1A5FH

Fab fragment of a monoclonal anti-e-selectin antibody
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
217
structure length
212
Chain Sequence
EVALQQSGAELVKPGASVKLSCAASGFTIKDAYMHWVKQKPEQGLEWIGRIDSGSSNTNYDPTFKGKATITADDSSNTAYLQMSSLTSEDTAVYYCARVYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVSVPTSTETVTCNVAHAPSSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTI-E-SELECTIN 7A9 ANTIBODY (LIGHT CHAIN)
publication title Primary and tertiary structures of the Fab fragment of a monoclonal anti-E-selectin 7A9 antibody that inhibits neutrophil attachment to endothelial cells.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 35
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 1998-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a5fH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a5fH02
3G08A 3ZZ1A 3CMGA 3K0WA 5TF0A 1TZIB 4KK5C 1S78D 3X13A 2IPUK 3X14A 4QOKE 1T3FB 4LASL 4JPWH 1N5YL 4OLZL 5D1QA 1KN4H 3C5SA 1TJIH 3D69A 5ETUB 4RX4A 4K7FB 5DVNA 1IARB 2LU7A 3TV3H 2H32H 4UQ3A 4YHPB 2CLRA 4ONGL 3SDCC 1QPXA 1TQBC 1B0GA 5C0EA 3ZKND 7CGTA 2JJUA 4BQCA 2OK0H 1A3LH 5E8DL 4J2XA 5FYKU 2IALB 4JZOA 5MP6H 5IR1B 2E8YA 4IRJC 4L4VB 5H2BA 1JTTA 2VLKA 2FEEI 1KGCD 3PL6A 4E0RA 1BFSA 4CVUA 1NFDF 4X7FC 4G80A 5JO5A 2IG2L 2MKWA 5C07E 3ET9F 1Q9OA 5C08A 1GIGH 4D9QE 4ENEC 3IF1B 3EYOA 4LEXL 4N0UA 4Y19B 2BOCA 3UPRB 3QUKA 4LHQB 3C8DA 4YR6A 4PG9A 5C0IB 4DCQB 3VXUB 5C0GA 5TF1L 1HK6A 3H9SE 3WIFA 1MFBH 3SY0B 1ZA3B 1J0ZA 3RWEB 4LP5A 4MNQE 1WBXA 3HC0A 3QPXH 4RWYH 5JXED 2Y06H 4ZQKA 4OM1L 2CUIA 3RY5A 3QXAB 4LCWB 1UWXH 5JHLL 3QB7C 5FYJE 1LHZA 1JHTB 4OD1L 2DLEA 3WE6A 1ITCA 1YEKH 3U30B 4KK6D 2BP3A 2HYMA 3BH8B 4D0CA 4G6FD 1A7QL 1KFAH 4Y2DA 4PD4K 3RZCC 3M17A 3TPKA 4M02A 3MUGB 2UY7A 1MF2H 3K7UA 3JXAA 3WJLA 1KIRA 4KKAD 4CJ1A 3HI5H 5ITBL 2FX8L 3I6GB 5IVXB 3HZYA 3MLVH 1NAKL 3T65A 1AD9A 1S7WA 1QSEA 1EXUB 5CUSL 3QUMB 2EO1A 4BH8B 4XP6H 1N64H 4UB0H 5GRJL 3IU4L 4Q9BA 3VXPA 4KAQH 3BKJL 1BLNA 2VLRE 5EO1B 1DSFL 1OAZL 2YBRA 1GC1C 1H3XA 1T2QH 1YEDA 2QADD 4PG2A 3WIHL 4ZUUB 3F7PC 3E2HB 4WY7L 2CPCA 3QQ4B 2IQ9H 2YK1L 1P7KB 3V4VH 1JZ3A 3STZB 3WFDL 1RZJH 3VMOA 5IMLA 4HLZH 1QR4A 2H2PD 1NEZA 4Y4FA 5JXAH 5D5MF 2GEEA 4LHUA 4LVHB 4GBXD 4BELD 5J7CC 4N1CA 3GFUA 3IFOA 2J4WH 4YHLL 4P4KA 1E4XL 3GGWB 3VGGA 15C8H 3W0WE 1HHKA 3PQYD 1IFHH 1XF5B 2IPUG 4KK9D 5T3ZL 3U7YL 2R29H 3C8KB 2NY5C 1NSNL 4HZLB 1XMWA 1QLEL 5CILL 4QOKA 5FDYA 2NXYC 4YHZL 2PCPB 3QDMA 3GJFB 3BUTA 3I50H 4HUUB 1XF1A 4UV7H 4OZGB 4ODWA 4EDXA 3VXQB 1TVHB 5DK2A 5HDBE 4PREA 2I9LB 2QQNH 4OZIF 5B39B 4X5LA 5ANMB 1NCAH 3GBMH 3N1FC 4KKCC 4DGYL 4ORZC 2CK0H 3WKML 3ARZA 1QG3A 2BSRB 4OZFA 4HIEA 1Z5LB 1KSRA 4APQA 4M6OL 3FZUD 2Q8BL 5MEPA 3M07A 2LV4A 2OX5A 1CXKA 1YJDL 5C07A 1R3KA 4LKXA 4MHHI 1MJUH 1DE4B 4DW2H 4L4TE 4ZOAA 3TWCL 3GIZL 3UPCA 2HG5A 3SPVB 4X4YB 5GS2H 3H9SA 3QEGH 1NGZB 3CFJA 4TRPH 1TENA 5IOPB 4L9DA 4PUBH 3QPQD 1PX4A 1AO7A 1MPAH 4OGXH 5CIPH 1U8JB 5E2VH 5I8EA 1ZHNB 1L7IH 3AB0C 2H2SC 2RR3A 2X05A 1RPQA 4N0FB 1C12B 1ZT7B 1IAMA 4JR9L 4F7EB 3KPRE 3SDDD 4L8CB 1CLOL 3STLA 3H6JA 2APVA 3C5ZD 5DQDH 4RIRB 1FFPA 4KI1A 4WFHE 3MRCB 4G8GD 3FO2A 1JP5A 1WZMA 2NY3B 2WWMD 4W6XB 1G7JA 3QQNA 3Q5TA 4NQTA 4A6YB 1U8OA 2HH0L 4MHHG 3PWVA 4JFHE 3QNXA 1FNLA 4RDQF 3H0TA 3ULVH 4FZEL 1A3RL 1J05B 5M94B 1D5MA 3WDIA 5MEQB 3R0MA 4HFWB 1GOHA 2AK4E 1RHFA 4OIIH 1INEH 2VOTA 1G0DA 4P5MB 4Z7NF 3H7BA 3GIVA 3R8BB 2G75A 4NM8L 5I19L 2VLRA 2A6IA 1KXVC 3ARGD 1D6EB 4U0RC 5IB2B 2ATPA 1EO5A 3VFSB 4ZOCA 2M1KA 4POZC 4TNVF 1SHMA 1E6OL 2OTWB 4OV5B 5JMRA 1ULVA 5IB4A 3TN0B 2NY2C 2ZSWA 1JF1A 4ODSL 1T03L 4KROB 3LIZH 4HJJL 4OFDA 5CD3B 1MLCB 3PL6C 2VABB 4FTVE 3ZDXF 4P2QE 4LLVB 2B4CC 5GRXG 5E9DE 1YC7A 3RBGA 5CCKH 5FF6B 1GZPB 4RQQB 2GFBA 1M4KA 1CICD 2Y07H 4TSAL 3O2WH 3LKSA 5CINL 2OLDA 3ZHKA 1FL5B 1F6FB 3D0LA 4UT9L 4PLJD 1M1SA 1DBJL 4WW2B 4Z7UF 1JRHH 5I75C 4R3SB 5MHSD 4NSKB 4NKOB 5EOCL 5KJRH 4IJ3C 5FHAH 3I3DA 3KYKH 2V2XA 4JY4B 1IL1B 1NEZG 4ZG1A 5IKCA 4H1LH 4XWOC 1WITA 3EO0B 4LHUG 4NNYB 4EOWH 4BK5A 3HR5A 3AY4A 5KW9H 4L3EB 2IFFL 4DEPC 2ED8A 5ITFB 2ICCA 3QEQE 4FFWD 4PP1D 4Q6IA 4GW4A 1R0AL 5EO0B 5C1MB 3CZFB 4L4TA 4OZIE 2ZKHH 3WJLC 2G2RA 3KR3L 4XCCL 1JFQL 3QA3B 2QSCH 5D7SH 3KXFD 3MV7E 4Y1AD 4TNWF 1QBLH 1OAXH 1L6XA 4BQ6A 4MS8C 1K85A 2F53D 3MRRB 3WO4C 1U91A 1S3KH 3WFBH 1NPUA 4WV1B 2BVYA 5D1ZB 5DA0B 4OZFG 3KPRA 2Z35B 4PG2C 4BSVA 5CZXD 1IZJA 1U36A 3CDGB 3HE7D 3TCXA 3CMOL 4WDIA 3BP5A 5D2LF 5JQ6L 1JYWA 5C7XH 1D5BA 4NOBA 3SGDH 4FZ8H 4XNXL 3VFUB 3BPCA 2ERJC 4YBQD 1ZLUK 4N8VA 3RA7L 5LXGH 4KTEH 5EBLB 2RAMA 2PO6D 9CGTA 2RJMA 1LE5A 5C0BD 1YYLH 3TIEA 5DS8A 2VZ3A 4P4KC 3O11B 4MB3A 3JTSB 4NO2B 1TTGA 1RZ8A 2FJFB 2B8OT 3WNLA 2AK4A 4PY7A 2W59A 2YUWA 1JMXA 3VWKD 4FQQA 3TJHC 2R0ZH 2FBJL 4YGAB 4FOMA 4D9LH 1S9VB 4KY1L 3PWJA 3NH7H 1IGIL 3ARBB 1R24B 1AJ7H 5D7JA 3PXJA 1F11B 1J10A 3MOAL 5J1AA 3BD5A 5D1XB 3VGAB 4BK4A 4XAWH 2A2QT 1A7RL 2VR9A 3GMNA 4NUGH 1RURL 1NLDL 4IIQB 2JB6A 4UV4L 3X12B 3EFDH 5JHDE 5DQJB 4PGDA 5GRWA 3Q48A 5IHUL 1OM3H 4M48L 1XF2B 4XBEH 3S35H 3LKQB 2XQYK 2X44D 1H3GA 1HHIB 3VFNB 4TTGA 4CN6A 4EJ1C 4Z7NE 5HYSA 3VDAA 5FECB 3HAEH 3HG1A 4FTVA 3I75B 2M8XA 2Q3AA 4P2QA 3VCLA 5E9DA 2Q76B 2PUQT 5FO7A 3MRQB 5D70L 3WL9A 1KN4L 4HWBA 4NCDA 2AK1H 5I1JH 4G6MH 4QGYA 3TV3L 1I1AA 3C60C 3T4YB 3FO1A 4CAGA 4XP5L 2RB8A 1C16A 2HWZH 2IANB 1DN0A 1GGBL 5EUOF 4PRAA 4G7YH 1CD8A 5C0NC 1JGLL 5ICZB 1A3LL 2OK0L 3O8XD 4IOSD 1G6RH 2YRLA 4G42A 3S96A 3WFHA 4Z78A 1NKOA 2FYYB 5B8CC 1YY9D 4DTGH 4HFUH 3GMQA 5HHPB 1JWSA 2NW2B 4P3DA 5TDNB 5HDLA 2IADB 3DX8B 4JGMA 3AU1B 1GIGL 2DKSA 1T89A 1JPGB 4XB7A 4LLWB 1EX0A 4M3KB 5E5UB 3RWJB 5IMKB 2NY0B 4YIQA 3NGBC 4Z7UE 1VFAB 4NKIH 1FLTX 4I0PD 2YC1A 3ARDD 1XAUA 5DC0A 4OZIA 3EKCA 3EZ8A 4RWYL 3FFDB 1BECA 2Y06L 5AG9A 2EYRB 5DHVH 4B50A 3MRFB 3MV7A 3INUH 2BVOA 4IOFC 3K4ZA 3S36L 3WDJA 4X99A 3TO4A 1YEKL 4WO4D 1BZQK 1IGTB 2FIKA 1R5IA 4JRYD 1MRCH 1T7YA 3LS5H 2RBLA 4PRPD 1FO0H 4QLRA 2I27N 2R1XB 1ZSDA 3OAYK 1ZT4B 4NKMA 3TBVA 1PG7X 4LGRB 1MF2L 1KCKA 3RGVA 2D03L 4NBYB 5JA8B 1SEBA 2Y5EA 1I1FA 3HI5L 3BESR 1V7NH 3ZTNL 3H2WA 2EIBA 3MJ7A 5IW1A 1A7NL 2BDNL 3T2NH 2ESVD 4Q0XL 4P0DA 5D96B 4I77L 2MNUA 1VDGA 4LKCA 1TZHB 4AEIH 2QHLA 4UB0L 5D7LD 4N8CH 3L5JA 4NN5B 3VA6A 1JF5A 4KAQL 3NN8A 4JREB 4X98B 1KC5H 1UENA 4H8WH 2FDBP 4FABL 4XNQB 3SE4A 5F9JB 5J13C 2E6QA 1T2QL 1MCQA 3EUUA 3LPFA 5D2LE 1TPXC 4LLYA 1BFOA 1J88A 5IGXH 1BVKA 1NCBH 2IQ9L 5E1HB 4WU7A 3V4VL 4XCNA 1CDUA 2GSIA 2UZXB 1MCWW 4BYHA 3FCTB 5DJXA 3IXTB 3LMJL 5JXAL 4X6FB 4XNZB 5BJTB 2AV1B 3QT2A 1QLRA 4ONFH 4E41E 2XZAH 3BMVA 5JHDA 2XQYG 2YEZB 4Z7OE 3BZFB 4ZXBD 4OSUH 5AUMB 1TCMA 4N8VG 5HHVH 1IM9B 1PKQB 2R29L 2R39A 4HV8A 1FNHA 1C5BH 2IQAB 3F65A 4RX4D 4HKZA 5IM7B 5T1KA 3GSXA 3I50L 5TGBA 4TPRL 2JIXA 3RX7A 2ZG1A 4KTDH 3U0PB 4UV7L 1F5WA 3IYLW 3JWDC 4NQUA 5F96H 1LD9B 5A16B 5BVJA 5A3IC 3MA7B 3RTQB 4XNUH 3S37X 1XF3A 1NCAL 5IEKA 4XC1H 4UDUA 3MNZB 2P46B 4OAWB 4XCYA 5DK3A 1P2CB 3QQ9C 4PGBA 4OCLC 5GRYA 2NY6D 4BZYA 2B7DT 1MJUL 2DJ4A 5HYSG 3TF7C 5DVLA 3GSRB 5DQ9B 2D9QB 1WBYA 3IKCB 2X4TB 3DV4B 4CUCA 4AZ8A 3QEGL 4Z7UA 4HIHB 3F7VB 2DYPD 3VG0H 5ISZE 1RIUH 3ROOB 4TNVK 1MVUA 1Q9KA 5B4MC 1LVEA 1L7IL 4NRYA 1G7IA 2Z31C 2C1OA 4GRMA 4WENB 4JAMA 3LPWA 1JIBA 1NLBL 4Y2DD 3IDJA 1GZQA 1ZWIB 4N0RA 5DQDL 4HUXA 3FOMB 1IC1A 2OZ4H 4QRTB 2GTZA 3CFCH 2J8HA 1UACL 1KTDB 1MHHA 3SGKA 3W39A 1IEAB 3VRLE 1NGWB 2PXYD 5J3HC 4FFYL 1HQRA 3GBLA 3S3SA 1O5DT 2WINB 4QCIB 3LCYA 4OIIL 2NCMA 3QG6A 5E6IA 1JV5A 1CFBA 4Y5XA 1KCUH 1FYTB 2DQIL 1NANI 3MRLA 4NQSB 2GITB 2HFEB 3CIQA 3DSNA 4J1UA 3WLWC 3E3QE 3BH9B 5DMJB 4S1RH 3RJQB 3IDYC 4WI7A 2E27H 3FQUB 5B38A 4YWGH 1U3HB 5J56B 3TVMB 1GC1H 2OP4L 3MRNB 1OP5H 5D2LA 3T0EC 4LPXA 4X80H 4AEHL 4MDIA 4QHNB 2EDKA 1P7QD 4U1SA 1IMHC 1P69B 1OTUC 4Y4FD 1JGVH 3C6SA 2I60L 2COQA 1MI5A 1Q94B 3PGFL 5KSBF 2V5MA 5ALCH 3UPAA 3MUZ1 1XT5A 5IROA 3LIZL 2BVQB 3BGMA 1RUPH 4HS6A 4XXDA 3TEUA 4DAGH 5GISL 3I02A 3HR6A 4TNWK 4MDJB 5IB1A 2QR0B 2J6EA 4JJ5A 3QWQB 3V6BR 1PG7H 1T89C 1NBVL 4HIJA 1DLHB 3S5LB 2VMFA 1FL3B 2OMBA 5FOBA 3BQUC 2OR9H 2C9AA 4KZEL 2OSLA 1MWAH 3EOAA 5DFTA 4BZ2H 1UXSB 1OHQA 3FB6A 2JJWA 3SE9H 5MENE 5J9PB 2CR3A 2A77L 1AHWB 4M1CC 5AZ2H 5AZEH 5KJRL 5FHAL 1RV6X 3VXOB 1AQDA 4APQD 1B2WL 1I4FA 1BQHB 1PFCA 3MCLL 4RDQG 5I9QB 5E08H 1NAMH 5C07D 4EOWL 2Q3ZA 3SO3C 3B83A 4D9QD 3QDGB 1Z9MA 5CHNA 5EULV 3L95B 1J7VR 1UZ6F 2H32B 2R2BA 4RGOL 2W9DH 5I76B 5EO9A 4U1IB 5EUOA 1D3CA 5JDSB 2PYED 2YSSB 2QSCL 5KS9F 4TQEH 4MNQD 3VG9C 3SHSA 5DSCA 3CVHA 2LE9A 3NCBB 4CVXB 1RUQL 5ISZA 3WEXA 5I15L 1GXEA 3F12A 5FYJD 3W9EA 2E7CA 3RHWF 1DQJA 3GHBH 1S3KL 3HMXL 5LCVL 3WFBL 5GGSY 5GIRB 1G9NL 3IDIB 4NOFA 3OKMA 1KLFA 3ZDZF 3ZKXB 3PWLB 3NZ8A 1KELH 2EDQA 1R3HB 3ETBF 5FUCE 1ZE3C 1F3JA 4NRXB 1J1XH 1MCLA 4JPKH 1I3VA 4X5WA 5ABDE 3S37H 3HTLX 3KLHC 4XTRD 1PX3A 1Q9LB 1DR9A 1TJGH 4PJ8A 3HZKA 4FXGA 1IAOB 4WGWB 5C7XL 3HHRB 5I1GH 4HG4J 4FZ8L 4X83A 1OAUL 4Y16D 3U6RA 4X9IA 1OPGL 1KG0B 3GK8H 4LDLB 1S9XB 4QWWD 2DQCH 3CD4A 1YYLL 5TDOA 2CKBA 2RHEA 1FVDA 2ZUYA 3I6KB 4TUKL 5DWUH 4P2OA 3RVXD 2MSPA 2X9XA 1JWUA 4E42A 3HE6A 1JGUL 2EZ0C 5F6HI 4XCFH 1G7HA 2BHUA 2ZCKH 2HN7B 2ZUSA 3BYYA 4N5EC 4ZAKB 1DUYA 1FC2D 1H9VA 4XX1G 4JRWA 3NCMA 1HOCA 2AJUH 1AJ7L 3B6SB 5TE6H 2VC2L 3KS0H 4B7LA 4XAWL 4PB0L 4LSQH 4Y4KA 1Q38A 3MLWL 2DQEH 4FQCL 3OXSB 3U2SA 4YDVA 4QHLA 5IVZA 5HYQA 4M1GL 1IAIH 1CTOA 1Q0YH 1MCRA 1TDQA 3ROLA 2V5SA 1OM3L 3RL2B 5HPMA 3E6HB 4XVTH 3W0WD 1P4IH 4G8EB 5CLTA 1ZLSH 1AKJB 3VFPA 3OKDB 3EO9H 3L3GB 1KB5A 1G1YA 3HPLB 4M62H 5DRNB 1BWMA 2H9GB 2AK1L 4GBXC 4G6ML 3LOWA 5I1JL 4NYLB 2W60A 3O0RH 2WAHA 1FG9C 3HN3A 3QCTH 5ADOL 4JFED 4KK9C 5JORA 3AS3A 3HI6H 2XPGB 5B38G 2YWYA 2R1WB 4BQ8A 2ZOKA 2XZZA 4QKXB 5MENA 4WEMB 5DGQA 1E27A 4P2RE 4HFUL 3PIQA 4UDTA 3NIDF 3ZKMC 4JFDE 3FB8B 2OTUB 3C6LB 5C92A 2R9HC 5DT1L 2UZYB 3RWDA 3QULA 4XHJD 4JANA 2V17L 4NKIL 3GMRA 4G3YH 2HVJA 5INDB 1YEJH 2MKLC 3PJSA 4R9HA 1I3UA 3LN5A 1VEMA 1KT2A 5D8JH 5F1OB 2FHBA 5HHNA 3WXWH 4GMSH 2RCSH 4G9FB 1FJ1B 2EDRA 1BHGA 2ZJSL 5E6IC 4Y5XC 4K3DL 4WHTB 4F57L 2LAGB 4CBPA 1QACA 3N0PB 3BYTA 4N90D 1GGYA 2OR7A 3LS5L 4KKLD 1KNOB 3EAKA 4JHBA 2NW3B 1QBBA 2BVPB 1RUML 3UDWC 5AWNL 3FN0H 5BOPA 3QI9A 1QQDB 3Q6FB 1RK0A 1N5AA 1NGPH 3OKEA 1CVRA 5I2IA 4JFHD 5C70A 4MA1C 1CFTB 1HWGB 5KG9B 2RFXB 1F3RB 3T2NL 1AH1A 3HMWH 5CIPB 3C5JA 2V7HA 3TNMA 2AK4D 2XY2A 1XGQA 5T1LA 5KZCB 4JM4L 1RJLA 3TYGH 2X40A 4OIAA 3WV0A 1NCBL 4UUJB 1X5ZA 1KPVA 1A02N 1IVLA 1QD0A 4Y5YB 4UBDC 5F44A 4MJ5A 3QDHA 2NY4D 5IFAH 4OUUB 5DEGA 4F9LC 2R0WH 4WTZG 4ONFL 4QRSA 2XNAA 4GJTB 1NDMA 2A6DB 3V7MA 2C4FT 3QIBA 4GXVL 3OX8A 4FTVD 4OSUL 1CLZH 4KRMB 1NCCH 5E9DD 5T3XD 4LCWE 4LNRB 1A1MA 1RZIA 3P73B 4KQ4H 4O58H 3CX2A 5K9JL 1C5BL 2XA3A 4OZFH 3GKWH 4XVJH 1W72H 1AP2A 1E4KA 5F3BA 3CFBB 4KTDL 3MREB 4I2XB 5F96L 2A74B 2E9BA 3S9DB 4HDIB 3VFMB 2A1WH 1BJ8A 1JVKA 3H3PL 3R0NA 2DBLH 3BKMH 4NFBA 4MQ7A 1JHLH 1TETL 2DLGA 3D25B 3K46A 1KTKE 3MV8E 4XC1L 1VFBB 3RZWA 4ZSOB 1NJ9B 4O51B 5IW6A 2XQBL 3KPSB 3LEXB 4R8WH 5DUBA 3L6FB 4P2RA 3O45A 2J12B 4JFDA 1CXIA 4QF1B 5FYJH 4WWKA 4OCXH 1PQZA 1IAIM 4XCEB 3QEQD 3G5YA 2YUVA 5AYQA 4LDEB 1D9KD 3DI2B 3QIWD 3LN9A 3KLAA 4MLSA 4PJ8C 4GFTB 3V52H 3OKOB 2BNQD 3VG0L 2D2OA 1LEKB 3MRGB 4PJFF 2CJUH 5I1IH 3MV7D 1UEYA 3WUWA 1ZT1B 2JJVA 3NIDE 4ZUWA 3TO4D 4ZFZB 2OQJB 4F80A 5I1KL 3O4OB 3EYUH 4H1LB 3BW9A 3HE6C 4OF3A 1FL6B 1K4DA 4R90L 1K3ZA 4U6HB 3VWJA 4XZUA 1U8QA 2FO1A 1BREA 4MD4B 4PJ5B 2HFFB 3E3QC 2E7MA 1WEJH 5SWQB 5KVEL 3CFCL 3RGVD 2A38A 4FXKB 4MQXC 4I18B 4KQ3L 4ZD3L 5EPMB 5EIVA 1LP9F 1BGXL 1I85C 3B8SA 4S1DC 5KS9A 5IBLC 4Z6AT 5I73B 4QXWA 1BVZA 1HQ4A 4G7VH 4K23H 1D5ZB 1T83A 4HS8H 5CZXC 4J8RB 5F88A 1FE8L 5DR5H 1H8OA 3P4OB 4ZO6A 3UROR 1OQXA 5JW3L 1Q1JL 4ELKA 4W4OC 3T3PF 1ZHLA 4S1RL 3TNNA 2E27L 4F8TA 4GLRH 1G9EA 2X4QA 2ZG3A 4MXWH 4HS3B 2DBJA 4YWGL 4O2FB 4MCYA 1EEQA 1GC1L 3IDMA 5GGVH 1KLUB 2XI9A 3KPNB 2P8PB 1IGMH 5EOTA 3T1FB 3ULSA 2QADB 1JGVL 4EQ3A 3BEVB 3Q6GH 3J8F7 1RIHH 3FHAA 3AAZA 3IDGB 1IC7H 3I3BA 2DS4A 3MRHA 3BPOB 1X5XA 2QQQA 5JIKA 4R2GB 2WUBH 2YWZA 3B8YA 5EIQA 1QKZH 3OQ3B 3KYAA 3O9WA 4W81A 1BBDL 2EC9U 2FEEL 2HTKD 1D5IH 3D2UA 1VGKA 4UOW0 1PG7L 1ZLWK 3EFFB 2QSQA 1WSST 2Y23A 3OKYA 4K7PH 1UJ3B 4RGNE 2JIXD 2X1QA 5ECJE 3TCLA 4CADB 1IKNA 1MUJB 2NY5L 3MLTA 3WLBB 2FX9L 1YEIH 2A0LD 4XAKE 4BZ2L 1MAJA 5DMGC 5JPMB 1ACYH 4M5YH 3MLZH 3V5KA 1PLGH 4RCAA 3KNBA 3CFDA 1YC8A 3VW3L 1SYVA 3O41B 4HGKC 2CRYA 5AZEL 3MUGA 3U4BH 1KCSL 3MV8A 1FDLH 5A40E 5DJ0A 2LAAA 3H3KA 3HAEB 4R4FH 5HI4D 3WXVH 1X6LA 3IVKB 4MXQD 4JN2B 2GJ6A 1CLYH 5FA4B 5IW3A 2YS4A 2ID5A 3BZEB 4KRNA 3BAEL 3QIUD 3HPJA 4YHOH 1OAYL 3MV9D 3MYJB 4N5UA 3QI9C 1JPSH 3VDCA 35C8H 2WQ8A 1FNEB 2G5BA 1BM3L 3FO0H 4LL9A 3U0TA 4X5XA 1T04A 1HSAA 1G6RB 4CU6A 3JV0A 1RUAL 3AXLA 1FV1A 1NMCB 1P7KA 3L5IA 4M5ZH 1K5NB 4JB9H 3GHBL 2P1YA 2IBZY 4M7JH 4X4ME 1N6UA 2EIDA 1WIPA 2F5AH 1N4XH 4BFIA 1KELL 3NCFB 3RNQB 1AXTH 3QNZB 1J1XL 1L0XA 3QUXB 4KJWC 4EBQL 4JPKL 1R3LB 3MBEB 5HHME 1EHNA 3N9GH 4XH2B 3GSUA 3S37L 4NKDB 2BVEA 4ZO7A 1TJGL 3PNWB 4WO4C 3C8KA 2XKSA 5CEZE 5DMIL 2F54E 3C5ZB 1WVZA 3TZVC 1MLBB 4G8GB 5GJTH 1MRDL 1S8DA 2R0LL 4NP4H 4ZNCD 3K8KA 1EHAA 2DQCL 5DHVB 4HKXA 2CDFA 4C55A 2VN4A 4V1DB 4YZFF 2V2TB 2J88H 5JUEH 2EYSA 3GRWA 4XBPA 5F1NA 5DWUL 3VXMB 2ENSA 2QHRH 4HCRL 3UX9B 3WUWG 2FX7L 4XCFL 5GGTL 4CMHC 4FQHB 3BISA 1HHGB 1FO0B 2PYFA 2C26A 3CSGA 2BSRA 1LP9E 1E4KC 1OP3H 4KZDL 3FT2A 3REVA 4P5TD 3SDAD 4RRPA 3GBNH 4L3EE 4HWBH 3PGCB 3TBSA 1PJ9A 5FK9A 3VH8A 5DI8B 1MNUL 3S6CA 1JCKA 3UTOA 1T1YA 4JM2D 3LRSA 2AJYL 2EXYD 2VL5A 2JELH 1T5XB 4NQEE 4E41D 4P46A 1LDSA 1IGJB 1P4IL 1A7OH 1JK8B 3OGCB 5DTFB 3AREA 5EZJB 5HI5C 1S7VB 3EO9L 4I1NB 2FGWH 5FB8B 3PHOA 5CJXC 2B4CL 1CBVL 1WUNT 4WWKC 1T7XA 1RHHA 1ZT7A 5JOFB 4MGXA 1KJ2L 4ZXBC 1Q9WB 3QCTL 2ICWI 1CICB 4L5FH 3CZJA 3JUZA 3HI6L 1YNKL 4M9PA 4W6WB 5HHQB 4JDTL 1WLHA 5IMMB 1AGEA 4FFVD 5IQ9A 4JLRA 3SGEI 4NJ9L 4LIQE 2DLFH 3SCMD 4M7ZB 3D85A 5KN5B 4A6YA 3OKLA 1I8KA 3SJVA 5EWIL 4KV5F 4U0QB 3VXNA 1FNSH 4LVNB 2HJFB 2PN5A 3MGOB 2H26A 5FHBH 3OJDB 1MFCH 2XWJB 5T1MB 1OGAE 4KRPC 4U7SA 2FLRT 3VWJC 5C0FB 4UTAH 2H1PL 4KMLB 5IJVB 2MWCA 4RMUA 5EN2A 1QRNB 1DEDA 2DM7A 4G3YL 1YEJL 1V7MH 2DKUA 2UVEA 1CF8H 4FHBD 1RZ7H 1KCRL 5D8JL 1Z3GH 4F2MB 4TVPL 3D1MC 2AQ2A 5ISZD 3MRDB 4L8SC 4LLMB 3SDCB 3OHXB 1TQBB 4ZYKB 3U4EB 4NCC1 5IB2A 1ONQB 4GMSL 4PJDB 5D2NE 3P30H 4UU9B 3NFPB 1I1RA 3GSVA 4IRJB 5FGSA 4Y1AB 3TN0A 2FD6H 3D3VE 3RVTC 5H94B 2P8MA 4X4MA 5CMAB 1A9EB 1HCVA 3U48A 3EBAA 8CGTA 2GTWA 3BKYH 1ES0B 1KJ3H 1PY4A 3FN0L 5FF6A 1PZUB 1GZPA 1R5VB 4JCMA 1IBGL 4OCWL 3MRKB 2OL3A 1NGPL 4FMKA 1DBAH 4ZTOH 5F9OL 2XA8H 1MAMH 1A14H 1CR9H 2F54A 2QBWA 3B9VA 3O3DA 1NUDA 2IANE 4X6DF 1FL5A 1A0QL 3V7AE 4GKNA 4P2OD 3EO1A 4EUPG 2CO7B 1A21A 2BNUB 3ZYJA 2VDOL 4LMQI 3ECBA 4RAVB 1KOAA 1OSPH 4YEFA 2PO6B 3QHFH 1BD2E 1I7UB 2OJEB 5DF0A 4NQXA 4NZRH 3CSYA 3OR7B 2NY1D 1PZ5A 2CLVB 4JY4A 4U31A 4YHMH 5T3ZE 5A1AA 1FGNL 1LP9A 2HFTA 1I9EA 4PJXF 4Y4KD 3RZCB 4X9GA 4BSWB 4YO0A 3F7RA 5D6CB 3BD4A 3KYOB 4YZFE 2E7HA 5ITFA 2IH3B 3QFJB 1IGFH 3CC5B 3KPLA 2Q6WA 1QYGL 2V7NA 2WW8A 3WIIH 5LGHH 4JHZA 1K3IA 3CZFA 1YMMB 1UT9A 1DL7L 2DMCA 4S2SB 1PGRB 1CLZL 2HLFC 4NQEA 1NCCL 3RNKA 4KDVA 1FFOA 3NZHH 3IGAB 5DVOA 1X6NA 2HAZA 1CL7I 4HJ0D 4NQDD 5DD3H 1L7TH 1JYXA 1W72L 1MFNA 2V5RA 43C9B 4F7PB 5CZVL 4O00A 4HQQH 1NMAH 3BIKA 2IBZX 4C56B 2YHGA 4UQ2B 1NFIB 3MX0A 1IGCH 4P5KA 5C9JA 2A1WL 4JY6B 3VXSB 4KXZH 1OGTB 2H6PA 3VU2A 3BPLC 2DBLL 3BKML 1ED3B 1JHLL 1NCWH 4RRPG 3DX6B 3RIAF 1ZHKB 4JPIB 4PGJA 4R8WL 5FGBC 3VH8G 1AGBA 4DFHA 5BXFA 4C57C 3PE9A 1WAAF 3TC9A 1OD7A 1C1EH 2AS5M 1OGAA 3VDBA 2FATH 4ZUSA 1IT9H 3U46B 1MAKA 2Q8AH 4LPTA 1DBMH 4YDLC 2F74A 2NXYB 3ILPB 1S7UA 3V52L 1MWAB 4G9DB 4J3WA 3UJIL 4ZOEA 3FQNA 4M61B 4OGAD 4R7NB 5K9QG 3T09A 2AEIT 1K8IA 1G84A 1F11A 1AQKH 3DXAB 4KV5E 5D1XA 5IF0B 4AM0A 3CXHK 5D2NA 5E8OA 1QLFA 1UQSB 4OLXH 4JFOB 1YY8B 2PW2A 3CPLB 3EYUL 5F89B 43CAA 4ORGB 4POYA 2IH1A 3CU7A 2CIIB 1U3YA 3D3VA 1KPRB 4CL7A 1WEJL 3ZE1E 4KI5F 1TXKA 4JFPB 5E03A 3MRQA 4PRPB 4BH7A 2GCYA 3NCYS 5J6HB 4G7VL 3WIHA 4K23L 4XI5C 5DYOA 3RVUD 1LO5B 5J57B 3EJZC 3DX9B 2AXGB 2IANA 5IIEA 3AMKA 4HJGB 4CDHA 5DR5L 4S10A 5ICZA 1VKXB 2ESVB 4NZUL 4Y16C 1S9WA 3AB0B 1MQKL 3MLSH 5B22A 1BD2A 2I07B 4QWWC 5D7LB 1BOYA 4JDVB 1HHJB 1JHKL 2J6EH 3DJ9A 1M6OA 4RGNC 5EU7E 3B2UD 3MXWL 3MRBB 4X8JB 1QFOA 4BZ1H 1XGUB 1NUFA 2IADA 3RVXC 1IGML 2VDPH 4JO2L 3PDGA 2E7BA 4X6CB 4X6DE 1GHFH 4JPVH 5EG6C 2VL4A 1RJZA 1IC7L 3QXVA 1XIWD 3I2CL 3CDFA 2BK8A 3RDTA 4FQ2H 4OGYL 1QKZL 1UB6B 4GH7B 4CRPA 1M7IB 5CEXB 1MCDA 1D5IL 4L8DA 4OJFH 3FB7A 4PBVC 4NHUB 3G08B 3F5WB 5GGRY 5IESH 4PJXE 3X14B 5GS0D 3BN3B 1WFOA 3W5MA 3HB3D 1YEIL 2X1WL 4LOUC 5D1QB 4M6NL 3C5SB 4PJCF 4JQXA 3D69B 2VYRE 3LN4A 4WFEE 4U0RB 4M5YL 3H3BC 4UQ3B 1N2RA 2CLRB 3JWDL 4WFFE 1JUFA 4PV8A 4GG6F 3IXAA 1B0GB 5C0EB 3U4BL 3T4AA 1LILA 4P2RD 1FDLL 5TH2A 2NY2B 1CK0L 4JZOB 1MCHA 4G6AD 2PETA 5H2BB 2YPLE 4P23D 2VLKB 3WXVL 2YA2A 3PL6B 1F4WH 3ARSA 4MAYA 3W5NA 4MB5A 1KIPA 2FECI 4XP1H 5EORL 4E0RB 1CLYL 3O4LE 4G80B 5D7KD 4EI5D 1SM3H 4YBHA 2ORBH 1Q9OB 5C08B 2J7LA 1LO2H 3EYOB 1KPUA 3L3DA 4N0UB 2BOCB 4M43H 2DL2A 3QUKB 3O6FD 1FORL 1DBBH 1JPSL 1QR1A 4YR6B 1ZMYA 2EDBA 35C8L 2Z8RA 3FO0L 5C0GB 4OUOA 1LEGA 3WIFB 1OW0A 4PV9A 3NCJL 4HC1A 4U3CA 3RKPA 1OVZA 4XHJC 1WBXB 3HC0B 5SX5K 2V9QA 2ZSVA 4ZQKB 4JB9L 3L3OA 3CFEA 3GI9L 3MQIA 1SEQL 2CKBH 2VITA 2VWEE 4YFEA 4IJ3B 1AE6H 3U7WH 4ALAL 3WE6B 2BERA 1J1OL 3LRHA 3X3GL 5FM5M 1UG9A 2P43B 2F58H 4D0CB 1YMHB 2DTMH 4DEPB 3IFNH 2EXWD 2IQAA 1RAMA 5BRZA 2DMKA 2JF1A 3M17B 5C0AE 3LB6C 2EE6A 2W1NA 1MEXH 2YD5A 1KIRB 3U0PA 5JUEL 1T1ZA 3LH2L 3ALWA 2DLTA 4Z7QF 4BJLA 4ELMF 5A16A 3O3EB 3CDCA 2QHRL 2VB5A 5E8PA 3RTQA 3T65B 4L4VD 1S7WB 1QSEB 2W65A 2Z93A 4TSCL 3WO4B 4KI5E 3VXPB 1QSFE 2WLYA 1BLNB 3N1QC 1KB5H 3KDMA 2YBRB 3D87B 3SKMA 3ES6A 1F97A 1FVEA 1YEDB 4TTDD 2ARJQ 4Y19D 1KUMA 3VXUD 1FAIH 3RWFA 4NFDA 4X6DA 2JELL 2DRUA 3MLXH 5IMLB 5KANG 4LVOB 4EN3A 2ERJB 1NEZB 5EU4A 4Y4FB 3O9WD 3VD3A 3WSQH 3F7VA 2L7JA 4LHUB 1J12A 4LCWD 5IT2H 2FGWL 3IFOB 4P4KB 5ICXA 2FH8A 2CDGA 1HHKB 1MREH 1JNJA 4IRZH 1CE1L 4PJXA 4HIXH 4QOKB 3ZE2F 3QDMB 3SO5A 4ONHA 1WISA 1MRFL 4ODWB 4QRTA 5DK2B 3MV8D 4PREB 1WF5A 4MD0A 1UM5H 2VUOA 3DHMA 1QFUL 1YECL 3IB4A 2BHZA 2ZUTA 1BF8A 2EDDA 5FHBL 2M2DA 2YPLA 2BY2A 4OZFB 5CGTA 4HIEB 3LEVL 2A83A 4UTAL 1W72B 2V6HA 4APQB 3O4LA 4PJCE 3MNVA 5MEPB 1MCFA 5C07B 1R3KB 2GITA 1U8NA 4LKXB 4JG1L 4U49A 1CF8L 5J11B 4GG6E 1LK3H 1YA5A 1Z3GL 3D5OF 5BVPH 1EFXA 3FQXA 3K1KC 4O2EA 3UYPA 2WQRA 3V6OA 3TVMA 3GI8L 1OARL 3L3JA 4IRSA 3WN5A 3H9SB 1UA6L 3QAZB 5KVDL 3AS1A 3REWA 3P30L 3CFJB 4XPGH 4QHNA 4JFZH 4V2BA 1D9KC 4OI9A 1AO7B 2C3VA 1WAAA 2WWKO 3TBTA 1NBQA 3WO3B 5I8EB 1P9MA 2XT1B 1MIEL 2BVQA 1J86A 2E6PA 2XTLA 3VFVA 3WBDA 3U0WH 1ZK9A 4RAHA 4HK0A 2GJZA 4IMKA 1N8ZA 1KJ3L 4Q9QH 3STLB 2V5YA 2QR0A 4L9LA 3IJYA 1FFPB 1IE5A 5DRZA 2VIRA 3FO2B 1DBAL 1M7XA 2XA8L 1MAML 1G7JB 3NGBB 4X7EC 1FL3A 5C0AA 4NNXB 5I8CA 4PP2A 1U8OB 1EEZA 3AVEA 1A7PH 3PWVB 4OFVA 5AYUL 3QNXB 1BBJA 1UM6L 1HINH 1OWWA 2EDFA 1OSPL 2X4RA 3H0TB 3P0GB 5EC2A 3UAJC 3V5HA 1D5MB 5K93A 3SE3C 3EJYD 4U1KA 4TOYH 2G9HA 4QGTA 3AUVA 4YHML 4YAQA 3H7BB 3GIVB 1QSFA 2G75B 2VLRB 2A6IB 5E1AA 5EU6E 3ARRA 3SQBA 4FQXA 4UIKH 1YJDC 2AQ3A 4FQ1H 2ATPB 5IVNA 1IGFL 4Z7QE 3WIIL 5TFSL 4U1IA 4WW1A 4XXCA 4EDWH 2HT3C 5IB4B 2ZSWB 1JF1B 3MNWA 3I9GL 3QRFM 1CDJA 3NZHL 2HMID 4G9FE 3ARYA 1BEYH 1LE9A 1NC2B 1CQYA 3DYOA 3DI3B 4U1HA 5BQ7B 3WYRA 5I8KL 1NMAL 3CLEH 4Q9CA 5IFJA 1JYVA 5J13B 2GFBB 5L8LB 5F1KC 1IGCL 4XAKD 3WD5L 3LKSB 1J1PH 3K81A 4F7MB 1A6VH 2NY3D 3D0LB 1NCWL 3U36B 3D85D 1T22A 1Q0XL 4OTXH 3LZFH 3C08H 1S7XA 1CGSH 3QUYA 3BFOA 2A0LC 1VEOA 4XVSH 4M8QB 5IFHH 1PY9A 2AV7A 5I1EL 2R2CA 3IETA 5JNYA 5FCUH 2V2XB 2YPVH 5IKCB 3U7AA 5ID1A 3G6JF 1DANT 4EEEA 2W9EL 2FATL 3ZE2E 4ETQA 1IT9L 3BT2H 5L0QB 4Y4HA 1JZ8A 1AGCA 4QHKJ 4S1SL 3HR5B 4PJCA 5JOPD 3BUYA 5DFVD 4U1MA 2SEBA 2O61A 5E2UL 4W6YB 4Q6IB 4GW4B 4I0CC 4XGZA 4XP9H 5EBMA 4L4TB 2VSDA 4GG6A 4YHKH 4JZJC 2G2RB 3W11C 4LBEA 2VH5L 3U79A 4Z7VF 4H20H 3TN0D 4YPGA 4PTUA 3UC0L 1VACA 2IMMA 1YUHA 3O3BA 2A73A 1ZS8A 2YD8A 1A6TA 4FXLA 3OXSA 2Q86A 3SGJA 2X4UA 1U91B 5IG7A 1K8DA 5KBNC 1BZ7A 3HNVL 5M7QA 4QEGA 4J4PA 3L3GA 4XMKH 3KPRB 4BSVB 4P4RA 4WJ5A 5CEZD 2EDOA 2F54D 4WDIB 5DD6A 3X3FH 3QBTB 4I2XE 1UM4H 3BVNA 4KUCD 2ITCA 1D5BB 4NT6A 5HYJA 4EN3C 3BPCB 4GAJH 4N8VB 4X7DC 3P9WB 4PJ9A 1VERA 1LE5B 1J0YA 3TIEB 5DS8B 4EXKA 2CRZA 3OPZL 3PV7A 3MLSL 4RAUA 5KTEH 3MROA 2HTLD 2J6EL 2R56H 5F3HA 4G8IA 2AK4B 4PY7B 5E5RB 4HULB 4FQQB 4DJMA 4GMTH 3SE8H 1TVBA 5CSZA 1DBKH 4L3ED 1V5JA 3LDBC 1VGEH 3PWJB 3M8OL 2F8VA 5LBSH 4GW1A 5EU6A 5D7JB 4HWEH 1J0HA 1HZHH 2YKLL 3B9DA 4JPVL 3ZTJG 3O6LL 5J1AB 5HVWA 1N3NA 1J5OH 4U05A 4ELMA 3D18A 1FLRH 3GMNB 4KJPD 4PYHA 2M26A 4FQ2L 4WI4A 4B7IA 2JB6B 4LRIA 4PGDB 4R4BA 1NL0L 3ILQD 2VE6B 4LSVH 2B2XL 5HYSB 1QVOA 3IAGC 3RI5K 4KPHH 3HG1B 2WIIB 5GRVK 4P2QB 4UOJA 3VCLB 3HUJF 5E9DB 1Z0NA 5FO7B 4U2YA 3PWUA 3WL9B 3OF6A 4AIOA 1Y6KR 1CGVA 2ICEA 1CFNA 1I1AB 3W82A 3FO1B 1NUGA 2P44B 2Y25A 1C16B 1H15A 3V6OC 1DN0B 4DUXA 4EUPH 3WN5C 32C2A 4PRAB 2LABA 4L3CA 2P49B 3VFOA 1QQDA 3V8CA 4G42B 3WFHB 4Z78B 1WFNA 1DEEB 2AI0H 1P9MC 4WU5A 4XP1L 4NBXB 1JWSB 1V3KA 3NIGF 4YHIA 4P3DB 3S4SA 1A5FH 1SM3L 4FRWA 5DJZA 2Y7QA 1LO2L 3P11L 4IMKC 4DN3H 3EIFA 4I4WB 1DBBL 2IC2A 5DJYB 1G7QA 1ZOXA 2VDMH 4YIQB 3ARBD 4KGLA 4FP8L 5CWSA 1DZBA 4ZPTA 1ZAGA 2YC1B 1A1NA 5D1XD 5TE4L 4K9EC 4OZIB 3IDNA 3UTQB 3QQ3A 4Y8DC 1GL4B 5EA0L 3G5ZA 5ENWB 2CKBL 1XCTA 3MV7B 3O2DL 2BVOB 3U7WL 3G6JE 3GRWH 4N1EA 1NBYB 3NMEA 4X99B 3TO4B 3BO8A 3JWOC 4G43A 1EO8H 3H9ZA 3MZGB 2FIKB 1R5IB 4NJAH 2NNAA 5ILTH 3IFNL 3P73A 2XXCB 1ZSDB 5GRZA 4LCCA 4NPYA 4ZFGH 1T20A 2ZUUA 1F13A 1FSKC 2NYYD 3W9DA 4Z8FH 4NKMB 4JGUA 3TBVB 1PD6A 2EDNA 3OZ9L 1X5FA 3RGVB 1UH3A 3CFBA 1SEBB 4Z7VE 1ZTXL 2IAND 1I1FB 1CE6B 4MJIE 4AMKL 4KJQD 4XMLL 5J8OA 3VG9B 3MJ7B 1U8MA 5IW1B 4HDIA 2G60H 4HBCH 3VFMA 3RVVD 1CZ8H 3N06B 4LKCB 1AD0A 2XKNA 1OT1A 1WCBA 3NN8B 1LO3H 2DDQH 2HT2D 4K71B 3MRMA 1SJXA 1KB5L 2H3NB 5T3ZD 2B39A 5LAXA 4LLYB 1BFOB 1BVKB 5I16A 4U6VH 3D9AH 2NY0D 4XCNB 2OTPA 1TZGL 4BFGA 3BDXA 3MLXL 4LSSH 3RDTD 2GSIB 2Y6SD 2VQ1A 4NC0B 3QUYC 3WSQL 1YN6A 3L5XH 3E8UH 1LEKA 3MRGA 4XNYH 1QLRB 4JCLA 5JHDB 5DHYA 5FYKH 5HGHA 4PLOB 1IAKA 1KEMH 5LGJA 8FABA 3EZJB 1MREL 3OKKA 3UJTL 4HV8B 2A9NH 2GT9A 4IRZL 1LWRA 4X6EB 2D7OA 5T1KB 3GSXB 1H3VA 5TGBB 1FZMA 4M7KH 1YEFH 3E1F1 3G6DH 2HFFA 4HH8A 2ZOLA 2MPAH 5BVJB 2FZ3A 2AGJH 2ZUWA 1I3GH 2CUHA 2WK2A 1C7TA 2OJZH 1CGXA 1XF3B 2Q7YB 2E7LA 1DQMH 5IEKB 4MAYD 1Q72H 2B5IC 4V1DE 3ZLQC 4Q7DA 4UDUB 2OYPA 4AT6A 3SGJC 2EH7L 3HUJE 3EDKA 4QHUA 4XCYB 4PGBB 3GSQA 2IMNA 3IJHA 3HMXA 4MA7L 3OJ2C 5IVOA 1J9CT 3VRIA 4LLDA 1KEGL 1ORSA 1WBYB 3PWNA 4KHXL 5FM8A 4HS3A 4UT7L 4Z7UB 5TQ0L 2OL3H 2ITDA 4XPGL 3JV6A 5MEOB 4JFZL 3T1FA 1MFEH 4XPHH 4LARH 1LEIB 5EZLA 4PJ9C 6CGTA 2VZVA 3NIGE 2JB5H 1WWCA 2I9TA 3GM8A 1Q9KB 4K55A 3P9LA 4NRYB 4Z5RA 1G7IB 2C1OB 3G6JA 4GRMB 1YEGH 4OKVA 3U0WL 1IM9D 4JN1H 3C09C 3D0VA 3IDJB 1GZQB 2MTPA 2J1KA 3OAZK 4S0SD 4HUXB 3ARVA 5CJ5A 2CO6B 3EFFA 3S4SG 1ERNA 4Y88A 2GTZB 2DQFA 1ZVHA 1MHHB 2AABL 5F8RC 5CGYC 1Z9LA 1J8HE 3W39B 4ODUA 1I7TA 1A7PL 2Z0BA 4OLZH 3RTQD 4Z7VA 4HPYH 1REIA 4D0BA 4MJIA 4D9RE 1HINL 3GB7A 3NAAL 1HDMA 4EIGB 4LRIC 2BFVH 1HQRB 3LEYL 4R4ND 3P0VH 5DFWH 4ZFFA 4ONGH 2W91A 2DOCA 3OB8A 5FOJA 1XH3A 4HUVA 3QG6B 2HT4C 5E6IB 1JV5B 4Y5XB 4JRXE 3RU8L 2NQCA 3MRLB 5E8DH 4DVRH 1B4RA 4JY5H 4J1UB 4U3HA 1XGTB 4CNIA 2F19L 2EDXA 4QRPE 1JWMA 5B38B 4MNGE 4FQ1L 2ED9A 5D2LB 1EHLH 5C3LD 5I1DA 2IG2H 4MDIB 3T0XA 4U1SB 3SN6N 1ROWA 4LEXH 1EEYA 4EDWL 3C6SB 1MI5B 4MA1B 3OMZA 2L7UA 4G8FA 4LLAA 4YQXL 1M7DA 2GI7A 3GDBA 5F1SA 4OFIA 4GQ9H 3D39A 4PGCA 3BGMB 4FG6D 4LIQH 4HS6B 4XXDB 3UEZA 3B9KA 3I02B 5DVKA 5HVGB 5IB1B 4NO5A 1XIWC 4OM1H 4JJ5B 3B9AA 4GQPH 4PRDA 4HIJB 3QZWG 4OD1H 2R23A 5FOBB 4WFED 4U1NA 3MBEA 2IAMA 3QEHA 2OSLB 4H5SA 3QJFA 1O0VA 4ESKA 3BJLA 4QXGH 4L4JA 1IJ9A 4OTXL 4RA0C 3C08L 1A7QH 3EYQC 3GJEA 1CGSL 4UT6L 3ZYZA 2LVEA 2VKWA 2R2EA 4F7TA 4XVSL 1OTTC 5IFHL 1GGCH 2XOTA 3TA3C 3T04D 1AQDB 5FCUL 1EV2E 1I4FB 2VLME 3HUJA 3DMMA 3VFGH 1FYTD 1NAKH 2ATKA 3BD3A 5T5NF 2ZCHL 1A3QA 5CHNB 3GJFK 5CUSH 4LCCC 2PTVA 1EFXD 3M45A 4XP9L 1U3HD 3TVMD 3IU4H 2R2BB 4IRSD 4X4ZA 2DM2A 4YHKL 5EO9B 1I7ZA 3OB0K 5EUOB 1OAZH 5GZND 4EI5C 5ACZA 1I9IL 5J6GA 2V5TA 3WIHH 5DSCB 3QFJE 2XN9B 2VAJA 1JZ2A 5DI8A 3WEXB 2YK1H 5IUSA 3F12B 3W9EB 3QUZA 4C54A 3TM6A 1YMME 2N7AA 3WFDH 4LCIH 1DQJB 1T5XA 3MRIA 2FB4L 1LO4H 1TQCC 2X1PA 3OKMB 4K2UL 5EZJA 5B3JF 3NZ8B 4XMKL 5KSAA 1F3JB 1OAQL 4YHLH 3OKNB 1E4XH 5C0JA 1DP0A 2WP3T 4PJ8B 3HZKB 4FXGB 1UM4L 1VHPA 3U7YH 4J3XA 1NSNH 5F7UA 3FL7A 3U6RB 1RK1B 1QLEH 5CILH 4GAJL 4JHAH 3RQ3A 1J8HA 4YHZH 2BNRE 3RJDA 5TDOB 4NO3A 2CKBB 1FVDB 1EPFA 3PGDA 1L6ZA 5IEHA 1P53A 2ZWLT 4KI5D 4E42B 3HE6B 2P8LA 2R56L 4JEGB 4I9WD 2ADJA 2R8SH 1G7HB 4JRXA 3HA0A 5T1DL 1BP3B 5GXBB 1DVFC 4GMTL 3SE8L 4DGYH 1DBKL 3QDGD 1DUYB 3WKMH 2GKIA 2ARJA 4QRPA 1HOCB 5DHXB 4NN7B 1CN4A 5IJVA 4M6OH 4MNGA 5KVGH 1H5BC 5SX5H 1FCGA 1YJDH 1RMFL 2AW2A 1FLRL 4Y4KB 1GJIA 3U2SB 2KH2B 4YDVB 4QHLB 5HYQB 1GVIA 4TTDC 3TWCH 1T6VN 4NUJA 2NR6C 3ROLB 4P9HC 3DXAE 3OHXA 1HYSD 1EMTH 4WTWA 1FFRA 2FJGA 1ONQA 2BOBA 1FNFA 3HZVA 4KPHL 4Z0BL 5CKGA 3VFPB 5TDPA 1Y18A 3LV3A 1KB5B 3QDJA 5E7BA 1BQSA 4CN1A 1OF2A 2BRQA 1BIIA 3MRJA 5JORB 2Y9RT 3U30C 2Z4QA 2GYSA 5IJKA 2ZOKB 4HC1H 5L9DL 3MRKA 5MENB 4MD5A 3LD8C 1CDCA 1E27B 1N59A 4ISVA 3PIQB 2EEBA 4HW6A 4UDTB 1T66D 1X5KA 5DGRA 3FTGA 1A5FL 3EHBD 5C0RH 3IJSB 4K8RC 2FJHB 2BNUA 4RAVA 4DN3L 4UOW1 1C5CL 2FO4A 4FZEH 1A3RH 3RWDB 3X11A 3QULB 2VDML 1NGXA 4JANB 4FQIH 1IM3A 3GMRB 2HVJB 3PJSB 3FRUA 3LN5B 1A1OA 1KT2B 2VDQH 3EOYG 4O2CA 5KAQG 3UZQA 4LU5H 4DGVH 4QHMA 3RZCA 3P40A 5D6CA 3KYOA 3DVNA 3T2QA 5HHNB 2IH3A 2PNDA 3CC5A 3BDYL 2IWGA 4HK3J 3TH3T 1RZKC 4KDTA 2ADIB 4YXKL 1EO8L 1OL0A 4J4PD 4ODSH 3TT3L 4UTBL 5K9KA 4YX2L 1ACZA 4DOHE 4ZFGL 4YLQT 3ZE0F 4Z8FL 4LVHC 4OCSH 3QG7L 4OF6A 3QI9B 1MOEA 1NFIA 1RK0B 4LEOA 4LPYA 1N5AB 3OKEB 2B1AH 5I2IB 1GOGA 4JY6A 3S3JA 5CINH 3IS1X 2VZUA 5I74C 1EBAA 2BNRA 3C5JB 2V7HB 3TNMB 1DBJH 3B9KC 4ZS6C 2DQUL 4GT7A 1XGQB 5T1LB 2DICA 2EYTA 1MFAL 3ULUF 3C6LD 1RJLB 1X5IA 5EOCH 2JJSA 1J0KA 5EU6D 3G5XA 5DD5L 2VDNL 4RZCB 4U6VL 1KPVB 2PR4L 3EJYC 4LSSL 2EKJA 4G6JL 4MJ5B 1RY7B 2IFFH 3GUTA 2HKFL 4JFFE 4MVBC 4PJEF 5DEGB 3MGAA 3E8UL 1R0AH 4XNYL 2XNAB 2YZ1A 4EVNA 1UFUA 2N4IA 4G9FD 1CGYA 4HGMA 5FYKL 4N9GA 3QIBB 4XCCH 3OX8B 4HHAA 3DXAA 1JFQH 1KEML 5IF0A 1A1MB 1RZIB 2WSKA 2MCG1 3DMMC 2VO5A 2A9NL 2NZ9C 3BKCH 5DEFA 2O5XL 4U1GC 2X1XR 1A22B 3IDUA 5F3BB 4M7KL 1HH6A 3TPUA 1YEFL 4Q2ZA 3FAWA 1FQ9C 3KPQA 4EKXA 2DQDH 5IBUG 2PW1A 1WC7A 1A7BA 5E6YA 4BQBA 5KSBB 4M4RA 2R0KL 4MQ7B 1A8JH 4TVPE 5F7EH 2IJ0C 3ZSTA 1VEPA 4RMVA 1Q72L 4OCNC 1JI2A 3CMOH 5J6HA 5CD5D 3SKJL 4OFYD 3QUZC 4YFLI 5IW6B 5DUBB 1INQA 2XTJC 4P2RB 3C8HA 2FEDD 3O45B 4QRRE 2DI9A 4MJ6A 4JFDB 5KZCD 1QSEE 2GY7B 4WWKB 3UYOD 1B6DA 2XZCL 3G5YB 1ZVYA 3ZTJH 2I07A 4JDVA 5FYJU 3KLAB 2WBJA 2OL3L 2FBJH 4F8QA 4MA3A 4UNUA 5HYFA 4G6KL 2VLJA 4KY1H 3WUWB 1IGIH 4K9EH 4OLEA 4OB5H 3ULVD 2C3WA 3MOAH 4ZUWB 1ZGLM 3DVFA 3L1OH 5I1HL 1U2CA 5ERWA 2GSGA 1CCZA 2HVKA 1K4DB 5IHLB 4KRPB 3VWJB 4HCRA 4XZUB 1GRWA 1HXYA 5DO2D 1JPST 4K07A 5GGTA 3DUUB 4C4KO 3F5WA 4KROC 3Q3GA 2YD7A 1FNGB 1GH7A 5IQ7L 2WM0A 3RWGA 1QTYT 2Y72A 5KS9B 5DC4B 4CW1A 4ZODA 3QDME 5D70H 2MQ0A 4HPYL 1HQ4B 5I1AA 2BY1A 2BFVL 4RFNC 3P0VL 4UIMA 4XP5H 5F7FA 5C2UB 4BM7A 5F88B 4JKMA 1GGBH 1WWAX 1VFUA 1XGRA 4GRWE 3KPSD 1JGLH 1RZFL 3T0WA 3VI3F 1X3DA 4HUWB 4DVRL 4JY5L 2P48B 1IKFH 3ZE0E 4ELKB 1ZHLB 3TNNB 5JIIA 2X4QB 2D7PA 1T7WA 5HBBA 4MCYB 5E99H 1FZKA 2CUMA 3G5VA 3IDMB 1EHLL 1VCAA 2YPKA 2X4OA 3S34L 1PYWB 4FMFA 2Y36H 5CP7A 5EOTB 3ULSB 5F7DA 2W0PA 4Y89A 2MMXA 1F4AA 3UXFA 1KJ2A 1F6AA 1MJJA 5IJKC 5F7WC 3LQMA 4F15C 3AAZB 4GQ9L 4JFFA 3MRHB 2ZP0T 4LIQL 1HIML 1OD9A 2HJKA 3ULUE 1AO7E 3O9WB 1WJ3A 3N1GC 4JFXA 3D2UB 1VGKB 1CVSC 2UWEF 2YA1A 2YN3A 4HAGA 4PJ5D 3S36H 3IFPA 3TCLB 3JSSA 3MLTB 1JPTL 5IWLC 5AAWA 2R4RH 3IKKA 4YK4B 4QXGL 1YMHA 4GO6B 4X9FA 1RQ5A 3PABA 2W92A 3WHXA 5I18L 3V5KB 3KNBB 3CFDB 5KVMC 4NZTL 1SYVB 1GGCL 4K3GA 5D1ZC 2D03H 3MV8B 4M93C 3RUGF 5DJ0B 3PP3H 3ZTNH 4KDTC 3RPIB 3VFGL 2YRPA 3O3EA 1BOGA 3KHOA 1N7ML 1A7NH 3MMEA 4QRRA 2BDNH 2GJ6B 4Q0XH 4H88L 5IBTH 5DLMH 4I77H 1N0XL 2C1PA 3Q0HA 2Y4SA 1XGYH 4LQFH 2ZUVA 3HPJB 5E2WH 1B9ZA 3MLRH 4HH9A 4OQTL 1M71A 4FABH 4EUPB 4N0CC 2G5BB 3U0TB 3BPLB 2EDEA 4X5XB 3MUHL 3RAJH 1T04B 1HSAB 1U3JA 4MWFA 3AXLB 1FV1B 3DGCR 3BE1H 1W8NA 4LCIL 4OCYH 4R2GD 3X17A 1LO4L 1YDPB 1MQ8A 3LMJH 3EDDA 5DZOA 4BFIB 4RMRA 2JJSC 4HD9A 4P9ML 1D6VH 3GSUB 3VXRA 5SX4I 4PTTA 4I8DA 3RVWD 3O3UN 4JHAL 4TUOA 4AG4L 4K3HA 2AJVL 1S8DB 1KIQB 1PEWA 2CDFB 4HKXB 1BZ9A 4TPRH 1AY1L 2ZUQC 2EYSB 3MUY1 3ARFA 2HLAA 4XBPB 1I9JL 5F1NB 4P3CH 4HUMB 5ESQA 3SDXF 6FABL 1U8IA 1TMCB 1WZLA 3ISWA 4CGTA 4MMZC 2R8SL 4QXUL 4NDMA 2YRZA 2QKIA 5D72H 2PYFB 4JO1H 5F7YC 5FUOH 2OMNA 5JPNA 3FT2B 3REVB 1W72A 5T5NG 1NDGA 3UO1H 4F9PA 5KVGL 4OLWL 2YD4A 3TBSB 5FK9B 2VUYA 4GRLA 2WBKA 4KDWA 5HI3D 3TP4A 1FZOA 3VH8B 2AXJA 3DLQR 1T1YB 3C60A 4TN9A 3LRSB 2VL5B 3VI3E 1EMTL 4P46B 2BZDA 2ZZUT 5J89A 3AREB 3NABH 1YQVL 3O2VH 3PHOB 1NFDE 3NBNA 3TBYA 5B8CA 3JV4A 4ZDHA 3G04A 1RHHB 2BXYA 2P24A 3PG2A 3QUXD 4KRLB 4RGNB 3MBED 2IAMD 4ZUVB 4NC2B 5H8DA 1NLBH 1HKFA 2NX5E 3UTTB 2WBJC 4LLQB 1HWHB 1B4JL 4PJEA 1AGEB 4HC1L 5IQ9B 4JLRB 2ENYA 4O02L 2W0FA 4V1DD 1UACH 2DQHH 3D85B 3DROA 3P4MA 4NNXA 3OKLB 3RFZC 4JVWA 1I8KB 3VXMD 3SJVB 3VXNB 5CJQL 5C0RL 1J8KA 3TO2A 5FGRA 2H26B 2X4NA 3HS0A 2CR6A 4FFYH 1A6UH 2APWA 4YC2B 3MODH 4I5BA 5EN2B 3VFRA 4TUJA 4FQIL 5BW7A 3R4DA 2DQIH 4KH2A 4YNYA 4R26L 2VDQL 1BQUA 4JREC 5E8NB 4LU5L 4DGVL 5BS0B 4D0DA 4ODHL 1X5HA 2QQKL 5FAAA 2ARWA 2OP4H 2VXTH 4DQOL 5I1LA 3VFTA 4AEHH 4GUPA 1V05A 3GSVB 2I60H 5MI0C 4M1DL 3PGFH 5INCB 1SYSA 1SMOA 3QH3A 5TJWK 5KSAD 5DJ2A 2D31A 2P8MB 4EIZC 5C2BH 4OT1L 3QFDA 3K2UL 3LPGA 2BVUA 3HG1E 1NC2A 4OCSL 1T0PB 5GISH 1RUKL 2GTWB 4ZO9A 4G5ZL 5HHMB 3ZT6A 2X89A 5BQ7A 5L8JB 4PJFB 1NBVH 1J8HD 2OL3B 2B1AL 2VLLA 5F9WB 3TYFA 3T0EE 1C5DA 2F54B 3O3DB 4GKZA 4F7MA 2JTDA 4KMQA 4NO0A 3V0WL 4GKNB 3EO1B 4KZEH 1QFWI 3U36A 1I8MA 2IF7A 5D5ME 3ECBB 1X4YA 2X10A 4Y2OA 3GMLA 2A77H 4M8QA 4NQXB 1DQLH 2FIRT 1T0NA 4NC1C 5H35A 4PJGF 3CSYB 4R4NC 1PZ5B 4KK5D 1B2WH 4NN6C 1QRND 1LP9B 3MCLH 4H0GA 5B21A 4QYOA 4YO0B 1UWXK 2DWEA 3BZ4A 3L7EA 3EYFA 3KPLB 2Q6WB 4BKLA 5DDHA 2V7NB 3SDCD 3TFKC 4HWNA 3HNSH 4XPTL 3MLYL 4RGOH 3CNKA 1OTSC 1H0DA 1MY5A 4NQEB 3RNKB 4IRJD 4D2NA 3C9NA 1FFOB 4P9HH 2A6KA 3BKCL 1WTGT 1RUQH 5I15H 3V2AR 1NFDA 4HKBB 2BSTA 3BIKB 4FG6C 3HMXH 5LCVH 5A2JH 2DQDL 4ENED 3CGTA 1HH9A 1G9NH 4P5KB 5C9JB 4HKJA 4M7LL 1KGCE 4JO4L 2H6PB 2NX5A 2ZG2A 2XFXA 5F7EL 3VFWA 1F90L 4PJHF 3V0VB 1AGBB 3QCVH 5BXFB 5IHZA 1BQLH 1OAUH 2CLZA 2D7TH 5BO1L 3BN9D 1OPGH 1EZVY 1UWEH 2IEPA 1AIFA 1S5IL 4LPVA 3A6CH 1OGAB 4K8RH 3ESVF 4TUKH 2Z31A 4IOIA 4XMPL 4ZUSB 5GGSA 3SEPA 4H25B 4LFHG 3RKDC 4LGPB 3LSOA 5L2KE 2F74B 1JGUH 1S7UB 1UVQB 3FMGH 1ZV5A 3RZCD 3FQNB 2X4SA 1W0WA 5DZLA 4WUKH 5F21B 3QFJD 1K8IB 4C58B 1TCRA 4K9EL 2EC8A 3L9RA 4OB5L 4ODVH 3RY6C 3RUGA 1XZ0A 2VC2H 3ARFC 4AM0B 5IHBA 1YMMD 3L1OL 5D2NB 5KVFL 5E8OB 1QLFB 4O4YH 2PW2B 1BWWA 4PB0H 4S11A 1RJYA 43CAB 3MLWH 4XBGB 4FQCH 2IH1B 1MFDL 1SBBA 2J5LC 4M1GH 1RZKH 3D3VB 3JWOL 2VE6A 3QWRA 5E4IA 4C56D 3BHBA 4OGZA 3BIAX 2WIIA 3U4AA 2H8PA 5J1TC 1IQDA 2KZ1B 1IC4L 4NNPL 4IM8A 4F9PC 1U58A 4BH7B 2GCYB 4ZPVA 4GRLC 3B3IA 3VXSD 4B0MM 4R97C 4TVSa 5DYOB 3V6ZA 2BNRD 3T0EA 1UCBL 3NPZB 4HWZA 5IIEB 1JZ4A 1YNLL 1E28A 5ADOH 3CXDL 3ULUC 5D5MA 1IKFL 4HT1L 5GSRA 4HEME 1S9WB 2YUXA 3ZDXE 4HUNB 3NPSB 1DEEA 1BD2B 5EBGA 3B43A 1K2DA 1AHWC 3IRZA 3UBXI 4X7TA 5E99L 1M6OB 1OB1A 1OQOA 3ZT7A 4DKAA 5F6HJ 4PJAF 2Y36L 3UMTA 2NXYD 3NIFF 3OR6A 4I4WA 5DT1H 1V3LA 4OCRL 5DJYA 3BQUA 2AJ3A 1RJZB 2V17H 4YPJA 3DXAD 3RDTB 3HC3H 4FQJL 3SDXA 3UTQA 2UYLA 4KKCD 4L8DB 1FFNA 3FB7B 4WGVB 5ENWA 3DSFH 2AEQL 1QO3A 3RL1A 4JQVC 1L0QA 1P7HL 4XX1E 1NBYA 2C7UA 2ZJSH 4MJ2A 5BW7C 2VJXA 4KJYA 2R4RL 4K3DH 3ARPA 4F57H 3SKUD 4J6RL 4X0KA 3LN4B 1INDL 3KJ6H 1N2RB 3UBXG 4XT1C 1JUFB 4PV8B 1RUMH 1H3TA 3IXAB 5ELIA 4KHTL 4J23A 2O5ZH 5AWNH 4BQ9A 3T4AB 4NFCA 4N0YH 1JJUA 5TH2B 1CE6A 2JCCF 4I48A 3GMPA 5ESVA 1KB9J 1I7RA 1GGTA 4MAYB 1A4JA 5KOVC 1KIPB 3OXRA 5IBTL 5DLML 4S1QH 4LQFL 1XGYL 5E2WL 3MLRL 1WFTA 3QHZL 1ZGLB 4HLZG 1KPUB 2J8UF 3L3DB 3MOQA 1C7SA 5JXEA 4DZ8A 4JM4H 3TT1H 2H3NA 5GZOC 1QR1B 5L2KA 1E6JH 4K94C 1LEGB 4XP4H 4PV9B 5E00A 3RAJL 4OLVL 4PJHE 1XEDA 3FO9A 4Y5VC 1JNNL 1CD1A 4BUGA 4ZAKC 4JVPA 3BE1L 2LTQC 3VD4A 2ZSVB 1MI5E 4OCYL 3L3OB 1ETZA 3CFEB 5GRVL 2VITB 3FT3A 3FB5B 1G9MC 2MCPL 1D6VL 5EC1B 4GXVH 4YHYC 5EUKA 5D1QD 3U9UA 5K9JH 5BRZB 4X6EA 1KJMA 1YEHL 2NY7L 3GSNA 3O6MH 3R06A 2IPTH 4POZD 3RPKA 1T1ZB 1T1WA 4DKEL 4CN4A 4P3CL 3UZEA 3GMOA 2NY2D 4NQCB 4FNLL 5E8PB 2VZSA 2Q7YA 3H3PH 5DJDA 1JMZA 1RZJC 2VLKD 2JJTC 2W65B 2Z93B 3PL6D 1MHPL 1TETH 4P2CG 5JW5A 4LVEA 5D72L 3EDFA 2R1YB 4JO1L 3CX5J 2XQBH 5FUOL 4DWHA 3KDMB 1CDBA 2BRRL 3SKMB 4PJBF 3T8XA 5C08D 3ES6B 3WJJA 1EZVX 1FVEB 4OLYL 3UO1L 1F42A 5A2KH 4GBXA 3RWFB 4QY8A 2AVGA 4X6DB 5EUOE 5ADPL 1A47A 4EN3B 1MH5A 5DJ8A 1FVCA 1U8LA 4MA8H 4MZ3A 4UILL 5EU4B 4E5XA 2UZIH 2XN9E 5J1SC 1IGYA 3NABL 5MEOA 3HKFA 3LKRA 1R5WA 1LEIA 3O2VL 2WV3A 2AXHA 4OV6F 5ICXB 4PJGA 4CVZA 2CDGB 2EKSB 4MZ2A 4XWOD 2DQGL 4PJAE 2QL1A 5I1KH 1PSKH 1NGQL 1U41A 3BP7A 3NIFE 4PJXB 1KBGH 4R7DA 4R90H 1E0OB 3P4LA 4YDJA 4ONHB 3SBWC 2AP2A 4JJHA 4TVPD 5KVEH 1Z6JT 4KQ3H 4ZD3H 3BDBA 2DQHL 4MD0B 1BGXH 1CI5A 2R2HA 2F15A 5LWYH 1T7ZA 3MFFB 4L3AA 1JRHI 1J11A 1QSED 2YPLB 3V8OA 1EGJA 2A83B 3ZDYF 3GSWA 1A6UL 3O4LB 3MODL 1FE8H 2CIKB 3MNVB 1CYGA 3MBXH 3DO3A 1HEZA 3PHSA 1U8NB 2G5RA 5JW3H 1Q1JH 2R4SL 1FN4A 1XGTA 5TQ2H 5DD0L 1DUZA 3KWWA 2FH6A 1EFXB 3FQXB 4O2EB 1GGUA 4JQIL 3L3JB 4IRSB 3Q5YA 5ACMA 3UDWA 2VXTL 3WN5B 2JCCE 5EIIA 3REWB 4PJHA 4Z77A 3MCKA 2VISA 3L5WA 5DMYA 2C3VB 3SDDA 3P4NA 3TBTB 4LHUD 4U1LA 2FHFA 1X7QA 1T0MA 3DRQA 4P4KD 5HPOA 5C2BL 2J8UE 3VFVB 3ULVC 4HK0B 2GJZB 2JKXA 1N8ZB 3TJHD 1BBDH 1P1ZB 4L9LB 3IJYB 2VR4A 3LKNB 4QOKD 5C0BE 3MACH 5DRZB 2VIRB 1R3JA 3QDMD 4PRIE 5EU3A 5L2JA 5C0AB 2VZ1A 2NY5H 4OFPA 2NXZC 3ARUA 5I8CB 4PP2B 1EEZB 2FX9H 1EH9A 1MCWM 1BBJB 5BZWB 1S78C 3UYRH 2X4RB 3VGFA 4LRNH 5EC2B 4F9LA 3VW3H 1KJVA 4UNTA 4XRCA 3SGDI 3V5HB 3ARGA 1OT2A 1DQLL 2F8OA 4U1KB 4AEEA 2RGSA 1KCSH 2IBGA 2QQLH 5L6YH 2G9HB 1TNMA 4YAQB 1QSFB 2CXGA 1FNAA 3ZKNC 1U8PA 5E1AB 1M05B 4FQXB 1FSKB 4O9HL 3UTSB 1MJ8H 3TIDA 3C60D 4N8PA 1ZANL 3BAEH 4YXHL 3HNSL 2JK5A 3P0YL 4KUZH 4AQ1B 3H9SD 1OAYH 2CD0A 3L7FA 5C0DA 4WW1B 4RMSA 5C0ND 5FKAA 3MNWB 1AO7D 1BM3H 4P9HL 3DO7A 1JGDA 3PP4H 2XN9A 3K8LA 1LE9B 4LLUA 1PAMA 1RUAH 2QTEA 3O6KH 1CFVL 2C3HA 4PJBE 4DKDC 2F8XC 2MOVA 4U1HB 3Q1SH 5IFJB 1KB9K 4PJAA 3O4OC 5JXEC 2L0DA 3CSBA 1JTOA 2KBGA 4EBQH 3OKNA 4Q74A 2HP4A 3K4DA 1T22B 1CG9A 4WTZA 5F6IB 1S7XB 3QUYB 1S5HA 3QCVL 4KK6C 4I18C 5DMIH 4CU8A 1BQLL 1RK1A 2D7TL 2AV7B 1MRDH 1L4IA 3IETB 1UWEL 1FZJA 2R0LH 5JNYB 4X7SH 4XC3H 4IOFD 3HC4L 3A6CL 3O2DA 1HI6A 1A9BA 5ID1B 3PWPE 4K8RL 4ETQB 2XZQH 4GKSA 2AJXL 1DFBH 4Y4HB 4WWID 4HCRH 4LCUA 1AGCB 3P9MA 4KKAC 4BUHA 4PJCB 5E8EA 2FX7H 3BUYB 4NQVA 2VLRD 4U1MB 1P4LA 2YXFA 2SEBB 2W9LA 3KXFA 3FMGL 5GGTH 3WNPA 2O61B 2HKHH 3V4PL 2ZUXA 3BP6A 4XGZB 4WUKL 3QUML 5SX4H 5T5FL 5EBMB 4GG6B 2F53A 2NPLX 3PDOA 4LBEB 4WEUD 4KZDH 4ODVL 3EGSA 1I85A 5EU5A 3I84A 2JCCA 2LQRA 1F4XL 4O4YL 1MIMH 4YPGB 4PTUB 1VACB 3KS0J 1YUHB 3O3BB 2A73B 1ZS8B 2B5IB 1A6TB 1MNUH 1QNZL 2EDTA 4UNVA 2Q86B 2QADC 2AJYH 2X4UB 5HY9A 1RZKL 3SDYL 1NC2D 2K1MA 3HE7A 5IG7B 1K8DB 2ZCLH 2C3GA 1UB5A 1BZ7B 5HGBB 1U93B 2X89D 4QRQA 2W07A 3BJ91 5FIEA 2J8UA 3K80A 1S7RA 1KCVL 4LSUL 2V9TA 3WJJC 2H2PC 4W4OA 4P4RB 4WJ5B 2B4CH 1CBVH 2EDWA 5C0BA 5DD6B 3CX5K 3IDXH 4NWUL 1N6QL 4NO0D 1WQVT 4XPFH 5FM5O 3BVNB 2ITCB 1KYOK 4PRIA 1GGIH 1IC5L 4NT6B 5HYJB 5KSBE 1KJ2H 2X70A 2YD9A 3K8MA 4PJ9B 1EHXA 3VWKA 1YNKH 4GAGH 4JDTH 2VXUH 3LKPA 1A2YA 2QV2A 4NJ9H 3AM8C 4RAUB 2D0GA 1QRKA 2DIBA 1Z9SA 3MROB 2Q20A 3NOIA 5AEAA 5F3HB 4G8IB 3U83A 3C09B 4H0HB 5EWIH 1TVBB 2K7QA 3IJSA 2FJHA 5CSZB 1VPOL 3DHJA 2AJZA 1RU9H 2KUTA 1JF6A 4GW1B 5EU6B 5FDWA 3L3KA 5I30L 2H1PH 2XYCA 4L4TD 1NUNB 1N3NB 5IK3A 1WIOA 1SMAA 4ELMB 3D18B 3H42L 4DUWA 3HC3L 4WVRA 1X4XA 3RY4A 3CLFH 3ARQA 2QSVA 1KENL 4E9LA 3FZUC 1WV7T 1KCRH 3TH2T 4R4BB 4TVPH 2DI7A 4XPBH 3DSFL 4C83B 5J06A 3RWIA 3ABZA 2ZNXA 1AXSA 5LKNA 1QVOB 1SVZA 3MA9L 5FYLH 3QQ9D 3L3IA 4QRUB 2E9IA 2BSSA 4PJBA 4LSPH 3PWUB 2ADIA 4PGZA 2FR4A 3WNKA 3KPRD 3O8XA 3QPQC 3KJ6L 1UZ6E 2ICEB 1CFNB 4U6XA 4KMTH 3OBAA 4WFHD 3UJJH 1H15B 4H26B 32C2B 5KS9E 2O5ZL 4L3CB 4N0YL 3VFOB 2ICWJ 2BX5A 1IBGH 5JDJA 4OCWH 5F9OH 3SDDC 4WU5B 5B4MD 3C5ZC 1I9RH 1KLGA 4YHIB 1A0QH 2Z31D 5H37G 2WWMC 3S4SB 4S1QL 4YDKH 5DJZB 4YHNB 2Y7QB 3ZDZE 4IS6A 2VDOH 3PWPA 5EH1A 2BC4A 3TT1L 5CSGA 1E6JL 1G7QB 1CDHA 1NCDH 2YD3A 3DOSA 4XP4L 2YXMA 5D7JD 5CWSB 1P6AB 4RZCA 4ZPTB 1A1NB 1FGNH 3IDNB 1JZ7A 3ARWA 3S88H 3QQ3B 4WO4A 3F6IA 3G5ZB 2V2WA 1XCTB 4JRYA 3TZVA 5J3HD 3W81A 3KJ4B 1RZGA 1QFWH 1QFPA 1QYGH 4WUUE 3HI1A 5JIHA 3ARGC 1ZLVK 2FL5A 3BO8B 2VDLL 2HJLA 4JHWL 5F9DC 1DL7H 4GRWH 4G43B 3HG1D 4P2QD 3WFCL 2NNAB 2VQTA 3WLWD 1NH6A 2GW5A 4LCCB 4NPYB 5HGAA 1T20B 3WS6C 3W9DB 1KN2H 4H8WC 5L8KB 1I1AD 5SWZB 5CZVH 3O6ML 3T0ED 2IPTL 3V9FA 4ODXA 3V6FA 1OTUD 1ZXQA 1U8MB 5KSBA 1AGDA 3MGTA 1NFKA 1CFSA 4QT5A 5DA4A 5DRXA 1CICC 3HRZA 3QO1A 3QZWB 1AD0B 2XKNB 1WCBB 3ZYOA 1EO7A 3B5TA 1ZVSA 1BJ1J 5D7IF 1KACB 3ULUH 3MRMB 4AL8H 4MAUL 1TQCB 3QSKB 2XICA 1BX2A 4PLJC 5LAXB 2GJ6E 5CJXA 5HDBF 3V0AC 1TNNA 5I17A 1WZKA 4ZUTA 5I16B 3BQUD 3NFSL 4X9BA 4MQTB 5I71C 2B0SL 2FHCA 1NMBH 4ZXBA 2X2YA 2VQ1B 4MA8L 5FKPB 1VADA 3UJIH 1YN6B 2UZIL 4FQPA 1BFVH 4M1CD 2VDRH 5DHYB 4WNQA 4FFWC 5HGHB 4PP1C 1IAKB 5LGJB 8FABB 3OKKB 4L29B 4EQ2A 1JN6A 4PRNA 1PSKL 2GT9B 1EK3A 1DVFB 5JA9A 2Z8SA 3AFLA 1CXFA 4PR5A 1KBGL 1PDKA 4NRZA 2OI9C 1FZMB 1MCPH 3NACL 3DUUA 2ZOLB 1W0VA 1S7QA 1H5BB 2FZ3B 3BI9X 1FNGA 3HLAB 5CJ8A 1N6VA 5DMKA 3VXTA 5LWYL 3EYVA 4ZTPL 4L8SA 1CIUA 1DQDL 4AT6B 1NEUA 5C6TH 3QISA 4QHUB 3HE7C 4LMQE 4QTHA 2PYEE 3EOTH 2ADGA 2Z91B 4OF0A 1JZ5A 3GSQB 3IJHB 3MBXL 4BFBD 4YXLH 4AYFA 5L2KD 2DYPA 4HUWA 4HGWA 5DK0A 4NZUH 4P57A 4EXPX 4YBQC 2X41A 1MQKH 4OZHF 3VRIB 4QXTA 2UY6A 3BN9C 3P3YA 5TQ2L 4LLDB 1ORSB 3V79C 2PO6C 3KLHD 5HJ3A 4RMQA 3PWNB 1JHKH 5C3TA 3MXWH 1CFQA 1FC1A 1ZEAL 2C4FU 4K94H 1I1YA 1PYWA 2ITDB 3JV6B 4JO2H 5EOQH 5EZLB 3LD8B 3VWKC 5DD1H 1EBPA 2I9TB 4AIZA 5LQBH 2W0KA 5JHDD 3P9LB 4YE4L 5K9OA 4Z5RB 3G6JB 1FHGA 3I2CH 1F4YH 4WUUA 4OKVB 4OGYH 1IEBA 2EZ0D 3D0VB 1U8KA 3S7GA 1G9MH 4N5ED 3MACL 3BXNA 1H3UA 5T1KD 2PXYA 2DQFB 1HKLL 3GM0A 3UTTE 4ODUB 1I7TB 4GS7C 4M6NH 4Z7VB 4D0BB 4MJIB 3A0OA 3GB7B 1ZLUH 4ZOBA 1HDMB 2ICWA 3LRGA 3UYRL 3LQAC 4LRNL 4ODTL 4ZFFB 4L1DA 3JWDH 1QPPA 4TSBH 4LSRL 5AD0A 1XH3B 1HHHA 4WCYL 5FYKE 4HUVB 3SJVE 1I1CA 2QQLL 2D7MA 2DM4A 5L6YL 1CK0H 3S8WA 1P7QA 2X7LB 3RPIA 2H45A 1EJ6A 4CNIB 2BMKA 5GGRA 1JWMB 4JKLA 5EORH 3O8XC 3U9PH 1FIEA 1MJ8L 1QFWM 5I1DB 1CD9B 1YY9C 1YZZA 4KUZL 3DGGA 4WIQA 1EEYB 3HCVA 2WNGA 1FORH 3MFGB 5BS0E 5JLZA 4EUPA 3HZMA 5FO9A 4G8FB 5FUZH 1M7DB 5HHOE 3J7HA 3D39B 4PGCB 2X4PA 2FCBA 5D7IE 3PP4L 5I74B 1J0IA 3NCJH 1U3ZA 1G7MA 4LDOB 2E8ZA 4DVBB 5BOZG 3B9KB 3O6KL 3ZKMD 5CBAA 1IAII 5FGBA 1LNUA 4JFEE 4NO5B 3NA9H 3Q1SL 2JE8A 3GI9H 3OSKA 3FQTA 1URLA 4I0PC 3ARDC 1SEQH 4PRDB 1WGOA 2R9HD 1WT5C 2DJSA 1YDPA 3H8NA 1CDGA 4ALAH 2J2ZA 4PIRF 2R23B 4RMTA 1Y6NR 1J1OH 3X3GH 4U1NB 5E4EB 3QEHB 2IAMB 4YH6A 1MHCA 1X44A 4H5SB 3QJFB 1CLCA 3SKNA 4X4XA 5J12B 4PJFE 3KYNA 3GJEB 3CXHJ 4F7TB 2R2EB 1H3PL 1IRAY 3BIBX 3VRJA 1EAJA 1HILB 3PHQA 4X7SL 4XC3L 1KIQA 4OKDA 1AFVL 2DD8L 2D0HA 3LH2H 3ZL4H 5BMFL 1CXHA 3HUJB 5E6ID 3QRGH 3DMMB 2XZQL 1DFBL 4OBSA 2ATKB 3G6AA 4KVNH 5E24E 2DJUA 2PYEA 4U1GB 4XB8A 4MNQA 2GIYA 1UYWL 2HKHL 4TSCH 5CEYA 1I7ZB 4B5EA 5ACZB 3FOLA 5J6GB 1AC0A 4N90E 4GW5A 5F7NC 3S35X 1MI5D 2XRAL 1MIML 1Y0LA 5I1CL 4WI2A 4WI3A 3NTCL 3QUZB 5GJSH 2EICA 4AEFA 3AMLA 2XTJB 5CSBA 1LDPL 3UCRA 3MRIB 2ZCLL 5I6XC 3QO0A 2Z92A 2AJSH 3T3PE 2IGFL 4OZHE 5DUPH 4KTYA 5FGCB 4Y16A 5KSAB 2P5WE 3OAYH 3L3HA 5C0JB 1MHEB 3IDXL 4XPFL 4P59H 4ZUVA 1GGIL 2WUCH 4UBDD 1CE1H 3UTTA 1J8HB 3WS3A 2BCKA 4LLQA 5D1QC 4GAGL 4NO3B 4U1JA 2VXUL 4FFZH 3FONA 1MRFH 3PGDB 2I5YH 2JLLA 5IEHB 3IS0X 3KAAA 2HFGL 2P8LB 2ADJB 5JR1H 1JTPA 1YPZF 2HA1A 1QFUH 1T21A 4JRXB 5IBUB 4ZFOA 1YECH 1U6AH 2GK0B 4GAYA 3RBSA 3R1GH 1RU9L 4GXUM 2ARJB 3LEVH 4QRPB 3KPMA 4HXBL 4WEBL 1T7VA 1SY6A 5C71A 4MNGB 4AIXA 5T3XE 3MO1A 4PJ7F 1U8HA 1AR2A 2VDKH 3TBWA 3W0WA 5D4QA 3CLFL 4Z7WF 4JG1H 2OXGA 3H9YA 5E8NA 4RFNB 2NY6C 2XN9D 4NUJB 5BS0A 5C09B 2XWTB 3I6LE 4XPBL 5HHOA 3QXDA 3GI8H 1OARH 4CJ0A 1UA6H 2FJGB 5D7IA 5SWSE 5JMOC 5KVDH 5FYLL 1EJOH 2KL6A 2BOBB 3HZVB 4LPCA 5TDPB 1Y18B 3LV3B 3QDJB 3BGFC 4LSPL 3GMMA 4JFEA 5INCA 1OF2B 1MIEH 5AG8A 2CMRL 3F7QA 3JUYA 4KMTL 1ODAA 2BXZA 4MX7A 1NANH 1BIIB 3MRJB 3UJJL 4PJ8D 5F9AC 1R6VA 2Z4QB 4NM4L 1T2JA 4YGVA 1ITBB 4PJFA 2ADFL 3AS2A 4F15B 4MD5B 3FN9A 4Y2DC 1XGPA 2I24N 4ISVB 5F70A 1N59B 1QOKA 5I66A 1I9RL 5HHXH 2YD1A 3FTGB 4YDKL 5AYUH 3LKOA 5C9KA 1QA9A 1UM6H 3HE6D 1VA9A 1AGFA 2BNQE 4Z18A 3JV5A 4JDZA 2FO4B 2R15A 1D5XB 2WIMA 1FPTL 3AS0A 4OD2A 3X11B 1NCDL 2PXYC 4M7LT 1NGXB 1G7PA 4HPOH 4U4BA 4MQXD 1IM3B 5IB3A 3QCUH 4NWTL 5FV1L 3FRUB 4S1DD 1A1OB 5IBLD 4O2CB 3S88L 3NFNA 3MJ9L 4QHMB 3GSNH 5EB9A 3DVNB 1NCTA 1QFWL 5GGQL 3SQOL 2EIZA 4M93B 4D3CH