2XCMC

Complex of hsp90 n-terminal, sgt1 cs and rar1 chord2 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
92
structure length
92
Chain Sequence
AKYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLEHGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/protein binding
molecule keywords CYTOSOLIC HEAT SHOCK PROTEIN 90
publication title Structural Basis for Assembly of Hsp90-Sgt1-Chord Protein Complexes: Implications for Chaperoning of Nlr Innate Immunity Receptors
pubmed doi rcsb
source organism Hordeum vulgare
total genus 14
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04969 CS CS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xcmC00
1EJFA 2JKIS 2Y1YA 2CR0A 3L1EA 3QORC 4JUTA 4M5TA 3J07A 2K8QA 4PBDA 3VQMA 3QORA 1X5MA 3AABA 2RH0A 4PCKA 3EUDA 2Y22A 2XCMC 5DS1A 2N0KA 5DS2A 4YDZA 2MNWA 3W1ZA 1WFIA 2KLRA 1GMEA 2WJ7A 2KMWA 3Q9QA 3QORD 4M5SA 5LUMA 3L1FA 1WGVA 1RL1A 3Q9PA 2BOLA 4ELDA 3QORB 1SHSA 1WH0A 2WJ5A 4JUSA 4ZJ9A 2CG9X 3IGFA 4YL9A 4YLCA 3AACA 3GT6A 2O30A 3L1GA 4YLBA 4RZKA 3N3EA 3GLAA 4I88A 4YE0A 4FEIA 3GUFA 2N3JA 3VQLA 4MJHA 2Y1ZA
chains in the Genus database with same CATH superfamily
1EVUA 4X8GA 3VD7A 2XRAL 4ZUUB 3MBEA 3AGWA 2H3XC 3G5YB 3QFGA 3LQZB 5EUOF 4S11A 1A02N 5BNXD 2XKNB 1XIWA 2VQTA 1F4WH 3RHWF 3SBPA 1XAKA 3MBED 3T3PF 3NZUA 3ZUNC 1PNCA 4Y4KC 1QR1A 2X12A 3LNFA 1P5UB 4HH8A 1QPXA 4QTIL 1XIWD 5T3ZD 3ZE1B 5CFHA 3TFBA 3ULVL 4PG9A 4Q6IA 3IJSA 3WFDL 5KJRL 4FL4B 2DN7A 4AYSA 3ABMB 1OARL 1GS7A 1ZA6B 4PJFE 5GRJL 3ARDB 5AVTB 6PCYA 1RK0A 4LLUB 4QO1B 3MREA 2LTQB 4R7LA 1COBA 3ABGA 2X1WL 4R97B 2QQLH 1YNLL 3BGAA 2DM2A 3WEBA 4WI2A 2RMNA 2VZVA 5E8NB 3SGDI 4Y9FA 3NZHL 1DQQA 1A7OH 1AZNA 4TNFA 5BMFH 4MGXA 2DQ6A 4L2LA 4B3VA 2FHFA 3FSZA 4UTBH 3K6FA 4I9XA 4PWGA 3C6EA 3OHMB 4FS0A 1LEKA 4BZ2H 3QQNA 2FJHA 3T4YA 3QIBC 3MRGB 1AS6A 1RUAL 3B3IA 1EAJA 2CO1A 4Y1SA 5F9WC 4E41A 4BRJA 3N6YA 4HV8B 1MI5A 1PW3A 2C9XA 2R1XA 3CFUA 4NXKA 4DVBA 3GMQA 4TSBL 3HZKB 4U6XA 1D6VL 2VN6A 2VXSL 3FQWA 3KPNB 3HNVH 3PAYA 2Y6SD 4UF7C 2MNWA 5CSZA 1T3FB 2DQIH 3K46A 5I8KL 1FGNL 4XOBA 4KXZH 4OZGB 3EFOA 1YN7A 5AENA 1PZUB 1SOSA 2ZXGA 4JFEB 2F1BA 1NUGA 1I9RL 5EUKB 1RULL 3L7FA 5IWLA 3Q2LA 3UZVA 2AK4A 5I28A 5JHLH 1A5FH 3S35H 4OUUA 4H1LH 1H6FA 2FO4B 5C0FB 2AK4D 1J18A 3MLTA 5TJWK 3BN9D 4XMVA 1Y18B 2YC1A 2R2EB 1CDYA 1NCWH 3GXDA 4PAZA 4FCAA 2ZWSA 4FI8A 2HMIC 2A6KB 2ATKA 2NNAA 3BKML 1YPZF 4EO5A 4X5XB 2Z65C 5FM5M 3DV4A 3FSVA 3UH8A 3CVIH 1MFEH 4TNGA 4J3VA 1X9UA 1ZA3B 3X13A 4TRPL 3DOSB 5DD6B 5AALA 4OCLC 4LLYB 3BSZA 1VJSA 3ZKXC 1HCVA 2C1PB 3Q43A 2NRDA 1TU2A 4NX0A 4HJGB 3SKJH 3ECVA 1BZ9A 4J3OG 4L3ED 4F15B 1Z5YD 1AKJD 5KANG 1MJ7H 4KY1H 1BYNA 5K1NA 1A3RH 4IK6A 4PR5B 4JO2H 3KJ6H 4U1KB 5E8PA 5D9SB 3HZMB 2R1WB 2B5IC 4BM7A 2G0LA 5IB4B 2RR3A 1NCTA 2A99A 4ZUWB 2FX9L 1UD6A 4JFSA 2WVVA 4OCNC 3K6DA 3ATAA 5ESQB 4QRPB 5CJXC 1V7MH 1A4JB 5IFHL 2AQRA 5A7EA 1CICD 5CKAA 1OV8A 1SEQH 3D05A 2HT4C 3INOA 3T6XA 1NC4B 5KW9H 2JCCF 3V6ZA 1A1OA 1T5KA 1KIPB 2W65A 4N2DA 3LN9A 4PWKA 3QDGB 4PJ7B 4Z0XA 4RETB 4Q6YA 1VCAA 4H25A 4PRDB 4F2FA 2VDOH 4ELMA 3ARRA 4PS8A 4OVUA 4P06A 5CP3A 3BP5A 1WFTA 4IRZA 1KGYE 4J7RA 4P9HC 1T7VA 3DI2B 1JHTA 3WE6B 4XPFL 3VAEA 2P5EA 5LGJA 2MPAH 5I6PA 1YVLA 4J6RH 3TT1H 1AG0A 3IS0X 2DJMA 5TF1L 3UG4A 3EO1B 3CMOH 2I07A 2X38A 3HHMA 4HPOL 1BJ8A 3DX8A 2P5ED 3SDAC 3OB0K 3N9GH 5C9JA 2VDRB 2XIDA 2B3RA 4I2XB 2WO2B 3ILQD 4ODTL 2JJTC 1CGXA 4KRNA 2V9TA 1DO6A 1DBML 5CBAA 2BOLA 1KT2A 1E90A 1IAKB 2BDNH 4JQVC 2EVIA 2C7FA 3IRCA 4LP5A 4NNXB 4Q9BA 3QUYC 3HBZA 1FG2B 4GUCA 2OJEB 3K81A 4R0LA 2H7WA 4CVXB 1CIDA 3TONA 1MFDL 1NFDA 3PE9A 1E7VA 2HCZX 2LV4A 2XVGA 4LVOC 4PJ6A 4Y5XA 5EIQA 5CLWA 1FRGL 3KLQA 4ONGH 1JZGA 1KENH 4GINA 1XGQA 4Y19A 3PP4L 1DQML 4K3DH 4W68A 1PSKL 3GXMA 1FIGH 1ZTXE 4Y19D 3D09A 4OM0L 1IU1A 4L48A 4L9DA 3FB8A 3V4VH 4YHPB 1KG0B 2FX7L 2ZE0A 3GSQB 3X11A 3VXMB 3ZUCA 3GKZA 3HIZA 4A2EA 3V52H 4A7TA 1DBKL 2AJ3B 1R3KA 2HVJB 2W07B 1A6VL 4XAKD 3BH4A 3NZSA 4P57B 2MCG1 2R59A 3MGOA 4WZ9A 1DBAH 3GIZH 1N5YL 3HMXA 1WA1X 4G59C 3O3BA 3VFGL 3NEXA 2OR7A 3S96A 3ZE0B 4HIIA 4OLYH 1JCVA 1ZKAA 3S5LA 3CUPB 1GTFA 1F8TH 1OP3H 4J27A 1USQA 1GAFH 3FTXA 4PSPA 1PZ2A 2ITCB 4GAJL 5CMAB 4RGOH 1OAJA 2FJUB 4JREC 1D5RA 2VLJB 2DEXX 3K72A 4JB9L 1XF5A 1AS7A 1JD7A 3BVTA 1QSVA 4B0MB 4MMZC 3BUYA 4LOVA 4WW2A 4LSSH 4M8QA 2LU7A 3LMJH 3W81A 4OZFH 3IGUA 2PO6B 2IGLA 2YMTA 3HI1A 4JM4H 4HAFA 2A77L 4PCSA 3BUBA 3L3KA 4KKPA 4ZMTA 3LB6C 1M6UA 3B83A 4GMTL 1ECZA 4Q2ZA 1NSNL 1PKQE 2L7QA 2FEEI 3BEWB 3GEWB 3SDXF 4FA8A 1NAKH 3WUZA 1FFOB 5IB1B 2OMWA 3B5GA 2IXQA 2Z0BA 4L1SA 5F96L 5ALBH 4J2QA 3OXRA 3MBWA 2F19H 2QSQA 2V8MA 3CVHL 3ZKSD 4EUPA 5KG9A 4ODHL 5AOLA 1X7SA 1YEJL 5LBGA 3EYQD 3QAZB 4TUOB 3K7UA 2QVTA 4P2RB 5DQ9B 5IMOA 5CWSA 4AQZA 4WENB 5EBWA 1XTLA 1D9KC 5I6OA 1AIFA 1AGFB 3JVFC 3MRHB 5SWQB 4OLVH 3T6ZA 4MAZA 2DD8L 2YPLE 4PH8A 1UCBL 4IJ3B 4A55A 4FI6A 3UROR 2EXWC 2WQXA 3BPNB 5HI5D 1A7RH 1AGDB 3V9CA 5D8JH 4ZPTB 1PPIA 2BWQA 3ZTDC 5TPWL 4FG2A 3S36X 1GC1C 2AQQA 5A6LA 5HYJB 1G0DA 4HETA 2CA4A 4AGPA 3KM1A 3S5ZA 4OGQC 1CDCA 4LSTH 1R34A 4F2EA 4KTYA 2NY2D 5MEPA 1SN0A 4AK1A 5IV2B 4JK0D 1SFDA 2FYYA 2GJRA 5AOIA 5IBUG 3I75B 5CJOH 1MIEH 2C4FU 4YO0A 2EXTA 1NEZG 1IB5A 1TYRA 5CBEB 1AHWB 3HLAB 3VE0A 2EVGA 1XEUA 4AZ8B 2KLSA 4Q9QL 1GA2A 4ADGA 4NP9A 2YZ8A 3JTTA 2YMXL 4WY7L 1HSAA 4OLUH 1HWGB 1N4XH 2K6YA 5T5FH 5K39A 4PRNB 1WD8A 3D3VB 5KS9B 1PLGH 3VXUA 3OSKA 5AW0B 5DD3H 5LCVH 1KACB 4B53A 4L3EE 1K9TA 1BVLA 3ZRSA 2DQFA 4Z6AT 3GMPB 5DGQA 3VG9B 5J1TC 2H0EA 3VXUD 4ODUB 5FYKD 4E5XB 2E86A 3F5WA 1FV1A 2Y6TE 3KXFE 4QLRA 3CC1A 1PNDA 3FB5A 4MJIB 1IM3B 4N0UB 3RWGA 4LCUB 5CIPA 5EZJB 2FECI 1JXKA 2DWSA 1AHKA 2IAMD 5HDBF 3KVDD 1JGIA 3OPZH 1N0XL 1KPUA 4PS7A 3P54A 4GB9A 5C86A 4X8CA 5D7IE 4M56A 1DJIA 5C0ND 5IVZB 2Q7YA 2R7EA 1UJ3B 2WYIA 1DQDL 1T22A 4K9EL 3V4PB 1U4EA 1NBCA 3DYPA 3KGUA 2AZAA 3WXVL 4QD2E 1WUZA 3EH1A 2IBBA 4M6OH 2IGFH 4ABQA 3KNBA 5CGMA 1L0YA 1T1ZA 3NJNA 5LB1A 3I9AA 4AH2A 4LLMA 2V2WA 2DQHH 1OALA 2R27A 4GQ9H 1UOVA 4L8SB 5B7MA 1KTCA 1S9KC 3FU7B 5BRPA 1KN2H 2WQSA 2P5WA 3OTTA 5J3HC 4KQ0A 5FFLA 1CLYL 5HYSB 1G7IA 4ZFFA 1NLDH 3AMLA 4PUBH 4X4ME 4AWJC 1YY8A 4WFGE 3FQXA 3VXPB 2P5WD 1LO5A 3IDMB 1ASQA 3SJVD 3L5XH 5A3IC 1LMKA 2N4IA 5MERB 3D9AL 1R4XA 4H88L 2AP2A 1XCQB 2PXYA 3OKYA 1M3JA 5AVVB 5BVPH 3VQ1C 4RFEB 1P4BL 2IDTA 3BFQG 3NCJH 2E7MA 4IIQA 5FA4B 1ZLDA 4YJZL 5TFSH 1J1XL 2PXYD 3B37A 4PJAB 1FNEB 2H26A 5TE4H 4GAGL 2JXMA 3SSGA 4D8PA 2XG5A 4N2AA 4Q56A 4N90D 5T1DH 3GTNA 3E2HC 1A4AA 3SD2A 4N87A 4TTGA 3FAXA 2YGPA 1IC0A 4X98B 3WNPA 1A9EB 5F3HB 5DJXB 3I2CH 2J3SA 4GW1A 4ZX3A 3ZN6A 5C0IA 1EMTL 2WZPA 4WTWA 5GZNA 4ZAKB 4JRFA 1KB5H 4OIBA 5D1QA 4PGCA 5LGHL 1GZQB 5LAXA 1VZHA 5GZND 4P2CG 4BE5A 1AXIB 5D96B 5I2IA 4S0SD 2F1EA 2YA0A 4AL8C 1YC8A 1E6JH 2YGNA 3SY0B 4Y19E 2W60A 4ZXBC 4K71C 1I8MB 4G6JH 2A6IB 5J6GB 4XNUH 1I3RA 2A4ZA 5MEOB 4XAKE 3WS3B 5CJQH 3NPSC 3UO8B 4KRPB 2WLHA 3KWWB 5EIIA 3VG0H 4Y1TA 3DI3B 5FUCC 5CINL 4FRWA 4G7YH 1J10A 5DD0H 1A1NB 3ATBA 4U3HA 4FKHA 3DROA 1KIUB 2GAZA 4FHBD 1S78C 4MLIA 3WIHH 4JZNB 4NQUA 4YDKH 3ZW3A 4UQAA 1AXSA 2VW6A 2KBGA 4UV4H 2X70B 3BGFB 3VA2C 4HV8A 4IU3A 3EJPA 3ARGA 2UXGA 5G5DB 1JPFB 3ZDXF 3AG2B 3EO0B 1TVDA 2ODHA 1IGIL 3ARGD 1CTOA 4LCYB 3N41F 2XPZA 3E80A 3TEZA 3L5HA 3CH1A 2Y5TA 1H3VA 4HUUA 2CAKA 1AMYA 4RAUA 3QG6A 4NHUA 4U2ZA 2WZ0A 4PJEF 2ZUTA 1ADQH 2HKHH 4BGDA 3ETBJ 1IMHC 4LXFA 2EYRA 1Z3RA 2EXYD 4XX1E 4UT7L 3TH2T 4NGHL 4JY4A 3ARBA 4JFED 4DKFH 2EYSB 3QE5A 4Y4KB 4X5LA 3WFHA 1P2CB 4FG6D 3ARBD 1KYOK 2IFFH 4TTDC 4OCSL 4R3SB 3JV4B 4YDMA 4WUUB 4Z7UA 1IGML 4A39A 2J88H 1F56A 5D4QA 4NKMA 1AP2A 1WISA 2AXFB 4JFFB 1ORQA 1VA9A 3G5VA 5BQDA 4LPXA 2ZXCA 3GI9H 3OKOB 5DD6A 2FIKA 3H56A 4XAWH 3RDTA 1QPKA 3U7YL 3IAQA 1RIUL 2AV1B 3H9HA 3WS6A 3F01A 3US0A 4OLZL 2VWEE 3RDTD 4KV5E 4ZT1A 2VSKB 3P73A 3S37H 2OMZA 1T03L 1JZDC 3B2PA 5CILL 2XKSA 5L4FA 5FCSH 3CU7A 1UD4A 3ZJAA 3AABA 1R19A 3HPLB 1HEZB 2B4CC 2BP8A 2DH2A 2KDGA 2OMYA 3N2JA 4YDVB 3QIBB 3UZEA 4MDJB 5F9WB 2ZX9A 4NZJA 1KN4L 2FJSA 1T6WA 3LCYA 4FQXC 4FLQA 5KJ4A 2BXYA 4V1DE 1V5JA 1LTXA 2R69L 2WLNA 3PP3K 4FFYH 4XVJL 2WJ5A 3DLQR 3HG1E 1AD0A 1MCOL 2OFQA 5ECGA 4KDTA 5K93A 5I76A 2X9WA 4YFDB 2PR9A 2WNGA 4XVSH 3UYPB 1NC4A 2JJUA 3QZWA 3FJTA 3DDFA 3KYAA 2VITB 4CN4A 2WCSA 1JF1B 4WI7A 4HAKA 2A74C 3MROB 5HVGB 3RHWK 1CDBA 1NC4D 1U8JA 1ZD6A 3SCMA 1CDIA 5F7LB 1SXCA 4IBQA 4A2HA 2N7SA 1UWGH 4DVRL 5IROA 4NENB 3PNRB 2VL4A 2H6PB 3QDGD 4EDXA 5IVXA 3BAWA 5ESAB 4OFPA 5E6UB 1S9XA 2FUQA 5KBMA 5FYKE 5IROD 4M1CD 1M7IB 1F58H 4N5UA 4J3BA 4K15A 1ZPLA 3VFWA 2HTLC 3S3PA 4MYPA 4X9HA 2WSPA 1KJ3L 1ZHNA 4AGNA 4PGZA 3L7EA 2WBWB 3BCDA 4K3EH 3MYJB 4PJHA 5EOCH 3FCTB 4TNVF 2XTJC 4U0RC 4U7SA 1FIEA 1AQDB 1CDHA 1FNLA 4X6CA 4XH2B 4C56A 2DQIL 2NDFA 4H1LG 4MD0B 2YZ1A 4ODSL 2VDKB 1MF2L 1PFCA 1V3MA 4PVLA 1J9CT 3UTOA 4XO9A 5EC2B 4C56D 1KBBA 3IT8D 3ZKXB 2X7LB 4XCCH 4L8DB 3KJ4C 3A47A 4HC1H 2FH6A 3SPHA 3ZDYE 5H94A 5J9PB 1RUQH 4GI6A 4Y89A 1JVKA 2DI9A 1FO0B 4OJYA 3V8OA 5EPMA 5F3BA 1KWKA 2B5IB 1BQHG 3VXQB 3SJVE 3LKRA 1ZVYA 1I1CA 2PYEE 2I7SA 2HPOA 5E4IA 1IGYA 1KCKA 1WBYA 2WGNB 4DGWC 1KBWA 3CK0L 4JO4L 5J12C 5C0CE 4X5RA 3KPRA 4HFWA 5DJ6A 1Q9OA 3QRLA 5FF6B 3W38A 5H2BA 2LU3A 5E24E 1ODUA 1YC7A 4X6DE 3QJUB 1TJXA 4S1SH 3KPRD 1H0DB 2ZAHA 3L54A 1KYUA 1KCSH 3MJ8A 5EZLA 3ZGHA 1CMOA 5MENE 1RZIA 4XNXH 1EGJA 1DFXA 3HKZA 5DC9B 4QF1B 3CZEA 3JTSB 3JV6B 3QNFA 5JHDB 1KTRL 5TE7L 1SXSA 5EZIL 3D0AA 1LHZA 3EGXA 5C0GA 5L88H 2X9YA 5DS2A 5CEYA 3RNKB 1ZTXH 4WEUD 5CD5D 5IOPB 4OD1L 4APQC 4ELKA 2CM6A 1GZHA 1I8UA 4Z77A 3BMWA 1AJ7L 3ZE1E 2ADIB 1CVRA 3SB3A 3ZHDA 5DQJB 3SDAB 5FECA 4KHTL 1JERA 4P4RB 3OF6D 2CA3A 1EHAA 3INUL 2X41A 3FH7A 4MNGA 4XPGH 1YN6B 4YHLH 3S9DB 1KCBA 3BEWA 5ITFB 4MXQC 5KW9L 1YNTF 1ROWA 4HUCA 4YZWA 5LN4A 4EEEA 3KW7A 3QUYB 2YD8A 2CBOA 5E5RB 3O6KL 1M9WA 4RZCB 4XP6H 4UZSA 1R0AH 1JN6B 4RMVA 1YAZA 2VN7A 3WNIA 2F7OA 4I3SH 4XC3L 3SDYH 3P3UA 1FFPB 4LCVA 3IAPA 3QHFH 1Q90A 2OR9L 4TULL 2D7OA 4EAEA 3V95A 4N2MA 3FYIB 2XVLA 4S1DD 1EUTA 4XB7A 3ZTCC 4HJEA 5CR1A 5CFAA 4PJXB 1J8RA 3PDOB 4ZS6D 3WMPA 2WHVA 3D18B 1KYFA 5D1QC 5D55A 2VXUH 3H2PA 5HDRA 4P3CH 3HNSH 1UOWA 2Z8RA 2BNQA 3DVNA 5AFAA 2RBLA 1E8ZA 1NFIB 4ZD3H 2GEQA 4D0CB 2BHUA 4HYTB 5HYJA 5BW7C 4JFHD 5C3TA 4AE0A 2BNQD 2OX5A 1EUUA 4OZGE 2QZQA 1VEOA 4GLRI 2ICWB 4TPRH 1UJTA 2PCPB 1MHHB 5HYJD 4X6FA 3D06A 1AY1H 3ELAT 4JFEE 3DJ9A 5AVYB 4YFLI 3T8VA 1XB8A 4JREB 3FT2A 4PRAB 5DMGC 5IEHB 3I75A 2AC0A 1R3HB 4PS3A 4DP2X 4K3DL 1XD0A 1PEZA 4MMZB 3SKOA 3SPCA 5L8KB 4YEEA 1AHWA 3GB7B 3JV0A 4NYLB 2F7IA 3SO3C 4ADIA 3UJIH 1UTDA 4HIXL 5E00A 2OSXA 3C09C 3BD5A 2XPGB 5BJTA 2CKBA 2B2XL 3V52L 3NZ8B 3FS9A 4YX2H 1IQDB 2JFCA 2BWDA 3CHSA 3J27A 5HHVL 5HGBB 4BSWB 3CCHA 2X4TA 5I8EB 3FTUA 3CSGA 5AVXB 4GIAA 3QI9C 3ZTEA 4ZX6A 3CU1A 4L4TA 1DQIA 1GGCH 3F7LA 1LM8V 3HRPA 5TGBA 3TA3B 4JO3L 3U2SB 3FN9A 2G3ZA 4RGOL 1PD6A 5DS8A 5F21B 1GHFH 2FBOJ 2ZSVB 3I02A 2P4AB 4KQ4L 4PBWD 3TEUA 3UC2A 5I0XA 1NBYA 4QRBA 2GFBA 2QV2A 3O3EA 1NGQH 1UD3A 1D9KB 4OCYL 4LEOA 4MJID 5CJ5A 1OKEA 4TM9A 2AMGA 2DQTL 3BAKA 5F7MC 1PDKB 1OAXH 1MRDH 4Y8AA 4Z7OB 1W72A 2Y7QA 3UTTB 3UP6A 1P6FA 3OJDB 1BXVA 1K2DB 3V4PA 3B34A 4I1PA 3GXUB 2CPCA 3MRDA 3DO4A 1NFAA 4N22A 4QRPE 3OAUH 5EMYA 3Q1EA 4ANKA 2OPCA 4B41A 4Z7NB 3MLYH 5T1JA 1JRHH 3ZDZF 1B6DA 3NTCL 3IJ8A 3BQVA 5IESL 3VXOB 3T04D 4DEWA 3EGDB 4C8XA 4KZEH 1BZOA 4BCYA 7FABL 3LRSB 2IQAB 3RP1A 5MEQB 3IU3B 4NUGL 3LQAH 4IOFD 4YBLC 3QDGE 3WFBH 4PJ7E 3L17A 4WU7A 2J5WA 3W56A 3P4NA 1HU8A 2W95A 4NZFA 2IV8A 3ZL4H 2V3EA 4D9RE 2H1PL 3BWAA 3M17A 5JXEA 3WS6C 3T0VA 3IJHA 3O8XC 3Q44A 5HJBA 1S46A 5JXED 4KVCH 2I5YH 3F58H 1CGYA 4OLVL 1WAPA 3H53A 4JR9H 4RFEA 2HX9A 5C1MB 3ULUL 4M29A 2VDMB 1BVKA 1BJMA 1FNEA 2CK0H 3T6WA 2NSMA 4I2XE 1BYOA 1KBKA 5E1HB 5HPMB 4XO5A 2HJKA 3VX1A 1GJWA 2EE2A 3CFBA 2QADC 1F2XK 1JZ8A 1DP0A 3IRZA 3QZPA 5KANI 2GITB 5DT1H 5I1GL 4P2QA 1TXKA 1WUNT 1JTPA 4X0NA 3O3DB 3WY2A 5KSBB 2DQDH 3GS0A 5CP3H 4L8CA 1XX9C 2FLMA 4P2QD 4HPYL 3UIZA 4ODXA 5T1MB 4GRLC 3AROA 4GKZA 5F1KC 1OK0A 4XX5A 1CXFA 1XGTB 2EYTA 4NIYE 3FB6B 3BISA 1L7TL 3TM6A 5TDOB 5HYQA 2NTFA 2RGSA 3QEQB 2Z6FA 4G72B 4ISVB 4KX7A 1HOCB 4ZQKB 3SCMC 3CV5A 5CJOL 2AF2A 1SJVA 2Y22A 1L0XA 2PN5A 2F08A 3MJ9L 3RGVC 3HN8A 2KLRA 2WJ7A 1KELH 4CNIA 3PGDA 4PHXA 4DQOL 1WGVA 1N8OE 3B4NA 2UX6A 3TNNB 2MCPH 3F7PC 4OUOA 5HTSA 3VXME 5I8CA 1N4XL 1B4LA 4HA1A 4KRPD 2BK8A 1CFVH 3TZVA 1QP1A 4HGKC 4FX5A 4FXLA 5BO0D 4J3XA 1J87A 3CSFA 4AENB 3FL7A 4UQ9A 3VFOB 3ZE0E 3TZVD 1FPTL 5KUKA 5GGVH 4BZ1A 2J2ZB 1CDJA 1DSFL 4NWUL 5G5DA 2Q87A 1G6RL 3VH8G 8FABB 3ZL2A 5DHVH 2VLJE 3U83A 3EJRA 5CCKH 1I3VA 4KKQA 4DWHA 5C7XL 4PI2A 4X4XB 2CGYA 4X4YB 3CLFL 3H54A 4EN3C 1H3UA 1IKNC 3PV6A 1DLHA 4PLKC 5A16B 3SIKA 1HL9A 4RLDA 4L23A 1MUJA 1P7BA 3BGMB 2XWRA 5E6RB 1CE1L 4YSEA 3N40P 3T3MB 1M05B 1WZKA 3E2HB 4ZFOL 2XWTB 2P28B 1T0MB 3QWNA 1TENA 3B2XA 3QO0B 4N2OA 1P2CA 3WN5C 3ULVC 1JPSL 3M1CA 4KJYB 1MCFA 4PUBL 4LESA 3IXTB 4R3SA 4Y4KD 1QFHA 3NN8B 1L9MA 4P2RE 1N64H 1Y6KR 3WFCH 1PL3A 2IV9A 2ILLA 3WFEH 4MASA 1HFUA 2AGJH 1BG1A 4XWOC 5EBLB 3FUDA 3M46A 1Q0XL 4PU2A 3FTYA 4YR6B 4L0YA 4ZXBB 2O5NA 1F41A 5BZDA 4K71B 4NM4L 1UURA 4PJ8C 4YE4H 4S1RL 3NPSB 1UM4H 1OPGH 1T4KB 4JAMB 4KO7A 3U4EB 3EUUA 3KPLB 3PQYB 4KI1A 3T0EB 3WN6A 2IPUK 1BFVL 1VACA 1TG8A 4G8IA 5DFVD 3V5DA 4YLCA 1R47A 4JG9A 2X5PA 5DO2C 1NICA 1CUOA 4AGOA 3GXIA 3MLSL 4YDVA 4UQ2A 4MDJA 3LKPA 4XPHL 3L1OH 2VSDA 3J07A 4JJHA 4ABUA 3RTQC 4WCYH 5I1EH 3WXWH 5DJDB 2WN2A 1S3KH 1J0YA 5ICUA 3GMLA 1E6JL 1WFMA 4UQ3B 3RE0A 3VXRB 3P77B 2WV3A 1SHMA 2O5ZL 2FGZA 1ZHKB 4RDQF 4TVPL 4IKIA 5EORH 4ORZC 2QLYA 2AZUA 5CJQL 3I9GL 5FW6A 5C0DB 1C5DA 4PGJA 2NY1D 3Q6GL 1GPOL 4JFPA 1JZ3A 3IXAB 4NENA 4PJCA 3KWUA 2D7QA 2K6ZA 5DD0L 1CF8H 1OGTB 3D3VE 5ICXB 1KCLA 2HG5A 4MJ5B 5KS9E 3D7PA 5B39B 3AREC 1O6TA 1DQLH 3VW3H 4YDKL 1EAPB 5FO8A 3AS0A 2VXVH 3I3BA 1I7RA 3WD5L 4XMTA 2BCKB 3GRWH 5AVRB 4DN4H 4X8JA 1UT2A 3ASWA 4MJIE 1E2ZA 2JH2A 4N0UE 3EOTL 2AABL 3QJVB 5DFTA 4N2NA 1PQZA 4W93A 3V2AR 4U1NA 1FL3A 2F61A 5JPMA 5PAZA 3LRMA 1MJ8H 4M7KL 5KVEE 5FKPA 1IC7H 3MRCA 4NRYB 3D2UB 1VERA 5DVOA 1F00I 5GS1A 1F86A 3OAZK 4K7FA 4UCFA 1ZVNA 1G7PA 4HOZA 1DEEB 4KH2A 5FYKH 4D0BA 5D72H 2YHGA 2IH3B 3KDPB 3P0YH 5ITBL 3BRDA 3LH9A 3TC9A 4AJWA 4AEHH 1A3LH 2XPYA 4GI9A 1T1WB 1KIRA 4OQTA 5D93C 4NAMA 4P5KB 1HX0A 5INCB 2K3TA 2Q7AA 1T4WA 2WXIA 3BFWA 3TFKC 1OXYA 5CEZL 4OKVA 2I27N 3BDBA 4JW3A 1BXUA 4KQ3H 1G7HB 4UIMB 5AOJA 2C4XA 4JDZA 3O3UN 2EIDA 3FT3A 3Q5TA 1R3LB 2CGRH 3S48A 2XN0A 5CXPA 5I71C 2LQRA 2Y1AA 3N0AA 4IGBA 4IBYA 4NQSB 4X7CC 2PWHA 3MMEB 3MRBB 1F4HA 1MEXL 4PJAE 3S7GA 1MCWM 2VDPH 3LD8C 4BELD 2VISB 2NYYC 4JFOB 1MWAL 2A74B 2Q9OA 3JTSA 4F37K 4EXKA 3FCBA 3F3HA 4X99A 3SE3C 5J13B 2GSIB 3L4WA 1OGAA 3P4OA 4MJ2A 4NZRL 1PTZA 4A68A 3UX9B 4A7VA 3WNOA 1OW0A 1QEXA 3RWEA 3H42L 3X2QB 1OGAD 3MI6A 1N26A 2DDQL 3FO1A 4U1SA 5ID0A 1JFHA 2WB7A 3UPCA 2XTJB 3VWJA 4U0RB 4KI5C 3ARFC 3L08A 1VIWA 5AZEL 4XVSL 4YGVB 1XGPB 4YL9A 1ZV2A 2VCOA 4KKCD 5DVMA 5ABZA 1UD8A 1N0LB 3C6SB 3Q0HA 1S7RB 4UAOC 1V8HA 4EOWH 3VFTB 4ZTPL 2Q8BL 3HUJA 3SOBL 1H5BC 5DURB 4PV9A 5FS5A 3MLRH 1JTOA 3KPOB 4ZW3A 4HQQH 3VFNB 5GZOC 2KLTA 4QRTA 4RMBA 1JDAA 2I25N 4O02B 1OM3L 3M1BB 4Z7VB 2XG4A 4F8PA 5C0RL 1P1VA 2A9ML 4KDWA 1I4FB 3LHPL 3TH3T 2QSCL 1YQVH 4S0HA 2EDMA 3I3DA 5IFJA 2NLJA 2JB6A 4G6KL 3M6DA 3MV9B 5T1KB 4GW4B 4ONOA 3H6AA 32C2B 2OMVB 3IKKA 5FK9B 4J12A 4QHLB 1F6LL 5J12B 2R0LH 2WWOA 3FU0A 5D5MF 3V0WH 2CBTA 2OZ4A 1A7NL 3NACL 4D0CA 3PWUB 4P2OA 3SPIA 4W9HC 5C3LD 4G5AA 1ZVSB 4PREA 2BSBA 3BEVA 4GKSA 4H5SB 4Y9CA 4XCCL 1EQWA 1MDAA 3NA4A 4P2OD 4HC1L 4NI6A 3GSNA 3CXHK 4HS8L 4YUEL 5AVSB 3CZLA 3SZKC 4Z3IA 3THMH 1MHCA 4N8VG 1WF5A 3SKUD 3O6FC 3Q01A 2YA2A 4NLAA 3LKNA 3WNNA 4UQCA 2MKWA 5TK2A 1MVUB 2FIRT 2O30A 3MLZL 2FUTA 3OMNB 5CLZA 1SBSH 3KPMB 4ZUSB 3AWEA 1XGZA 4L4VA 4BQ9A 4QT5A 2HN7A 2RA1A 3HHSA 1NLBL 3WYRA 4Z3HA 4Z7WF 3QYNA 5DU7A 3ZKMD 1OOAA 1VGEH 4WUUE 3ZMRA 5C2UB 5KN5A 3NFNB 4L4VD 4PV1C 1Y6MR 4LAJH 2F58L 3G08B 4RMRA 3KVQA 4PGBB 3GKWL 4NRZA 4PFEA 5E99H 3NFPB 4JFFE 5LAPA 4JFUA 3ULSA 2XXMB 3HVNA 3VGFA 1P9MA 4EI6B 3RIFK 2AEPL 3PS6A 2ADGA 2WXLA 1E4WH 3TASA 2NT0A 3FSWA 4TQHA 1OCOB 4NKIL 4XNXL 4M1GH 1A7PL 1U8IB 5G4NA 3DO7A 3D85B 3QUZC 5BO1H 1ZV9A 4LOFA 1EDHA 5IHZB 3F2LA 3TA3D 2XV6B 5I75C 1CBVL 2WXQA 4BJLA 5LVEA 2BW4A 5INDB 4N6QA 3WDJA 1QATA 1AQ8A 1QBLH 4OSUH 2ZWNA 35C8L 4UMGA 1BFOB 4JN2A 2D9CA 2J6EA 1VESA 2ZZUT 3OKLA 3MZGB 4GBXC 4NPYB 4ORGA 5F1NA 4KVNH 4EI5C 5EEWA 1OAZL 4UDTB 5KTEL 2LOEA 1MOEA 4F3FB 4N2BA 4NT6A 4MA3B 5H8DA 2ATPB 2O61A 4G80B 2OL3B 4NZ8A 5EC1B 1BMZA 5EH1A 1EK3A 4U31A 1QOKA 3PIQB 5AG8A 3U0WL 2W9EH 3QNZA 4D94A 3OMAB 2D3JA 5DUBB 4P23A 3HJEA 2YPKB 1ZGLA 5JDSA 5FYJE 1CD1A 3P0GB 1I9IL 3GXTA 3RA7H 2CBMA 1RZFH 3CAFA 4OZIF 2KZ1B 4TQ8A 3BESR 2XICA 2X6BA 2R2BA 4KZCA 4F1ZA 2NUPB 3KWVA 1Z5LA 3K4AA 1ZT1A 1CE6B 5DD5L 1DEDA 4L3AA 1ZLVH 4BA8A 3MJWA 3SO3B 1CL7H 3C09B 3ARXA 4YWGL 4AYDC 2P42B 4M6MH 1G9HA 1UM6H 2VLLB 4XNQB 5AL8A 2XHNA 3FOMA 4GIOA 3LS5L 3C6LC 4FXGA 3QI9B 4YHIB 4H26A 4LLVB 5A40E 4KROC 1AY1L 1AGEA 3FTVA 3LH8A 5E2TH 2VT0A 3FB6A 4GO6B 2XZQH 2BVQB 2L3BA 3S4SB 1LO3H 3PXHA 1G9MH 2W92A 3POCA 1QSZA 4XXCA 4XN1A 1ODAA 1HK6A 2VDRH 3QEQD 3RNQB 1U8CB 2OMTA 4N8UA 5ICZB 2AQ3A 4ZW6A 4X9IA 1PD0A 3GSWA 4AYGA 2ZCZA 1RKRA 2R39A 5T5NG 2WXFA 4PW9A 4GG6A 1TNMA 2GK0B 5DJYB 3L3DA 4IRSC 2F53A 5FO9B 3WIFB 2ICEC 3FCSA 4QR7A 5JIHA 1MAML 2HP4A 5IHLB 3EBGA 5L9DL 2EEBA 1X9LA 1U92B 2F53D 3HE7C 5F9DC 2DMKA 5TDPA 5EU4B 3DUSB 2EIMB 4QCIA 2R0KL 5JUEH 4KXZI 3DJZA 1AI1H 3FQRB 3HI5H 5GGTA 4PB0H 5JHDE 3UAJC 1FH5L 2B1HL 5GS1C 1CLCA 4FG0A 4RMWA 1NPJA 1BZ7A 3O8XB 5DA4A 4AKPA 4JNXA 4FI7A 3PHQA 3RL2B 4DUVA 4PRHA 3RVUD 1WT5A 5EOQH 4R96A 2NQCA 3RGBA 4PJFF 5GIRB 4HHGA 1N6QL 2H0PA 2ZKXA 4OGYH 4PRHD 2FHCA 5HGHB 4O58L 3RPIA 5A16A 2WTRA 5D1XA 3H9ZA 4UILH 4EBQL 1AD9B 3C8DA 5E1AA 3EFDH 2QADB 3ME0A 5TE6L 4Q9CA 4FYSA 4GO8A 5D1XD 4A6YL 2IDFA 1OZUA 1KEMH 1WVZA 3RAJL 3MSPA 3NABL 2VOTA 1J5CA 2PCFA 4QTHA 2FWSA 3BP7A 1SLVA 2ZOUA 3FUKA 2V3FA 4UTAL 1EEUA 4GRLB 4LPVA 5AW5B 2H2PD 2OYPA 2VXTH 1XSOA 1MAJA 3GNMH 4UM9A 1HS6A 5TDNA 4PVNA 3AQZA 2WM0A 3NCYS 4KVCL 4BFKA 5GXBB 3WL9A 2XXCB 1B9KA 3L1GA 4UM9D 5AB2A 5DO8A 4DTGL 4JGNA 3RGVB 4OM1H 1WGOA 1WHOA 3CVBA 3UTZB 3SKMA 2FWOA 5HYEA 2FJGB 3B9KA 2VZ3A 4TS6A 4G1EA 2OSLB 4PJXE 3U4EA 1LE5A 1H6UA 3BVUA 3PQYA 1HH6A 1IBYA 4ENZA 2B59B 3B9KD 5C8JA 3T0EA 2OJZL 43CAA 5T3XD 4C59B 2CHNA 5EULV 1MXDA 1UB6B 3QUKA 2NCEA 4BXSV 3PQYD 3T0ED 3JWDC 3CD4A 4MA8H 4Q8BA 3CVDA 5ALCH 3E6FB 4U6YA 4MQTB 2ZCKL 4UYQA 2X1QA 5AVWB 1EEZB 2Q86B 1OGPA 2GBVA 4TN9A 4MXWH 1VSCA 1JE6A 4DQAA 2ZICA 5AZUA 5DJDA 2NZ9C 5EO9A 1W0WB 1OANA 1OE3A 3GF8A 3WIIH 1JNHA 4PGDB 5BRZA 2NW2A 3P0VH 3G04B 1B9ZA 5FA3B 1EFXA 4OF6A 3P2DA 4EN3B 1FFNB 3EOBA 3T77A 5I1JL 3CVCA 2GIYA 3VXRD 3QXUA 4Q0XH 1EFXD 2XTLA 5FCUH 1UUNA 4FMFA 1YYLL 4JHZA 4F2MA 1R5WB 3LSOB 3IXAA 3CHPA 4MSWA 2CG9X 2FJFB 2EH7L 2L7JA 2VRQA 3RIAF 2IG2L 2B20A 3ARSA 5ISZB 4G9DA 4G9FB 4C4KO 4GQPH 2J5LC 4MBRA 2BX5A 3B2VL 1JGDA 1MQKH 3WN5B 1CDGA 4ZSOB 1ZEAL 2XBDA 3CFDB 3FFCA 2VLKA 4YFEA 2ZJSH 5AWNH 5E08H 1OAKH 1F90H 1OE1A 2FGWL 4F57L 1ZY9A 2X42A 4HJTA 1JPGB 1IKOP 4NSKB 1RZJL 5FV1L 3CZFA 3FFCD 2VLKD 3S5LG 2OW6A 5C7ZA 2YEQA 1VFOA 3GK8H 1IAIM 1UZGA 1G9EA 5A43C 1NKOA 2D2CC 2BC4B 2ZG1A 1ETZB 1PY4A 3D2UA 1XGYL 3T0WA 3BZFB 3UTTE 4OGZA 5DJCB 4DCQA 3IFPB 5BQ7A 2I69A 4PJ8B 1ZSHA 1NCDL 3GXNA 3JWOH 3ZTJG 3D2UD 4Z7NE 4LLQB 4X5QA 3HE6B 2D2OA 2Q3AA 1J5IA 2Z7WA 4ZO9A 5GGRY 2OTUB 3AY2A 5BS0B 5HI3D 3E7JA 4JPIA 1HOEA 5E6SB 3ECUA 2EIEA 1U3HC 5FHAL 2CLZA 4U3CA 2HFFA 2GTQA 3OHXC 1ID5I 4Z5RB 1CQYA 3ATDA 4NN7C 3EBHA 4QXWA 3ZKND 1QI5A 2HRGA 4ILDA 4HJ0C 2UXVA 4WV1C 2HH0H 5KVEH 4OKDA 1K5NB 4P5MA 4L5FL 3WFEL 2AGJL 4I0KA 3P3TA 2Z8SA 2O6PA 3O6ML 3P4MA 3V4PH 2BNUA 3OPUA 4XBEL 3MMEA 1YMHA 2XIBA 5I1LA 1QRKA 5I30L 4WWPA 4KVPA 2XZAL 3L4VA 3AG3B 4XZ4A 3CQFA 4XP1H 4QRRB 4IK7A 1BZEA 2ZX5A 1KTKE 5FYLD 1N2RB 4G1MB 1IC4H 2CR3A 4GXVH 1B0GB 2EKSB 4I18C 1OAUH 2WKGA 5KSBE 3AREB 4E2OA 1KYDA 3IGFA 1L7IL 3WMSA 5SX4H 2EVJA 5EWIH 1RJZA 3DJRA 3BKYL 5ENWA 1YCSA 4NAQA 1D7DA 4Z76B 3BQUB 4WCYL 2EEAA 3BW9A 1LO2H 3WXWL 3QEQE 1MFVA 2EC9T 1A4CA 3SQOH 4AC2A 5F7YC 3CSBA 1A3ZA 3UGEA 1U42A 2BVYA 4P23C 2ESVB 5EUOA 3UTQB 5KVGL 1A0QH 1U8KA 1CIUA 2DYSB 3OJVC 4HZLB 4R6UA 4ZFGH 1EA9C 1JZ5A 4F1SA 1MFCL 4KK6C 4LP8A 2Z91B 1RZKH 4AQAB 2PR4L 3TP4A 3KGRA 3O9WA 1TKWA 3QR1A 1EIBA 1CDUA 3QJRB 1MCSA 3MQIA 3O2DL 1S7QA 1FSKC 4HX1B 4AKOA 5KWYC 3RIKA 4WTZA 4NP4L 2H2SC 3O9WD 4N3UA 4OZHB 3OKDA 2Q8AH 3M1BA 3ABZA 1KY6A 4I88A 5DURD 4XE5B 3R19A 3BAXA 1I9EA 3OXSA 3VW3L 3GBNL 2YFNA 2VXVL 4FXTA 1I4FA 4UDUB 1XF3A 2ITDA 2BVOB 3QQ3A 3PHOB 2C3XA 3FCGA 5AYUL 3D12B 3BRFA 4YK4C 4KAQH 3R1GH 3CZKA 2OV0A 5DJ2B 5GSVB 1RJYA 3TYGH 3WLWC 5DWUL 1OAYH 2APBA 2A73B 4MB3A 4OV5A 4JS7A 1I1YB 3AUVA 1MY7A 4QHLA 3L9EA 4OD3L 1QVOB 4A7SA 1T83A 2X6MA 3Q06A 1HINH 2DICA 5JIIA 2WLIB 2CIKA 3KR3L 3EH3B 5HYIA 3MGTB 3MCLH 4HCIA 3WHE0 1JZJA 3HZ3A 1R1CA 3LD8B 5J56B 1CLVA 3C9NA 3CSTA 5DRNB 1KY7A 1MNNA 3K6OA 2B3IA 2PTVA 5D72L 1L5GB 5HHPA 4DESA 1B0RB 5IM7B 3QH3A 4FTVB 3T3ME 1A3LL 3NESA 3QA3A 4YHZL 4LMQI 4ZUVA 4H4NA 5CNHA 4HXAL 2EIZA 1OTTC 4JKPH 4LSRH 5EZPA 3DMMA 4PSRA 3PG2A 1H6TA 4HUWA 3D34A 1LDPH 4H8HA 4KRMB 5D71L 1ZS8B 3LNEA 3UYOD 3B5HA 3DMMD 1NM4A 1A9BA 1XL4A 3U9UA 3VUAA 4LNRB 4UT6A 1N10A 5DJ8B 4QHUA 4F7MA 4R7DB 3VI4B 2CD0A 1K4DA 3BE1H 4LAQH 1ZHLB 2BFVH 3F7VA 2GEEA 2WCGA 2C9SA 4L3CA 1BMGA 4JDEB 1XB3A 3TWCL 3U36A 1ORSB 3HZYB 4UAOB 4Q9RL 4G6ML 5T3XE 1H5BB 5FUCE 1YPZA 4FEMA 3T0EE 2ORBL 1E9QB 1MZZA 3AG1B 1UT1A 5HDQH 4MJJA 4ZNEE 3D85D 4QXTA 2HJLB 2IADA 1E4JA 2VC2L 5FDWB 5F9OL 1S7VB 3K5RA 1T2QH 4KKBC 1YEFL 1AYRA 3T65A 4YSCA 4H8QA 3IGLA 2UY6A 5T5NF 3GI8H 4RAVB 3Q05A 3KYKH 1TJGH 4HIQA 3QPKA 3RFRA 4W6YB 3BZ4B 1EO5A 2Y25A 2WWKT 1TQSA 4XCFL 1PLAA 5HY9A 3VXRE 4HP5A 3N1QC 4MA3A 3ZR5A 3TEXA 2V17L 4FQCH 1KFAL 4BH8A 2MHAB 4EOWL 1D5BB 2X0UA 5L8LB 4N68A 1LK3H 2DBLL 4UANA 5DUBA 1CD9B 3ZHNA 3O6LL 4WK0B 2W0FB 4CMMA 4HIHB 1JGLL 3HG0A 5CU9A 4ZTOL 1NAMA 1WITA 3BIKB 5F7NC 2AI0H 3WLBB 1DZBA 3O0RH 2X6VA 5EIIG 3O6FB 3KPQB 5IMMB 2MCAA 3BT2H 2NR6C 4TQPA 2G2RA 2JCCA 2D3LA 4GFXA 4F9PC 5FEBA 5DXWA 3RJOA 3Q2NA 2CSPA 2OQJB 1BM7A 5D7IF 3LKSB 3LRGA 2FYVA 2QGBA 2AQTA 4XCYB 2W8CA 4KKLC 4ZX5A 4ABWA 4DW2L 2C9PA 2OTWA 4UOQA 4LKCB 3RWCA 3QQ4B 4KUCF 4JBSA 4RSYA 5F7BA 2FCBA 4XHQA 2BRRH 1HQRA 4JMNA 5DEGA 4LSQH 3RVTD 4F5CE 5FYJH 2PW2B 3QORA 5BCAA 4ATTA 2YSSB 4PLNC 5F7AA 1A47A 5JHAA 2P8LA 2QPFA 3QORD 3Q8AA 3SPJA 1U6AH 2FT8A 1U9KA 3LZFH 3L13A 3K2IA 4FQ1H 5I75B 4PJGB 3RNQA 3FXIC 4NOBA 1WIUA 1BD2A 4PP2B 4QXUL 1OQOA 5FUOL 3FZUC 4B60A 1RLBA 2PWEA 3NIDB 3QR0A 1BD2D 2VDKH 3FQTB 4K8RD 1SJEA 4ZI8A 5JW4M 3V7AE 2E9WA 4GBXB 1MW0A 4UQBA 2D0GA 2HFGH 2FATL 2P80A 3SE4A 3K4ZA 4X6EA 3P30H 4HJJH 1MH5A 4POUB 3O2VL 4EI5B 5DJ0B 1MPAH 1R5IA 3DIVA 3MHZA 1AOHA 4R8WH 2P80D 2NY0B 3GJEB 5F93C 2IDSA 5DEJA 3GLZA 4WFHE 2QHRH 3ZT6A 1FE8H 1MLCA 2IANA 1FO0H 4G5ZL 3ZVVA 1TZGH 3ZK0A 5DK0B 2AVFA 4ONHA 5JXAL 3AACA 1BF5A 5I1DB 1XGUA 4FJ6A 4NNYB 5HHOB 3HPJA 4JFDB 2Q1EA 4TOYL 3EDDA 5FV2A 3LXCA 3MNWB 3ULUC 5I23A 4Z0BL 4B9GA 1LD9B 1LILA 1P84J 2IMNA 3MFGB 3O8XD 5GIRA 3RWDA 3TBWA 5GISH 2YIHA 2V0AA 1IC5L 5BUPA 3L9BA 4OCMC 2K7PA 1U3YA 3LY6A 2XTJE 3FB7B 3OX8B 5D2NA 5C6TH 7PCYA 3ATFA 3MNMA 4GAAA 3UERA 4S2SA 2GSGB 3MRFB 3BP6A 1EEYA 2E9IA 4KO9A 2YBRA 5KVDL 3ZZ1A 2QADD 2BCMA 3C6LB 5LNGA 4K4KA 4K3JL 1FAKT 3EOAB 1QX1A 2COVD 2JQZA 4NQDA 3QO1B 4KROB 4P9HH 1JUFA 3QZWG 4NM8L 2A9DA 1T7YA 3LZNA 4ICWA 3WTVA 4NQDD 4NIKB 1GMIA 4Z7VE 2EICA 4ZDHB 3RA7L 5FYKU 3SDXA 1E5CA 2JTYA 4JQIH 1J05A 2BOBB 4PM1A 3L2LA 1KXTB 4F80A 4QHKI 5IB5B 3NJVA 3MV9E 5CSBA 4HEME 1Q72L 1YSOA 5T1LB 4BQCA 3T5WA 3GSRB 1YAIA 4P59L 4IRSB 4HGWB 3D4YA 4M48H 4YBHA 1XT5A 1PZ5B 2ICEB 2BY2A 4GSQA 4NHCH 3ISRA 3RX8A 2BLFA 2C3GA 2XU9A 3AS2A 4LARL 3HE7B 4ANVA 3P02A 5GGRB 1C08A 3E6FA 2QQQA 1S7TB 5I6KA 2V9UA 3SBQA 3OB0H 5E2TL 4GG8B 5IJKC 3GM8A 3Q8CA 1I7UB 5C2BL 3DHMA 4YAQB 1AS8A 3PWNA 3C8KA 1CFQA 4XBPB 1D5IH 2XX1A 4J8RB 3VRJA 3DX0A 1BBJA 2EADA 3HBQA 4XI5D 4FMVA 1PAMA 2R56L 4F8OA 2V2TA 1UA6L 4G70B 3CFMA 1BOGB 2MIZA 1ILSA 3O45B 2OZ4H 3X1NA 3OR7B 4KZ0A 1PAZA 5JR1H 3FO0H 1O7DC 4OGAD 1DVTA 2QQNL 4ZK8A 3VFVA 3QVAA 1WP6A 3CDZA 4DZ8B 1KPVB 4KV5F 3D0VB 1CGVA 4ZX4A 3WJLC 3WDIA 3MX0B 3UAAA 4DGUA 4HUXA 2VR6A 5JUEL 5LG6A 5B3JE 5AD0B 4JHWL 5ISZD 5F89B 4M02A 4ZPVA 3WU1A 3L4YA 3GS7A 1AXTH 2W9LA 2YRBA 4HWZA 1YEKL 4QHMB 7PAZA 4F24A 3CZJA 1SEBB 1U3JA 1SFHA 4G7SB 4M1DL 4MRCA 4XWOD 7CGTA 1E27A 3IFPA 4PLJD 3EDEA 1KOAA 4HU8A 1QSFB 1J7VR 3Q8BA 5IHUL 2AJSH 3EFDL 3MLVL 3HE6A 3FO2A 4DKEL 2NY4B 1WEJH 1FQ9C 3QIWC 5AW2B 2Y5EA 3EBAA 5I1CH 3S36H 1IEAA 1H3PH 1QZ1A 1RIHH 3LHAA 1DCLA 1GOGA 1MCWW 4OGXH 1OP9A 3HE6D 4XVTH 1BLNA 2CR0A 2VR4A 4ONFL 4WWKA 1HHIA 1FVEA 5CN2A 1IKFL 2WZ6A 4XPTL 4B9CA 4WWKD 4CJ0A 5AKTA 1FYTB 4UBDD 4OBRA 1IGFH 2WB1A 3MFFA 2WLKA 4WEBH 4G42A 3EJYC 4NN5C 4MWFA 1HNFA 1OB1B 5FM8A 4IOIA 2BIOA 2J6EH 2CDGA 3V5KA 1A4KA 1GC1H 2VJXA 4I5BB 1EANA 1JV2A 1UEYA 4XOCA 2IIJA 1T04A 2ZYIA 4J6IA 2W1NA 4WFEE 4UU9A 5CR8A 1SF5A 3MN8A 5CHNB 4QRRD 1YQ2A 2X1XR 5C08A 1UZ8B 5EN2A 2VLRB 3PHAA 1R46A 1LP9B 3ZDYF 1OOWA 3AT8A 1HHKB 2J5LB 5C08D 5B4MC 1HXYA 2AEWA 1UXWA 1N8ZA 3C5ZA 3RWIB 3BQUA 3HBPA 3PWJB 2GUOA 2GT9A 3GHBH 3FUNA 3Q6FA 2IH1B 2VDMH 5EO0A 3V0EA 3BQUD 3OLIA 4ENED 1S9WA 1RMFH 2WP3O 3GGWA 5I16B 2Q3XA 1IZKA 1JHKH 1UA3A 3II2A 3L9RB 2Z35B 5JIKA 5A2AA 2IWKA 2B77A 3US9A 5JW4N 1TPXC 1XSIA 2FL5A 4X6DF 3TJEL 3E8UL 1FNSL 5MP6L 4LO9A 4NDMB 2ZKHL 5DZVA 1FZJA 3T8XB 2DJUA 1FGVH 5HD8D 4OZHA 3MRLA 3MV7A 5EA0L 3RFZA 2H41A 3RY6C 1TQCC 1HESA 2JKLA 4H44C 3MA7B 1U3HB 4A67A 5TTRA 2YKLH 5I1AA 1UA7A 3OHXB 4JHBA 1INDH 3C2AH 1F1AA 3TFKD 3HC3H 4WV1B 4PGEA 2P26A 3ZE1F 4QRSB 2C3WA 2ZX8A 5K9JH 3EF7A 1XXFC 2B08A 3CN0A 1JGUL 3KBEA 4TVSa 5LXVA 3VFRB 2E27H 3AXHA 4NQXA 1Q9LB 4HLJA 2HZHA 3FTZA 4ZOBA 3A0OA 1JF6A 1PJWA 2G75B 4FNUA 2UVEA 5F88A 3RIAK 1L6PA 1QLFB 4XXDA 4X7DC 4PMFA 2VH5L 4OLXH 3NG5A 3AXLA 3WG7B 5JHBA 4JQXA 3SHSA 4W4OA 1AQKH 1BZQK 2HTKD 2YPVL 1I7TA 4OCXH 4I18B 4G8AC 9CGTA 1LQBC 1XZ0B 4FTVD 4KXBA 3IBOA 1BQRA 4CILA 1LNUA 4X80H 4KKRA 3CXDH 3QUMA 1U3NA 4G3YH 3CZGA 1HHJB 3PXLA 1QMUA 5HYSG 2UZXB 1JAEA 4M7LT 1QG3A 3P9MA 3S34L 2X4OA 4JDEA 4Z8FH 2RQ8A 3QZOA 1C12B 1XH1A 3II3A 3KGSA 1KJMA 3BPLC 3NSJA 3O81A 1RZ7L 3LIZH 3VNZA 1JGEB 4I48A 2ID5A 5J1AB 1SF3A 2CIIB 2NDGA 3OGCA 4HSCX 2ZX6A 4HZAA 4OZGF 3HC4L 1FSKB 1OHQA 4DP8X 1JRHI 5IBTH 2EIKB 2DTSA 4GXVL 4L18A 2BVEA 3MCKA 2PETA 4UOW1 3QS3A 1PBYA 4Y2OA 1K8IA 2LFEA 2WQ8A 3MRQB 1MCIA 4ELDA 3SGJC 2IALA 1IAOA 2BSSB 1AZUA 3H55A 3NAAH 4TNWF 1LO2L 2ZOLA 3VDBA 6FABL 3LN4B 3MTXA 4CJ1A 1I1FA 3HN5A 2VNCA 2G5RA 5EOTA 3QJHA 4HF5L 2ETWA 3ML8A 5T3XH 1EZVX 4HH9A 3AJ7A 3UJJH 1IRAY 3L3HB 4MKTA 1X7QA 1MWOA 4PRIA 2PYFA 4YHOL 1D5BA 4KX8A 2CH8A 3IMWA 3CN2A 4H20L 5KJ7E 1TTAA 3CHXA 3V0DA 4LLDA 4PRID 1VFBA 4FULA 4CSZA 5GHWH 3MJ7A 1SY6L 2AKRB 1P4IH 1UM5L 5BXFB 3GSXA 1P4LA 2RB8A 2ZAGA 3A67L 4KJQD 3WLBA 4AJYV 1WWWX 5IMMA 5ISZE 4G9FE 3ESNA 4U6VH 5KOMC 2EC8A 4PP1D 5GRVL 3P3RA 3PDGA 4ZSOE 3ULVE 4WDIB 4KAQL 1M56B 2B14A 2Q20A 5E95B 1NH6A 3R8QA 3SGKA 4WI6A 5IMLA 3QQ9C 5D7SL 4ZMOA 4M5SA 1VDGA 4PRBA 1FI8C 5TQ0H 3QJTB 1I8IA 3ARPA 3LAFA 4NQVA 3DA0A 4M5YL 4OJDH 5I1IH 3U46B 3IDJA 1EHNA 3EDKA 4M00A 3CFJB 1RHHA 3U6XS 3CVHA 3OZ9H 3AS3A 4TQEH 2PTUA 4G8FA 2VRAA 2FO8A 2YSSA 3RWHA 5I5IA 3TYFA 1HILB 4AV4A 4BXVA 1ACYL 1DVXA 3JWNC 4PJ7F 4M6NH 1A6WH 1W6WA 5BS0E 3UDWA 3L4XA 2O6EA 4QDGA 2A6JA 5JNYA 2YGQA 2WWMC 4K23H 4W9ZA 3TURA 2AS5M 3LV3A 5K9OA 2WBKA 3JT2A 5JPNC 1UC6A 3FSOA 3C5SB 4JDTL 4I3GA 4Y4FC 1WH0A 1KCVL 1LO0H 2FD6H 1TTUA 2XETA 4GQZA 3BE1L 5IIEB 5IGXH 4LLWB 3I6KA 5ERWA 4AW7A 2NXZD 5JLZA 1DVQA 5ACZB 4GBXD 4EDWH 5DLLA 5DEFB 3WJMB 3VI3B 4EI5D 4EZMA 1E9PB 4K2UL 2ED6A 4CW1B 4W6XB 3LRKA 4ICXA 1HWWA 5HVWA 2QMKA 1BX2B 4HS6A 3X3GL 4QRRE 2YLHA 2NY0D 4PW3A 4WTXA 5FOJA 4AV5A 2YR3A 3EYOB 4KZDH 5CF3A 4AGLA 2B4CH 3BPCA 3QFJB 1ZLUK 1THCA 5EU5A 3U1QA 1RURL 3WNKA 4AMKH 4JN1L 4OD2A 2ATAA 1M71A 1HEJC 2AJZB 5JOEA 4GAFB 1CPUA 4HWBL 2ESVE 4N0FA 2EABA 4YC2C 4ALAL 2OMXB 4WUKH 1CFTB 1F13A 4FABL 1DSWA 3WKML 3MUZ1 4FQCL 1T5XB 4BINA 4P4KC 4RISH 3VMOA 3LEYL 3UP1A 2EKJA 5LWYL 2NQ3A 3B5TA 3GUTA 2BPBA 2ED9A 3MV01 4N2EA 4UUJA 4MCYB 4B97A 1YECL 3W0WB 3G5XA 4ECNA 1NGWB 2J6WA 4M93C 3ZE0F 2V5SA 3BAEL 4M61B 4OZHE 4RIRB 4WWID 4XNYH 4JM2B 2IVFC 3ILPA 4CMHC 4GW5B 3ESUF 3DSNA 3LZPA 2CCVA 5D4HA 3ETTA 4RRPA 2C3VA 1PZCA 2IPTL 3FUIA 5LKNA 2OI9C 1UOKA 3ET9F 5FM5O 1FNHA 3CWGA 1DVZA 4YDLC 2R29H 5CD3A 3OKKA 2BS8A 3OKMA 4OFIA 2OR8A 4QRQB 2GJ6B 4HUVB 4RNRB 3MO1B 1QHQA 3C5ZC 1QNZL 4AM0B 5HI4C 2AJUL 5T1LD 4CA4A 4UINL 4IBTA 1YEWA 1ND0B 2CJSA 4ODWA 3MNZB 4RA0C 3AUWB 4U1JB 4LSQL 2DLFH 4JM0A 1ZT7A 4ZTEA 5FYJL 4F8NA 4O02H 2CO7A 3DPBB 4JE4B 4JHAH 2GBUA 3DX3A 4FTVE 4XPAH 1GGYA 4FMKA 3WHXB 2KL6A 1NCCH 3FUMA 3N1GC 3V6OC 4NPKA 4UT9L 1NZRA 15C8L 4FERA 1JGVH 3GM0A 4LF3A 4F9LC 1G0XA 3FSAA 3RFZC 3B9EA 4LCWB 1GJUA 3MRMA 4YSRA 2EDQA 3SE8L 3H3PH 4ZS7L 4E9LA 1I1AC 4GSUA 3VI4E 3NJXA 5LNEA 3ZMEA 5KSUB 3MV11 3B7TA 1JZ2A 4KI5E 3VJ6B 1WFJA 3PWVA 4G8GA 5F2FA 4J3OC 5SWSB 4RWYL 1KPVA 5EEZA 4MDRA 4YSPA 1BHGA 1JK8A 3HCVB 5F0MB 2EDHA 3SYOA 1KGUA 2VGLM 4G8GD 2CHXA 2QHRL 2GQHA 4PD4K 3KCPA 3L3JB 2NW3B 1FO0L 5E6ZA 4RCAA 3DV6A 5DHYB 2DQJH 5LBSH 4U1HA 1HZLA 1FCCA 3PL6A 1JNLL 1TETH 1KIQA 2TRHA 4GSDH 1HVXA 1YDPA 3V5HA 4QHMA 4UT6H 1TNNA 4WKZB 1J11A 1X3DA 4P5TA 1E5ZA 4ZUTB 3E6HA 4AQ1C 4F33B 3GHEL 1U8PB 1SYVA 3AY4A 5I0ZA 4HJ1A 5I19H 3LNDA 3PWLA 3QS2A 4P5TD 3SN6N 4TUKH 2AEOA 1E8WA 4GP5B 1ZXQA 4KTEH 2FVNA 1D6EB 1G1OA 4HWUA 1LMIA 4FOMA 1UWXK 4YL4A 4TL4A 2VXQA 4Q4IA 3REWA 2QKIA 2NY4D 3UBXI 3UC0H 3QW9A 4RGMC 5D2LB 5EF0A 4F7TA 5KS9F 4P9HL 2HWZL 3EJCA 3P9LB 5HJDA 5TQ2L 4XVUD 1G6RB 4MD4A 1RIVH 1O75A 2R2HB 5AW3B 5K33A 3I6GB 4TLTA 5HHNB 4H8WL 2PCXA 3HS8A 3EJUA 1B4TA 1TQVA 1C1EH 3L4TA 3QP3A 5C07B 5F44A 1R6VA 2N0KA 2VAAA 1FYTD 2D3NA 2VZTA 2WWKO 4F7CB 3IVKB 2HRPH 4FYQA 3U6RA 3IDNB 2VDLL 3W11D 2FK9A 1C16A 2AMUA 2ALAA 4U3SA 2FAUA 2OL3H 3OJMB 4JFQB 2X4QB 4MMYA 4RDBA 1ED3A 5DJAB 2WVSA 3CFCL 1A6TA 3FHQA 1FVDB 3MLXL 4AIZB 4ZFOB 2WBJA 1D5ZA 1HN1A 1Q38A 2LVCA 4HCRL 5CHNA 5KYWA 4IBVA 1DJHA 1NMCC 4N8CH 5F7EH 4S10A 2WBJD 1IFGA 1WDAA 1M9SA 1N5AA 3ASOB 5E1QA 1Q9WA 4PV8A 3QXDA 1LGVA 3IEAA 5IKCA 1NIFA 1RZJC 1MFNA 4DKAA 4QNPE 5KSVA 3H85A 4EZLA 4WQOA 3IGAA 3KH4A 4QRUA 2CUHA 2VIRA 4PJGE 2EC9U 4JKWA 1INEL 5DEZA 2JJSA 2X4SB 4JJ5A 3QCVL 3RI5F 3FQUB 3AM8C 3NIDE 3REVB 4LPCA 3LVEA 1P7HL 25C8H 5D70H 3BHBA 4HIJA 4PJAF 3MAWA 2DIJA 3T8XA 3QIWB 3D69A 5ANMB 5DZLA 2CDFA 5DMJB 2ZOKB 1KSRA 1ZK5A 5FUZH 2Q6WA 3TL5A 2PPFA 4EZKA 1KEGL 1I85C 5CGYC 1JPTL 1XR9A 3MBXL 4PJ5A 3RVVD 1FVCB 1BAFL 3SE9H 1TVHA 4FD0A 1F3DH 1U3HD 3NSXA 3WIAA 3K91A 1CXLA 1M2VB 3D08A 3QQDB 5HHOE 2ADFL 3G5ZA 4YLBA 2LFGA 4JFDE 3UZQB 2VMCA 1PG7L 4MNHA 3FONA 5L7XH 4KO5A 1TO4A 1DVFA 1LK2B 4LCCA 3FQNB 4NN5B 4V2CB 3NP3A 1XF1A 4PLOB 3Q2CA 5ABAA 1FZMA 2A9NH 4J1UB 1Z9SB 1UWFA 1OPOA 2WIIB 5FAAA 1I7ZB 4M4PA 4FNPA 1K6QH 5JORB 2A6DB 3GPSA 2DQCH 3SDDA 3HC0B 1RIHL 2L8AA 2QDVA 1V27A 3KYMB 4BZ2A 5AOKA 4UTBA 3ML9A 4H8UA 1Z7JA 3PF2A 4U6HA 4XVTL 5EEXA 2UZYB 3FRPB 5DD1L 1UWYA 4LP4A 3KCWA 3AAZA 3BLPX 3LPPA 1PGRB 2YD3A 1B4RA 5FOBB 3RZWA 3CZNA 4HFUH 1AAJA 3K71B 4DF9A 3PRZA 1HHGA 3EYVA 4HHWA 3VXSA 4U7MA 4DP0X 1JBJA 5T3ZL 5FYJU 5GRYA 4UM8A 5DSCB 1UACH 3MUHL 4JRYB 2WXOA 1HAUA 1MREL 1WIPA 3QJQB 3WKQA 1E28A 2RHEA 3WUWB 3SDCA 1RI8A 3FT0A 1ZANH 5LXGL 4NWTL 1TPXB 3NDYE 5JQ6H 3GD1C 4LQFH 2PPCA 1BPVA 1HI6B 1BAWA 1QFWL 1ETJA 4FJYA 5JHLA 5LHDA 1X5IA 4N24A 2UUDH 5TH2B 3S3DB 1QA9A 4H8VA 3C08H 4C57C 5GRUL 3GSUA 1W0YT 1TQCB 1J9RA 1WS8A 1RZ8B 3NK4A 2ZXBA 1MDTA 3LN5A 3TPUB 3QDJB 4FQLH 5EF3A 4WK4B 2BSSA 2OMUA 4LASH 3D52A 3H9YA 3CFEB 1RU9H 1S4IA 3KVPA 2JVUA 3KGTA 5DRWA 1BM3H 4WNQB 3UAFA 4Y2DC 4KJPD 3RY5A 4HKBA 4AGMA 2O6CA 4YHMH 5D4JA 3QEGL 4I0PA 5FO7B 3MXVH 4EIBA 3QXAA 4IRJC 4JX0A 5IEKB 4JY6A 3L3IA 3LKQA 4E42B 4CKQA 4NBZB 4IEFB 3F8UB 4I0PD 5DHXB 4OB5H 2I9TB 2YK1L 1MWAB 3HZVA 3KPSA 3MRJB 2FQDA 4H0HB 5HHQB 1CL7I 1S5HB 1AYOA 2R4SL 1DVUA 3KPSD 1U93B 4J4PA 4TSCH 2YQGA 1IJNA 1YEEH 1A6UL 4AUUA 1E3XA 3F7YB 1H3GA 2V7HB 2ED7A 1SXAA 4D9LL 4DN3H 2OCJA 3QFDB 1IGJA 4J4PD 3E8VA 2UWEB 4PJDB 2P8PA 1P7QB 3HVDA 3UAEA 2XA3A 5J7CC 3UTSA 4BGLA 4JZJA 3QRGH 3UTSD 5BOZG 1B2YA 1MIMH 2XRAH 4HBCL 1G1YA 1WTGT 1EXUA 1YY9C 5B3SB 5IQ9A 4E9SA 5IQ7L 2D7PA 2M26A 1S8DB 1QSFE 2QVMA 4QAWA 1JYWA 2RD0A 3O2WL 4R5TA 3X12B 5AKSA 1JK9B 1TZIB 4QTIH 4D3CL 4GUQA 1UD5A 5CEXA 2P52A 3JZYA 2DEWX 3IU4H 3ULVH 3DURA 1M6OA 2H9GA 4HHAB 5CLTA 1NDMA 2KERA 4YIQB 4X2UA 3F12A 5E94B 3BSZL 5KJRH 1OARH 1GTNA 3BAJA 4JLRB 3X14B 5GRJH 2XWXA 4CSSA 4XPBL 3QJXA 5EZOL 3ZSTA 3U0PA 5F8RC 3ZQ9A 1EVTC 2XTSA 3LEXA 4K7PL 3WJJC 1IL1B 4LB8A 5DC0A 5DK2B 4QLWA 1SRDA 2BVUA 4R2GC 1FYTE 1YNLH 3U25A 5J6SA 1RVFL 1VLXA 4G6AC 1NIAA 4U1MA 4YN3A 5AZ2L 1KCRL 3NZHH 3ZHKA 4GKNB 1FNFA 1IGCL 4LVHC 5D1ZC 4PTTB 3TBYB 4N6RA 1U8MA 4FCHA 1BVOA 4FYRA 3MKGA 1TTGA 4PY7B 2YRPA 3QB7C 1ZPUA 2WIMA 1BX2A 1UXMA 1EHKB 1XVSA 2BFGA 2N59A 5DRZB 5JYMA 2XN9B 4OJCA 2NNCA 4OV6F 5IBTL 1RUAH 3O4LA 4LRNL 1S7UA 3QNYA 2QTVA 2VLRE 1AGCA 3CIAA 5CLXA 3WY4A 1LP9E 3ZTNL 1G43A 1QR4A 4LKXB 3O4LD 4JRLA 3ARYA 4TSBH 3VGDA 2X4RA 5E6IA 5EU3B 2QTEA 3STLB 3V4VA 1HQ4B 2DIAA 3PU7A 5AW7B 4AL8L 3HB3C 4IRZL 2AJZA 4XZUA 3K6SB 5ACMA 1FGNH 3RUGB 1QO3B 2XIIA 4H2CA 3MNVB 3E38A 3EZJB 1MCQA 3OM3B 4YPGA 3RBSA 2OMXA 1FUNA 5BUGA 1CS6A 4FYTA 1RULH 3MUGB 4KKLD 1P7KA 1NPNA 1XR8B 3LXAA 2BSEA 3IDXL 1RZPA 4XMXA 1T5WB 3PPSA 4MKMA 4BUQA 2WXHA 1FJ1B 5DZAA 3W0WD 1ACCA 4P2YA 4TNWK 2ISDA 2H4EA 3FRUB 1MCLA 2QSTA 1ID2A 2IPKB 4W9JC 4JM2D 4D0DB 4OZFA 4LBEA 4LOUD 3TO4C 3ZZLA 1HXMA 3FW6A 4BYHA 4X5WA 5JPNB 1AO7A 1BA9A 1E8XA 4HS3B 4TRPH 1F6AB 2BMKB 1RY7B 4Y4FB 4Z3GA 3NCCB 2O5YH 3EGSA 3FZUD 3TCLB 2DS4A 2P49B 3IJEB 1T66C 1AO7D 4AE1A 5H4ZA 4BWWA 5D7LA 1ND0A 4BKLB 1J5OH 3S98A 4QYOA 3UEQA 1RK1A 3MXWL 2Y36L 3KYOA 3B8SA 1YJDL 5DWPA 5D7LD 5FKAB 3FUFA 5KYXB 3F7RA 2A83A 3NVQA 4WU5B 3V6FB 4RQQB 4AXWA 3PGCB 4X50A 4HIEB 2L7EA 3EYFA 4RMUA 2DWEB 4M7LL 3DRTA 5C0JA 3HMXL 2DWTA 2VMDA 5I66B 2XQYK 2F54B 2CO6A 1QLRB 4UIKL 1IGTA 5IFHH 3FU3A 4L37A 4H8PA 4JPWH 1S7WA 1BF2A 2R9HC 1NUFA 1N68A 1N3NB 2GJZB 3OAZH 1QBML 3ULUD 2JQMA 1LEIA 4E0RA 1O6VA 2H3KA 5DYOB 4GKLA 1H3XA 5KAQG 3RWFB 3DX7B 4LCWD 1MJJA 4F7PA 4YC2B 3LH2L 4PJXF 5IQNA 4XP4L 1NC2A 4P4KB 2JK5B 5SWSD 5GPRA 5K9KA 4WW1A 3GZPA 4XPFH 4Z7WA 5DHYA 5C09A 1OSZB 3D51A 4ODVL 3V0VA 5TF1H 4APXB 5FB8B 2CO3A 1DDHA 4YNYA 1I8LA 2YPLB 2B4CL 4M93B 4L1BA 4AGQA 4CMHB 4YXHL 3HI6L 4JRXA 4IHOB 1GY1A 4ODTH 3SDDC 5GS2H 3EH2A 3VFUB 1ML0A 4HOXA 4QXGL 3HOGA 3SQBB 1DBMH 5E9NA 2EO7A 4JRXD 2OI9B 5B8CA 5D6CB 4BK4A 4YDLB 2Q3ZA 4WI0A 5C0EA 2WK2A 1UKSA 2OXHB 5T5FA 2AAVA 3PV7A 4KU1A 5B22A 5LCVA 4WJ5A 3G6JB 2WO4A 1MFDH 3IAGC 1IFHL 1NUNB 3P1VA 2XBTA 4MA1B 5DI8A 3NIFB 3QSKB 1FRGH 4MNQB 1TZHA 2A9BA 3QUXC 2HFEB 1RZGA 1KTDB 4NRXA 4O2EA 4WI3A 3PP4H 1XF4B 1DQMH 1PSKH 3LNHA 2Z4TA 3SBWA 2HG0A 2D3VA 4OM0H 3R06A 2VERA 3MRKA 4PRPA 1T20A 4WTZG 1QSEA 2FX7H 4ZZKA 3RZCA 2FZ3B 1FL6A 5C07A 1DE4A 4JANA 4LK4A 3S3BB 4AYMC 1DBKH 5E8EA 2VQ1B 3DVGB 5SX4I 1A6VH 1D7FA 1QSED 1JTTA 2DQEL 4J2XA 2JIXB 5C07D 3ROOB 3IDNA 4NO2A 3KYNA 3QEHB 4Z7OF 3VFGH 5I6XC 5KSAC 1I1AB 1SOXA 1UH4A 2X4QA 4JCLA 4M4RB 1UH2A 3W1ZA 4WJG3 2JKNA 1FVDA 1LL1A 4GJTB 5KOVC 4ZFOA 4MMXC 4A6YB 5HJGA 1U58B 4Y2NA 1RFDL 4Z7NF 3FN0L 4GAJH 4OZIA 1JMXA 1AKPA 1G1CA 1U91A 3DHUA 4O02L 3U4KA 3BD4A 4JB9H 4ZYKA 4EKJA 4PB9L 5IB2B 3NRQA 1NPUA 3GSVB 5HGDA 4C83B 4WO4A 4X7EC 2FX8L 2E8ZA 2W59A 3NEEA 2G9HA 2AK1L 2BNRA 4JFZL 4FQQB 1PY0A 1U8OA 3K2UL 4WO4D 2A77H 1CT8B 3S3JA 1JYVA 4BA0A 3ZO0A 2GJPA 1JGVL 4GFTB 3I85A 5I0VA 4AIEA 2BNRD 4GMTH 3EG9A 3PJLA 2BSRB 1RJLB 2X4SA 1E5YA 1NSNH 1SDDA 5I74C 3TIEA 2OM5A 3NOIA 1BIIA 3CDGA 5D7JC 1XH3B 4AQ1B 3IKCA 4JG5A 5JW5A 1XF2B 3U7AA 5F96H 1DQJB 4QOKA 5AAMA 1JZFA 1R24B 3KHOA 1QACA 2QFPA 4ODHH 3TX4A 1NGZA 1YEJH 1JWSB 4EIGB 2MQ3A 4HLZG 3VI3E 3FUEA 2GY5A 4YVNA 5E2VH 3UYRL 3QIWD 3C60A 3QEUB 2A0LC 4F93B 2OSWA 5KSBF 1HH9B 2DQJL 1G7QA 4M5ZL 5MHSD 5A2CA 3AXIA 3C60D 1MCDA 4MQXC 4DO4A 2DD8H 1WV7T 1UCBH 3DXAB 3QFJE 4W9FC 2G3MA 4GSDL 3QPXL 1FZOA 2QJDA 2X4UB 4PIRF 1S7SB 3B2MA 3CZUB 3F05A 4XXWC 1A6AB 2EDFA 6TAAA 3J8F7 5TPWH 1B4JL 4JO5A 4NO0B 4KOCA 3VD0A 3DVFA 2X4PB 3JBG7 2Y06L 4FADA 3V0AC 1UGNA 2D7MA 3B9VA 2F5BL 4HUMB 3VRIA 4NUQA 3IPBA 4HIPA 4TVPD 5A6IA 5IR1A 1AGBB 4FP8L 4M5TA 2A6DA 5E0QA 5FLUA 3TT3L 2P43B 5L6YL 3WIHA 3KYMA 1BECA 1VFAA 3MUUA 1DLFH 1NMCB 2FB4L 4YZFE 3UC0L 1V3KA 4PJFA 1FDLL 4HKJB 1JSYA 5GGSY 3TBSB 3U0TA 1EJ8A 3W0WE 2H6OA 2UV3A 2H1XA 3OMZA 4YHNA 3NJMA 2YUWA 3RYMA 5KYNA 3VMNA 2YXMA 4XN4A 4HXBL 4Q9QH 1C1EL 2YMXH 1SLXA 4WY7H 2E7LC 5I18L 2BP5M 2X4NA 1ETB1 3I3EA 4MD5B 1EAOA 4JRYD 1ADQA 2F5AH 4AEFA 4ZFQA 2GJ6E 1JMZA 2OL3L 5E6IC 4CVZB 2R1YB 2R83A 3H0TB 3B7YA 4N9OB 3DNKA 1ES0B 1R5VA 1KB9J 4NO3B 5E4AA 1A7QH 4LSVL 2CALA 3TVMC 4B5ZA 5IF0A 5T33L 1WZLA 5F7EL 5CP7B 5ESVA 3T3MF 3ECBB 1MFAL 2XXGA 4PW4A 2XV3A 4MFHA 4XMZA 2JELL 3T1FB 2BZDA 3OLEA 2XJKA 3HAEB 2DW5A 3FOLB 2PTTB 2BIMA 2ZQKA 1AG6A 3IF1A 4PJ9C 1DQDH 5SWZE 4IU2A 1UXSB 1CTNA 3WXVH 1TCMA 3N44B 3ULUE 3HC2A 3VFMA 3POHA 4LCWE 4P9ML 4LT7A 3HRZC 1A7BA 1X5LA 3IPEA 4PBVC 1HYRC 4Y4HA 5HDWA 4WHTB 1B2WL 1EWHA 2H8PA 4GSXA 3VACA 1KJVB 5SWSE 1KLUA 2AJXL 4J23A 4DGVL 12E8L 4Y4HD 3W9DB 3GMNB 2Q76B 3KPPA 2JLPA 3D9AH 4H88H 2OXGA 3PFQA 1NMBL 5ETUB 2I7OA 1F3JB 4XMWA 3MA9L 1P4BH 4FFYA 3F85A 4Y5YC 5DQDL 4CC0A 1YEHL 3RI5K 4MDIB 3HW7A 2C9QA 3N06B 4QHKJ 1I8KA 1XGRB 3Q1SL 4JFXB 3PABB 3WSQH 4GAGH 2BS71 1E4XL 2A9NL 2C9AA 1UASA 1IE4A 2X1OA 3ELQA 3PWPB 5GGUA 5J6HB 1OE2A 1A21A 2NY5L 1GXEA 1F0LA 4R4FL 1JK9A 5HJ3B 2IC2A 4XRCA 1EMTH 3CE1A 3SEPA 4NKDB 5LGHH 2IAAC 3QULA 4RGNC 5F7UA 4KK9C 4GUPA 5E94A 2DIEA 1U95B 3IDIB 2VR8A 5D2LE 1ECYA 4OAWB 5IBUB 4ZOAA 4NKOA 4HFUL 1FHGA 2WNXA 4XNBA 5GRVK 3II1A 4U1IA 1NEZB 4P46C 2YD4A 4R4BB 5E8OB 2APVA 4Y2DB 4Y1AB 2NYZA 3QIUA 4FNSA 4O2FB 1ZT4B 3NRFA 3FC8A 3MODH 4MS8D 2XWJB 1UADC 4IRJB 4KJWC 3TN0A 4K3GA 5CINH 5EOCJ 1XCTB 1M1XB 3PJSB 3QIUD 3I50L 1O9WA 3ZHLA 4Q58C 4HC1A 4LQFL 5BVJA 1X5ZA 2AJVL 3RJQB 3PHSA 3FU6A 1HDMB 1JWMB 3EXLA 3JWDH 3VXNB 1Q9KA 1O7DE 1A6PA 3EHBC 4BFIB 4L8BA 1L9NA 2JNZA 2XN9D 1BBDL 3VXTB 1VADB 1W0VB 1IGIH 2ERJC 3IDUA 4K5MA 5D6DA 2WINA 5B3NA 1LEGA 3DJSA 1BM3L 2BINA 2J43A 1KDJA 4N9GA 5KAQF 1HT6A 2ZCHL 1JNJA 1DN2A 4P04A 2R23A 3NA9L 4CC4A 5C70A 2JB5L 5A6MA 3L3OC 2NY6C 4Z78A 1DBJL 3AWGA 4E9RA 2DM4A 4AVKA 3QWOB 4OB5L 4UT7H 4JDVB 4LDOB 3DETD 4NGHH 1ULVA 2GCYA 1KGCD 5L8JB 2FDBP 1YMMB 1GZPA 2LT9A 3JZ7A 2DQMA 1PYWB 1EV2E 5ANME 2VC2B 2RCSL 1TVBB 2EACA 3WNLA 5MHSE 4NQTA 1IGMH 3NCXA 4TUJA 3W3BA 4ETQB 1YZZA 2DYPA 4BWUA 3CX5J 3EXJA 2BIHA 5GJSL 1M7DB 2JKWA 2X1PA 3QJFA 1L9QA 4JVWA 2X53A 1K8DB 2DYPD 3Q5OA 3U7YH 4R2GB 1RIUH 3IJEA 5MENB 1N7ML 4PHZA 1QI3A 4OLZH 2H1LM 3W9EB 4BKLA 2EE6A 1BEYL 2D03L 2G4EA 2YKKA 1TTRA 2R0WL 4BFGA 4LVHB 2CO4A 1FC2D 4TVPE 1T03H 1FH2A 5D1ZB 5CILH 4A37A 1F2QA 3BUIA 3CTTA 2Z1PA 5KYXA 1E8YA 3FT4B 4WU5A 5CGBA 4K3HA 4JCMA 3IU4L 4LZKA 3CQQA 1KN4H 2ICWI 2NY3C 2XZZA 4NZUH 4FQIL 5GS0L 1SMDA 2R69H 3DBXB 4BEIA 4XVJH 1B6UA 4JY5L 4Z7VF 5EU6B 1EGJL 1MCOH 3MRIA 1PKQA 2ZXAA 3R4RA 1KLFA 3VWKC 5BV7C 3EBIA 3HB3B 1OP5K 4DH2A 4DEPC 4ALAC 4FFWC 5C0AB 4JRYE 4WSKA 3WKNA 5H35B 1HEHC 4DVRH 3PAZA 4JFYA 5C71A 1EO7A 3AU1A 5KYYB 2GUYA 1M7XA 1E4KA 3WI9A 3IB4A 4OV5B 1CFNA 1IO4C 4XGZB 3VTMA 1LWHA 3S88L 2CLVB 1MCKA 5B1JA 2YPLA 3DRQA 1IT9L 2IPUG 2I60H 5JZ7D 3JVGA 1KJ3H 2BERA 5CEZE 4Q6KA 3F00A 2YPLD 2YN3A 3STZA 3WDHA 3ZE2B 4AVHA 1S9YB 4WWOA 5K9QI 1DUZB 1UB5B 3GMRB 1WCBB 3IS1X 3MRPA 3QDJE 3NQIA 3TO4B 2WTPA 4KKNA 2ADJA 5KZCD 4KUZL 4ODSH 4HZ1A 4RX4A 1A8JH 5D6CA 5F3FA 4X6BA 1MF2H 4IHBA 4V33A 3HS0C 5IFAL 2HLFC 3LVTA 4XN8A 6PAZA 1ZOXA 4OVVA 1YYCA 3IMBA 4RX4D 3RKDD 4QWWD 1MW3A 2W91A 2WLJA 4OI8A 4H13C 1EEQA 1SM3L 4G7RB 4PPTA 3I6LE 2B0SL 2YUXA 1U8HB 1ZSDA 1JV5B 4LPWA 1NANH 2AFNA 4M7JL 4OF5A 1IEBA 3ZQXA 3QC5X 4RAHA 1G7LB 5DJZA 4AT6B 1WC7A 1XF4A 5B3JF 2V2XA 4BK5C 1OSPH 1GMEA 1J1OL 2J8HA 5GSRA 3RX5A 3NJIA 1DQKA 3CK0H 5D7KE 4JO4H 2UWEE 4PJDE 1FZKB 2Y2WA 1VGKB 1S7XB 2PW1B 2VQ1A 2Z31C 5F7DA 5DVKA 4Z7OE 4YVUA 3M86A 1O7SA 3MRRB 4FXKC 2O5YL 3OZKA 4L3EA 5HGAA 1AKJA 4A2GA 4DZBB 5HHMB 1KJ2L 4MQSB 2XWBB 4XTRD 2JIXD 1DN0A 1TZAA 2K4AA 5AUMA 3KXFA 1J5OL 4WFFE 4JG0L 2E8YA 2OYMA 5TE7H 3A6CL 3K8MA 3KXFD 5EZIH 3JT0A 4HALA 4JRWA 4U1LB 1E50A 2CKBL 2UYLA 3KLAB 4OD1H 5D7IA 2OCCB 3VCLA 1Q94A 1AJ7H 4IMLA 1LE9B 3WAKA 5BZWA 1AR2A 3B2UC 4G71B 5GGSB 3SODB 4YHKL 1CICA 3DX9A 3NCBB 2JWYA 4KHTH 4P5SA 5E03A 3INUH 1CT8A 5AKVA 1A66A 2GY7B 3P2BA 4TNEA 1H9DA 2EDYA 4JPWL 3T4AB 4O4YL 2PNDA 1AE6L 4I4WB 8PAZA 3QR2A 1WBXA 4KUCD 3S0PA 1JG9A 1MFUA 4MAYC 1HYSC 2CLRB 2CBPA 3FUHA 3QDMB 5F71A 5E2UL 5E5MA 1QRNB 4LE8A 3O6KH 4X4MA 2NUTB 3BUDA 1JWSA 1W72L 1HL5A 1OVZA 3ZX1A 1T1YA 3VU1A 2EE3A 4PTUB 4WFGD 1XDTT 4XC3H 3QUXB 3OKNA 2H6UA 1FLTX 2X6CA 1AR1C 1HH9A 2XN9E 3DTXB 1DBBL 2OR9H 4TULH 4H8WC 4PD4J 1SUJA 5C97A 2YUZA 4NO5B 2XFXB 5DRXA 1KXQA 3G9AB 2V7NB 3VQMA 3KHQA 2O4EA 1XB6A 3O11B 1TR7A 1NBZA 4KXAA 4AQEA 1MFBH 3DXAD 1V54B 1PD1A 3WY1A 4B3EA 5LN8A 3GDCA 4AUJA 4ODBD 1MLBA 3RUGE 4NO0D 3TNMB 5I6XB 4CUCA 3IFNL 4J28A 5KSAB 4PJIB 1FFQA 3SPVA 3NSCA 3SY6A 3JUYA 2WOBA 1QWUA 2G60L 4FFTA 1KGCE 1O0VA 3CC5B 1JNNL 3EIFA