5FGRA

Crystal structure of c-terminal domain of shaft pilin spaa from lactobacillus rhamnosus gg - p21212 space group with yb heavy atom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
b'TYERTFVKKDAETKEVLEGAGFKISNSDGKFLKLTDKDGQSVSIGEGFIDVLANNYRLTWVAESDATVFTSDKSGKFGLNGFADNTTTYTAVETNVPDGYDAAANTDFKADNSSSDILDAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell surface protein SpaA
publication title New insights about pilus formation in gut-adapted Lactobacillus rhamnosus GG from the crystal structure of the SpaA backbone-pilin subunit
pubmed doi rcsb
source organism Lactobacillus rhamnosus gg
molecule tags Cell adhesion
total genus 26
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fgrA00
5IEHB 2VDQH 4NKDA 5EO1B 3O2DH 4JFXB 5D7LD 3BKCL 4JFFD 4PJIB 3LQAH 4TNVK 3UDWA 1L7IH 3P9MA 1B6DA 5C0AE 4DJMA 1TCRB 4K55A 4PYHA 2W1NA 4HJGA 1I8LC 1A7NH 3MLSL 1YNKL 2VZ3A 4ODHH 4RIRB 1F3JA 1KT2B 4XBEH 5IEKA 3FT2B 1RZGA 1UCBL 2DYPD 5BS0A 2GY7B 4L3AA 5I6XC 1FN4B 2JCCB 4QRTA 3UYRH 3LKPB 2A6IA 1MCOH 4MA1B 5J1TC 2CIKA 4HXAL 4BELD 5F9OL 3G04A 1K8IB 2IH1A 4KZDL 3LB6C 4P2OC 1BZ9B 4JFYA 1RZ7L 5GSRB 4CJ1A 4JG0L 3WEXB 5CZKA 3WKML 4I5BA 4PS4H 1S7WA 5I1DB 4BK4A 4OLXL 1NGXB 1T5XB 4PJFB 4F8QA 1SEQL 1NEZB 1CLYH 4ORGA 3TT1H 1E6JH 4DGYH 5D5MF 5E6ZA 4C55A 4ELMB 4KPHH 1ORQB 1A1NA 1CDUA 1G7QB 3SDAA 3B9DA 1VGEH 1UJ3A 3L6FB 1KULA 1A2YB 3CIQA 3FQNA 5DRNA 5ESQA 3IAGC 3MBXL 2X89A 1HNGA 3FMGL 3RKDC 3OXRA 4HWBH 3G6JE 1BBJA 1BX2A 1PQZA 2V7HA 2ZCLL 1DTUA 1A6VH 4XP6H 4PJAA 1WZ1L 4BH8B 3RU8L 1NQBA 2OK0H 4LEOA 1X5IA 4XAKD 3VW3L 5CSZA 2PCPB 3GI9L 3CH8A 4XVUD 4F58L 1MNUL 4WHDA 5CD3A 1I4FB 4XCNB 1JGDA 4YHIB 1IM3B 2P5WA 3BW9A 2CMRH 1T1YA 3OBAA 4NRZA 4PJ5E 1UACH 2DD8H 2GIYA 1S7RB 3W9EB 2DKSA 1KLUA 1IQDA 3SDXE 4I3RH 2O5ZH 4YR6A 2C7UB 3OSKA 4ONGL 4Q9RL 1LD9B 5F89A 3KPRB 1YNLH 3HMXL 3TJHD 2ZCHL 4JFPB 2X1PA 2J6EH 4KJPC 3DO7A 1C16B 1LMKA 3QDJE 4NFBA 4QXTB 3LRHA 1NCAL 4QRSA 4WDIA 3QXAB 2HFGH 3D3VE 2X4UA 4F33B 3W81A 4PRDB 1AP2B 2BJMH 1OTSD 4MZ3A 1KNOA 4OAWB 1H8SA 3BP7A 3DMMB 3TLRA 1RZIB 1J8HB 1NKRA 4JDTH 5F6HI 4G6FB 5JA9A 1BQHG 1RHHB 1IAIL 3DWTA 4EI5D 4G80A 5IFAH 5GRVL 3V9FA 1NCWH 3KR3H 4PTUB 3WS3A 3O3AB 2YPVH 2JB6B 1KB5L 5CZVH 4NM4L 5DDHB 3CH1B 3ZKMD 2W9EH 4Q0XL 4YK4C 4U1JA 4Z76B 1JPTL 4IRJD 4I18B 4QHNB 1FGVH 4FFVC 2H8PB 1TZIA 3GSRB 4HK0B 4ONFH 1IGMH 3VXRD 4M00A 2ZSWA 2NNAB 4X80H 1S9XB 4JM4H 3VFGH 3MREB 3KLDA 1KF9B 3KXFE 1JVKA 5HVHC 4X6FB 3VDCA 3S3JA 1FG2B 4I13B 3MR9A 4LGSB 1BP3B 5E8EB 1DBKL 2Z93B 2AXGB 1NGYA 3PQYD 3RVVD 1J0ZA 3BI9X 4I18C 2P5EE 5CS7A 2DBJA 3VFWA 2FLRT 4PGBA 1U8IA 4WTXA 3GMQA 4OCSH 1FJ1A 2YUXA 2Y72A 4P59L 2PR4L 1BBDH 5E2TL 5GGRB 1QBLH 3ZE1E 4YHZH 3MZGB 3SBWC 4LEXH 4IJ3C 3T3PE 3R1GH 4GRWH 4X6BA 3C8KB 1XCTA 2DS4A 4D2NA 1VGKB 4HJJL 2NZ9D 3LIZH 3P9WB 4H8WH 4KK6D 4TVPH 2HJKA 4XNZC 2GCYB 5J4MA 4FQ1L 4TULL 3RUGF 4PJ9B 5JXAH 3VXSE 1RK1A 2R56H 5F6HJ 3AROA 2C1PB 2XRAH 3UTSA 5DFVD 3MRMA 1AO7D 1F13A 5FUOH 1BVZA 5FEBA 4P4KC 3MNWA 5F88A 3OJMB 3WIHA 3E0GA 3B5TA 5HHPA 3FKUS 4ZOBA 2YHGA 3GUTB 4EEEA 4PRIA 4U1SB 3HE7B 1CS6A 3OKNA 5CJOH 1DQLL 1MFCL 2FL5B 3K2MC 4U0RB 3LEXB 25C8L 2XT1B 3VXTA 3MOAH 1IEBA 1XF4A 1ZXQA 5K9JL 1ZLWK 3O4OB 1Y0LA 5FYJU 4P5TB 3O8XC 4AENA 2X9WA 2HH0L 4Q9BA 1JYVA 2HT2C 4YEEA 1OD7A 3EYOA 1KB9J 3FQUB 1OSPH 4ORZC 1SJHB 4LLYB 2NYYD 2ARJA 4AG4L 3FT3B 3D39D 1NGQL 3HE7C 4N8PA 4U1IB 3VG0L 5FHAL 1FL5A 4UNTA 4X4YA 4MCYA 4J3WA 1EGJH 2X41A 4WTZG 5L8KB 1RJLB 1FV1A 1P1ZB 4JVPA 1UC6A 1RULL 4DZ8B 1OD9A 2PO6B 3GSXB 3A6CH 3QDHA 2X4NB 3PGFL 3O4OC 4Q9QL 5EZIH 5GGRY 2P46B 3JVGA 4LLUB 5BRZE 1WF5A 3LPFA 2PTTA 3VCLA 1A6TA 2ZCKH 4DVRH 5CAYB 5JPMA 3QDMB 3SGJA 2H2PD 5D2LF 5FA4A 3LS4L 3FB8A 2UWEB 4ZUUA 4KRPD 3D2UA 4F3FA 1UJTA 3FN0H 4FQXC 1CU4H 1AQKL 2CR3A 2UZIH 4PV9A 5FK9A 2WIMA 5A3ID 3DX6B 4K71C 3X11A 2BVQB 2AGJH 4RX4D 2KPNA 3Q6GL 5IB5B 4PLOB 4KI5C 3D1MC 4RGNE 2DQHL 3PL6B 3RGHA 3T4YB 3JXAA 3ZYOA 1H3TA 4PBVC 4ZUSB 3DRTA 1CL7I 1XH3A 2R1XA 2IF7A 4HLZH 5I76B 1T83A 1NFIA 3MV11 4Z5RA 1QBAA 4UAOB 2AS5M 4H0IA 5CBAA 4C83B 3VDBA 5HVFB 3WSQL 2W0LA 3VXOB 1ZOXA 3R8BB 3VG9B 1UXSB 1XT5A 3SDDC 2P42B 5DMGD 3HUJF 1K6QL 1VKXB 5H37G 1AHWC 3C9NB 1AR2A 2DWDB 3MNVB 4G8GA 3T0EA 4M1DH 4NQDE 1CIUA 5IMOB 4Z7WB 1NFDF 3BGFB 4LCUB 4NWUH 1RD6A 2YKLH 3DHMA 2PUQT 3GIZH 4TUOA 1RUAH 3C6LA 1AC6A 4N0FA 1HZHH 2CJUL 3WE6A 5HY9B 2M8XA 4CMMB 1BD2B 1HSAB 4G3YH 1FFQA 4P2YA 1RZJL 4JQXC 1WWCA 3MV8B 4HUXB 3EIFA 4LLVB 3PQYE 5ETUB 3VG9C 4OGYH 3ULSB 4P46A 1I3UA 3O2DA 4NZRL 3VD4A 5C08D 4JO2H 1REIA 3SJVE 5B22A 2Y07H 2FHBA 1DLFL 2IANA 2FX8H 3VFSB 1IEHA 1NC4D 2W9LA 1U0QA 2E9BA 3QULB 4UT7H 4XVJH 4UU9A 4ODXB 2EDKA 4JB9H 4K8RL 5I17A 3CD4A 4RFNC 2FX9L 4EDWL 2YMXL 3EYUH 3EOAB 3QCTH 2AI0H 1W72L 4NGHH 4ENEC 2BHYA 3L1OL 1HSBB 2VNCA 4ALAH 4NQEA 1NLDH 4DAGL 1QSVA 3DUUB 2VYRE 2WMPA 1NMAH 1KTLB 5D1XD 3F58H 3KYKL 3GSNH 5JHDE 4LHUD 4MD4B 4YDIL 2OTUA 1CK0H 1A6AB 2GJZB 5FFLA 5MEQB 3I6LD 3ZT7A 1UA6H 1WFTA 3P4MB 1NBYB 5JPNA 4U3HA 2E9IA 3IDUA 5EC1B 4JDZB 1CZ8L 5JDSA 2V2TB 5HDQH 3ETBF 1ED3B 4KY1L 5SV4A 1PZUB 3GMNA 3N1PC 3ALPA 4NO5B 3BPCB 1FP5A 1TFHA 4RMTA 2Z35A 1FYTB 1DR9A 2GI7A 3Q0HA 2OTWB 1SYVA 2O5YH 3LMJL 1PKQA 4HWBA 5BXFA 1GGUA 4XP5L 2Y9RT 1I8KB 5EIIB 3P0YH 1OSZA 3CSYB 2R69H 4KQ3H 5LBSL 2FRGP 5EO9A 3QG6B 3ARGC 4MJ2A 3D39E 2VITB 1X6LA 2ZJSL 3HPJA 5D8JH 1JHLL 3MLUL 4P99A 5ISZD 1BIIB 4UDTB 1XGQA 3WO4B 4R4BA 1MWAB 5GGQH 3ARBC 4DOHB 2J8UA 3GO1L 1VFAB 4Y19A 4NZUL 3QCVH 3ARWA 4M7LH 4A6YL 3TJEL 4NHCH 1ZEAL 4NOBA 2Y06H 1AGFA 3VA2C 5HI3D 1QVOB 2P7TB 5DHXB 2J6EA 4W4OC 3TO4D 3GI8H 2BNQB 4U2YA 3UPRA 1F90L 1EHAA 3BVNA 5C07B 1LO3L 2A9NH 3RVWD 3ZE2E 4K8RD 2CLRB 3QEQE 2G9HA 1W0WA 3W0WE 4XP4L 3TV3L 5C0RL 2YUZA 4Y0GA 2VIRB 4WUUE 2K9UA 4MQTB 3D0VA 5D9SA 4EUPH 5KN5B 2PXYA 3O9WB 1KCSH 1U2CA 2DLHA 3BRFA 3FTGA 5EU5B 4G42B 2C3WA 2YD5A 2YSSB 4XRCA 3LPWA 1A47A 1EAPA 2WAHA 4MD0A 4X4ME 5ITBH 4ZQKB 5DZLA 4KVNL 2F19L 5ACLA 4TTGA 4P2RA 4YDJB 1X4XA 1YEJH 4NRXB 5GZND 2AABH 1H0DB 4XCCH 1YC7A 4YBLB 3HE6B 2DI8A 2HN7A 3C09C 3IXTB 2QADD 1IAKA 2F53A 3NFSH 4M61B 3K2UL 4M1CC 4F7CA 2ATPA 4JM2D 5F1KC 4Q6IA 4BQCA 1JI2A 5SX5H 3MUGB 4QGYA 5LQBL 5DJCB 4FQJH 4L3CB 4N0YH 4OSUL 4GG8A 4JPVL 1E6OH 4CL7A 2DTML 4N0UB 4RQQA 3PWVA 4C56A 3KPSB 5ELIA 3DO3A 1H3PH 1GSMA 3MMEB 3RRQA 3UTTD 1FNEB 4P2QD 4BUGA 4RMWA 2ERJC 4MCZB 1HHIA 1EFXD 1N4XH 1E4XI 3UP1A 5IB4A 5IGXH 1JN6B 1T0NB 3E6FA 2IMMA 4PG9A 4XZUA 5DVOA 3PJSA 5HGDA 5L2JB 1S7QA 2JELH 1E4KA 3DSNA 1ZLVH 4JFZH 1PLGL 3MLYH 3PGDA 4NJAH 1QFWH 4NO3B 4OZGB 4UOW0 1QLFA 3V4PH 1Q94A 1QD0A 4YHOL 4DFHA 3OGOE 5TDNB 2BSSB 3SDYH 4ZAKD 1AGBA 2IAMA 3LOWA 3BPLB 4MQXD 2G5BA 5C0IA 2JCCF 5GHWH 1JZ5A 1TQCB 4J8RA 4HPYL 3EHBC 2A6KB 1BVLB 3D18A 2ICEB 1QSED 3QCUL 3O11A 3U0WH 4AT6B 3CFJA 4X7EC 3ZKND 1LEGB 3CSGA 1KELL 3F7VB 3IDYB 4K07A 1ITCA 3PV7A 3TF7C 4PJFF 5J6GB 1ONQA 2X9YA 3FCTB 1JV5B 4HUKB 3JWOC 5BOZG 1N8ZB 5I1IL 3CFEA 4MLSA 3TFKC 4ELMF 5IJKC 1S7TA 2P24B 1EIBA 4N68A 3LKOA 2FATH 3VGFA 4KRMB 2UUDK 2VSCA 3BWAB 2OR9L 1XEDA 1A6UL 5HDBF 2VISB 1DANT 3GKZA 5CEZH 1EZVX 4CMHC 2Y7QA 4OZHE 1A4JB 3ILQC 4DTGL 5D5MA 3RWIB 4ODVL 4NNYB 4NNXA 3QUML 3Q1SH 5FO8B 2OJEB 5MHSD 3T3ME 1UB5B 3FB5B 1F4YL 1CXKA 1ZA6B 3C60A 3VI4F 1D6EA 1GH7A 2BVEA 1EGJA 2HKHL 1VADA 4KTDH 3BN3B 4JFEA 4U3CA 1WQVT 2JK5A 4D9QD 1AXIB 4CVZB 5TQ0H 3ZYIA 4FZEH 2VUOA 3NFPB 5D7IE 3UTZB 1DN0B 2XN9E 1EJOL 4D9LL 3M8OH 1X5KA 3QFJA 5DRWB 2GW5A 5FV2A 3BEVB 2W60B 1NEZG 5GZOD 1QYGL 2BX5A 2QSVA 3DUHA 4G8EA 4GG6B 2XTLA 5DHVH 4MD5A 1CT8B 2O61B 5TDPA 4IMLB 5GGSB 4Z7UE 2AKRB 2BXZA 5T1KA 3P9LA 2VLRE 4YE4H 5DUPL 5F9WB 3ZE0E 4AK1A 2XPGB 4I77H 5H35A 2IADB 3VMNA 4GKSA 4JLRB 1FFNA 4DWHA 1GGYA 4FQIH 1D5ZA 3T1FB 4U7SA 3X3GH 1U8PA 2NR6D 1N5YH 5DMKB 3AY4A 4MGXA 5KVGL 3X13A 4XWGL 1IILE 3IU4H 5FYLD 4NO2A 5CEYB 5KVDH 4NKMB 2AJYL 1X6NA 1ORSA 1HXYB 1LO2L 2H41A 4FTVD 2EYSB 3MPCA 1KGCE 3TBVB 5BS0E 2SEBB 3MXVL 3HC3L 3CCHA 1K5NA 5AD0A 5K59F 2QQLH 4N90E 3MRLB 3RNQB 2OYPA 4YH6A 1OPGL 3S5LB 4OM1L 5E00B 4BQ8A 1MQKH 5GS2H 2DIBA 2D03L 5EOCJ 3TZVA 5GGVL 2PYEE 5DWUL 1IQWH 3QHFH 4GKZB 4KKBC 3TA3A 4PRHD 3DETC 4AM0B 4QRRB 3GHEH 2HFEB 5ANMA 4LSQL 2FWOB 3C8DA 3SE8H 3FQWB 1TQBC 1CF8H 2DQFA 1DVFD 2RCSH 3VXUA 3A67H 1Q0XL 3KS0J 5D6CB 1QO3A 3N9GH 2CUMA 4JHAL 2MSPA 1IL1B 3B6SB 3VJ6A 5GGSY 3RWDB 4N5ED 2BRRH 2F54D 4XP1L 5JOPD 1QOKA 5DC4B 2Z4QA 2ORBH 2F9BT 2BK8A 3GSNA 1GZQB 2FX7L 2NLJA 3O2WH 1T21A 1G7LB 3BQUD 5ESAB 3QWQB 2Q8BL 1S78C 3BGAA 5IW1B 1S3KH 4ZTOH 2BNUA 4MDIB 2VDRL 3VFRB 4JO3L 1IC4L 3U6RA 1P4BH 1RJYB 3CDGB 1II4E 2P5WE 1F02I 5F7HA 1CVSC 1NCNA 3BT2H 1BQLL 4GKOA 1EHNA 1S7VA 2D4DA 4X5LA 3RUGA 4M93B 2FDBP 4EOWH 5J57B 3ULUC 5IHUH 3FONA 3MV9D 3H9SA 5DUML 2AJXL 1PDKA 4UUJA 4NPYA 3HB3C 1CGXA 4U1LA 4FRWA 1URLA 2X05A 5MHSE 3ZHLA 4OLWH 4HK3J 3ZL4L 4KKLC 3MLWH 4WHTB 3SQOL 5T5FL 1QPPA 4P3CL 3MRQB 1ZWIA 2IBGA 4P5MB 4WI3A 2ITCB 4P3DA 5EU6A 4WI6A 1AKJB 4GAFB 5GS3A 1WZKA 3C5ZC 5EBWA 5J7CC 4B5EA 2V7NB 3F12B 3K8LA 1IRAY 4OCXL 1HCVA 2V6HA 3WO3B 3U4AA 3X3FH 1OTTC 1N6QH 4KI5F 1OOAA 1RUML 3NH7H 1MLBA 1VCAA 3L3GA 3IXAA 5FO9B 1AQDA 4ZYKB 3CLFH 5IB1A 2A83B 3G6JB 5ENWA 1T0PB 2F8VA 4XMKH 1VFBB 2NY0B 2ADIA 3KYNA 5CCKL 1ZA3B 3VA6A 4AEFA 4G43B 1I1CA 1A6VL 2VXSH 1MREL 2X4OA 1GZPB 4JR9H 5FDWB 3RVUD 1OGAA 2VDLL 3DVGB 4EUPA 4MNQB 2M2DA 1U93B 3T2NH 2FJHB 1NJ9B 5DVMA 1SBBA 4U1MB 3MRBB 5D2LA 5E8PA 5C0DA 4Y16A 5BMFL 1IGFH 4LLQA 4I9WE 4PJCE 3H9HB 5HHOD 1PG7H 3MC0A 1D9KB 1S9VA 5T1LB 4PJXB 4PREA 4IOFC 3BP4A 4LVEA 5KSUB 4KK8C 3NCBB 4JN1H 1OLZA 1BJ1H 5AYUL 1KLFA 1CFQB 2YPLA 3ZDZE 4Z0BL 1CG9A 5J13B 3RTQD 1IZKA 2H9GB 2YN5A 4GW4B 2BVTA 1QSFD 4U1GB 4MSWB 2JB5H 1JE6A 1HNFA 1CFTA 4F80A 3CDYA 3N06B 1HQRA 2AJZB 1A9BB 4OCYL 2VSDA 3KPMB 4PBXA 2ATKA 1AGCB 4J4PA 1D9KC 5CMAA 1J12A 2VLJA 1AGEB 2M26A 3HUJA 5DD1H 3CXDH 3RFZC 3QAZC 2G2RB 3ZYJA 4ODUB 1BLNB 1QFUL 4UILL 3G08B 4Q97A 1NFDA 1UM6L 4PJBF 4U1NB 5EBLA 3FAXA 1CL7L 2EIDA 5E1HB 3NA9H 3SGDH 4X6DF 3BZFB 4WO4D 1E27A 1HQ4B 3EO1A 4LSTH 5DK0A 4HKXB 1MCIA 2ZZUT 5K9OB 3RDTA 2R1WB 4AIZA 4S1QH 1T7WA 5CZVL 4M5ZL 3QA3A 1Q1JH 1R5IA 3IRZA 3ARYA 4MJ5A 1FO0L 5ICXB 4KMLB 1CDIA 1YECL 1IFHL 1KJ3L 5L2KA 4GW1B 2GJJA 4X6CF 2DDQH 4Z9KB 1TJIL 4QRQB 4QT5B 3DXAD 3WCYA 1NBZA 3CVIH 5FECB 3KPPB 5HHMD 4U6XA 3LEVL 1FNGB 4X9HA 3KGRA 5D7LB 3L5WB 4JFFB 3OTTA 3JSSA 4LF3A 2QQKL 5E2JA 1ROWA 3PF2A 3TT3H 4LOUC 2I9TB 5DURD 3HS0B 3TPUB 3WFZA 4OD3L 1M7DB 3B8YA 2A9MH 1MRCH 5LAXB 2JJTC 1CLOL 4UBDD 1C5BH 5J0BA 3EDKA 2DYPB 5J3HC 2YRPA 4JJ5B 3L7EA 3WFDL 1T66C 5JMRA 4PG2C 1S5IH 4KKNA 2NY5L 1Q9WA 5HYSB 3MRCB 5ID1A 5E99L 3V6ZA 4K3JH 1ZVYA 1MFBL 1DUZB 4QTIH 4X6EB 5GXBB 2GSIA 1U3HA 3V6OA 4Z7OE 1MUJA 2YRZA 1KIPB 2VZSA 2NY6C 5L9DH 2QQQA 3VXNB 3VFTA 5KBNC 2B4CL 2AEPH 2IBZY 2ZP0T 4PGDA 1UXWA 3MSPA 3G6AB 5D1ZD 4AEEA 3U83A 1KPUB 1LO0H 1KC5H 5CD5D 1X4ZA 5D1QA 4MQSB 1RMFL 4RDQF 3JTTB 2XY2A 4JQIL 3LH2L 3UXFA 5I73B 5HHNB 3I2CH 4X8XA 2ZUXA 4OGXL 5JLZB 5KG9B 2OL3H 1NUNB 2VQTA 3B3IA 4JZJA 2Q20A 3BIKA 4HWEL 4UT6L 1BAFL 2LAAA 1MJUL 2C3VA 2E8YA 4PP1D 5DHVA 5DMYA 4PRPA 5TE7L 5C70A 1LVEA 1H3XA 4HMEA 3T0EE 1QFPA 2AJVL 3GM8A 1NCTA 3NCJH 2X4SA 3NTCH 3LSOA 3TN0D 3MCLH 1JGEB 3N1GC 2CKBL 3L3IA 5FB8B 4JVUA 1J5OL 3RL1B 5DD3H 2R4SH 2E6QA 1AY1H 1RV6X 3X12B 4TN9A 2CDGB 2NY1D 5EC2A 2ICWB 2VXQL 4AL8L 3JV5A 2OQJA 3TBWB 1CDHA 1UB6A 1LEIB 1U92A 5DS8A 1T1XA 4TUKH 3QYCA 5D4QA 3KPOA 1RZKC 4X8JA 5KTEH 4YDLC 4XHQA 5EWIH 5IV2A 3QQNA 4RBPH 1XIWC 1NBVH 1J1XH 4G8FA 3T2PA 4NQCA 1MI5A 1HINL 3WJLA 1EX0A 1WTLA 3BZ4B 2DQUL 1ZANH 1JCKA 1KLGB 3NFNB 1T2QH 3VWKA 3MV7A 5MP6L 4LIQL 5I74B 4PBWD 4PLKC 2NTSP 1EEYA 4OB5H 3E8UL 1I1FB 1YEGH 1CFBA 2EDXA 3EYSH 4EI5B 1SBSL 1H3UA 3DECA 3PWNB 1B9ZA 5IROA 1J1OL 5LG1A 4OQ1A 4NCDA 1ITBB 5FYKL 4HWZB 2V17H 3PP4H 1YEHL 2JKXA 4I2XB 2H3NB 1JK8A 4JFQB 4P49A 1A7RH 5C0BE 1GRWA 3BKML 4CDGC 2VN4A 4FQQA 2BCKA 1MIMH 4IRJB 4LLMA 4YX2L 1OP5H 4MXQD 4C4KO 3I84A 3HC4H 4XPTL 1S9YA 1U91B 3MA7B 1G9NL 4RGNC 3ARDC 3VXRB 4EN3D 5HYQB 1MJJB 3QXWA 1INQB 1AD9A 5EO1A 1TTUA 4JFXA 1J0JA 3BD4A 1UGNA 4H20L 3ZKMC 2DLFL 1RZFH 4P2OA 1JPSL 3NCFB 1T20B 2MHAB 1TCRA 1JYXA 1BZ7B 4N8CH 2Z0BA 2X09A 4IRJC 3PQYB 4ODWB 4OZFH 5IMMA 4HCRH 1KT2A 4MQ7B 5KOVC 4XP9L 3FT2A 4YWGL 2B2XH 1NCDH 4LPTA 1JUFB 3OAYK 4YHMH 3QDGD 3IB4A 4NSKB 1E4XL 1FAIL 2JCCA 1A1MB 3FHAA 3LKPA 1BMGA 5CBEA 2Z8WC 3T4AB 3PUCA 2XKNA 4LLDB 4UTBL 1A6PA 4TYUA 4XPHH 4HT1H 3VGHA 4IHOB 1K8IA 4M3KB 2KZWA 5I8OL 3KDMB 5GGTH 2P8PB 4D0DB 1BZ9A 2GJ6D 1ZLSL 3H42L 1UEMA 4X9FA 2HTLC 4CN6A 4UDUA 5CLTA 5I75B 3RVVC 4F2MB 5I1DA 4PJFA 5BOPA 1NEZA 2EE9A 2DM7A 1AO7B 5IMKA 5C2BH 4ELMA 4KJYB 2X4QB 1ORQA 3H8NA 1G7QA 1HHHB 1E4WL 4Z78B 3ARUA 4L8CA 5FM5O 4MVBC 4XBGB 5HVGB 4ZUTA 4KGJA 2QSCL 4HG4K 1P7QD 1NLBL 3CLEH 1UEYA 4KK6C 3RP1A 5FYKD 2OXGA 4K7PL 4Y4HD 1YPZB 1KB5B 4KMQA 3ESUF 1N26A 5BW7C 5HHVL 3VH8B 1I3GH 4RMSA 2IMNA 3UZQA 4G6JL 4XCNA 2VLME 3QPXL 4YHIA 1IM3A 4P2RE 3TYFB 4RA3A 4IS6A 5GISL 5A40E 5CLWA 4LARH 3U46B 1S7RA 5C0CD 3W9EA 3MCKB 2W65B 2AEWA 2GK2A 2VZ1A 3P40A 2BRQA 1ZE3C 5TPWL 4HKZB 5KSAD 4U6YA 4K9EH 4L4VD 4J3UA 3GM0A 2RBLA 4L4TA 4R97B 4JFPA 1LDPL 1WT5A 1P69B 1LP9B 1QP1A 2X70B 2FZ3B 4H5SB 4C56E 2AK4D 3X14B 3MFFA 4IDJL 4QXTA 4K7PX 3ROLB 5EOQL 4MB5A 4IRSC 3QXAA 1BOGA 3DRQB 5DXWA 2R39A 1HHKB 3R0MA 4DGVL 3RAJL 4KRPB 3EOBB 2VABA 3DMMA 1RZIA 3VFMB 1MIEH 1VHPA 4S11A 5ALCL 4ZG1A 1T7XA 4H88H 1TJGH 4JRXD 4ZFZA 4HPOL 3QH3B 5BVPL 1DBMH 2PW1B 3E2HC 3P30L 4WWKD 5FKAB 4GFTB 3ARFD 5EU3B 3V8CA 5CGTA 3O3AA 1NDGB 3ESVF 4JFDD 3WD5L 1ZHLB 3QO1B 5IOPB 4XNYH 4YUEH 3BRGC 5DDHA 3JV0A 5EUKA 3MRJA 2EE3A 1F4XH 4O9HH 2GT9A 4HV8B 3PWLB 3EKCA 3RWFA 4IRZL 4BFIB 4Z76A 3ES6B 4X7SL 4I18A 1QPXA 4QHNA 2H8PA 1M6OA 4LQFL 4D8PB 4JFOA 1GGBH 1EDQA 4HK0A 3UJIH 3UO1H 2MQ0A 2A77L 1U8KB 1I1YA 2XZCH 3BP6B 2DKMA 4WGVB 4WU7B 2NNAA 1S8DB 3SBWA 3GRWH 1MRFH 4FS0A 4PJ8D 2YPKB 3HNVL 5H2BA 1HH9A 4MS8C 5TH2B 4MB3A 4LCYA 1DSFH 1FG2A 3JV4B 3U0PB 5I1HL 1KACB 2VXUL 2Z93A 2R23B 4FA8A 1A7QH 1QLRB 4L3EA 1JJUA 4KDVA 4R96B 5DRXA 3DGCR 5INCB 1U95B 4ZFOL 1JFQL 4LSUL 1XF1A 1NKOA 3ULUF 1DN2A 1F4WH 1U8LB 3C8HA 5F1NB 4N0YL 2UVFA 5C08B 4P4KA 2Y4SA 5E70A 3CUPA 1NC4B 1B0RB 2KQMA 3S35X 1RURH 3C8KA 5F9JB 3S5LG 1FFRA 2W0PA 1VGKA 4JFEE 1OTUD 3JWOH 3N50A 4KVCL 2GCYA 2GJ6E 1I1AD 3VFNB 1HIML 5C0JB 1YQ2A 1RFDL 5JW4Q 4BH7B 4PJ9A 5LGJB 4RISL 3TBSB 1QG3A 1D5IL 4M48L 3UYOD 5D1XB 1CBVL 3MROB 4LHUB 1BJ8A 1X5LA 3MUZ1 4XMPL 1C7SA 4KUZL 3LPGA 4Y7MA 5T3ZD 4XNXL 1GGCL 43CAB 4LIQE 1X9QA 5BO1L 1S7UA 5C09D 2WSKA 1BWMA 4BZ1L 4M8QB 3T77B 3GUTA 4YXKL 5E5UB 3MODH 2H2SC 2P43B 1XF3B 4U1SA 2WWKT 3HE7A 1UENA 3RZCD 3LEXA 1OAXL 5KVEL 1ACZA 4R26H 4TTDC 3IDIB 3QPQD 4KROC 3UBXB 5ID0B 4GXUM 4ODSH 3C5JB 3BO8A 2LABA 4QTHB 3PHQA 5E94A 2OL3A 2PTVA 4HIIB 2VERN 3O3BB 1RUQL 2YXFA 5D7JD 3FQUA 3WNKA 3LKNA 3BKYH 3O3DB 1JNNL 1DQQB 2VE6B 4FQXA 1QACA 4TOYH 3FT3A 4OTXL 4HGMA 3TVMD 2FATL 3CFIC 3G6JF 2DIAA 5ISZB 1RJLA 3RY6C 1ZTXH 1ND0B 2NXZD 3EZ8A 3GSXA 4DZ8A 4YPGB 4U49A 1P9MC 1QEWA 4LLUA 3MBEC 3U7WH 3HLAA 2R4RL 4QRPA 1YY8B 2IG2L 4LCWE 2NTFB 3ARSA 2LE9A 2UWEA 3QO0A 4M02A 3TO4B 1OP9A 4KJWD 1JHKH 1XAUA 2R0LL 3SDDA 4PJXF 2DL2A 1S7SA 4FQLH 2AEQL 2YZ8A 3NIFE 3SDXF 3O6FD 1AHWA 4G7VL 1RUPH 5IB5A 3V5DB 1C1EH 3L3HB 4KK9D 2FECI 1JIBA 5DO2D 3QXTA 5SWZE 4G9FD 2C4FU 3PL6A 2G60H 3T4YA 3VXUE 4A2LA 4U6VL 3OB8A 4YFLF 3QUYD 4ZUSA 5DK2B 1QRND 5MENE 1MPAL 2E7LC 1FC1A 4GMTL 5FGSA 2Q6WB 2D7OA 3CFBA 3HI5H 3QHZH 1C7TA 5CINL 5HI3C 1CICD 4JQXA 4RFOL 4C83A 5IG7B 3QSKB 3EJZD 1UWGH 3VXOA 5AZ2L 1UXSA 2ESVD 3UX9B 3U36A 5SWSA 1DBJL 1VKXA 1QHPA 4R7NB 3C9NA 2DWDA 4NCC2 1L9NA 5IMOA 2AQ3A 4G5ZL 2VMFA 4GO6B 4LCUA 3MLRL 1YDPA 2LU7A 2B39A 4TQEL 2HP4A 2XQYK 4O00A 1YJDH 2E7CA 5HY9A 5HHQB 3DARA 2QADB 4G9DB 1HSAA 3UZEA 1J0HA 5A1AA 4JM2B 3W11D 2KH2B 4XTRC 1G7MA 5D7KE 1XZ0B 3IKCB 4LLVA 3S36L 1MHCA 5DMIL 3ULSA 2R0KL 3H9SE 4JY4B 1NH6A 5LXGH 2ZPKH 4X6DA 1TITA 5ILTL 3C87A 4JQVC 4L4JA 3UTTB 4P2QB 4WHCA 4YIQA 5E4EB 4YHYB 3VXMA 4UIKL 3HRPA 3T65B 3QULA 1EFXB 4NO0D 3C2AL 4OZFA 4ZTPL 4ELKB 4HCRA 5EU6E 2NZIA 4GT7A 3WUWB 1A21A 3R06B 2HWZH 2C26A 2XTJD 3V4UL 3HMWL 4JREC 2OI9C 4X6CA 3DUUA 4B7IA 1HK6A 1KTLA 2NY3C 1YMME 3P4NB 4G6MH 4K3DH 4MD4A 3TC9A 3ZKSD 4ZAKB 3PWPD 3ULUH 1A6AA 2GJZA 3LHPL 5MEQA 1I3VA 5F7DB 5GGTA 2DQIH 4AMKH 4WTWA 3P4MA 1KPRB 4YHYC 1NBYA 3S4SA 1CYGA 1T7YA 5E03A 1A1OA 3T3PF 3DV6B 2QSTA 4JDZA 3ARGA 4OT1H 2F58H 3P0GB 2V2TA 4IBLT 1QSEB 1F00I 1DL7H 4YXHL 1I9RL 32C2B 3QRFM 4Y2OA 4NO5A 3HI6L 1X5XA 3BP5B 1OGAE 4JRYA 1FYTA 4MWFB 3RX7A 3Q48A 3LZFH 5E5MB 4YHKH 4ZAKC 3S3SA 4OI8A 2Y36L 4LVOB 4FG6C 4OFPA 3RY4A 1RU9L 3SEPA 2BVPB 5E6IC 2UY6A 5DK3A 1Q72L 3B4NA 5C7XL 5JXEC 3REWB 4CAGA 4W4OA 3WJJC 1RVFH 1QR1B 1UWEL 3ZDYE 1SEBB 5E7FA 2AW2A 2VITA 2IFGA 3MA9H 4TPRL 4UV4L 4DKAA 4P3WA 1BIIA 3ARED 1YMHB 4UDTA 4WI9A 3G6DL 3B83A 3THML 4TSCH 2H45A 2EXYC 3V6FB 3ZKNC 3VRIB 3I6GB 5DQDH 4PLJC 1VFAA 1UM5H 4XAWH 2QV2A 4LVOC 5HYSG 5CILL 3RA7L 1INDH 4YXLL 5C6TH 4S1SH 3RZWA 1XGTB 4KJQC 2P7TA 5DSCB 1QQDB 1WBYB 2VLJE 2R0WL 4O4YH 3HUJE 5CSGA 3SGKC 1I8MA 2VDKH 1I9IL 5CHNA 1MFNA 1DLHB 3EO0A 4J12A 2CLRA 2H6PB 3MNZB 1KFAL 1NFDE 2R29H 4BUHA 1FLRH 1G7PA 1FLTX 1IGTA 2G5RA 3ZSTA 1ZHNB 7FABL 3MV01 3EO9L 4XPFL 1PYWB 1A7BA 3C08L 4BSJA 1YQVL 2DQEH 3ELAT 3WHE0 5KN5A 2ZG1A 4HKJB 4UIMB 4Y5YC 3JTSB 4NUJB 4ZUVB 1K4DB 1KCLA 5F8QC 4JPKL 4F9PA 1RUKH 1OAQH 4MNGE 2YSSA 3SCMC 1MEXH 1IGJB 5L2KE 1GHFL 4WI2A 3SPVB 4ZSOA 4WCYL 1FH5H 1CE1H 5FUZH 2AK1L 4WUKL 4YDJA 2VC2H 5E4IA 4NRXA 4Q58C 1H0DA 1HYSD 1JF1B 4GSDH 5J12B 3HE6A 4R0LC 3QQ9D 3IXTA 4PJCB 2WUBH 3QJFB 43C9B 4M61A 4Y4KD 4I4WB 3LKQB 3U9UB 3IDNB 3VD3A 4EJ1C 3MUGA 1R3LB 1LWRA 4L3CA 4B7LA 3FFCD 4U31A 3GRWA 4N0UA 2O5XH 4FTVB 5DD6B 5C0GB 4GRLC 5JOEA 1PKOA 3S34L 2XY1A 4MCZA 3IFLL 5DD5H 2RFXB 2J4WH 2APFA 3JUYA 2GUOA 3IDMB 1T0NA 3P11L 5BQ7B 2FGWH 3QUMB 4HFUL 5L2JA 3PDDA 5I16A 4RGOL 4PRHB 4NO3A 5KVMC 3LKSB 4JZOB 1U3YA 3FZUD 5DJDA 3KLSA 3ZTNL 1DVFB 3OZ9H 4NQSB 5JNYB 1A5FH 4UINH 4APQD 1CXHA 3MJ7A 1R3HA 4DKEL 4ZS6D 5IJKA 1WSST 2GEEA 4M43L 1XGYH 2EDWA 5F97E 4H26B 3RIFF 3F7PC 4W68A 2F54B 4XC3L 3DYOA 5KZCD 1BVLA 1FZMB 3QR2A 2AVGA 3CSPA 4XNQA 1EZVY 1KCUL 1TNMA 3KHQA 5F7YC 1TETL 2WM0A 3BQUB 4AT6A 1PGRB 4MJIE 4PIRF 4PRPE 1W8NA 3F7VA 3QI9D 4P23D 5IFHL 1ZT7A 1FORL 1OLLA 4JO1H 5IBTH 5J6GA 3IFOB 5JIIA 5D72L 1JV5A 1N7ML 1T4KB 1J10A 3H6JA 4AH2A 3VWJD 1SVCP 2P24A 1CD8A 1WIUA 4N5EC 3BWAA 3MOBL 1HDMA 3O81A 1R24B 3JBG7 4BZ2L 1YEKL 3CC5B 4DW2L 2HTKD 4XB7A 1RJZB 2BOCB 4KKAC 1TJHH 5LVEA 2NW3B 3MV9B 5DVKA 3RWIA 4OLYL 4QF1B 1PSKH 4HH9B 5KAQG 3RVTD 4JCMA 3ZDXE 5FO8A 2OJEA 5IM7A 4P0DA 2XZQH 4LPVA 4X99B 1DQTA 2FBOJ 1IC5L 2R9HC 1EJ6A 1KV3A 3FB5A 1MI5E 1ZA6A 1G6RL 5HGHA 4XVTH 3BJ91 3FOMB 3OXSA 3I02B 3BPOB 2FSEB 4CVZA 1IBGH 4J7RA 2BSTB 4EBQL 5KS9E 4KH2A 2WLYA 4HDIB 1KIRA 3NFPA 3B9KD 3UTZA 3DSFL 3MV7E 3GBMH 1DN0A 3MYJB 4PRID 4FABL 3JV6B 2KKQA 5DRWA 3BEVA 4GXVL 3WFEL 2W60A 3EDJA 5GRUL 4J2XA 1NMBH 1FPTH 4S1DD 3MJ8B 2YA1A 1A7PH 4GG6A 1DQML 5A2JH 4J3TA 2APVA 4OF3A 1CT8A 2HRPL 4N0CC 4IMLA 5GGSA 4JO4H 3QIUD 5ECJE 1Y6NR 5HXMA 4W70A 1GPOH 2XPGA 4LCIL 4R4FH 3VRJB 5KG9A 3TCLA 3WIFA 1H5BB 2IADA 4FQ2L 4YHNB 3O4LD 4JLRA 3MRFB 4NC0B 4JVWA 4I3GA 3ZE2F 4XI5D 5C0EB 3F5WB 1ZAGA 4JHWL 5DMKA 5KSBE 3BKCH 4UTAL 4P9HL 3PE9A 4GS7B 4WEBL 5C6WH 1KYOK 3BOVA 2EC9U 2UVEA 4PJIE 3MLSH 5T5NF 1YNKH 5HHOB 1RQ5A 4F57L 4M4RA 1UCBH 3QEGL 4Z0XB 4M8VA 1JNLL 1PX3A 3G5VA 1JGUL 1HKLL 4XMLL 1HXYA 1U8JB 3TIEB 3D25A 2EYSA 3RTQB 5ALBL 3MRDB 3T0EC 4OIIL 2SEBA 1IZJA 1KTRL 1QSFB 4HXAH 5F9OH 2CQVA 2JCCE 3GB7B 4KZDH 3FT4A 3RNQA 3O6KL 1UVQB 5E6YA 2LTQB 3L7FB 1RZ7H 3C6LC 4G7YL 4JG0H 2X44D 1DCLA 3SKMA 3WKMH 4R2GC 4GKZA 2DQCL 4OLXH 1SEQH 4AM0A 4QRRA 3AS0A 2HFEA 3QNXA 1TZHB 3ULVL 2YA2A 2FWOA 3NBNA 4ZO6A 4PJFE 4HIEB 4P46C 2XOTA 1YZZA 4HUWA 4L29B 3MBXH 3LQAC 5E9DD 3FMGH 5B38B 5D6CA 4ELME 4E5XA 5FYJD 1KPVB 4AZ8A 1IL1A 2ZCLH 4WO4B 4G8GD 5AZEL 4CUCA 2LTQC 3RWDA 3BAEL 5K9KB 1WZ1H 3RU8H 3VW3H 1S5HB 3LQZB 5EUOE 3W9DB 2V9QA 3GI9H 2H32H 4KUCF 4F58H 1MNUH 5HDLA 1JZ2A 1G7LA 5ESAA 2CDEB 2Y5TB 4JY6B 4GW5A 1A3LL 4ZNEA 1WBZB 4LVNC 5A16B 5BVJB 1WCBB 2EDFA 3IYLW 3CFKB 1VSCA 2XNAA 3VFRA 4RWHA 1CR9L 1RJYA 3CDGA 3DXAB 5JO5B 5I8EB 3WNNA 2GKIA 5HHMB 3B8SA 1I9EA 1JWSB 4IOIB 4WO4C 2I5YL 3B43A 4ONGH 4Q9RH 5DQJB 2IAND 5AWNL 3HMXH 2IQ9L 3IFPA 5DURB 2ZCHH 1T2XA 1I7ZB 1UZ8B 3OB0K 5EIQA 2NXYD 1BFOA 3KPRE 1XR8B 2D0GA 3RI5F 1U8NA 1NCAH 3D48R 1JHTA 1DEEA 1TTFA 2ENYA 1UWXH 2Q76A 4NQED 4JE4B 1N64L 1FFOB 1BEYL 1CGYA 1WAAF 4P5MA 5CEXB 3RVXC 1HOCB 3OR6B 6CGTA 1AKJA 1O7SA 4J3SA 4NFCA 4QLRA 3UAJD 2V9RA 4J23A 1J8HE 1IAIH 1PEZA 2UY7A 4X9IA 4QY8A 3V5HB 5I8CA 2Q86A 1U8HA 4ZFFB 1S7XA 1YEIL 2V7NA 2WBJD 4PLNC 3F12A 5HYFA 3VXPB 2Z8VC 4PB0L 4OZHF 1KYOJ 5D1ZB 1KB5H 4NM4H 4LHUG 1UQSA 2ITDB 3DBXB 3QUZD 4Q0XH 5FO9A 3TYGL 2D2OA 1JPTH 3T3MF 2J5LB 4KMTL 1FL6B 4Y2DD 1OAUL 3G6JA 1PD6A 5MEPB 5E8NA 1QBML 1GC1L 3P77B 4PB9L 3H7BA 5EN2B 5HPMA 1Z6JT 1GZPA 2EKSB 5FDWA 3AGVA 5K59E 2ZNXA 3DVGA 3TN0B 4RWYL 1U93A 4HS3B 3NPSB 2IALB 2FJHA 2GFBB 3BXNB 4HGKC 5D1ZC 3UBXG 1JNJA 2MKLC 1P84K 4JJHA 4U1MA 1YN6B 5L88L 3MRBA 4ODBD 5H94B 4IOSD 1DBKH 4YFEA 3LDBB 2ICWI 1ZHKA 3H9HA 3KJ4B 1D9KA 2XWTA 4Z7UF 4Y19D 5T1LA 1MWAL 2NY1B 3DROA 4PJXA 4CNIB 1MF2L 3SDXA 5KSUA 1JPGB 5IVZB 3G5ZB 3V52L 1CFQA 2CK0L 4P59H 2PR4H 5E2TH 2HKFL 2H9GA 4GW4A 3QDJA 4MSWA 2GTZB 3TN0C 2O93L 1T2JA 2Z31C 3V7AG 5J1SC 4HJJH 5J56B 3Q3GA 4FQ1H 4TULH 3KPNB 3NACL 3KPMA 4I48B 4JDVB 4PJ7B 3NGBC 2AXFB 1MVFA 3FRPA 5IQ9B 4Y1AB 1OWRM 3W5MA 2FECL 2G2RA 3MGTB 4ODUA 5I18L 2PXYD 1BLNA 2A6JB 3G08A 4JANB 3QIWD 2B1AL 4U1NA 4GQ9L 4HIJB 1ZHBA 3F7QA 4G8IA 5CJ8A 3J8F7 1FZKB 2YN3A 4U1HB 3BZFA 2VDNL 5B39G 1OQXA 1PVHA 3U4EA 2CK2A 4PV8B 4L8SB 4PY7B 5K9OA 1DQLH 1MFCH 5FM5M 4GKNA 25C8H 2NY5C 4WFHE 1YEEL 5K9JH 2JJTA 3STZA 5F44A 1MQ8A 4WEMB 4Y5XB 1UZ6E 2ZUTA 1YA5A 3FO9B 2HH0H 3HCVA 1A6WL 2F53D 4GW1A 1HXMB 4PG2A 1CD1A 2IPUG 4QRQA 4D3CL 5E1AA 4QT5A 2GQHA 4EN3B 4WW2C 3KPPA 3AUVA 2BSRB 1SJXA 4AG4H 1G7JB 5DZOA 4LFHD 1FNGA 3VG0H 1NGQH 4JFFA 3WMSA 1RK0B 1CIDA 1V3MA 5FHAH 1GIGL 2FR4A 3GJFH 3DJ9A 5E2UL 1RULH 2I9LA 4NJ9L 3ME0A 2P5EA 3HZVA 3PGFH 4Q9QH 5ESVA 2F74A 4MXWL 2DYPA 3OAUL 1CQKA 2B8OT 4JJ5A 2Y23A 2X5PA 2NY7L 4RAVB 2DLEA 1NMCC 3QDGB 4OQTL 4ODTL 5HYSA 4EN3C 3LS4H 2EH8L 4OFDA 3OKEA 5MI0C 5C71A 3ORJA 1AQKH 3CFDA 1DUZA 2DI7A 4X6EA 3QDME 5EH1A 1HHGA 2UWEE 4YGVA 1KIPA 2GJ6B 3QEHB 4TVPD 2OBGA 1DBBL 3D85D 3WUWG 3Q6GH 4L8BB 2FBJL 3VXNA 1X5JA 3VXSA 2DQHH 2C3GA 4NN7B 3VGAB 3Q6FA 3G6AA 1G7HB 5DJAB 4RMVA 5ICYB 1KPUA 3LVEA 4Z77B 4P4RB 3QQ4B 3ULVE 5A2IH 5JW5B 35C8L 4TSAL 1AI1L 3JTTA 1LK2A 2BP3A 1VACB 4QOKD 3WSQH 1ZS8B 4FXLA 3IDGB 1P7QB 5JLZA 5F7LB 3L95B 1XCQB 1K6QH 4Y4HB 3C6SB 1T89A 4NWTL 4UV7L 3WN5C 5B8CC 3MCG1 1YEDA 4MA7L 2C4XA 2IQAB 1JTOA 2HT3D 5C3LD 2ADGB 4LASL 5JUEL 4Z7WE 3MRHA 1JGEA 5FB8A 2CJUH 1P7KB 2MCPL 4F7EA 4OV5A 3RL1A 1K85A 2YWZA 1DQDL 4J3VA 5C2UB 4V1DD 1RZJH 4Y89A 5C0CB 3X12A 2P48B 1BD2E 3EYQD 4HZLB 4NFDA 2ICWA 5KSAB 1FAKT 4L4VB 3MV8E 4WJ5B 4NZRH 3QHTC 4LGRB 1WGOA 4ISVA 3QWRD 1DLFH 4X7TB 1ULVA 5IJVB 5L8LB 1PY9A 2AK4B 2P8LB 3QWOB 1QA9B 3AY4C 3VMOA 5CP7A 4K8RH 3B2VL 3QFJD 4JCLA 2FX9H 4EDWH 2YMXH 4IIQB 1ZSDB 3BZ4A 1W72H 3HNSL 3L1OH 4BZYA 4PJCF 4DAGH 1HEZB 3P73B 2OXHA 3NFNA 1Q9KA 1MHEB 4YC2C 3KYKH 2BFVL 4JAMB 3MGAA 5T1KD 4YDIH 4JRXB 5JIPA 4X9GA 1VA9A 4R4NC 2HMID 1I1FA 5JQ6L 3ZDZF 4O51B 3ARXA 2F5AL 3PWNA 3ARDA 1F6LL 3MO1B 1J87A 2APTA 4WWKB 1E28B 5C9JA 3ARFB 4OZIB 3L3OB 1HHJA 2BZDA 3B9EA 4JFDB 5MERB 4HWZA 4I2XA 1CZ8H 2H3NA 4JFQA 3EJYD 1YYLL 1BF8A 4XH2A 1MJ8H 2K7PA 4YBQD 2H1PL 2JIXA 4KY1H 3TZVC 3QUXC 4OLEA 5J6HA 1EAJA 4IRJA 2DIJA 3TA3C 5F6IB 5F3BB 4NKIL 3LMJH 1WK0A 4NQDA 2F15A 1U91A 4XP5H 5BJTB 1FYTE 4PUBL 4HFWA 5HYQA 1MJJA 3CGTA 4WWKC 4HWUA 1INQA 4ZXBC 5LBSH 4PJ8B 2H32A 2HLAB 2XZAL 5D93B 4PGZA 4S2SA 2ZJSH 3MLUH 1JHLH 1BVKA 1JPST 1AC0A 2MHAA 1J8KA 1MCQA 3TGXA 3PQYA 5F6IC 2V5TA 1KENL 4MQ7A 3GO1H 1ERNA 4NZUH 3KYAA 4A6YH 5KOMC 3SJVA 5IQ7L 3TJEH 3WS6A 4DOHE 1OP5K 3RKPA 1ZEAH 4NSKA 1YY9C 2XG5A 1A1MA 3V0VB 2D7MA 3OGCA 3HMXA 1IGCL 5HTSA 4IHOA 5KSVB 2ZWLT 1F90H 2P8PA 1KTDA 1LO3H 4DVBB 1I1AB 2NW2A 2BNQE 1UYWL 4U7KA 4XP4H 5C07E 4F2MA 3KWWB 4WFFE 3TV3H 2OR8A 5C0RH 3S96B 4PYGA 1H3WM 4J6RL 1AO7A 1ZVSB 2X4QA 2ADFL 3EYFB 1HHHA 5C09B 4Z78A 1IJ9A 2Q7NA 5FF6B 4YO0B 2I60L 4GBXD 2MPAL 4F15C 5DJZA 2W0FB 4LSRL 1OTUC 4Z7OF 2L7UA 1KB5A 2UZXB 5T1MA 3RZCB 3UBXI 1Q9LA 2N56A 1X44A 2F19H 4KVNH 4M6ML 3VH8A 2MJWA 4K7PY 4POZC 2A0LD 2J2ZA 1X5AA 4XBPA 3KYOB 4NN6B 3K2UH 1MFAL 3MRNA 1MCLA 5D7JB 4RZCB 3MCKA 3VD7A 4JFHD 2W65A 5LQBH 1G0DA 1SYSB 4HKZA 5C9KA 3DVFA 4OSUH 1EEUA 4L9LB 1NUDA 1Q9OA 3D39A 1UG9A 2DTMH 2XFXA 4JPVH 3TVMB 2DMBA 2Y5EA 3AMKA 5DR5L 3PIQA 5FGBC 3DUSB 4HAFA 2PETA 3TM6A 2NXZB 2X70A 2FZ3A 4GRMB 3KPSE 3G9VA 4U1KA 3X14A 5TJWK 3ROLA 3EOTL 1W0VB 4JEGB 15C8L 2B5IC 5FOBA 4X98A 4Y16C 2Z92B 2DI9A 3RWEB 1PLGH 5L0QB 4CN4A 1DQJB 4GUPB 3EOBA 3VFMA 1RIUL 2DQJL 4L9LC 4YHOH 5JOFA 5CGYD 3NABL 2X4TA 4L5FL 2A74B 4OD2B 4OZGE 3O6FB 4RX4A 2HA1A 3QEQA 3CDFA 3W0WA 4G9FB 2PW1A 2VLLB 1F11A 5FKAA 3DIFB 3UZVB 1ES0A 2E27L 3QUYB 1QRNB 3VFUA 4HPYH 1ZHLA 3QO1A 5JW4M 4KKCC 4NUGL 1DUYA 3IAPA 5ERWB 4YDKL 2ICCA 3AC0A 1SJVA 5IKCA 4HGWA 3QCUH 1MCBA 4HV8A 3PWLA 1IGYB 3MRGA 5BV7B 1TENA 2EYRB 4BFIA 1CICB 4J4PC 5HD8C 3ES6A 4JPIA 4WI5A 1KELH 2HLFC 3F7YB 2K3TA 4MNGB 2ESVB 4P9ML 1L0QA 3RWJB 5GJTL 1LE9A 4N8VA 4X4MA 2WINB 1HI6B 2JLLA 5I1IH 1DE4B 1U8KA 5DO2C 1NGWB 2BSED 3M1BB 3BP6A 4WU7A 1S8DA 1BFSA 2BHUA 2L0DA 4WWID 2NY4D 2EZ0D 3QIBD 2OR9H 1S9WB 2WK2A 1IC7L 1A6UH 4GAYB 5TH2A 3L3KB 2IPTL 3R8QA 3JV4A 3WLWC 4HLJA 1AXSB 3U0PA 1JZ6A 3RDTC 2R23A 2BY3A 4XWOD 1R3IL 4FQCL 2R2EB 4DTGH 1IMHC 1H3VA 4R96A 4Y4FC 1T6VN 5INCA 4WW1B 4ODVH 4M62L 3SKOA 3WFHB 4NKOB 2YRLA 3QUMH 1OARL 3AAZB 2Q7YB 1U8LA 5F1NA 2FLBT 5C08A 1R3JA 1F4YH 2KBGA 3GJFA 2HKHH 2J3SA 2CGRL 2BY0A 1NC4A 1B0RA 4NO0B 4TSBL 5F9JA 1BPVA 2GAZB 5CSBA 5C3TA 1LE5A 4OJFL 1C12B 4K23L 4TUJB 4B41A 1EJOH 4D9LH 4BQBA 2XTJB 5LGJA 1QYGH 2VXTL 4OIBA 4QXGL 1L6ZA 2VKWA 3HZKB 3PWPB 5J89A 3HC0B 4GG6E 5B38G 1FDLL 3IDXL 4OKVB 4KI1A 5DUPH 1EMTL 4M7KL 4HIHA 5C0FB 1AR1D 4M8QA 3T77A 1TVDA 1BM3L 2IWGA 1OP3H 1KJVA 1U3HC 3HR5A 2ZSVA 1T03L 5DUBA 3RY6A 4OF6A 3N85L 2XTJC 5FCSH 2YD7A 3P9MB 3IDIA 5KVGH 4XWGH 3D69A 3VE0B 4PJGB 4Y5VC 5ID0A 5F7EL 1CGSL 3MBEA 3DV4A 4QTHA 4D9RE 5F96L 5GRJL 1EA9C 1WAAA 4HIIA 4J3XA 4XCYB 4RAHA 5AAMA 5IEKB 1RZGB 5EFIA 2AJYH 5CJQL 3W2DL 4S0TD 5ACZB 1DQQA 2VE6A 3S7GA 1V3KA 3HG1D 1LO2H 2A6IB 4MAYD 2XIDA 2CIKB 4FFWC 1KOAA 3MXVH 4OZHA 3HC3H 5CEZD 3AREB 2IH1B 1ND0A 5SX4H 2DJUA 3OWEA 2IFFL 1EEZA 2E5EA 3ZMRA 5I1KL 1OPGH 4UQ3A 4XPBL 4R6UA 4I5BB 5D96B 4QNPE 4OM1H 2E7LA 2YK1L 2V5MA 3WIIL 1TZGL 2D03H 2EE2A 4J1UB 2R2BA 4QXWA 5GGVH 5DWUH 2WUCL 4ZOCA 4I0PC 2W91A 2NTFA 2NY2D 4YHPB 4LSQH 5D1QD 1UJ3B 3FQNB 1OCWL 4QRRE 4I1NB 2XN9A 2Z91A 4UZGA 1CD9B 3AREC 1Q0XH 4PD4K 1WFUA 3L3HA 5D2NB 1BBJB 3V5DA 2V7HB 1X5ZA 4JHAH 2AJ3A 3MLTB 3RWGA 4PJAB 4DUVA 2XWJB 1KEGL 2HVJA 1W72A 4FZ8L 4QCIA 5CSZB 4XP1H 4Z7UA 2Q6WA 3P4LA 3GK8L 3O45B 2HAZA 5EULV 3U2SA 2FX7H 3HNTL 2Q8BH 3AB0B 4K3EL 1VESA 2EYTA 2ZUUA 4PJ7F 2W9DL 1WC7B 5IVXB 3VWKC 2VDRH 4FN0A 5DJ8B 4JO3H 1IC4H 2WZPD 4H1LH 1KLUB 3HZYB 1IQDB 2WANA 4YR6B 4WI4A 3HFML 1BQLH 1LQSR 3F7RA 4WW2F 2D31B 5EZJB 3DTXB 4PJEE 3DO7B 4AYFA 2RGSA 1T5WA 4QWWD 4N9GA 2FD6L 1M1SA 3K4DA 4WDIB 4LP4A 4Y4KB 1ZMYA 1A0QL 4NQCD 4OM0L 1ADQL 2X4UB 5DUMH 2AJXH 1XZ0A 3IKCA 4H0GA 1P2CA 3FFCB 4MJ6B 5JQHC 1IGIL 4XHJD 4JY4A 3U9PL 3ZL4H 5CIPB 3SQOH 5T5FH 1YNTB 4LLWA 3TNMB 4P3CH 4LL9A 3SGEI 3S8WA 3CVHL 5KVFL 1HYSC 4G80B 2PYEA 5E8DL 4OCXH 3KLAA 4A6YA 3O0RL 3GGWB 1N0XL 3VGGA 1RUMH 1IAOB 1FL3B 4GLRI 4U1JB 3P4NA 4DEPB 4ZAKA 1M7XA 4APQB 1F2XK 5F7DA 3GHBL 5I1GL 1FVEB 5F1IB 4CBPA 1TZIB 1DFBL 4QO1A 4MA1C 5E6IA 1KPRA 1KIQB 1Q38A 5EZLA 3HA0A 5CCKH 5JXEA 1EBAA 3DV6A 3WJJA 1YYML 1JL8A 2ZSWB 3ZTJG 1MREH 5EUOB 5KZCB 2CPCA 2CH8A 2VDLH 3BE1L 3LB6D 3KPTA 1KCRL 32C2A 4P2OD 3BP5A 4KFZC 5EPMB 3QI9B 4P23B 4MNQE 4KGLA 4MWFA 5E5MA 1PZ5B 5BMFH 4LU5L 3VFWB 4PGBB 3DGGA 3OMZA 3GMQB 1K2DB 1WUNT 3VWJB 1WEJL 1R3KA 5AYUH 3REWA 4W6WB 3L5HA 2X4PA 4PJXE 4LKCB 4Z0BH 3SGKA 3EW3B 1YUHA 4D0CB 5DT1L 5GRZA 4PRBA 3AM8A 2YUWA 3RKDD 1XCTB 1YMHA 3O3UN 2HJKB 3V6FA 3VRIA 1U8OA 3I6GA 4AJ0A 1ZLWH 4OCYH 1K3IA 3H9ZA 5SX4I 5CFHA 1WBXA 3MRMB 3WNPA 1XGTA 4Y5YA 5DSCA 1QQDA 1J0KA 1WBYA 1PG7X 1QFUH 2DQTL 3MNWB 4UILH 5I1AB 1UM6H 1KCVL 4XNUL 3L5IA 3B9KB 3SCMA 1CL7H 5T33L 1EO8L 3RIAF 1JPFB 4PRIB 3DI3B 1D5XA 3MNZA 1MJ7L 1MY5A 2HTKC 2RHEA 1WT5C 1YN7B 1EPFA 5I1EL 2Q8AL 3P3YA 2EDYA 2O26U 4XXCA 5CUSL 1ZHNA 3SY0B 5J11B 4KJPD 4R0LA 4M5ZH 2AP2A 2UZYB 1Y0LB 1FO0H 1U58B 4HKJA 3QIUB 4UIMA 4NUJA 1YECH 3V79C 1IFHH 5CP3H 1KJ3H 1K4DA 3MLXL 3DMMC 3EYOB 5A43C 4EKXA 3O4LB 3CDCA 1Z0MA 1TJIH 4NCC1 3NIFF 2ARJB 2GK0A 4GRLA 4DGIL 3HR6A 4B0MM 1FL5B 3LEVH 4NDMA 2YC1A 4L4TD 2QQKH 1FV1B 1BFTA 4KHTH 3NVQA 4KU1A 4OZIF 1OAZL 2DTSA 4OD3H 5D7LE 4JFFE 4PJCA 4XPAL 4M4PA 3QJFA 5TE6L 43C9A 4I0KA 2LAGB 4I4WA 1CLOH 4HHAB 3RHWF 4ERSL 3H0TB 4FNLL 3U9UA 3V4VL 5DLML 1R3LA 3WFDH 5JPMB 2NY5H 3QP3A 5FA4B 1AJ7L 3FB8B 4ZUUB 1A02N 1T04B 5K33A 5E99H 1MCSA 5C0GA 1MFBH 1HKFA 3VXQB 3PDOB 5F7MC 1AIFA 2EDOA 4HJ0C 4C57C 5BQ7A 1TTGA 2B4CH 3QUMA 3BUYA 3DRTB 3FB7A 3LY6A 1T3FB 2ZOKA 1G6RB 4ZS7L 1QLEL 4Z8FL 4JZOA 4Z5RB 4YQXL 3GMMB 1DVFA 1LDSA 1RMFH 1X3DA 2YR3A 5TF1L 5JNYA 5DRZA 4JQIH 3LH2H 5E9DB 2C9AA 2A2QT 4Z7QE 4OGXH 4G8GB 1QHOA 4HWEH 3CPLA 4UT6H 2F54A 2FIKA 1BAFH 1H8OA 1MJUH 4F7TB 1FZMA 5TE7H 1EHLL 1LGVA 2AJVH 4N0FB 4XAKE 3BQUA 4PJ9C 4QYOB 5E2WL 2CKBH 2VDML 5F71A 3FB6A 4FMFA 1J5OH 4CDHA 2AV7A 3AXLB 4HBQA 3IFOA 4L3ED 3ARZA 1T4KA 1WIOA 2R8SL 2VXQH 5M7QA 4AL8H 4M9OA 1UH4A 4P4KD 2IANB 5IB2B 4P48A 5E95B 1R24A 2NXYB 3CC5A 1CWVA 4U0RC 2CRZA 3MGOB 1RJZA 2BOCA 1HYRC 5INDA 3MV9A 3MRRA 2CDFA 1XGRB 5DJXA 1HINH 4HH9A 4LAJH 4P5TC 4NQEB 4PGEA 4X99A 2AJSL 2DQUH 3SDCD 3K80A 5EU7E 4L8DA 5FIEA 4NOFA 4KQ4L 4QHUB 1VEPA 5DYOB 3JWDL 3O8XD 2APXA 3I02A 2OTUB 2WV3A 5MP6H 3RNKA 4LIQH 2BSTA 3OL2A 2HT2D 3MXWL 2ARJQ 1OQOA 3E8UH 3ZDYF 2HVKA 1SBSH 2NXYC 1J1OH 4GAGL 2WBJB 1WITA 1MCKA 2VL5B 4M9PA 4GAJL 3SOBL 1SJEA 2PO6C 5FYKH 2DQGL 1Z5LB 5I19L 1YEHH 4R3SB 4LSPL 2DWEB 3KPLB 3QUZB 3BKMH 4I2XE 1N0LA 2PTUA 3SE9L 2DJSA 2OZ4L 3GFUA 4Y2DB 2VR4A 3NA4A 1SYVB 5GS1B 4YX2H 1PKQB 3VRJA 1H5BA 4XPTH 3UPCA 4YHNA 1U8QB 1G9NH 4FQXD 4N5UA 5EO9B 4G6AC 3VFVA 3F5WA 3OJ2C 2IBBA 1G9MH 4LRIC 3VXRE 3PL6C 1BFVL 4NN5B 4H20H 2QSQA 2DLFH 4K2UL 3C5SA 1JPSH 3ULVC 5DA4A 4KI5D 3QUZC 1WZMA 4AEHL 4R4BB 5HHOA 2VLKD 3WFCL 2J8UB 3BHBB 1FNLA 4Y19B 4H1LA 4UNVA 4UAOC 4ZOEA 2LVCA 2P8MB 5GS1C 1OB1A 4QRPD 4XP9H 5HI5C 4YWGH 4RMQA 1MHHB 2D7NA 1E4XH 1FAIH 1D5MB 3RTQA 3GMLB 5HGBA 4YGAB 5DEFB 4UTBH 1QSFA 3SDDD 1SVZA 1P4IL 3BGFC 4NZTL 2D7QA 5I8OH 1KEML 4FP8L 3L7FA 1Y6KR 1EVTC 1ZLSH 3H42H 1W0WB 3CJJA 3L5JA 3CXHK 1J9CT 2RJMA 4XXDA 1A9EB 2NX5D 3BN9C 2PF6A 4POYA 3D0VB 2OTPA 2PXYB 2VWEE 3OAZH 1H15B 1PFCA 3QIWB 4OGZA 3FTGB 4RNRB 1E4WH 1AO7E 4U6TA 1I7RA 1KPVA 4XRCB 2QSCH 5SWSD 1NLBH 1KJ2L 2X4RB 4WO4A 4K7PH 5TE4L 5K9KA 5C0BA 2ZUVA 3FO1B 3OHXB 4ETQB 2JF1A 2FEDC 5HHXL 1S5HA 5ADPL 2QQNL 5HHVH 2D9QB 3W9DA 5IFJA 5E08L 1YPZE 1I1RA 3NIDE 1MJ8L 5HVWA 1OW0C 2HN7B 1T0MB 2CDEA 2Y5TA 3MJ9L 4G6JH 1CGWA 1IAKB 1LEKB 1WBZA 3QPXH 5A16A 3PNWA 4R7DB 4NQVB 2F53B 5BVJA 4F7CB 2ATPB 1WCBA 4Q6IB 3CFKA 5GISH 4ENED 5JO5A 1HWGB 1HE7A 2XA3A 5TPWH 4RQQB 4IOIA 3PWVB 2APWA 2OMNA 5DQJA 3BGMA 1UZ8A 3VXMD 5CJXC 1WFOA 1LDPH 2P4AB 4BKLB 5CKAA 3BSZL 4IDJH 4M3JA 1IAMA 1XR8A 4OUUB 2FJGA 5EOQH 1LP9E 4PG9B 3B2UC 2JJUA 1LHZA 3PJSB 1S7QB 1L4IA 4OCRL 2EXWD 4DGVH 2BMKA 1M71B 3UJTL 3PGDB 4PJGF 1FSKB 1GC1C 4Q9CA 1FVDB 1FFOA 3RAJH 5IF0B 4LPYA 4GRWB 1CN4A 2C4FT 5CEXA 1HOCA 1AGBB 3OR6A 5ALCH 2VDOL 3KS0H 1CE6B 3IRPX 1UCTA 4HPOH 3NCYP 3GMOB 3I85A 5BVPH 3D85B 3NIGE 3CU1A 3V5HA 2YEZA 3P30H 2HG5B 1MCDA 2P49B 1XGUB 4J8RB 2BNRD 1IEAA 3ARGD 3WO4C 1BQUA 5D1ZA 3WD5H 4E41D 2ITDA 3DBXA 3O11B 5H37H 3A6OA 3DX8B 5F93C 3ZDXF 4CN1A 3S98A 4IRZH 3ARBD 3LS5L 4K9EC 4JRYD 1UWXK 4X7SH 4QOKB 4LQFH 5MEPA 4I8DA 2X7LA 3KYMA 4JZNB 2HJFB 3DVNA 5KS9F 3P77A 2A77H 2Q3ZA 3KNBA 5EN2A 2FH6A 4LDLB 4XGZA 2OCFD 3TN0A 2V9TA 2Z31A 1TNNA 1FO0A 2GFBA 3BXNA 3HNVH 1PX4A 2XA8L 1YN6A 5CP3A 2Y7QB 3BH9B 5I1HH 5HPOA 2VXUH 5H94A 3M17B 5CJ5A 3CXHJ 3UROR 5D5MB 2XWBB 4V1DB 1F6FB 2OSLA 2ZUYA 4NNXB 1B4JL 1T1ZA 3O9WC 4NC2B 2WLZA 2UYLB 1JFQH 4LSUH 4U0QB 1JPGA 3G5ZA 4F9PC 1D3CA 1UH3A 5I2IB 2DLTA 3K1DA 2MKWA 4MYWB 4MMZC 5LJYH 5C08E 5KSBF 3FO0L 3W82A 2BOBB 3QFJB 4KVCH 4YBLC 3HE6C 1HIMH 4X4XA 1RFDH 1G6VK 3CU7A 3KPNA 4PJ7A 1FYHB 2AXFA 4PJIF 3LQMA 5IQ9A 4RISH 2KUTA 2AV1A 1R5VA 1D5IH 2ZG3A 4M48H 1CBVH 1NANI 3WNLA 4XMPH 4ZNCD 3PV6B 5T1KB 4KUZH 4N9OB 1MCFA 4X9BA 4XB8A 1GGCH 4JANA 4XNXH 4S1RL 5IMLB 2HT4C 1V8HA 5BO1H 4HIJA 1LILA 2BDNL 4BZ1H 4WW2A 4HSQA 4KTEL 4GKSB 1M05A 4YXKH 3I6LE 5JDJA 2IH3A 4PV8A 1D5ZB 1SMAA 2VO5A 4L8SA 3LKRB 4PY7A 1F2QA 1U8PB 2LQRA 3CX5K 5FGCB 1OAXH 5KVEH 4OD1L 3MLVL 2ZOLB 3RWHB 4AY0A 5B21A 1OGTB 3MRIB 2ENSA 4Y5XA 3GSOB 4NO2B 4BFEA 3LN4A 5FYLL 2CLVB 3P0VL 1QBBA 1RUQH 5M94B 3OJDB 3D0LA 4AEIL 3FL7A 4EN3A 1WAAE 1JNNH 3BPLC 5BZDA 4C58B 1G7JA 4OTXH 2YZ1A 3IAQA 5IT2L 1TQCC 3CCHB 1K5NB 2QHRL 1OM3L 1I7UA 2CKBA 2W0KA 2J88L 5AD0B 4TRPL 1CDCA 4NQTA 2N4IA 3BDXA 1RIVL 5EUOF 5ISZE 3K8MA 1K4CB 3EHBD 1FIEA 4DK3A 2E7MA 3LRSA 3IDYC 2R4RH 4OBSA 5HYJD 4RAVA 3SKUD 1FCCA 2VKXA 3OPZL 3QDGA 3HTLX 3PG2A 3V7AE 3FQTA 2IG2H 5ANMB 4EQ2A 1ZV5A 2XQBL 3EFDL 1KTKE 3V0WL 2DQFB 1Q8MA 2R0LH 2AEQH 4YDVB 1A3RL 2GJ6A 1QO3B 3QEHA 4G7VH 4HUUB 3S3PA 4L8BA 3WN5A 5B8CA 3ROOA 1OWWA 1BQHA 3GJFK 1UM4L 2WWMC 5DC9B 2QL1A 4U6VH 2LU4A 3DNKA 3T0AA 1WJ3A 2I24N 4OZ4B 1G7HA 1MPAH 5DJAA 4BSWB 1XF5A 5ICYA 4GMTH 3HI1B 2BERA 2LVEA 1XMWA 5JW5A 5CINH 2BNUB 4GBXB 4RFOH 2Y6SC 1VACA 1IC1A 1ZS8A 5AZ2H 5I1CL 3ZSSA 1U8MA 3WXWL 3IDGA 1P7QA 3U6RB 2ILLA 1XCQA 1DBJH 1MCEA 1VB9A 5EZOL 4I3SL 4Y4HA 3OR7B 1JWUA 4PJHB 4KK5C 4G5ZH 2YD4A 2FEEL 2A73B 2IQAA 5DTFB 3MLRH 3RUGB 2J8OA 4TQEH 3WFBL 3CFCL 1BJMA 5HSFA 3FONB 3RI5K 1X7QB 2X1XR 3LEYL 5ITFA 4NPYB 4HXBL 4HZLA 3S36H 2EIBA 5F9WC 5DMIH 4PRNB 2R0KH 5IBLC 5IW3A 1Z0NA 5ILTH 4NP4L 1ZWIB 4HIXL 4X7TA 3OKKB 3MUJA 2FJFA 4UIKH 2P8LA 3RBSA 1V7ML 3C2AH 3UTTE 4P2QE 4ZTPH 5IR1A 3K0WA 3CX5J 4CRPA 3VDAA 4IIQA 4XVSL 5HGAB 4LCWA 3CZFA 3V4UH 4LPWA 3GMPB 3QUXA 3HMWH 4CGTA 5JR1L 3P73A 2VTFA 1ZKAA 3L3GB 1MHEA 3UTPD 3Q5YA 3BIBX 4KRNA 3OKDB 3LHPH 5IB1B 3I6KA 5I1JL 3BX7C 4X7CC 5SWZA 5IP4A 1YJDC 3MO1A 4WWKA 4OZIA 4ZXBA 4DN3L 4LPCA 5MENA 5MEOB 4JFDA 5MERA 4K3GA 1JTTA 1JGLL 3MACL 4EUPB 4HUVA 2LV4A 4M6NL 3ARTA 4DUXA 4YXHH 1I9RH 4R8WL 3HI6H 2FO4B 4JGUA 2QLVB 1QSEE 4ZUWA 1AE6L 4LVHB 3EDFA 4KKBD 3UJJL 1VPOL 2VDPL 2Y36H 3WUZA 1RU9H 3DETD 4PREB 2KDGA 2FYYA 3BP4B 3QXVA 1JZ8A 1DEDA 1Q72H 4O2EA 5C7XH 2N7AA 2NY4B 1CG9B 3QIBB 4PJ8A 1UWEH 2HLAA 3BUTA 4PJEB 1NC2D 2RB8A 1FHGA 4B50A 4LAQL 3STBA 5CIPH 4PGCA 3S37L 4TPRH 4UV4H 1OAYL 4Q74A 4UB0L 4DQOL 1IARB 1J1PL 1DBAL 4M7JL 1CFTB 1MAKA 1F3DJ 3G6DH 4GOSA 1HQRB 4WTZA 3THMH 4ESKA 3QXDB 4EIGB 2QTEA 4G6KH 2MTPA 4N1HB 4URTB 4OLZL 2DM4A 4WGWB 4PJDB 4U4BA 5HI4D 1UZ6F 3MRPA 3INUL 5CMAB 5CILH 3RA7H 1X5HA 4YXLH 1S78D 3V0VA 4GH7B 3QDAA 2AXJA 2W59A 3QIBC 5CZXC 2R0WH 4PRAB 5KSVA 4D9QE 4MA3A 3SO3B 3W5NA 1I9IH 4E42B 2CXKA 1KFAH 2WNGA 1E27B 5DK0B 4WFGD 4M93C 5DI8B 3KWWA 3NPZB 2ZUQB 4LMQI 4R90L 3S96A 4AIZB 1I85C 7FABH 3S37X 1YMMA 3EO9H 1JGVL 2WW8A 3QA3B 4X5XA 1R5IB 4ZD3L 4XPFH 1G0XA 3C08H 3ULUD 5F72S 1YQVH 1ZVSA 2DBLL 3EYFA 3H3PL 4ETYA 3FQRB 5C09A 3QFDB 5FF6A 4YO0A 3HB3D 5DFWH 3PDGA 4JPKH 5D6DA 2W0FA 2QKIB 1NBZB 5DF0A 4KKLD 1GHFH 2UWEF 5FGBA 2IGFL 2YD9A 2EC9T 2YD2A 4WCYH 4JKPL 3RZCA 1LNUA 1V7NL 4M6OL 2AK1H 4WUKH 5C0AD 2XACC 4NRYB 3A6BL 4C59B 5F8RC 3C5ZD 2XYCA 3FO2A 1F4HA 1TPXB 3KYOA 4X4ZA 4X5WB 4F37K 4C4KT 1T1WB 1OTTD 5FYLE 3ULVF 4RZCA 5TDOB 1SYSA 3RX5A 3HG1B 2VQ1B 4CVXA 4L9LA 3TVMA 2NY0C 4MAYB 5ID1B 3V6ZB 4HKBA 2EDHA 3EYVB 4M6AA 1UADC 3DUSA 4O02L 2GSIB 4HK3N 3S34H 3QNZA 4FTVE 4GRMA 3IFLH 3IFNL 4ZPTB 4A2MA 1MLCB 3RQ3A 2R1YA 3VFTB 3P11H 3MLZL 5DHYB 4ZFOA 4Z7WF 4HFUH 3CMGA 4JKLA 1UXWB 4RGOH 2Z92A 3RWEA 2NY2B 4GUPA 4X7FC 4S10A 3QQ3B 3QRGL 5D1QB 4PRHE 5F3HA 3OF6A 1Q0YL 2FB4L 3ZTNH 4OD2A 3O6FA 2CUHA 4IOFD 1I3RB 5J13C 4KK8D 4DKEH 2VLLA 3BIKB 4M43H 3DIFA 1MAML 4U1GC 2EIZA 3QUYA 5EIVA 5DHVB 4XC3H 4D94A 2X4SB 5L7XL 4JHZA 1KCUH 2F54E 1TETH 1IGYA 3L3IB 4JPWL 4LSVL 5JOPE 2EYRA 4PJ5D 4RAUA 4Y4FA 4MB4A 5IFHH 1FORH 4MNGA 5C0ND 2ESVA 4FXGA 1ZGLB 4F9LA 3UTQB 5D72H 5C8JB 1MH5B 1N7MH 1MFEL 2WINA 3IU3B 5EC2B 1DE4A 3REVA 3D9AL 4XX1G 1U92B 2FCBA 1T1XB 5DS8B 3KLHC 3WHXB 2I07B 3MOBH 3QDJD 4M7ZB 4GAYA 4X8JB 4KHTL 3L3KA 1AXSA 4BZ2H 1YEKH 2OP4L 3FOLB 1QNZL 4DW2H 4G8FB 3D3VD 2R2EA 1KJMB 4NQCB 2UV3A 1SM3L 4OLYH 3WFHA 4NKOA 1ZLUK 1KSRA 3MV9E 1LO5B 1IC5H 3VRLF 4UT9H 1G6RH 1TVHB 4K3HA 4WIQA 2C3HA 4EBQH 1MRDL 5DQ9A 1PY4A 2GAZA 5HJ3B 4CJ0A 3BKJL 3DSFH 1C12A 4QRUB 4QWWC 4FABH 4GXVH 3V95A 3WFEH 2CLZA 1FCGA 5GRUH 1KUMA 2QEJA 1OVZA 1TVBB 3GSQB 4LOUD 1DQMH 1RZKL 4Y5VA 4FQQB 1QKZL 3PWPA 2HRPH 3HC0A 4KZEL 2EEBA 5TGBB 4OLUL 5J3HD 5C0FA 2RIKA 3PWUA 5I6XB 4LCIH 1D7FA 3AU1A 4FQ2H 2XXCB 4HUNB 1OAKL 1SY6L 2DM3A 3KXFD 1AD9B 1XF2A 4YPJA 4NYLB 4MJIA 4JHWH 4P2OB 2VAAA 4JKKA 4P9HH 4UTAH 2NY6D 4XT1C 3U0TA 4WEBH 3VE0A 4PJGA 4YZFF 5JORA 3H7LA 1JMXA 4N1EA 5BZWA 2P5ED 5IMMB 1BQSA 1CFNB 4X83A 4XCYA 4NHUA 1KN2L 3ARRA 5EA0L 3TNNA 4I0PA 3G5YB 2DAVA 3AS1A 4F57H 2K7QA 4LFHG 5I73C 3QEGH 5HHOE 4HC1L 5ACZA 1JNLH 1JGUH 1HKLH 4XMLH 5CBEB 2XKNB 3DHJA 3I9GL 3BDYL 4Q7DA 1T89C 5ALBH 1OP3K 4OIIH 3AREA 4AQ1B 2ZUSA 5IESL 4XVUC 3O6KH 3S88L 3O2VL 1QSFE 4NIKB 5B4MD 4G7YH 3VXSD 4UDUB 1H9VA 4J1UA 1G84A 2DQCH 5B3JE 3P2TA 3TH4T 3CK0L 3T2OA 2XICA 3IJSB 5IMKB 1BGXL 4Y1AD 1JZ3A 4YHPA 5KS9A 3ULVH 3QUKB 3DLQR 3EFFB 4XCEB 4MA8L 1CGUA 3CVHB 2D7TL 1F42A 4L8CB 4ZUTB 3TJHC 3OV6A 5D2NA 3MLTA 2XWJA 3U1SL 1U36A 5AZEH 3BAEH 1QUNA 1FRGL 3U7YL 5EU7C 5FDYA 2YXMA 3O45A 4HS8L 1XIWD 1OTSC 1A3LH 1B6UA 4YAQB 4IS6B 4PR5B 3ABZA 3ARQA 1WC7A 5IVXA 4PTTB 5I74C 5DJ8A 3RL2A 1CR9H 4CVUA 1A14L 3HZYA 4OZGF 2HJLB 5KW9L 3FQXB 4U6YB 4EI5C 5DEGB 1H3GA 4K94L 5KSBA 1FQ9C 3DXAE 4PLKD 4L4TB 2I5YH 1Z3GL 5IEHA 5GS0L 5AWNH 5HHME 3WXVL 1G9ML 3FJTA 2D31A 2IQ9H 4PJIA 5EZJA 3DTXA 4E9LA 4CU7A 3MFFB 4O5LL 1AFVL 1RIHL 5BRZD 3STLB 4Y4KA 1BOGB 4TVSa 2IPKB 4RIRA 1GGIL 4YK4B 3FFCA 3CAFA 4MJ6A 1OT2A 1KB9K 4P57B 5EU4B 1D6VL 2VABB 1N64H 3BJLA 1FN4A 5CIPA 4HEPG 1BEYH 1YNTA 3FN9A 3TNMA 3UMTA 4LDEB 4M1GL 5EB9A 4ZFZB 8FABB 1JRHI 1IT9L 5LGHL 4RGND 3ARDD 4ONHB 4LGPB 1NCBL 1YEIH 5GSRA 3NCCB 3TIDB 1EFQA 3WEXA 4D0BB 5IWLC 5HVHB 1AD0B 4QHLB 4PB0H 2VZOA 3GGWA 2AQ2A 5EUKB 3MRJB 1NGXA 1T5XA 2JIXD 2GT9B 5FCUL 1IAOA 3RWFB 1FL3A 1EBPA 2B0SL 3ZYZA 1O5DT 3TYGH 3WS6C 4APQA 2XQYG 1FVEA 5F1IA 1M6OB 3IJHB 3L6FA 4KMTH 1A2YA 1OAUH 2ED8A 4JFOB 1KIQA 4LRNL 4NQDD 1J05B 1QBMH 4HLZG 3DX7B 1I1YB 4ZODA 1GC1H 4PB9H 2NZ9C 5EUOA 4IJ3B 3SQBA 4BH8A 2JE8A 2R0ZL 3OKLB 5H2BB 1HH9B 4RWYH 3QISA 4Z7NE 2PCPA 5I75C 1QFOA 4LCYB 1CLZL 4XNZB 2VWEC 5EPMA 3QI9A 4LCCB 4P23A 3TWCL 3VD5A 5L88H 5DFVC 2HTLD 1I4FA 4QXUL 4L3EB 3I3EA 1PZ5A 5DRXB 5DJ2B 4JG1L 1N3NB 4GG6F 5CWSB 1MWAH 1J88A 3CX2A 1MF2H 1K2DA 3VWJA 3GBLA 2OJZL 3SJVD 3V52H 4P4KB 2WIIB 2CK0H 2D7PA 2EEDA 4MAUL 4LKCA 3CUPB 3PWJB 3PXJA 4OV6F 1PBYA 2XXMB 4D0CA 5GS0D 2C7UA 2HKFH 4OF8A 1LD9A 4RMUA 4MVBD 3MX0A 1S9KC 3KPRA 3O41B 2WP3O 4PJHF 3HKFA 1B2WL 1C16A 4LCCC 2JJVA 5EOCL 3NACH 1KN4L 3SDCB 3J7HA 3GZKA 3O6LL 4F33A 4OFYA 5JHDD 1Y18B 4L9DA 4PRDA 4F8TA 1AP2A 3O8XB 4PJ7E 4OAWA 2C1OB 1MY7A 4Y1AE 5I18H 1PEWA 2NYYC 1S7UB 1J8HA 5I1AA 1ZT4B 2B1AH 3B9KA 5T3ZL 4GQ9H 4LSSL 1NAML 1JPFA 4R97C 1RHHA 1YN7A 2VDNH 3RY5A 2AXHA 4PTUA 3SY0A 2JB6A 3CH1A 4FFZL 4QNPF 3SDCC 1IM9D 4LPXA 5EORL 1YEEH 5FUCE 1U58A 3QIUA 4IRSD 2H2PC 3BO8B 3PHQB 5E94B 4KRPC 2OL3B 3VMPA 1FZOB 1A6WH 5A3IC 3O4LA 4DFIA 3LKNB 2HFTA 3GSRA 4ZPVB 3S35L 4D3CH 3CNKA 3T2QA 4FQXB 5KJRL 4K71B 3TBTB 1S9XA 1HWHB 4OCMC 1GIGH 1NUGA 3MREA 4X6FA 4GXUN 4OFVA 5E2UH 5C6PB 1F97A 4NJ9H 1Z9OA 1QEWB 2H26B 2VLKB 5E8EA 1I8IB 2CR6A 4HHAA 4QHMB 3H0TA 3HLAB 4QRPB 2AXGA 3HRZB 4MXWH 3OAUH 2NY7H 5DMGC 4OQTH 1F3RB 3EUUA 4ODTH 3QO0B 3GMRB 1T04A 2EH8H 1OL0A 1AGDB 5GGRA 3QDGE 1TIUA 1A22B 3SDDB 1S7SB 4HG4J 2P44B 1AHWB 1U2HA 4K7FB 3VXQA 3PDOA 3QEQD 3PGCB 3W0WD 1MHPL 1DBBH 3IDJB 4FOMA 4NBXB 2FBJH 1U3ZA 5L6YL 3NCYS 4PJEF 1UFUA 4YJZL 4WUUD 3QNYB 1T3FA 1BZQK 2NX5B 4MS8D 1G6RA 3BZDA 2YD8A 2ZNWA 3CFBB 2C1PA 2D4FA 4KV5E 4HX1B 3IGAB 35C8H 3GMMA 2VOTA 3M07A 1AI1H 4PJDF 4TSAH 1EO7A 5BV7L 1W8OA 3OQ3B 5E9DA 5IUSA 1NUFA 3U36B 2FNBA 5SWSB 4GMSL 1JMZA 4EUPG 4NWTH 4UV7H 3ZO0A 3DI2B 4F7TA 1YDPB 5FYKE 4MA7H 2FL5A 3ARPA 3CMOL 4LASH 4NC1E 3UYPA 5JUEH 4QYOA 3PP3H 4NNPL 3JWDC 4RFNB 2MCPH 1BHGA 4HQQL 4LHJB 5D1XC 3V2AR 2R2HB 4P5TA 3AXLA 1DQDH 1G7MB 2D0HA 4PJBB 1MHCB 3ZT5A 1NCCL 2EICA 4O2CB 4X6DB 5C0CE 1SJHA 4LLYA 1CTOA 1MFDL 3QZWB 5IB2A 4U1IA 1WZLA 2YD1A 4YIQB 2EDBA 3VXMB 4L4VE 2P45B 2XI9A 4NQUA 2H2SD 1NCUA 1P1ZA 5JZ7D 4OZFB 3MGOA 4YHLL 2PO6A 4KUCD 1J0IA 2X4NA 4OLVL 2AK4E 3B2VH 1XGRA 3IVKB 1F6AB 4XC1L 3GBNL 5FOJA 4X6CB 4TTDD 1MSPA 3HNSH 4KROD 4WVRA 5A2LH 3HAEB 4QHUA 5D70L 4W6XB 5DYOA 3QDMA 1LK3L 1NAKL 2BFVH 2CRIA 3I50L 2X1OA 7CGTA 3DX6A 3ALWA 5JQ6H 4M5YL 3SKJL 5F7NC 2F5AH 3S4SB 2BVQA 4JRXE 1A1OB 2WBJA 3I3DA 2VL5A 2BNRB 4WV1B 3ARGB 4E41B 1Z5LA 4LRIA 1EH9A 3DPBA 4R3SA 3AS3A 1RZJC 2DWEA 2EXWC 3KPLA 4OZIE 5B39B 1YYLH 1N6VA 1A8J