1A5FH

Fab fragment of a monoclonal anti-e-selectin antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
217
structure length
212
Chain Sequence
EVALQQSGAELVKPGASVKLSCAASGFTIKDAYMHWVKQKPEQGLEWIGRIDSGSSNTNYDPTFKGKATITADDSSNTAYLQMSSLTSEDTAVYYCARVYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVSVPTSTETVTCNVAHAPSSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Primary and tertiary structures of the Fab fragment of a monoclonal anti-E-selectin 7A9 antibody that inhibits neutrophil attachment to endothelial cells.
pubmed doi rcsb
molecule keywords MONOCLONAL ANTI-E-SELECTIN 7A9 ANTIBODY (LIGHT CHAIN)
molecule tags Immunoglobulin
total genus 35
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 1998-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a5fH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a5fH02
3QBTB 4NCDA 2IBBA 4K55A 4NWUH 5H94A 1C16A 5C0ND 1CLZH 1FVDA 1FCGA 2APWA 3BN9C 4FABL 1ZLSH 1U8KA 1ZS8A 1ZVSB 4XHJD 3IFLL 1V05A 4L9DA 3LB6C 4YGVA 1MH5A 4ETQB 2EDJA 4M1GH 5I74C 4ODVL 3QUZB 4IJ3B 5EU6B 5JXAH 3TCXA 5ADOL 2NXZB 1UKQA 4KXZI 5SWZB 4QTHA 2JJUA 1KCVH 2P47B 2E8ZA 3BN9D 2HG5A 4P2OA 1T1ZB 5ESQA 4ALAH 4Q6IC 5EZLA 3LB6D 2YOCA 3EOBA 2XI9A 2GJ6B 1BZQK 1I8IA 2EDXA 3MV8B 3BKML 1GL4B 4JQXA 1A6TB 4YDJB 2ATKA 4WY7H 4NQEE 5KANG 3UROR 4K7PL 1A1MA 4HUXA 3WBDA 2X09A 5DHYA 2EIEA 1C7TA 3HFMH 1JPSL 4AEHH 2Y9RT 4Q7DA 4OZGE 5J1AA 2AXHA 3VWKC 4K71B 3X13A 3E8UL 1XCTB 4XAKE 5D7LE 3P0GB 2W9LA 1INDL 1VGEL 2QQLH 1YPZA 3QRGL 2HKHL 4G43B 1C16B 2CUMA 2F19H 4ZO7A 1U8KB 4ZXBA 2JKXA 4YGVB 1K5NA 2J6EH 4TSCH 1A3RL 3VWKD 1RFDL 3RTQC 1PZ5A 4DKFH 3VXSE 3GSNL 4YE4L 4X80H 3TT1H 3LVEA 2MKLC 2OM5A 4J3TA 5D71L 5SWQA 1H3UA 4DVBA 2XN9A 4TN9A 2HG5B 2DQJH 5ESQB 2CDFA 5EZLB 5CUSH 1CDCA 3EOBB 3UTTE 1A6ZA 1RUAL 1I8IB 1VACB 3JTTA 3RTQD 1CXLA 4MA8H 2ATKB 1DQML 4QXUL 5DD1L 1A1MB 4JKWA 1DQLL 2Q3ZA 4WENB 2E7BA 1OF2B 4IS6A 5DHYB 5I15H 5CJXA 1L0YA 1CBVH 2YS4A 3MXWL 1OAYH 3RAJH 1FGNH 4WO4C 5IB1A 3HHRB 2OL3H 1B0RA 4W6XB 1SBSL 3FT3A 1YPZB 4M5ZL 5H37G 4XVJH 3TN0A 3WXWL 2R0WL 2YK1H 5I1HL 1T04A 4K3EL 5EBGA 4ZXBB 4N8VA 3BI9X 3FOMA 3BKYH 3U36A 1MRDL 1K5NB 1IGYA 1NBYA 4LSTH 4KRNA 3PWNA 4JM2C 4MNQE 2Y36L 3D1MC 4PLOB 4WO4D 5HXMA 3IVKA 1PZ5B 4RIRA 3WFZA 5ISZB 1YNTA 2ICCA 4NQUA 2W92A 3HZYA 4I48A 1E4KA 4JRXE 4LFHG 3B8YA 2XN9B 3ZSTA 1KELH 2HFTA 4PLJC 3X12A 3EYVA 2DKSA 1EH9A 2CDFB 5F1OB 4K94L 1MJ7H 5I1IL 5I8EA 2J2ZA 4OCSH 3DTXA 4JM2D 3JTTB 1PBYA 3EDJA 1MFAL 5SWSB 1T2JA 5AG8A 4KFZC 5D96C 3KPRE 3VDBA 5EH1A 4PJAF 5D6CA 4C58B 1TIUA 5ANME 3MLRH 1NGQL 5T3ZL 4NKOA 1KCUL 4PLJD 1CFQA 3JV5A 5D5ME 4P2RD 1A4KA 1RVFL 1WIUA 2R4SL 1CFBA 5FA3A 2DD8H 3UTQA 1ZTXH 4F57H 5IB1B 4BH7A 4J7RA 1RUKH 1B0RB 3Q5OA 2P5ED 3ZYIA 3LQMA 4OD3L 5E4IA 3VGBA 4OM0H 4OSUH 1MVUA 5DMGC 3T77A 2WW8A 4HIXH 1T04B 4N8VB 3SDAA 1I7TA 2AEQL 2VXQL 3PIQA 1N8ZA 3U36B 5BQ7A 4AM0A 3EDEA 1GC1H 3PWNB 1JPTL 5ENWA 1ZE3C 4RIRB 3UYRH 3BT2L 4UUJA 3HZYB 4I48B 4D0DA 5FGCE 4DKAA 5DMGD 2VLJD 3VG0L 2BVPB 2FATH 1XF2A 5J1TC 3EYVB 3WIFA 1TZGH 2DQEH 5FYKU 1EEUA 1PSKL 2D7TH 5GS3A 1XH3A 2P8PA 1OSPL 3C09C 2WV3A 4Q9BA 1A6UH 3VXMD 5D6CB 4RDQF 4JFZH 2A6JA 1YNLL 2ZSWA 1MEXL 4WEBH 1Z9MA 2EDYA 1RK0A 2CPCA 4CDHA 3AMKA 1CFQB 2EECA 3RKPA 5C92A 1A4KB 1L7IH 1G9MC 1U58A 5I18H 2W0PA 3EO1B 2NNAA 5HTSA 1AXSA 5HGHA 5E95B 4X8JA 3UTQB 4EEEA 2F15A 5HI3C 4O9HL 5C1MB 5ALCH 3AGVA 1P2CA 5ACMA 3D87B 1I8LC 1TNNA 4MQTB 1G0YR 4QNPF 3FB6A 3N1PC 5E9DA 4BJLA 3T77B 3THML 1H8OA 1U3ZA 2XA8L 3JV4B 4HLZG 2OSLB 1MFEH 1YQ2A 3SDAB 1I7TB 3PIQB 1N8ZB 4HK3N 2YHGA 4AM0B 4QRUA 1P6AB 5AG9A 4NZUL 5HI3D 4U7SA 4UV7L 5IT2L 4JHWH 4U1IA 3AY4A 4UUJB 4D0DB 1TXKA 1CDIA 2H1PL 2VDML 1U2CA 4JKPL 4O02L 1XF2B 3WLBA 4KPHL 1X6LA 1CE1H 3VXUD 2IPUG 1M6OA 5DZLA 3EOTL 5IHUL 2P8PB 5BZDA 5LXGL 4P4RA 5BVJA 1FYTE 3ESVF 3UEZA 2VDRH 3IFNL 4KROC 4GW4A 4PRIA 1INEH 4JFPA 3VFGL 3ULVL 2A6JB 4ZFZA 2ZSWB 4JGMA 5HDQH 4JKMA 4KHTH 2MCPL 3QAZB 2VN7A 3P0VL 1EHAA 3H9SE 4U33A 5LGKA 4OLVH 5DQ9B 1BEYH 5E4EB 5B3JF 1U58B 2MNUA 4POZC 2NY7H 2NNAB 2VLLB 1AXSB 5HGHB 4U1GC 4JDTH 4NRXA 3MBEA 4X8JB 3G9AB 3TT3L 4KROD 3V4UL 3QDMA 3UJJH 1EGJH 4PJ5A 2KQNA 1ES0A 4WTZG 4ZSOA 1CU4H 5E9DB 3FB6B 3JWOC 2JJTA 4HWEH 3IDMA 3PJSB 1ZOXA 3ZL4L 3MPCA 3OB0H 4POZD 5E2UH 5HHPA 5CJOH 4Z7NE 1INQA 2A73B 2PR4H 1QBMH 2YBRA 3DI2B 1DQQA 2MOVA 1F00I 1MLCB 4KJPC 4JVWA 3I84A 1WWBX 4HPOL 1VFMA 2W9EL 2ZJSL 1D7FA 2JB5H 4F58L 3C60D 3TH3T 4APQC 4NGHH 4PGEB 4P9HH 2MJWA 4MHHI 1IZJA 4QHMA 4PJBA 4KZEH 5BZDB 4P4RB 5BVJB 5EO1B 1MVFA 5HVGB 4A2MA 4GW4B 4KJPD 4DGYL 4ZFZB 1RUPH 1CK0H 3KPSD 3VA2C 4HT1L 2F9BT 2Z8RA 3OX8B 4G8GE 2LU7A 2JJSC 4APQD 2AJVL 1AO7D 2W91A 5HYJE 4L9LC 2MMXA 4DVRL 1JWMA 4NRXB 2OI9C 5CEZL 2IAMA 3QDMB 2B1HL 4HG4K 4LLDA 4PJ5B 5CBAA 4DKEH 4OTXL 5ID1A 1ES0B 1CIDA 4ZSOB 5DRNA 2R2HA 4JFOA 1QO3A 1WQVT 4OD2A 1HXMA 4E41D 4KV5F 4BFBD 4Z0BL 5A16A 5A43C 4XCCL 4F7CA 1INQB 5EU6E 5TPWL 1IC4H 1XGUB 4UB0L 4JFDA 3DGCR 4XC1H 1OW0A 1T1WA 2YBRB 2HFFA 4IDLA 4J12A 4XWGH 1DQQB 1LDSA 5SWZE 5MEOB 3GI9L 2AW2A 2Z91A 5T33L 1CDHA 3RWDB 4ZUSA 4WUUD 1FC1A 2EE2A 3MV8E 3GHEL 4M62H 3UDWC 5KOVC 1B6DA 4PJBB 1TZHA 4QYOA 3BW9A 1MAML 2X4OA 1U2HA 2XICA 4NQXB 3GFUA 1JF6A 1KV3A 4DGIH 3VI4F 5GS1A 4H20L 2GW5A 5IUSA 5GZOC 4U6HA 1X5GA 4JDVA 3D3VA 4RRPA 2IH1A 3QDJA 3FHQA 4N0YH 5C0CD 3WN5C 2JK5A 3GMMA 3E3QE 4HQQH 1JWMB 3TIDA 5FYKL 4PR5A 4HS8L 4LLDB 4YHYB 3P11H 4DZ8A 3EUUA 4QEGA 4PP2A 4PS4L 1RZFL 2DTML 2R2HB 1BD2B 1VDGA 1QO3B 2E9WA 1X5LA 4HBQA 4JFOB 4OD2B 1HXMB 1X5HA 3CGTA 1X7QA 5B39A 5F71A 4N68A 2FX8H 4Z7WA 3MRKA 4ORGA 5A16B 3B8SA 5DD6A 4F7CB 1HKFA 1WGOA 1KIUA 3P4OA 3VU2A 1IKNC 1SEQL 3WS3A 4LL9A 5L8KB 4D9QE 4JFDB 1JYVA 1T1WB 2V7NA 2PTUA 4JN1H 4OLWL 5CZVH 4OAWA 2FD6H 4GXUM 1HOCA 4RMVA 4K9EC 1Z9SA 2Z91B 4GBXA 4UNUA 1JGVH 4GRLC 3P3YA 4RSVA 4ZUSB 2VR5A 4EDWL 3EJZC 3WNMA 2DOCA 5KSAA 1Q1JL 5FUOH 3STZB 5BS0A 3MMEA 4PRPD 3VXNA 1TZHB 3BJ91 3BGFB 3NACL 3R1GH 4QYOB 4K94C 3BW9B 3AREC 3IDUA 1UJ3B 4GSDH 3GMNA 3WFEH 4DKDC 2BC4A 4XAWL 2X4PA 5JW5B 2XNAA 1LDPL 1HINH 3Q3GB 5BV7L 3GBNL 1UCBH 5GGTA 3MLSH 1RZ7H 5CS7A 4GRLD 4KAQL 4JDVB 4U6HB 3D3VB 2NLJB 3EJZD 5B3NA 2E3VA 1T22B 4PB0L 3IDGA 2IH1B 3QDJB 3UYPA 2JK5B 3GMMB 1BJ1J 4N0RA 5GSRA 2WIMA 5E00A 3GJEB 3TIDB 1N0XL 3ARED 5L8LB 4PP1C 1FH5L 4PR5B 3MV9A 4WHYH 2EYRA 4FFWC 1NC4A 4DZ8B 1YPZE 5C9KA 1F13A 2ICES 4KHXL 4OCYL 4PP2B 5C0RL 4W70A 3I6GA 4ZQKA 2M2DA 4W4NA 1RMFL 1T5WA 1X7QB 2Z92A 5T3ZD 2O5ZH 4Z7WB 3IXAA 4ORGB 5DD6B 1BJ1H 3P4OB 3T3ME 4I0PA 3NMEA 4HUUA 3EIFA 5HY9B 5ISZE 2DQUH 4PP1D 5FDYA 4FFWD 4R3SA 2V7NB 3EO9L 1IQDA 5F1KC 4OAWB 2XN9E 4M1DL 1HOCB 3CLEL 1ZLVH 3OPZL 3SCMC 2P24A 3UTZB 4GBXB 1P7KA 4FP8H 1UM6L 1FZOA 4NNPH 2A9ML 5A1AA 5SWSE 2VC2L 2XTJB 5BS0B 4HF5H 3VXNB 5IJVA 1FNFA 2XQYG 4LCYA 3KPQA 3EYUL 2BC4B 1D5XB 2X4PB 3V6ZA 3H42L 4Z7OE 2AEPH 1AJ7H 1P4IL 4Q0XL 4TULL 2BNRD 1RZKL 3DX7A 3RKDC 4QRPB 2OR7A 3IDGB 1UWEH 3RVTC 2I5YL 3U0PA 3OXSA 5DUBA 4CADB 1U36A 4OLUL 5GSRB 3KJ6L 1A47A 5E00B 1QKZL 2G5BA 1MIEL 4HGMA 3MV9B 5E8EA 1QLRA 1NC4B 3QCVH 5C0JB 1Z3GL 3RU8H 3D85D 3I6GB 4ZQKB 1XGYH 5IMMA 4LPYA 3RKDD 1T5WB 5TQ0L 3V0WL 3F12A 2Z92B 3RVTD 4KI5E 3BQUC 4B53A 4ZD3H 4JHZA 2YN3A 1MCBA 3LOWA 2AJUH 3ARUA 4I0PB 4NUGL 4HUUB 4KMTH 5FECA 4EDXA 1NCBH 4R3SB 4MA1B 2KZ1B 1P4BH 5I19L 1IQDB 5GJTL 3FTGA 3A67H 5D1ZC 3AS2A 3RGVA 1CVSC 3PWPD 1N4XH 3GIZH 43CAA 3BQUD 1NUGA 3BGMA 4KKBC 1FZOB 3OL2A 5IJVB 3SE8H 2BRRL 2GEEA 5L9DH 1JZ4A 4WCYH 4JO3H 4LCYB 4GAJL 3V6ZB 4AYFA 3LKQA 3J8F7 2EDOA 3VWJC 4PV8A 5D1ZD 5HPOA 1IM9A 5FYJH 4ORZC 2NY5H 4RFOL 3ULUC 1UB6A 4DQOH 2F5BH 3ULVC 4O58H 4R4FL 3VCLA 4FTVA 4LSQH 4ODXA 3SGJC 2D4FA 4KKBD 3U0PB 3OXSB 5DUBB 2XZQL 5E1HB 4GFTB 1P5UA 3GRWH 2P5WD 3EFDH 5E8EB 1QLRB 2DM2A 3VWJD 2X6MA 5I16A 3ETBF 4P48A 4PRBB 3ULUD 2IFFH 1AKJA 1AR1C 5D1XC 5IMMB 4XVSL 3ULVD 1BQHG 1VESA 2K9UA 2WZPD 1T3FA 4UT9L 4MLSA 3VD3A 5D2LA 1J1PL 1NMBH 2GUOA 2Y72A 5FECB 4LLMA 4U1SA 4C4KO 3LS4H 3O0RH 4ZFGH 3BDXA 3F58L 4J23A 2WM0A 2APXA 3RGVB 1DCLA 1AR1D 5D1XD 4PTUA 1PLGL 4RGNC 5DHVA 5AYUL 5JXEA 1A7NH 43CAB 3MRJA 3BGMB 4NQCD 3BISA 1E6OH 1EHLH 5C09A 5BO1H 4F9LA 4KTYA 1HILA 2GKIA 3WIHA 4JZNB 4IRZL 4XCYA 3W9EA 1QLEH 1SQ2N 3LKQB 3BWAA 4PV8B 1CFNB 3LIZL 5DUMH 4RGND 1UB6B 4C83B 1NMCB 4UDUA 1JNHB 3VCLB 4FTVB 4ODXB 1NMAH 1ORQA 1A0QH 1ZT4A 5D7SL 4CAGA 4M7KL 1HHIB 3P4NB 3QQ3A 5E9DE 5DC4B 5I16B 1NEZG 1L7TL 3RP1A 2YWYA 1AKJB 5E5RB 3GIVB 1T3FB 4MAYA 2AQ2A 4JY5H 2ID5A 4PJ7F 1R3LA 1KUMA 4RA3A 1AQDA 5D2LB 3VFPB 4QRSA 5K59E 2NY4B 3QFJA 1RHHA 4LLMB 1G6RL 3RWFA 5FHAH 2IPTL 3UPCA 5FM8A 5CEZD 3SGDH 1U8IA 1NCWH 5DHVB 3N9GL 3MRJB 4X6EA 1EA9C 4HUNB 3WJJC 4IM8A 4PJFE 4JVUA 2VZSA 3KYOA 5C09B 4ONOA 1HILB 3CVHA 5CILL 3W9EB 1OT2A 3OJMB 3R0NA 3BWAB 1BQSA 4MWFA 2BNUA 1JN6A 3IXTA 1X5YA 4UDUB 1G7LA 1RZJH 1OTUC 1RUQH 2B20A 2I9LA 1ORQB 3T65A 3QDME 5HPMA 1FL3A 1RZ8A 1ZT4B 1QQDB 4PJ5E 3MRFA 2RGSA 4Y2DA 1LO4L 4QRRE 1FSKC 4JRYD 4QXGL 4ZSOE 3QQ3B 5FO9A 1O0VA 2NY6B 2DWDB 3CFIC 4LIQH 3KYNA 2JELH 1AP2B 3SQOH 2J5LC 2L7UA 4R7DA 3GSVA 15C8H 2V5TA 4MAYB 4WFED 1OTUD 1R3LB 1A3LL 1XR9A 1AQDB 4LRNH 3BZFB 4QRSB 1W72A 3QFJB 4NRZA 1RHHB 3OTTA 2Q6WA 1FFPA 1NC2D 3CSGA 3KHQA 3RWFB 2D03L 5L2KD 3ZKQD 4HPYH 5JIPA 4RMTA 5FYKD 3LS5L 5JHLL 4ZO8A 1U8PA 3V9FA 4HWNA 2J8OA 1FDLL 1YYMH 4X6EB 5HI4D 4PJBE 3A6OA 4LMQE 4F7TB 5I1EH 3SE4C 2C3WA 1GIGL 3QO1B 3KYOB 4YXLH 3CC5A 4OCXH 4UMGA 3VD4A 3KPNA 1XR8A 1CGUA 4PD4K 4MWFB 2BNUB 1JN6B 3IXTB 3WYRA 1X5IA 3AMLA 4I77H 5BV7C 1G7LB 2I9LB 2O5YL 1NUNB 1B2WH 3C5SB 3FFDA 3T65B 1FL3B 3WD5L 5HDBE 5HPMB 1W0WA 2WBJB 4D8PB 3FQWA 3MRFB 5DZOA 3VGAB 5EC2A 1KJ2L 3UCRA 1HZHL 1BD2E 25C8H 1IGFL 2N7AA 2KPNA 2YUZA 5IR1B 3ZTNL 4OV5A 3FQNB 4FQPA 1AE6H 1XR9B 3MLZH 4Z78A 3P2TA 1RIHH 4JFDE 2EDQA 1H3PL 1W72B 4NRZB 2YA0A 2Q6WB 4G8IA 5DJAA 2N7BA 4N5UA 5DRZA 1E4WL 1XAUA 4LGSB 4CNIA 1WCQA 2YD2A 5DQJA 5GHWL 4R2GB 3OKNA 1HIML 1U8PB 2UWEF 2X4UA 4Z18A 1J8HD 1OAQL 1CFVH 3MODL 4C56D 4N8PA 4G8FA 2YMXH 3E0GA 1P1ZA 5J3HC 1KTRL 1CICC 1CXIA 4PFEA 2CKBL 5LBSH 1TTGA 2XQBH 5IVZA 1S5HA 1QFHA 3KPNB 2BJML 3O2VH 5GGSA 5C6WH 4TSBL 1X5JA 2QSCL 2GK0A 3QXVA 1EV2E 3QDJE 2LTQB 4OIBA 2I25N 1P7QB 4MJ6A 2Q8AH 1A6VH 1KNOB 4P5TA 2OZ4L 5J3HD 3FFDB 1E4JA 1CICD 3DBXA 1RZKC 1NJ9A 3FQWB 5TQ2L 3T0DA 5DMJB 2FJHA 5EC2B 3WFBH 4PJGA 4G5ZL 3WFCH 5JOPE 4PGDA 4R90H 5T5NG 4X8XA 5J9PA 2WNGA 3VG9C 2LVEA 3ET9F 4DTGL 4Z7WE 1VGKB 5D93B 4OV5B 2DI8A 1LO0H 3EYSL 4KWUA 3K1KC 4Z78B 3F65A 5GRUL 1S8DA 3BDYH 4G8IB 4KTDL 5DJAB 4ZNEE 5IVXA 2AERT 1CE6A 1NCAL 5DRZB 1MHPH 3UBXA 4CNIB 1JHTB 1XMWA 2X89D 5DQJB 3NFPB 1EX0A 3OKNB 5F1NA 4KZDH 5FYLL 3CH8A 5KVFH 2X4UB 3DVNB 4MHHG 3O6LH 5DJ6B 2XTJE 1G1CA 5BS0E 2Y4SA 1P1ZB 1FBIL 5J0BA 1NBVL 1YN6A 1RIUL 4HEPG 2EZ0C 2AJXL 4F33A 3LHPL 3BMVA 2WP3T 1S5HB 2E6QA 5IVZB 3G6DH 3GO1H 1URLA 4ZOAA 4NPYA 5GGSB 5EN2A 5F1SA 4CN1A 4QRPE 2GK0B 3B3IB 3MA9H 4GQ9H 4MJ6B 2IBGA 2G75A 3FO9A 3LD8C 1MAKA 4P5TB 4B41A 1DANT 4C59B 3DBXB 4ENEC 3MV9E 1ZGLB 1P69B 1UEMA 2EZ0D 3JTSA 2MSPA 5E2TH 2FJHB 4FRWA 4PJGB 5D7KD 3EOAA 4PGDB 4LPXA 5I8KH 2X10A 5J9PB 1FZMA 5GZNC 3BZ4A 3QDGD 5EOTA 1KB5A 2VL5A 2X9XA 5I8OH 4EBQL 1IL1B 2K7PA 2VZ1A 1TNMA 1R5VA 1X5XA 2ZOLA 4PY8I 4NOBA 3NIGE 4ENED 2DLTA 1S8DB 3K80A 4OLYL 2HJLB 2XZAL 1BIIA 5IVXB 1CE6B 3SBWA 4WFGE 4S1QL 3SKMA 1DANU 5IBUG 3L3OA 4LQ1A 1TCRA 5F1NB 1MHHA 3QNXA 5GZND 1DBJL 4PY7A 5GGTH 3NGBB 5K33A 1YEJH 1RUML 1DUYB 4Y4HA 4J3UA 1ADQA 1JGLL 2X9YA 4NNXA 3PDGA 2BFVL 1YN6B 1N6QH 3ZE0E 2YEZA 3C8DA 4MCZA 5DXWA 3BPLB 2P44B 4F33B 4JKKA 5JHDA 5EWIL 3MRBB 3PG2A 4NPYB 5EN2B 1JVKA 3B2VL 5I1AA 1RIVH 1T03L 3K1DA 3MLPA 2BDNH 4JREC 2G75B 3FO9B 4H25B 4Z95L 4KU1A 4G3YH 4YHOL 2JJWA 4LFHD 2R69L 4GW5A 4LOUC 1DSFH 5H8DA 4PJIF 2NY2C 2NX5D 1GH7A 4PJXF 4PRNB 4AEIH 1SY6L 1UM4H 5EZOH 4YK4B 2LU4A 5DZNA 3B9KA 1IGCH 5EPMA 1FZMB 3BZ4B 5EOTB 4EI5C 1KB5B 1PZUB 2VL5B 4Y5XA 3QFDA 4J4PC 1R5VB 2PCPA 1ZSDA 2JIXD 2ZOLB 4POUB 1P84J 3EZ8A 4LOUD 4D94A 5I0ZA 5I9QC 2NY2D 5FO8A 3T0EC 3DGGA 3LQAC 3BKCH 3SKMB 1F42A 1YY9C 1QYGH 3QI9A 5LG1A 3L3OB 1TCRB 3MR9A 1MHHB 3QNXB 4EI5D 4WU7B 4WEUD 1Q38A 3MREA 3O2WL 5MI0B 4J4PD 4WDIA 4PY7B 2DJSA 2YC1A 4IRSA 3BESR 3BO8A 3FB5A 3MRPA 4Y2OA 4Y4HB 3IKCA 5J11B 4MDIA 1T6VN 3ARPA 4NNXB 3NH7L 4XGZA 3T0ED 4J3WA 2YEZB 5J4MA 2H32A 4MCZB 1CGSH 1YY9D 5DK2A 1JZ7A 1CLOH 3S6CA 4HKXA 3QQ4A 5KS9F 1QBLH 2HTKC 4PYGA 3OKMA 4I3RH 5I6XB 3GSUA 5I1AB 3WE6B 3BPNB 1QFWH 4Y4FA 4GXVL 3A0OA 4MVBC 4WI5A 5KG9A 3REVA 3DVIA 2AAVA 2AQ3A 3NFNA 4GW5B 1KEGH 1MFCH 2FSEA 4LARL 2HTKD 4P57B 5TE7H 5IQ7L 2EXWC 3B9KB 3FAXA 1Y6KR 1VKXB 2IH3A 3NCJH 4KKNA 3HNSL 1EHXA 5GGVH 5FFLA 4Y5XB 3BP7A 4MVBD 2WWKO 4P23A 1Q0XH 1A1NA 1ZSDB 1FZKA 5ITBL 1Z0MA 4RMUA 3N06B 1R6VA 4P9ML 1G9NL 3NIDE 2IFGA 2GITB 3DGGB 1F4WH 2XZCH 3AS0A 3QI9B 2NY3B 3MOAH 4FQJH 2EXWD 3AM8A 3MR9B 4FQ1H 3O11A 1JV5A 1NDMA 1UA6H 3MREB 5CJBA 1DVFA 2EO1A 4U3CA 2YC1B 4IRSB 5E7FA 1KPUB 4XPAL 3BO8B 3FB5B 2YZ8A 3LDBB 5ETUA 5C09E 3IKCB 4GLRI 4XGZB 2ZPKH 5BMFH 3U6RA 4I1NB 4MQXC 2IG2L 2XKUA 1DBAL 2H32B 1MRCL 4JHAH 5DK2B 2WMPA 2IPUK 1CFTA 3QQ4B 2IMNA 3RWIB 1GYAA 3G6JA 1AHWC 3OKMB 4ELKB 3MFFA 2AJYL 3GSUB 4AIOA 2HH0H 4Y4FB 4YEFA 2EO9A 4TPRL 2ZCLH 3U4BH 1Q9KA 3DI3B 5KG9B 3REVB 1DL7H 5KVGL 3NFNB 4MQXD 5I0DA 1C7SA 1U42A 3O3UN 4PJEA 1PFCA 3X3FL 1A14L 2FSEB 5EU7C 3KPLA 4LVHC 1ZA6A 2IH3B 4UU9A 3U0TA 2AK4D 3IETB 3IDIA 5E5MA 2WLYA 3BP7B 3D2UD 4P23B 3QFJE 3ZHKA 5GS0L 1NLBH 1A1NB 4V1DB 1OAXH 3O6FA 1FZKB 5DHVH 1RK1A 3BXNA 2QR0A 2EH8H 3V52L 3DPBA 2DIAA 2YUXA 2Q8BH 1N0LA 3N1MC 2YD3A 3WIHH 5MENA 4GUPA 3O11B 1JV5B 5DLMH 5DD5L 2BVOB 1NDMB 1DVFB 4IHOA 2K3TA 3KXFB 5ETUB 1J0IA 4UOW1 5EU5A 1BREA 2EDNA 2DMBA 5T3XL 4KVCL 5KBNC 1P6FA 3WFDH 1BFTA 1CFTB 3HZMB 4LSPL 3ARVA 3G6JB 5A40E 3MFFB 4K8RL 4X4YA 1UACH 2WUBL 4YQXL 5C6TL 1CLYH 1BWMA 3GJFK 1Q9KB 3GSWA 2A9NH 2CO7B 2KKQA 2PO6C 4DN4L 1FFNA 5BRZA 4PJEB 2OS7A 1KYOK 3TVMC 3RDTA 3KPLB 2R2EA 1ZA6B 4NFDA 4UU9B 5INCA 3U0TB 2B5IC 3IDIB 3S96A 4YNYA 5E5MB 3FN0H 5GGRA 4EI6A 1AI1H 1LILA 4GW1A 4FZ8H 1O5DT 3KPMA 4FQXA 5CP7A 5H35A 3O6FB 2PO6D 3RY6C 1RK1B 3D6GA 3RIAF 3EO0A 3BXNB 4YX2L 4AJ0A 4XPHL 4CGTA 4L5FL 3TVMD 3FFCA 3O3DB 3CVHH 3DX9B 3HG1A 4M43L 4UAOB 5I8CA 4GUPB 4M02A 3TZVA 1IC7L 4O2CA 3TIEA 5DVLA 4D9LH 4F80A 1JYNA 4NM8H 4IHOB 4K23L 4I2XA 5EU5B 3T2OA 1KPRB 2FX9L 3KLAA 3B9DA 3FB8B 1OGTA 4QHUB 3HR5A 5LVEA 2R1WA 2J88H 3UJIH 2VDKL 4JO2L 1FAIL 4ODWA 2IEPA 5I1DA 2YA2A 4X4YB 1UC6A 3MGOA 5AWNH 2HVKA 3HC3H 5FYLD 2XWBB 4O5LH 4RMRA 2C3GA 1J1OH 1IZKA 4ESKA 1FFNB 3HA0A 2BY2A 1W72H 1V5JA 2R0ZL 1I1FB 4HFWA 4M7ZC 4Z7VA 4Y5YC 3VFUA 4P4KA 5INCB 5EOCL 1MNUL 3OJ2C 4I18C 3O6KL 3S96B 3M45A 1H5BC 2IQ9H 4DEPC 5GGRB 4EI6B 3AFLA 4GW1B 3SKJH 2XTLA 3KPMB 4FQXB 5H35B 3BKJH 5DEGA 2JCCF 2A83B 3EO0B 4IBLT 3S88L 2VZ3A 5DTFB 5DWUH 4BQ9A 3W9DA 4XP4H 4JQIH 3FFCB 4I9WE 4PJHB 1FG2A 3HG1B 5ICZB 5IFJA 5I8CB 4Y1AA 5DT1L 4O2CB 3TIEB 2J12B 1V7NL 2XY2A 5JW4N 4BSJA 5EBWA 2AV1A 3JUYA 4GAGH 1MCDA 4TNWF 1P53A 1OARL 4I2XB 5KVEL 4KDTC 3KLAB 3QXAA 1OGTB 1QFWI 1A5FH 1WAAA 4YHMH 1KIQB 3HR5B 3HUJA 2R1WB 2UZYB 4WI7A 4LLUB 2QKIA 2HFEA 3D0VB 4WHYG 4ODWB 5I1DB 3MGOB 2CDGA 2HVKB 2HFGH 3GMQA 2DDQL 4OCNC 4W6YB 1QRKA 1I85C 3PL6A 3LH2L 4PJGE 2DIJA 3HMXL 3IU4H 1JZ2A 4HFWB 5T1DL 4M1GL 4Z7VB 4LBEA 3VFUB 3RTQA 4P4KB 5T1KA 3KR3L 3M17A 3RWEB 5LGJB 4MCYA 5F7WC 4YHLH 4URTB 1KCVL 5GPRA 3DROB 4HWBA 5DEGB 2DQCL 5IVXE 5HHXL 4XP1L 3W9DB 3ZDYF 1WTLA 1FGVH 1WEJL 1FPTH 1G7HA 3KYKL 5IFJB 3TJEH 2ZKHH 5E6IC 4H88H 5CD5C 4WY7L 4Y1AB 2HRPL 1TITA 2CLRA 3PWUA 4M3KB 3R8BB 5F3BB 5B38A 2BNQB 4OZIF 5EBWB 2DLEA 2AV1B 2VDQH 4X7CC 2ERJC 2VLKA 3O8XC 2DM4A 1VFBA 4CMHB 2ESVB 4OUUB 3RIAK 2EEAA 3HUJB 3PP4L 5D70H 5HI5C 3CPLB 5DI8A 1WF5A 2QKIB 1U8JA 1WBZA 3SDDC 5CD5D 2HFEB 5E6ID 4WO4A 2H2PC 1MFDH 4A6YA 4XP6H 2OYPA 1NSNH 3HAEA 2CDGB 3V5DA 3NPSC 1AQKH 2DYPD 3CDFA 3MRCA 1V8HA 1X5AA 1WJ3A 3GMQB 3O8XD 1H3TA 3TYGH 3L3GA 1JP5A 1OAZH 3PL6B 3SDXF 1J8KA 1AFVL 1I7ZA 2R56L 5HI5D 1B9ZA 1CF8L 3SDDD 5I71B 2ZCHH 4H8WH 2CUHA 4EOWH 2J6EL 3Q1SH 4LBEB 3C5JA 3AS1A 3KVQA 1S3KH 2H2PD 4ZPVA 5CLTA 3RTQB 5KTEL 5T1KB 3DMMA 3M17B 4IRJC 4DKFL 5F21B 1OQOA 3SO3B 1EIBA 1F4XH 4MCYB 4O2EA 2UUDH 1MCNA 3V6OC 1YUHB 3T8XB 3OJVC 4N90D 2DQJL 3RY5A 3OR6A 4JPWH 3J7HA 2E7LC 4HKJB 5AAWA 4HW6A 4IRJD 4MA8L 1G9NC 2CLRB 3KDMB 3PWUB 2P5EA 4A2LA 5HYQA 5B38B 3S97C 3A6BL 4HS6A 2VLKB 4XNUL 3OQ3B 4DJMA 2X7LA 1VFBB 3GBLA 3T08A 1O7VA 1JNLH 5DI8B 2ZUQC 4L4TD 1U8JB 1WBZB 4N8VG 3CFBA 4QO1A 2J4WL 1GGYA 4ISVA 4ONFL 3P9WB 3QCUH 3HAEB 1N2RA 1BVKA 1L0XA 3V5DB 1A7QL 2WWMC 1KB5H 3MRCB 4Y89A 4XVJL 4TNWK 2DI9A 1MIMH 3L3GB 2VKXA 5E1AA 3ALXA 4EUPA 1I7ZB 3VXPB 2VR9A 4DWHA 1KGCD 1XGRA 1L6ZA 5FGRA 4H0HB 4OM1L 3L9RA 2WUCH 3DMMB 1OAKL 5J6HA 4XP9L 1BIHA 4PGZA 2DBLH 3QUMA 1QSEA 3CX5J 4O2EB 2WWMD 1DQDH 4NWTL 2R23B 4HJ0C 1MJ8H 5DD3H 1FNAA 3OR6B 1ADQH 2VDNL 5C7XL 5DJCA 4HMCA 3MXVL 2NY0B 3JV6A 1IRAY 1BZ9A 4U1JA 3HNVH 3L5WA 2P5EB 5HYQB 1J10A 4BFIB 5DO2C 4HXBL 1QNZH 2V5RA 4HJ0D 1GHFH 4HS6B 5EORH 2X7LB 2VIRA 5E99L 5FCUH 5IESL 2QBWA 1CT8A 5D2NC 1CFSA 4F57L 1ZTXL 4ISVB 5F9WC 2RFXB 3QQ9C 3BAEL 1RUKL 3FB7A 4OBRA 1N2RB 1BVKB 1VPOH 3IKKA 1JF1A 5DO2D 4OM0L 1I8LA 1BOYA 3OSKA 4NO5B 2YD7A 4RZCB 5E1AB 4K8RC 2WAHA 4G9FD 4EUPB 3VXUA 2VDPH 1T0NB 4AIXA 1S7TB 2EE3A 4ZTOL 3L9RB 4MD5A 7FABH 1NCDL 2G9HA 3D39A 3C5ZB 3QQ9D 1BFVH 4TUKH 3WMSA 1FFRA 3MJ7A 3SE9H 1MI5A 5J6HB 3UYRL 4P46B 1QSEB 4V1DE 1YN7A 5HYEA 2E9JA 4ZDHB 1F4YL 1S7WA 1WVZA 1EO8H 2FATL 5A3IC 4K8RD 1DBBH 2G60H 1UB5A 1A6AA 3MJ9A 2D7TL 1YEEH 3OG6B 1CGVA 2B39A 2FHCA 2H32H 3QHFL 2MFNA 1A6UL 4M61B 3L5WB 1YZZA 4JFZL 2EIZA 4NIKB 4G6JH 3KXFE 4AMKL 3FN9A 1BBJA 1PEWA 1QEWA 5A3ID 5IHLB 4XCNB 3OB8A 1S9WA 3A6CH 1VENA 1M05B 2VIRB 5I18L 2LQRA 4M6OH 1SM3L 1CT8B 1CFSB 1HQ4A 4LAQL 2VXTH 3HNTH 2DBJA 4PJAA 1KBGL 3TO4C 4U7KA 3FB7B 3QEQA 1VHPA 5MP6H 5EC1A 4RBPH 1JF1B 1BVLA 2P4AB 1R3KA 5E6YA 5T5NF 4PJEE 2JB6A 3LV3A 4TSAL 2VH5L 3VXUB 2AGJH 1RU9H 1DBMH 4MD5B 2DQIH 3V4PH 3CLFH 2Z4QA 1PG7X 3D39B 4LSSL 4EXPX 3TO4D 4Q58C 1MI5B 3CVIH 3UX9B 1IILE 2FYYB 3DV4A 3HE6C 3KPSA 3WUWA 2HYMA 4OZGF 5I2IA 2APTA 5D72L 4Z5RA 2KH2B 1UB5B 1ZGLP 2VLRE 4L8SC 1A6AB 3G5VA 5IEHA 4PG9A 1R0AH 1QFUH 3MBXL 5SX5H 1ZLWH 5IK3A 3VRLE 3TA3B 2FH6A 1BM3H 1ZEAH 1TJHL 3SN6N 4KROB 2VDRL 1INEL 4ZODA 2EIZB 1T1XA 3MGTA 3H7LA 1LGVA 3UO1H 2FGZA 3HE6D 1BBJB 4KHTL 2R29H 1QEWB 3CCHA 1V3JA 2JJSA 3ISWA 1LEIA 3H7BA 4S2SA 3JUZA 1S9WB 4BZYA 2V7HA 2H3NA 3N1QC 1IJ9A 4L9LA 5SX4H 4LRIA 4HJJH 1HQ4B 4LPUA 5FO7B 3GB7A 3PDDA 5DURD 2CIKB 3F62A 2VITA 1EGJL 4PJAB 4RMSA 3QEQB 4XPGH 5EC1B 1G7PA 1FJ1A 3GHBH 3ARBB 1BVLB 2JB6B 3LV3B 3PXJA 3LN9A 1S7SB 3MJ8A 2ADIA 1TENA 5CJOL 3Q6FA 2W9DL 5C8JA 2UZXB 1NDGA 2Z4QB 1A6WL 4EIGB 4AEFA 3FT4A 4PUBH 1ZV5A 3KPSB 5F7NC 3WUWB 2V2XA 3GSNA 35C8L 2BXYA 3QO0A 4Z5RB 4NGHL 1NANI 3FFCE 3PWVA 3H3PL 3W0WB 3G5VB 4PJHE 3U7AA 2CD0A 5GRVL 5C0CA 3HG1E 4PG9B 4FXKA 2EDLA 3UDWA 1FE8H 3QUXC 3BYYA 2GSIA 4LSRL 3MRRA 2EDBA 5CCKH 2CRZA 2X4SA 2EC8A 4XMPL 3MGTB 1RUPL 4I2XE 1MLBA 2XKSA 3PQYD 5ALBH 1YEGL 1LEIB 3H7BB 4XBGB 4IOFC 4UV4H 2XV6B 2V7HB 4LSUH 3WN5A 2H3NB 3TNNA 5I75C 3QUXD 4L9LB 3DO3A 3TPUA 1FV1A 5GGQH 3GB7B 4YFDB 2EH7H 2VITB 2QQKL 2A2QT 3RWJB 1G7PB 4DKEL 3LKNA 4F15C 1T89C 1WC7A 4IOFD 3GK8L 1HWGB 5DMYA 2CJUL 3Q5TA 3OKLA 3MNVA 3MJ8B 4ODTL 2ADIB 4Z7VE 4KTEL 3Q6FB 1G6VK 1IKNA 4JPVH 5C8JB 4ONGL 3U83A 4PRPA 1NDGB 1BGXL 2LAAA 1ERNA 1AGEB 5FOJA 1K3ZA 4CL7A 1MPAH 1DP0A 1Q0YH 4YJZL 1Q9WA 5D5MF 2V2XB 1QOKA 4NZTH 4Y8AA 2EE9A 4GRLA 3QO0B 4J6RL 2OR8A 3PWVB 2L4OA 1MCLA 4O00A 4FXKB 4FS0A 3F6IA 2GSIB 4Y1AE 3MRRB 4XP5H 2FECI 2BNQE 4NFBA 2HWZH 4YAQB 2DQDL 4ZS6C 4NJAL 1MLBB 2VB5A 3G6AA 1OP5K 3FQRA 3WKMH 5JPNA 4P2CG 2ESVE 1WAAE 3HUJE 2H26A 3L5XH 3QUYC 4FA8A 3S35H 3RBSA 4Y5VA 4N0YL 4FFYH 4NQED 3TPUB 3LKSA 5IMOA 2RCSH 1FV1B 4K7FA 5SV4A 5FGBC 3RL1A 4TOYL 2DL2A 4OFKA 3CFKA 4UT6H 2C5DC 3P0YH 7CGTA 4ZS6D 3LKNB 1QR4A 3FQTA 1WC7B 3QUYD 1WFTA 4M93C 5HHNA 2X4QA 3OKLB 3MNVB 1FRGL 4YUEL 3MLVL 4XHQA 4XAKD 5D7LD 2UVFA 4PRPB 5HDOA 4G7VH 3JVGC 3CXDL 5F3HA 3FO1B 4JN1L 5CZVL 3IDXH 1Q9WB 3SCMA 1TTFA 4L3EB 2B1AH 3QH3A 4QRTA 4GRLB 2BNRA 1WZKA 2ZNWA 3U0WH 2ICWI 4MMXC 5ICXA 3DYMA 3VXSD 3Q48A 1JZ8A 3L3KA 4GSDL 2VQ1A 3V0AC 3G6AB 2O61A 2VLKE 1CTNA 1RZ7L 1MF2H 3UTTD 4HUKB 3QUKA 4XXCA 4QHNA 4NJ9H 4Y5VB 3IJSA 3KNBA 3LKSB 2CDEA 1ZMYA 3MGAA 2GFBA 5IMOB 4K7FB 1TFHA 4HIEA 3U9PL 3RL1B 1AR2A 3CFKB 5J7CC 5IGXH 1N5YH 2ZSVA 4PG2C 5DJYA 4IMLB 4M48H 4NQTA 4ODUA 5EBMA 3NCYP 1KLUA 2WQ8A 3PWPA 1LE9A 3ILQC 5HHNB 2I24N 2X4QB 3BSZL 5I73B 1XF5A 3BQUA 2O5ZL 5ITFA 4MA3A 4NYLB 4HWBH 1XT5A 5L6YL 4UTBH 5C3TA 1EUTA 5CGYC 5KAQF 3X3GH 2DQUL 1D6VH 1DDHA 5F3HB 1S78C 2P48B 4PJDB 1QR1A 3SCMB 5DS8B 3ILQD 1MJJA 2BNRB 1CGYA 2R0LH 1A22B 4RFEB 5DQDL 4FP8L 3OAYH 4MNQD 5ICXB 4KK9C 3CH1A 1XZ0A 1C12A 5CGYD 2VDOL 2ADFL 1X44A 4Q9QH 3HS0A 4JRXD 5GGSY 1S78D 2P5WA 1IGIH 2BCKA 2VQ1B 3P30L 3FO2A 3VWJA 3ROOA 4RFNC 2AEPL 2IGFL 1OP9A 4A6YH 2O61B 1AJ7L 4AG4L 1SYSB 3HAEH 2ADGB 1NGWB 5C07D 5HVHC 3QUKB 4ZFOB 1IARB 1KN4L 4KK9D 3IJSB 3KNBB 3C2AH 2CDEB 3MNWA 4WGVB 1DFBH 4TUOA 4YHNA 2ZSVB 4OF8A 5DJYB 5EBMB 2V17H 3NABL 1KLUB 3MLTA 3PWPB 5D1XA 1QFPA 1LE9B 4TQEH 1UQSB 5C86A 1OWWA 1XF5B 3BQUB 4MA3B 4NP4H 4JRWA 2AJUL 1KN2H 5F7DA 3QWRD 4KMTL 4Z77A 3JWDL 1LMKA 1QSEE 5KSUA 1DDHB 2J3SA 2QQNH 2XRAL 1QR1B 3QCTL 4U6TA 3SOBL 2W0LA 1MJJB 2P8MA 1YJDH 4DW2H 1EJOL 3GIZL 4HEME 1X4ZA 1N7MH 3CH1B 5F7MC 1XZ0B 1C12B 4LSVH 2BVEA 4XCEA 5I1KH 3C6LC 1MQKH 5E2VH 2XYCA 3IDJA 3FO2B 3VWJB 1I9IL 3ROOB 2YWZA 1WZ1L 4IDJL 3MRDA 5E2WH 1GGIH 1A7PH 3S4SG 2F5BL 3GDBA 1V3KA 5A2IH 3PXHA 4YDKH 4U31A 4JKLA 4EUPH 3MNWB 1QRNA 3C6LD 3GRWL 3EFDL 4OF3A 3OBAA 1WBXA 2F53A 4MJIA 3IDYB 4TRPL 5C0FA 2A77H 1Q94A 5JQ6L 3QUMH 4U1MA 4HIJA 4LU5H 4WW1B 1BAFL 1WWWX 1IGMH 4LVNC 5BOZG 2IANA 3HMWL 2N1KA 3D39E 5F7DB 1NMBL 1MI5E 3MJ6A 2C1OA 4Z77B 4CJ1A 5C0BD 5KSUB 3OB0K 2A0LC 1RULL 1TVHA 3EKCA 2P8MB 4YLQT 1N64H 1V7ML 3O9WC 1FAKT 1G9MH 3S34L 1M7IA 3ARGC 5M7QA 4XCEB 1X5FA 4WWKA 5IW3A 2VE6B 3EDFA 5I1CH 2A0LD 3L1OH 5TF0A 3IDJB 5GRVK 4XNYH 3FCTA 1BF8A 1AGBA 1GXEA 5HYSG 1CZ8H 4BSVA 1J1XH 2CGRL 4OB5L 4BFEA 4K7PX 5F93C 4M7JL 1HYRC 1I1AB 4OLZL 3S5LB 3BPCA 5JW4M 1FYTD 3O9WD 4KJYB 2I60H 4R8WL 3I50H 2DLFH 1QRNB 3ARGD 1GSMA 1FORL 4UTAL 5CKAA 4QHKI 3QEQE 5I1LA 4WV1B 5CWSB 3CZJA 4OI7A 2FGWL 2IMMA 1D5IL 5GISH 5JDSA 3T0AA 4ODHL 4S1DC 3TBSA 3RL2A 1WBXB 2VERN 3H9SD 2F53B 4MJIB 5C0FB 3P77A 1Q94B 4S10A 4U1MB 2FEDC 4HIJB 3EDDA 4LHUG 4NBXB 3TBTA 4MJ5A 2IANB 5LJYH 3VXTA 1XGPB 1EFXA 2NR6C 1ZT1A 2C1OB 1OM3H 5GJSH 4S1DD 1I9RH 4BK5A 3MRQA 2R1XA 5D8JH 3UZQA 1TVHB 2IBZX 2E27H 3W0WE 5TE4H 4GKZA 5HGGS 3KYMA 1SMAA 2F58L 2DLIA 3MYJA 4YO0A 1T21A 1BBDH 5JIHA 1M7IB 2NR6D 5KN5A 3S36X 4UINL 3OZ9L 4WWKB 5I30H 4MYWB 3V5HA 1PG7L 3FCTB 4R96A 4NFCA 3VXRB 1LK3H 2PXYC 1A7BA 1AH1A 2KZWA 4YHKH 3T3MF 3JWOH 3BPCB 4K2UH 4OJFL 1KFAL 1RUQL 4ZOBA 3D25A 3U48A 2F54D 3CMGA 3WFHA 5CGMA 4X7TA 1C8PA 1KENL 1JRHI 4WI3A 2MPAL 12E8L 2OP4L 4WFFE 3IFLH 4G8GD 3TBSB 3TP4A 3RL2B 4MSWB 2PXYD 3P77B 1J8HA 3Q2CA 5HYJD 15C8L 3TBTB 5ADOH 4C56A 4LRNL 2NXZC 4MJ5B 2AXJA 4WNQA 3VXTB 5M94B 1DJSA 4MA7L 4BKLB 3MC0A 1EFXB 1ZT1B 4Z7OF 1QZ1A 5DVKA 1MREL 5TF1L 4HPYL 4HG4J 2IQAA 4G6ML 3MLUL 3MRQB 5TE6L 3Q0HA 3BKMH 1JMZA 4R6UA 1KB9K 5EU6D 1SJXA 1YYML 4PJ7A 2NXZD 2GAZA 4RNRA 3KYMB 4K7PH 1IFHL 3MYJB 4YO0B 3BDBA 2Q87A 4U2ZA 4YXLL 3INUL 1ACYL 3L7EA 1JPSH 3V5HB 2EDFA 3MV7E 5IIEA 4R96B 3SGKC 4YDIL 5JUEH 2ZOKA 3MV8D 4C57C 5FB8B 2ZCKL 3E3QC 3LN5B 4I77L 4BQ8A 4ODBD 1MFBL 3D25B 4BSWA 1INDH 3WDHA 3WFHB 3PF2A 3O6MH 1FL5A 5I66A 1S9KC 2AXGA 2CO6B 2R2BA 3VDAA 3KWWA 5LGHL 1J8HB 1RFDH 1JPGA 4PRPE 4YE4H 4S1RH 4WNQB 1JYXA 2NY1B 5D71H 3LAFA 3IJYB 1S5IL 1UKSA 4MXQC 1GCFA 2YPLE 2VUYA 4L3EE 2IQAB 5IFAL 3O3EA 3CFCL 3K74B 3NZHH 1RUAH 4U1HA 1T6WA 3KJ4B 2NYYC 4PJ7B 1DQMH 4D9QD 4RNRB 6FABH 1T66C 2YMXL 4QXUH 5DD1H 1ZLVK 5DDHA 1TJGL 5T1LB 4F7MA 1CLCA 3L7EB 4MXQD 2COQA 1Q8MA 4NHUA 3MXWH 1BFOA 2DQHH 3GMOA 5IIEB 1VEMA 4MGXA 4M4RA 3NBNA 3QDGA 1YEKH 4PLKC 2NYYD 1A6VL 1T66D 2DQFA 4OUOA 1DQJA 4BSWB 1IEBA 1YC7A 4L4VA 2FO4A 2G5RA 4WEMB 1KJVA 4M5ZH 1J0YA 4XPTH 3WXWH 2R0WH 3WNOA 5I1HH 4TNVF 4K3EH 2YD4A 1FL5B 5I66B 3WFCL 4ZXBC 2AXGB 1FZJA 3NN8B 5JORA 1MRDH 2R2BB 3KWWB 4OCRL 4PLKD 2XOTA 5K93A 1F2XK 3DX8A 1JPGB 3D48R 4M8VA 1CWVA 3HKFA 2Z35A 1Z5LA 3LCYA 3DRQB 3SHSA 3ZE2F 3G04B 3O4LB 4PJDE 3SGEI 2AJSL 2B4CL 2C4FT 3RPIB 3T3PE 8CGTA 4JN2B 4ZXBD 4K94H 4H1LB 2BNRE 4JM4L 5I1IH 4KV5E 5J89A 2AV7A 5KVFL 1EUUA 4U1HB 3SJVB 1MFAH 5ISZD 5CJ8A 4EN3A 2DN7A 1G0XA 3NZ8B 3FQXA 1NGQH 2AK1L 3DURA 3OKOA 4F7MB 4NKIL 2XN9D 1G7IA 4HZLA 5CJXC 5TGBB 4NHUB 1II4E 1ZT7A 3L7FA 3GMOB 4LLWA 3FONB 3GO1L 3HPJA 1RVFH 2UWEA 3SKUD 4MXVF 2PN5A 3QDGB 3RVUC 4N8CH 2R4SH 5SWSD 4GQ9L 1R3IL 5K59F 3ROLA 1UZ8A 2DQFB 2AJZA 5EZJB 1LO3L 2H8PA 1DQJB 2JIXA 1IEBB 4L4VB 1ZANL 4JJHA 3FJTA 1F58L 1KJVB 3IS0X 3I3EA 5E8DL 1W0YT 2JTDA 1D3CA 3VI4E 1H3VA 2VXQH 2AEQH 1FZJB 3NIFF 5JORB 3RVUD 2J7LA 3MFGB 4EI5A 4KI5C 2AEWA 2VDLL 4Z7UF 4UOW0 4J4PA 4PJFF 4EJ1C 5I8OL 3MJGX 3DX8B 1IBGL 3BT2H 3G9VA 2Z35B 1Z5LB 1E4KC 2AS5M 3ZSSA 3NFSL 4IEFB 3T0EA 5HHVL 3VG0H 2J8UE 4ERSL 1LEKB 2FLBT 1EZVY 1F02I 1PSKH 2N4IA 3D69A 1CDJA 4KI5D 1XIWA 1G6RA 2AV7B 3V6FB 1OSPH 4U1KA 1JUFA 4KVNL 4OFVA 1X4XA 1YEJL 3RZWA 4EN3B 2CXKA 3FQXB 3HCVA 2P1YA 1MEXH 2QV2A 3DURB 1J12A 3OKOB 3LZFH 1N6QL 1G7IB 2O26U 4HZLB 1NAMA 3O41A 5IOPA 3GGWA 5F7HA 1ZT7B 3L7FB 3ZTJH 2D0GA 5I1JL 4MQ7A 3HPJB 2UWEB 3WUZA 5EB9A 1IT9L 4IIQB 3HLAA 5IFHL 2DS4A 4HH9B 3ROLB 1MFNA 2AJZB 4O9HH 2H8PB 4MB4A 3H0TA 3L5JA 3U7WH 1HHHA 3GUTA 5C0AB 2JJVA 4NT6A 1MCWW 3QWQB 2XA8H 3CNKA 4GS7B 3TH2T 4GKSB 2OMBA 3VD7A 3V6BR 2YUVA 5EZOL 4LGRB 5EZIL 1IGCL 4EI5B 4PJBF 5FF6A 4D9RE 4MD4B 4NZUH 4UV7H 2DKUA 5IT2H 2DB8A 1DN2A 1FLTX 2H1PH 2VDMH 5SV3A 3T0EB 4H5SB 4U0RB 3MLXL 1K4DA 3FN3A 4JKPH 4O02H 4KPHH 5ESAA 1WZLA 2CIIA 4XMLL 1HHJA 3D69B 3GNML 1XIWB 1G6RB 4CJ0A 3U30B 4U1KB 2FIKA 1KTLB 5LXGH 4KI1A 5LQBL 3IFNH 1JGEB 3TBWB 5HDBF 1UFUA 3OF6A 4Y19B 3VFGH 3F7PC 1GJIA 3HCVB 4O51A 2MCPH 3G08A 3QAZC 3O3AA 1NAMB 2E9BA 3O41B 3P0VH 4YHZL 3GGWB 1MHEA 5IOPB 2MQCA 2ZUSA 4MQ7B 3QIBA 1AHWA 4RAVB 4M7LL 3OKKA 5DUPH 1KEML 1UXWA 2AK4A 2I9TA 3TT3H 3BP4A 1QFWL 3HLAB 3V4UH 3D2UA 3MZTA 3MA7A 4G80B 1QRNE 2YRPA 4P5KA 3SKOA 1HHHB 4N1HB 4MXWL 4UIMB 3GUTB 3HB3C 4NT6B 1WISA 2F53E 4MJIE 1JTPA 5ILTH 4HUVA 5TE7L 1KJ2A 1OSZA 3FRPA 5FF6B 1QVOA 4S0SD 2IANE 4PGJA 4WTZA 1HCFX 1A2YB 4PJIA 4HPOH 3BIAX 1KCKA 1J0HA 3HB3D 4P2QA 4IOIA 5E9DD 2W9EH 2ZJSH 1K4DB 1MQ8A 3ARYA 4PJXA 5ESAB 2CIIB 4FQJL 2ADJA 1E6JL 5EIIA 2EDTA 5E8PA 5EA0H 1T20B 5C2BH 4JG1L 4YGAB 3ZDZE 1UA6L 2FIKB 3BE1L 5GRYA 4JFHE 2CK2A 1UCTA 4JM2F 2C7UA 5HVWA 3MRHA 1QFWM 4DGYH 1CGWA 4JDZB 4O51B 3T1WA 1SVCP 3G08B 2VXVL 3O3AB 4QOKB 1MHEB 5GIRA 3SE3A 3VXRE 2E7MA 4DUWA 3VFSA 3QIBB 2AJVH 2D31A 3OKKB 2CKBA 3D9AL 2Y06L 4JPIA 1UXWB 4OIIL 2HH0L 2I9TB 3T4AA 4ZNCD 3BP4B 3GJFA 4HZAA 4LNVA 5CEZH 3MA7B 2B1HH 1FIGL 3LKOA 2ZP0T 4P5KB 3SKOB 3CMOH 2PO6A 4OTXH 1XGTA 3ZYOA 1TCMA 5F8RC 5I76A 2JJTC 4L29A 3DV6A 2OZ4A 5FA4B 3C8KA 5FYKE 1TTUA 3TVMA 5KS9A 4HUVB 4J8RA 4Z0BH 4XCCH 2YD8A 1KJ2B 1OSZB 4KK5C 4UB0H 1RHFA 2NMSA 1QVOB 3QDMD 3H3BC 4PJ5D 3TH4T 4NQVB 3RY6A 1GRWA 4QRRD 3DHJA 4PJIB 1HKLL 4P2QB 4IOIB 4D3CH 4HCRL 3C9NA 5T33H 1U8OA 4PJXB 2I07A 1QSFB 2A6KA 2BY1A 5DSCB 5EIIB 5IEKA 5E8PB 1FO0B 4NZDA 2W1NA 2YD5A 5DLML 4KK5D 4KRLB 4UNTA 1RJYA 8FABA 5IV2A 5AUMB 2C7UB 3MRHB 1MAMH 2AKRB 3NAAL 1VCAA 3P4LA 5H94B 3WFDL 3TNMA 2X4NA 2ICEA 4UIKH 2Z0BA 1FVDB 2AQ1A 5GIRB 1ZS8B 3VFSB 5CAYB 2D31B 2CKBB 4JPIB 2AI0L 1MH5B 5E94A 2A1WL 5FYKH 1UACL 3T4AB 3GJFB 3QHZL 3NIGF 3K0WA 1CD0A 4MAUL 1R24A 4HS8H 4M6NL 3B43A 1EO7A 3LKOB 2P7TA 3I75A 4YHYC 2A9NL 5E03A 3SO5A 1XGTB 4QTHB 2GT9A 1QBBA 4PS4H 5I76B 1RZFH 1TQCC 2DTMH 1F3JA 2ZUTA 3RVWC 5KJRL 4L29B 1EPFA 2Y07L 3TVMB 4HXAL 4P2OB 3E6HA 3QXDA 3S36L 4J8RB 1IKFL 4M5YH 4I18A 1SEQH 1H5BA 4PD4J 3FN0L 4PJ9A 4RWYL 1X4YA 3ZE0F 4OLWH 4S1SL 5CD3A 1DZBA 3UP1A 3RVWD 1BD2D 4HUXB 3C9NB 1IEHA 2MWCA 2A6KB 1DE4A 5IEKB 5J1AB 1PAMA 4L3AA 1Q1JH 4XMKL 2I27N 4MS8C 4YPGA 4U6VL 4PJ7E 2B4CC 4JFDD 4JAMA 3U1SL 5HSFA 3BGFC 1RJYB 1AXTH 5IV2B 1X5ZA 2WLZA 1UJ3C 3X13B 1A9EA 5HVFB 4PB9L 4KDTA 1LDPH 4LPCA 3GBNH 4KMLB 5FUZL 3TNMB 2X4NB 2ICEB 4KAQH 5H2BA 4EKXA 2APFA 1Y18A 4MS8D 1KT2A 1N0XH 1KXVC 4JFED 3V79C 1FH5H 1ULVA 1R24B 3DSFL 4K9EL 4M3JA 2P7TB 2PW1A 3I75B 2Y23A 3EYOA 4BQBA 4KHXH 3PGFL 1I85A 4OCYH 4LCIL 2GT9B 4X4XA 5SWQB 1F3JB 4DVBB 3E6HB 3QXDB 3QDJD 5CJQL 2VYRE 3T2NH 4WI4A 4HLJA 3VH8A 1A6ZB 4X99A 2IQ9L 1SY6A 4DEPB 2VQUA 4PJ9B 5CFHA 5T5FL 4MDJA 4N1CA 3O4LE 4S0TD 5CD3B 3CLEH 5JOPD 2R15A 4IS6B 3OPZH 3VD9A 3BHBA 4JQIL 4GBXC 1T0PB 2CXGA 2N56A 1UM6H 1RJZA 3BP5A 4Z7QF 1UKTA 4XVTL 3SJVE 2HN7A 4OZ4A 2A9MH 2VC2H 5DFWH 4YPGB 1F6FB 2XTJC 4JAMB 1YYLL 2V9QA 4GAGL 3EYUH 2DYPA 2Z9TA 1A9EB 4ODSL 3O8XA 2Q3AA 3FT3B 4LKXA 4NM4H 4RA0C 4TULH 5D7KE 4GBXD 3OR7A 3TN0B 1U8QA 3IYLW 1L9NA 2I5YH 4HJGA 4JQVC 1IQWH 1Y18B 1EZVX 2QL1A 5F88A 2XTJD 5BS0D 3FOMB 3KJ6H 3T0VA 1IGYB 1NBYB 4NC2B 1KT2B 1BOGA 1MIEH 4JFFE 3K81A 3IVKB 2HA1A 4L4VE 4Y7MA 2PW1B 3QPXH 5CBEA 4KGLA 3EYOB 1YNTB 4JFQA 4YZFE 3LSOA 1KCLA 2VL4A 1D9KA 1OP3K 4X4XB 1U8NA 3BUTA 4RWHA 1FIEA 5E5UB 3IU4L 4CU8A 3X12B 1WK0A 4QRPD 3V0WH 3M07A 4IRJA 1WWAX 4NUGH 3VH8B 4I0PC 5I8EB 4H1LH 3DTXB 5D6DA 3MV9D 4WI2A 4YHLL 3LEVL 4HIHA 4MDJB 5B38G 4MA1C 5I19H 3GMPA 4JFXA 3TPKA 2MQ0A 4NKOB 2QHLA 3BHBB 3QEGL 3ESUF 2X4RA 1BQUA 3RHWF 3NCMA 1RJZB 1J86A 3BP5B 3TJEL 1XF4A 2HN7B 4I0CC 4I0PD 4OZ4B 2BRRH 2XXCB 1G84A 5FA3B 2C1PA 2VDQL 2DYPB 4GAJH 3RA7H 4BH7B 3HAEG 2JCCA 3O8XB 1BZ7A 3LPGA 2BX5A 4HDIA 4WFGD 4QY8A 2D7QA 1G0DA 4LKXB 3RWHA 3PHOA 4AL8L 2IPKA 5D70L 3OR7B 1MVUB 1U8QB 4R97C 4RFOH 2UWEE 4P3CH 4R4FH 1YECH 5B21A 1UWXK 4HJGB 5IKCA 1MFDL 2XZQH 4XP6L 5F88B 5BQ7B 3TBYA 5HHOA 4PJ8C 2PYEE 1TVDA 1MOEA 1LO2L 1BOGB 1I7RA 5ENWB 5JR1L 4RGOL 5C0AE 5CBEB 2BOBA 4JFQB 3LSOB 2XY1A 1Z0NA 1D9KB 1OPGL 1U8NB 4YBLB 3FL7A 5H37H 3RY4A 1D5BA 4XVSH 2ZCHL 4DFHA 2X1QA 3Q1SL 3WIFB 3RWCA 4UT9H 1HNFA 1J1PH 3EYQC 2XWTA 4PJ8D 2VWEC 1XH3B 1HHKA 1R3HA 1HE7A 3WKNA 3V8OA 5DR5L 1R5WA 2B7DT 4OQTL 4HIHB 3ULUL 2VLME 3GMPB 3LEYL 1S9YA 4JFXB 3F58H 1BQHA 3S9DB 2NXYB 1WICA 3N0PB 1RK0B 2FH8A 1JGUL 2X4RB 1F6LL 3BZDA 4TTDC 1ETZA 4LEXH 2OX5A 3EYQD 1ZGLM 1XF4B 3EJJX 1MCRA 2LABA 5J13B 3QNYA 4Y19E 5DD0L 4X7SL 2C1PB 3VW3L 2FBJH 1BZ7B 4WU5A 4HDIB 1P2CB 5HHMB 4QY8B 3RWHB 3PHOB 3LIZH 2IPKB 1NGYA 2ZUQB 4EUPG 3RZCC 5D2NA 4XX1G 3GI8L 4DUXA 4HUWA 3C60C 5EIQA 3WHXA 4TTDD 4I3SH 4XPBH 4PJCF 4OLXL 4LGPB 4ZO9A 3TBYB 5HHOB 3SDCA 3HI6L 5D7SH 4QRUB 1I7RB 1EFQA 4OZIA 1XFPA 2CKNA 4M7KH 4OKVA 1KB5L 2AABL 5IB2A 2ATPA 1MY5A 2BOBB 4U1IB 1L7TH 5C3LD 3B9EA 3RZCD 1D5BB 4ZAKC 4JHBA 3WLBB 3RWCB 1BQLL 2OTPA 1M6OB 4G8EA 3DVFA 4NQSA 2XWTB 2A6DA 3CX2A 5EIVA 1R3HB 4OI8A 1G6RH 2VZUA 3BZEA 1R5WB 4PRIB 1FNEA 5D9SA 2IPTH 4JFPB 1S9YB 3SDXA 5DD3L 4OFYD 1BQHB 4KK6C 4X5XA 4B0MM 4ZOCA 4ZAKD 5C0GA 5IG7A 3N9GH 5EO9A 1ETZB 1NAMH 4DN3L 2YD6A 4HV8A 4YIQA 1SJVA 2RIKA 2VKWA 4NO0D 3MBEB 5CILH 4F9LC 1CI5A 1UZ6F 1UT9A 5IROC 5C0IA 4WU5B 5EORL 1PY9A 3RX7A 4KK6D 1NCCL 4QOKE 1NL0L 2FECL 1NGYB 1SJEA 3IDMB 4L8DA 3TEUA 3WHXB 1IEAA 2F8VA 5HHPB 3RHWK 4AQ1B 3TO4A 2OR9L 3SDCB 1W2KT 3AXLA 4OKVB 1S7QA 1LO4H 4QLRA 3B5HA 4QXGH 5IB2B 2ATPB 3HE7A 5DJ2A 3ARDA 2NY6C 1KC5H 3M8OL 4E42A 5KW9H 4EIZC 4MAYC 2GJ6E 1U3JA 3ARWA 4NQSB 1BFVL 4QHMB 2C26A 1CXKA 3HE6A 4MZ2A 2D03H 1BHGA 1FNEB 4PJIE 5D9SB 4P2QE 4M1CC 3LS5H 1DBBL 1VB9A 2NY6D 3I02A 3O3BA 5E70A 5JHLH 4L8SA 1QSFE 3R4DA 4MAYD 5IG7B 1FDLH 3K8MA 3SPVA 5EO9B 1CG9A 3GBML 4HV8B 4YIQB 4I13B 1CQYA 1GIGH 1MAJA 1IAIH 4NN5B 2IAMB 1OL0A 4YR6A 4M1CD 5C0IB 5CBAB 4XNXH 3O2DL 4LHUD 4P59L 5ID1B 3A6CL 3K2MC 1F4HA 5DRNB 3P73A 4M6OL 1MELA 1SJEB 5T1MA 3O4OB 4L8DB 5GQBA 4K3DL 4XCFL 3KYAA 3W5MA 1FL6A 4X98A 2VXTL 3MOBL 2O5YH 4JPKL 4G6FB 4YXKH 3TO4B 2OQJA 3WD5H 2WBJC 2V9RA 3VGAC 1S7QB 1KJ2H 1ZA3A 2HFFB 4UI2A 1S7UA 4Z9KB 5JO5A 3HE7B 1HZHH 4NN6B 4U4BA 3ARDB 4PRHA 3WUWG 1IGFH 1S9XA 1WT5C 2ED8A 4QTIL 1ZHBA 3ULUF 1RU9L 5CINL 3ZTNH 4OFIA 2EYTA 3V4PL 3ULVF 3CLFL 4RGMC 4OGXH 1JNJA 2ZUXA 3HMXA 1H3PH 2PUQT 2PYFA 2WBJD 2ZNXA 1FO0H 2J8HA 3ECBA 1E4WH 4CDGC 1T7VA 2WQRA 2X4OB 1KCRH 2FZ3A 3I02B 1U91A 3O3BB 4R2GC 5DC0A 4L8SB 5ICYA 3ZYZA 5GS1B 1GPOL 5BVPL 4J3OC 4POYA 1OAQH 1KYOJ 1PDKA 1BM3L 3SPVB 1PGRB 3LPFA 1CG9B 3OGCA 5DJ0A 3AS3A 3R06A 2F5AL 1DLFH 2CKBH 4RDQG 4YR6B 3WNPA 2MCG1 2BJMH 3GJFH 3PGCA 4R2GD 1JI1A 2R0KL 2QSCH 3P73B 1ED3A 4OCMC 1F8TL 2X42A 5B39B 1J0ZA 1FL6B 4X98B 3MRKB 5IB4A 2OQJB 3WS3B 4OBSA 3GHBL 4HFUL 5TQ2H 1K4CA 4AZ8A 4BH8A 1A7OL 1QLFA 1ZA3B 1T89A 1S7UB 5JO5B 2O5XH 1C5DA 4GT7A 1MY7A 1YQVL 2K1MA 1I7UA 4PRHB 1MCJA 1S9XB 1L0QA 3QG7H 4DTGH 1U41A 1ZHBB 1P7QD 1SVZA 5DGRA 2EYTB 3EYSH 5KSAB 2XXMB 1B90A 5GRUH 1J9CT 2EC9U 1FFOA 3MMEB 3QJFA 4KTDH 2GCYA 4HK3J 1NCAH 3ECBB 2RHEA 2RJMA 3GMNB 5F7KC 2XNAB 2YRLA 3T4YA 4KRMB 5MHSE 5ICYB 1SJHA 5EFIA 3FT2A 1JWSA 1A64A 5BOPA 4LLVA 2BVYA 3OGCB 5DJ0B 3RRQA 2MTPA 3L3JA 1NBVH 3X11A 4NZRH 3RPKA 1RIUH 5FYJE 1H0DA 2YSSA 2AJXH 3ALPA 4BQ6A 4GAFB 2EDWA 3GKWH 2EYRB 3LHPH 1BVZA 3PGCB 1NCUA 2XIDA 4I9WD 3IFPA 3DNKA 1ED3B 4OFDA 5GGQL 2DLHA 1JK8A 4P5TC 2EH7L 3CK0L 4BQCA 3IXAB 5IB4B 3TLRA 2FBOJ 1MJUL 1QHPA 4F15B 4BH8B 3FRUA 1C5DB 1MRFL 3D0LA 1FQ9C 3DOSA 3UXFA 4R4BA 5FM5O 3RUGF 2P24B 4MD0A 1P7KB 2GK2A 4EBQH 1Q72L 3T0XA 4P5TD 3QIWA 1S7RA 4DK6A 1FFOB 4TTGA 3QJFB 4OLYH 2XZAH 4LCCA 4M4PA 1Q0YL 3ULSA 3KPQB 4S1QH 2DI7A 4ELMF 1QPXA 4OT1H 3T4YB 1CD9B 1DBJH 1SJHB 5EFIB 1C08A 3FT2B 3HR6A 1JHKL 1JWSB 4NN7B 5DMIL 4AQOA 3DX7B 3HC4L 3QJHA 4YWGH 3NGBC 3WO4B 1RUMH 3I3DA 5JA8B 4LLVB 5E08H 3ZYJA 1JGLH 3L3JB 2BFVH 2HWZL 3X11B 2G5BB 3QT2A 1UH4A 1H0DB 2YSSB 3N50A 1VEOA 3BPLC 2CRYA 5EWIH 1ZVHA 3IFPB 4HMEA 1SEBA 5C08A 2CSPA 4L1HA 5HGDA 5M95B 1TQBB 4Z95H 3F12B 3TO2A 5KSBF 4MZ3A 4I8DA 4PG2A 2R69H 3PP3K 1EEQA 4HAGA 3E2HB 3R8QA 2V2WA 1S7VA 4EDXB 3DSNA 3FRUB 3E1F1 1SY6H 3D0LB 4I4WA 1NQBA 4LPWA 4X9GA 1B6UA 2VABA 3FTGB 5E56A 4LCUA 2VN4A 1G7QA 3T1FA 1K2DA 5F7EH 3QIWB 1I1YA 4JRXA 4PRDA 4YXHH 5GRJL 3DXAA 3IDXL 4LCCB 3ULSB 3GEWB 3SBWC 4FQIL 5D7JC 5C07A 2NPLX 1IAKA 1AD9A 2QSVA 1IM9B 1IAII 1HHGA 3O2WH 2Z31A 1OGAA 3GSQA 1LNUA 3QJHB 1EMTL 5ANMA 5TH2A 4BM7A 2C9AA 3T2QA 1GGTA 2HLAA 3QIUA 3ZT7A 3NH7H 4P2YA 5IBUB 5HHME 1L9MA 5D7JD 2BSTA 5J6GA 4LKCA 4WTWA 1QTYT 5I6XC 1SEBB 2H41A 5C08B 3BPNC 5HGDB 3TO2B 2X4TA 3QWRA 5HHOE 3LQAL 5IGXL 1UM5H 5J8OA 3MROA 2Q86A 1AY1H 2GUOB 3NA4A 5FHBH 1FNGA 1RURL 4LIQE 2ZG2A 4JE4B 4W68A 1KCSL 1S7VB 1XEDA 4X5LA 4U1SB 4GXUN 5IQ7H 3JXAA 1JRHL 3VRLF 3V4VL 3BD3A 4LCUB 4XPFL 3HNSH 4PTUB 5B8CC 3T1FB 1K2DB 2W60A 3LN4A 3X3GL 5CZKA 5CP3A 2Q1EA 1I1YB 5ITBH 4JRXB 5HJ3A 4F9PC 5JOEA 1I1CA 4FQCL 3DXAB 1XF1A 4PRIE 4P9MH 1NAKL 1EAPA 5KZCD 1CYGA 4UT7L 4KXZH 4XCYB 1WLHA 2NY3C 5C07B 1IAKB 3VRIA 1AD9B 1BLNA 1UEYA 3C87A 1HHGB 2BHUA 3I9GL 2Z31B 3IJHA 1OGAB 4MQSB 1C5CL 1LNUB 4G9DA 1GZPA 4XPAH 3WIIL 5ANMB 3C6LA 5TH2B 3ZDXF 5BXFA 2HLAB 3QIUB 3N1FC 3NA9L 1IGIL 4KY1L 2IG2H 4U49A 1MCPL 4U0QB 1T7XA 1MRCH 2VQTA 1NFKA 2NY3D 2BSTB 5FKPA 3BD5A 5J6GB 4LKCB 3ZDYE 3U7YL 1TVBA 3S37L 4WGWB 4L8CA 5T3XE 4Y4FC 2X4TB 4TPRH 4PREA 4LHJB 5HI4C 5C0BA 1I3GL 2Q86B 1YNKL 1HSBA 4FHBD 4W4OA 4WW2F 3X3FH 1A14H 1IAOA 4PJHF 4HGWA 5F96L 1U8IB 2BZDA 4OKDA 5DGQA 4Y4FD 1YEFL 2W60B 3LN4B 4P23C 5GS0H 2GJZA 5HJ3B 5EUOF 1FVCA 3ARFA 5JLZA 3V52H 1EAPB 3CVHB 3I6LD 3UTOA 2E6PA 3AM8C 4S11A 3VRIB 1BLNB 3WO3B 5DD5H 4L4JA 5ESVA 3IJHB 4UQ2A 3ZE1F 3S5LG 1CXFA 4NC0B 4P23D 3ARGA 3MCLL 3C6LB 4V1DD 3W82A 5BXFB 1P9MA 3T09A 1B0GA 1HNGA 5T3XH 4KVCH 1QBAA 1RZ8B 4Y2DB 3H9SA 1AC6A 3UC0L 4WHCA 5FKPB 4LSPH 5FO9B 4MNHA 4BZ1H 1TVBB 2FB4H 4K8RH 4L8CB 3KYNB 2ENYA 5C6TH 4R7DB 2V6HA 3GSVB 3KXFD 1EDQA 3I2CL 2CQVA 5C0BB 2PNDA 4DN4H 1EO5A 4XB8A 3EDKA 1FFPB 2HVJA 1KIRA 1IAOB 2A77L 4HGWB 1C5BH 3UTSA 3ARZA 4JB9L 1CR9L 2B2XL 4JY6A 4P3DA 2XFXA 5F6IB 2BSRA 1V3LA 3HZVA 3O6FC 5D4QA 1FVCB 3ARFB 4YX2H 4XPHH 1I3RA 5D7IA 1ZHKA 5JLZB 3HUJF 3QWOA 2YKLL 1F11A 3C08L 4L5FH 1MCEA 3CC5B 1JNNL 2R4RH 2ITDA 4M43H 1XR8B 4PIRF 1IC7H 3D3VE 2UZIL 5ESVB 4UQ2B 2F54A 3ARGB 2DL9A 5IVNA 4K23H 3O6FD 4NKQB 4R0LA 3WXVL 4EXKA 4M9PA 2FX9H 3G5XA 4CVZA 4CN6A 4HBCL 1W0WB 4G8GA 5IHZA 4QXWA 5AZEL 5L0QB 2VLRD 1REIA 2H45A 2PXYA 1J1XL 1JHLL 4MNHB 2VDKH 4Y4KA 2BXZA 5F9JA 5EOCJ 5L8JB 4K3JH 2X44D 3MRIA 2DLFL 2OK0L 3RBGA 2FLRT 1N3NA 4WJ5A 4JG0H 5GISL 2UVEA 5CSBA 2AP2A 2HVJB 1KIRB 2R0ZH 4FFVC 1NUDA 4PRHE 1KG0A 1U8MA 3UTSB 4OI9A 1PD6A 4WRLA 5EOCH 1MNUH 4JY6B 3O6KH 4P3DB 3MLWH 1TPXB 2BSRB 4NCC2 1BJMA 4FQLL 4FQXC 1TJIL 3HZVB 4G8FB 4FZEL 5GJSL 9CGTA 3VJ6A 1I9RL 1I3RB 5D7IB 1ZHKB 4FFVD 4WW2C 1F11B 4X4MA 3ZKXB 1VERA 1M7XA 1BF2A 2E27L 5TE4L 2ITDB 4FQ2L 3FKUS 2KBGA 5DT1H 1OCWL 4CN4A 1V7NH 2Q7NA 3OAZH 1BBDL 2F54B 1DR9A 3SDYL 1OOAA 2Z8VC 2XG5A 4FQXD 1OARH 4R0LB 5I30L 1UWGH 4CVZB 3G5XB 1CCZA 4G8GB 4MMZC 1NJ9B 1FN4A 2KL6A 1U93A 3V7AE 2VXUL 1NEUA 1ONQA 3FFCD 2PXYB 3HG1D 5JDJA 4Y4KB 5F9JB 1XCTA 2A74A 2D7PA 4Q2ZA 4DAGL 4F8TA 1HYSC 3MRIB 3FO0H 3OJDA 1A8JH 2B0SL 1N3NB 4G43A 1JE6A 4WJ5B 2DDQH 3SGDI 1IE5A 4OGAC 3BVNA 1CQKA 3LH2H 3OAUL 3HMXH 1KG0B 4RQQA 3UBXB 2PTVA 5T1DH 1U8MB 4E0RA 1N6VA 4XTRC 3KR3H 4P4KC 4YH6A 2A6IA 1ZKAA 1HYSD 2V5SA 2GJJA 4NNYA 3HI5H 1AGCA 1F45A 1RZGA 2DQTL 3W2DL 4OGAD 2DQCH 3VJ6B 5HHXH 4XP1H 1NBQA 4JEGB 5GS2H 4Q9CA 3EBAA 1WEJH 3KYKH 1VACA 4XTRD 2PW2A 4P4KD 4XBEL 3PNWA 2HRPH 4IMKA 1FC2D 4KC3B 4J3SA 3MRNA 1OF2A 1GGBL 4J1UA 3VFWA 4X6DF 4CMHC 3PP4H 4UQ3A 1FN4B 4XWOC 1U93B 3JTSB 5JUEL 1ONQB 1F90L 2Q76A 2QADB 3EOAB 5CIPA 3RFZC 4Y1AD 2A74B 4Q2ZB 4OIAA 2JF1A 4YC2B 2FX7L 2BNQD 3JBG7 3OJDB 3O6ML 1IC5L 3BVNB 3PL6C 2ESVD 1AFVH 4OF0A 2R56H 4XWOD 1CF8H 1QFOA 3VFVA 1BIIB 5I71C 4RQQB 4OCWL 4H1LG 4E0RB 4OQ1A 5KTEH 4GRWF 4P0DA 2A6IB 5ISZA 5CSGA 1EBPA 3SO3C 4S1RL 4NNYB 5IJKA 4R26L 5JW3L 1AGCB 4H26A 1RZGB 1WIOA 3PL6D 3WJLA 3CDYA 4X7EC 4YDLC 1T83A 43C9A 3NZHL 4G7YH 1OP5H 1J7VR 2XWJA 5JHDB 3QQNA 2PW2B 5SWSA 2D9CA 4ZTPL 5T1KD 4CKVX 3PNWB 2GSGA 6FABL 4P3WA 5IBTL 3QDAA 4FTVE 3I3BA 3A6BH 3MRNB 1F6AA 3FMGH 4XNUH 4J1UB 3VFWB 3OAYK 4I3GA 4LPTA 2DQHL 3WSQL 3LQZA 4UQ3B 4FFZL 3HPLA 1CN4A 4RX4D 1A7RL 2Q76B 3QSKB 1MWAL 1YEKL 5CIPB 5JW4Q 1I3VA 1PKQA 2J4WH 1FNSL 2QEJA 2R2CA 2W65A 4ONFH 5C08E 2FDBP 5EPMB 1YMMA 5E8OA 2EDDA 1A7QH 4LMQI 3ZHDA 3QFDB 5D2LE 4XNZC 3ZT6A 3PE9A 5I1GL 2ZUWA 2YXMA 4XPTL 4DUVA 5BW7A 2PCPB 2VLKD 2VXSL 3B9VA 5TDOA 3H9HA 5FO8B 4Y16C 3VFVB 3CJJA 3GRWA 4OM1H 2CK0L 2VAJA 5HGAA 2OXGA 1NGPH 4GMSL 1QHOA 2ORBL 3DMMC 1OAKH 4XP9H 2P8LA 4KKLC 4WDIB 1J0KA 4ZFFA 1K6QH 4Z8FL 4H26B 2XG4A 4NWTH 2BVPA 3DXAE 3MRPB 5FUCE 4NQDA 4MDIB 3WHE0 1I9JL 2V2TA 4Y16D 5LAXA 3CIQA 43C9B 2VDNH 5C07E 1CXHA 2VNCA 2XWJB 5C7XH 4O4YL 4HKXB 5DJDA 3MXVH 3DMMD 2NY0C 2GSGB 3ALWA 3VD5A 3KPOA 1OGAE 3RVXC 1YEIH 4FXLA 3STLA 4KKLD 1YJDC 2ED7A 5DEFA 4HXBH 3HTLX 4JO4H 3FZUC 1F6AB 2GIYA 4X7DC 3F5WA 3LQZB 5E99H 3GKZA 3EO1A 4X9IA 5IESH 3HPLB 4LCWA 4N8CL 3F7RA 2NY0D 4OZFA 1PKQB 3TBVA 5DMKA 2W65B 3BAEH 4KQ4L 3RVXD 1YMMB 4NO2A 5E8OB 5E8NA 3RVVC 4D0BA 3FZUD 1W8NA 4YHPA 3JV4A 1JL8A 2OSLA 1X3DA 4NO3A 5TDOB 1JFQL 4LPVA 5D1QA 1DBKH 3H9HB 1V3MA 1UYWL 3V95A 4ZTOH 5HGAB 2EE6A 1NCDH 3T2PA 2APBA 5EU4A 3C5ZC 1IGJA 4ZPTA 1S7XA 1N5AA 1HK6A 4JCMA 4UBDC 1U3HC 5LCVH 3RVVD 5JMOC 2P8LB 4P46C 4ZFFB 1FLRL 1F4YH 4OZHF 2ZUUA 4NQDB 2B8OT 3U6RB 3V7MA 2V2TB 5LAXB 2VR4A 2CR6A 5DJDB 3C5ZD 3QHFH 2R9HC 4UBDD 1U3HD 2CMRL 3KPOB 2EXYC 1J5OH 3STLB 4P46D 1QSED 4AMKH 4NKMA 4ZFOL 1CL7H 1R5IA 3LZFL 3Q6GL 5DEFB 3ZLQC 3MRMA 5DQ9A 3F5WB 5IVOA 3CZFA 5JW4R 1SM3H 2VLLA 4LCWB 3S98A 5CMAA 2F8XC 2R9HD 4LAQH 4OZFB 3TBVB 5JIIA 5DMKB 2EXYD 3MZGB 1KBGH 4NO2B 4U7MA 5E8NB 2HJFA 3U7WL 4D0BB 1U6AH 5C0BE 5E6ZA 5KOMC 3DYOA 4YHPB 1HXYA 3RNKA 2D7MA 3PJSA 4TSAH 3PV6A 4NO3B 2VH5H 4GOSA 2OJZL 5D1QB 5L88H 2QR0B 5CP3H 4YDVA 2KUTA 1CDUA 1OVZA 2JLLA 1HCVA 2C3HA 2A73A 1NH6A 2LE9A 4LSSH 4P49A 5EU4B 1IGJB 4ZPTB 5MENB 5F7YC 1S7XB 1N5AB 2YR3A 1MLCA 3U4AA 3BH9A 1LE5A 4LF3A 4QF1A 3DLQR 1YEHL 1NLDL 5D72H 5C70A 3QEUA 4PGEA 3DIFA 4N9OB 3MBXH 4Z7UA 3TA3C 4PJFA 3D39D 1TJHH 5EO1A 3CSYA 4M6AA 4TVSa 4PGCA 1MI5D 4TVPE 4HH8A 2UY7A 4NKMB 2FR4A 1R5IB 3OX8A 1J87A 4F2MA 3GSWB 2P46B 4LDLB 3MRMB 4WUKH 4H0IA 5BRZB 3CZFB 2DQGH 4X6CF 1ND0A 5DUPL 5DJZA 5E7BA 5CMAB 4JGUA 3TA3D 3QB7C 3RDTB 2R2EB 2ZUVA 3FRPG 1C1EH 3DRTA 2HJFB 4FMFA 3RGHA 4QRRA 4YNYB 3ARBC 3JV0A 4XC3L 1HXYB 5CP7B 3RNKB 3PV6B 5ILTL 4Q6IA 4YDVB 1M7DA 2W9DH 3UTSE 1H3WM 4BZ2L 1XGUA 2BVUA 1A6WH 3VGFA 3TZVB 3OKEA 3QEQD 3BH9B 5DVOA 3IRPX 5MEOA 2EICA 3CDGA 3ARBD 1WTGT 1LE5B 4LF3B 4QF1B 2YD9A 3ARRA 5D7IE 2CRIA 3L3HA 35C8H 4TVPH 3RWDA 3ORJA 3QEUB 3H3PH 1AD0A 1PYWA 1F3RB 5EA0L 2FHBA 3DIFB 2YD1A 2YPVL 4M6ML 4LSRH 5C2BL 4Z7UB 2OTUA 3L5HA 4PJFB 4V2CB 4XVUC 3TESA 3VWKA 3CSYB 4PGCB 4NC1C 4HC1A 2FJFA 2F54E 4XMPH 4NQXA 5FGSA 2FR4B 3NCFB 1IM3A 4GO6B 4NWUL 3QG6A 4F2MB 1YEGH 1CLZL 4AY0A 1ZLSL 3PWLA 3W0WD 5KSVA 4N0CC 5HBBA 1ND0B 5DJZB 4LRIC 4MNGA 5I74B 4XVUD 4QWWC 4V2BA 3QULA 3S3JA 5JXAL 4HGKC 2QQKH 3DRTB 1E4XH 3CMOL 4DFIA 4QRRB 4PJDF 2WK2A 1JTOA 3PHQA 1OT1A 3T3PF 1BD2A 3GK8H 2CJUH 2A38A 4ALAL 4Q6IB 1B0WA 4ODTH 1M7DB 4N0CD 4KTEH 4LLQA 4K3HA 4ZS7H 4ONGH 1BGXH 1FG2B 1NFDF 4QWWD 3ZO0A 3OKEB 2X1WL 3CDGB 4WFFD 4D3CL 2CLVA 4C54A 3L3HB 1LP9F 3HFML 4J6RH 1LD9A 4HKBA 4X4ME 4AEHL 3QXAB 3VI3E 1AD0B 1PYWB 3STZA 2OTUB 3FOLA 3O45A 3VWKB 4JFEA 4LASH 4UILH 1UJ3A 5JW5A 1L4IA 2FJFB 2DQDH 1J0JA 4NJAH 2XQYK 3Q3GA 5EUKA 1IM3B 4JGJA 2JE8A 2QQLL 3DECA 3QG6B 4UIKL 2GI7A 2NLJA 4KH2A 2F19L 1T22A 2DRUA 3PWLB 5KSVB 1MCSA 3GZKA