3FQ1A 2W38A 1H5BC 3FQXB 3VWJA 3X11B 1ZLDA 3UG4A 1E50A 4G5ZH 3SDYL 4K3JH 4JPIB 3IWUA 2VC2L 2LVCA 3ARFD 4X5XA 1E2WA 5IQLA 5MEOB 5J7CC 3EYSH 4UIKH 2GT9A 1BXAA 2X09A 3C60A 4L8BB 4MB3A 1MQ8A 1NCJA 5DI8B 2JLPA 5C1MB 5A7BA 1LNUB 2DQFA 2XN9E 1KTLA 2OTUB 4DGWC 1F97A 4PJCE 2OPCA 2O5YH 4Y5VA 4P9HC 3B9KB 1USZA 2ZXDA 1CICD 5CP7B 2VE6A 4XT1C 3QUZA 1RULL 1W72H 2PTTB 1YJDL 3B2DC 5DK3A 1HL5A 5JMOC 4XC3H 4YSUA 2I69A 3FSWA 1LEIA 4WY7L 5BZDA 4PVBA 3G6JA 4FI6A 3B9KD 2IADA 1QFUL 4ZSOB 1HEZB 3OKYA 2G4EA 5EA0H 1D5XB 1MJ8H 1CLYL 3BP6A 5D2NB 1X5MA 4BJLA 4GJTB 2NLJB 4H8HA 3IU4L 1JOIA 1JHKH 1LHZA 2CWRA 1PW3A 3SOTA 3IVKA 3WJJA 4Z7NF 4RISH 2V9RA 3QJTB 1E4KA 3CG8A 5HHQB 3TBWA 1PLGH 1OTTC 3CV5A 4GT0A 2FNBA 4K3GA 3DJZA 4F7PB 4YK4B 2WO4A 43C9A 2NSMA 4FLOA 2HCZX 4DKDC 4DP2X 2IPTL 5DZVA 1CIDA 4I48B 1S9VB 4MJ5A 1UJTA 2TSBA 1BM7A 4JCMA 2YBGA 1X5FA 1UM4H 2QPFA 2E9BA 4IKIA 1QYGL 2VQ1B 4P5KA 3MLUH 3RL1A 4UTBL 5DJ0B 5C0NC 1A6WH 4UQ2A 1NSNL 1W0WA 1HT6A 2XKNB 5DD5H 2ORBH 5J1AB 2V5MA 4OQTA 1SDYA 4XPHH 2Q86B 3QJQB 1M3JA 4FNQA 4MMXC 1YCSA 3KWWA 1J8KA 4JBSA 2O6CA 1YNLL 2DKSA 4CVZB 4POZC 5F96L 1EDQA 1K4CA 1UYWL 4ISVA 1G7PA 4X5PA 1XR8B 5JORA 2W94A 4G80A 3WIHH 4E41B 1UD3A 5JMRA 1AJ7L 4S1DD 4OQ1A 4LLDA 3IDIA 5HI3C 3ARDA 4PJBE 4EUPG 1L9RA 3D5OF 1WQVT 2V5TA 3IJEA 1I53A 2EYTA 4XNZB 4E5XA 3MQIA 3IFOA 2IIJA 4UUJA 2ZXGA 4E41D 3EG9B 2AJ3B 4YS4A 3MN8A 1E8YA 1MDAA 3Q13A 1F4AA 2IH1B 5CM1A 1NANI 5B3JE 3ULUL 1XR9A 3BD5A 1HQ4A 1CVRA 4K3DL 4Z77B 3EXJA 2HVJB 2YD1A 3US0A 3MJ7A 3NSDA 4AG4L 3G3LA 3SGJA 2BVOA 5F0MB 2WVVB 4FTVB 1UWFA 2WXFA 3NJLA 5JPMB 2VDKH 3N0AA 3HFMH 4HWBH 4RAVB 3UBFA 3BUIA 2IPUK 3MRLB 4K2UL 3PDGA 3E8UH 3QFGA 4RESB 4WU7B 3G5VA 4NUJA 4R4ND 5IW6B 3OKKA 2R2CA 4PLOB 1AC0A 1X6LA 1YEDA 5I1CH 1FZKA 2XFXA 4P2QB 3D08A 5CKGA 2IALB 1N59B 1T1XA 3NIFE 5TPWH 3O6MH 3PJLA 3E3QE 3SE3A 1V05A 3QIUB 2G2RB 3QNXA 3RUGE 4D9RE 4OZHF 4Y9BA 1WTGT 2Q3XA 5DD0H 5KTEL 3TN0C 4MAUH 1QUPA 1SNRA 2VMFA 4P2QD 1AY1L 3K91A 4OZGA 3TYFB 2MPAL 2ITCA 4PV9A 1FZJA 2ZWNA 1NC2A 4YQXH 4BZ1A 4OZ4B 4CMHB 5ICYA 5EO1B 3QIUD 1MIML 2HKHL 3GRGA 5J11C 3GK8L 4WRLA 3BH8B 3RVUD 1P4BH 1XWVA 3K8MA 2E56A 5I18L 2AERT 4IRSB 5GSRB 4X80H 4H13C 4HSAC 2OFQA 4JDZA 3EYQC 5EEYA 1A6TB 4JUSA 4P2RA 3OXRB 2EH7L 4LLUB 1T7VA 2EH8H 5JW4N 2VLJA 3N0PB 1X5JA 5IBTH 4JFEA 4MB1A 3Q2VA 1OCCB 2A5UA 5DVMA 2AI0H 4OTXL 5GSVB 1D9KC 2FSDA 4OR1A 5IESL 4YAQB 1TZHA 5IJVB 5HGGS 4F8PA 3FTXA 1JV5B 3P40A 1HKLL 25C8H 2R2HB 3U2SB 4F37K 2GTWB 3X17A 4HOWA 3WTSA 3GHEL 1VB9A 4L9LA 3UEZA 3VG9B 1CDCA 2YPLA 5GGRY 4YEFA 2ENSA 2ERJB 3JTBA 3D85B 4LNRA 4FHBD 4Y4FB 2XV0A 3FSZA 1BJMA 1YQVL 1NUGA 3GSQB 5C3TA 1YAZA 1OTUC 1BYPA 2NY3B 4IOSD 3ULSA 1YEHL 3ZKXC 2ATAA 1G43A 2R0ZH 4NJAH 2EICA 4AUYA 5L2JA 4R26L 2XICA 4CKQA 1DSFL 4LEXH 4R97C 1IRAY 3QAZC 5E5MB 5MERB 3ROOB 1BX2A 3D85D 1ZA6A 3LQAC 1A65A 2GCYA 1SZNA 2KDYA 3JQOB 4L1SA 4F7CA 3GB7B 5K9OA 3BSGA 4P59H 5EB9A 4E5XG 5JIQA 5DZPA 2BOBB 2OXHA 2QSTA 1UEMA 2F8VA 2GFBA 3S6CA 1A0QH 5E0FA 5J06A 5F9JB 5BS0E 2R8SH 1NJ9B 2KUTA 5IM7B 1ACYH 2XWBB 3WMSA 2X4RA 4PWEA 3RJOA 3A4EA 1EUTA 4KBPA 3U4EB 4K73A 4G6KL 1O7DC 5EC2B 4FERA 4XNDA 3OKEB 5D9SA 2B39A 3O11B 1BBDH 1ZTMA 4OZFB 3AG2B 3ALPA 4WFFD 3DGGA 1YNTF 4X0NA 4AVIA 3GBEA 5C0AA 1TNMA 5I30L 4H2AA 2AJSL 2R39A 4JFXB 1IO4C 3QARA 3VTAA 5DJ2A 5IV2B 2PWEA 1NGZB 4JM2A 1GIGL 3AW5A 3CMGA 4OGYL 4YBHA 4XN8A 3SD2A 1E27B 5HHNB 3VMPA 4N0CC 4ADIA 4X8JB 4ERSH 2WKLA 3EOAA 5I5JA 5JHAA 1QUNA 3SYAA 1LO5A 5HHPA 1J0YA 4QRPE 3RTLA 2XVGA 2WSKA 4DK6A 3BDYH 4NQDD 5LN4A 4H4NA 3O45A 1MZYA 4K71B 6PCYA 1J5CA 1M71A 1F42A 4Y2LA 2CR0A 2R2BB 3TA4D 3T0VA 2AXWA 3S96A 1LVEA 3PRZA 4PGEA 3VRIB 7PCYA 5ICXB 1TVHB 4NRZA 4F1ZA 4GKSA 1UWGL 1W16A 3BSZL 3G5XB 1JK8B 1DUZB 4NHUB 5D5MB 4OLEA 1B4TA 1AGEA 1HNGA 5KVEH 2NY7L 2OXGA 2HWZL 1RZIB 2BDNH 2V7HB 1JPEA 1M9WA 4X7EC 3GIVA 3OQ3B 1S7TA 1MWAB 3DNKA 2CGZA 4XAWL 5LVEA 1ZPLA 4BDVA 1CFMA 1JNNH 2R7EB 3VXTA 4QHPA 4JPSA 4ZX6A 1SOSA 1HH9B 4V2CB 3D0VA 3DV4B 5FKAB 3C5JA 3VI3F 3ULVL 3VXUD 3LNHA 3BUYA 3DYPA 2AEWA 5CJBA 3ZDZE 2YUXA 3EF7A 2DDQH 1Y1DA 1KEMH 1GJWA 1ZIAA 1SM3L 1ZKAA 1RPQA 3DPBA 3RWDB 2WUCH 2NX5E 4ZW8A 1RZ7L 2FEDC 2WMPB 3Q6FB 4PV8B 5TH2A 4JCLA 3ZYZA 5IBUB 3DVGB 4MWFA 1J0IA 4AK1A 3U0WL 5J89A 2YD8A 3UIYA 4N8PA 4AEIH 3UTZA 4HS8H 1RZ8B 2J8OA 2MNUA 2VUKA 5J6GA 4WEBL 4OZIA 3HZVA 4ZMLA 1J48A 4P8QA 4K5PA 4MA3A 1WUNT 2ZIDA 4PRHD 4WFEE 3F7LA 4JQXA 4FG2A 1XXDC 2IH3A 3O8XA 1WO2A 1I8IA 3BGAA 4HIIB 5F9OH 4ZO7A 3GI9H 1QFWH 2AABL 4JRYA 4MZIA 5GGVL 3OX8A 2VDQB 3LHAA 2BCMA 1U8PB 1IT9L 3GDCA 4PRBA 3ZKSD 5DVNA 4GG8B 3QIWA 3C8HA 1RIUL 2KT6A 4AYFB 1MEXL 3TC9A 3PL6A 1E30A 2O1AA 5AW6B 3PWVA 4X4YB 5B39B 2O61B 1L9OA 4YC2B 4TUJB 3JV6A 2MKWA 3L08A 4FADA 1M2VB 2YGOA 3ASOB 1N6VA 5D5MF 4J3OG 2QKIB 5DYOA 4GW4A 1S9XB 2A2QT 2BHUA 3O6KL 4H25A 4U1HB 1BZ8A 4JO3L 5DJZA 1Z6JT 5JXEA 5HDQL 1A5FH 3LNFA 4F2EA 2XN9B 2PW1A 3Q43A 4U6XA 4PJCB 1BM3H 5D6DC 8CGTA 4HJIA 1MCNA 4G6AC 5E95B 1NEZB 4NLAA 1OARL 5A16B 1B4JL 3ARBA 3HUJE 2DH3A 3KBEA 3RY6C 5HGDB 4HK3N 2PPFA 1M05A 4S1RL 3VQMA 3M7OA 3WSQL 4EBQL 4B0MB 3JWDH 3FO0H 4X4KA 3WFBH 3NCEB 3AS0A 3HG5A 2VDRH 1LLAA 2WTRB 5F7NC 2OK0L 2CDFA 2EYRA 2KPWA 5KYWA 4GYBA 4F7KA 1I75A 3FUNA 4M3JA 3LRMA 4A6YH 1U3JA 1EEZB 4JQIA 3CN1A 4KKBC 4G7VH 5I6PA 3FBKA 5CEZH 1WA0X 1K9TA 1XF1A 2KKQA 3DX3A 2X0UA 1EGJH 4DESA 3QDMA 1AIFB 4OLZL 4PR5A 4CNIA 4JK0D 4MVBD 2CIIA 3LTVA 4M61A 4X7SH 5EUOA 4HS3A 3RWFA 1EO5A 1B0WA 4OIFA 5T1KA 4WHCA 3DARA 3PQYE 4OCXH 1ORQB 1FRGL 3BUBA 2B8OT 2DJUA 1YPZA 4NUGL 4PJGF 4BBWA 4ONHA 3OG6B 3T2OA 3TONA 1IE5A 1YYLL 1AQKH 3I9IA 3Q9PA 7PAZA 3NACH 4R4BB 1F1AA 1MLBA 2G4GA 4JB9H 3BDXA 3K6FA 4PS3A 3VNZA 5J57B 3FQUA 2H0EA 1UA3A 2DYPA 2WJ5A 3CFMA 2VIRA 2A4CA 4XAKE 4F3FA 3MCLH 2F53E 3DJRA 5IVXE 1W9XA 2WO2B 5M95B 3P9MB 1H5BB 4BFIA 2H26B 2AJZA 2IGFL 4YPJA 2ZOLB 1HIML 5KSUA 2NYYC 2EVFA 5I1LB 1AP2B 1N7ML 1WAAA 2HLAB 1RZJH 1PSKH 3GMMB 3LPFA 3HMWL 4KROC 3KAAA 1NMBH 1LGVA 1BEXA 2H0FA 4JFFA 2J8UF 4Y4HA 4XVSL 1B0IA 1KB5A 5HHVH 3TNMA 5IREA 3ZYIA 4KZCA 1ZT7A 3LPPA 5H4YA 4FA6A 2AEQL 1OLZA 4YDZA 4KNSA 2HPOA 3ZJAA 4N9GB 1T5KA 1Y6MR 3HMXA 4Z9KB 1S9YB 1GAFH 4OLYL 4DP4X 1TNNA 4R7LA 3SGKA 3MR9B 5EEWA 4BK5A 1RMFH 3GGWA 4YZFE 2A99A 3SJVE 3LKOB 5KUMA 3ABMB 4G3YL 3NP3A 4YHLL 5IBLC 3FO9B 2D7MA 1RFDH 3M17B 5F44A 3SIKA 1KIRB 3G5WA 1YNKL 2J72A 2IGLA 3BEWB 4YLBA 3JYBA 5A2FA 4N2NA 2BNQA 4JHAH 4ZMAT 2OZ4L 1COBA 3QQ4A 4FOMA 4AE0A 5DD3L 5AWNL 4YH6A 4MDRA 1LWHA 2ADIB 4MMYA 4DZ8A 5F6IB 5ICZA 1HJBC 4XN7A 3VG0H 5BVJA 1A4JB 1DL7L 1HXMB 3GMQA 4WCYL 1AVAA 3IRPX 3NIFB 2R0WH 3P2TA 4Z3EA 4F2MA 1F11B 1IIIA 1ODAA 4GQPH 5DS8B 3RUGB 4CADB 1DDTA 2CO1A 4DWHA 1GGIH 4EZKA 4GMTH 4KNUA 5IIEB 4BH8B 3W2DH 1ML0A 1WFJA 2BMKB 1B0GB 4X6DF 5J3HD 3OZLA 4E9YA 2V5SA 3VW3L 5D72H 4BD4A 2NMSA 3ZUCA 5HYFA 3UPCA 1ZVSB 4X8XA 5GGTA 4GAYB 5I74C 1F4XH 1XDTT 4YOKA 3OJDA 3RILA 4CU6A 2H7WA 3V55A 3B7SA 1BD2A 3UZEA 2W9DL 1BVNT 5LCVA 3BP4B 2XCMC 3DMMD 3FT2B 4XMXA 3D39B 5FYLE 4RCAA 4PJ8B 4QAMB 2VLKB 4ORGB 5M7QA 4DZBA 3L3OC 1CTNA 1XGTA 2VABA 3L1EA 2XU9A 1C5CL 1CGTA 4LVEA 4G9DA 1J1PH 4XMZA 4PJ8D 1F3JB 3NJVA 1KBGL 3ZQWA 1TPXB 4ZUVA 1ZHNB 3EAKA 2I9TA 5DLML 3MTRA 4KTDH 2YQGA 2AJUH 4ODTL 1CFNA 3LS5H 3V4LA 1YZZA 5CEYB 2QGBA 1JYVA 1S7UA 4NQQA 4I3RL 3SOBL 2EO1A 4ZYKB 5DCCA 3CZUB 3RTQC 5C0GA 2WXRA 4O58H 4AYGA 1E28A 5E99L 1L9QA 2E75C 5LBSA 3RL2A 3WELA 3V79C 5J13C 1J1XH 2V8LA 1C12A 4JFQA 3QXWA 2DD8H 3IN0A 3GSVA 4DO6A 1KCKA 2JKTM 2LAGB 4J8RB 4M5ZL 1XSOA 2DIAA 1P4IH 2FZ3B 3NEXA 1P2CB 3NGBC 4HKZA 1WHOA 4WSKA 4YHNA 5JO5B 3SE8L 5GS0C 4IIQA 3H2WA 1G6VK 4CSZA 4RQQB 2E6JA 1MCDA 2NT0A 1T5WB 2DYRB 2CJSA 3HRZC 1PGRB 2R29H 2VZ1A 1JWMB 1G7JB 2P46B 5DMKA 4GUOA 1YDPA 2J21A 5F3BA 4Z8FL 2Z4QA 2GSMB 5GHWL 5BS0D 3V9CA 3D2UB 1ETJA 2XZAH 3U1SL 3FAWA 5AVYB 1A14H 3TN0B 2R4SL 4K9EH 1QMUA 1L7TH 3V4VH 4R2GC 1N3NA 4QHNA 2MRYA 3L3IB 3D2UD 2K45A 3R4RA 4QRPB 5ADOL 1N6QL 2FQDA 2EO7A 1S7SA 2ZX9A 4JE4B 2BP8A 3RYMA 3M6DA 4DO4A 4BFRA 3FFCA 2W88A 1IBYA 2WWNA 5D7IA 4QF1B 5HGBA 4OLVL 1E6JH 2H0JA 2Y2TA 5DJDB 2EEBA 4QRPD 4LHUA 4NN7C 3O3EB 2HMIC 1K4DB 4L23A 4R7DA 2JELL 2P4AB 5CZKA 4LEEA 4KQ3L 5KYUB 5DC0A 4P0DA 1GZHA 2HJKA 4PHXA 1UT1A 2BSDA 1MNUL 5TF1L 2YD9A 3FOMB 4DIXA 4E9XA 3KYKH 4ECNA 5J6HB 2BSRB 5C9JB 4N0YL 1AFVH 3REWA 3WFEL 2H1PH 3PWUA 2QHRH 3OKLA 4U6YB 3WU1A 4TQEL 1F90L 1I3GL 1JPTL 3ZKXB 5JW4M 5GS3A 3JYCA 3TCXA 3DO3A 4LARH 1CE1H 4R97B 3QAZB 4K8RL 3ZDZB 2LAAA 4AVKA 4N0FB 5L2KE 3G5YB 5ECJE 2NY0C 3VXOB 2RQ8A 1XL6A 2X6AA 1OIOA 2NX5B 4WTQA 5KS9E 2VMEA 2PF6A 2Z1PA 3IFLL 1ZV5A 3MCG1