4O4YH

Crystal structure of the anti-hinge rabbit antibody 2095-2 in complex with ides hinge peptide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
215
structure length
215
Chain Sequence
ESVEESGGRLVTPGTPLTLTCTVSGFSLSSYPMNWVRQAPGKGLEWIGGIGTSGNIWYASWAKGRFIISRASSTTVDLKVTSPTTEDTATYFCARGLYNDYTVWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 2095-2 light chain
publication title Structure and specificity of an antibody targeting a proteolytically cleaved IgG hinge.
pubmed doi rcsb
source organism Oryctolagus cuniculus, homo sapiens
total genus 42
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2013-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o4yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o4yH01
3MA9L 1Q9WB 4QHKJ 2P24B 4KRPD 4W70A 5IB2B 3CX5K 5IHZB 2EE6A 3VXSB 5JQ6H 3RWDA 1B0GB 1MCNA 1VGKB 1XF2A 3ARED 4LNRB 3OXSB 3PWLA 3RA7H 1GC1H 3L5XH 3S3PA 1GGIH 3L3OA 4NP4H 4NRXB 4R2GD 2NY2C 5KVDL 3IRZA 5CD3B 4Z7VA 2Y06L 1PAMA 2DQCH 4FQIL 4XWGH 5F7MC 5LGJA 1DQQA 3AXLA 4OKVA 2Y5TA 3D0VB 1R5IB 1NBQA 3WFEL 1A02N 1JTOA 1HQ4A 4NFBA 3OAYK 3VFRA 5JZ7C 1JPGB 1X5HA 3PV6A 3X3GH 2HVKA 3QDGD 1VEMA 4Y4HD 1VFBA 4G80A 2FBJL 2NW3B 1X4YA 2W9EH 4ODUA 4CJ0A 1PX4A 3GSNH 4LLQA 1X7QA 3O6ML 4P2QE 3L3JB 4M1CC 4MAYD 3WO3B 4AT6A 3Q5OA 4D0BB 3ZT6A 4KDVA 2DQIL 3H7BB 4RGOH 3OB0H 5D70H 3LQAC 5DQJB 2I07A 2YA0A 4X6CE 4JY4A 4QRPD 1KN2L 3W39B 5HYJD 3KYNA 5C0BB 3W11C 1CLZL 1D9KB 1NGWA 1AQKH 1T1YA 4HSQA 1QFWL 4G7YH 5ISZB 2Z35A 5C08A 3HAEH 3P2TA 5DFTA 4U6XB 3GMOA 2ADIB 4X0KB 5KSAB 1I4FA 4PJ5A 5CD5C 1HH6B 3PXJA 4YHLH 1F4HA 3G6JF 4LK4A 4P2RA 4ZSOA 3TIEA 2EXWC 4MXWL 1UM5L 3MNZA 4KDTA 3IYLW 5D96B 2FX9H 2ATKB 4P9ML 4N0CC 3GSWA 5EU7C 4LP4A 4C58B 1ORSA 4Z76A 5C0EA 2YWYA 4ELMF 5BW7A 4GBXB 4MJ2A 2DIJA 1YEJH 4R8WH 5BO1H 4Y2DC 5E8PB 3TEUA 3G04B 4LOUD 5C2UB 4OZFA 2PYEB 2X4UA 3KLHD 2A83A 1T0MA 4R4ND 4TUKL 4L9LC 4U1HB 3VXSE 1I8KB 2Q8BL 2QQLH 3SQOH 1F3DJ 3REVA 3S4SG 1QVOB 5C0RH 2A6JB 3JTSA 4YBLB 5JOPD 4HGMA 1MHHB 3ZKMC 2AEQH 2GSGA 1LO4H 4KU1A 3BKJH 3B2UC 4PRIB 1CFSB 5C0IB 5A2KH 1YMHB 4UQ2B 5D5MF 5KSBA 2A6KA 5EU5B 2YC1A 2JJTC 4BH8B 3JV5A 4F9PC 4HV8B 3TO2A 5IUSA 2UYLB 3FQTA 2IBBA 5C0AD 4N9GB 1ROWA 1A7QH 1U0QA 3KDMA 5B38A 2ZWLT 3T2OA 4EBQL 3H9YA 4OZGA 1XH3A 2N1KA 5TPWL 2OQJB 5IM7B 2A6DA 1J87A 2R8SL 5CIPA 4UV7L 5DHVB 1OPGH 5FYKD 4A2LA 2JJSC 4HC1L 4XNXH 2M2DA 1SEBB 1CXFA 2CLVB 3RWCB 3MRQB 4OCXH 2OJZL 1CK0L 5FUCE 1HWHB 2CUIA 4U49A 3QA3A 1ZLVH 4XVJL 4U3XA 3OKMB 4JFEB 3QXUA 3U36B 3IRPX 2XQBL 5C0BE 2AJXH 5EU4B 4MLSA 4RAUB 3DX9B 4LVOB 3PGFH 1IKFH 4R26L 4N5EC 4GQ9H 4MA8L 5ISZE 1D5XA 4OD1H 2IANB 3LPFA 2E7LA 1WFUA 1XF5B 1MJJB 5DK2B 1F13A 1MCFA 2NY0B 3T77A 3DSNA 3L3DB 5F7WC 2PO6A 1U92A 2RR3A 2AAVA 4JFYB 1FP5A 1YEGH 1OP3H 2DQHL 2FZ3B 4JR9H 3ZDYF 4GT7A 4JN2A 5GGSY 5JPMB 2AJVL 2ED7A 1NC2D 3AS0A 4JDTH 4XVSH 4LSPL 3U7WH 3UCRA 1QYGL 4Y1AB 3W0WB 1AGCA 2AJUH 4WO4B 1NANH 4HUUA 3SKMA 3SOBH 2KZWA 1KTDB 3GHBH 4NQEA 2H2PD 1RUKL 3C6SB 4HEPG 4Q97A 4HUXB 4JZNB 3UC0H 4PJBF 3UO1L 3EOTL 1CBVH 3MCKA 5CSZA 5D72L 1E27A 5B22A 4E41D 1EHLL 3QCUL 1A7BA 1JHKH 2PYEE 1UJ3B 3WJLA 4RAVB 1MPAL 4HGWB 2PNDA 5EPMA 1R3KB 5DJCB 2QSQA 4HK0A 3TZVD 2K7QA 4K8RH 4NWTH 2V5TA 4ODBD 5L7XH 1G7JB 2EKSB 4P23A 1PZ5B 1RUML 1YJDH 5DJXB 2BVQA 2WP3O 3MCLH 4M03A 1AC6A 5DHVH 4PRIE 1CXKA 1TJIL 1IL1A 3ALPA 2DL9A 4QHLB 4YQXH 1QR1B 2ERJB 1MIMH 4KKAC 2AXGB 4GH7B 2D7NA 3TIDB 4H8WL 4LCYB 2ICWA 3C5SA 3RVWD 3IVKA 3T0EB 4BQ6A 4ONFL 2IALB 4AM0B 2AXFA 4L4VA 4U6VL 1YMMB 4V2BA 5EZOL 3MLVL 1BECA 3DVGA 3MJ6A 5JA9A 4GFTB 4LF3A 1P69B 2FRGP 4GRWF 1J8KA 1FFPA 5IMKA 1GC1C 2NX5D 3AGVA 3VXSA 1ZA6B 4JFEE 1VGKA 2RHEA 4LKXB 2V5SA 3UTSD 1HZHH 1S7SA 3OXSA 3MV01 3KPMA 4DKEH 3JV6A 4JY6B 3K81A 1ACZA 3QEQB 2H9GA 5ABDE 4NKIH 4KXZH 1K85A 2BFVH 3D0LA 1T7YA 3T4YA 4WUKH 4XC1H 2IANE 3ZL4H 2ADFL 3HE7D 1PG7L 6FABL 1BVZA 2NR6D 4LSTH 4NNPH 3VH8B 2MCG1 3GJEA 2IPTH 1E4JA 3BUYA 1BBDH 3NIFF 1KNOB 1QFUL 2VLLB 4WHYH 3GKWH 2ZP0T 2OK0L 1GAFL 3FT2B 3MUGB 1AKJA 2YA1A 1DEDA 3N85H 5I17A 1LQSR 1RMFH 4P23C 1D5BA 5D7IA 5FYLD 1S7VA 1L7TH 4LLUB 4Y1AE 3AVEA 5DRXA 4UI2A 3W0WE 4IJ3B 4LPTA 4P2OA 2EE3A 5AYUL 3CX2A 3VD4A 1S3KL 5E6IC 4BZ2H 3CFBB 4R4BB 4O51A 4D0BA 3STLB 5D71H 1AIFA 1E4WH 2FJHB 3MO1A 4MAUL 3RTQA 1BFSA 5HGAB 3Q3GB 5EORL 1DR9A 4TSBL 1AGBB 3WIHA 5K9QG 1BJMA 1I8MB 4P4RB 4ELKA 4WEUD 4OI9A 2V5MA 4LASH 3FAXA 4HHAB 1T0PB 4QEGA 2DLHA 4PGCB 4U6XA 3RVTD 3S96A 2DRUA 4GW1B 5JORB 2P7TA 4Y5YB 3S88L 4JM2D 1MRDH 4YPGB 1OAQH 3VI4F 3QUYB 4IMKA 4L29A 1QRND 2P43B 2APTA 4MXVE 1MJUH 1NUNB 4NC0B 3MUY1 5HI3C 3SGJC 4JG0L 4HGKC 2NY1D 5DJ2B 43CAB 2DI9A 1YMME 1I75A 4W4OA 4XAKE 3CGTA 3ZTNH 2AQ3A 4H25B 1QA9A 5I1DB 1CU4H 4TULH 1R3JB 1DBKH 2FLBT 2R1WB 5JO5B 3QZWG 5ANMB 1N6QL 2ZKHH 1QHOA 4Z7NF 2IQAB 3QB7C 4PGDB 5EWIL 5MP6H 2AEWA 3BKML 5D1ZD 1IC4L 1JPTH 2IBZX 1UACH 3G9VA 4WUUD 4HIHA 3I50H 2ZJSL 3CIQA 3V7AE 3E8UH 5LBSL 3HC0B 3BP5B 4PJEF 5HI4C 3QEQE 1K9TA 3T09A 2HKFH 1H3PH 4HF5H 3QIBB 5FUCC 4XPAL 1U2HA 1FH5H 4YEFA 3R06A 3F58L 1FJ1A 1A6WL 3BP6A 4E0RB 4LP5A 3GO1L 1D9KC 2J3SA 2APBA 15C8H 2UYLA 5D7SH 5IMLB 1JTTA 4CU7A 1B2WL 3BPLC 3UJIH 4F7CA 5D6DA 5KN5B 2OQJA 5KSAC 3UJJL 4O4YL 5ADOL 3QUMH 5HDQH 3NA9H 5E8EB 1WAAF 5EB9A 4YX2L 5FGBA 5BZDA 3RX7A 3M17B 5D7LA 5EU6B 3ZHKA 3UYRH 2BHUA 3VXUB 4RIRA 1U8OB 3AY4A 5GGRB 2HJLA 4IOFC 5I16A 4DN4H 3ROLB 2V2TA 3BT2L 2UY6A 4UOW0 2JELH 4ONGL 1IM9D 4GBXC 3C9NA 4RAUA 2KKQA 4KV5E 4U31A 3K8LA 4OCWH 4W6WB 1XF4A 4Z95L 5KS9F 3QJHB 4NCC1 4JPIB 2CDFA 1WTGT 3O3AA 3SDCD 3FQRB 3VFWA 2WWMC 4L4TD 4LSDA 4U3CA 3VWKA 1DJSA 1QSEA 4NO3B 1A7NL 1CDGA 1R3IH 2R1XA 4YBLC 3TGXA 1INEH 1OP5K 1YEKH 2HA1A 8FABB 3FFDA 3WFBL 5EA0H 5BRZA 4Y1AA 1MJ8L 1FG2B 5TJWK 2CIIA 4C57C 5HYFA 4OCYH 3X12A 1UG9A 1A9BB 3RKDD 3DMMB 1MCIA 4RMQA 4JZNA 2Q8AL 2CK2A 2EC8A 5DZNA 1A64A 1T83A 2YPVL 1FVEB 4QRRD 1GZPB 1UJ3A 1WITA 4I77H 5ANME 4R7NB 4K8RC 1Z0NA 1B0RB 4TPRH 2JB6B 1YJDC 3ILPA 2NPLX 2FEEL 4R0LB 5CUSL 4OFDA 3QDAA 2APVA 3B5GA 2EKSA 1AQDB 4YNYB 2HVJA 4KI5E 3IJSA 2DAVA 2UUDH 1CE1L 5EOQH 2ICEB 3AY4C 3I84A 3GI8H 4X6DF 3U4BH 5JOFA 3WSQL 4JKPH 4N68A 5BVJB 4POZD 3KS0J 4AEFA 2JIXA 5J56B 4S1RH 1TCMA 3OXRA 4UAOB 4ZOBA 4HW6A 5DEZA 1P7QA 1N8ZA 2GJ6A 2D31A 4LVOC 1T89A 1OD7A 5T3XE 4YXLH 3MROB 4LCYA 2VQTA 1MFEL 1JPST 2Y1VA 1JRHI 2NY0C 3SCMB 1ZGLM 1GGUA 4DK6A 1A14H 3CLEL 1SMOA 3HN3A 5J12B 1NGPL 3FAWA 1TETH 3VWKC 3NA4A 2BY2A 4AM0A 2NY5H 1YMMA 2N4IA 1TVHB 3MMEA 3KPRD 1SY6A 1Z5LA 3C8DA 2X6MA 4TUOB 1X4XA 1B88A 4HKZB 1A1OB 3CDCA 5TH2A 4QXUL 2YPKB 5EU6E 2G60H 2V7NB 3QDHA 2D0FA 2RFXA 3RIAF 1PYWA 1IEAA 3VXUE 3F8UB 4M43H 2NNAB 3C5JB 3GBMH 1BX2B 4WO4C 1YC8A 5I1EL 1BFTA 5JLZA 3SJVB 2XV6B 1YEIH 2W9DL 5IJKA 2FYYA 1NKOA 4LSQL 1CICB 5I76B 2P5WA 3QCTL 1UJ3C 1MCOL 4NZUL 2BNRD 3CLFL 4PFEA 4OTXL 3MV8D 4PJAF 3EDJA 1FL6B 4OM1L 5CCKH 5F9JB 2P8MB 3MBEB 3JBG7 2DLTA 2X7LA 1S7TA 4RWYL 1V3KA 4S0SD 5I1JL 3DV6B 4N1HB 4F7MB 3I6KA 2DIAA 3OG6B 3N1GC 5DFVC 4U1MA 4X6EB 4QTHB 3RBGA 3P0VL 3MOQA 5CEZD 5FUOH 5HPMA 1JYNA 1UWEH 1LK2A 2ZG3A 3SE8H 1UYWL 3P0GB 4KUCF 2ERJC 4JFDD 3OX8A 4MD5A 4QHNB 4Z7UB 5I71B 3MRMB 1EGJL 3FB5B 2NY6B 4G6AD 3TYFA 3T0EC 2DLIA 3QIWA 1KUMA 1PGRB 1IAIH 4XMLH 5CHNA 5EUKB 2Q6WA 5ACZA 3CFIC 3EJJX 3IF1B 2GJJA 5FXCH 3VXQA 2V2WA 5IHUL 4XAWL 1OTUC 5F96L 3VW3L 1T7WA 4XHJC 2R56L 1MRFL 1UKSA 4K7FB 3V6ZB 1T1WA 1F6AB 5CGYC 5DWUL 1A9EA 1RZGB 3VWJA 3WYRA 1W0VB 3MFFB 4NNXB 4GRMB 3PABA 3V5KB 3ULVH 2W1NA 1NC4D 4OAWB 3QIUA 1R3HB 4LLAA 1N5AA 2A9ML 4S10A 5EH1A 5IVXB 4X4YB 3IKCB 3A6BH 3OAZH 1FE8H 4KRPB 5GGSB 4PRBA 2F54B 4TQEL 3ULUE 3C5ZA 3MGTA 1TNNA 5L88H 2E9WA 2X4OB 5HHXL 4Y4KD 5ESQB 5C0GA 4P46B 3OR6A 3ZZ1A 1NH6A 1GL4B 1MY7A 3RZCB 4NZRH 4IJ3C 4QHMA 1Q0YL 5AYQA 3F12B 1J0KA 3W2DL 1KB5L 1LP9B 3A0OA 5E6YA 3DIFB 5H94B 1QBMH 4OLWH 2X70B 1YQVL 3AM8A 2R1YA 3O4LD 3LS4H 4M6OH 4NUGH 4CW1B 4E0RA 5DLML 4X8JA 2K3TA 3VA2C 3X11A 3QDGB 2ADJA 4NHUB 1NMAH 2QQKH 4Y89A 5EU3B 3KWWB 1RK1B 32C2A 1EAPB 2ORBL 1CG9A 5DI8B 5KJRH 3EOYG 3RHWK 3SBWC 2HFEA 4MAYB 4XVTH 3MRFA 5DJYA 2Z31B 4UDUA 3M8OH 4PTTA 2X1OA 3QUYC 1HHGB 3QIUC 4PJFF 3VXUA 1TIUA 2VXTL 4YBHA 3BVNA 4C56A 1KCSL 5E5MA 2DMBA 4YXKL 1M7IA 4XRCA 3CFDA 2Z4QA 3GBLA 3QQ4A 1KN4H 3TWCL 1PY4A 5FKPA 3DI2B 2A6IB 3MLXH 4G8GA 1CD0A 3K3QA 1ES0A 1YN7B 3WD5L 4JB9L 4XXCC 3IDJA 5DHYA 1C16A 3O6KL 1A7PH 5KVMC 4KJWC 4KK9C 3QPQD 1HEZA 4YXHL 4GW4B 5C0JA 5IVOA 4M5YL 4MVBC 2R2BB 4KI5C 4RDQG 4WHCA 2W38A 2UY7A 1U8LA 3QIBC 4M62L 4MJID 1X5AA 3MNWB 4G8IA 2Y06H 3HCVA 5HBBA 1NFDA 4X4ZA 4PGJA 4FQIH 3BH9A 2BK8A 1GGBL 4NSKA 5IVXE 3TBTA 1KC5H 2VZ3A 3DMMA 3FFCA 5CZXC 3WFEH 3ESVF 4JPVL 3EYVA 4BFGA 3RKPA 4HUMB 5MERB 1FVEA 4FA8A 1ADQA 5K9OB 3NZHL 3TYGL 2A77L 2FBJH 3I3BA 2B0SL 1FL3A 4MYWB 1IGMH 3PHSA 1JYWA 3O6MH 4NDMA 5CINH 3LV3A 1VADA 5DGQA 1HINH 3BQUB 1ZT1A 1AJ7H 2EO9A 4XP6L 2DQIH 4DCQA 2ICEA 4YFLI 1Y18A 1EUTA 3LKNB 1KN2H 3GMQA 2BX5A 4XCEA 1DN0A 1JZ3A 1MQKH 1CLZH 5BVJA 1T3FB 1CGXA 2DICA 1FL5B 3QDGE 4JDVB 5F7HA 3DGGA 1QFWH 4DVBA 2P42B 4X5WB 5HYSB 1DSFL 3SO3B 1D5IH 5E8DL 5SWSB 1RAMA 2DI8A 3WN5A 3ZE0E 1IQDA 1DVFA 1ETZB 3CCHA 2R29H 1HHKB 4ODTL 1ZV5A 4MXWH 2VLJD 4I3RL 1KENH 5HYJE 3QEHB 1BM3L 4P57B 2NNAA 4P9MH 2YD4A 3OGCA 2DM4A 3TJHD 3L3KB 4YAQA 3DMMC 4HXAL 4XXDA 5ITFB 5F7YC 3V4UH 5ELIA 5TF1L 1EAJA 4NT6B 3FQNB 3ALXA 1P2CB 3RU8L 4BFIB 5CBAB 1E6JH 4UV4L 1J12A 4TUKH 5GGTA 1IRAY 4U1SA 2Q8BH 5HHPB 1NC2B 1FL6A 1IAII 1T22B 4R0LC 1M05A 1CDUA 3MPCA 3QAZB 4XP9L 5F9JA 1TITA 3MJ9A 2EYSB 3C60B 4POUB 2HJFA 3TT1L 2KUTA 2XQYK 2YUXA 1DQDL 5GJSL 3IDIB 3QRFM 2DWDB 3RDTA 2ED9A 1JF1A 4LMQE 4M93B 3JZ7A 5F9DC 2X4SB 3FB6A 1L9NA 1XZ0B 3CFJB 5F7FA 2XWBB 2MKWA 4EBQH 3FB5A 1CFTB 4P4KA 5HYQB 3TZVB 3SCMC 5DJZB 3M1BB 3CJJA 5J12C 2R8SH 1S9WB 5JOPE 3KYMB 1KPRA 3GGWB 4UV7H 1LD9B 4HC1H 5FYKH 2IAMA 3FRPG 3MODL 5CS7A 1I3GH 4M3KB 4QXTB 4PRPD 2E5EA 4PJDF 5F70A 3PXHA 5F7DA 2OJZH 3X14A 3HI6L 3NIGF 3ULVC 4XVJH 5DZOA 1SMAA 5I1KH 3GSRA 5E2VL 3RL1A 4NNXA 4HS6A 3GSQB 3N50A 2X1PA 1ZLUK 5GS1B 2CRMA 1WSST 3IFOA 3HMWH 4OF5A 5SWQA 4R26H 4UIMA 3TBWB 5J4MA 5B39B 1EEZA 1CICC 4KQ4L 4MA8H 3LEYL 4QOKB 1S7RB 3SKNB 3HS0B 1R3HA 4RAHA 4BK5A 1QLFA 5FYKE 2HLFC 2H2SC 1T03L 2LFGA 4P2CG 2DQHH 2NX5B 2YXFA 3TH3T 1RIVL 5KZCD 1X5YA 5FKAB 4H1LB 4FFYL 4PG9A 4I9WD 3ZYOA 5J1TC 5E70A 4F7TA 4LSPH 3UTSB 3AREA 4ZPTA 4ZTPL 1QYGH 2EEDA 4RFEB 1I7UA 3HMXL 1V7MH 3LIZL 1OQOA 3CVIH 4C54A 4M7KL 1RUKH 3ARGB 3UO1H 1ZHLB 4EVNA 2JCCB 1CDHA 5D72H 5I71C 3DIFA 2NY6C 4HKXA 4G5ZL 4LSVL 4P4KC 5L6YH 2H6PB 2CO7B 3GHEH 5C6PB 3D9AL 1KXTB 3G6DH 2X9XA 1FNSL 2X10A 3CZFA 3QDGA 2OR7A 1OAXH 3UP1A 2IPKB 4Y4HA 1CDIA 2D03H 2IAMC 3KWWA 4HUWA 2K9UA 3GUTA 3GSVB 3VU2A 2OXGA 5C6WH 3KLDA 1TJIH 4UT7H 5DJAA 4MAYA 2W0KA 2R23A 3LEXB 5H37H 1CWVA 1EFXB 3CNKA 1I85C 1BIIA 5F6HJ 4QRPA 3QJFA 4U1LA 1U36A 5HYJA 1CXIA 4H8WH 2AV7A 4NCC2 2OL3L 5JMRA 3H9ZA 2BXZA 3MRGB 2XWJB 1YPZA 5ESAB 2JJWA 3I02A 1RJYB 5IW1A 1JNLL 4KRPC 5FO9A 5EFIA 1CZ8L 3DX8A 5ESVA 2A6IA 3T0XA 1BLNB 2BHYA 4P46C 4Z5RB 1BWWA 3RZCC 2GSIB 4R2GC 1QRNB 3UTZA 5E24E 2GJZB 4ZUWB 2VE6A 4GW4A 3EYSH 5E9DD 2PXYD 5DO2D 3HI1A 3L9RA 5D9SA 2JB5L 4BZ1L 2F53A 1ED3A 4KY1L 3F7PC 3QPXL 4LARH 4UB0L 6FABH 4ERSL 3UDWC 2YRPA 1QFUH 1WBXB 3IJHB 1FN4A 1D7FA 1A3QA 4D9RD 2V9RA 4KK6C 4FFWC 4XTRD 2NX5E 4Y4HC 4AG4L 3MNVB 2DL2A 2ESVD 1QFWI 3ULSB 3I9GH 2PCPB 4WUUB 4DEPB 1PKQB 3UTSE 3NFNB 5FYLH 4MAYC 1X5LA 3WEXA 4WV1B 4ZDHB 1CYGA 2Z31C 1ZEAL 1DDHA 1S3KH 1XFPA 3MJ8A 2KL6A 4K55A 3RL2A 1G7IA 3PWNA 1J05B 5D93B 3T65B 4HAFA 4LHUD 1A6AB 2JCCE 3PIQB 3UBXB 5TGBB 4BK4A 5FF6B 2KBGA 3DX7B 1S78D 2IADA 5C0AA 3ARDB 5EORH 3A67L 4LCUA 2NTSP 2NXZD 3OKLB 4TSBH 4AL8L 5T1LD 1II4E 4CVZA 5DR5H 5CBEA 1P6AB 5FYLE 4JVPA 4RGMB 4JRYD 1FVCA 1N4XL 3Q6GL 2R9HD 2X4PA 4BM7A 5J6HB 1EJ6A 2E7BA 1ZSDA 5C0FA 1A6VH 1N7MH 2CK0L 3BZFB 3HI5L 3WNNA 5F3BB 3ZTJG 3S88H 2A74B 1A3RL 4I0PD 1N0LA 4L8CA 4ZYKA 2PKDA 2IGFL 4NO2A 1V3MA 2P5ED 2X4QB 3Q2CA 4MZ3A 1DTUA 5GGVL 1AHWB 4C83B 4QXGH 1IM9B 4PJHB 1M71B 2Q20A 4D9QD 3MV7A 4RMWA 3GM8A 3CPLA 3FTGB 4LBEB 4LSUL 3ISWA 4JG0H 4DOHE 4LOUC 2G75B 3IXTA 1JHLL 3KLHC 5E1AB 4KJQD 1D5MA 3WUWB 1NGZA 4Q9QL 3EDFA 2XN9B 4L4TB 5IEHB 1HDMA 3FQNA 2V7HA 5DJ0B 1P4IL 2CQVA 4WI6A 4EI5A 4XNQA 1IC4H 1VEOA 1YECL 2NY4D 1IC7L 4CVXB 1WZ1L 1NC2A 1QRNE 1EHXA 3GK8L 3QHTC 5J7CC 2ZJSH 1OAUL 3BMWA 4NPYA 3BQUC 2O61B 1RZ8A 4TRPH 2HT2D 1J0JA 4XPAH 3EJZD 3F58H 4EN3B 1F4AA 1BD2B 2A38A 1JV5B 1Q9LA 2HG5B 2GFBB 3GO1H 5E2UL 3P9WB 4E41A 4GMTL 5F9OH 1PQZB 4M00A 3FN0H 2BSSB 2BCKB 4KPHL 5DEGB 3FOMA 1CT8A 3BPCB 1XGYL 3EOBA 4WUUE 4F7EB 3UJJH 3SO3C 5ADOH 4ZUVA 4OZFG 4WTZA 1E6OL 1OAZH 35C8L 3DO7B 5DD6A 3BIKB 1MH5A 4PTUB 3G08A 3V52L 1S7XA 4NKOB 3V4PL 3QH3A 4QXTA 2FO4A 4G43B 3ME0A 4ZTOL 2VXQH 4MWFB 4P3DA 5IB5B 1LWRA 1OTSD 2OJEB 2WZPD 1UM4H 1D6EB 4JN1L 3DARA 3BT2H 4HCRL 4ONGH 1JZ2A 5D2NB 1ZHBA 2P47B 4HFUH 4XBPA 4L8SB 4OF7A 4JJ5B 5GSVB 3DUSB 2H8PB 4RFOH 3H7LA 4OT1L 5B39A 2HLAA 4KAQH 4KHTL 5F3HB 5B8CA 3SKNA 2B7DT 3HZMA 5EO9B 2F58L 3U79A 2ZSVB 5B38G 5IMOA 3L3GA 4OCSH 2FX8L 4J4PD 1KACB 3NCMA 1WF5A 3P77B 4U1KA 4LRNL 2DQJL 4FNLL 2FH6A 4H1LA 3C60C 3MUZ1 1HQRB 4XP5L 3NH7L 3WNKA 2YD2A 1RZIA 2JTDA 1EMTL 2A73B 1CDYA 3DROB 2QQQA 5EC1B 2ZCKL 3RP1A 1BVLB 4M93C 1EBAA 5JDSB 2R69H 3F7QA 2WUBL 3HE7A 3CSYA 2V9TA 1FHGA 3MV8B 2XN9E 4L4TE 4LLYA 1GOHA 3MV9A 3EO0B 4OM0L 3U0TA 2XY2A 5L8KB 3QO1B 1VKXA 3TZVC 1A6PA 2B39A 5DJDA 1NCUA 4FRWA 1HXYB 2Y07L 2VJXA 3K2MC 2F5BL 5CUSH 4P48A 3MRNB 2IPKA 1OL0A 1I1AD 4LLVA 1J1PL 4BKLB 1CE1H 3KVQA 1G9ML 1YDPA 3W5MA 4JFDB 3U30B 3KJ4B 1RHFA 2XY1A 4L8DA 4HX1B 3WJJA 1CE6B 4QCIB 2K7PA 4Y19D 3ZT5A 2XQYG 5GS1C 3RVWC 4FQPA 3CDFA 4PR5B 3CDYA 3S37H 1P6FA 3L3IB 1DZBA 1EK3A 3H0TB 5DMGC 1KJVB 1MFEH 3BZ4B 4M8VA 1A4JA 4PD4J 4S1SL 3NCYP 3CLEH 4YHKL 1I7TB 5IVNA 1A7RL 1VFAB 3QEUB 1RJYA 1IM3A 2DTSA 1UZ8B 3K4AA 4OIAA 2AVGA 5GQBA 3W9DA 3V6OE 5C0DA 4QXUH 4JM4L 4JM2A 1RIUH 2B20A 5HVWA 1KPUA 4TSCH 1AD0B 4J7RA 4Z5RA 1JGDB 3GB7B 3SDAB 3VXMB 4TSAL 2NLJB 5I1EH 1CTNA 1NC4B 1R5VB 4N5UA 1RK0A 3LQZA 1DFBL 5D2NE 2VN7A 2GUOB 1A8JH 3ARGC 3D6GA 3N9GH 3O8XB 3ROOB 3T08A 4ZUTB 4NOBA 1MHCA 3HE7C 5I2IA 2NR6C 4MCZA 4H20L 5H2BA 4U7MA 4LSQH 4LQFL 3T0DA 2OCFD 3PV7A 4D0DA 3QUZD 3VGAB 3CLFH 3B8YA 4OTXH 5JIPA 4HQQH 1RFDL 5EOCL 4Y4KB 2PTTA 5DD0H 4OM1H 2VC2L 3TA3D 3B9KD 4Q6YA 5D1ZA 4HFWB 2Q7YB 1OT2A 3KPOA 1HHHA 3BPNB 5LXGL 1QSVA 4HWBL 5I1JH 3NFNA 1DLHB 1UB6B 1KB5B 3P0VH 3L3HB 5C09B 5JPNA 4NN7B 5CEZH 5K9JL 1OY3B 1UYWH 3RY5A 1FYTD 3VXNB 4DN3H 1YN6A 2VDPL 2BNRE 1J05A 3T65A 3I85A 4GG6F 1EGJH 4HH9A 5GRJH 5TGBA 3MV8E 4OGYL 1R3LB 5DC0A 5IQ9B 4YLQT 4OGAD 2XA8L 1ZANL 2Q76B 1NLBL 4NRYB 3DVNB 5IHUH 4XAWH 1W8NA 3VW3H 1G1CA 1MRFH 1NL0L 4GUPB 5CEZE 5J6HA 2W0FA 5D6CA 5DWUH 3FB7B 4KZDL 1ZT4B 2DDQL 3PL6A 4CU6A 4JFDE 4EIGB 4WI2A 2EH7L 3MCG1 1OWRM 1CLYL 3MRLB 3MGOA 4NZJA 2J8UF 2YEZA 4LVEA 2GI7A 1MCWM 5FCUL 1IM9A 3BEVB 3K8KA 5IVZA 2FWOB 2A9MH 2H41A 2Y4SA 3OF6A 4Y4FD 1P7KA 3FTGA 4JPWL 4JAMA 3HZKA 3MLUL 3E3QE 3UBXI 1QLRB 3OSKA 3CU7A 1C7TA 3PDOB 3SDCA 2W0LA 3SDXF 3LHPL 1EHNA 4OLYH 5DRWB 5FCSH 5IEHA 5HHXH 1ZS8A 3RIFF 4FFZL 3RWHA 4DEPC 4Y5XA 3ZKSD 1NAKL 3BW9A 3MLSH 1FVDB 1NLDL 4OQTL 3TESA 4WV1C 2WK2A 4H26B 2VISB 1OGAD 2UWEB 4MJIB 5F8QC 3EW3B 1RQ5A 2WAHA 3W2DH 1KB5H 2O5YH 5D93C 5DC4B 2YUVA 4O2EB 4OZHB 4LFHG 1YQVH 4K7PX 3ARDC 2VITA 1FZJB 3JV4B 5DLMH 3C2AH 3KJ6L 3RVVC 4QRRA 5TDPA 3V8OA 4KROB 3TF7C 5J9PA 3ABZA 5EC2A 1SYSA 5E8OB 5AZEL 1JMZA 4ISVB 4RGMC 5FV1L 2ORBH 3MRDA 3OR7A 1JUFB 3L7EA 3QXDA 4S2SB 4PJIB 3HUJA 1OSZA 4KUCD 1V3JA 2OTUA 5ILTH 3HPLA 1NBZA 5IR1B 5INCA 1KYOJ 3CDGA 4Z18A 5IEKA 3BIKA 1FZOA 2CUMA 1MCSA 3O4LE 5ERWB 1HH9A 2ITCB 2VLKB 5I15H 1AHWC 2VXTH 3MJ7B 4FABL 3FCTB 4Z7OF 4Q2ZA 3U83A 1JWUB 4OFKA 4BSVB 3MACL 3KPLA 3SE4C 5FO8B 3VFOA 3S4SB 4MB3A 2W9LA 3TWCH 5ID0B 3BYYA 1JK8B 1YA5A 4TVPD 1WCBB 1MVUB 4EEEA 2EH8L 5DA4A 1OAYL 1U8MA 4IS6A 3KPRA 3OG4B 4CADB 5EO9A 1I9EA 3O6KH 1KIQA 2WWKT 3N0PB 3P3YA 4OZIA 3DBXB 4YXHH 3OKOB 3BE1L 1ZVSB 1A7OL 1AY1H 2Y25A 2FEEI 3O6FD 1HOCB 3P73A 4M5YH 1OM3H 2DOCA 1ZHNB 3BXNB 1GIGH 3O2WL 3BHBB 4M62H 3RKDC 1C5BL 4EN3C 4GS7B 3CXHJ 4C59B 1UKQA 1GGBH 5EBWA 1BVLA 5EZIL 2Z91B 4TUJB 5C07D 3LKPB 1N0XL 2WQ8A 2BNRA 4WTXA 3T3ME 3IDXH 1DE4B 5B21A 3MV8A 4G9FD 4H0GA 2BSTA 5DMKB 1WLHA 3NZHH 3TYGH 5JA8B 1AI1L 4JG1H 1P7HL 3P0YL 4IDLA 3OKNB 4N0FB 3TBSB 3EGSB 4ZAKD 2OX5A 4DKFH 3OAUL 4MJIE 3V6OC 4XP6H 2XFXB 3IJYA 3QEGL 4POZC 4JANA 1GOFA 4RCAA 2XOTA 3EDKA 4KZEL 3I3EA 3WFDL 1C12A 5D2NC 3LDBB 1SVCP 2GW5A 4X9BA 4L8SC 3BSZL 3CC5A 3DV4B 25C8L 1INQA 3VGBA 4WWKD 1S7QA 2MQ3A 3U7AA 3G5XB 4PY7A 1KT2A 4ZG1A 1A3LL 5IROC 5FGCB 3N06B 5T5FH 2ZOLA 4PJIE 4NHCH 2EEAA 4X4MA 1EZVX 2NYYD 3OZ9H 3Q1SL 3VXRA 4LPXA 2X05A 2AP2A 1OQXA 2J8HA 4ODTH 3TVMB 3W5NA 2AERT 2CDEB 2VLKE 3LKQA 4PLKD 4G6KL 5IK3A 1NC4A 1NFKA 5ALCL 4HXAH 1F00I 3O11B 1J8HD 4ETYA 2R15A 4O58L 3PWUB 4F8TA 3RU8H 4XPTL 3CFEA 2BOCB 4JKLA 3HR5A 4UV4H 5IW3A 5GS0L 4YHIB 3JVGA 2VZUA 4M7LH 4WFHD 2VLJE 1JNJA 4M48H 4Y4KA 1VA9A 1T5WB 5DTFA 5CJ5A 4ELMB 1N6VA 3VRLE 3TT1H 3NIDF 1NAMA 1RV6X 5EBGA 5SWZB 2F19L 5D1QB 3V6BR 1DQDH 4O2FA 4M8QB 5GJSH 5JXED 3BRDA 2I9TB 4U1GB 3U30C 4PJ7F 1S8DA 3KJ4C 5ITBL 1K2DB 2EDLA 4WW2A 4XNUH 2QL1A 3I2CL 3OKEA 3O4LA 5I73B 1HXMA 4UQ3A 1BZ7B 2YD7A 3E3QC 4MDIA 3UZQA 3NMEA 3MRPA 5DMJB 3WL9B 2FX7H 1GSMA 2PYFB 1VFOA 4J2XA 1ZT4A 2E7MA 5ICYA 1X5ZA 3SDAC 1U8PA 2LAGB 4RMRA 2OL3B 3ECBA 4MJ5B 2AJ3A 3O8XC 3ARBA 5CZKA 4NYLB 3OTTA 4P3CL 3AC0A 3OV6A 1LO2L 4KQ4H 3LEYH 1QSZA 4FTVB 5M94B 3KPPB 5CILH 4ODVH 4J3VA 5IG7A 3VGAC 3CMGA 4KQ3H 4XC3L 5FGCE 1T03H 4PRPE 4Y4KC 1Z3GL 1NPUA 2D7QA 2PETA 2R0WL 4KFZC 3D39D 5GS2D 3IETA 1IGYA 4FFYH 5BMFL 2WQRA 4Q58C 1U8NA 3BPNC 4X99A 4ZTPH 3BDYL 4R3SB 5E08H 5E9DB 5ETUB 5T33H 2PXYB 4MNQA 4PJGA 4A6YL 4NN7C 2QHRL 5I8KH 3RUGF 5D2LF 1UZ6F 2OTPA 4MSWB 1BOGB 3HRZA 3VGDA 5HVGB 3IU3A 1Q1JH 5CJQL 2JK5A 3HNTH 4O2EA 4G5ZH 4L5FH 4LSVH 3WS3B 4XBGB 5HGDA 3D9AH 3QQNA 4I9WE 2Z8WC 4Z0XA 1JJUA 1K8DB 4ELME 3PWPD 2PF6A 4FS0A 4PJBB 3FQXA 5J0BA 3EFFB 5SWZE 1GJIA 4RSVA 4PJXA 4KMTL 3NCCB 4WGVB 1WBYB 5SV4A 3T4AB 4D8PB 3MGAA 5I1GL 2J4WL 3VMNA 1U95B 4HJGA 4U1IA 1R0AL 5F88B 5T1LB 3UPAA 3QZWB 4JO3L 2OL3H 3LQAL 4ZFZB 4F15B 4YBQD 2DB8A 4NCDA 4BSVA 2BVEA 1JNLH 1KLUB 1MLCB 3MOBL 3T1FB 5ID0A 2JF1A 1CZ8H 2J5LC 4ENED 3T0VA 2EYTA 4MCYA 3VXTA 5MEPA 3TPUA 3AS1A 3VFNB 5F1NB 3QPQC 3ZSSA 5D1XD 5D8JH 1OTTC 3U0PB 5DRZB 3AAZB 1T0NB 3MOAL 4LPVA 2VLJA 1ZVYA 5EUOB 1K3ZA 1DUYA 1XR8A 5E0QA 4KHXL 3FO2B 3MR9B 4R4FL 1IGTA 2JB5H 1JP5A 5TFSL 4IIQA 3DVIA 3KXFB 4GRWB 4UB0H 3NPSB 4QWWD 3RQ3A 4ERSH 3LN4B 4KK8D 3VFGL 4HS3A 4PJ9B 3TNNA 4AY0A 1JF5A 1R5WB 4KROC 2NY7L 4HG4J 4H88L 4Y16D 3NABL 4RBPH 4AG4H 2OSLA 3V5HA 1NFIB 5FYJL 4MJ6B 1G7PA 2C26A 1T04B 4LCIL 3WLBB 1HKLL 3RY6A 3ARFB 5E9DE 4FP8L 5F1SA 1FNAA 3WHE1 3FONB 4OLXL 4G6MH 3EHBD 4NUJB 3M07A 4LCWD 3ZDYE 4PJCB 2FATL 2EEBA 4FQQB 4D9RE 4QGTA 3CD4A 1KELL 4F33A 2ESVE 4HIEA 5B3NA 2CMRL 1UJTA 4X7EC 5EBLA 3EKCA 2FR4A 1UWGH 3MLRH 4PJBE 1DQJB 5GRXG 3SDDA 1SJVA 1W72B 3WBDA 2DJUA 1S9VA 4WU5A 1K6QL 1A3RH 4PRPA 4Z77A 5F7UA 5BOPA 3V6FA 4QRUB 1KEGL 2IPUK 5JUEL 2XG5A 5SX5K 1G6RA 3TJHC 4NO0B 4IOSD 1KJ2B 1DL7H 3B3IA 4LSUH 2IBGA 4RMTA 3VRIB 1HHIA 1IFHL 4JFZL 4JRYE 2ZUSA 3BEWB 4YR6B 4GRWH 1H8NA 4Q9QH 3G6JA 1BEYH 3PHQA 1XR9A 3OAYH 4ETQA 1S7WA 3PWUA 1P4IH 2XKSA 3F7VA 1A4KB 1NMBL 3IFPB 3IDGB 4NZTL 4ZFFB 1WZ1H 5EUOE 5T1MB 1XEDA 2P5EE 3GK8H 2HH0L 1KGCD 4D9QE 2QV2A 1OAUH 4TTDD 3TJEH 43C9B 2HRPL 1BFOA 1YYLL 5DFWH 3KLSA 5LAXB 1JHTB 1H15A 3LKRA 3B6SA 4GRWE 4U6TA 1UENA 3EIFA 1K2DA 4CMMA 3LDBC 2JKXA 2GITB 2C1OB 3D69B 2NXYD 5EG6C 3CK0H 5F7KC 1U8KB 3HNSL 1DANU 3KPSB 1N64H 5TE6L 2OS7A 2Y36L 1XGYH 1FNGB 5INDA 2BVPB 3R1GL 4DQOL 4L3CA 1CGVA 1X5JA 1I1AB 5DRNB 4YPJA 1E6OH 5D5MA 1F2QA 4OLVL 2ZUWA 4JHAH 3V52H 1SYVB 1I3RA 3V4PH 3TVMC 1AGEB 1W72H 2ZG2A 3VI3F 1TMCB 3GMRB 3ESUF 4ZTOH 3WCYA 4XCCH 4F57L 3ARXA 4HIXL 4JN1H 5DUBB 3OHXA 3CSPA 1ZWIA 3CMOH 1OB1B 1TCRB 3LSOB 4X98A 1KJ2H 2DLEA 5F21B 3KYOA 2VZSA 3D87B 4P5MB 2VL5A 2MWCA 4LLMA 1JVKA 4TN9A 3U46B 2F58H 4QHUB 2BNQD 2GT9B 1C5DA 2FX8H 4LQ1A 1EEQA 2VIRA 4X7DC 1F02I 2DQJH 3PNWA 4FNLH 5JQ6L 4EDWH 5C8JB 4I48B 1GC1L 3E0GA 3QQ9C 3L5XL 5CWSA 1GGIL 4NP4L 4U1GC 1AGDB 4NQED 3GMLB 2ZCKH 2BVOA 3UTOA 2VDKL 4KVNL 1SQ2N 2WUBH 1EO5A 1X5IA 2EDOA 2PW2B 3OB0K 4WHTA 1FNFA 4HUVB 1J1OL 3BDXA 4HKJB 5I73C 2VZVA 4FQ1H 4OM0H 5B3JF 1T80A 3TA3B 3B9KB 3RGVA 2ESVA 2GCYB 4PP1C 1NBYA 3G5YA 3DETD 1I1YB 3R4DA 5HJ3A 3JWOH 4UBDD 2CO6B 1K8DA 4XCNB 5C0ND 4MHHG 1J1PH 4L8BB 2GK2A 4J8RB 5IGXL 1FYTB 3GSOB 4GKSA 4LGPB 1NGXB 4HDIA 3WKML 3KR3L 1NGQH 1T4KB 4LHUA 1K3IA 3GSXA 5D70L 4Z7NE 4LVNB 5A1AA 1QBLH 5FECB 4OB5H 1ZA3B 4LDEB 3QHZH 2LQRA 3KPSE 1AQKL 2XA3A 4YHNA 1H0DA 4PJEE 3NCJL 2WP3T 1CFQB 2EDBA 4L4VD 1A7RH 1AXSA 1EHAA 4JRYA 4X6DB 5F1IB 2YD5A 1KCLA 4UIKL 2XTLA 3T1FA 1DBBL 1XGRB 4YHLL 5F7NC 3QISA 4JM4H 4RMSA 4I0PA 4XNMB 1PJ9A 5F1NA 1TVBB 4Y19E 1U93A 3QUXD 2VSDA 3BP7B 4D2NA 1HKFA 3U0PA 4S1DD 5FOBB 1MHEA 2PXYC 5ICZB 5DO2C 2P5EA 2C3WA 3S37X 3TN0A 3BH8A 1I8IA 3PP4H 5IHBA 4ONHA 4OD2B 3AS2A 4ODWA 2VR9A 1YEJL 3HE6B 1KIPB 4R8WL 5BO1L 3LN4A 4HH8A 5EOCH 1ZTXL 4YJZL 1FORL 4ZUSB 1QO3A 1AKJD 4NQSB 1JNHB 3MRHA 2QQLL 1OGAB 1T04A 5LXGH 2WINB 3P4OA 4HWBH 4QYOA 1CFNB 5DVLA 3S97C 5C0RL 5KS9E 2QQNL 3L7FA 2UZIL 4PJ8B 4YDIL 3BKJL 1JZ5A 3JTTA 3NFSL 5GGQH 3WFCH 2VDPH 1BZ9A 1QSFB 1S78C 2N7AA 1PZUB 3RTQD 5CLWA 3L5WA 1MFCH 1KTLA 2YN5A 5MEND 3PGCB 4F15C 2XA8H 3D48R 4FQLL 4JZOA 1YNTA 5C71A 1ZANH 2Z8SA 2R9HC 3K4ZA 2B1AL 1DQLL 4HIIA 2YKLH 3QHFH 1VESA 3RVUD 1NL0H 1OPGL 5EZLA 3UZEA 1IEBB 1FYTE 2DDQH 3HC3L 2EH7H 4OCXL 2FHCA 1I8LA 2H26A 1A1NB 4LFHD 4XPGL 2AKRA 1MWAA 1KFAH 4QRUA 1ND0B 4X6FA 4M9OA 4QF1B 1OWWA 4ZO6A 1IAIM 3VG0L 4C55A 2A0LD 3HG1A 1FFNB 4U6HB 3IXAB 2KZ1B 1N59B 3NPSC 4XZUA 3R0MA 4GQ9L 3BKYH 4UT9L 5MEOB 1KBGL 3MLUH 4N0UA 1K8IA 4PJ9C 4X6DE 3STBA 2ZUXA 3HC4L 2ENYA 4F3FA 4UTBL 3NFPA 3I6GB 3LHPH 1EX0A 1AP2B 2E6JA 4ZO8A 5GRWA 4LRIA 1YEGL 4FFZH 4J4PA 4POYA 4JR9L 3WIIH 1NAKH 2ZOKA 5TDNB 4OQTH 1LEKA 4JDTL 1DQML 1WTLA 5T1MA 3U7WL 3U0WH 2HT2C 2R2EA 2AJUL 1AH1A 3SOBL 1OF2A 3LKOA 5CJXC 1CBVL 1A47A 2BSRB 5GIRA 1NCDL 2DJ4A 3KJ6H 3ILQD 1JHKL 4GXVL 3LRSA 1I1CA 2DBLH 4GW5B 1IGJB 4DGYL 5BCAA 3D2UD 1OGAE 1A1MB 2X4NB 4HIJB 4PJEA 5L7XL 3EOAA 1RZJH 1NUFA 1FIEA 2X42A 2O5XH 1I8LC 1JPSL 2JJUA 3C08L 2YSSB 3MCLL 1KLGA 3RPIB 4NRZA 3GRWA 5D7LD 4OLEA 1SYVA 3L95B 1QSFE 3LEVL 1AGEA 3MBXL 5L9DL 4U1NA 1LEGA 3KG5A 5DJ6A 4Y19A 1ZOXA 1KB9J 1MIML 4FABH 3MACH 4M61B 1BBJB 2EYRB 2HMIC 3PUCA 3GNMH 4K3EL 1JGVH 3SQBA 3G5VB 4U1JA 1WAAA 3UTTA 1XIWB 1OAYH 3U46A 3U9UB 3TBYB 1S9YB 4N0YL 4X7TA 1A6UL 3L6FA 3PHOB 1Q94A 2G9HA 3BE1H 1EEYB 1CCZA 4QGYA 4JREB 5EULV 4G42A 1BVKB 4WTZG 5C8JA 4DKEL 5KS9A 3EYOB 2UV3A 3Q0HA 1C5BH 2X89D 1KJMB 4LVHB 1C7SA 2ICES 2YA2A 1LGVA 3S34L 3KLAA 4F9LA 1WZKA 4NKIL 2BJML 4G8FB 4TVPE 5EZIH 2FBOJ 1JWSB 4PV9B 4WUKL 4XC1L 3ZL4L 2LVCA 1MLBB 1GGCL 1OLLA 3QUZA 3BO8A 1TTFA 4Y5VB 4M5ZL 4XNYL 1YNLH 2CLZB 5ID1A 2QR0B 2ZG1A 4Q6IB 1HILB 3UYPA 1VDGA 3GMNB 1AI1H 3JWOC 3B9KA 5FDYA 3GMPA 3N85L 1RMFL 1FYHB 1I1AC 3P0YH 2YPLD 3GMMA 4HWZB 3P9MA 4EUPB 5KW9L 3EO1B 4EDXB 7CGTA 2NW2B 3QEGH 5EDXA 2DWEB 4UOJA 2GK0B 4C4KT 3X3FH 4IMLA 3T1WA 4FQXA 2Z8RA 3T3PE 5D71L 4OLZL 2JIXD 1E4WL 2YD8A 1P4LA 5D7JA 5E7FA 3QP3A 3SGEH 3D3VD 3BSZH 4N0RA 1P7QD 2IJ0C 3FKUS 3EYUH 25C8H 4HBCH 5IWLC 5FECA 4OD3H 2VH5L 4NQDD 4HLJA 3FO1A 1WT5C 4P9HH 4K23H 4LPYA 1A3LH 4MX7B 3PQYA 5KSVB 1T20B 5C86A 1KEML 3CZJA 1SY6L 2I24N 3VXOA 1MUJA 5FA4A 5JMOC 3OJMB 4WU7A 1OP5H 1XCTB 4AJ0A 4IRSD 4Z7WB 1MRDL 4X4XA 1NQBA 1W0WA 5JNYA 1TVBA 5HHQA 5FOBA 5F7EH 4F9LC 2COQA 4RFNB 2W60A 3BI9X 2DD8L 3VA6A 1RSFA 5ALCH 1HYSC 1A6TB 3RNQA 4OUUB 5IFJA 4OD2A 3VJ6A 4Y4FA 3KPNA 4JZJB 1FNEA 1JN6A 2P5WD 1U2CA 3NZ8B 4ORGB 4MXQD 1H8OA 3MA7A 4QHKI 1CGYA 3TA3C 3B9KC 1DBKL 4HLZG 3MLPA 2ZKHL 5HVFB 1I7ZB 1DEEA 3HR6A 2DLFH 2EDFA 1P53A 1HI6A 2YS4A 4QLRA 1OCWH 3LVEA 1UACL 2DKMA 5LGHH 4A6YB 5DEFA 1OGAA 2F19H 3I50L 1K5NA 2VDMH 5EBMB 4EUPH 5JW4N 2R0LL 4S0TD 3WIFB 1J8HE 4AH2B 2HKFL 1H3PL 3NVQA 3PWVA 5EZJA 5E2TH 1DQTA 2VERN 4LVNC 3I2CH 2XWTB 4DZBA 4PJAA 2W65A 4UT6H 5E94B 4K07A 1F8TL 5I1AA 2O93L 3WHXA 5KAQG 3IDYB 15C8L 5D7SL 5I8CA 5I75B 2VL4A 5KG9B 4NQXA 1JPFA 4JFPB 3MV11 1NDGA 1NDMB 3UJIL 5IB3B 3VFMB 2APFA 1VFUA 4LEOB 5HDQL 1KIRA 3NA9L 3O9WA 2XNAB 4JFXB 4HKBA 5BQ7A 3BAEL 3ARZA 5GJTH 3DRQB 3SE9H 1N5YH 1XGPA 1GZQB 3UYRL 4MA3A 2CGRL 1NJ9A 1UM6H 4AEIL 4I5BB 4K3JL 4WNQB 4P3CH 5C3LD 2WBJA 2JELL 4QF1A 1U8IB 1PX3A 4Z8FH 3HE6C 4OCWL 3QDJB 4GLRH 4XCFL 1EFQA 4XC3H 4U4BA 1RJZA 5MEOA 1OW0C 4QXWA 4B7LA 2EDNA 4JGMA 3VMOA 3RWDB 2NY3B 4OBRA 5GS2H 2VDQH 5F97E 2XACC 1XF2B 3PWLB 4Z7WE 3ZE2F 5C9KA 4OV5A 3BDYH 3L3OB 4BJLA 3O6FA 1JWMA 1INEL 1CLOL 3QNXA 4PJ8C 4MNHA 2APWA 4A6YH 1FRGH 4Z7VB 3O2DA 2ZNWA 3EZJB 1CGTA 5FYKU 2UUDK 3MRJA 5E8NA 5A40E 5LGJB 4PRDA 1TJGL 5H8DA 1DQQB 3AXLB 4JRXD 4OKVB 2Y5TB 5C07A 2LU4A 1HQ4B 1FC2D 3QFJD 1PDKA 4OLUL 2XZQH 4ZXBD 1RD6A 3VFRB 3PV6B 1L7IH 2HVKB 4G9FA 4I77L 3H42L 5DQ9A 1VFBB 4G80B 2VWEE 1T2XA 4L1DA 5L2JA 5T3XL 4GW5A 5BZWA 3VD3A 4ODUB 1RZJC 3J8F7 4LLQB 4AYFA 4R96A 1X7QB 4ZMAT 5FM5M 5BXFA 4ZAKA 1U3YA 4FFVD 3VGGA 2OM5A 3HZVB 1WV7T 2I07B 4D0CA 4JY4B 5T5NF 1R0AH 3BX7C 2H3NA 3KYNB 4KTYA 1JI1A 1UH2A 1NGWB 3K1KC 4PB0L 3V5DA 3LQAH 1BF8A 1T1YB 2FL5A 2CXGA 3D18A 3QDMD 2Z35B 2BP3A 2VABA 4WWKA 2EYRA 2ZSWA 3GMOB 1SJHA 1I4FB 1K4DB 4QRQA 4ZQKB 3DXAD 4G8GD 5CEXA 4P2RB 2VAAA 4ZPVA 1P84K 4ZSOB 3TIEB 1G7MA 3WXVL 3MOAH 4PJFA 4MS8D 4MB4A 2X9YA 4M43L 3GSWB 2FEDD 1ORSB 3LN5A 5C0EB 5KVGH 5HSFA 1YEIL 1QUNA 5TFSH 1N2RA 1FBIL 2EIZA 2ITDA 1J8HA 3QO0A 4PJDE 4KRNA 1IKNA 4OZFB 3RWEB 2X4UB 2W59A 3NIGE 7FABL 2A83B 4F80A 4HJ0D 2FD6H 1T0MB 4H88H 3QULA 3SGEI 3SEPA 1T2QL 1ZAGA 3ZTJH 5FYJH 3MRCB 3REVB 1ADQL 1FDLL 4M6ML 4ZS6D 3JTSB 5CCKL 1HKLH 4HT1H 2GSGB 2XXMB 1UGNA 3P4NB 4GXUN 3VMPA 4Z7VE 4KUZH 3EO1A 3OGOE 4XP4H 2RQ8A 5KSBB 2A6KB 1H3TA 2YC1B 3MXVH 3O81A 3ZKQD 3TO2B 2UZYB 3SE8L 3PJSA 3FQTB 5HXMA 1G9NL 5CSGA 1EXUA 2FATH 2NXYB 3KDMB 5B38B 2VB5A 1KELH 5CMAA 5J1AA 4OZGB 1XH3B 2MCPL 4P9HC 5A2LH 4GRLA 2EC9U 2A6DB 3F7YA 2Y7QA 3BUTA 5CIPB 4S1QH 2EDDA 4RRPA 2NYYC 1X6NA 1I3UA 5DVOA 2C4XA 1DVFD 3VFTA 4JO4L 5I1HH 1FC1A 3QA3B 3ULUL 4LCWE 4JREC 1KCVH 1KEGH 3G6AA 5C9JB 3UJTL 3DVFA 4PLKC 2IG2L 4X9IA 4KV5F 3V0VA 1HNFA 4LVHC 4J12A 4U05A 4PD4K 1D5XB 4PLJD 3SE3A 3HFML 2R2HA 3MRKA 3T77B 3REWA 1IAOA 2PO6B 5GPRA 1U92B 2DBJA 2XRAL 1Q38A 4OZFH 4Y5VC 5GRUL 3A6BL 4GAGH 2EICA 4K7PL 4P2RE 4RISL 1E4KA 4Q6IC 1NMBH 4JN2B 2H45A 1UT9A 3D39A 5L88L 1MNUL 1T1XA 2Z8VC 3PF2A 3RAJH 3BFOA 1U8HA 1WK0A 2VUYA 4WEMB 1AGCB 2ZPKH 5JXEC 5HGHA 3MJ9L 4HUUB 2GTZA 3SKMB 4MDJA 1KCRH 1YYLH 4NQEB 4PG2C 4HUKB 3MCKB 1EA9C 5CSZB 3WIFA 4JFFA 1CD1A 3QBTB 2Y6SD 1Q9OA 1K4CA 3BPOC 1U58A 3LS4L 4M6OL 4NUGL 4KKLD 3FZUD 2Y36H 5EPMB 4NKMA 4HK0B 3R1GH 4WDIA 1U6AL 1NCTA 4CNIA 1KGCE 1WZLA 4KI5F 5KG9A 4GLRI 4P23B 3PWPA 3NACL 5CIPH 2BVQB 4NBYB 3TNMA 5GISL 1IL1B 4JFQA 3QYCA 1V3LA 5KSBE 5EOCJ 2AEIT 4JFXA 1C08A 2ICWB 3C5SB 3AS3A 4RFNC 1YEEH 3SE3C 2M1KA 4OZGE 3IVKB 2AJYH 2SEBA 4XH2A 3WDHA 1J7VR 1G7LA 2AXFB 1GVIA 3MRRA 4L4VB 5AD0A 3TO4D 2V2XB 5HI5D 3U2SA 3ZO0A 4LHJB 4PJDA 3MYZA 3RWFA 3MLXL 4G8EA 3QSKB 1FFPB 4BH7A 5IMKB 4APQD 4U6YA 2VWEC 5LJYH 5D1XA 5E4IA 2XPGA 5JW4Q 1A7PL 4PUBL 4RQQA 4Y0GA 3C8KA 1S7SB 3KPMB 5FA3A 2YR3A 3JV6B 4LPWA 4MQSB 3WS6A 2H9GB 4WI7A 5FAAA 3D0LB 3T4YB 2R2CA 2VDKH 4KVNH 4LCCA 3HB3C 3GJEB 2DF3A 3BUYB 5IIEA 5CGMA 1J1OH 1LO3H 1IGIL 4X8XA 4YFLF 2BNQE 1P1ZA 4ZOCA 1KC5L 4WENB 3IDYC 2O5ZH 3JWDH 5DA0B 4XCYA 4Y16A 1AKJB 2ICCA 5I75C 5I17B 3AUVA 1D5BB 5D7IB 1S7VB 5BJTA 5L2KD 5DRXB 1T21A 3LKSA 4P2OB 1I7RA 1IGML 1MCCA 4NQEE 5CINL 5IGXH 2ILLA 4PV8A 4O51B 3WKMH 1HINL 3PDGA 3KR3H 1AJ7L 3HZVA 1AIFB 3MO1B 1HHJA 3F6IA 3RTQB 4J1UA 1AD9A 1OARL 1P5UA 1ZLUH 1P4BL 4LCWA 4YBQC 4QNPF 1MQKL 4G7VL 4I18A 2IH3B 5JOEA 2NY2D 4ELKB 1YQ2A 3NCJH 5I19H 3MTRA 1UC6A 3BPLB 1FCGA 4ENEC 4FHBD 4Z7QF 3S96B 4UIKH 1K4DA 3EJYD 4ZQKA 1DBBH 1D5IL 2YD6A 2P7TB 5HDOA 1ZLSH 5C6TL 2NY3C 2CUHA 3SKUD 5AUMB 2R29L 2Y9RT 1Q9KA 4F2MA 1O0VA 2V5YA 1PEWA 4L29B 3WS6C 1M6OA 1KENL 4DAGL 4QWWC 2CR3A 2DKSA 3B5HA 4M1CD 3QXAA 2F53D 4L4VE 3RWIA 4X83A 3V4UL 3DLQR 1QA9B 4JHWH 2HT3C 3RWEA 1ZTXH 5I18L 3W11D 1E6JL 3ULVF 1FORH 4FQ2H 2Y72A 4YFEA 4K7PY 4IRJA 2VZTA 1Y0LA 3MRCA 4HIHB 3U82B 3E6HA 2WW8A 4JFHD 1UWXK 2E9IA 2QQNH 4JPKL 4WFFE 4N1EA 2G2RA 2UZIH 4YDIH 3P4NA 5CD5D 2B2XH 3MZGB 3NFSH 3R06B 2GTWA 1FJ1B 5T3ZD 4F8QA 2VDRH 3BP6B 5MEQA 5HD8C 2EXWD 2D7MA 3MLTA 3CUPA 2VLRD 4QRSA 1NKRA 1URLA 4B0MM 5KANI 4JQVA 4FQLH 2C7UB 3WIHH 4F7CB 2B1AH 1DQLH 5D7IE 2AJZA 3DTXA 4Y2DD 5BZDB 4GG6B 5FYKL 4Z7UF 5D7LB 1JFQH 5KSUA 3HC3H 1I3GL 3MFGB 4KDTC 3TT3L 4RIRB 4XPGH 2HJLB 3F6LA 3VFUA 5I16B 4IOIA 1JL8A 1MCRA 2V2TB 5I1KL 3ZLQC 5C9JA 2CSPA 3ZYJA 5BW7C 3VG0H 4OCRL 3ZKMD 3MV7D 3C9NB 1PG7X 3IDNA 3HMWL 1XF4B 3BD5A 4R7DA 4UT9H 1KBGH 1MI5A 2CDFB 3O3AB 3VFWB 3HC4H 4UTBH 3T2PA 2J8UB 3VWKB 1ULVA 2BNQA 2CPCA 1JBJA 1QSEB 5IW6A 2BC4A 4EI5D 4OKDA 2HFFA 2PW1A 2D4FA 2R1XB 4TTDC 4DFIA 5MHSD 3FFDB 1DQMH 3CFKA 4M1GH 5BRZB 2WIIA 1E28A 1V7ML 1ODAA 4JFOA 2CIIB 2P48B 4UINL 3THML 3CVIL 5IVXF 3VFPB 3X12B 4OJFL 3QNZA 4PPTA 1VSCA 1VENA 2NXYC 4PB9L 4JQVC 1NCDH 3VCLA 3ARQA 1YY8A 2WANA 1G0XA 4GXVH 5L6YL 1S9XA 1CTOA 3GHEL 1A6ZA 3G6DL 4DGYH 3ILPB 4NNYA 2HFTA 4N5ED 1OAXL 2PTUA 4HWNA 1WWWX 1N3NA 2D03L 1LP9F 4MJ4A 1ERNA 2HVJB 3IJSB 1G7QB 1JPSH 3C08H 4PIRF 2XZAH 4UT7L 5BOZG 4XI5C 1DBMH 5JOFB 3LEVH 2BOBA 3O3EA 3MBXH 3HMXA 5L9DH 2JIXB 1FNHA 4JY5H 1EZVY 3OXRB 2GKIA 5GHWL 2ZZUT 5GS3A 1F11B 1N8ZB 1P7QB 2D31B 2GJ6B 5KBNC 2DQGL 4ZUUA 5EO1A 1U3HA 2E7LC 3MYJA 2FLRT 1CGUA 5DJ8A 1X6LA 4ODHL 4K3EH 3ZKND 4H0HB 3D1MC 2V17L 5LKNA 2PO6C 1MFDH 1LDSA 2F5AH 1T1ZA 2VAJA 3GZKA 3MMEB 2V2XA 2GQHA 3WHE0 1U8JA 1Z5LB 4GG6E 4N0YH 5TH2B 5D7LE 1A6UH 4R97B 2RFXB 1PYWB 4TYUA 1IEAB 3O41A 3QUXA 2X1WL 4WI5A 1CF8L 3QQ3A 5JLZB 2X4RA 3SY0A 1ZGLA 3K0WA 5C7XH 1FGNL 3EYSL 2FYYB 3MLYH 3FQUA 2RGSA 3S34H 1ZKAA 5DXWA 1DBJH 2BJMH 2P5WB 5HHOD 2VUOA 4J3UA 4MD4A 3KYKH 4LARL 2OZ4A 3JWDC 4LSSL 3B9AA 4K3HA 4YDVA 4JLRA 1GGCH 3U48A 3WJLC 3ARSA 1RIHH 2J8UE 4M5ZH 3MV9D 4XNYH 3LPWA 1MAMH 1QSEE 2IH1A 3HTLX 3FB8B 5DUPH 3AFLA 3ZE1F 2X7LB 1S7TB 3RIAK 1YZZA 3I9GL 1LEIA 4LHQB 1WZMA 5KW9H 5BRZE 5FYLL 3I6KB 4P5KA 4U1MB 5HPMB 1I9IL 1LK2B 5GRVK 2I60L 3OX8B 4MD5B 3SDXE 4RMUA 4B50A 1UFUA 4OLZH 4AQOA 3CFCL 3BZEA 3TYFB 5MENA 1LO0L 4FXGA 3QIWB 1L0XA 2VH5H 5CHNB 2Q6WB 5ACZB 4HUNB 5DR5L 2IH3A 3VXQB 2V2WB 2YPLE 3QNYA 3WXWL 1RI8A 4YIQA 2BERA 1JF6A 5DDHA 1KEMH 2CKBB 4O2CB 1T1WB 1SY6H 1WWAX 1A6VL 1A9EB 1N7ML 3VWJB 1BWMA 3VD5A 1D6VH 1MSPA 1UEYA 5AUMA 3PABB 2QTEA 1TTGA 2YK1H 3D3VE 5DS8A 2C4FU 2GJ6E 3TBVA 4JQXA 3B4NA 4YGVA 3QIUB 4QXGL 2DD8H 5CJ8A 4NQDE 4F58L 4RNRA 1N5AB 5HHMD 1F90H 3R8BB 5FOJA 5E6ID 2DQUH 4LHUG 1KXVC 3VGFA 4PRBB 1RVFL 3C5ZB 3MGTB 4YHPA 2IFFH 4V1DD 5C0GB 1TQBB 3OR6B 4M7JH 5IJVA 2QADD 1CN4A 3D25A 3E6FA 1ZVHA 3WNLA 3O4OB 5EN2A 3VGEA 4P2OC 3OPZL 4QHMB 1I3VA 4WCYL 1UXWA 3KHQA 2R0LH 3OKYA 2FJFA 4TRPL 1BQSA 3RTQC 3VXPA 2P5WE 2R1YB 2OI9C 2EDJA 3QFJB 3KNBA 4X8JB 1F8TH 3X11B 3JUYA 2GEEA 5F9OL 1J11A 2ADJB 3FN0L 2AS5M 4PLNC 1NBVH 32C2B 2C7UA 4WTWA 1CG9B 3RVUC 4NKQB 5I8EA 2HFEB 1RJLB 4U7SA 3BZDA 3D2UA 3MRFB 2B8OT 3MRBA 5DJYB 2FIRT 2V6HA 5EOTA 3VFSA 1WEJH 1OAZL 4UDUB 3BAEH 3PL6D 4GG6A 4PTTB 1G7HA 3P4MA 2E7CA 4IMKC 2VXQL 2CGRH 2A0LC 1H5BA 1UM4L 3BVNB 4AEIH 2AEPH 4C56B 5E5MB 4K3JH 3QDMB 1M7IB 1MJ7L 1NANI 2VQ1A 3CFDB 2Z4QB 4XRCB 3QQ4B 4HFUL 4NKDA 3OF6D 1MHPL 4W4OC 5CJOH 2OMBA 4XCFH 5FKPB 1MFAH 2IMNA 4G8GB 4RFOL 5JQHC 3W82A 1ES0B 4KAQL 1ACYL 2BZDA 2KQMA 3IDJB 5DHYB 1C16B 3F5WA 2J8UA 2FGWH 2A1WL 4FXKA 4OCSL 1HEZB 4MA7L 1IILE 5C0JB 5ISZD 3SHSA 1CLOH 3WKNA 5KSAD 1AGFA 3CH8A 1U8LB 4CN4A 4G8IB 3HCVB 1NFDB 2X89A 1Z6JT 3BGMA 3BH9B 1RPQA 3VFPA 2DI7A 4H5SB 4NSKB 3TBTB 1TJGH 1FO0A 1LO5A 3FFCB 2R69L 3SDXA 4HCRA 5DSCB 5K9KA 3EYVB 4OLUH 4C4KO 5CP7A 3Q6FB 5D6DC 3WDJA 3H42H 4NQTA 4GBXD 2A2QT 5T3XH 1FL3B 3S9DB 5DK3A 2I27N 4NDMB 2YPLA 3OKDA 3BRFA 5FGBC 3AMKA 1ZGLP 3LV3B 3K74B 4GSDL 3TLRA 1VADB 4MQ7A 2JCCF 1KG0A 1ZT1B 1G7QA 3H2WA 4DCQB 5IT2L 3VFVA 3ARWA 1Y18B 3V0WH 4I2XA 1Y6KR 3DPBA 3LCYA 4UILH 1Y6NR 4JRXE 3GMQB 5IESL 4XCEB 1DN0B 2ADGA 3QFJE 1CS6A 4PB0H 5A3ID 3W9EA 3D3VA 3DGGB 2DTML 4DVBB 1F11A 4DGIH 3S37L 1X9QA 4KRMB 4NQDA 1BQHA 4KXZI 3EYQC 4PJ7E 3INUH 4K3GA 4KMQA 3WN5B 4P5TA 1IQDB 2P8PA 1DVFB 2YN3A 3CCHB 4KMLB 2GAZA 2X1QA 3WXVH 3LPGA 4K8RD 3WFHA 1RIUL 4IRSA 3O3BA 4TSCL 3C87A 4C56E 1I9RL 3OGCB 4UU9A 3QDME 4YAQB 3N9GL 4XXDB 1FBIH 3NCEB 4AENB 3DXAE 1T83C 2Z92A 3KPQA 4ZS7H 4G8GE 7FABH 5FHBH 3OL2A 2P8LA 4U1SB 1MY5A 1T2QH 4HQQL 2R0KL 1BFVH 5ICXA 1ADQH 1FDLH 2QBWA 4M6MH 5DD0L 1M05B 4DW2H 1XF3A 3FB8A 2HJFB 2NY0D 4KRLB 4E5XA 1AR2A 5CZVL 3GKZA 1A5FL 3RDTB 1NFDE 1JF1B 4LLWB 1O5DT 5CEZL 5F6IB 3UX9B 4LLDA 1G9NH 4DN3L 3FB6B 3FFCE 5HY9A 1BQUA 1QFOA 1T89C 3W0WD 3U9PH 5GRJL 2MCPH 1BGXL 1Q8MA 4P4KB 3EO9H 1JI2A 1KPRB 1MCWW 3LOWA 1QFPA 2XT1B 3DRTA 1UZ6E 2VTFA 5D2LE 1KLFA 3RJQB 5IOPA 2IAMB 3FRUA 5F7DB 3FOLB 3X14B 4R97C 1QQDA 3VXRD 2CKBA 4JO4H 4KJYA 4K94L 4O2CA 2EDXA 3S6CA 4NO5A 3ULUH 5C2BL 1CIUA 5GZOD 3GSRB 4JGJA 3RL1B 2ARWA 2E7HA 3UJTH 4HS6B 3VRJA 4LKCA 5F6HI 2IG2H 5IJKC 1UEMA 3IFOB 5SWQB 5FM8A 1LE5A 4GG8A 4UIMB 2OTWA 1EEZB 4HZAA 3HFMH 3ZYIA 1BREA 5I1LA 1QLFB 5E00A 2XRAH 5GRUH 1HWGB 4K7PH 3QI9A 2XTJD 4RISH 4WW1A 3X13B 3GIZH 3NPZB 5GGTH 3UAJC 2X4TA 4Q0XL 4PG9B 1X5GA 4OLYL 2ICWJ 1MNUH 1XCQA 3T0ED 4I4WA 1EJOL 4F7TB 2NTFA 3AREB 4PJHF 4ZPTB 1I7UB 2E6QA 2MHAA 3MLSL 3MJ9H 4ALAH 4R2GB 1OTUD 2EDEA 1NAML 1IAMA 3DOSA 4XHJD 1INDH 3CSBA 4EVNB 2O5YL 5CGYD 4KJPD 4XWOC 3LMJL 5H35A 4HKXB 3RPKA 4JRXA 4DJMA 3QIWC 3QFJA 3C2AL 4ZXBA 5L8LB 3CZFB 1KCUH 4K9EL 4ZNCD 3C6LA 2RIKA 3WMSA 1U6AH 4Y4HB 3UEZA 5FK9A 4HUWB 1TZIA 3NACH 3GUTB 4PJ7A 1FIGL 5GISH 1RJLA 5DJAB 3DUUA 2R23B 3VWJC 4M1DL 3L5IA 5C3TA 1S7UA 4L3ED 3F7RA 5ILTL 3WFZA 5IBUG 1L6XA 3RX8A 1BIIB 3SGKA 4QRPB 3QJFB 4U1LB 1RZKH 1JMXA 5HYJB 5I15L 2AV7B 2ZCLL 3ARBD 1MFNA 2EZ0C 4KC3B 1ONQB 5KVFL 1YPZB 2JLLA 3QDMA 3I02B 5IW1B 4XP1L 1TPXB 4EOWL 4GAYA 2KH2B 4CGTA 1EO7A 5FO9B 1WC7A 5EFIB 1VGEL 3DX8B 5ESVB 3C5ZC 5M7QA 3DXAA 1WICA 5FDWA 3BOVA 1TQBC 3E1F1 3MZTA 1PSKH 2CLRA 3O4OC 3IS1X 4IHOA 4PUBH 5J13B 3UTZB 2WV3A 4U0RB 5IB1A 2VE6B 2DM3A 1AY1L 3KYAA 3TFKD 3ARTA 4MNQD 4DUWA 3HI1B 5E1HB 1OM3L 3IAPA 3L9RB 1RHHA 5D9SB 1F42A 1GIGL 2F53B 1ED3B 3AM8C 4JCLA 3RX5A 2HN7A 1IGIH 4H5SA 1FN4B 4ZXBC 2DM7A 4HJJH 5IB4A 5DSCA 3QWOA 2Y5EA 3BKCH 3IDXL 2YUWA 2FB4H 3Q6FA 2G5BA 5AAWA 4AEHH 1WWBX 4JG1L 2Q86A 3WEXB 2I5YL 1LILA 3RUGA 1N26A 5D2LA 1DDHB 4YE4H 5IFAH 3DHJA 3MJ8B 2VDOH 4DKFL 1P5VA 3RL2B 1G7IB 3PWNB 4X5XA 1YY9D 1BAFH 4YO0A 1OARH 2BDNL 3GSUA 1P4BH 1T66D 4KJWD 2IADB 5C0AB 4KK9D 4LCUB 4G7VH 4CVZB 1U91A 4MVBD 5CBEB 2DQDL 5JR1H 1DUZA 2I25N 2I26N 1X4ZA 3RNKA 1VACA 1FVCB 2X4PB 4XBEH 3FHQA 1ZSDB 4XGZB 4D9LH 5C0FB 3IGAA 1MRCH 3A6CH 5T5FL 5C6TH 4NHCL 5CZXD 4LEXL 3OZ9L 4L8CB 4MS8C 4ZYKB 1UCTA 4WI8A 4NO2B 4QRPE 3MREA 1WIOA 1CD9B 4W4NA 4DAGH 3MV7B 5E5UB 5IMMA 3CPLB 4QTIH 2MMXA 4ZFGL 2WUCH 1YPZE 3IXTB 4M02A 1RU9H 1D5MB 4HJ0C 1NGZB 2YZ8A 4AENA 3O2VL 5DMYA 1HDMB 2V7HB 1L0QA 3NN8A 4TNVF 5I18H 5KOVC 4EI5B 3O45A 4XNQB 4NQVA 4M7LL 1NGYA 2J6EA 4M48L 3S5LA 4PY8I 1PY9A 4JPKH 4NPYB 1RZ8B 3IFLL 3LB6D 1G9NC 2F53E 5J3HD 1A0QL 4Q9RL 1Q9LB 1CGSL 3Q48A 4LLWA 4E41B 2WNGA 4XNUL 4GOSA 2Q3AA 5HPOA 3CVHB 3FOMB 3DYPA 1CT8B 3EOBB 3GJFA 4I0CC 4EXPX 2AI0L 3TP4A 3ZKXB 4QY8B 4JFHE 4ZUVB 3WN5C 4BA8A 1R6VA 1XF1A 1DVFC 4IDJL 2BMKA 3SDDD 5DD6B 1MH5B 3ULUC 2FX7L 3G08B 1S7XB 3DHMA 5T3ZE 3QH3B 1FZMA 2FO4B 1FZKB 4HXBH 1IEHA 3TT3H 3FOLA 1MFBL 4P3DB 5B3JE 4PGEA 1VEPA 4TNWF 5C0AE 5TE7H 5L8JB 3RZWA 1J0YA 5BS0A 1ZHBB 1G6RL 4BQ8A 4OCRH 4PLJC 4XBPB 5EU7E 4FG6D 5C0CA 1A22B 5HHNA 4PGBA 2HLAB 1NCNA 1ZXQA 5B8CB 4FZEH 1DBAH 4I3SH 3T0WA 3HZMB 3TO4A 1RURL 4PRHA 5CILL 4ODVL 5I66A 1CGWA 4KQ3L 5IMOB 1A21A 5DT1H 3HZYA 3IDMA 5FO7A 1TZHA 3L3GB 4APQA 2AQ2A 4U1KB 2HT4C 3X13A 2VMFA 3RBSA 2W0PA 4Z0BH 3SCMD 4RRPG 2AABH 2HAZA 3G5ZA 1RZIB 3GIVA 5E08L 2VOTA 3MV7E 5T33L 4UINH 3RDTC 3THMH 5B4MD 5IFHL 5CLTA 4NC1E 4OJFH 4NOFA 2VDNL 5F6IC 3BISA 5I8KL 3ES6A 1FPTH 3HE7B 3T3MF 1E4XL 3CSYB 3H6JA 4PB9H 2HFGL 5EIQA 5CP3A 3K7UA 3ULVD 1Q1JL 4LLYB 3D85A 3QG6A 3HNTL 3FZUC 3MV9B 4KKLC 4L5FL 3U0TB 4XHQA 3SJVD 1VKXB 1IAKA 1BMGA 3GEWB 5DJDB 3HNVL 4MLIA 4E42A 1FFOA 2BY0A 5MHSE 2UWEF 5IBLD 5L2KA 3DURA 4KWUA 4LLVB 4OZHF 1YDPB 1QKZL 5F8RC 1X44A 1JYXA 4L8DB 1RZKC 1HSAB 1AO7A 5SX5H 1BHGA 1W2KT 3VDCA 4BSWA 3MBED 4E41E 2WBWB 1T7ZA 3STZA 3BP4A 5GHWH 1VHPA 4ZFOA 3M45A 3P30L 3CSGA 3CH1A 2DQGH 2HRLA 1A4JB 3ET9F 1WIPA 5HI5C 4ODHH 4PJIF 3VD7A 2H32A 2V17H 5GZND 1ONQA 2HTLC 2F74A 3U7YL 4DOHB 1TTUA 3RWGA 1IM3B 1OGTA 4EI6A 4UMGA 1NEZA 4PRNA 4ZOEA 4APQC 4DTGH 3FO9A 3W9DB 2YWZA 3BWAA 5C0DB 1FV1B 3MSPA 4JM2B 3BESR 1JZ7A 3VE0A 1KPUB 4PP2A 1EH9A 3AREC 4MB5A 5D8JL 5EO0A 2A9NL 1CF8H 4H1LH 5JXAL 1RK0B 3LQZB 1MHCB 2F15A 5C1MB 1FGNH 4OUOA 5J89A 5I2IB 4MCZB 4GKOA 5H2BB 4LPUA 2NY1B 4YUEL 4D0DB 4B5EA 4LSSH 2EKJA 3MQIA 4OCMC 4QT5A 3PP3K 4I8DA 1JNNL 2PTTB 4HWUA 2QADB 5T1KA 2X2YA 5K59E 5D1ZB 4D3CL 3H8NA 3RGVD 3DX6A 3KPOB 1HHHB 4EKXA 5FUZH 3JV0A 3RGHA 1T5XA 3UTQB 2F54D 2OMNA 3GBNH 5JPNB 3WUZA 1I9IH 4U0QB 3H9HA 1IMHC 1YN6B 5HHOE 1JIBA 1H9VA 2I60H 1QLEH 4P46D 5I6XB 3H9SA 1KPVA 3KAAA 4G6ML 4HH9B 3CFCH 3RZCD 3LN9A 3MV9E 4MMXC 3UROR 2XZZA 2VLRA 1LO0H 3TC9A 3HA0A 4HLZH 4MNGE 1TPXC 4EJ1C 5DC9B 3EJYC 3WXWH 1UWGL 2B4CL 3MLRL 4X5LA 5GSRA 4LMQI 4Y2DA 2W0FB 5D6CB 4XGZA 3PL6B 5AG9A 1T2JA 3CAFA 5J13C 4KK6D 4FFWD 3MGOB 2YEZB 5I9QB 4U0RC 4YDLB 2K1MA 1VFMA 4L9LA 1JGLH 4HZLA 3PGDA 3S35X 1M7DA 1RULH 3FQWA 3TN0D 2FO1A 2FGZA 4F58H 5IVZB 4OIIL 3RFZC 2Z31D 1DL7L 1P7KB 3PWJB 4OQ1A 3P11L 4JAMB 1XGUA 2LVEA 3HZKB 5TQ0L 3T8XA 1RVFH 1YUHA 2JJTA 3SDCB 4F9PA 3FMGH 4R4NC 1SJEA 1BEYL 3WDIA 3F62A 3MUHL 4OBSA 1ZS8B 3MRIA 3RWHB 1DN2A 4Y5XB 3ZDZE 2XKUA 2AV1A 3BW9B 3H3PH 2D7PA 4MQTB 3OPZH 5DYOA 5EIIA 4WCYH 3B2VH 5HHME 1AFVH 3TJEL 1QNZL 1MCKA 2JJSA 1JYVA 5IV2A 1JCKA 4JCMA 4FQCH 2VITB 3SKOA 2CDGA 4FQHA 1D5ZA 2MKLC 1U3ZA 4V1DE 4QRRB 1F4XH 5TDPB 4I13B 5J9PB 5EC2B 4YDJA 1SYSB 4NBXB 3CK0L 2VXSH 1AXTL 3RIFK 1N64L 3CVHA 3RWJA 3MRDB 3OR7B 1ZT7A 3L7EB 3QXDB 1JZ4A 4XNZB 4Z78A 3HUJB 1ORQA 4QY8A 1OSZB 5A2JH 2OTUB 3HPLB 1NBZB 2YBRA 5INCB 5KTEH 3CDGB 5IEKB 5IP4A 1FZOB 4JHAL 3UYOD 1W72L 2D2OA 1HH9B 3AROA 5TE4L 1FZKA 4XCCL 5HVHB 1PBYA 4Q2ZB 1MWAL 3KPLB 1MJ7H 4NC1C 4JEGB 3VFOB 3CMOL 3HG1D 4ZNEA 3BQUD 1KJ2L 2C3HA 1MHPH 2X41A 1ACYH 1U8MB 4IS6B 3KPRB 4FZ8L 4O02H 1J0IA 1HSBA 4EI5C 1KIQB 2CJUL 2A1WH 3P9LA 4PREA 4OZIB 4MA7H 2WSKA 3P73B 4JQIH 4Q9CA 3K46A 4PY8J 3UXFA 4EDWL 1CQKA 3B9EA 1F97A 2H2PC 2L7UA 5SWSD 5E7BA 5FEBA 1DP0A 3ZDXF 5EBWB 5IBTL 4N8VA 3BMVA 5HHOA 1B4JH 1XGTB 2BNRB 4JDZA 1X5FA 5IF0A 3WE6A 2BSTB 4FQ1L 1TJHL 4DZ8A 1UB5A 3ZKXC 1XGQA 3P40A 1MQ8A 3Q5YA 4MNGA 5CEYA 4OZ4B 1QBAA 4GSDH 2UVFA 3JWOL 1X3DA 4P59H 5IT2H 3IJYB 1YNKL 4BQCA 4JANB 1WBZA 2XZCL 3GRWL 5IESH 1HSAA 1NGQL 1C12B 1BJ8A 2FJGA 4UDTA 3C60D 4QRRE 5J6GA 4DKDC 1QBLL 3CC5B 2BNUB 2DTMH 3ZKNC 4P2QA 4OB5L 1INQB 2DKUA 1S7QB 3QHZL 4UZGA 4YHOL 1UA6L 5B8CC 5CSBA 4PY7B 1ZHKA 1KT2B 2QJDA 5FB8A 3QFDA 3OJDA 4ZO9A 4UUJA 2ZOLB 4XPHH 3HUJE 3UTTD 4X6CA 3VXRB 3SN6N 4KK5D 2QKIA 1RZ7L 4NIKB 3BIAX 1ZLWH 5HGBA 1RUAL 1FV1A 5I30H 1U8QA 3U4EA 4CBPA 2ATPA 1IARB 3LKQB 1FCCA 3GSNA 5JW5A 1JGEA 4PYGA 1I9RH 4YDKL 5J06A 5IK3B 1MCJA 5IHLB 1XT5A 2XKNA 1AE6H 1UXSA 2E9JA 3PP4L 1A2YA 4AIZA 1F4YL 1TVDA 3DSFL 3DJ9A 3HKFA 3I75A 5DURD 3HLAA 5E6IA 4WEBH 1IE5A 3CFEB 2XTJB 3HR5B 3KPRE 4PRAA 5TDOB 4NQUA 4V1DA 2R0KH 5EUOF 5HGGS 2VXVL 5DMGD 5DTFB 1KTKE 2E27H 4CU8A 3FT4A 4OZIE 1CFBA 3HAEA 4QOKD 3QG7H 1NAMB 4KKCD 5CZVH 3NAAL 4O2FB 3S98A 1Q9WA 1A5FH 1S8DB 2YMXL 3UTQA 2P24A 3WJJC 4WW2B 5IB2A 5IHZA 5GGQL 4M6NL 4FN0A 1B0GA 3WFCL 3OKEB 4FQXD 2DLGA 3O4LB 5KVEL 2BRRH 4LNRA 5D7JD 3ZE2E 1BGXH 1MFCL 1HXMB 4NRXA 4UQ3B 1KF9B 1JRHH 3ARGD 5CD3A 2ZUTA 4I1NB 2OLDA 4MDIB 4XPBL 3MRPB 3SGJA 1CXLA 2D0GA 2EDRA 2YKLL 3RVTC 1TDQA 4WJ5B 3PQYD 3HRPA 3QHFL 2NQCA 4MQXD 3D0VA 1R5IA 4JM2C 4L3EB 4JJHA 4BELD 2IMMA 4K94H 4PJCF 5E6ZA 5C2BH 1JPGA 1PW3A 5ICYB 4N8PA 5FYJU 1U8PB 3ECBB 5I1IH 2AJ3B 2NW3A 3ARBB 4O5LH 1KFAL 1XAUA 5E99L 3L3JA 2NY1C 2WMPA 1EFXD 5IG7B 5J57B 3H7BA 3PWJA 5DQJA 3BKYL 1EEUA 4X4ME 4XPFL 4YZFF 3W39A 3VXRE 2QADC 5C0BA 1D9KA 2J5LB 3IETB 1IGYB 4Q0XH 5D1ZC 5DD1L 2CD0A 4NFDA 1EJOH 4BUHA 1U8NB 4KTDH 4X99B 5A2IH 3QUMB 5ISZA 3WIIL 4MNQB 4Y8DC 2P4AB 5SX4H 5I8OL 2ADIA 4X0KA 5KSAA 4PJGB 1NAMH 3U0WL 3ZHDA 1HH6A 5GRVL 1BQLH 5I6XC 3HRZB 3KGRA 3LMJH 3IU3B 2JK5B 4DGVL 2FSEB 2XTJE 5HGDB 5FM4A 2ATKA 3T0EE 4K9EH 4OV6F 4Z0XB 1KJ3H 5I1CL 2DBLL 2EXYD 4GBXA 3FQXB 4J6RL 5E8PA 1FIGH 3G04A 4PJXB 3PL6C 2PYEA 4M1DH 1RZJL 1OSPL 2O5XL 3O9WD 3O6LL 5I9QC 4YDLC 4HJGB 4U1IB 4U1HA 1I8KA 1H8SA 1QVOA 3T2QA 2A6JA 3C09B 5J8OA 2ZCLH 2IWGA 2Q87A 1HIMH 1MHHA 4HEME 2WBJD 5KVFH 4PRIA 4NM8L 1CFSA 4Y88A 5C0IA 4XP1H 1YMHA 2FDBP 4YH6A 5JIHA 4UQ2A 4EOWH 4M9PA 4LIQH 5EU5A 1B3JA 3GNML 1VGEH 5LQBL 3CXDH 4BH8A 1JGVL 2YRZA 4HV8A 1CFVL 3SDCC 1NCBH 4TVPL 2EYTB 3ARDD 4MCYB 3VXTB 5MEPB 4N9GA 4OFIA 3TPUB 2FCBA 4M4RA 4L3EE 4HWEL 4Y5XC 3RVVD 2VLJB 5IM7A 1DUYB 1XR8B 1HE7A 1H3XA 2D9CA 1LMKA 4QRTB 5DHVA 1IGTB 2OR8A 3OQ3B 3S36X 1SEBA 1MCHA 4IIQB 2CLVA 3O2DL 4LIQE 3MRQA 3RWCA 3SKJL 4JE4B </