5FGRA

Crystal structure of c-terminal domain of shaft pilin spaa from lactobacillus rhamnosus gg - p21212 space group with yb heavy atom
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
TYERTFVKKDAETKEVLEGAGFKISNSDGKFLKLTDKDGQSVSIGEGFIDVLANNYRLTWVAESDATVFTSDKSGKFGLNGFADNTTTYTAVETNVPDGYDAAANTDFKADNSSSDILDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Cell surface protein SpaA
publication title New insights about pilus formation in gut-adapted Lactobacillus rhamnosus GG from the crystal structure of the SpaA backbone-pilin subunit
pubmed doi rcsb
source organism Lactobacillus rhamnosus gg
total genus 26
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fgrA00
3MNVA 4IOFC 5DUPL 4MXVE 4D0CA 4NO5A 5IMLA 3ARQA 3UBXI 5I15L 3QEUA 4DEPC 4LSTL 1QSEB 2ZSVB 3HE7B 4R7NA 1WAAF 3O6ML 4PUBH 3AB0B 5KSUA 2AGJL 5C2UB 4OZGF 3FQWB 5GISH 5JORB 1PZUB 3PGFL 5JPMA 3ZYJA 1FO0H 1IGFL 1XR8A 4JFEB 1UM6H 2FWOA 1MHPH 4K2UH 1U8LB 5CJQH 3OG4B 3TEUA 4HF5L 5C0IB 3MOBL 1PG7X 1FYTA 2MJWA 3TWCH 3BZ4B 1EPFA 1JGVL 4WW1A 1D3CA 1R5WB 1QBMH 1FLRL 3O3DA 5I1JH 5FIEA 3P4OA 3QDMA 3QDGE 1LD9A 1F4WL 1VENA 1OWWA 2CLRA 1HCVA 5CJXC 5E8DL 4DN3H 2X4RA 1SEQH 4Y1AE 4JAMB 4EUPA 1UQSB 3L5XL 1V7ML 2W9DL 3V0WL 3QPQC 4PRNB 3S34L 1T1XA 1AQKH 1TENA 1INEL 2VTFA 1VESA 25C8L 1B4RA 4S2SB 2X2YA 4JFDE 4XPHH 5JDSA 1EX0A 2X09A 3KPLA 3O6FD 3SKJL 3KYOB 4YBLC 4F3FB 3WKML 1IKNC 5C0BA 5GRWA 1QO3B 2NY1C 3DUSA 1QD0A 3VFMB 4JFQA 3TT1H 3ZTJG 1P1ZA 4AQ1B 3MRQB 32C2B 3RX5A 4JZJA 5E1HB 3ARFA 3QEHB 4OCWH 1BZ7B 2ZG1A 4O4YL 1N6QH 1RUQH 1U92A 2EKSB 3JV4B 5D2LB 3ULUE 1RUPH 2JJTC 3ME0A 2WINB 3CCHA 4BELD 1S9YA 1KB5B 4DKAA 1W8OA 3O3BA 5F9OL 1X5JA 1MFBH 4OFKA 1JV5A 4PJDF 2W9LA 3UDWA 3OKEA 4HBCL 5KVDH 5EO0A 4LHUB 2MFNA 5C7XH 1KLUB 2VRAA 4AQOA 1UWEH 3PWJB 3UJTL 2YPLE 3U30B 3HC0B 5CEZL 4XPBH 1OF2A 2UZYB 4QOKD 4BQCA 4NNYB 3G6DL 1P4LB 3VXRB 3QIUC 4GMSH 2HLFC 3VXUB 2HG5A 2J6EL 4OLYH 4U2YA 4CVWA 4U1JA 4FQHB 4J3SA 4PJ5D 4OT1L 3S97C 1PYWB 5IHUH 2C3WA 1MJ7H 12E8H 5D7IB 1HKFA 5B8CC 2GHWB 5ESQB 4P4KB 1PQZB 1VACA 2GT9B 4MSWB 1HWGB 2IBBA 2X4SB 5I74C 5EUKB 3UAJC 2EECA 1D5IH 3DO3A 1MCLA 1K8IA 1T83A 4OIBA 1EHLL 4MQXC 4Q7DA 4XH2A 2BMKB 3BGAA 1Q0XL 3AXLB 3LHPH 1NMAL 4LKCA 4ZXBD 4XMLL 3B9KA 4G8GA 2G5BB 1QFUH 2WQ8A 4I0CC 4R4NC 1HYSD 2ZKHL 1U8QB 2AI0L 3U7YH 4NO3A 2YR3A 4Q0XL 3LKPB 4JFZL 5CZXC 1UM4H 4RGOH 1YJDL 1QHOA 3HE7D 4RFNB 2APVA 1AC0A 4DUXA 3U82B 5GGSA 3R8QA 5BZWB 2GTWA 3L3IA 3DV6A 3GJFK 2BNRA 3CDGA 3RA7H 1B0GB 1VKXA 3SKNB 4FTVA 1KOAA 2Z92A 4JY4B 5KSBE 1BJ8A 4GRMB 5DWUL 1BZ9B 2H6PA 1VERA 3RZCD 5DK3A 1SYVA 4XP4H 2C5DC 4HFUL 4JFED 4U0RB 4YPGA 5GGQL 1P9MA 3C60C 1AQDB 4XNXH 4ZAKB 2JB5H 4CVXB 3ESVF 5BOPA 5HHOE 1U8KA 2NY6D 5DZOA 3RX8A 5IBLD 3UP1A 4ZFGL 1ZHLA 5E1AB 2ZCKL 2X4TB 4X6CF 1FVEB 5JW4Q 4HS6A 3NCJL 4QLRA 4M1GL 2AJZA 2DIAA 3D69A 3IFLL 1FPTH 5IBUG 5HY9A 5J1AB 1DBBL 3WS3A 1MRDH 1RZ8A 3BWUC 3BP5A 3KXFD 5IJKC 1AR2A 1MJJB 2GITB 4TSBL 3HZVB 2A6JA 2F8VA 4MD0B 3ZKMD 5DMIL 4F37F 1JRHH 4BZ1L 1KENH 1MNUL 3RPKA 3C5ZC 4PJ9B 3JV0A 4TSAH 1UFUA 2HH0H 3U0TB 2DQDL 4YIQA 5L9DH 5GGTL 3O8XB 2W0KA 1U91B 5ICYA 3MRDA 2IQ9H 3REWB 1QSFA 3VXSE 3QZWA 4X4YA 4OFPA 2HKFL 4OGYH 5JW4N 3IDJB 4WHCA 3I84A 3I6LE 3QUZB 5AWNL 4YR6A 1MREH 1S7UB 3G9VA 5DS8A 4ODVH 2GJJA 1V3JA 4Z8FL 1PVHA 2V2XB 1V05A 1RURL 1I1FA 1TZHA 1Z3GH 1TJGL 2IAMD 1EVUA 3UJIL 4LHUD 1VEPA 3IAQA 3RVTD 2F74B 4GFTB 3RNQB 3SCMA 3OV6A 4PJCB 2OLDA 4IRSA 4PRID 1JPFB 3RUGF 2A73A 1KACB 3N1PC 1ZSDA 1FNHA 1MFDL 3D39B 3D2UD 4FNLH 1DQLL 4WV1C 4L8BB 4PFEA 5FO7B 4W4NA 3B8SA 3V5HB 4NWTH 5EU5B 3EJZC 5C08D 4GG8A 1HXYB 4OCLC 5D7JD 3NCBB 3CUPA 5HTSA 5FB8B 1YNTA 1G6RL 1A3RH 3QXVA 2B0SH 3HI5L 1UJ3A 2WP3O 1C8PA 4ZFOB 1RJZB 1PFCA 2MOVA 1FYHB 1HH9A 3TYFA 3HZKB 2P8MA 3FCTB 4OLEA 1I3VA 1AXTL 1FE8L 3DUUB 4U1IA 4RFOL 2SEBB 4PP2B 3SGEH 1JJUA 4S10A 3IYLW 5L8KB 1XZ0B 3RU8H 2R69L 2ZJSL 1CZ8L 1QA9B 4NQCE 3PGDB 4ONHA 1PEZA 2EDKA 1KJ2L 2VITA 1IC1A 4HUUB 4YXHH 4Z78B 4HPOL 4U6HA 2VXUL 4KVNH 3U46B 2PF6A 2CIIA 1MOEA 4W68A 5EBMB 4OKDA 3KLDA 1BFTA 3KJ6L 2Y07H 1MFAH 4MQSB 3VFNB 5I71B 1G7MB 3FOMA 4P2OB 4HFWA 4P3CL 1I3RA 4MAYA 4ZNEE 2NX5B 3FOLB 3GI8L 4S1DC 2OJEA 4ZAKD 3K8KA 2J5LB 4Z7WB 4YGVB 5JOPE 1F5WA 2IEPA 1WLHA 1KGCE 2BRRL 1R24B 4TYUA 2VZTA 2H8PA 4L3ED 4X7FC 5DMKA 5ID0B 4RGMB 3ARDB 2QQKL 2GQHA 2Z31C 5I1DB 1WZMA 2PTUA 1P7QA 3RWHA 5LWYH 4OV6F 4S1QH 3QI9A 5FA3B 1UWXH 2MHAA 3WLBA 4WNQA 3BGMA 5IQ7L 4PJ9D 5FGSA 4P46A 1HHKB 1M1SA 2C9AA 1QRNB 1FN4A 4QCIA 2NLJA 4JO4L 3THMH 2A0LD 4Y16B 4OTXL 1CGXA 4G8FA 5FUCC 1SJEB 3G04B 3SDAA 2VQUA 3IU3A 3F12B 4ZFFA 3JWOC 4MDIA 3ZDZF 4JANA 3V6FB 4YHOH 1HNFA 4Q2ZA 1A7PL 1WK0A 4WU5B 4ZYKB 2FJGA 4A2MA 2PYEA 2PO6C 4K7FA 4YHIB 3CSYB 1JFQH 1KTKE 3SQOH 2C4FT 2XY2A 4NM8L 1IBGH 5KTEL 1ZK9A 3MCLL 3CFDB 3QEGL 4OZHF 1R3IL 4WW2C 5IVZA 1AGDA 3Q1SL 1CGYA 2Q7YB 2I60L 5F70A 3B2VH 3P4MA 3ROOA 2FO4A 3QEQE 1OAUL 4QKXB 1NKRA 4NJ9H 3ULVC 3EO0A 1HHIA 1LO2L 1ZS8B 1NBYB 1WC7B 4KY1H 2BSTB 3NCEB 4AMKL 4MJ6B 3ZL4H 2BERA 3C8HA 4LCCB 4Q6IB 5T1DH 1DVFC 3FB5A 3DSFH 2AEQL 2VR4A 4U4BA 4BSWB 3MA9H 3FQNB 3VXMB 1CD1B 4G43B 5D96B 1U3HB 5HGDB 5FHBL 3GGWB 2VERN 1JGEA 4ZUTB 1S7QA 1NL0L 2H32B 3IVKA 4MXQD 5T3XH 3S3JA 4LCWE 1A4KB 1IILE 5EIIB 2CMRH 1GC1L 2LQRA 3ILQC 4YHYB 1E4XL 1KXQE 4OZIB 1A1MA 2X7LA 1HCFX 4GQ9L 1P53A 4MA1B 1Y18A 1K4DA 1EJ6A 4JHAH 4Z77B 5DQ9B 5J1SC 3BZEB 2ZCHL 4XAKD 3WMSA 2YWYA 4YFDB 3K2UH 4OCSH 1J0JA 1S7SB 1BQLL 1WCBB 3GHBH 4JB9H 3ZDXF 5HVHC 1EXUA 5I73C 3MRMA 2Q20A 2EXYD 1CIUA 1TITA 1GGTA 2A6KA 3PGCA 5D72H 4K55A 1KTRL 4XGZA 3IS1X 3TBTA 5FYLD 4P2OD 5CGTA 3O2WH 1A1NA 4HPYH 3WL9B 1J1XL 1SM3L 1T2XA 5EU7C 3DMMC 2EDHA 1KPUB 5GRJH 3LZFH 3V5DA 2YD2A 1IKNA 4OF3A 1WBYA 5TE4H 5BVJA 4LOUC 3CC5B 5DDHA 1I8IB 1ACYL 3QIWB 4TSCH 3UBXG 3AB0C 4WO4B 3QQNA 1G7HB 5FYKU 3GJFA 1L4IA 4KGLA 5JXEC 5IFJB 3ARDD 1GZQA 1OAYL 4ZOCA 2J88H 2JJTA 3LEXB 4PJFB 1SBBA 2CO6B 3CMGA 4ISVA 1S9VA 2DBLL 4L9DA 2VDOL 4G9DB 4HDIA 3RHWF 5HYJB 3MUHL 2CUHA 3LKSA 5TE6L 4Y16D 4NUJA 4F15C 5IVXF 4JFXB 1DE4B 2BCKA 3W9DA 1DDHB 1NMCC 1B9ZA 3UMTA 2CDEB 1S5IL 3KPRB 1KCKA 2F58H 5D8JH 5I1KL 1RIUH 3MRHB 2BVPA 2OI9B 3T3PF 5MEPA 1XGPA 2DI7A 4YXLL 1H3VA 4ODUA 1CVSC 3TVMB 5DJYB 4LVEA 4JDZA 1B6UA 1G7PA 1NCAL 3LDBB 4KVCL 1E6OH 1SJHB 1YC8A 2FBJL 2YD7A 1IEBA 4ZTPL 1ZWIA 4KDTA 5FYJU 1EEYA 5E24E 1LWRA 1ROWA 2OTWB 1EVTC 5KOVC 4CJ1A 3V7AE 3H3PH 4D94A 4K3JL 1J05B 5D1XB 1UM5H 4BK4A 2XTLA 4WVRA 5E94A 4GOSA 2HVKA 1KYOJ 2E8YA 5IBUB 3HMXL 3K1DA 3UTSB 2QJDA 4LCIH 5DD3H 2P49B 3KYNB 5K33A 2A6DA 1TNNA 2HTLD 2WQRA 2WANA 3LEYL 4JQIH 4JVPA 4JFOB 2IG2L 4HMDA 4OD2A 4DKFH 1UCBL 1AI1L 3FFCA 1RK1A 3MBEB 2B20A 3RGVB 4Z7VA 4MZ2A 4Q9RL 3O6LH 5FGCE 4LMQE 3U9PH 4Y5YB 4XZUB 4LCYB 3RL1B 3HRZA 3K4AA 4ZDHB 3LIZH 4CMHB 3IKCA 2IPTL 4H0HB 4IRJB 4RWHA 4XBEH 4KDVA 1L7IL 3MACL 4NT6A 5ANMB 3C60A 5IKCB 2Z8RA 2VZSA 4LSVL 5JIKA 3GMRA 5K9QG 4Z6AT 2CXGA 3OGCB 4X80L 3HZYB 3IXTA 3HLAA 1L7TL 2I07B 3RWGB 1IAOB 2D7QA 5FO8B 1IGJA 3ESUF 4P4KC 4M48L 4NQDB 2V2WB 1M05A 1G0XA 2KKQA 1X3DA 4ODWA 3SY0B 2DD8L 3T09A 5GZOD 2HWZL 2HLAA 5T3ZD 5IJKA 5CUSH 3N06B 3WNKA 2FECI 3VGAB 4NO0B 4M8VA 3C5ZA 3QYCA 2BK8A 2YUVA 4GKSA 4JG0L 3PDDA 4K8RC 5MENB 1A3QA 2CJUL 3LKOA 4JM4H 5FKAA 4AH2A 5TQ2H 3IETB 4RFNC 4QT5B 4FQCL 3T0AA 2AK1H 2FH6A 3AY4C 3PXHA 1ORSB 1F4XL 4TUKH 4Y5VB 4WO4D 4UAOB 1WTLA 4EJ1C 3NACL 2N1KA 3L1OH 5TDOB 3JV6B 4HWBH 4YDKH 4LVHC 5M94B 2IWGA 3TYGL 2XA3A 3HUJE 4RGNE 3HHRB 4G9FB 4HWBA 4KUCD 1BFVL 3ROLB 2EH7L 3VJ6A 1IGYB 3STLA 2FDBP 5FGBC 1YY8B 5E2UL 1OGAB 3QDGD 1DQDL 4U1HB 1E27B 5HYJD 4Z0BH 5I8CA 4GW1A 4Y1AD 3RKPA 3QB7C 2FYYB 2H1PH 1MPAH 3BGFC 1D5XB 4WV1A 4LARL 4YDIL 3DBXA 3L7FB 5GRVK 1WIOA 8CGTA 4MNGB 5E00B 3GBMH 3S96A 4FQQB 1DANT 1XF2A 5HHVL 4KRPC 3HG1B 3UTPE 4YDLB 4N0CC 4MLSA 2K7QA 2HRLA 4O51B 1KIRA 5BOZG 5J7CC 4XT1C 1YMME 2ZCLL 3G6JA 4LNVA 3KAAA 1GAFH 1XGTB 1DN2A 4CVUA 2BSSA 3H9SB 1FZKA 3HPJA 1SVZA 3LAFA 3PF2A 5HDBE 5IMMA 1R3KB 1RMFH 1T3FA 4MWFA 4ZUSA 3ULUD 1ZXQA 1HHHA 3HB3D 2N4IA 4UUJB 5GGUB 1I9JH 4Y5XA 1XCQA 2NXYC 1A7NH 5JQ6L 5SWSB 2DLTA 1DP0A 3QG7H 3TZVC 3HC3H 3QFJB 2VLJA 1S7WA 5DK0B 3DVIA 4YWGH 3UROR 2VAJA 5LXGL 5DI8B 3SE8H 4MA8L 4M62H 4V1DA 4OCYH 3VRLE 3UTZB 4KJQD 1QNZL 4NKIL 3SJVB 1GPOH 1AY1L 5SX5K 1YDPB 3Q5OA 3NCFB 5E4EB 1G7JA 4WTWA 4K3GA 2XRAL 2YA1A 4HS8H 1ZMYA 4W6YB 2RBLA 2IF7A 5F88B 1MCSA 4PP1D 2IH3B 3KR3H 3SOBH 2OQJB 3HE6D 3T0EE 1FH5H 3JTSA 2XXMB 3QPXH 5C09A 4HHAB 4C57C 2VDPL 2VQTA 1LO5B 3LOWA 5KZCB 3QG6B 2AK4E 2OR9L 2HFGH 5CGMA 3E1F1 2UWEB 4AEFA 4ZO9A 2GUOB 1JNHA 3OMZA 2K9UA 5J8OA 4YAQB 2CLVA 3GSRB 1VGEH 3MRLA 2ERJC 4LLWB 4XP6L 3VFWB 2XQYK 2AEWA 4JRXB 5AUMB 5EPMB 1J5OH 1YYML 2R1WB 4N5ED 3TFKD 4LLMB 5C0GB 2C1OB 3WIHL 2HJLB 4GG6B 3ZKQD 1YC7A 3RWIB 1M71B 5MERB 3D9AL 3JWOH 1DQQB 2VMFA 1M6OB 2FBOJ 2ED9A 4OGXH 5IESL 1BP3B 1WZ1L 3EYUL 4D9RE 4F8TA 1UB5A 3X13A 4QXUH 3S6CA 1JGDB 4NOBA 3BIKB 5I1CL 4YNYB 1CICD 1F58L 2ICEA 4MCYB 4R26L 5T1MA 3EYFB 1S5HA 1VSCA 5GGVY 4L4TB 4RCAA 2PO6A 4HUWB 5HHOD 2FD6L 4YC2C 4ZPVA 4R90L 4XP9L 1NGXB 2J5LC 3NIFF 5KANI 3WHE1 5CLTA 1KTLA 1ZTXL 4WW2A 3LKQB 1A6WL 4QRTB 2FCBA 4X4ZA 3ULVH 3A6CH 2APTA 1OAQH 3M8OL 4HLZG 4TQEL 3DURB 3KYMB 1KEML 1YN7B 1N3NB 3QJHA 5FOBA 3MLUL 1PLGH 4WFGE 3VE0B 1KB5L 3GSXA 5DA0B 3UZVB 1FFPA 3HG1D 4XRCA 1RZGB 1VPOL 5L0QB 3V8CA 4WTZG 1DVFA 1SQ2N 3PWPA 3HNSH 4ORGA 4Y2OA 4DOHE 1O7VA 3PDOA 3BPNC 5C6TL 2DQFB 3KYKH 3OKMA 4X83A 2PXYA 3GSUB 3VXSD 3WXWL 1NCTA 4UV4H 3MGTA 2BZDA 5TPWH 2O93L 1GVIA 3UBXB 1XGYH 3I6LD 1CE6B 3UTOA 5EOQL 5CD3B 1A5FL 4R2GC 3QULB 4E9LA 5D1ZA 4D8PB 3EYOB 1JPSL 2P5EB 3QDJE 4NM4H 1J1PL 1OARL 2MQCA 3GKZA 1QR4A 2D31A 4JO1L 1BQSA 5T5NF 2JB6A 3GK8H 4AG4H 1QRKA 3QFJD 2IH1A 4MQ7A 7FABH 3D85B 2G60L 4F7PA 1HIMH 3DOSA 4BZ2L 3C6SA 1NFDE 4GAGL 2VLRE 3QUYC 3O3AB 2NY7H 5C0FB 5BV7L 5DJ8B 5L2JB 1JNLL 1GIGL 1N59A 1UYWH 3P9LB 3X17A 2YD9A 3IDXL 4JREB 2QEJA 1HKLH 5HGHA 3MO1A 4GKNB 2X1PA 3DMMA 4EIZC 2ICWJ 4OQTL 1YJDC 1CE1L 1DBJL 1DBKH 2IANE 5IF0A 4PV9A 1P4BH 1ITBB 3HCVB 3K2MC 5DHVB 5JNYB 2VUOA 5EU6E 5HI5D 5C07E 5D96C 1U3HC 3EHBD 1QLRA 5KZCD 3RNKB 5JXEA 2H2SD 1LP9A 4RMSA 5J1TC 1JCKA 3H3BC 2XKNA 1FNFA 3D0VB 3UO1L 4U6TA 3S35X 4TN9A 5KG9A 2AXGA 1IC5H 1HXMA 1MF2H 1RIVL 1KB9J 2Q76A 4NQCD 5C0IA 2AJ3B 2YD6A 2AXHA 2X4OB 3O3EA 4YHML 4P2YA 4HJ0D 1YQ2A 1OQOA 5TFSL 5BQ7A 2PCPA 4U1NB 4ONGL 2E6JA 3IF1A 1HHJA 2FGWH 3PWVB 5DUMH 4XNUH 1BX2B 4JHBA 3WFEL 5K9KB 4LSPL 2LABA 1INDL 3D3VE 1JF6A 4URTB 4W70A 1BJ1J 1L9MA 4OZGB 5KSVB 1XR9A 4L4TD 5L2KB 1Z5LA 3DXAE 4OLUL 4PY8J 1U8MA 5JOPD 3LS4L 2E27L 4JKLA 1KGCD 1PSKH 1JYVA 3MRIB 1AGFB 2HT2D 2W91A 1FJ1B 3VFMA 4D0BA 3BH8A 5JMOC 2JE8A 4YHZH 1IEHA 2RFXA 1ZVSA 5T33L 5HGBB 1L0YA 2AABH 1BZ7A 1OP9A 4AJ0A 4YXKL 1UWGL 3ZKND 1CCZA 3P4NA 1T89C 4GSDH 3UEZA 2WINA 3UPRA 5EOTB 4YO0B 1RU9L 3BP7A 4XP1H 4TULH 4IIQA 5DQJA 4PBXA 1F6AA 5HDQH 3T2NL 3GO1H 2ZPKH 4HKBA 3F7VA 4Y4KC 3RFZC 5JLZA 1YEDB 1YUHA 1P6AB 2DOCA 4ZFZB 2DQHH 1GL4B 2ENSA 1RULL 4OIIL 5C8JB 4OBSA 3KG5A 2IGFH 3GBLA 4JN1H 3BKML 3CXHJ 2XFXA 4XC3L 5F9JB 3NN8A 2ADIB 4KMTH 4RAHA 3L3OA 2W0LA 3D85D 4UIKL 5LGKA 3EGSA 3P9WB 1D5ZA 1F90L 2RGSA 5ESQA 5HXMA 3G08B 4P4KA 1AE6H 1SBSL 4OZFH 4PJDB 5LGHH 1X7QA 1JRHI 4RA3A 3F65A 1XH3A 4NQSA 3AXLA 3L3HA 4OCMC 1NGWA 1OHQA 4K8RH 4OZFA 3PABA 3V6OA 3QHFH 1NAMB 4RDQG 4M3JA 3SDYH 5D6DC 5HHXH 3CDCA 2ZZUT 3B9EA 2KZ1B 3OPZL 4NCDA 5ACZB 4PJAE 4I3RH 1YEKL 1OW0C 3QRGH 3PWNA 4WY7L 4K9EL 3MOAL 3QWOA 2FH8A 3GMMA 4BYHA 1YEEH 4PRBA 3AY4A 2XIDA 4RAVA 1N7MH 3QNZB 2CGRH 3MBEC 1QYGH 2VDRL 3IDNB 4LCWD 1JUFA 3TO2A 4Y5YC 2WIIB 3VXQA 4I9WE 3IDYB 5DR5H 4JY4A 4CMHC 4GRMA 5ITFA 5JPNB 4RZCA 4HXAL 3S88H 2GY7B 4NJAL 1HSAB 2Z91B 2A83A 3P11H 1NDGA 3GZKA 1N2RA 3CFEA 5DFVD 2FR4A 2ENYA 3FB7B 4AK1A 3RJDA 4M3KB 5KSAD 2AXJA 3DROA 5FGBA 4MZ3A 5JW3H 3MXWH 1DQJA 2BJML 4Q74A 1HQRA 1BOYA 3KPQB 3O4LA 4PJXE 4D0DB 3B5HA 1F02I 4KI5F 4BUHA 3F5WB 4XVSH 3UXFA 4LLQA 1CBVL 2ID5A 4PJ8D 43C9B 4Y4FC 2FL5B 3RAJL 4F9LC 3MV8B 4Y88A 5D9SB 3LPWA 3PV6B 1WFOA 2V7NB 3VGAC 3KWWA 1UXSB 4PJGA 5FK9A 5E8OA 1MI5E 3FT2A 1VFAB 3MGOA 3SGEI 3S37L 4OFVA 2ICCA 2DQIL 2OMBA 2NYYD 2DBJA 4JN2A 2G75B 3TJEH 5IGXH 4KTDH 3BE1H 4X99A 4CU7A 3VFUA 3IDJA 1RJYA 4NZRH 4RGNB 3LEVL 4BH8A 4KKAC 4XAWL 2V2XA 5ENWB 3S8WA 1KV3A 2V5TA 4NBYB 4PGZA 2X89D 2ITCA 4QRRE 5E70A 2EYRB 3TZVA 2ZUUA 1C1EH 3MRRA 4MA7L 4KROB 2BDNH 4H88L 1AGBA 3H7LA 5FM5O 4UTBL 3LMJL 4NGHH 2XWTA 4QY8A 1XF4A 1D5BA 1YEGL 1TETH 5FYKE 1JP5A 4IS6B 5DUPH 3D48R 4YBQC 4HUNB 4H5SA 1MFCL 1SY6H 3MCG1 4U7KA 1J1OL 1T1YA 5D7KE 2VXQH 5EU5A 3CH1B 5LCVL 2HYMA 2VLKA 1SY6A 3RP1A 4YDLC 5I6XB 2I9TB 3HAEH 8FABB 4R3SB 1FIGL 4QF1B 1CGUA 3U4EB 4HAFA 3F62A 1BM3H 5GGVH 5FDWB 2R2BA 3LKNA 1BFOA 4JRYB 3HAEA 5AD0A 4J3XA 1RJZA 3SKOB 1RZ7H 1IGFH 4L8SC 4LRNL 4PS4H 5F1IA 2WUBH 3LKRA 1J0IA 2JELH 4HKZA 1KCSH 1OD9A 2I5YL 3MV9E 1FG2A 4FP8H 4OJFL 3F58L 4P2RE 2Y72A 1XFPA 3P3YA 5MP6L 3Q2CA 2G9HA 2YZ8A 4NO2A 1IQWH 1H15B 4DGIH 3RUGB 2OZ4H 3AM8C 5K9OB 1F4WH 5E8DH 1J9CT 5AYQA 2RIKA 4I77H 4O2CA 5CHNB 4B5EA 4JJ5B 1D6VL 1V7MH 3C6LC 1FZMB 3SDCC 1PZ5B 3P9MA 3I3EA 3SDXE 4P2CG 4D9QE 3FFDB 1LDSA 1HEZA 1INEH 1F6FB 2FEEL 1JZ5A 1II4E 4OD3H 1OSPL 4PLNC 1HINH 2NY5L 3T77A 4EOWH 3KVQA 4JZOA 5T3ZL 1RHFA 1ZE3C 3QQ3B 1J8HE 5E4EC 2ZOKA 5ISZE 1CK0L 2O5ZL 3EYSH 3G5VA 5KVMC 4FFVD 1Q94B 1FYTE 1BGXH 3HPLB 1BMGA 1MHHB 3TC9A 2FX9H 1NLDH 2ESVB 1YEFL 4NQEB 4L9LB 2OSLA 4J8RA 4UILH 1FNEA 4ZO7A 3K1KC 4ZUUB 2XWJA 5H94A 5F9OH 2EDXA 3X14A 4ACPA 4XX1E 3BQUA 4HBCH 5E7FA 2Z8VC 4L4VE 4OSUH 4PRHB 3K74B 3TPUA 2YC1A 3RTQD 1NFIA 1QBLL 2APFA 3NVQA 3TV3L 1KN2H 4OF7A 4L1DA 2IBZY 1ES0B 4LFHD 5F89B 1HHKA 1GOGA 2FJFB 3V5KB 1AFVH 3MLWL 3IFPA 5CMAA 2OTUA 2AEPL 4NRXA 2P7TB 3RY4A 1FL5B 3RY5A 2WMPA 4OT1H 5BXFA 4HUXB 4KKLD 4EZMA 2J6EA 3MJ8B 1CR9H 3Q48A 2X1OA 3W5MA 4POZC 1A22B 3N1GC 4RGND 4XNMB 4MX7A 1A6VH 1KJ3H 3MCKA 3L5WB 3W39A 4MDJB 2RR3A 5DJAB 1T2QH 2ADGA 3CSYA 2EDYA 2R8SL 5DEZA 3MZTA 5IBTH 4HXBL 4G7YL 4Y8DC 3QUYA 3BP4B 4P2QB 1U41A 2M2DA 3BKJH 5DRXA 4A6YL 4JFZH 5B4MD 4WUUE 3ULUL 4U6XB 4IBLT 2A1WL 5CCKH 1T0MA 1YJDH 5EDXA 3UTPD 2O5XL 3VG0L 1NBYA 2PYFB 1FNSL 5F3HB 3CFJB 1A9BB 2PR4L 4MJ6A 4XBPA 3PQYE 1U93B 4FQPA 3G6AB 1BIIB 3VWJC 2H32H 3ECBB 1T6WA 1YEHL 1OP5K 1U3HA 4ODTH 3ZTJH 2Y4SA 2VUYA 2H32A 4MJ2A 3O3UN 1A1OB 5K59E 3ARXA 3T8XB 2C4XA 4DN4L 4OI7A 4ZFGH 1DN0A 2D9CA 2GK0B 4NN7B 5DSCB 3QCUL 2BSED 2J12B 1I7ZA 2YPVL 4OZHB 4PRPB 3W0WE 4QXTA 4G6KL 1G1YA 4EUPG 1BPVA 4HWZB 1XGUA 3KYAA 4RWYL 1BBJA 3GMOA 5ITBL 2JCCA 2DQGL 3BI9X 3NFSH 1LEKA 4Y19B 4G5ZL 5ALCL 2Q8BH 1ZT1A 1KJVB 2BOBA 2D3VA 5DMIH 4I48B 1YEIL 4OLWH 2I9LA 3ETBF 3QQ9C 4OBRA 3D6GA 5D7LB 1XF5A 3LS5H 3BFOA 2FSEA 4HGWB 4YDJA 4BSVA 5FM4A 5LAXB 3L9RB 3LN4B 1C12B 3X3GL 3B2UC 4K07A 3T4YB 3UCRA 5C0JA 3U6RB 1NCBL 3FQTB 3DTXA 3DYMA 5T1KA 4CVZA 5EU6B 4HUVB 2CKBB 3CC5A 3EOBA 4GBXB 4X6DE 4NQED 2AK4D 5EU4B 5IW3A 4Z8FH 5IFJA 1A7QL 5C0CA 1WZKA 5HVGB 4KRNA 1BEYL 2JIXA 2NR6C 1LO4H 3BDBA 4RA0C 3QO1A 3UJIH 1T89A 4K3EH 3N1FC 3O6FC 4UTAL 4ZPTA 3E6HB 3T65A 5AG9A 4GXVH 1MFDH 3I3BA 3MLVL 5F1NA 1DQLH 2A74A 4P5KB 4WUKL 3BXNB 3PHQB 4JDVB 4LCUA 2NW3B 2B2XL 3NZHL 4N8PA 4GRWF 5BRZE 4Y4KA 4Z7UE 4G42A 4D9RD 2ARJQ 3TIDB 5HPMB 5D4QA 3CXDL 4FQXD 2ZWLT 4QYOA 2E7LC 5DJDA 2X6MA 3I02A 3MRHA 1F4AA 5E2VH 3VGFA 2EDBA 4AIZA 3M17B 2XXCB 1LGVA 1HI6B 1NFKA 2DS4A 5HYIA 4U1MB 1G6RA 3FRUA 4CW1A 1PY4A 2D2OA 3CSPA 4NZUH 1JTPA 5DURB 1I8LA 3N9GL 5C0AA 2XN9A 3C9NA 2Y36H 1T04B 4RFOH 2QQNL 5T5NG 3VCLA 5I1AA 4P2QD 1FORL 5CEZE 1G7LA 3GMLB 4C83A 1I8KA 3DIFA 4EVNB 4WFGD 3EDDA 1S8DB 2CO7B 2L7UA 1E4WL 5EOCH 5D6DA 3UTSA 3E0GA 5GS1B 4RQQA 5IVXB 4CU6A 1XT5A 4X6FB 1L6ZA 1G7QA 3BHBB 1OW0A 4J1UB 1JI2A 3QWRA 2NCMA 4NRYA 3A67H 3LQZA 3OAZK 5D5ME 5T1LB 3MBEA 3RWJB 5J9PA 3VD4A 4XVJL 1ZLVK 3TCLB 1OWRM 3FL7A 4M1DL 2HAZA 4BFGA 1HYSC 3AREB 4YBHA 4HD9A 4M6NH 1ZA3B 3ARVA 5HYSA 2EEBA 2AAVA 1ONQA 2DDQH 3MR9B 3V4PH 1ZGLM 3QDJD 3GIZL 4L8DB 4LKXA 3U0PA 4EI6B 2QQKH 5D2NA 2ZUQB 5GJSH 3RL2A 3MRGA 3U9UA 4ONFL 4JPIA 2VLRD 5E6IC 5FHAH 1JGUL 3QNXA 1PKOA 4OFYD 3RWGA 2N7BA 3HI6L 4QRPE 3FQUB 1JNNH 4JY5H 3KLSA 3NOIA 3L7EA 4LLDB 1QEWB 3NZ8B 3MLSL 1EEQA 4R97B 5J11B 1HOCB 2BC4A 5HGAA 1DQTA 2N7AA 4Y4FA 4LNRB 3VFVB 1U9KA 5DEFB 3NA9L 4LBEA 4Q9BA 4F9LA 4YHLH 3S36L 3JUZA 2VZUA 5IBLC 1KELL 2P42B 5BZDB 2IAND 4LSUH 1U8NB 4AENB 3QUXD 3SPVB 4O9HL 1R5VB 3QZWG 2Z0BA 1M7IB 5EU6D 5C07D 4OCXL 4FZEH 4GBXD 1A6UL 2IPKA 4U6VH 4WEBH 4X7TA 4PJEE 3VD3A 3VFOB 3SDDC 4O2FA 2P5WA 4U6YB 1EBPA 1W0YT 4G80B 4OAWA 2YEZB 4NM8H 3RY6C 1QFHA 1UCTA 1X44A 1IGIH 4FZ8L 3MCLH 2AV7B 2EDLA 3QWQB 2CK0L 3RI5F 2QQLL 1IFHH 2EIZB 3IFNH 5I0ZA 4FQJH 4S1SL 4WJ5A 3W11D 4MNHB 4G7VL 1LHZA 5C9JB 5A43C 1YY8A 1ZLUK 4ZUWB 2OL3L 1E27A 2WBKA 1LO2H 2J7LA 3KPPA 3L6FB 4KV5F 2FYYA 2YK1L 4N8VA 4YDVB 2QKIB 3Q3GA 4O58H 1V3MA 1U8PB 4FS0A 1BD2A 4NZTH 3L7FA 4D9LL 2AEQH 2YXMA 3D3VD 1KCUL 2D0GA 1AKJA 4U49A 5EBLA 3BYYA 2PYEE 5DO2C 1N0XL 5EZJA 3DXAD 4J12A 3P30L 4LVNB 4P9HL 3IXAA 3RVTC 1ADQL 4FQIH 3WO4C 1WWCA 1NGQH 1E4XH 4PTUB 4L8SA 1XGTA 3FHAA 4JFFE 1LK2A 5JHDE 1OB1B 4LLYB 4QTHA 4WFHE 4G8IA 3MRBA 1KYOK 2G2RB 1K8DB 1PKQE 5E4IA 4JZNB 4Z5RA 1R0AL 4O00A 1BQLH 4ODXA 4UUJA 1AO7A 5SWSA 2EIBA 5E2TL 3C6LA 5E6YA 3SDCA 4R8WH 1MCQA 4K7PX 4KROC 5CGYD 3F8UB 4C56A 4XPAL 3I85A 2WBJB 4ZS6D 4M7ZC 1MVUA 1S7RA 2HN7B 4M6MH 4DW2H 2W1NA 5E5MB 4CADB 1SYSB 5BV7C 3P0VL 3UTZA 1J88A 5IJVB 2ORBH 3STZB 4HWNA 4X7SH 3ZDYE 2Y23A 3T1WA 1LP9F 3EDJA 4R9HA 4Z7OF 2R56H 1TVHA 4XPFL 4YFLF 1T7WA 2CLZA 3IT8D 1PG7H 2APWA 1NC2D 5IB1A 2ATPA 3CLFH 2D03L 4E0RA 2IFFL 1OAYH 2R0WL 1F4YH 3TIEB 1FBIL 1UXWB 1JWMA 1FGNH 4F80A 2UWEA 3MV9B 6FABH 2VISA 5ALBH 1TTUA 3VDBA 2V5SA 3CFCH 4QRSB 2VDOH 3MNVB 4R96A 1N5YH 5AZEH 4D0CB 4NO5B 5IMLB 5FO9A 5AUMA 5TE6H 3QEUB 2D0FA 1ORQA 1UH3A 3FO1A 4R7NB 5F97E 1WEJH 2C1OA 2YBRA 2WAHA 4ETYA 3WE6A 3RWIA 5KSUB 4GAJL 1T20B 4PGBA 1J11A 5FXCH 5HYQA 5KAQF 2GJ6A 2VWEC 2YMXL 5EFIB 5JPMB 4O2EA 1PBYA 1ZV5A 4U31A 4I9WD 4EN3C 2FB4L 5DEGB 1XR8B 3O9WD 4YZFF 5I1HH 2Q86A 4U1LA 2NNAB 4F33B 1FYTB 1AJ7L 4XCCH 4HUWA 4WW1B 3RVWC 5C3TA 1F8TH 2WWMC 3O3DB 3DYOA 3P4OB 1T1ZA 3QDMB 5JR1L 1LD9B 2ADFH 4EUPB 1NCDL 5EH1A 1YN6A 1IKFL 4I3SL 1OTUC 1T1XB 4Z9KB 2ATKA 2O5YH 3M1BA 1F2QA 3KYMA 1Q0YH 3R4DA 4OV5A 4IHOA 3MUZ1 5JDSB 2YWZA 3KPLB 5KJRH 1X5IA 1FFOA 3IDGA 1IGML 4Y2DB 3GSOA 3DX7A 4Q9RH 2P45B 5D6CB 2NY2D 3CK0L 5C0BB 3VWJA 3I75A 2EH8L 5A40E 3LRSA 1MI5D 1CD9B 5SX4H 3MV7E 4X9FA 4Y4HB 4JFQB 1P1ZB 1L7IH 3TM6A 1CLZL 1WTGT 4NFCA 4JZJB 3MACH 3ARFB 1D6EA 1NUGA 5IVNA 2R1XA 3GSUA 1NUDA 1U92B 1FFNA 4LSVH 5AAMA 4LVOB 3CCHB 2V9QA 1S9YB 3O3BB 1AR1D 4HQQH 5A3ID 2HJFB 1CFNB 5HI3D 1JV5B 2NQCA 1R6VA 1A14L 4GAYA 3ZE1F 3OKEB 4QRRD 3EYOA 5EO0B 4M48H 1WVZA 1QUNA 2EDFA 5IG7A 3FFCE 3NIGF 4Z7VE 3LCYA 4MXQC 1IC4L 4BUGA 1OF2B 1LDPH 2WBJD 4AM0A 5FYKD 5HHME 5EBWA 5I0DA 2HG5B 2Q3AA 4ZNCD 4DCQA 5L2JA 4ZO8A 5ICZA 2F5BL 4U1JB 4PJBA 3OX8A 1G84A 2NTSP 5D7KD 3WFCL 1NAML 1JPTL 4R6UA 1I9RH 1B0WA 3ZMRA 1XCTB 3CLEH 1LEIA 3BVNA 1VACB 4KJPD 4N90E 3AGVA 1K8IB 3MYJA 4PJIA 4XH2B 3LD8C 3PUCA 1FG9C 3I3DA 3MV9D 4YLQT 3B9KB 4G8GB 4P2RD 2K1MA 5I1IL 1JHLL 1KNOA 3FO0L 4UT7H 4NO3B 4TVPH 3O6FA 4UV7H 1FZOA 2AVGA 1ED3A 2EDDA 1B4JL 1FNLA 3DUHA 3MODL 4NOFA 5BCAA 3X11A 4WWKD 4FFWC 3DVFA 4YHPA 5EC2A 5GRYA 3REVA 5GGSB 4D9QD 5BMFH 2GTWB 5E95B 3L3IB 2EDJA 3DV6B 3L3DA 3HMWH 2BNRB 2XG4A 3CDGB 4ODSL 5TE7L 2QHRL 1VKXB 2A6IA 4FTVB 4U1NA 1OM3L 3WD5L 2Z92B 4NPYA 3JV5A 2E7LA 3E2HC 3EDKA 2H6PB 1SYVB 3QFDA 4YPGB 1J8HD 5ISZD 1M4KA 4QHUA 1U8KB 4EQ3A 4GS7B 1FYTD 4DKDC 1ZHLB 3QCTL 1HWHB 3MV11 3WHXB 5BS0B 1NCCH 4HS6B 5D70H 4DVRL 2AJZB 4TTDC 3D69B 4MS8D 3VXNA 2DLHA 4ELMA 3LQAC 3EDFA 1TDQA 2V5RA 5HY9B 3U4BH 5EUOE 3WS3B 1RZ8B 3BP5B 4L4VD 1C08B 2A6JB 4PJ5A 4Q9QL 4GRLD 5LXGH 5ECJE 4DZ8A 3HR6A 2F54E 2ARWA 5DVNA 5F7MC 4KQ3L 5C0BD 2FGZA 4YIQB 3Q6GL 4QWWD 3G6JE 3UPAA 5ICYB 2QTEA 3K7UA 2C3XA 4FG6D 2EE9A 1QSFB 3QZWB 4R4FH 4PG2C 5TQ0H 4MAUL 4I2XE 4XPGH 3LPGA 1S7XA 1RUAH 4YR6B 4UINH 5DS8B 1YYLL 2DI8A 1QFWH 1I1FB 4DGVL 2KUTA 1H8NA 1H3PL 1A6AB 2VN4A 2HTLC 4XP5L 2E7MA 3RGHA 1U3YA 1FFRA 1T2JA 3SCMB 4Z95L 4J4PD 4LASL 1AC6A 1C5CH 2D9QB 3SE3C 1VFBA 4IRSB 5E6IA 5INCB 4I0PD 1BVKA 2A73B 1NJ9A 1QBBA 2PN5A 1S7VB 1ZSDB 4XP6H 4XNYL 1NKOA 4HWEL 5GS0C 1ZANL 4WUUD 4PJDA 3PL6D 1T21A 3WIIH 3PP4H 1YYMH 2I26N 4GG8B 1YECH 2AXFA 2X4PB 1OPGH 4B53A 1KFAH 1OL0A 1E6JL 3C08H 3KPNB 3PQYD 5GS1C 3FO2A 1UJ3B 3EYUH 5ACZA 1OD7A 2FJHA 4N0UA 4NNPH 1HH9B 3TYFB 3UZEA 3HKFA 2V5MA 1X5XA 4R4BA 2CR6A 4R26H 1JZ2A 2P8MB 4GJTB 3DVNB 1A3LL 2DQEL 1X9QA 3U1SL 5I17A 3SDDA 2HMIC 3KXFA 4M7JH 1JPGA 2WSKA 3BKCL 3OZ9H 4R90H 4XP9H 4YX2H 1J10A 3RY6A 1I8MA 5HD8D 1XGQA 1V3LA 3W0WD 4ONHB 4EBQL 1KB9K 2Z91A 1MQ8A 4OF8A 1B90A 4DVBB 1CDIA 4U6HB 2ZUQC 5EA0L 1EMTH 2CIIB 5FUCE 1RIHH 4WENB 3BN9C 1BECA 4LGRB 2JTDA 4U1GC 4RNRB 4P9ML 3RIFK 3FOMB 4HFWB 1I3RB 4YHKH 1JZ7A 3OKDA 3BRGC 3BRDA 3QIBD 3CNKA 5F21B 1MAJA 4HIHB 43C9A 2ZOLA 4P23B 1WIUA 2OJEB 2XICA 1MCBA 1MCRA 1UACH 1YNLL 2IAMA 1IM3B 3MV8A 3KPSE 4BQ8A 1D9KB 2YUZA 5JMRA 4LSRH 1MIEL 1CDYA 2HFTA 4LAQL 3K4ZA 1ZHKA 2PTTA 1OLZA 2H8PB 5DMKB 3D2UA 1I1AD 4F7MA 5C2BH 1A5FH 1RZFL 4PJ7E 4XXCA 4QHNA 5CJBA 1RVFH 1P7QB 3RWHB 2Z93A 3ULVE 1ZT4A 4KQ4H 3QI9B 4PJHE 1FVDA 3KJ4B 2BNUA 2YRZA 1MUJA 3MLZH 3Q5YA 3QR2A 4X6CA 2NXZB 3S7GA 4DTGH 2MHAB 3WLBB 3VXPB 4WNQB 3BGMB 4F58L 2Y9RT 3WFDL 4P46B 1MCHA 2MCG1 3BZFB 3SGJC 2NLJB 4D3CL 5BV7H 4YQXH 4G8FB 5LQBL 3SDAB 3IU3B 5LJYH 3AMLA 1R5IA 4ZFFB 3AUVA 1NUNB 4MDIB 2MQ0A 4JANB 3ULUC 1CL7H 3KS0H 3CMOL 1CE1H 4Q2ZB 5I2IB 2FJGB 1RZIA 3ARGB 1KTDA 5DJXA 3CXHK 1RQ5A 1QP1A 4K7FB 3CH1A 4OQTA 3T0WA 3OWEA 2FLBT 3BIBX 3PE9A 4MJIA 5I8EA 4QF1A 5GS2D 5FV2A 5E0QA 5C0RL 4LSQL 3FONA 5IVZB 1AGDB 2NZIA 5FDWA 1TQCC 5KS9F 1GHFL 3GEWB 3SKOA 5CEZD 3P4MB 3ROOB 2FO4B 1MWAH 4KTEH 1U42A 2XY1A 1KEGL 4PYHA 3WSQL 2F53E 3EO0B 1HHIB 2JCCF 5JA9A 3BEVA 1MWAA 2DQCL 1H15A 5EN2A 4FFYL 4YHMH 2PW1A 3RUGA 4PP1C 4DEPB 3FB5B 3GSNH 5CJOL 5HHNA 3MLPA 5DRNB 2OJZL 5TFSH 5DHYA 5K9OA 2Z4QA 3JTTA 1RI8A 1KIQA 1DCLA 1QSEE 5L6YL 1JGEB 1KIPA 1S7QB 4RIRA 3GSNA 2W07A 3IVKB 5ILTL 1IZJA 4UIMA 4BH7B 2Y5EA 1JHTA 4Y7MA 2VAAA 1OAKH 5AYUL 4EN3A 3VGHA 4OLUH 3RQ3A 1FDLH 4RISL 1A1MB 5H2BA 4HS3A 2X7LB 2X9YA 3B43A 1K6QL 4H0IA 1Y18B 5I18L 1ERNA 1KUMA 4Z76A 4Z7QE 3DX8B 2DM7A 3QT2A 2GFBA 5IIEA 5J3HC 5F7EH 1F11A 3O2VL 3MYZA 1EXUB 4NP4L 3MRMB 5INDA 2CKBL 5GSVA 5JXAL 3QNYA 4YXKH 1B0RB 1F3DJ 1UWGH 2ESVA 4X8JA 3O11A 5IM7A 3PGCB 5TGBB 4GKZA 4OD1H 4XGZB 3ZE2F 3TBTB 1S9KC 4NHUA 4MAYD 1A1NB 1J0KA 5I1EH 2B5IB 4ZUVA 4JKMA 3V5DB 3I2CL 5BVJB 2BHUA 3UZQA 4UT6H 5DDHB 1FSKC 3OXSB 2NY1B 3V0AC 1EUTA 3MLRH 4POYA 4JO2L 3LV3A 3CIQA 1LO0H 5F89A 2VXTH 3GJFB 2FJFA 5DFTA 3V5KA 1IJ9A 4PPTA 1GZQB 2KZWA 1MJUL 2L0DA 3GHEL 2BVOB 1RUMH 3EOTH 4UT9H 5D2LE 3BT2H 3QI9D 2NXZD 3INUH 4UIKH 4ISVB 4GMTL 3VWKD 4NFDA 1EBAA 4HWUA 3P73A 1TJIH 4WI9A 4P46D 3P4LA 3SKUD 1RHHA 1LE5A 4HDIB 1MAKA 2B1HL 4PR5A 4KRLB 3LKSB 3NAAL 3EO9L 3W9DB 4LQFH 4OLXH 3ES6A 4KUZL 5FGRA 5MEPB 1XGPB 3OPZH 3VXRE 4ODUB 5B38A 2R9HD 3VXUE 4KZEL 5CILL 3FTGA 5DC9B 2D7OA 4JDZB 3MOAH 2PYED 1IAKA 2DJUA 2PYFA 1TQBC 1G7PB 4N8CH 5F3HA 4KXZH 2NY3C 4ODHL 5FUOH 4Y2DC 1IEBB 1U93A 4XNZB 5D7IE 1ZWIB 1KPRA 1S3KL 1OCWH 1BIIA 1EEYB 5FYLH 3NTCH 4Y4HC 5I74B 2APXA 3NIDF 3C5SB 4JGMA 5HJ3A 4JFFD 5JHDD 2DQUL 1QPPA 4WFHD 1R3LA 2FECL 3R06A 3VI4F 4ERSH 1DUZB 4JR9L 5E94B 5JOEA 1JNJA 4UDTA 1RZKL 2DWDA 5ICXA 4OF0A 3QA3A 4LPYA 4OD2B 4K23L 3TO4C 5HI5C 3BMVA 4NN5C 3EHBC 1EGJL 4MJ5A 1KJMB 2H2SC 2R4SL 5DJ6A 1A0QL 3IKCB 1JHKL 2Q3ZA 1UA6L 2E7BA 4M5YH 5T3XD 4S1RH 1CDGA 1MCIA 5HHQA 5KAQG 4NT6B 3C60B 5ID1A 4KJYA 3FN0L 3GMRB 2ICWA 3RIAK 2CUIA 3S37H 4BSJA 5EO1A 2DQIH 3LQAH 3U6RA 3IXTB 2XZAH 4AEIL 4G6JL 1IGJB 2P4AB 2VABA 5SWZA 1M05B 2DKSA 3QHTC 4YUEH 3QPQD 2AJYH 4JG1L 3LEVH 4Q6YA 2MCPL 2HLAB 4IRZH 1DFBL 2L4OA 3HNVL 4TNVF 1VFMA 4Z7NF 3B9KC 5JA8B 3LB6D 1EAPA 1ZLWK 2F19L 3MJ7A 5F9DC 4FFZH 3C5ZB 1DR9A 2B8OT 4GKSB 3N85L 4UTBH 5TF0A 3LKOB 5TF1L 1B88A 4AH2B 5CIPA 2DTSA 1GXEA 2EE3A 4MHHG 1MFCH 4N1EA 4P5KA 2OBGA 5I16A 2NW3A 4PG2A 3SKMA 4WHYG 5GRUH 5F7UA 1CGSH 1FRGL 5I66A 4N0FB 4XWGH 3KDMB 5EB9A 3GM0A 3HZMA 2EXWC 5JW4R 2A77L 1MIML 3W5NA 2VE6A 4I8DA 2MNUA 4BK5A 5BW7C 2J8UF 1KF9B 4UB0H 1HI6A 2OYPA 1MHEA 3VJ6B 1X5GA 3STLB 4LRNH 4GS7C 4KKCC 5D7SH 3GUTA 1Q1JH 5GS0H 4OM0L 3SE3A 4OM1L 2I5YH 5I8CB 4GW1B 4OJFH 5E5UB 4NHCL 4PJCE 4R7DB 4WV1B 4NYLA 4XC1H 1LO3L 3D39E 5EZIL 3QIUD 1XF2B 3GMLA 3GMPA 4KKBC 4N9GA 2J8OA 1YEJL 1D6VH 1YPZA 4AL8L 1S8DA 4GRWB 2Q87A 5F6HI 1C5BL 3BPOB 3I50L 5A2KH 2VDQL 3NABL 1DLHA 1KIRB 3EBAA 5GS1A 5IVXA 3AFLA 4DAGL 4M6OL 2P24A 1NEUA 1IZKA 1WWAX 1I4FB 3MV7D 4J1UA 2BSSB 3OB0K 1FZKB 3HPJB 3VFGL 5JW5A 3WUWA 4DQOL 5IMMB 3WNNA 1T3FB 4MQXD 5F96L 3SEPA 1KN4L 3U36A 4ZUSB 5IV2B 1HHHB 5FEBA 1GGBL 4Y5XB 4LSSL 4KAQH 1DL7L 1AD0A 4OLZH 1DBAH 5E99L 3OGOE 3ARWA 1NQBA 5CZXD 3MBXL 3U7AA 3S35L 2D4DA 3MJ9H 2VLJB 1S7WB 3DYPA 1IC7H 2OP4L 4MA3A 1XGRA 4MB3A 1YA5A 1OAXL 3B9DA 3ARPA 3DPBA 3FFCD 4RBPH 5I8KH 4V1DB 1N5AA 4LU5L 3MJ9A 4IRSC 1K85A 1KC5H 1QQDB 2LFGA 4FQ2H 3FQUA 4CN4A 3WDIA 5HHMD 4F57L 1KBGH 2B1AL 4LLDA 1ND0A 1G7JB 4XHJD 5IFHL 1ZHNA 4OKVA 1MRFH 2NX5E 3C60D 4WI4A 3TN0B 1A4JA 3WFBH 2BVUA 3KPTA 5B3NA 3WXVL 1NSNH 3QISA 5KSAC 3QXAA 1FNAA 3CPLA 4Z7WE 4M6AA 3JTSB 1UJ3C 3FN3A 3QDGA 5C09B 3MA7A 1NGPH 1OVZA 4Y1AA 3UTQA 4N90D 4DJMA 3PNWA 2ZUXA 5F7DA 1JNHB 3RBSA 2CLVB 3FAWA 3MRLB 1G7IA 3T2QA 5D1QD 1DTUA 2CRMA 2OXHA 5GISL 2ADJA 2LVEA 4JFDA 2VXVL 2R8SH 4NRZA 2WLZA 4OCRL 1CS6A 4WFFE 1FO0L 5DUBA 3CGTA 1A8JH 5JO5A 1TZIA 3SGJA 1MHPL 4K2UL 3R0MA 5CJQL 5FCUH 2HTKC 1QRNE 3TWCL 3OSKA 3ZE0F 1DSFL 4H20H 2O5XH 4A6YA 1OLLA 3VMPA 3X13B 3VG0H 5I1JL 3H0TB 4DN3L 3X3FH 2ICEB 5JUEL 5T1MB 4F7EA 3I6GB 4FABH 1S5HB 4XPTL 3GDBA 5CZVH 2QSCH 2PO6B 1AQKL 2FEDC 4XMPH 1JWSA 3LRHA 4NCC2 4P23C 4ZPVB 3HAEG 4ZG1A 1U8HA 1D9KC 3EYQC 1GJIA 1B6DA 2YPLA 1AD9A 4OFIA 4WW2B 1JGLH 4DN4H 3V4UH 3QCUH 5K9JH 3Q5TA 3L3JA 3TT1L 1JWUA 1U2HA 3QJHB 5FOBB 3QXTA 4G6KH 1UKQA 3GSXB 2FX7H 1FFPB 4OCWL 4XRCB 1T1WB 5IT2H 3ZZ1A 1N6QL 1RUQL 4JZNA 4WIQA 1RUPL 1DVFB 4L8CA 3PWPB 2DICA 2VSCA 3CZJA 3PDOB 3HE6A 3RZWA 1MFBL 2M1KA 4PJBF 3VXME 1K5NB 5KVDL 4JVWA 4PGJA 2PXYB 5C7XL 3GSVA 5IB4A 5IMKA 3SDAC 1UWEL 1JF1A 4EEEA 1D7FA 1EO5A 4JY6B 2JF1A 4CADA 1SYSA 4XPBL 3EIFA 4QXWA 3G9AB 1U8IA 3GNMH 1NCBH 1U3JA 3T3MF 4IJ3C 4AT6A 5D1ZB 4GMSL 1VADA 4PJIF 4OLYL 4XBGA 5LBSL 2D31B 3ARGC 2JB6B 1G9NC 2XKUA 2IH1B 4MQ7B 5HVHB 4F7PB 5I73B 4FXLA 3C6SB 5ADPH 1LEGA 5E8PA 1MJ7L 1XIWB 12E8L 4V1DD 5EIQA 3DETC 2EYTA 1Q9OB 3TNNA 3L95A 5KSBA 1N59B 3DLQR 1NCNA 1D5IL 3DX9A 5SX4I 5HGHB 3MO1B 4I5BA 1XEDA 4EXKA 3MLXL 2GCYB 3VG9C 4WUKH 1P5UA 43CAA 5HHOA 3VDCA 3RVUC 2R4RH 2DAVA 4FFVC 4GW5A 3NZHH 1QFUL 4D2NA 1PJ9A 5IF0B 3U7YL 4PV9B 2QSVA 5D93B 3HN3A 4BJLA 3CXDH 5C09D 5IHZA 1UM4L 1QLRB 4RGOL 2C26A 1LP9B 4E42A 3OKKB 5J6HA 1T20A 3L3KA 2CSPA 2Z31D 1CXEA 2IBZX 2XKNB 4GKOA 5EFIA 1FVCA 1IGCH 2DIBA 3N0PB 5DEGA 5KG9B 1Q9WA 2AXGB 4PJFE 4ELMF 1HXMB 2Q76B 3RTQC 4APQB 1MAMH 4XI5C 2NNAA 4F33A 4XP4L 2QQNH 5E5RB 1T4KB 4MXWH 3O3EB 4EUPH 4XNXL 2JB5L 3WFZA 3QDAA 1FNGA 4F15B 5DRWB 5BQ7B 2PCPB 2FATH 5HYJE 1NMCB 3VXSA 3IF1B 5I19L 1HHJB 5F7NC 4NDMA 5C1MB 3KPRE 1FPTL 1Z0MA 3ZKXC 3MRCA 4M7KH 4LPCA 1XR9B 2IFGA 3CD4A 4X9IA 2PO6D 1MRDL 2B5IC 4QXGH 5I8OH 1Z5LB 3KPSD 1U8MB 4Y2DA 3V0VA 5D6CA 1JRHL 1KENL 3DVGA 4JKWA 1LMKA 3MLYH 4DGYH 4Y4HA 2J2ZA 2JJUA 4TSAL 4D0BB 3BH8B 3MUGA 2RFXB 4OZ4A 1ZVSB 4H8WC 4JPVL 4E41A 5L9DL 4WI8A 1MCEA 2IQ9L 1ZEAH 3HTLX 3ULVD 4WU7A 3P4NB 2VQ1B 5FA4A 4OGYL 3UPRB 2ED7A 4HJJH 4PGCB 1MEXH 3UTSE 2FO1A 2HJFA 1CFNA 3BUYA 1DVFD 3TBSB 1MREL 1UG9A 1EJOH 3BP7B 5IEKA 2QHLA 1INQB 4IIQB 5DQJB 1F6AB 2NZ9D 4U3XA 3TO4A 1Z3GL 3IAGC 1IMHC 4Z7QF 2FNBA 4HKBB 4W81A 3KLAA 1HH6A 2FRGP 4G6AC 3F7VB 3TP4A 2ZUWA 4HGMA 5H37H 3BWAB 5I1GH 2HKHH 5JLZB 5L88H 3T4AB 4DK3A 1TNMA 1YUHB 1UVQA 2OCFD 2EEDA 4PLKD 5K9QI 5C70A 3HR5B 2VH5H 4ENEC 3PP3H 4FNLL 2R0ZH 3MJ6A 4NQCA 5ANME 2XFXB 4NQVA 4NWTL 3KPMA 3O2DH 3NN8B 3FZUD 5E9DA 3C2SA 3L3OB 1XCTA 3EGSB 1D5ZB 3OAUH 4XNZC 4ZOEA 3O2DA 4JQXC 1A3RL 4KDTC 2B0SL 2OMNA 5B3JE 1X7QB 2P8PA 2VDLH 4PRDA 1G9ML 2EO9A 4NQDE 1JL8A 1WFNA 1XH3B 3NH7H 4ZS7L 4NQSB 4ZNEA 2F53D 2IPUG 3L3HB 4RRPA 1NGWB 2FHCA 1SEBB 4OZFB 3PABB 5IWLC 4MNQA 1WWWX 3DMMD 4G7VH 2DB8A 5CSGA 2P1YA 3RU8L 3D0LA 1WT5C 3PWNB 4LOUD 1QSED 1I9EA 3QWOB 3GMMB 4YPJA 3T0EC 5MENE 4PRBB 4RAVB 3BDXA 1T7YA 3SHSA 2BVQA 2GAZA 2IQAA 4P3WA 1YZZA 4YXHL 2OL3A 4HGKC 1QFWI 5JXED 2LAGB 4XMKH 2BSRA 1CDJA 1JUFB 3TO2B 3B5TA 3VXQB 2A9MH 3NFNA 5A16A 1N0XH 4LVHB 2X41A 1K4CA 5ITFB 4PTTA 1BBDH 4RZCB 1QKZH 3BJLA 1NAKH 3D25A 1MFAL 2A83B 5ELIA 5BW7A 1NDGB 1N2RB 3CFEB 2FR4B 5C92A 5F7FA 3UTTA 4C4KO 4G9FE 4JDTL 2VDNH 1DLFL 2J3SA 3DROB 2F5AH 3OAYH 3WHXA 1DQJB 3ZLQC 5BS0A 1HQRB 1SJXA 4M43H 3O4LB 2E9WA 1OGAE 3VI3E 1MQKH 1F45A 3BGFB 3N1QC 4FQXC 3T0XA 1G6VK 4LLQB 1FZJB 2EIEA 2V7HB 4KRPB 4NN6C 4MNGE 1C08A 3V52H 1LVEA 3HG1E 2HT3D 2P47B 5I76B 1Y0LA 5LWYL 4S1QL 3KWWB 4XPAH 4EI5C 4PB9H 4PJGB 5FK9B 5E8OB 3FT2B 3A6BH 3MGOB 3P0VH 1BLNB 3LSOA 4IMLA 3H9SE 4JN2B 1UZ8A 3QEQA 3THML 5HYSG 1IM9B 4X99B 3VFUB 1P2CB 3MC0A 1RJYB 2BFVH 2NXYB 1TPXB 5EC1A 4BH8B 2DYPA 4M93B 1FAIH 3EFDH 3ET9F 3VW3H 5SWSE 3B3IA 2NW2A 2ITCB 4YHOL 4IEFB 3TZVB 3MRRB 1A6AA 1X4YA 1MLCA 3BKYH 4M1CD 5HGGS 3QFJE 1AGBB 3SQOL 3KHQA 4QY8B 1X6NA 2XWTB 1IBGL 5INCA 1XF4B 1D5BB 1EO8H 1S7VA 3QUMH 15C8H 4H5SB 5CBAA 3VXRD 5F1OB 5AEAA 1T1YB 3SJVE 3VXUD 3QUMA 2DQJH 4PB0H 3B2VL 4POUB 5T5FH 1H0DA 1VGKA 4FQ1H 4UNVA 2VLKB 1EEZA 5BO1H 2MPAH 5LGJA 1I85C 2X4PA 4NJ9L 3ULSA 3BPOC 5KSAA 3KPNA 4KPHH 3ZL4L 5C6WH 1AH1A 5T1DL 2R2BB 2ZUSA 3LKNB 1BFOB 5CSZA 3DSFL 3HAEB 1FFQA 5E2JA 5AD0B 4P4KD 4G3YH 3MA9L 3O0RH 5F1IB 3LKRB 4PLJC 1IT9H 4HKZB 4MYWB 2UWEE 1KXTB 3BOVA 3G5YA 1FG2B 4Z0XA 4U7MA 5IW1A 3DVNA 1WWBX 2ERJB 4PJ8A 1DJSA 5T3XL 3TA3C 5DMGC 1EZVY 2G9HB 1T5WA 4NO2B 2CMRL 1J0HA 3LN5A 2VSDA 3OBAA 4OF6A 4U1SA 4Y5XC 1AIFA 4K7PY 4JRXE 5KVFL 4O2CB 1GGCH 4K8RD 2RAMA 5AAWA 3P9MB 4RX4A 4DVBA 4GG6E 1HSBA 1CFQA 3B83A 3MRFB 4N8VG 1CL7I 1HEZB 4JRWA 3K2UL 3NCYS 4UBDC 1RK0A 3UJJL 4JB9L 1FGVH 4HCRL 3T77B 2R2HA 4JZOB 1MCPH 4RNRA 2FZ3A 4Y89A 3OR6A 5D72L 2EH8H 2CUMA 2ZOKB 1W0WB 4F7CA 4JM2C 3G5VB 4HIHA 4CN6A 2X89A 4JQVC 1H3GA 2BVYA 4P23A 4YC2B 1DQMH 3OHXA 4L4TE 1NBZA 4TVSa 3TN0C 4ZO6A 4HPYL 5I30H 1IM3A 1D9KA 4Y8AA 3W11C 2OSLB 4J8RB 3SBWC 1FNEB 5TE4L 2XWJB 5H94B 2C3GA 1YNKH 2E7HA 3QBTB 2AJVH 3X14B 5IMOA 4TSCL 3BQUB 3UC0H 4XWOC 4JLRA 4KRPD 3S98A 3EO1A 4KFZC 5F8RC 4LPTA 3TPUB 4QHMA 2YC1B 1QFPA 1NFIB 5J12C 4X5XA 4M5ZH 3VXPA 2F15A 4P57A 4OGZA 1JPST 1CQKA 3BPNB 3BZFA 2LE9A 4QHKI 3IFPB 3MNZB 5CMAB 2OTUB 3O8XD 4NRXB 3VMOA 3WFCH 5BXFB 2XQBH 3FQXA 4OQ1A 1OTSD 3NMEA 1ZHBA 5DVMA 3QUZD 1G9NH 1QBAA 2NXYD 4GXUM 4R2GB 4MX7B 4S11A 2F58L 3MCKB 1RIUL 2E9JA 5I2IA 3SO3B 3W39B 1DUYA 4KI1A 3ARGA 2ADGB 2P5EE 1G0YR 3WEXA 3L3GA 4HC1H 4I4WA 1U8OA 1UZ6F 4KH2A 4RFEA 3Q6FA 4GQPH 3QUYB 5CGYC 4ZD3H 3RVXD 1NMBH 1AP2A 4HC1A 5IW6A 1CG9A 1MELA 1BHGA 1BVLA 5DRXB 2O61A 3D39D 1T0MB 3H3PL 2EDTA 3MODH 1E4KC 1OSZA 2RCSL 1EDQA 1UM5L 2VLKD 4XCYB 4XBPB 1CTNA 4WI3A 3IB4A 4IMKC 2V2TA 4ODSH 4LCIL 5DRNA 5DD3L 5GS3A 4FMFA 5E7BA 2J4WH 4OB5H 1WFTA 4DKEH 2YD8A 4JQIL 4CDHA 3GBNL 4DKFL 2PXYC 4X5WA 4BH7A 1NCWH 3AU1A 5DK2A 3M07A 3O6LL 4HIEA 3U9PL 1DN0B 1WIPA 2M8XA 1I7ZB 3RTQA 4XBEL 5KS9B 3TBWB 4QXTB 5D1ZC 1WBZA 2Y7QA 3DX8A 4TVPE 1XGUB 1Q38A 4LEXL 1BBJB 3GMOB 3IFOA 2JCCB 1KPVA 3AROA 1LEKB 2AKRA 1B0RA 1XIWC 1ZT1B 2BOBB 4PGEA 3QXDB 2I9LB 3MZGB 5FF6A 1XF5B 5TGBA 4HK0A 4KXZI 2FSEB 4YDJB 4BSVB 3RHWK 3P0YH 3HUJA 3O9WC 1OP3K 1WAAE 1YY9C 4WHTA 5ADOH 2NX5D 2NPLX 3Q6GH 4WGWB 2BXZA 1T0NA 4OZGE 5GHWH 3V6BR 5C0JB 1CU4H 4MQTB 5CUSL 4UI2A 5L2KE 1U2CA 1OGTB 3DTXB 2PW2A 5T1KB 2C1PA 4H8WH 3EW3B 4CVZB 3GJFH 2X10A 3SO5A 5D93C 3OXSA 3EOBB 1CDHA 4OI8A 4YJZL 4JM4L 4HIXH 5TQ2L 4K94C 1LK3L 3OJ2C 2AK1L 5C0CB 4TUKL 5DJCA 3MGAA 2JIXB 3QO1B 3C5JA 2BVOA 2UUDK 4TNWF 3EJYD 3SGDI 3L1OL 4ZQKA 4ZPTB 4WFFD 2NMSA 4HWBL 3T65B 3NPSB 4M61A 2Q8AH 1QZ1A 1YMMA 3RWFA 4APQC 5F1NB 1DEEA 1FCCA 2XZZA 4OZIF 2A74B 1YPZF 4LCUB 3VRIA 1QRND 4Y4KB 4G42B 4MD5A 2Q6WA 3BDYH 4QRQA 4QYOB 1N4XH 3MSPA 5DJDB 2LVCA 3I02B 3EJJX 2H1PL 1MPAL 4AIZB 3CVIH 1U36A 4X4MA 5C0DA 5DD5H 3GBML 4CW1B 1G6RB 3FRUB 1NBVH 1MH5A 4LGSB 1TVBA 5E8EA 5C0AB 3T04D 5MI0C 4KHXL 1NLBH 2XN9B 3U1SH 4MXVF 3C9NB 4JQXA 2N56A 2AJXL 3VCLB 3BKCH 5IQ9A 5I1AB 3TLRA 4KHTH 4JKPH 3C5SA 3U83A 3AVEA 1G7LB 2VYRE 3H42H 2OR7A 4C83B 1GAFL 3IRZA 1I8KB 3DIFB 4PJDE 1C7TA 1RPQA 1DUZA 1RMFL 2Y6SC 5CINH 5IWLA 5DD1H 3W2DH 4RQQB 1KJ2B 3D1MC 1K9TA 3G5ZA 3ZYZA 1B3JA 4X4XA 1G7QB 1AGEA 1I9JL 2IALA 1A7NL 1WT5A 4NRYB 3T0EA 1UB6A 3LQZB 5I1LA 1DBMH 4IIQC 3VXMD 1U3HD 4KUCF 3HC3L 4YWGL 1CFSA 5J9PB 1KJMA 1N64L 4UMGA 3RVVD 4U05A 2Y5TA 3EKCA 3MNWA 1U0QA 1YNLH 2YD5A 1F6LL 4M62L 3IJYA 4OCYL 3D18A 5HYSB 5FUZH 5CWSA 1ONQB 1MIEH 4LIQE 1XF1A 4Q58C 1GPOL 2B4CC 4LKXB 3U0PB 2COQA 4WFEE 3VFPA 4HS8L 2DMCA 4WWKC 5D2NB 3RL2B 3MRGB 3U9UB 4JPIB 4CRPA 2DKMA 2P46B 4KKNA 4N0YH 3QNXB 5J13C 1OTTD 3KR3L 4GW4A 1F42A 1I7UA 3L7EB 1FH5L 35C8H 3QPXL 1MFEL 4FQXA 2BC4B 5HGAB 1GOFA 2HFGL 4Y4FB 5IVOA 3H9HA 2O26U 2F9BT 1NGZA 4X9HA 4LBEB 1A2YA 3V6OC 4M4PA 1VGEL 5TDNA 1JN6A 3CU1A 3ULUF 3MV8E 4EI5A 3JXAA 1T22B 4X8XA 5HDOA 4NZDA 3RWEA 3TNMA 1TCRA 5T1KD 2F8OA 3GSQA 3UYRL 4XNQA 2BXYA 2IPKB 3QIWD 3OTTA 1OAZH 4X7TB 2BP3A 1P4IH 2H26A 3ZKSD 4OLVH 5I9QC 5JHLH 4JEGB 2XZCH 1A9EA 1QVOA 4O2FB 2P5WB 4OGXL 4OAWB 1F4HA 2JIXD 3BX7C 3PV7A 4JPWH 4N0FA 3KDMA 2UZIH 1W72L 4X6CE 4QXUL 4MVBC 4NKMA 4LSQH 3S37X 2GYSA 2R0LH 3FT3A 4ORZC 3CSGA 4WJ5B 4XVUC 4K7PH 1X5HA 4FG6C 3VGGA 3KPPB 5CP7A 3IRPX 4N8VB 3BSZH 4R7DA 3Q3GB 4OGAD 1BD2B 3KPRD 4GRWH 3ULVL 3VFSA 1AKJB 3A6CL 5EBLB 1OAQL 2LU7A 5L6YH 3TVMD 3DHJA 3QDJA 5EZJB 1I85A 4HEPG 4U1KA 1PLGL 3IXAB 5ILTH 2DM4A 3BZDA 3FAXA 2P8LA 3H3KA 4J4PC 2Y06H 1NFDA 4OCNC 2VLRA 1I4FA 4I0PC 1HDMA 4OFYA 3HNSL 4L8SB 4JRYE 1LK2B 2DM3A 2J8UB 4QTHB 3WO3B 5IOPA 3PL6C 3KYKL 4G8IB 5DD0H 5D1XD 3MRBB 3TA3A 5IV2A 1MHCA 3OG6B 1TJHL 2LU3A 4Z5RB 4ODXB 4UV4L 4V2CB 5DJ0A 1AO7B 5TPWL 4NP4H 4X7CC 1TPXC 3UTSD 1XGYL 2WBWB 4XXDA 3E8UH 2Y1VA 5KSBF 3RUGE 4M93C 4HKJB 4HIJA 2IANA 3DSNA 3C6LB 3SDCB 3QUXA 1IAIH 5C07A 3PJSA 3OKOA 1U3ZA 5KOMC 4C56B 1AGCA 4F2MA 3MBED 1RUKH 3TJHC 1MVUB 1S7RB 3GK8L 2VWEE 3RGVD 4AG4L 7FABL 2XTJC 1FV1B 3CH8A 4WHDA 1HIML 4I0KA 3CVHL 1IAMA 1QQDA 4TRPH 3U7WH 3V4VH 1EA9C 2X40A 4FQLL 4UDUA 3VGEA 4CBPA 4IRJD 5IK3A 4LHUG 3MMEA 2OR8A 4ALAH 4JM2A 1UYWL 4TUJB 1TVHB 4JQVA 2CLZB 3TN0A 2BVEA 1BOGA 5IB1B 3FQRA 2ATPB 3IDMA 3G5XA 4E0RB 2W59A 4GXUN 3SBWA 2ESVE 3V95A 4NQEE 2LAAA 2IBGA 1JWMB 2E6PA 4NQDD 5F71A 4GMTH 2VISB 4G6ML 3U2SA 5DLMH 3D3VA 4Y4FD 3QIBC 4PV8B 3IJSA 3BYTA 4O02H 4R96B 3U48A 3HNTH 1M7DA 2NY0B 4PRHE 5FO9B 3DXAA 1ORQB 3FO1B 4RMWA 4NO0D 2EZ0D 4I13B 5JIIA 4U33A 2YBRB 1YQVH 5E08H 5MEND 3WE6B 1MF2L 2AJUH 3T2PA 5FECA 3VRJA 1EEUA 4PGBB 4HT1H 4MD4A 5HYQB 2GJ6B 2H3NA 4O2EB 5JIHA 5IFAL 3H0TA 3V9FA 1DZBA 4U1LB 4UOW0 2Q86B 1E28A 5DUML 2AV1B 5DYOB 3I6GA 3O45B 5SWQA 3WLWC 1CFVH 4G9FD 5F3BA 1F3JA 1JYXA 3OKNB 5FDYA 3T1FA 4EDWH 1T1ZB 2ITDA 1BREA 5D71H 4J6RL 4XTRD 1OGAD 1YN6B 3BAEH 3VMNA 1QLEH 2XZQH 4KK5D 1PSKL 1CN4A 3VFTA 4P2QE 2WUCH 2XV6B 2ATKB 4BQBA 3M1BB 4OI9A 4OV5B 3BQUC 4IHOB 4YHZL 1E4KA 1AKJD 1KG0A 4JFPA 1FFOB 1Q72H 2AABL 1T1WA 3IDGB 1C16A 3O6KH 4IMKA 3GSOB 1EGJH 3DX7B 3OXRA 4PRAA 3VWJB 4GSDL 3I75B 4UOJA 3LRSB 5HI4C 4ETQA 4P3DA 3ZDZE 4X6EA 1JHKH 1EGJA 3EOAA 3CX2A 1MLBA 1D5MA 1A7OH 1K5NA 4TULL 3NCCB 3W82A 5LKNA 1NC4B 5HDQL 1HILA 3H9SD 1T66C 1D6EB 2R1XB 4PY7A 4PREA 1NEZA 1H9VA 1FFNB 3GO1L 2ZPKL 4MGXA 2EE6A 4JY6A 3SE9H 5A1AA 2WWKO 2VXSH 5F44A 4GAYB 1A6TA 5SWSD 4PJAA 4PRPE 4OZHE 5DD6A 1FC2D 1ZLSH 3SO3C 2DTMH 4JG1H 2L7JA 2IGFL 2VR9A 2XG5A 4JJHA 5IG7B 5GZNC 3PHSA 2YSSB 4JN1L 3BEWA 3OAYK 1XIWA 4AM0B 4KMTL 4YGAB 1G9MC 5EBWB 1I1CA 4ZSOB 4XVTH 1Q9OA 2YUXA 4Y19E 4DCQB 5ICZB 3ALXA 3DI2B 3X12A 5D7LE 3SJVD 3O9WA 1E4JA 4X6BA 5LGHL 4PJBB 3OX8B 3I6KA 3DRQA 1GGIH 1N8ZA 5IB5A 3MX0A 3R1GH 2GCYA 1NGYB 4K8RL 3QHFL 3QJFA 4K94H 1LEIB 2QADC 3SDYL 3BVNB 5HHXL 2ZUTA 3WBDA 4I3RL 4PJXA 5DJZA 3S3PA 3MYJB 4GT7A 2YA0A 1HK6A 4PJIB 1JMZA 3OKKA 4M8QA 1N7ML 4O5LH 4QNPE 3H2WA 4EQ2A 5F7LB 2R29H 1KNOB 1ODAA 1ZAGA 3HFMH 3EYVB 3O6FB 3RKDD 1FZOB 3ZDXE 5EIVA 5CEXA 1ED3B 1QR1A 1H5BA 4WGVB 5DR5L 4H1LH 4H26A 4JRXD 4APQA 3S88L 3X11B 2R0KH 5DRZB 4YHPB 5EC2B 1T4KA 3P11L 3REVB 2D7TH 4H1LA 4QTIH 1ZVYA 3L3DB 1T03H 1WV7T 1EFQA 2A6IB 1U8JB 1UT9A 5DRWA 5B38G 4AL8H 4NPYB 1WZLA 3MXWL 1P84J 2VDQH 1RJLA 1TTGA 3QFDB 3EDEA 3VFRA 3IGAA 4XVSL 3VWKC 5MEQA 4QHUB 2VZVA 5FM8A 4C55A 2DWEA 4QRRA 2CDFA 2R23A 3VFGH 3WN5C 4N1CA 4EDXA 3FN9A 5FYKH 2VDMH 1MCCA 2MQ3A 3VXNB 4ELMB 3D5OF 1DL7H 2DKUA 1ZT7A 1CDUA 1KXVC 1GGYA 1CFTA 2AQ3A 3OL2A 2VLLB 2R9HC 3EFFA 3TT3H 5J89A 4PJ5B 5KVEH 4K3DH 3TJEL 4WTXA 1MJ8H 4MCZB 4KTDL 2VQ1A 3BE1L 4DZ8B 4PGCA 1IE5A 4QHLA 5IVXE 3TBSA 4AIOA 3NPSC 4N1HB 1INQA 1HZHL 1W0VA 3T3PE 4LDLB 4X98A 3S5LA 1C1EL 1FQ9C 3E6FA 5GSRB 3VGBA 2BDNL 2Q7NA 4NKDB 1MCOL 3I9GH 2BY1A 3BWAA 4ZXBB 4WHYH 3CX5K 1S7XB 4IOIA 3T4AA 2ZUYA 2B4CH 3IU4H 4CN1A 3FMGH 1KSRA 2A9NH 4TUOA 2K3TA 1TETL 1X4XA 3ZYOA 3LH2L 3HR5A 4AEHH 1I3GH 2X4NA 3C09C 1SY6L 5FYJH 2P5ED 4NNXB 5DTFA 4WWKA 2VXQL 3SDXA 1I8LC 1VFBB 5E6IB 1BVKB 2JK5A 1NJ9B 4ZFOL 2P43B 4HJGA 3DO7A 2VXVH 5DQDL 3KNBA 1BM3L 5GGVL 1JYWA 3QQ9D 1T21B 4OCRH 3RZCB 4M7LT 1RZ7L 4PS4L 4CGTA 2WUBL 5B21A 1J8HA 2JELL 2AXFB 1KCSL 5ISZA 3CZFA 4P5TC 1SEBA 4L5FH 3RWCA 1FO0A 4FP8L 2NY6B 1MCWW 4HX1B 3B2UD 2NTFA 2NY4C 1PW3A 4R0LA 3FO2B 4DGIL 1IQWL 1UWXK 3BP6A 2FJHB 4N0UB 3SE4C 4Q97A 1DSFH 2R2EA 1N26A 4XCFL 5EWIL 2OZ4L 3TCXA 2YRPA 1I1YA 3AS3A 4I77L 4R4BB 4FXGA 1UENA 5JUEH 3QQ4B 4U7SA 1CLYL 2GTZA 3QO0B 5SX5H 1BWMA 4XPTH 4AEEA 5I17B 3SDDB 2DQTH 3S36X 3KXFB 1JPGB 2NR6D 4L4VA 1I8MB 4OD3L 4NQUA 2C3HA 1HINL 4TPRH 3LB6C 1HHGA 1XGQB 4GRLA 4EOWL 3H8NA 3QXUA 3PHOB 1KCRL 1CLOH 4NWUL 4H25A 4TVPD 3ZSSA 3EYSL 3QCVH 5D2NC 5J4MA 1BGXL 2HRPH 4LEOA 1V8HA 4KJWD 2H45A 2FX9L 1NLDL 1XMWA 1PD6A 2XWBA 3QUKA 4UILL 2DIJA 3OKDB 3TBVB 1B2WH 1FZJA 2XACC 2V7HA 2OK0H 2ZOLB 2UVFA 1H8OA 1HQ4A 2IAMB 1I9IH 1LQSR 5I76A 3WO4B 5L2KD 5EOCJ 4OSUL 3HI1A 3HC4H 3WUWG 4J4PA 1BJMA 4PRIB 1ZHKB 4I0PA 1ZA6B 2PTTB 5IB2A 5MHSE 1KN2L 3D2UB 4F7MB 2VKWA 2XA8H 1BLNA 4QHNB 4U2ZA 4WUUA 3PL6A 4JO3H 3WUZA 1T80A 1AFVL 2Z93B 5LBSH 4P48A 1ZT4B 1IM9A 2DLFH 2GEEA 3GMNA 3GKWH 1FVDB 1P2CA 5C08B 2BNUB 4X6CB 1MUJB 5D7JB 4E5XB 3OJDA 5FOJA 5AZ2H 2APBA 3PQYA 5EG6C 1CR9L 2J1KA 3QHZH 3BW9A 1A6VL 1KJ3L 2UZXB 3BISA 5CBEA 5F7HA 2FX8H 1A7RH 4LQ1A 1T2QL 3IDIB 4M7ZB 3JWDL 1R5IB 5IBTL 5BV7B 3MLXH 3OR7A 5I15H 3BKJL 3W9EA 4LSTH 1XF3B 1RZIB 2ARJB 3W0WA 5DJXB 1KTDB 3O6MH 3B6SB 5CCKL 2AGJH 3GMQA 4MJIB 2ZSWA 5I8EB 3ZHDA 4LL9A 1H8SA 3PGFH 3BPCA 1IL1A 3FONB 5E6ID 3KHOA 2EKJA 3VD5A 2C7UB 5C0EA 5F6HJ 5C0NC 1WGOA 1GC1C 3HRPA 4ODTL 2UV3A 3R0NA 4HF5H 5F9WC 3QIBA 3MOBH 4XHJC 1JGVH 3BEVB 1MWAB 5EN2B 2PW1B 1FLRH 5IEHA 5HHNB 5DHYB 2Z4QB 3MFGB 3JTTB 1KIQB 4FRWA 3L5XH 5I19H 3HUJF 2W9DH 3V0WH 1X5FA 1KIPB 4J3WA 3S34H 4X6DA 4RIRB 3GSNB 4L3EB 2WW8A 3MRFA 1CWVA 3WDJA 4UIMB 1I1AA 4UZGA 1JHTB 1I7RB 25C8H 1Z9MA 2VAAB 3SDDD 4EN3B 3SKJH 5D1QC 2VL5A 2M26A 3NFSL 4LMQI 5H2BB 4BKLA 4HS3B 2Q8BL 1PG7W 3WKMH 4OLWL 1BAFL 1K3ZA 1Y6KR 4Z76B 3TF7C 3LS5L 1W0WA 2GFBB 4WFED 4HG4J 5IIEB 1F11B 4JPVH 1BF8A 3NGBB 5E8NA 5INDB 5GSVB 3QNYB 4O4YH 5BRZA 4Z7UA 3QDME 3BD5A 2VO5A 3O11B 4X8JB 5IM7B 1VEOA 3O41A 4GKZB 4M02A 3FB6A 4NHUB 3GSWA 2DI9A 5HDBF 1CYGA 3PWUA 5GS2H 5DO2D 4ZUVB 1BIHA 1LO4L 3RDTC 3UJTH 3MV8D 2NY0C 4K3EL 5CEZH 3WJLA 3MRKA 2VNCA 3QAZB 5C0BE 3K8MA 3LV3B 3G6DH 4NUGL 2K7PA 2GSGA 5HDLA 4GXVL 2J6EH 2IADA 3MXVL 3MNZA 3CFIC 4KK8D 4E41E 2EDQA 5KVGL 2EC9U 1REIA 5K93A 4J3OC 1S78C 1MVFA 2C3VB 3DECA 3VRLF 2VN7A 3NIFE 1KIUA 4JFYA 2X5PA 4LK4A 3P73B 5E2VL 1S9XA 1UKSA 1ETZA 4L29A 1RHHB 1LE5B 1G9MH 4PR5B 5B39G 5D5MA 4KROD 1EHLH 4ZS7H 1CF8L 1Q0XH 4NZUL 1NMAH 1CQYA 4XMLH 1BQHA 3ES6B 2ZKHH 2AI0H 2Y36L 4Q0XH 3FB8B 5B38B 1P5VA 4NC1C 3FTGB 2HFEA 2FHFA 4QEGA 1IAKB 3GB7A 4P5MA 2H2PC 4XCYA 3OKLA 1L0QA 5EOCL 5E9DE 3TBYA 3ARBC 4MJID 1KPRB 2V9RA 4X5LA 3MRNA 5DWUH 4QRPA 5HJ3B 3QH3B 4JRYD 5BVPL 3A67L 3LD8B 1R3LB 3R06B 4HFUH 5GGQH 4UQ3B 1ZOXA 4IDJL 1WQVT 5E6ZA 4JDTH 4LLVA 4G8GE 1DLFH 1H3XA 3OJMB 4UDTB 2DWDB 4NQXA 4MNQE 3T0BA 2ZCKH 3NCJH 2WZPD 1F00I 3MPCA 4M1GH 4UNUA 5ICXB 5KS9A 3TBWA 5DJ2B 3QA3B 4M6NL 2B7DT 3O4OB 5H8DA 3IFLH 2DDQL 3V4PL 4X0KA 1YMHA 4XB8A 4MJ5B 1DBBH 5DJ6B 5GJSL 2BNRE 4PJEA 4TSBH 3E2HB 2OM5A 1A7BA 1I3UA 5FHAL 3QXDA 4FTVE 3CFBA 3AAZA 5EO9A 4EN3D 1EH9A 1CDBA 4OFDA 4BZ1H 4CKVX 3NBNA 5HHQB 1JNNL 4JY5L 1MNUH 4L3CA 5ESVA 5ID1B 4KJYB 3P77A 4X9BA 3VWKA 4LF3B 1MCDA 2ICWB 2DQDH 1FL6A 1A02N 3UTTE 1R3JA 2EYSA 4IDLA 5EO1B 5GGTH 3RVWD 3WN5A 2WWMD 2IMMA 4YHLL 3TESA 1F97A 1OGTA 5BS0E 2BHYA 2HKFH 4AY0A 4C59B 2VABB 5SWZB 5GGTA 2ESVD 4LSUL 5F7KC 5AWNH 1IQDA 5TJWK 1MY5A 1OTUD 4FZEL 1EFXA 2VLME 1RURH 4U6VL 1TJGH 1P69B 3ZYIA 4WEBL 4KZDL 1NH6A 2BOCA 1EAPB 4YK4B 1JK8A 5MEOA 3MJ7B 4PRHD 1MSPA 2YPKA 3BH9A 2KH2B 3BESR 3DARA 3ZO0A 3BIAX 1IGIL 5CIPB 3TH4T 1KLGA 2YXFA 5FV1L 2X4QA 1IFHL 5I16B 4JFFA 3IFNL 5JHDA 4FQJL 5H37G 3SKMB 5L7XL 3DI3B 1QSFE 4XHQA 2MMXA 5C3LD 1WBXA 1NFDF 5I66B 1SHMA 1PKQA 3HZMB 1G6RH 2VE6B 3HI5H 4O58L 3ZTNL 4NZTL 1T5XB 3NFPB 4JHZA 1MHEB 3FHQA 5JZ7D 3QXWA 3GUTB 2NZ9C 3CFKA 3GM8A 3ISWA 1AXTH 1FE8H 2X9WA 4FQIL 3ILPA 4RR