1A5FH

Fab fragment of a monoclonal anti-e-selectin antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
217
structure length
212
Chain Sequence
EVALQQSGAELVKPGASVKLSCAASGFTIKDAYMHWVKQKPEQGLEWIGRIDSGSSNTNYDPTFKGKATITADDSSNTAYLQMSSLTSEDTAVYYCARVYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVSVPTSTETVTCNVAHAPSSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Primary and tertiary structures of the Fab fragment of a monoclonal anti-E-selectin 7A9 antibody that inhibits neutrophil attachment to endothelial cells.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords MONOCLONAL ANTI-E-SELECTIN 7A9 ANTIBODY (LIGHT CHAIN)
total genus 35
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 1998-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a5fH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a5fH02
3L3GB 4MHHG 1SEQH 3RGHA 1NDMA 4JM4L 2WWKO 2X4UA 4PJFE 1FJ1A 4CKVX 1RV6X 4NRYA 1KJ2L 1JRHH 4EJ1C 4PLNC 4MJ5B 4LSRH 3VGBA 4F8TA 4JRXE 3U9PH 4JDZB 4G9FE 1IILE 3JWOC 1XR8B 3WD5L 3MA9L 1UJ3C 3UC0H 4HG4J 3ULSA 1YEHH 2P7TA 3U2SB 2GCYA 2QR0B 1XGYL 5IFHL 5AYQA 3DUHA 1UCBH 5J6HB 5GGQH 3AXLA 2R56H 4NGHH 3BP6B 4U1LB 1G9NH 4P5KA 2ESVE 2VXTL 4WW2F 5HGBB 1YYML 3O3EA 2VB5A 15C8L 3MOAH 1X9QA 1KF9B 1WF5A 3WFHB 3K2UH 4MQSB 3LQAL 1GZPA 5I18H 5EPMA 4WI2A 4W4NA 1CCZA 3ECBB 5DDHA 3EHBD 3HMXA 1IEAA 4PRDB 2L7JA 3FQUB 4KJWD 5DMGD 1AR1C 5C6TH 4HLZG 2VLME 4R4ND 3QHFL 3TO4A 4HH9A 1ORSB 3O4LA 3QQ4B 3PJSB 1F6AB 3WL9B 4YHOL 1VDGA 1ZT7A 4HBCL 4G9FB 4UT6L 1OSZA 1B4JH 3S35L 8CGTA 3N85H 5IBLD 3O6FA 1FO0L 4PJFB 3T2OA 3STLB 3PHQB 5CEYB 3RGVB 4JFOA 3H0TA 2NY7H 4XVUC 3HE6C 3BW9A 2EDDA 4LGPB 5GRUH 3NIGF 3FN9A 2AJUL 2H3NB 1WBXA 3VRIB 1JWUA 5AZ2H 5EG6C 5JMRA 3GSNL 4R7DB 3MCG1 4U6VL 1I8IA 1SYVA 2DQFB 3HPLA 5JHDB 1KB5L 2UZIL 2DQGH 4KK5C 1H3PL 3W81A 4DOHE 3QUKB 4MVBC 2OI9C 5F9AC 5TF0A 3GBMH 5T1LB 4YDLB 1KTLB 3U1SL 3VCLA 2WLYA 4E42B 3K4AA 1XZ0B 1NLDH 1QLEL 1SY6A 2FJFB 1MHPH 3WNNA 3ESUF 2A73B 3ZYJA 3QXTA 5SWSA 3IDNB 1MVUB 4LLMB 1MJ8H 3DV6A 2FBOJ 3NH7L 3LVEA 4J4PD 5D1ZC 1QSFD 3M8OL 2EIEA 1MNUH 5F9JA 2OYPA 4IRJA 5T33H 4PG9B 4NQCB 3WIHH 1MIEH 4UNTA 1BM3H 2AQ2A 3QDHA 4Y16C 1EGJL 3CC5B 4NQXB 3AC0A 4WW1B 4CN6A 3OG4B 4ZFOA 3QDJE 3P73B 1C16B 4Y4HB 4N9GA 4M62L 5L7XH 2XKSA 1CD1A 3C6LA 3X14B 4WUKH 4FP8H 4WTWA 4C83B 1BQSA 5J3HC 3X11B 5EU6E 1IGCL 5DJZA 1EZVY 1IGIL 2QQKH 3UCRA 2E3VA 2VKXA 3DNKA 1T7WA 2HJLB 1G7JB 3SDCD 2FGZA 1I85C 4E9LA 5BRZD 3GSOA 1ROWA 1MVUA 1I1CA 1T22A 2B20A 1IAIL 5C6WH 3MFFA 5E2WL 5D1ZD 4NQUA 2L0DA 3D85D 2PO6A 4LSQL 4YGAB 5I8CB 3FQXB 3O3DB 3NCYP 1IC5L 4PTTB 1F6AA 2YZ8A 1PAMA 3MROB 1VFAA 1RMFL 3UBXB 2B39A 4NO0A 1D5MA 4X0KB 1F90L 3FQWA 1EDQA 3HZVB 4OLUL 1ZWIB 3FB6A 3KLHD 3QO0A 2NYYC 2Y06L 3SQOH 1KJVB 2X1WL 5KS9E 3TJHC 2J8OA 2AJVL 3LN4A 4ZO6A 1U92A 5IJKA 1INQB 2AEWA 5I76A 1J8KA 3MBXH 3BEVA 4JFFE 4NZUH 3MBED 2VITB 3LDBB 3CFJA 4N1EA 4HV8A 3IDJA 1B90A 4PJXE 2FECL 4PRBB 4ZTPH 5I1HH 3VXOB 3ULSB 4TOYH 3BD5A 4JY6A 2FIKB 5BVJA 3GJEB 4YXLH 1QSEA 4ELMF 2ZCHL 4WNQB 4LK4A 4YHNB 2R29H 2DD8L 4LLVA 4MAYA 5E99H 4LSTL 2DI7A 2ZSWA 1HH9B 4NC1C 5F7NC 4QF1B 5KSVB 4PTUA 3VWJB 2P8LB 1OAQH 2Q6WB 5FOBA 2DICA 3P9LB 4Q74A 1QNZH 5IMOA 4JREC 3LIZL 5ENWB 2JIXB 4LEXH 1C5DA 3T0EB 2BVUA 1XF5B 4G8FA 1IE5A 5ITFB 4UILH 3ARDD 5D2NA 3S3JA 3U9PL 2A2QT 2D03H 3QAZC 2Z91B 4NWUL 5HJ3B 1U8JA 4S1QH 1CVRA 1NSNH 2ERJB 3ISWA 1CDHA 1P4LA 5ESQB 5FUZL 1NCWL 4P2YA 5ALBH 2RCSH 4HS8H 1MCOL 3WS3B 4NO3A 5F6IC 1VADB 4OCRH 4NQEA 2BOCB 2C4FT 1J10A 2NMSA 2R0ZL 3SJVB 5CJBA 1BPVA 2BVOB 3RU8L 4YE4L 4LEXL 4I5BB 3TWCH 1IEHA 4H88L 3VFNA 3H9SB 2CLZA 4BUHA 4JG0L 4JLRA 1CZ8H 4XVTL 2ATPA 3NGBC 1A7RH 4MD5B 3ARZA 2AAVA 5E2TH 5GZOD 3QQ3B 4LAJH 3P4OA 3VCLB 2AI0H 4LMQE 3U0TA 3WIFA 3QUKA 1NBZB 4NFCA 4JRYA 2GJ6D 5F97E 4XTRD 1U95A 4I2XB 2V2TB 2QSCH 4TTDC 3NN8A 5DHVB 4M7KH 3BP4A 5LBSH 3NCCB 2MPAL 5D1XB 3V2AR 4PJBB 1INEL 2GCYB 2C3XA 4HG4K 4U1GB 1GOFA 5IMKB 3WUZA 3KPSA 2Q3AA 1I1FA 1XIWB 3IXTA 3LN5B 4IBLT 1DQLH 1HHGB 4GW4A 2O5XH 4X6CF 2WLZA 1BVKA 1FFRA 2VDRH 1CGUA 4F7CA 4B53A 2WUCH 3BGFB 2NLJB 3CX5J 2VUYA 5F7HA 1KTDB 5I8KL 1FE8H 3ROLB 1KCSH 3OMZA 5D5MA 3VRLF 1CXFA 2BSED 1BZ7B 4GMTH 3BAEH 2R0KL 2O5YL 1NL0L 5SX4H 4P2RA 1IEAB 3ARBB 4W70A 1YQ2A 1IQDB 5IJKC 1A6UL 1C5DB 1YY8B 5D2LB 1R5WB 4OBSA 5DHVA 3W2DH 2XG5A 1Q0YL 4X4ME 2FR4A 4BKLA 4ODWA 4RBPH 1E28A 5JA9A 1EEYA 5DQDH 4OD1H 1HQ4A 5K59F 1A22B 1LP9E 3WUWA 4OCXH 2XTJE 4I4WB 3S7GA 3V4PH 2HFEA 2YPVL 3EYSH 2A6JA 4OF5A 4XH2B 3GSXA 4K2UH 1N4XH 4YDIH 5C7XL 3WLBA 2YN3A 1F8TL 5JOPE 4XP6H 4L8CA 4CU7A 4FQPA 3EOTL 4P4KC 4F7CB 4L8SA 4HK3J 2R0KH 3G5ZB 5ETUB 1MREH 4QHNB 1RUAH 3BGMA 2EO1A 2A0LD 5EUOB 3RJDA 2LV4A 3QUMB 4XHJC 4R3SA 1N3NB 4XC1L 2DM2A 3MCLL 1CL7L 4TSBH 1OY3B 3WDIA 2VL5A 2PTUA 4JZOA 2PR4H 3QXAB 1KIPA 1TPXB 4XMPL 1DQLL 3S5LA 2X10A 1UT9A 3I6GB 4Q2ZB 1FFOB 1OD9A 5JXEA 3MJ8B 2IH3A 3JTSB 4NKMB 4I3GA 4HIJA 1QSVA 4I2XE 4QRUB 4HIIA 4JFXA 3QUYA 5GGSA 8FABB 2OTUA 3TA3A 1G7HB 4FQXC 5GZND 4MNQD 1ZA6B 3GB7A 5ANMB 4JG1H 4PRHA 1HKLL 3P9LA 4D0BB 1S7QA 3UDWC 2CIKA 1MI5A 1ZXQA 3RIFF 1J8HE 1M05B 3WBDA 5HYJB 2ZUQC 5HI5C 1BLNB 1U91A 3L3GA 2IMMA 1CXHA 2VXSL 1FAKT 1T1WA 3BWAA 4YR6B 3VXMB 1U8JB 4BQBA 5CEXB 1TJGL 3R8QA 3VXRE 4NQDA 5J13C 4OZFG 4LVOC 1I1YA 3N85L 3BGFC 3R0MA 4LCCB 1OVZA 1NEUA 2JJTA 4JFHE 5DGQA 4H8WC 1JRHL 5CSBA 2XPGB 2WIIA 4L5FH 1VPOL 3HE7D 3VWJD 1SVCP 2XICA 3CZFB 4LASH 5EWIL 3OKDB 2VR4A 3T0EE 1GYAA 3IDNA 4FOMA 4LLMA 1T7VA 1ZVSA 3HMXH 4X6DF 1MRCH 2BHYA 4KHXL 5AAMA 4ZFZB 3CPLA 3ARGD 3RY5A 4K9EH 5CINH 2QQLH 4JR9H 3HC3L 4BK5A 4F2MB 2Q76B 4WO4A 3RWDA 5LG1A 5IEKA 4MCYA 3WMSA 4YBHA 3B9KA 6FABL 4XBGB 5GGRA 3VD9A 3BO8A 1W0VB 3PWJB 1UM5H 2NW3B 1A6ZB 4NZRH 3TO2A 4QRPB 2R0WL 4K7PX 1YEGH 5EA0L 5E7FA 2C5DC 4QOKE 2AK4D 3ZE0F 1E4KA 1YMHA 3CLEH 2X70B 4PBXA 4M1CD 4K94L 3VFPB 1FNEB 4JHZA 2NX5E 4GMSH 1A4JA 3X11A 1NGZB 3BVNB 2H1PL 2HJFB 5J1AA 4JFOB 4PB9H 2AK4E 2A6KB 4HKBB 3MV8B 1FDLL 4Q6IB 3C2SA 5CD5C 5AD0B 4Z7NF 5E8OA 5JNYA 5ABDE 1A7RL 4R7NA 2NLJA 4PJXA 1LD9B 5HYSA 1N0XL 4KY1H 4QF1A 3FQXA 5BQ7B 4YE4H 4J8RB 1RZ8B 3IJSA 3UTTA 3GKWL 1G7QB 4NT6A 2ICWJ 1JL8A 4XTRC 4NUJA 2K9UA 1L6ZA 2JCCA 4G7YH 3MMEA 1T83C 1IGJB 1FJ1B 1S9KC 3REVB 4JN2B 2MQ0A 4LHQB 1ADQH 2AJ3A 3QIUA 5CLWA 5HSFA 4GW5A 4OBRA 5I0DA 5HYQA 3IU4L 1S7WB 2B4CH 1A14H 4GAJL 1RZ7L 4DVBB 1IMHC 3DX7A 5CJXC 5CZXC 4MVBD 3N1MC 4NKDB 5F3HB 3SDAB 5F71A 2VLRE 5KSAA 2V9QA 3RL1A 1BVLA 3B2UC 2DM4A 3OGCB 4MQ7B 3DROA 5EA0H 3ZE1F 2CLZB 3NIFF 1YECL 1G6VK 4OI9A 2YA2A 1G9ML 2ENSA 4OZGA 3B5GA 1X4YA 1GOGA 3P73A 1UVQA 2I07B 2P47B 3HS0A 2OP4H 3PL6A 5EUOA 4ZOEA 4FZ8H 2APTA 4DTGL 1X5IA 1OP5H 1P1ZA 5DJYB 4JN2A 2P8LA 4Y0GA 5ILTL 1AXSB 1GC1L 3SO3C 5IB2A 2H45A 4QRRA 3B9KD 5I1HL 4J6RL 4P9HC 1UM4H 4K3JH 3BP5A 1NCAL 3MLUL 4H8WL 4JG1L 1RULH 4P0DA 2B5IB 4YAQB 1PJ9A 2YD9A 4MNGB 1MLCB 4PJDA 1RJZB 4OTXH 4APQA 2B1AL 4DOHB 1F13A 1NGQL 3ULVC 1CTOA 1S7XB 1NLDL 5E9DB 1RJLB 3KNBB 4D9QD 3UTPE 4LBEA 2ZCLL 3BKJH 4L29A 4F80A 3J7HA 4NQSB 4EKXA 2E7BA 4XBEH 1BZ7A 5HDBE 2FNBA 3ARFD 2C3HA 4DGIL 4UQ3B 3C60D 3LMJH 4OZGF 2IG2L 1IFHH 5LJYH 3EFDH 1EGJA 3L95A 3WXWH 3RY6C 1NUDA 3SE9H 3MLRH 1N6VA 2VH5H 4IIQB 3FFCE 5J9PB 3ECBA 1UQSA 3QCVL 3U4EA 5J6GA 5E8NB 3B3IA 4TQEL 1Q9OB 4M9OA 2PN5A 4I3SH 5C9KA 1IM9B 1LO3H 4OI8A 3T65A 1RUMH 1MCDA 4JFHD 3DYMA 5GS2D 3BPNB 3DX8B 3RKPA 3O6LH 3D0VB 5GHWL 4ZUVB 3ARRA 1HHKA 3BP7B 3H0TB 3C60A 3DX7B 1ZGLA 1KTKE 3BAEL 4ZAKB 2FYYA 4A6YH 1MWAH 1RJYA 3CLEL 3BO8B 5FDWB 5HHME 1J87A 4MHHI 3ZE2F 3MFGB 1HHGA 4LOUC 2C3VA 3EFFB 3H9SA 5J3HD 1B0GA 3HI5H 2HKFL 4URTB 4KTYA 1DBMH 4YXHH 5IM7A 5DR5L 1KENH 1J8HD 4XX1G 3Q3GB 3GKWH 4EDWH 2MOVA 2B5IC 4PRIB 3K4ZA 3HE6B 3WCYA 4HWZB 4KJYB 1BJ1J 2W38A 4G6MH 2AV1B 3MRNB 1U8MA 3QYCA 2NNAA 4K7PY 4P5KB 5HDBF 1NUFA 4PJHF 3VMNA 3QIBD 4U6YA 1NGXB 4P23B 4EZMA 4TNVF 4XP4H 4FQJH 5IG7B 5EZJA 5TQ2H 1ZMYA 2R2EA 4L4VB 1NL0H 3Q5OA 4I1NB 1G9NC 2GAZB 2AJYL 4NM4L 5C0FA 3K2MC 3PWLB 1VKXA 4YR6A 3JTTA 3KPSE 4P59H 2W07A 4J3XA 3ROLA 1CQKA 3S35H 3IFOB 1Z2KA 4PJAA 1L6XA 3GHEL 2X4UB 4F9LC 5TE4L 3LQAC 4H1LH 4P5TA 5K9KA 4EEEA 3OZ9H 4GKSB 4UOW1 1BQHG 5DC4B 4IJ3C 3GIZL 3GJEA 1XIWA 2AVGA 3D85A 4HGKC 1IC4H 1INEH 3WO4B 5DT1L 1W0YT 5KN5A 2SEBB 4R7DA 2GJZB 1N26A 2C9AA 5F7UA 3IDIB 2J8UF 4BUGA 1DJSA 3OAUL 1H15B 2O26U 5INDA 4F58L 2B0SL 4HFWA 5AWNH 4FMKA 4JG0H 3EO1A 3M17A 4Q6IC 4FQ1L 4WI8A 3VI4E 4QT5A 3TWCL 3LZFL 1HE7A 2JJUA 1HN1A 2JJSA 1G7PB 4OV6F 5HDQH 3ZE2E 1UJ3B 5EIIB 4X6DA 3VXMA 4JRXD 4KRMB 4G8GA 4HS8L 4MQTB 4GKSA 3DECA 1ES0A 3L5HA 1TETH 5MHSE 1GL4B 3FN0L 1N7MH 3WNMA 1G7IA 1WFUA 1T7ZA 5JTWA 1B2WL 4FXKB 1PKQB 1UB6B 5BMFH 2X6MA 2Z8WC 4RQQA 1EH9A 1ZA6A 2YKLL 4IIQC 2Z93B 4P9MH 5JDSA 4KI5C 3GO1L 4YXKL 1A3LH 1DBML 4YXHL 5E24E 5F88B 5ICXB 1KCRH 5IG7A 1LDPH 5C3LD 5MEQB 1HNFA 4MX7B 3ZZ1A 5JMOC 4WV1B 2E7MA 4GW5B 4MJIA 3O3DA 1VEOA 5D96B 3ZTJG 4Z7WE 5E99L 5A2JH 3RBSA 5E2UH 3QNYA 3EYUH 3U4EB 1X5KA 1YEDA 3QG7H 3IDMB 2APVA 3FFDA 1OTTC 3LN9A 1RY7B 2EYRB 5HHOA 4XCNA 1YC8A 2I9LB 3BP7A 4IDJH 4RX4A 2IALB 4HKXB 3UTOA 3WS3A 2Q8BH 2XQYK 3WFCH 4O4YH 3PWPE 3UZQA 5CMAB 1MCIA 4MDIA 5D5MF 4MMXC 3U36A 1S9VA 4F9LA 4GXUN 3VXRD 1I8IB 3PUCA 1ZSDA 4P2OD 3RWGA 2H2SC 4W81A 4Y19B 3DXAE 5GGUA 4C4KT 3KPRD 3TGXA 4KKBD 4WUUB 2CXKA 1UXSA 4PJ9C 4MD5A 1YY8A 5D2LA 1UGNA 4X4XB 2CRIA 4X6BB 1AD0B 3T04D 3NAAH 3MJ9H 4LCIH 3A6CH 5I8KH 1L9MA 4PGCA 1GRWA 5BVJB 3EZJB 2ARWA 1JGDB 1XGRB 3THML 3MRIA 3IS1X 3CVHL 1H5BB 3KPSD 4NN6B 4KK9C 2JJSC 1OAZL 3UO1H 4AIZA 1D3CA 1AGEA 5D1QA 1ZHKB 5EZOL 4LBEB 5BO1L 1DUYA 4AL8L 1NCNA 4HDIA 4G42A 1DE4A 5ALCL 3DX9B 2WWMC 3MJ7A 4O58L 3QDJD 1PQZA 3NCYS 1IAII 1A14L 5F1NB 4WWKD 3LD8B 5CCKH 5GSRB 4C57C 2ICEA 1M7IA 2YD8A 2YC1B 3ARDB 2PW2B 5DZNA 4IRSC 5GRUL 2RIKA 2NW3A 2OJZH 2X1QA 3WIIL 4APQC 4BJLA 1J0HA 5HHQB 1HSAA 3DURA 4XXDA 1LE5B 3PG2A 2JF1A 3VFWB 4LPVA 4HJGA 1UM5L 2XN9B 4Y5YA 4LAQH 2PO6B 1UWXH 2WMPA 3QQ4A 3O4LB 1Q72L 1XGRA 2VLJD 1KIRB 5J56B 1FORH 2PUQT 3KXFB 5HD8C 1MFBL 1NAMA 5C70A 3C2AH 5EU5B 3S3PA 4P9ML 4U2ZA 5C6TL 5E2VL 3CSYA 3U1SH 1RZ8A 1GGYA 5F70A 1PX4A 1G6RB 1KJ3H 5CKAA 2IH1B 1EEZA 1UXWB 5KJRL 4JHAL 4IRSD 4EBQL 1FYTB 3CDYA 3TVMC 3E6HA 3EDEA 5LAXA 4XP5L 1I1YB 2YC1A 2ZUVA 4YPJA 4BYHA 4TUJB 2RR3A 4LSSL 5DJ0B 5BS0B 4O51A 1Q72H 1HINL 5DJCB 4KJYA 1KIPB 4RWYL 4U1JA 3NPSB 1JGEA 1CDYA 1FVCB 3D39B 2VXUL 1C5CH 1C7TA 3GIVA 5KSVA 3AMLA 4IRJB 1J0KA 5FKAA 4YIQA 1DVFD 1T3FB 3GI9L 1KLGB 1HCFX 2E5EA 1TQBC 4ZUWA 1AE6L 4K3EH 3TYGL 2AXHA 1JZ5A 3VXTA 3OR7B 5DWUH 1J0YA 4WU7A 2A38A 2YUZA 1S78D 2PTVA 4JFZL 2OMNA 15C8H 2BVEA 5T1LA 3CLFL 1BHGA 3IDYC 2NX5A 4I0PA 3CFKA 3QRGH 2EEAA 1E28B 2XXCB 1XGQB 3MNVB 2IFGA 2DI9A 4K3DH 4QO1A 5HYFA 1XGYH 2A6IA 3V6OC 1AI1H 1F90H 3HNTH 3E2HC 5FUOH 4PG9A 1JV5A 3HNSL 4HKXA 3HAEB 3FO1B 2YRPA 4NFBA 2RQ8A 3JWDC 2CIIB 3NFSL 4DZBA 2DM7A 2DOCA 1JHTB 3HMWL 1AGBB 4YH6A 5HYJD 1VHPA 4KI5E 1S7TA 1T3FA 4J12A 2AKRA 4Q9QL 4N8VB 1A1OB 4CU8A 5BXFA 4TTDD 4UTAH 1WZLA 3OKYA 5E2JA 2FBJH 4ZFZA 1WAAE 3LAFA 2OJEB 2IANB 3TIDB 4X7TB 4GKNB 5HHMB 1WJ3A 5D1XD 3TBVB 2FSEA 4P4KA 1X4XA 5GGRY 8FABA 1RUQH 3BP4B 3BX7C 3JTSA 3B43A 1MJJB 4PV9A 3VXSB 5EO0A 4QTHA 4TULL 1AQKL 2FL5B 4X8JA 4PREB 4E41B 4UQ2B 3UXFA 4ETQA 5M95B 1LWRA 4NO0B 2YBRA 2Q20A 3QJFA 2CMRL 3QB7C 5BRZE 4ZPVB 4CVXB 4DGVL 1G7IB 3M07A 1ZAGA 3RWCA 5KSUA 1YN7A 3M8OH 2VISA 3PWUB 9CGTA 4YHPA 3BT2L 3TM6A 1RUML 3V79C 3NA9L 1KGCD 5GS0C 1KIUA 5CEZL 3L7EB 1PG7H 3BIKB 5DK0A 2ZOKA 1DLFH 4PJ5D 3MLZH 1GH7A 2I25N 2MJWA 4Y8AA 4PJ7B 2C3VB 2FHBA 4N1CA 3I2CL 4GUPB 1MY7A 2VZ3A 1I8LC 5IW6B 4JZJA 1JWMB 4G6AC 3GBNH 1EHNA 4E41A 2F9BT 4RFEB 1CL7I 1HHJA 2OL3B 1B6DA 4HWZA 4LLWA 1FFOA 1AR1D 1AQDB 2VDPH 1MRDH 5F9JB 2JE8A 3BKJL 3JUYA 4I3RH 2Q6WA 3V4PL 2VISB 5I8OL 5E8EA 5C9JB 1ETZB 2XZAL 3CFBB 5GGSY 4CADB 1OD7A 1S78C 2A83B 1CD0A 1DBAL 4HLZH 4GW4B 2YRZA 1CWVA 1WLHA 2AJZA 4XBPA 3V6ZB 1JHTA 3O6KH 1F11B 3RPKA 1ADQA 1T21A 1IZKA 3MRLB 3U0WL 3SKMA 3UTSB 5LQBL 1W0WA 2QEJA 1K8DA 3RRQA 3BUTA 4F7PB 4QRRD 2XQBL 3MUHL 1WZKA 4O2CB 4IOFC 4KQ4L 4E0RA 5AUMA 4PJDF 4HUVB 2FHCA 4ODHL 4WEBH 2VE6A 3GHEH 4JREB 1YNLL 5IJVA 3TO4C 4JPIB 2GITA 2R69L 4KMLB 3I50H 2ZP0T 1V7MH 1E4KC 1F3DH 4BZ1L 1AXTL 1A7QH 3BZ4A 3WNPA 3F7RA 5I8EA 3VFVA 4MD0A 4CNIA 1FIGH 3HB3C 1MJ7H 3OX8B 4V1DB 5C71A 3K8LA 3RTQB 5DTFB 1T1YB 1YJDH 4PJIB 1J1OL 4NO2A 2NW2B 3HG1E 1QBLH 1CK0L 3BOVA 2G2RA 3O3BA 4POZC 1CFSB 3V8CA 3O3AB 1YQVL 2R1XB 5FV2A 1G0XA 1W72A 5BV7H 3SDCB 5GRJH 1W8NA 5GGUB 1NDGB 1MLBA 4H88H 4PJDE 5HVFB 1D5BA 2DS4A 5AUMB 4G7YL 3LEVL 5BZDB 4LP4A 2P24A 5D9SA 1QHOA 3MV8E 4JFPB 5EORH 1LEKA 1K5NB 1IEBA 5ID1A 4NKMA 3HRPA 3FB7B 3KLSA 4Y4HD 4NNXB 5C8JA 4H0HB 1MAKA 4HT1H 4OGXL 1A8JH 3W0WA 3JWDL 4D9RE 1EXUB 5ALBL 3DMMC 3SDXE 2AJYH 3S3SA 5IHLB 2JCCF 1BX2B 3HFMH 4OIBA 3CXDL 1YEIH 1RK1B 4X7CC 4NWTH 3FT4A 3W5MA 5GGTL 3EOYG 3BSZL 4HJ0C 4HWBA 3IYLW 4MNHA 5F7LB 2CSPA 1DQJA 2VXQL 4RRPA 1MAML 1FZMB 3NPZB 3P9MB 4L3AA 5ALCH 1LO3L 5TH2B 4BQCA 5T3ZH 3U46A 3GSWA 5C09A 2Z91A 4HCRH 1DANU 4QTHB 5GSVB 2UZXB 5T1MA 3TBSB 1HZHH 3LEYL 1IBGL 4WW1A 4LSPH 2DLHA 4HULB 3FOMA 4GSDH 4WU5B 3RX8A 5DJXA 3WN5B 1D5ZA 4YHIB 4EIGB 1IZJA 5C6PB 4LRNL 4JO3H 3SDDC 4L4TE 5ICYB 2CUMA 5D6CA 3UZEA 1A3LL 1NCBH 3O11A 4YQXL 3CGTA 4ORGB 3ZDZF 1Y6KR 2XIDA 3CXHK 3GFUA 1UQSB 3GSUB 1P1ZB 1BQHA 1BZ9B 1QFWM 5ICZA 2F53D 4WTZG 1WUNT 3PDOA 3SQOL 2P44B 1MRDL 4ODXA 3MNVA 3ARDA 3V6BR 4KRLB 4ZSOB 3QNZB 2EC9U 5DC0A 3HAEA 4ODWB 3I6KB 4KKBC 3SE9L 1EJOH 1QYGL 4RGMC 3QG7L 3KYKH 4EN3B 3MJGX 5JIPA 1ZHKA 4PGBA 1HIMH 5E9DA 4OLYH 5E2WH 2NY7L 3TT1H 4NP4H 2CJUH 1FGNL 2OQJA 4NQCD 4JQIL 4XBPB 3V6ZA 5TFSH 1KELL 1BECA 4UBDD 4WFEE 3F7VB 1ZLUK 4NO5B 1T2XA 4EDXB 5H37G 2CK2A 2BERA 1T0PB 1MHHA 2NY2C 3IDMA 4JZJC 4LLDA 3FRUA 3KR3H 5D93C 2WINB 4PJBA 4XHQA 4TUJA 5EZIL 4GRLA 2DQTH 1SM3L 1I9IH 2VZUA 3V4VL 3QG6A 3CIQA 4BSVA 5F1IB 1FFQA 2EXYD 2QADB 2XYCA 4ZDHA 1MFAL 2J12B 5E5MA 3UYPA 5GGSB 4HS6A 1CD9B 2FATL 3N1PC 3RX5A 3PGDB 1NBVL 1REIA 1CICD 3KPRE 4KGJA 1AJ7L 3RTQC 1HILA 3ILQD 4PP1D 1YEHL 3MLPA 1CE1L 1CFSA 4Q7DA 1A6ZA 1HNGA 4HBCH 3QUMA 3W9DA 2G2RB 3QFJE 5E6ZA 4P5TC 1RZ7H 2ZJSH 3BSZH 4ELMB 2ORBH 2V7HB 4F7EB 1KTLA 3OQ3B 3AB0C 3SGJA 5I2IB 3GSNH 1S9XA 2EDLA 3PJSA 5F96H 3UBXG 2DQEL 5HBBA 4AQOA 2IQ9L 4M1DH 3BDXA 3VGFA 4D9LH 2A73A 1XGUA 5I18L 5ID1B 1U93B 1GGCH 2BFVH 1FNGA 2I26N 2UYLA 4XX1E 5E4EC 1LD9A 1U8KB 4HS6B 4HBQA 3WFHA 1FFNA 2BY1A 2EZ0D 3P30L 5FGBC 5KANG 5HHNB 1Z9LA 4OZFH 4C56B 4ZMAT 3ES6A 3ZSTA 1NC2A 5DVNA 2H2SD 1J05A 5CD3B 2BNQB 1TLKA 1H8SA 2OJZL 3WIIH 3VXUD 1SQ2N 4M1DL 3D48R 3WL9A 1KYOK 2VZSA 2H1PH 4JQVC 3S35X 5TH2A 5F96L 3MRCA 5IQ7L 1B88A 5ECJE 4OF6A 1C08A 3FKUS 3PNWA 4JY5H 1PEZA 1W0VA 1XZ0A 3VJ6B 2VXTH 3DVFA 2VDQL 2EXYC 1DBJH 2J88L 3C2AL 4IDLA 1CE1H 3VXPB 3S34L 5IB3B 3QDGD 3FOMB 3H42H 3QHZL 3MJ6A 3B9VA 4M00A 2I07A 4YHML 5KVDH 2LAGB 1FV1A 3Q5YA 3HC3H 1VGKB 2VJXA 1V3JA 1FFNB 3SGJC 1SJHA 1KPRA 2VH5L 3DHMA 4GH7B 2F58H 2A0LC 4NM8H 3UJIH 7FABL 3DXAB 2MFNA 3A6CL 4R0LC 4HDIB 1KCKA 1OM3H 1FHGA 4FXGA 3QZWA 1G0DA 5E95B 2PETA 5KSBF 4QRTB 3KHQA 3V4VH 3RVVD 2F54A 3MLTA 3NZHH 3FQNB 5T3XD 3B9KB 2E27L 3QWOA 1BGXL 3O2WH 4Y7MA 1F4WH 1KOAA 43CAA 2R4SL 4PG2C 4Z78A 4JVPA 4PGDB 3STZA 3RZCD 1QKZL 5E4EB 1IC7L 4Z7VF 4RSVA 5HTSA 3W11D 1S8DA 5EIIA 2F74A 1AC6A 4RISL 2R2CA 3RWCB 3GMPA 3MRMB 3VGDA 5HHXH 2OR7A 1MHEA 4LF3A 1KIRA 1MFEH 3NAAL 1NGWA 4IS6A 2LQRA 4X6FA 3C6LB 1EXUA 1T5WA 5HGBA 2DWDB 4JPIA 3MRGB 2OXHA 3WO3B 3WS6A 1A6AA 4F8QA 4OM0L 1H3XA 4YXLL 3RWFB 2NPLX 5FB8B 3GSNA 3K80A 5F9OL 3U48A 5FEBA 3I6GA 3RZCA 4MXVE 1MUJA 1AIFA 3B2VL 1FBIL 4MWFA 3RZCC 3DO7B 5BO1H 2X4QB 3UP1A 3WFDH 1FL5B 4KQ3L 3V0WH 4PY8J 4HQQL 3G5YA 3QUZA 5GS1A 1ZHBB 5CILL 4FN0A 4KUZL 5D6DC 5HGHB 1DDHA 3JSSA 4PJCB 1DUZA 4G8GE 4NJ9L 2YUWA 1ZE3C 3OKEB 5DMGC 3JV0A 2CRZA 4HAFA 4WRLA 3SPVB 2F5AL 3HUJE 2J4WH 3KVQA 3EKCA 4L4VD 5IF0A 4YFDB 2DL9A 1XF2A 4G5ZH 2X4TA 3KWWA 3GJFB 1CGVA 5DQ9B 3NCBB 1Q8MA 4X7TA 2FWOA 1TENA 3F7YA 5F7KC 1J86A 4KK6D 3RAJH 1I1AA 4BQ6A 3H42L 3QHZH 5J57B 3H9ZA 4ZNEA 4XAWL 3LB6D 3VMOA 1QFWL 4X7FC 3LS5L 4P46B 4PJCE 3TP4A 5D72L 1XGUB 3EDJA 2V5RA 4JFDB 4PRPD 5DUML 4R0LA 2VRAA 5DRZB 4Z7WF 4GAGL 5HGAB 4JM2D 4XPBH 1JTOA 5IESL 3VGAB 3CVIL 3F58H 1GAFH 2NXZD 2Y5EA 3NZHL 2R2BB 4X5XA 5I16B 3ES6B 1J9CT 1F3JA 4X4YB 5HYJA 5MEPA 1W8OA 5ISZB 1AHWA 4FQIH 4HEME 4HUWB 3MODL 3P0YH 4J3UA 4V2BA 4LARL 1JFQH 4FFWC 2BDNH 5CKGA 1JTTA 1Z0NA 5J4MA 2BY2A 3QEUB 1P2CB 1QLEH 3WLWC 2J3SA 4NQDB 1V7NH 5C0AA 4GT7A 1XF5A 3GDBA 4JM2A 3K8MA 4JKMA 3O9WA 1NDGA 1TTUA 4ETYA 3JV6B 1J5OL 4M8QA 4NN5C 1NH6A 1HYSD 5TQ2L 2OCFD 4GS7B 3BH8A 4PRAA 5DA4A 5DI8B 4CMHB 1EA9C 3TV3H 5IKCB 2H26A 4POUB 2BY3A 4ZUSA 2Y4SA 4YHNA 1J18A 4UILL 5ESQA 1BX2A 2H32H 4DKEH 3VRJB 1S7UB 3W0WB 4GFTB 4HK0A 2HA1A 4PD4K 3ARGB 1FC2D 2YK1L 2OR9H 4ZFGL 2Z31B 3WE6A 1NAKL 4KAQL 1CD1B 4LCYB 3C60C 4G80A 1P7KB 5HI4D 3MRPB 1P2CA 5GJSL 1QLFB 5DRWB 1OAQL 5J06A 4JCLA 3D87B 1RJYB 3SBWC 4PGBB 4OZIB 1EEZB 5IB4A 3KYMA 4QKXB 3Q6FA 5IB1B 4WWKB 1YC7A 1O0VA 5DLML 2CK0H 3HZMB 3BWUC 1PW3A 1R5WA 1I9IL 1I1AD 3T8XB 4ODBD 4G8EB 3N1GC 1RHHA 1UKTA 4K7FB 4RGNB 1BBDH 4PRNB 1QSEB 4OD2B 4C4KO 4PJCF 2XG4A 4ZD3L 5IVXF 1C12B 3F5WB 5C0GB 4MJ6B 1NC2B 2PYED 2JKXA 1NMAL 3WUWG 3U6RB 1RU9L 5EO1B 1I7ZB 3QIWB 4BA8A 1C5BH 1V3KA 2CMRH 5C0NC 1CE6B 2VZOA 3IU3A 1WEJH 2X4QA 4ZO9A 3DSFL 1DN2A 3EZ8A 1WBXB 4X80L 3MJ7B 3SGEI 1T83A 2PYEE 4WI4A 5FHAL 2YHGA 1MLCA 4AQ1B 4JRYD 4Y1AE 4XPBL 5HI3C 5IUSA 4R97C 3GSVA 1YEEH 3NN8B 1AHWC 4X99B 1W0WB 1CT8B 4MJ4A 4M7JL 3DYOA 3BD4A 4NRZB 5C0AD 2UWEB 5MENA 5C07A 3PHOB 5E7BA 1T4KB 4DVRH 3HC4L 2ZCKL 1K3ZA 3PQYA 4BSJA 2WM0A 3LRHA 1JPSL 3QCUH 1LK2B 4KKAD 4HS3B 1IQWH 1CIUA 5E6IC 3QO1B 1NCBL 4YQXH 3OJDB 5ESAB 5CEZD 3DETC 1Q9WA 2B1AH 3IETA 2O61B 3L7EA 3IRZA 2H26B 3PE9A 1JHLL 5D7KE 5CZVL 4A6YA 4ZTOL 4E5XB 1KLUB 5KG9B 4LRNH 3IXAB 3SHSA 3QQ9D 1ND0A 2VLKD 4N8CL 5GZNC 1P6FA 3QWOB 4XWGH 4LCWB 3FRPG 2OL3A 4ZTOH 3MLTB 3AFLA 4JFEE 3FTGB 4MXWH 3CVIH 3F58L 5LGJB 4X5WA 1IT9H 4WO4C 4QRUA 3TBSA 2VLRB 2XWTA 2COQA 4RNRB 4S0TD 3MO1B 1ONQA 1ZHLA 1PFCA 4MCZB 2DQDH 4UV7L 4HQQH 2GHWB 3P4MB 5GZOC 1F4YL 1NBYB 5DD1L 3DARA 4OFVA 2DBLH 1P7QB 2GQHA 3VFOB 1EAPB 5JIIA 2M2DA 2Z4QA 3U79A 4NHUA 4UV7H 3ARED 4DEPB 4QLRA 4C59B 4M6NH 4M48H 4HPOL 3UROR 2GK2A 2BHUA 2P45B 1A1OA 2IGFH 1BD2B 4XVJL 1Q0XL 1PG7X 2VDOH 4TRPL 1A5FL 3ROOB 5D6CB 4PG2A 5HHQA 5KVEH 3PGCA 3SKUD 5F88A 5FA4A 4IEFB 4L8BA 2GK0A 4EUPB 3DUSB 5C0CD 3MXVH 5CJOH 2GITB 1O7VA 4K94C 2X70A 1D6EB 3BKML 4MD4B 3RL2B 1FVDB 2AXGB 4U4BA 5GRYA 4Z95H 5GXBB 3FL7A 4EBQH 5IW3A 4YFEA 1BGXH 3O2WL 3DMMB 3MYZA 1R3LB 5J6HA 3L5WA 1ED3A 1YPZB 1IM3A 1UJTA 4J3SA 5D71L 1JCKA 3BW9B 4XNYL 4X6EA 3KHOA 3LEXA 5DZOA 3FQWB 1QBLL 1CG9B 3K2UL 4NZTH 1R5IA 1NLBH 4GMSL 1DN0B 2EEBA 4NN7B 4M7LT 1BLNA 3HN3A 3W5NA 4BZYA 5IMMA 1YY9C 4HF5L 5JOPD 2W60A 5E5RB 4CN1A 3TO4B 3RVVC 4OFDA 1B4JL 3L3KB 1KPUB 5BV7B 4XRCB 3QP3A 3QUYC 4U1JB 4ODUA 4HUMB 4XPAH 5JHDD 2VQ1B 2VLLA 4KJQD 5LCVH 3U7YL 3SDAC 5A2IH 4OQ1A 1F3RB 5DURD 5E5UB 2VAJA 4ZSOA 1ITCA 3RGVA 5CLTA 4DVBA 4N0UB 2LVEA 1QBAA 4PY8I 1JZ4A 2NTSP 4UOJA 1MFDL 4OB5L 1JP5A 3DJ9A 1FRGH 4Z7VB 1DVFB 2A83A 4DN3L 3GMPB 3VFUB 4QTIH 5I1LA 2LAAA 5H8DA 2QR0A 3QXWA 3G5ZA 5IW1B 3ZTNH 2KH2B 3OSKA 3P30H 1QPPA 2NCMA 1T1WB 4N90E 4FQCH 4G6JL 4V1DA 1CLYL 4K9EL 2Y06H 5K33A 3LSOA 4TUOA 1IGFH 1G7JA 5FXCH 1SBSL 4LCIL 3EO0A 1ZHNB 2EH8H 5FO9A 4XP9L 4CMHC 1Q9LB 3O41A 3OAUH 4WU5A 4HC1H 4M7ZC 3CD4A 3O0RL 1DBKL 5MENB 3VXNB 1U6AL 5IFJB 1XCQA 5L9DH 4WFFE 2VC2L 5EOTA 2Y25A 2NYYD 5C08E 4GRLB 1QQDB 1WWWX 1RI8A 1U3HB 3I2CH 1CIDA 2OMBA 4A6YB 2OJEA 3QQ9C 5C0JB 4M6OH 4AM0B 4AYFA 3OG6B 5A2LH 1F4YH 4PJIE 3TVMB 3T4AB 3OBAA 1MH5A 3PHQA 1EVTC 2AK1H 3FB8A 1QUNA 4HXBH 4Z77B 2R2BA 2Z0BA 2HYMA 1K85A 1RURL 2V9TA 3MRHA 1BQHB 4I3RL 4OZHE 5ICZB 4DGYL 1E4JA 4IHOA 4RMUA 4J3WA 3RPIB 4MA3A 5JW4M 4L8DB 3D3VE 2X4PA 1GGBL 1YN6A 3T0BA 1H9VA 3ZKMC 2PYFA 4YHLH 3ARBA 3P4LA 5SV3A 4O2CA 1GPOH 1XT5A 2IGFL 4XWOC 3O6KL 5EDXA 4NYLA 1IVLA 3L5XL 5IHUL 2VE6B 1K4CB 1VGEL 4EIZC 3UTSE 3RGVD 4PTUB 3VWJA 3V4UH 5IT2H 2W9LA 5EO1A 2UYLB 4TQEH 3LCYA 2PR4L 1F58L 1XF4B 5I66B 1M7XA 5IHUH 3RWIA 3L95B 3S37L 2Q7NA 4XB7A 1U8HA 4PJAE 3RWHA 3VD5A 3WNLA 3HMWH 4PJFF 5AYUH 3UJTL 5F6HJ 1BD2D 2K7PA 4I18B 4OKDA 4IHOB 3EJZD 2XQYG 4BSWA 3FAWA 2UWEE 4LFHG 5F21B 4YBQD 1JYWA 1OQOA 1HKLH 2J6EA 4YWGH 1I7RA 1N4XL 4YDIL 5C7XH 2XZCH 3S36L 5M94B 1OTUC 2CR6A 5EU3A 1L9NA 3MCKB 3QIBB 2XWJA 2Y07H 4BELD 4HUVA 4EI5C 2YD4A 4GG6F 1JNNL 5EC2A 1Q9LA 3O41B 4I18C 5F3HA 3SDAA 4RA3A 2A77L 3W39A 2X40A 1QKZH 4W4OC 4P23D 4OSUL 5I73C 3MUJA 3MROA 1IM9A 4LCWD 1TPXC 3T0EA 3QCVH 1N8ZA 1EEQA 4ELMA 1NKRA 3JUZA 1EMTH 4NIKB 5FYLH 3QWQB 2CRMA 5IQ9A 4NBXB 3H9SE 1U8NA 1T20A 4Z7QE 2ENYA 3AS0A 2BNUA 1RZGB 4OJFL 4RMWA 4PJIF 1XCTB 5AZ2L 4F7MA 3SJVE 1QFPA 5BOPA 3MQIA 3CUPB 4OT1L 3P4MA 3HNTL 1TCMA 4PD4J 3IAQA 1Q1JL 1C5BL 2XTJC 3CFJB 1BF2A 5D7SH 4QRQB 4W6XB 3W39B 2XT1B 1AO7E 1U3HD 4X7DC 4X98B 3RIAF 5D9SB 2MPAH 3QJFB 2RAMA 5GISL 2VDQH 4ZFOB 4XP5H 4QYOB 1BREA 5TGBB 4N8VG 4X4MA 5DHVH 1FIEA 3D0VA 4JY5L 4UDTA 1DCLA 2E8ZA 3MZGB 2ATPB 1KJVA 4KXZH 1KV3A 3OWEA 5DRNB 4X6CB 3UPRA 2EH8L 4M7LL 4TUOB 5FA4B 5ESAA 5L88H 5E94B 1H3VA 5ENWA 3RVXC 4MAUL 3U0PA 1INDL 1VSCA 2ADJA 4OGYH 1BOGA 4P2CG 1I3VA 1HZHL 4HK3N 4HV8B 4S1RL 5I1KL 2YUVA 1T03H 1J0IA 4DKFL 1JI1A 3B5TA 4I77H 5KW9L 2FZ3A 3LKRA 4M6OL 3X3GH 3RI5F 4MS8C 3G5YB 1I1FB 1ZLSL 2MQCA 5HJ3A 2NXYC 1S9YA 4OF3A 2VXQH 3E6FB 3TYGH 4H20H 1TJIH 5C0JA 1IM3B 4ZO7A 1KPRB 1M4KA 1LMKA 4FQHB 1D5XA 5DURB 5JDJA 3FB6B 1YEKH 6CGTA 3BPOC 1KJ2H 3FQRB 2FX8H 5DYOB 3Q1SL 1D6VH 3UTZB 4PJGE 1YMME 4L4VA 3NIFE 1SEQL 4YDKL 3H9HB 3RKDD 5T3XL 3RA7L 5IBUG 3WSQL 5BOZG 3VGEA 5EZOH 3TZVA 5IMMB 4FFZL 5EOCL 1T03L 5C0IB 4LQ1A 1CLYH 2F5BL 3C09B 1TJHL 3FB5A 2WP3O 3PGCB 1ZT1B 3K3QA 1IKNC 2J6EH 2BNRA 5A3ID 3FQTB 3C87A 2KQNA 4Q0XH 1OGTB 1NJ9B 5JQHC 5BS0E 2YUXA 3SGKA 3NZ8A 3PWVB 4K3HA 4LKCB 3ARPA 4PJ9B 4YDKH 4R90H 3MJ9A 4PS4L 4CVZB 4JRWA 4KKAC 3ZHLA 5DK3A 4NWUH 5HHPA 1PZ5A 1RSFA 2FYYB 4EN3A 4LCYA 4UDUA 5JIHA 4XCCH 5C1MB 1ND0B 2W91A 3DYPA 3IFLH 5I19H 3HZVA 3WJLC 1CF8H 2NY3C 1X5ZA 5LGJA 1QNZL 1Q1JH 2LU4A 1S3KH 5EUOF 4HPYH 5E00B 1RIHL 2QADC 4WEBL 4DQOH 2EDBA 2OSLB 4OJFH 5HYSG 3REWB 4XPGL 2DQCL 1BAFL 4JM2B 4NHUB 2ADJB 4HJJH 3MRIB 4U7KA 4LCUA 5B39B 1MCJA 3KG5A 2LTQC 1QHPA 3G6AB 4M8VA 5DJ6B 2FIKA 4MQ7A 4RAUA 3MZTA 4EN3D 1RHFA 4UV4H 1T6WA 3MLZL 2DQUH 4JFED 2WQRA 3MV9A 4I4WA 2OQJB 1EHAA 2IC2A 4ONFH 5L0QC 4OV5B 3F7YB 5A16B 4TSCH 3GUTB 1AY1L 4KDTC 2OS7A 4L9LC 4QRPD 3QA3B 1BMGA 1HEZB 4MQXD 3MBEA 5ETUA 4TVPD 4WV1C 4FG6C 3TNNA 3C8HA 1L0XA 3FN0H 1QVOA 4Q9RH 1UJ3A 1AXIB 3T2QA 5DD5L 3T1FA 4P3DA 5SWSE 1MWAB 5KTEH 2AJSH 1RZFH 4OCSH 1D5IH 3OKNB 3AAZB 1FH5L 3OKDA 2GIYA 5T5FL 1XIWD 1ED3B 1YPZA 3G04A 4UDTB 3TN0C 2NY5C 5ADPL 4M7ZB 5C0DB 5HPOA 1X6LA 4R26H 1T0NB 2LU7A 2DLFH 3T09A 2ICEB 5DQDL 2D7QA 4MXQC 5E03A 3ZDYF 3S8WA 5I71B 1FPTL 4TPRL 3TH4T 2AEIT 4ODTL 3WO4C 1BJ1H 1GGBH 4KK9D 5HVHB 5JXAH 1DQJB 4R90L 1JWMA 1A6WH 5FO7A 1CU4H 4H0GA 2YPLD 3S37X 3QUYD 7FABH 1IBGH 4QHKJ 5CEXA 5DFWH 6FABH 5C07D 4IMLB 2ZWLT 4HK0B 5CJXA 3RVTC 1R0AL 1KEGL 3ZTJH 1LO4H 2FIRT 2M1KA 3GMMA 1BJMA 4Y2DD 1BBDL 2HT4C 3KXFA 1FFPB 4J8RA 1E4XL 2FJGB 4HX1A 2R2HA 4CW1A 3OF6A 4XMLH 1N8ZB 1RZJL 2NNAB 5DUBB 3RWGB 4PJ5E 4NNPH 1AHWB 2VDML 3DXAA 4JFQB 4U1HA 1JPFB 4KRPB 2BJML 5T1DH 2BVQA 4CDGC 3HFML 4XMLL 1NGPL 1EHLL 2P24B 1GHFH 5CJ5A 4HWBL 3OXRA 3MGTA 5D7LD 1ZLSH 4ENED 3LY6A 1S5IL 3DRQB 2BNRB 5F6HI 5F8RC 2OTWB 1T80A 3RU8H 2H41A 5DVMA 3STBA 1JZ2A 2EC8A 4M3KB 5DD6A 2BSRB 4MJ5A 3AY4A 3WKNA 1DQDL 1I7TA 4PRPB 5DEFB 4GBXB 4HMCA 4G3YH 4LHUA 2P5ED 1MEXH 1KFAL 1L4IA 1IC1A 5DS8B 4FXGB 3UYRL 2IQAB 4FS0A 3MNZB 3PXJA 4U05A 4HIHA 3WLBB 1CDBA 2DTSA 4TNWF 2OM5A 1FNFA 4LASL 4Q6IA 4S1QL 5EWIH 4G43B 3L9RB 3BPNC 4MYWB 3L3HA 2R15A 3QEUA 4P2RD 2ZNXA 4XNQB 1IJ9A 5LCVL 3L3KA 4WDIA 4M6AA 2X4PB 3KPMB 4UINL 1K4DA 4XPAL 5DQJA 1H15A 1YMHB 1XGPB 4HIXL 3UZVB 3QBTB 2UY7A 5D7SL 3SGDH 1RJZA 1FYTD 1QRNA 3BKCH 2P5EB 4DEPC 1CFTB 3PXHA 1OSZB 3L7FB 1A1MA 1R3IL 2R23A 2HRPL 1MCPL 3F65A 1UM6L 4ODVH 1I9RH 2VERN 2DQHH 3H3PL 2VSCA 2ZG2A 4DN3H 1YEJH 3GIVB 4JHWL 3S4SG 5IFAH 5HPMA 2N4IA 3LMJL 4F37K 1MCWM 2NY3D 5HDOA 1DLHA 4IOSD 4WVRA 5DUMH 3CFBA 5E4IA 1KPVA 2AEQH 5JXAL 1LO5B 5HHNA 4W6YB 5F1OB 4L9LB 4JCMA 4OZGB 1UZ6F 5F3BA 1SEBA 5KOMC 1AO7A 4L1HA 5GHWH 4Z95L 2DLIA 2ZOLB 3B83A 4PR5A 1ZGLM 4R2GD 5TE6H 3JXAA 2VN7A 4M02A 3AS3A 1YNKL 2VTFA 4GRMB 1ZHNA 4MNQE 5F7EL 3WHXB 4JKKA 43C9B 1FORL 1BF8A 1SY6L 1J1XH 3N06B 2AJXH 4LARH 5GSVA 5B4MD 5SX5H 1FAIL 2VQUA 5ADPH 1RUKL 4G6FD 4YBLC 4JPKH 5KVEL 4OLYL 3MRNA 1KCSL 4HJJL 1Q0XH 3W82A 2WUCL 4D94A 5F44A 3V6FA 1CGSH 1T1ZA 5T3ZE 4WI3A 2XACC 2YD5A 5DI8A 3VG9B 4JO4L 1EZVX 4LLVB 1A9EA 5FCUH 1MFEL 1R24B 4JQVA 1CDUA 3EBAA 2IBZX 5HHXL 4KQ3H 3V0WL 5CUSL 1YN7B 3VFUA 3EYSL 4NQTA 4OCXL 4OIIL 5CJ8A 2WAHA 5FB8A 3AMKA 5D70H 1FVEA 4L8SC 4WGVB 5HYQB 4R4FL 1CFQB 3SCMD 1PYWA 4WI7A 4L3EA 5E6YA 3UAJD 4J23A 3IDGA 3QXAA 4OFYA 5F7WC 2FCBA 2HTKD 2EDOA 5IIEB 3ZYOA 5DD5H 2OR8A 3LKQB 2YWZA 4M9PA 3N1QC 3IJHA 3PV6B 1NCAH 3MLUH 4POYA 1CZ8L 4XVTH 4UB0H 1R3KB 5TDPB 2J6EL 3MRQB 3KPNB 4G6AD 2DJUA 4D0CA 2ADGB 1VADA 3UTTE 2HLFD 2GTWA 2MHAA 4N8VA 3AREB 4ZODA 4OIIH 3SKNA 2Q8AL 4NBZB 1HEZA 2YSSA 4WTZA 4MDJA 5CZXD 3MRJA 3VH8G 3M17B 2Q86A 4KI5D 3VXRA 3LS4H 1YQVH 3GSOB 4PRDA 3VI3F 2Q87A 4D3CH 2Z31C 1HXYB 1WZ1L 5B3JF 1NBQA 2B2XH 4GW1A 1AIFB 2IADA 3ZE0E 4MCZA 3FJTA 4EUPG 4PJDB 1J1OH 3C9NA 3Q6FB 4K71B 5IB1A 5D6DA 4ISVB 5I74C 4OUOA 3V0VB 1MJ7L 1ERNA 3DSFH 4OUUA 1JF5A 2DYPD 1IM9D 1KACB 1OCWH 1WFOA 1UH4A 2BHZA 4PJAF 1SBSH 3WE6B 1NMAH 1NGYA 1N2RA 1ZWIA 5J11B 5C0BE 5EH1A 4D0CB 1DANT 4HCRA 3KS0J 3BIKA 4RMRA 2HP4A 5DHXB 2Z8RA 3HRZB 1T20B 2ZCKH 5E1AB 5I1CL 1LEIA 5FYKL 3UX9B 2C1PB 4QXGL 4WWKA 1NCWH 1JMXA 3VXUB 1IAOB 1QBBA 5KVMC 4NCC2 2GAZA 1VPOH 3VFWA 1XCQB 2H32B 3FONB 4JFYA 4KRPD 2EXWD 2X9YA 3W11C 1JPTH 3VD7A 4DJMA 3DETD 1SVZA 1C5CL 4ETQB 3PABB 2ZKHL 2H8PB 4ZQKA 5FGCE 3PDGA 1NMCB 1CFVH 4BZ2L 2AV1A 1T5XA 4GRWE 3HZYA 4KUCF 4MNGA 4X9IA 4R4NC 1D5MB 1A4JB 2I9LA 3GMRB 4GRLC 3N0PB 3MCKA 3QIBA 4YK4B 3IKCB 3QQNA 1HSBB 4FFZH 1J12A 4NC0B 2R69H 4FQXA 3OJMB 3SJVD 4Z7WA 3RUGB 1LEIB 1U2HA 3CZJA 2HFGH 4R6UA 4HLJA 2E6JA 4LGRB 4MX7A 4K8RL 5FKPA 4M6NL 4TUKL 4O58H 3K1DA 4NSKA 5FYJH 3S36X 3L1OL 3VXOA 43C9A 1K8IB 4C83A 4H26B 4OZ4B 4WUUD 1GJIA 3FT2A 4I77L 1RK0A 1V05A 5DZLA 3TNNB 3WHE1 5DR5H 4Z7UB 2C1OA 1A3RH 3BGAA 4FQQB 1AGCB 1WWAX 1ZVYA 3BN9D 1GIGH 3P0GB 3V7AE 2DRUA 2ZSVA 4NHCH 3LKNA 4QHKI 5JLZB 1YYLL 3MA9H 3MV9B 2OL3H 4M93B 5EIVA 3LV3B 3OPZL 4JPWL 4U6HB 2BJMH 3FOLB 5T1DL 4XC3L 1F11A 5EBMB 3BZEA 2YD1A 3D69B 5KOVC 3D1MC 5DMIL 3ROOA 3ZDXE 3VXQA 4XB8A 1QVOB 3WV0A 4Z77A 4YNYB 1H3UA 3ARUA 3G6JA 4Y4KB 1LE5A 4XXCC 2A6IB 3CH1B 4WV1A 1R5VA 2XV6B 1A7OL 4LVHB 2QSVA 1FO0B 1P7QA 4LPCA 5JOEA 4LL9A 3ILQC 4PP1C 5KN5B 2HT3C 2R9HC 4P3WA 5KVGL 3L3OB 1FGVH 4G5ZL 2XPGA 1NEZA 1QSZA 1P5VA 4XWGL 3MCLH 3AVEA 5C2BH 2DQJL 1PBYA 1O5DT 1CLCA 1RUAL 3UYOD 1FLTX 3KR3L 3FO9B 1NC4A 2DTMH 3OTTA 1FO0H 4KK6C 4AH2A 4WHTB 5T33L 4FTVD 4QHNA 3VU2A 1DBBH 4LVNC 1X5JA 3VGGA 1J8HB 1U0QA 1TVBB 5HXMA 4JPVL 3DTXA 3PWLA 2YZ1A 3GO1H 3T0WA 1MHPL 2D4DA 3HE7C 4YX2H 3RUGF 5K9QG 1F2XK 1AR2A 1QSED 1HH6A 2ZG1A 4OLZL 4MZ2A 3OV6A 1KC5L 1UZ8A 5TQ0L 3RAJL 2CJUL 3U7WL 4P9HH 4JFPA 5I1IL 1MAJA 5IWLA 1H3PH 2HWZL 3WKMH 1JF1B 3BN9C 3MV9D 4UIKH 5EBWB 5LVEA 3Q2CA 5JOFB 1XMWA 1GC1H 1VEMA 1KCVH 3VFRB 3L3OA 4AENB 4EN3C 3TIEB 2YD2A 1IFHL 5FUCC 3AU1B 4HKBA 1WCQA 1I8KA 1HYSC 3BGMB 4I5BA 5EU6A 1KXTB 2GJZA 1LVEA 2NY6D 4JAMA 5CGYD 1FN4A 2GJ6E 1KB5A 2AJXL 4ZS6C 3RTQD 4G42B 5T3ZL 2PXYD 2O5XL 3MNZA 3VFTA 2GUOB 4HKJB 1VFMA 4MLIA 4YXKH 4MA7L 3CJJA 2W0FB 1U8QB 4HGMA 3LPGA 2PXYB 4QT5B 3Q5TA 2HFEB 3D69A 5IV2A 3TV3L 3SOBH 4HXAH 3ZDXF 5FUZH 5I1GL 2BK8A 3ZL4L 3L3JA 3TH3T 3K8KA 3V6OA 4O02H 1ZV5A 2D7TL 2JK5B 4MNQB 5DLMH 2PYFB 2HFGL 3CZFA 4C56A 5DUPL 3VXUE 2D7OA 2XKNB 1F2QA 5CSGA 2NY4D 4OCYL 1HDMB 3S34H 3ULUC 3R8BB 4JDTH 2GJ6A 4LNRA 1B0RA 5E6ID 3SKNB 1G6RL 1ACYH 4U3HA 2X1OA 4LSSH 2DN7A 2XTLA 3UTSD 2ITCA 5EO9B 2ZKHH 2DBJA 1NLBL 4OAWB 4M7KL 2ZCHH 5C0BB 3P77A 3CUPA 3QUML 3U0PB 1AXSA 1YJDL 4F7EA 5GQBA 3B2UD 4NUGH 4KROB 1QFUH 5IVXB 1JNLL 1WSST 5FA3B 3MV11 4CGTA 2DL2A 3MXWH 2V2WB 4RIRB 3G5VB 1HQ4B 3VWJC 4QOKA 3NACL 3ARSA 3B9DA 3HC0A 4QYOA 4BH8A 3MV7A 4S0SD 2X4SA 1GGIH 1S5HA 2SEBA 2WZPD 5LGKA 4N5EC 1BJ8A 2Z31A 3VFNB 2JTDA 1C16A 1DP0A 5GGVY 2BFVL 4AENA 4UB0L 4XAKE 5EOQH 4MA3B 4FABH 4GKNA 1HHIA 1OTUD 3U4AA 1I7UB 1ZEAL 2HFTA 2ZOLA 1A9EB 3REWA 2YWYA 5IW6A 3P40A 5IBUB 4L5FL 1W72B 4PP2A 4Y88A 3O2VL 4O2EA 4FQJL 4NNYB 4PJEA 5FYLE 1U8NB 2GUOA 2BNRE 2MKLC 2IPTL 5TJWK 3I75A 2QTEA 1QRKA 3ARGC 4M6MH 5EU5A 1KN2H 2E7HA 4NDMA 3KPLA 3MUGA 5JW5A 3MV7D 3LS4L 4PGDA 5I75B 1CBVH 1PG7L 4Y1AB 4F15C 4NKIH 3EIFA 1FV1B 1VB9A 5CP7A 1UYWH 3EYOB 3KPRA 1PY9A 1E27A 1QR4A 3FCTA 2WWKT 1CFBA 2FWOB 4GXUM 4TOYL 3DIFB 4FHBD 4U1KB 4O02L 3WIHA 1E6OL 3IU3B 1MVFA 4Z0BH 1K8IA 2DQEH 1J1PH 5CZVH 1DQQA 3QIWD 1MCSA 2UZYB 4OQTA 4KJPC 3TA3D 3MRJB 3TO4D 1HYRC 3H7BA 4HPOH 3STZB 3VXMD 3SDYL 2P8MB 4YEFA 3NA9H 3QIUD 2EIDA 1YPZE 3CCHB 3MRQA 4FQQA 2CGRH 1EO8H 4HSQA 4NP4L 2ZUUA 4GQ9L 1PZUB 2E7LA 4HIEB 4UT7L 4X8JB 5D5ME 4KKCD 1WT5A 5DD0L 1WAAF 2VYRE 2E9JA 5DEGB 4MZ3A 1X5HA 2DJ4A 3IAPA 1HWHB 2IG2H 4NQDD 3B6SA 4XCYB 4DUXA 2HRPH 5FM8A 3BP5B 3QIWC 2DWEB 4XBGA 5GGRB 1IAIH 4K23H 5B3JE 1KC5H 5TQ0H 4ZXBD 3DGGA 1KT2B 3IF1A 2ZCLH 3MREB 4PGZA 4UU9A 4LSVH 4TVSa 4UNVA 2F53A 1IGMH 2EICA 1FL6B 3GK8L 4MB4A 1ZHBA 3CLFH 3LEXB 2NY3B 5TE6L 1WBZB 5I1JL 4PJEB 2V17L 4IRJD 5IKCA 3HCVA 3V6FB 3I9GL 3KPQA 5DJAB 3ZO0A 3HC4H 2WBKA 4LOUD 3MV01 2DLTA 2VWEE 1VFOA 1KEMH 4KZEL 4YHZL 1LK3H 1XH3B 2X05A 2CD0A 5HYSB 1MREL 4UMGA 5INCA 3B5HA 4PJ5A 3V5KB 1A6AB 4KXZI 5EN2B 2XZQL 1P7KA 3IT8D 1A3RL 4KROC 2AK4A 1HHKB 1DQDH 4GUPA 5GGQL 3VDAA 4ONHA 1PQZB 1A7OH 2OR9L 5K93A 1F5WA 4FQ1H 4H1LG 4RZCA 2H32A 1X6NA 3NCJL 4UTAL 3IFLL 5I19L 2FZ3B 3LKRB 3GMNA 2DQGL 4XCCL 4PRPE 1Z3GH 3F6IA 3MRFA 3NFPA 2EDTA 5I0ZA 3G6JB 4GS7C 4PB9L 4K9EC 1WK0A 2FX7L 2KL6A 4ZOCA 5FHAH 2YPLB 3BXNA 2DJSA 2KZ1B 2ADGA 3H9HA 1HSBA 3DUUB 3UPCA 3MRDB 1WEJL 3BPOB 4TTGA 3UTZA 2HLFC 3O3UN 4QXWA 1L0YA 1PKOA 3X13B 4DKFH 4LFHD 5JLZA 1H3GA 1CE6A 1V5JA 3KPMA 5L8LB 4NKIL 2IANA 2FEEL 4X9BA 3PWJA 3RIFK 3PDOB 4B5EA 3C9NB 3CSGA 1QLFA 5DRWA 3UBXI 1GGCL 1OCWL 2KKQA 3G9VA 1RAMA 5F9WB 4OLWL 4L3CA 4C54A 2MCG1 1UACH 5B3NA 1U93A 2P7TB 3U2SA 3INUL 2FX8L 3MUGB 5JW5B 3GJFK 3D0LA 1K6QH 5B21A 4AEHL 4Y2DB 3PNWB 5LXGH 1QSFB 4DKAA 3ALPA 1WZ1H 2GW5A 1RHHB 1ITBB 3IJHB 1I7TB 3G5XB 3IDJB 5HI3D 4U6XB 1V7NL 4RWYH 2X4OA 4P2RE 3OXSB 5D7IE 4V2CB 3U36B 5DDHB 1RZJC 3MUZ1 3MA7B 3THMH 5F89B 4I2XA 2V2TA 1RIVL 2GSGB 3MTRA 4FQIL 3ZLQC 3VD4A 4Z7OE 1EJOL 1QYGH 2FEDC 2VLRA 5JW4R 3QEQE 3CCHA 4UT9L 4LCUB 3G5VA 1OAXL 4AL8H 1U8QA 3QG6B 4BSVB 4PRPA 1U41A 2V2WA 5E70A 3ULUL 3U46B 3JV4B 1UWGL 3M1BA 2HT3D 2R9HD 4XGZA 5FO8A 2J8HA 1A4KB 3FFCD 5D7JA 3U7YH 3NCFB 2WK2A 3ARFA 2P4AB 3CDFA 1B9ZA 4WI9A 3VG0L 5C0FB 4HWUA 4K3GA 1AH1A 2H9GB 3LKSB 3RBGA 5TFSL 2YMXL 2ZG3A 3ILPA 4LSDA 4M5YL 1HHHA 1F4HA 5FDWA 3KPTA 4DK3A 2F54B 2EH7L 4YHKH 4ZUUB 3O3EB 1KN4H 2C7UA 1T7YA 4X9GA 2DQCH 5E8DL 1AO7B 5IB5A 3SDCA 5C09D 3C6LC 5E8PA 5D7IB 2FR4B 4QWWD 3VA6A 4KI1A 2BVTA 2XWBA 3VE0B 5I1EH 3N9GL 2FSEB 1LEKB 4P4KB 5B8CA 3OAYH 4O5LH 2F74B 2PF6A 1G9MH 1HCVA 4NDMB 3ARQA 4WW2C 1PGRB 5C0BA 1UB6A 5BZWB 3VG0H 3JV4A 3P3YA 1OW0C 3NABH 5IGXL 4KUZH 4MDJB 1H5BC 4U49A 2Y07L 3S9DB 3EJYD 4GBXA 4L8SB 1QSFA 3S98A 4M61A 5EBMA 4Y5VB 3B2VH 4UT9H 4XC1H 1JRHI 3F8UB 1CXLA 1TETL 1NFDF 2Z8VC 3KPPB 3K4DA 3KWWB 3ARFC 3VE0A 4X4XA 1YEFH 4DGYH 4Y4FA 4J3TA 1A7PL 1I3RB 1MJUH 4MJID 5IGXH 3FRPA 4MXVF 3CDGA 4DKDC 4H0IA 5AEAA 4LNVA 4WY7L 3TYFB 1B3JA 3NA4A 1IGYB 5DK2A 4LSUL 4JJ5B 1PD6A 3GBML 3VFMA 2FJGA 4HX1B 2UZIH 4ELME 1BFSA 3NPSC 4PJ9D 1FNSH 3DUUA 5D1ZA 4ELKA 4WUKL 5DK0B 4XMKL 4QEGA 1ODAA 4I0PC 5DS8A 1I9EA 3LKNB 5GS1C 2BNQA 4XGZB 12E8L 1HOCA 3O2VH 4H20L 5HDQL 4N5ED 5JZ7D 4WW2A 1AGFB 2XFXA 3BEVB 3S96B 3FQNA 4JDTL 3EOAB 1I3RA 1EV2E 1PYWB 3I50L 3NGBB 1HHIB 5DD3H 4F57H 2W9DH 3MO1A 3LKOA 2Q3ZA 4GRLD 3X14A 2G75B 4LHJB 5T1MB 3HE6A 5E8PB 4KKNA 2APBA 3MV7B 4JVUA 5I1DB 4P5MB 4RGOL 1QRNE 1XH3A 4FQLL 2VR9A 4TUKH 5A3IC 3WNKA 1JUFB 4U7SA 1MPAL 4HC1A 4IRZH 5FUCE 2JCCE 1BWMA 2I5YH 3TVMA 3RNKB 2VDNL 4EOWH 4MA7H 4U1SA 3RWJA 2WIMA 3OX8A 4NRXB 2ZUWA 2YK1H 4Z78B 4ZFGH 2NY1D 2XN9A 3KJ4C 2G75A 3UC0L 2P1YA 4OLEA 2VZVA 3TBVA 1ZVHA 4GRMA 1P4LB 2D3VA 4OUUB 1DEEB 2JLLA 3O9WD 2HJFA 2Y5TB 1OF2B 5ID0B 4KPHH 5KJRH 5JPMB 2XOTA 1UZ8B 2A9ML 4Y4FB 1NCUA 4NYLB 4ZNCD 4TYUA 3OAZH 5DWUL 1RD6A 3VMPA 4LLYB 4XNXL 3UEZA 2IQ9H 2ADFL 2DMCA 4PRIA 1K9TA 3SE8H 4N0FA 4HXAL 5I1GH 1YZZA 3QCTL 4PJFA 2HKHH 1T6VN 3IJSB 3MOAL 1KFAH 1MFNA 3AS1A 4IJ3B 5BQ7A 4YIQB 3DX6A 5T1KB 3U4BL 1JNNH 1WISA 4LSVL 2BNQD 1L7IL 4TSAH 1WQVT 2VL4A 3MODH 5IFHH 4LAQL 1JPGA 3RNQA 4N0UE 1C08B 4B7IA 1CU4L 1DQQB 5GS0L 3G6DH 4MD4A 4N8PA 4Z76A 2DQJH 3MOQA 3FMGL 4D2NA 4BH7A 1VKXB 1QA9B 3MLRL 1HXYA 5ITFA 1T5XB 3FT2B 4OLVL 5D2LF 5CCKL 2HN7A 1UH3A 2V9RA 1CVSC 2G9HB 2ZJSL 5D71H 1Z9OA 1J5OH 1KJ3L 3UBXA 2E6QA 4AEIL 1CGXA 2AABL 4KV5F 3HR5B 5HGGS 4P9HL 3RWEB 2XY1A 4F7TA 5I1IH 4I3SL 3O8XA 1A9BA 4LSUH 3NCJH 3QO0B 5T1KA 3CXHJ 2IFFL 4FRWA 2NY4C 1NGWB 4MJIE 1MSPA 4P4RA 5T5FH 1MHEB 4LF3B 1JHKL 4CADA 4X83A 4J3VA 3SDYH 1BZQK 1QFWI 2Z35A 4KTEH 4O9HL 3LV3A 1Q9WB 3IETB 3GI8H 4Z7NE 1H8NA 5GIRB 2BVOA 2MKWA 5L7XL 5JW3L 3QRFM 5DEZA 5FF6B 4MJIB 1MWAL 2CLVA 1X5LA 1TDQA 1T4KA 3QR2A 1A7BA 2ZZUT 2XRAL 1U95B 3WIHL 2X42A 4QCIA 3FONA 4JFYB 2HMID 5FCSH 3P11L 4HWEL 1AGDA 3G08B 3WFBL 3ZE1E 5IP4A 3HKFA 4IS6B 4MA1B 4BK4A 5D72H 4P3CH 3CSYB 3EAKA 1CDGA 3OKMB 3KAAA 5IVXE 4YEEA 4G9DA 1TCRB 2XFXB 1VGEH 1EBAA 1RZGA 1WV7T 1T2JA 2Q86B 4M4RA 1KB5H 3OKLB 5ERWA 3L5XH 3ORJA 1Q94A 4A2LA 2QSCL 4JHBA 4JO4H 4KKLC 4MCYB 3BESR 1U2CA 3E1F1 3CU7A 4NO2B 3TZVB 1T04B 2MCPL 4V1DD 4XC3H 1EGJH 5C92A 2ICWI 2VMFA 5I17A 5C0EB 4LMQI 3ULVL 4PJBE 4I0CC 2FGWL 3IJYA 4HPYL 1BEYL 5I9QC 4HT1L 3T3PE 4XI5C 4XP1L 3L3DA 4KK8C 4OKVA 3PABA 2XKNA 2L7UA 3TH2T 3C5SB 3BEWB 4GAYB 5JXED 3QULA 2X4NA 3GKZA 4L9DA 5C0DA 3R06B 2X4TB 3RA7H 4Z7OF 3FN3A 2R4RL 4R97B 4XPTH 5DJ8B 4IOIA 3G5XA 3GM0A 3IKKA 5FYJL 5T1KD 1ADQL 5I1EL 1HI6A 4FTVE 3MLXL 4HH9B 2J2ZA 2X1PA 5J7CC 4OM0H 5GGTH 5H35A 1Y6MR 4PJ8B 3SO3B 1ZA3A 2ED9A 4UU9B 2BY0A 4LSPL 2EKSB 2F8VA 3EYQD 4KFZC 4Y4KC 1JYVA 3TYFA 3LZFH 5BVPH 5JPMA 2UWEA 2EDHA 3CVHB 5E08L 5EOCH 2HT2D 1NAKH 2Y5TA 4OF7A 1WWCA 3T2NH 3WSQH 1GGUA 1T22B 1GGIL 2X4NB 5JO5B 4ZUTA 4Z7UA 4LSTH 4YHOH 4LLYA 5SWZA 4JFXB 1T0MB 3FO2B 1ZLVH 1DQMH 2R2EB 3RL1B 1Y0LA 4QNPF 5CHNA 1CICA 1AGDB 4UDUB 1T21B 4PJ7E 3KLHC 1KXVC 4K07A 4NSKB 1JPGB 4OLWH 1M6OA 2VO5A 1KIQA 2C4XA 3GNML 1NCDL 5ISZE 1VENA 2W0FA 1NEZG 2GJJA 4NZUL 3TBTA 3IFOA 3ARGA 4KHTH 4D9RD 4YDJA 1MCPH 1WWBX 4ODVL 2H2PC 1JZ8A 2AEPH 3GMNB 1TVBA 2A1WL 4MWFB 3MGTB 2FEDD 5HGAA 4HKZB 4HMEA 5I30L 3ULVF 1LEGB 1T1XB 5IEHA 2GI7A 2C4FU 3ZSSA 3FFDB 1QR1B 3FB5B 3GRWA 2OZ4H 1K5NA 1TZIB 4H25B 5BZDA 3AUVA 4HJGB 4BFIA 4R7NB 4F7TB 3BPLB 5IR1A 1XF1A 3EGSB 5F3BB 1U36A 2ADIA 2MSPA 4OF8A 2EDXA 3FB7A 4OIAA 5IQ7H 1EFQA 2XQBH 2FO1A 4YPGA 1ORQB 2UVEA 3U30C 2X89A 3IDIA 4OGAC 4YK4C 4XNYH 3MRBA 4Z0XA 3TJEL 4Q9CA 1MRFL 1UWEH 1T2QH 4KC3B 3U7WH 5L6YL 2ZOKB 1LNUB 1OHQA 2AW2A 1JGLH 4F7PA 1JWUB 4H1LA 3LKPB 5LGHL 1JJUA 2R0WH 4JO2H 4PJHE 4MNHB 2RHEA 4F7MB 5DSCB 1G7PA 2P8PA 3VW3L 1YNLH 4QHLB 5J9PA 1OL0A 4JR9L 2FATH 3Q6GH 1L7TH 4M62H 1SHMA 4OF0A 2R0LH 1QRNB 4WIQA 2B7DT 4ALAH 1CGSL 3R0NA 4MAUH 3G6JE 1BVZA 3MLVH 1F42A 1LGVA 1QTYT 3SCMC 4NM4H 5I8EB 3VFVB 1TQCC 3D39D 2A6DB 3I02B 1ZT4B 1U9KA 3L5JA 3BYTA 4XH2A 2PYEA 3AS2A 1OP3H 3GMLA 5DK2B 5EFIA 1WGOA 4P46C 5I76B 4HZAA 4KVCL 3WKML 3KS0H 2R1XA 2VLRD 2DWDA 4B7LA 1CFQA 1P9MA 1WT5C 4O4YL 1FZOB 4RAVB 4JB9L 4IRSB 1TZGH 4PJHA 3ARDC 3KLAB 2XZCL 3S36H 1BFVH 4BFGA 3RY4A 4D9QE 4Q9QH 4QXUL 3DVNB 5FCUL 3RFZC 4U6VH 1U8IB 2EKJA 2W0LA 1JGUL 5J12C 3S4SB 1JE6A 3KPLB 4PJEE 4HW6A 3L5WB 2B4CC 3M1BB 3IVKB 4YFLF 5FECB 5FM5M 3V52L 3MV8D 1I85A 4OD3H 5K9OB 3KNBA 2VSDA 3QULB 4Z7VA 5EZJB 4XPHL 3BKCL 3VFOA 1KJMA 3BE1H 5IMKA 1OF2A 2YMXH 5KVGH 1J7VR 1DSFH 3GB7B 4DAGL 4JAMB 3KDMB 2I9TA 3TNMB 5I1DA 4ONHB 3NIDE 5CILH 4NCDA 1FL3A 1JN6B 3JWNC 4MDIB 1P4IH 2X7LB 4G43A 2DF3A 4XNZB 3LSOB 3QT2A 4HD9A 5EIQA 1KPUA 1KTDA 2ADFH 2YN5A 1KJ2B 1XR8A 4XWOD 4EUPH 1J8HA 1IC4L 5DJYA 2QSQA 2EDYA 2NY2D 4KK8D 1A3QA 2A9MH 5EU3B 4Y4KA 3V9FA 4JANA 4HHAA 5EC1B 3OAZK 1MCLA 1JBJA 1QSEE 4LLUB 1DL7L 1KN4L 4EI5A 5T3XE 1NCCH 5ANMA 4M03A 1YA5A 4HEPG 4LIQH 1WVZA 2VN4A 3C08L 2PO6D 4M5ZH 2FL5A 5GRVL 3D3VA 5I30H 5LGHH 1TQBB 1CICC 1NQBA 2ESVB 2HJKB 4WFHD 4OFPA 4LCWA 1UKQA 3T0ED 1OAYL 1ZLUH 4KTDL 4OTXL 2DQUL 4WENB 5LXGL 5H2BA 2UVFA 1CGWA 5GS0D 1HK6A 1JZ7A 3INUH 1QBML 4QWWC 4U1GC 5JPNA 2HRLA 2Z35B 1EERB 3TO2B 2DDQL 4U2YA 3U9UA 1T66D 2WNGA 3RNQB 1EO5A 5GGVL 4WI6A 5F7DB 1UYWL 4YDVA 4LLQA 4U6XA 3W0WD 4G9FD 3DVNA 1A1MB 2PO6C 5C0RH 5I8CA 5GRVK 3VW3H 1RZKH 2DM3A 2XA8L 4ZPTB 2FD6L 3LRSA 1TNNA 2ZUXA 3A6BH 4J4PC 4N0RA 1ZVSB 4N0FB 2LFGA 2G9HA 1NCDH 5T3XH 3T4AA 4WUUE 1LE9A 4WFGE 5LKNA 1KN2L 3BRGC 4BZ2H 1JNLH 3DX8A 2R29L 3B9AA 4LGSB 1GAFL 4EUPA 3MBEB 3KPRB 4H26A 4OZ4A 3R1GL 4P2RB 4IRZL 3FZUC 5EU4B 4AZ8A 1DUYB 4HUKB 4QRPA 2MNUA 5F6IB 1RZJH 5FFLA 3O0RH 2YA1A 2Y36H 4FMFA 3S6CA 4MA8H 1JWSA 1KTRL 2DMBA 5IV2B 1MI5E 2FD6H 3QWRA 1V7ML 4ZO8A 2FX9L 4UI2A 2D31A 4M4PA 5IVZB 1DFBL 1GZQA 4X6DE 1S7UA 2MQ3A 2A74B 5KSBA 1FVCA 3QI9D 4U1IB 4P46D 3IDXH 4P5TD 1X5GA 32C2A 2BNQE 2EDNA 4KY1L 1N0LA 5CBAB 4YHPB 2FGWH 1J05B 4P2QA 2Q1EA 5CGYC 5IW1A 5EOTB 3RVUD 5IB4B 4LHUG 3GMQB 3WDHA 5F7YC 3BZDA 4YFLI 1LDSA 3T3PF 3AREC 1M6OB 4JFQA 4U1HB 5IB5B 4Y89A 5DO2C 4QRTA 5HYEA 4K55A 1XF3B 2RB8A 5EU4A 2XA3A 1OWRM 3V95A 4U1MA 3SEPA 4JZJB 2J1KA 4ZOBA 5FO9B 1NGQH 4HUXA 1S9WA 2YA0A 3T2NL 4Y16A 2W9EL 1FYTA 4M5ZL 5BRZA 5I6XC 3HNVL 3S97C 5K9OA 4P23C 2I60H 2QQNL 2MMXA 1IGTA 1SJEA 1G7LB 4WFED 5LWYL 3NFPB 1S7QB 1H5BA 3O4LE 4NQCA 4OZHA 4U3XA 3PQYB 3HCVB 3EO9L 4AH2B 1CXIA 4LLQB 1JGEB 4YBLB 1AGBA 2R8SL 3CFDA 3F7PC 1F02I 2D9QB 3O2DH 5ICXA 4U6HA 3TVMD 1M7IB 2GJ6B 2QL1A 3MREA 4LNRB 4Z7VE 4PGEA 5I1JH 4U1MB 4KVNL 1I3GH 5T1LD 3DGGB 1RFDH 1GZPB 4MAYC 4PR5B 3CDGB 4KJWC 2EECA 5DQJB 3WFBH 4M1GL 3Q0HA 3BQUB 1I3GL 1E6JH 3CH1A 4AIXA 1B0WA 4OLUH 5MEND 4QRQA 1KULA 4HGWB 3ALXA 4LPWA 1J1PL 3X3FL 3ZHDA 3SQBA 1HXMA 2QKIA 5D1QC 1S9YB 4XI5D 5E0QA 3SE3C 1FNGB 3D9AL 2O61A 5B38A 3SE4C 1JHLH 1MWAA 2E6PA 3O6FB 3TF7C 3D0LB 5I15H 4F33A 4PRID 2D31B 3WN5C 3BRFA 4Y4HC 4X6CA 5DXWA 3UPRB 4DFHA 2HWZH 4JPKL 3A67L 3NFNB 3MLSH 2HTKC 4JEGB 4K2UL 3RDTC 4FTVB 1H0DA 1WAAA 5DD1H 2ATKB 4P2OB 1N6UA 4XCYA 1INQA 4ODSL 4ISVA 4P4KD 1AD0A 4HFUL 4OM1H 4RFOL 4Z0XB 1WTGT 5DJCA 1FZKB 1NBYA 3SDDB 3PWPB 5JR1L 1KUMA 4H5SB 1SJXA 1D5BB 2H8PA 2X5PA 4ZQKB 1CR9H 4GMTL 2VWEC 1JF1A 1G1YA 2X4RB 3LRSB 4GQPH 4J7RA 1JMZA 2CK0L 5F1IA 1WIPA 2VLMD 4JHWH 2NXZB 1FAIH 1RIVH 4J1UB 3MRRB 2GY7B 3QFJA 5GS2H 3OB0K 4HXBL 1FG2A 1BIHA 4S1RH 3RUGA 3HG1A 4Z7WB 5I1KH 2L4OA 1BIIA 5EORL 1DFBH 3CH8A 2ITCB 5IK3A 3PIQA 4V1DE 5E6IB 2JCCB 5DJ2B 4YHYB 2NTFA 2X7LA 1N0XH 4JM2C 5DF0A 4HWBH 4P4RB 5EB9A 4FQ2H 1IRAY 5DUBA 3I3BA 2C7UB 1DEEA 1TVDA 4K7PH 4N0CC 2IPUK 3WFZA 4NZJA 3KPOB 2VDMH 3QDGA 2EXWC 4XCEB 4X80H 2IH3B 3UTQA 3VFGH 4LKCA 2VOTA 1TZHA 2DYPA 1JNHB 1KNOB 5DC9B 3C8KA 4CAGA 4J3OC 3KJ6L 1FG2B 1N59B 1AJ7H 4K3DL 4HIEA 4PV8A 4J1UA 4Z8FL 1L7IH 4MD0B 4NO3B 4CNIB 4QXTA 1OAKH 1YDPA 1CXKA 3BZ4B 3G6JF 5A40E 3CMOL 5CGMA 4D8PB 3VDCA 2H6PB 1T1YA 1Z5LA 1S7RB 3C60B 5HVHC 5FGSA 1TVHB 1EEYB 1RUPL 3VFGL 5A1AA 1P84J 4ERSL 4ONGL 3HAEG 4LKXB 4HAGA 1P7HL 4ODTH 1MCQA 1QLRB 1N64H 2A6JB 4IRSA 3OZ9L 3B8SA 3TN0D 1D9KB 5D7LA 1MLBB 4NOBA 5D2NE 4DUVA 5MERA 1ZK9A 3CAFA 3MACH 5FGCB 1A64A 3P4NB 5EBWA 3TN0B 3I84A 1A02N 3RVTD 1J0JA 4PJCA 4CJ1A 1I4FA 3GSQB 4ZPTA 5CMAA 4G80B 4FQXD 4NC2B 1FH5H 4QXTB 2WANA 2VXSH 1CFVL 5K9JH 1NCCL 2NY1C 3KYKL 1DL7H 1BD2A 4M61B 4MA1C 4IMKC 1UENA 3PL6B 1V3MA 4KMTH 1E4WL 2KPNA 2HH0H 4TNWK 1EO8L 1IKFL 1CLZH 3RDTB 1HHJB 3VXNA 1TZGL 5IBTH 1DBAH 1I9JH 1RK0B 3MSPA 2W92A 1TZIA 4LLWB 3ULUD 4ZSOE 5FK9B 5E5MB 3EGSA 5B39A 1TTFA 2APFA 1F45A 3O9WC 1MQKL 1T0NA 1MCNA 2J4WL 4JO3L 4JZNB 2F54E 3V52H 4X6FB 1A4KA 5D7JB 3O81A 3MRHB 4L4TD 4L9LA 1ZOXA 4WHCA 1LHZA 1IC5H 3SKJL 4B41A 2EYSA 4AT6B 3O6FD 5IOPB 5EU7C 4ENEC 3RZWA 4R4FH 1RJCA 3M45A 3JVGC 4JE4B 4L4TB 3T0AA 3VGAC 3Q3GA 3HR6A 3QUXA 1FNSL 4NKOA 3UTTB 5DMYA 3F12B 2DBLL 5EO9A 2LTQB 4PJGB 3PWPA 1F58H 2CKBB 1IAKB 1JF6A 2VDLH 4QY8B 5SWQB 3MJ8A 3MV7E 4ODUB 3LKOB 1EFXB 2EC9T 3BDYH 3BZFA 3AY4C 2FLRT 4JFFA 4QOKB 5TPWH 1N6QH 1U8KA 3MR9B 1C7SA 4WW2B 1LP9A 4QGYA 4MB3A 2ESVD 1MIEL 1JZ3A 5HHMD 2H9GA 3LKSA 1EAJA 4ORZC 1AI1L 3H9SD 2X4OB 3BZEB 2CUHA 2NY0B 2CIIA 5DTFA 4RISH 1MQ8A 2BVPA 5FKPB 2HVKA 3BPCB 1WFTA 3C09C 5ACZA 5BXFB 3RY6A 3LEYH 2QQNH 1N5YH 3QCUL 5C07B 2FX9H 4R4BB 1A21A 2YEZB 2P46B 2F19H 5CIPH 2FDBP 2BC4B 5ICYA 2I24N 3LOWA 2P5WE 1JNJA 4Y5XA 5DSCA 4JFDE 1CLOL 3SCMA 3F6LA 2Z4QB 4UTBH 2C1OB 1MFDH 3PV6A 1MAMH 3VXSE 1OPGL 2BMKA 1MJJA 4PV9B 3VXSA 3DO7A 2R8SH 1OM3L 4HUXB 1KNOA 2EDWA 1R3LA 4WCYH 2D03L 1V8HA 4IOFD 2AJUH 1FIGL 3CU1A 2AQ1A 4DW2L 5E9DD 4JKWA 4OV5A 4YC2B 5AAWA 5CP3A 5INCB 5GS0H 4YHMH 5KVDL 4NZRL 4NQXA 2E8YA 5ESVB 5ACZB 3BMWA 2GK0B 4NRXA 1HINH 5CBAA 3UJJL 3C6SA 4CMMB 3CPLB 3P9MA 3PP4H 2CKBL 3FB8B 3ARTA 4I8DA 4QRSA 3DSNA 3BRDA 5MI0C 5IOPA 4NNYA 4JANB 2JJTC 4XVUD 2V7HA 3GMOB 2P42B 2DKMA 1FRGL 1E4WH 5B8CB 2Y36L 3NVQA 4NKDA 4WGWB 1QBMH 4JFDD