4O4YH

Crystal structure of the anti-hinge rabbit antibody 2095-2 in complex with ides hinge peptide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
215
structure length
215
Chain Sequence
b'ESVEESGGRLVTPGTPLTLTCTVSGFSLSSYPMNWVRQAPGKGLEWIGGIGTSGNIWYASWAKGRFIISRASSTTVDLKVTSPTTEDTATYFCARGLYNDYTVWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2095-2 light chain
publication title Structure and specificity of an antibody targeting a proteolytically cleaved IgG hinge.
pubmed doi rcsb
source organism Oryctolagus cuniculus, homo sapiens
molecule tags Immune system
total genus 42
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2013-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o4yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o4yH01
1MHCB 2XN9A 5HGDB 4MDIA 1IAOA 2VL4A 4K3GA 1C1EL 1X5AA 2HP4A 4W81A 4B7LA 4S1QL 4XC1H 1JPTL 2XIDA 1J1XH 1Z9MA 3WFHB 4CW1A 1DZBA 1IAKB 4PFEA 3RVVC 2VLMD 4WO4B 3GO1H 3C2AH 4WHTB 3OKOB 1QVOB 5MHSD 5C71A 4C56A 5D1QA 1IMHC 1RZGA 2DQDL 2HVJB 1EO5A 2NX5E 4XP4L 1P4LB 4Z7WE 4QHLB 3H9SA 3W9DB 2OTWA 1G7QB 3QFDB 4X0KB 3MCKB 5EORH 1RUAL 5I74C 1SHMA 1TZIB 2VLJD 4Z0XB 1ES0A 1INEH 4FNLH 5E6YA 5CZXC 3DECA 5TDNB 3GB7B 2JKXA 4QHKI 5IROC 3V8OA 3O2VL 4CRPA 3QULA 4BH7B 5I8EA 4CMMB 3TPKA 3V4UH 2V5SA 5IHLB 4UUJA 5DUMH 4WFHE 5F9WC 5HHOA 2E7MA 4E41A 3DVIA 5JORB 1EUUA 1S7QA 4K71C 3RNQA 3MBEC 5ANMA 1C08A 4KTDH 3PNWB 3FB7B 4YDKL 4M6NL 1CD1B 4DVRH 3IJYB 5HD8D 4TVPL 2B7DT 4JQXC 5LCVL 5L0QB 4JR9L 4XP5L 3FT4B 3QI9B 3QDJE 3SGKA 4O02L 4KDTA 3V6OC 3GRWL 3TCXA 2DTMH 3RWFA 2IF7A 1F13A 2WWMD 3H9HB 2M1KA 4KC3B 4WU7A 1RVFL 4DVBB 1QLEH 4YBHA 1G6VK 1QO3A 2FO4A 5J57B 2DOCA 1T5WA 4ZUWA 2AJXL 5CJ5A 2FB4L 1CE6B 1VENA 4N1CA 1ZTXL 5DUBB 3LEXB 2B0SL 3Q1SH 1JZ6A 2OTUB 1XF2B 3OKDA 2JJSC 3T2NL 4LLWB 5GGTH 3NZ8A 1RZFL 4P5TD 3ROOB 1PX4A 5T5FL 1IL1B 2NLJB 4XPTH 3U6RA 2VXQL 4PP1D 4I77H 5E4EC 2IANB 3HZMB 3KPOA 3ZE2E 4ODTH 1JTPA 1MY7A 5DT1H 1AE6L 3ULVH 3UC0H 1G6RB 1X5FA 3UPCA 1DBMH 1NCUA 4UT6L 1I1AC 4PRPB 3I6LD 2XFXA 1IQDB 4M48H 5EOCJ 4HKJA 3CVHL 3RZCD 4JO4H 4PY7B 3GNML 4YHLH 4TYUA 3QG6A 1MAML 3BEVB 1JWSA 2X2YA 1JZ3A 1IGIL 3CNKA 4ZQKB 4FFZH 3ULUD 4PJXA 1Q8MA 3ZYIA 1AP2A 1QSVA 2EDHA 2WMPA 4YLQT 4IBLT 1DQTA 4UTAL 2CJUH 3QNXB 3TO2A 3P4MA 3ARFC 1X5GA 4U1GC 1NJ9B 3RVXD 3FQRA 3SCMB 4M02A 1QBLL 2NXYC 1B0RA 4TUKL 5IOPB 5IFJA 5FAAA 5CEZD 3W0WB 4KQ3H 3OMZA 3TJEH 2C7UB 3MROB 3GSVA 5C3LD 1N6VA 1K6QL 2FATL 4GW4B 5ESAA 1T89C 4HDIA 1GIGL 1KB9J 2BMKB 2ARJQ 4B50A 4D9QE 2JCCB 2VRAA 4JFDE 3K7UA 5D6DC 3VRLF 1C12A 2CRIA 4QNPF 4EEEA 4WI5A 1KIPB 2VLLA 2VN4A 1ZLSL 2F53D 4G9DB 3NIDF 1S7XB 4Y89A 5C8JA 3O2DL 4NNXB 1TLKA 5JW3L 1LP9F 4BZ1L 1EO8L 1E4JA 5IHUH 4OF3A 2O5XL 3MA7A 4G9FA 3EIFA 1S78D 3IDXH 2XTJE 4TUJA 4LSRL 3VWJC 3ULVF 4JFFB 4AEHH 3QJHB 2LAAA 4NNPL 2AJSL 5DRZA 5C0AA 2AV7B 3VGAB 3UTSE 3QJFB 3JWOL 3WIHL 5A2KH 4OCWL 2R1WB 4WU5A 3TVMD 2X41A 2W0KA 5BXFA 4OCYL 1T2QL 2XKUA 2EIZB 3GMOB 4CNIA 4HIHB 5ALBH 2BNQD 2DTSA 4HJJL 3FO2A 1SVZA 2DIAA 2R56H 5SWQB 1NAML 5EIVA 3GBNL 1A3RH 2OZ4L 1HH6A 5IMOB 3MMEB 5CJBA 5IBTH 1O7VA 3WYRA 1K4DB 1DN0A 4L3ED 2PN5A 3O3BB 2E27H 1QSED 5DO2D 3VRIB 3W11C 1A6TB 1JRHH 3D85A 1G0DA 1MHHB 4XXCC 5GS1A 3RGHA 1GGCH 5E08L 4H8WL 3PWLA 4FRWA 4N5UA 2A6DA 1ZT4A 2GAZB 3P0VH 3ALXA 4OGXH 1A5FL 1DVFB 1YEGL 4M7LL 3QIUB 1FN4B 5LAXB 5DMGC 2GT9A 3ARVA 3L3HB 3MRCA 1OT1A 2VZOA 3TA3D 1H8NA 4UOW0 2IH1B 4MWFA 1QACA 1K8IA 5EU5B 4NUJB 5DS8A 3FB8B 4WHDA 3BUTA 5D2NC 4R6UA 5C0GB 1CBVH 1QFWL 5KS9E 1CWVA 5IEKB 5IVXB 4JFZL 4QRRD 3VWKD 3NIGF 4P3WA 3FQUB 4NN5C 4PG9B 3DROB 4PRNA 3S37L 3TIEA 1U8OA 1ZHBB 4JM2C 1LDPL 2CUHA 4MNGB 3VFGL 3BKYL 2EEDA 4K9EH 2A1WH 5C09B 1AGCA 3E6HB 3HG1B 3U2SB 4YK4C 3AUVA 5ILTH 3QDGB 5JHDB 5EU6B 3IDJB 1QSFD 3TBSA 2LABA 5DHXB 3KPRD 3EOYG 4PRHD 2FH8A 2FX9L 4X6FA 3SPVB 1D6EB 3WFCH 3RPIB 2AABL 1ZV5A 3W81A 4LCWA 1E6OH 1FYTD 4XPHL 1BPVA 1ORSB 2A9ML 3K1DA 1I7TB 1P2CB 1O0VA 3T3PF 1N0LA 4HK0A 3H0TA 3HE6D 2DMBA 4RFOH 4LP5A 3L5WB 2EH8L 5D7IE 5F7YC 4HZLB 4UDUA 5HDQL 1EK3A 2DQIL 4N5ED 1KN4L 2EDRA 4X9IA 3PG2A 4OZHB 3O6MH 3UYOD 1CGSH 3AM8C 3U0TA 1F6LL 4KPHL 4LL9A 5IKCA 1AQDA 3QIBC 5DJZA 2YHGA 5EZJB 1OGAB 3W39A 4KI5D 5IUSA 4OCXL 3BP4A 1JRHI 4JZOA 2F58L 1X3DA 3C9NB 1X9QA 4P46D 1YYLL 1NAKH 3LMJH 2E7HA 1CE1L 4XC3L 1WZKA 1V05A 3T1WA 1WZMA 2VLJA 5C86A 2P1YA 4RA0C 1FZJB 3T4YB 1I1RA 1U3HD 4TRPH 4I4WB 1S7WA 2NQCA 1G9NL 4Q6IB 3UTZA 5DK2B 5MP6H 1YQ2A 3VD3A 3WE6B 4BQ9A 3MFGB 4CADB 1UCBH 1BWWA 4D94A 1RQ5A 2EO1A 4ZNEE 1LEKA 1IRAY 5JOFA 1DL7L 4DUVA 5L2KB 3LKNB 1J86A 4XNXH 2E7LC 3BIKA 3WKNA 4YR6B 2FBOJ 4Q2ZB 4XBEH 3RA7H 4FFWC 1Q9OA 3FMGL 5TFSH 1HHGB 5C6TH 4BELD 1JHLL 3OKMB 3CXHK 2EDJA 3DVGA 3MLUL 1K5NA 2AK4B 1LEGA 1AGEA 3BE1L 3P0YH 2FO1A 3GHBL 5FUCC 5AD0B 2JJTA 3HI5H 2A38A 1FLRH 3GKWL 3CMGA 2R0LL 4FXGA 1J0KA 4PJ5B 5D71H 3U9PL 4DEPB 2VIRB 2GJ6B 4RMUA 3SDCC 4KK8C 2NY3C 3U83A 1LEIB 2XZAL 4OAWB 2B20A 2QSQA 4JHAH 3LIZL 5DZOA 2X1XR 3L6FA 4LAQL 4QHMA 2Z92A 4YHZL 5ICYA 4P5TA 3AREB 5CAYB 1M71A 2ILLA 2Q3AA 4KKAD 1JPST 1ETZA 3BN9C 2PYFA 4ODXB 5CP7A 2H2PD 3KPMB 1F58L 2WLYA 5L8JB 4F15C 4ELMB 3ARDB 2X1QA 2C3VA 5TE7H 4PJXF 3VXNA 3SKJL 3BYYA 3VW3L 3RZCA 3PXJA 3B2VL 1FORL 3FZUC 3PQYE 4MJ6A 1TTFA 2EYRA 2WK2A 4KMTH 3DXAA 5DK0B 2MOVA 3AXLA 3OXSB 5JO5B 2D31A 4X7SL 3CFJB 1P4IL 4NOFA 5CSZA 3BRGC 5TE6L 5GS2H 1QRNA 3SKMA 3MNWB 3NPSB 4PJFA 1HILA 2EKSB 4J4PC 4NT6B 3B3IB 3EFFA 4BJLA 1NSNL 4F7CB 3FHAA 3C8HA 1EXUA 3MJ9H 2OR9L 4HKBA 2G60H 4N0FA 1U8JB 1O5DT 4K7PH 3GUTB 4AM0A 5IK3A 3TN0B 3MGOB 3L3DA 5M94B 1FGVH 1A9BA 3OX8A 1YQVL 1H0DA 1XCTB 4O9HL 2CKNA 1KSRA 4DN3L 5K9JH 3RBSA 4JFHD 4NYLB 1D5XB 2GFBB 2GCYB 4YDLC 3MRPA 1S9WB 3V6OE 1FNGA 5CJXA 4P5MA 3ZO0A 4HS6A 2IALA 2V9RA 2CUMA 3TO4D 4BFEA 4JFYB 1MQKL 1CD9B 4GQPH 3Q3GB 2N4IA 2SEBB 4FQCL 4PLNC 2YUVA 4DGYL 3EHBD 3SKNA 2NTFB 3RWDB 1MCKA 5EU7C 2J1KA 4KK9D 5TGBB 1FNSH 4GG6F 4NP4L 5BS0B 3GBMH 3L9RB 2FJHB 4NQDD 4MD5A 4GRWE 2R8SL 3KLHD 1ZHKA 3TVMA 1DE4A 4BK5A 2AW2A 1J0JA 2EDXA 1ZGLM 5I8KL 1RIHH 4FMKA 1FSKB 3HE7C 2BNQA 5EFIA 1AC6A 4WWKB 4H1LG 4HWZA 3SDXF 4M5ZH 5FEBA 4DUXA 1S3KH 1JBJA 5CJOL 4HUMB 4X5XB 3U4BL 4I0PA 5CFHA 4A6YA 4WI6A 3MA9H 1M05A 4GJTB 1KEGL 4L3EA 1EVUA 1QSEA 5CP3H 4LF3B 1YEIL 3HCVA 4Y5YC 4UT7H 3GSUB 5DFWH 3S3SA 3H3PH 1WC7B 4U7MA 1A6VL 2ADFH 3FOLA 4MJIB 1YPZE 3G6JA 3NN8B 1H3WM 4NJ9H 4Z5RA 2R2HA 5I9QB 2VQTA 43C9A 1MFEL 4XP9H 5GQBA 1HSBA 5M95B 1Q0XL 5BW7C 3TA3A 4NWUL 3H7BA 2IFFL 3QAZC 5FYJE 4LIQE 1WAAA 4AIOA 4RGMC 1VEMA 2IADB 1ZEAL 4QRRA 3VWKA 2F8XC 4L9DA 5CEXB 1S7TA 2NX5B 3DGGA 1A4JA 4BFIA 3OJDA 1QNZH 3N0PB 4R0LA 4FZEH 1INQB 3ZKQD 3FQXA 3R4DA 3WFEH 3HMWL 2IAMB 4NRYA 1WSST 1EFXD 4FHBD 3VXTB 3CFEA 5I30L 1QSFA 5H2BA 1IAMA 1XIWD 4NQCE 5CLTA 3KPLA 3CC5B 3KPRA 4BUHA 4PRHA 2ENYA 1T1WB 5F7NC 3TM6A 5JA8B 5CHNB 5MI0C 1P69B 3LV3A 1ZS8B 4U6TA 1A7NH 1J0IA 3LVEA 1FYTA 1OAXH 1GZPA 5F1KC 4FQ2L 3OKNA 3UDWA 3VXUD 2WUCL 3I85A 4EI5B 4JQIH 1NCAL 2R0KH 2W59A 3RTQB 1NBVL 5KZCB 1M6OB 3HE6A 3QUMB 4NQED 4LARH 3SEPA 1N4XL 5ESVA 2BDNL 1JNNH 5HTSA 3BW9A 1IQWL 2ZOKA 1TQBC 1PAMA 3C09B 3B9VA 3OV6A 4AIXA 3SE3A 1E27B 6FABH 1MRDH 1YEDA 4LSSH 3M17B 5EU3B 1VPOH 3KPSE 3P11H 3T77B 2CDFA 4UAOC 3VGDA 4NO0D 2HN7B 5J4MA 1U8NA 5DEFA 2OBGA 2VR4A 2WINB 1PKQE 4YBLB 3KYMA 2YK1L 4P46A 4ZUUB 4TQEL 1FPTH 2VZ1A 4YQXH 2DD8L 2EH7L 3FT3B 5KW9L 2DL2A 3ZKNC 5DURB 4HEME 5FM5M 3BP6A 5HHNA 2MQ0A 1B2WH 3CVHB 5EB9A 1I7UA 3CX5K 4NO5A 2F5BH 1I75A 4M61B 3MYJA 1U3HA 3QUXB 5E99L 1RZIA 4JEGB 3D5OF 5CGTA 1QFUL 1IEBB 3CLFH 5IESL 4BFBD 4F58L 1SJVA 5JQ6H 1FL5A 1QTYT 3RVTC 1OAYH 5HVHC 4XPBH 1N5YL 4X5LA 3BX7C 3KLAA 3I02B 4Q9QL 3NA9H 3TH4T 3NCMA 2EO9A 1AR1D 4C59B 1TVHA 5HHMD 1MWAH 3P30H 4ZFOL 5DUPH 4X8XA 1FC1A 3CXDL 4DWHA 1KXTB 4M03A 5JIPA 4LSPH 4ZOCA 2I27N 5HPMA 3VI4F 5DJ6A 2AJUH 1DBKH 4F57H 4MHHI 2ICES 3IDGB 2OS7A 1WBZB 2YKLH 2RFXB 1KEML 2DQFA 1H15B 3ILPB 4HAGA 2DLEA 2EDDA 43CAA 3RIFF 2DDQL 3CFDB 5CEZH 5JXED 1MCPL 4OGYL 1U6AH 2CDEA 1TCRB 5EUOE 1NCTA 5JW4M 1J10A 3KXFD 4GRLB 2K7PA 3MPCA 5GGSB 3TNNB 4M3JA 4FTVE 4NO2B 3B8SA 4Y4HB 3MXWH 1R3IH 3UP1A 4KKCC 4OF0A 4LSQL 1KCVH 4QY8B 1OT2A 3WN5C 3WDIA 2BHUA 1YY9C 1T4KB 2R39A 5I16A 3GMLB 5L7XH 5E8NA 2BNRB 1WQVT 1J5OH 1RUMH 2DJSA 1D6VL 2YD2A 2CDGB 4U0QB 4B0MM 5D7JC 3BGMB 1Q9KB 1NAMB 3ZDYF 2ADIA 3P9LB 1CGTA 2OM5A 2AJZA 2IQAA 4U1HB 1KJVA 3MXVH 4EDWH 3MV8A 3EYVB 2FH6A 4HH8A 2EDTA 3UTSB 5GJSL 3IGAB 3QZWG 1CU4H 3WFZA 4AT6B 2WIIA 4Y2DB 5LXGL 3H7LA 4PJHE 3V7AG 2P7TB 1JUFA 4PRBB 4PJFF 3QEGH 3T3MF 3BEWA 3HC4L 4JAMB 4MZ3A 4GW1A 4ACPA 3PIQB 5C0RH 3GJEB 1I85A 2R0WL 3VFOA 1L6ZA 1DBJH 6CGTA 1FGNH 1QFWM 4YPGA 3HR6A 3Q6GH 4K8RC 4IRSB 3RVWC 4N8VA 5AZ2H 3IVKA 1AD9A 3S36L 3ZKSD 4WFGE 1F4HA 1BBDH 2MPAH 2OP4L 3PV6B 1H3PL 3QHZH 4S2SB 3X3FL 5FGSA 2FJGA 3FO9B 3BD3A 2PO6D 3QYCA 2CK0H 4RRPG 1F11A 1Q0YH 1Z9LA 4TSBL 4RNRA 5DJ8A 4PJ8C 4ZOEA 5FUCE 1NFDE 1NUNB 4ETQB 5I8OL 2YPLE 1VB9A 5HXMA 3V6ZA 2BCKB 3TO4A 3MRNB 4IDJH 4XCNA 1RZKH 2HH0H 2X1WL 3LPFA 4W6WB 3KVQA 5E8PB 2BRQA 3MGTB 3VD7A 1KUMA 5KS9B 2OJEA 5EU4A 5IB1A 4YFEA 4NZTL 5IVNA 2DKSA 4YHYC 4LNVA 5LGHL 4NQDA 2WBKA 1IC4L 5I15L 5D5MB 2ICCA 1KENL 4NBZB 4QOKE 5JXAL 4PJBE 2VZSA 1S7UB 2VH5L 1LHZA 3LN5B 2QQQA 3DBXA 5CIPB 5E56A 3OAUH 3CGTA 3U46B 3LPWA 2X5PA 1BFOB 4OKVA 3HC0B 5IQ9A 4BZ2H 5IMLA 1BX2B 5T1LD 1AGFA 2Y23A 5D1XC 4R4FH 1OSZB 2Z8SA 3GIVA 3ILQC 4LCCB 4AL8H 3O6KH 2P5WB 3GSNL 3W9EB 4EUPG 3ZMRA 4ONHB 4OTXH 4QXTB 4IOIA 5IF0A 3MV9E 4HZAA 4UV7H 5C0CB 5BV7H 5EBWB 1S5IL 2R23B 2C3XA 4LSVH 4JPIA 2CGRH 4P9HC 5D7IB 4X6DE 1GYAA 1WAAF 3KPQA 3HNVH 2FEDC 3ES6A 1BFSA 5F9DC 3O81A 4L5FL 3DUSB 4KRNA 4O5LL 4MA1C 1IKNC 4WIQA 4ZNCD 4WI2A 3QUKA 1FL3A 5E8EA 3GSRB 1KCUH 4KJYB 2W9DH 3CCHA 4YUEH 1NMBH 1IBGL 4Y88A 1IM3A 1OARH 1V3MA 4LLQB 3L7FB 4UQ3B 4F2MB 2BP3A 3AS0A 5DVOA 1HCFX 5DMIL 5CSGA 1R5IA 3TT1L 3BPLC 4V1DA 4L29B 1MJ8L 1QA9B 3MRJB 3CPLA 3JXAA 4OT1L 2DQEH 4FQIL 3RWCA 1EFXA 1IGCL 1UACH 2H32B 4WUUB 3T4AA 4JG0H 3U7WL 4YHNB 4R26L 1PZ5B 1OOAA 2OSLA 2VXTH 4EXKA 5HYJD 1LO5B 4JZJC 5KSVA 5ALCL 5DJ2A 5A2FA 3FB5A 1FFNA 1NUGA 1QKZL 1CLZL 1LQSR 4GXVL 4HUUB 1QHPA 5DR5L 1HHKA 1OPGH 1OSPL 1RJYB 2FX7H 2VNCA 5E2JA 4RFNB 2C1OB 3PHQA 2O61B 2X4TA 4X83A 1KNOA 5I19L 4FN0A 2VLKE 3BJ91 4JO2H 1I3GH 2Y5TB 4PJEA 3KPNA 4W4NA 3O11A 1IFHH 3QB7C 4N0CC 4P2OB 3B9AA 1UC6A 1DR9A 2CMRH 1ORQB 4XPGH 4G6KH 2XACC 1TJGH 4F7EB 4KROD 4LKCA 1K2DB 1FZMA 4L9LA 1MRCH 3G08A 5MEQB 2WBJB 4KI5F 2DQHL 2BVOB 4EN3B 2P5EB 2E5EA 4UIKL 1XZ0A 1AXSB 1WBYA 4HCRA 5EWIH 3ROLB 1K85A 2DM7A 1BJ8A 4G8GE 4WW2A 5KSBE 4BSVB 5FCSH 1GOGA 3FQTA 3VI3F 3D2UB 3DX6B 4CVWA 5K93A 4NO0A 1R5VA 5FCUL 5HYIA 2XT1B 1EAPA 5H35B 4KHTH 4XBPA 4NZUH 1WK0A 2CLRA 4NQSB 1I8LC 4OFIA 3DMMC 5DWUL 4F9LC 2R2BB 4F33B 3MOBH 4R4ND 4C54A 1XGYH 4OCMC 2DQGH 5EO1A 3EO9L 1TTGA 5E00A 2ENSA 3C5ZC 1XGQA 4M1DH 1HSAB 4DZ8A 1UWEH 2CD0A 2VZVA 3TBWB 1DJSA 4D3CL 3K2UL 4W6XB 3QCUL 1OCWH 1ZE3C 5I74B 3ZTNL 4MQXC 1IC5H 5T33H 1I8KA 1VEOA 3PHOA 4YFLF 4HQQH 5EOCH 4LASH 1HIMH 1A2YA 5JA9A 1KF9B 1S9KC 5CBAA 4Y5VC 2Z31C 3CMOH 5DHVA 2H6PB 2AEPH 3S88L 2DLTA 4XI5D 1XGTA 3ULVC 4CDGC 1YUHA 2A2QT 2IPUG 2OJZL 2OL3B 4Y19D 5F9WB 1UVQB 4WGWB 2YD9A 2AKRB 4K71B 2MKWA 4OCNC 3BVNA 1MF2H 5JXEA 3IFPA 4UT9L 3MBEB 3LQMA 2W38A 2K3TA 1V5JA 1NCCH 5D7LB 4HS8L 4L8SC 5K9KA 2IJ0C 4FOMA 4EBQH 2GTWA 1ITCA 4K7PX 5IMKA 5C0BA 2G9HA 3FQWA 4B41A 3KXFA 3WCYA 4HK3N 2AGJL 1T7ZA 4ZFFB 4YFLI 4FMFA 1F45A 4PJ7E 3B6SA 3GJFA 4A6YL 4KRPB 1L0XA 4WTWA 3RJDA 1FNLA 1VKXA 3WXWL 4PRID 4P59H 5GJTL 5SWSD 4M9OA 5GISH 2ZJSH 4Y5XC 5L9DH 3CSYA 2CO6B 4K07A 3LKRA 1ZVYA 5IMMB 4NGHL 1WZLA 4MLIA 3AY4A 2N7BA 3LQZB 1KJ3L 4DKDC 5DD1L 4PBWD 2A74A 1FE8H 2VLRB 4AENB 1BD2E 2DQUL 5C6WH 3HUJB 3MRIA 1OAUH 4U6HB 4GRWB 3NZHH 3BSZH 4I0CC 3F7YA 1Z5LB 4AIZB 5E4EB 5F1SA 3FAXA 4HMCA 3BQUB 3GMPA 4U1IB 5D1ZA 3GM0A 1EDQA 1A9EB 2R2EB 4E5XB 3P4OA 5F1NB 4ZXBC 5I17A 3WHXB 2AS5M 4G5ZL 3MRGA 4QXWA 1LO4H 1F97A 4KDWA 5I1DA 4NIKB 3PE9A 4YXHH 3DHJA 3NCFB 4LKXA 3CK0L 2YD8A 2X4NA 3GHEL 4NSKB 3IJHB 2VR9A 5KTEL 3HNTL 4BK4A 3JTSA 3I50H 1UWXH 2UZIL 3IXTB 4LOUC 4LSTL 2BZDA 5CMAA 2QQLH 2PO6A 3ARFB 4U1GB 2MCPH 1BF2A 3AU1B 2NXYB 1NUDA 3FFCE 4YBQD 3TBVA 1JGEA 2VQUA 4M7KL 2F8VA 3HAEB 4ODSL 4OM0L 4FFYH 1NANH 5F6HI 2D7QA 3PWVA 4M3KB 5EBLB 1G7JB 1RAMA 3LKQA 1BIIA 3EOAA 2YD6A 4ORGA 3HC3L 1EEZB 1VADA 2JK5B 5T3ZE 3CSPA 5J3HD 1JPGA 3GSXA 2BC4B 4I3RL 3N1GC 1J8HB 5D1QC 1BFVL 4NZRH 1PSKL 2H26B 3IDUA 1GHFH 3B9DA 4S1SL 2YZ1A 3MSPA 4LPXA 4IM8A 4X6CB 5B22A 4M7LT 3L1OH 5DGRA 1SJHA 4WJ5B 3UPAA 2VTFA 4JZNA 4HPOL 4BKLA 4GAGH 5JNYA 3UBXA 5IEHA 4GKSA 4M6ML 4URTB 5KAQF 1DANU 3G9VA 4K9EC 1X5JA 1NLDH 5KVDL 1T3FA 2P8LA 3OKEA 4NCC2 5T1LA 1KLUA 5EPMA 4KMLB 4ORZC 5T3XH 1E4XL 4KK5D 1XCQA 3TT3L 3U0PA 2YSSA 3QUZD 1OW0C 1QG3A 4Z7UF 4MA8L 5AUMA 1AQKL 1F90H 3TC9A 4OIIH 1WV7T 5HI5C 1MCBA 4OD2A 2DWEB 4H0HB 3UTTE 3RKPA 3WJLA 3QFJD 4KVCH 5C0IA 1IEHA 1P1ZB 1WLHA 2ZKHH 1NBQA 3EJJX 3HFML 5IM7B 2VDOH 3KPPA 3FN0L 4HCRH 1TVBB 4LGSB 1CDBA 1KIRB 1ONQA 2HVKA 3MRRA 5INDB 5I1CL 4EDXB 2NW3B 2NR6D 2X4OA 1F3DJ 1CN4A 5DC0A 3GK8L 3TZVC 1EAJA 3ZE0F 4K94H 1G7PB 2R1XB 2NY1B 3KPSB 2GW5A 2YWZA 1CD8A 4KDTC 1JYNA 1T5XB 5TE4L 4B7IA 1PKQB 3THMH 4MVBD 4L8CB 3QA3B 4Z18A 2NPLX 1TQCC 1N2RA 1IGML 3O0RH 3MUHL 4ZFOB 5D2NB 3MOAH 4CN1A 3RWIA 1MAKA 2FEEL 4D0DB 4XBGA 2QSTA 4LVOC 3VCLB 2XTLA 4LLMB 5BMFL 3LSOB 4NN5B 4POZD 4JRXD 1LK3L 1P7QD 3MOQA 1NCDH 3F58L 1HH9A 3I9GH 1RUPL 1TJHH 35C8H 1LO3L 4Z77A 5HYJA 2NY6C 4KTEH 1NANI 3IDMB 4HXBL 2XA8L 1YEEL 4YK4B 1N64H 4XVUC 5FFLA 5FYKL 3U36A 2GITB 3D0VA 3O6FC 3RGVD 3T04D 4HIIB 1JZ2A 4C4KO 5ACZB 1JFQL 3D3VD 2Z35A 1A64A 3CU1A 4XVTH 4YZFF 3VG9C 5IJVB 3TYFB 4IS6B 4MNQD 4WW2F 1G7IA 3HMXA 1A22B 4GKNA 4JRWA 5F3HA 1DQDH 4FFVC 3WFDH 5JDSB 2Q8BL 3LH2L 1MFBH 3EYQD 5D2LB 3NACL 1YDPB 4DAGH 2GI7A 1L6XA 1FQ9C 3P9MB 5EUOB 3ESVF 4M7JL 3GJFH 1RFDH 3PL6D 4NRZA 2P49B 3LRHA 3FTGA 4R4BB 4IHOB 2FZ3A 4FTVB 1CFQA 2UY7A 2XPGB 1CR9H 2W65A 2YBRA 3QEQE 4KJQD 2YUWA 4PRDB 4WDIB 1UKQA 4DTGH 3SOBL 3U0WH 1XH3A 4CVZB 1AGDA 3NFSH 5FHAH 1IGJB 4LFHD 5H94A 4DKFL 4XVSL 4N68A 4P2RE 3PGFL 1RU9H 4JO3H 1SEQL 1NDMA 1NGZA 3O8XD 5JOEA 1NGYA 4PGBA 3V9FA 3RIFK 3DNKA 3OR6B 2NW2A 5FUOL 1T03H 3V52H 3V0VA 3NIFF 4JY6B 1YN7A 1KLGA 4N90E 3JV6A 3AB0B 2VDML 4ALAL 4TTDC 4MX7A 4Q0XH 1PEZA 3DETD 2C26A 3K8LA 4O4YH 2Q6WB 4PJHB 4KRMB 1SJEB 3D1MC 3MLSL 1BVLB 4U1MA 4XC1L 1J1XL 2W0FA 4C83A 3F7PC 3EFDL 5B4MC 1TJIL 4Y19A 5EUKB 1GGBH 2UVEA 4M8QB 2ZSVB 5GRZA 1P5UA 4OLZH 4WNQB 1N5AB 3VD5A 3QWRD 2VXVL 2DLHA 5DJYB 1OP3H 3UJTL 4I2XA 4K7PY 4MXQD 3RUGB 1AD0A 4U6XA 1MHPL 4Z76A 3B2UD 5TQ2H 5GRXG 3MO1A 5D72H 2J8UA 4P57A 2HFTA 3SE8L 2UYLB 4PB9H 4OSUL 2DI8A 3MODL 3EYSH 2KH2B 1T1ZA 2HKHH 2CKBA 1WEJH 5GS1C 4CUCA 1KFAH 4ZPVB 2I07A 4YNYB 4PR5A 1J05B 4UV4L 3QO0B 3O45A 4OZGF 2YPLB 4PRIA 5SWSA 1TETH 4J1UA 3M8OL 1Z3GL 3H3KA 1C16A 3MRHA 5HHPB 3S97C 1LO0H 4UTBH 1FFPA 2B1AH 3SDCB 3EYFB 2NY3B 1FFOA 1J0ZA 4M62H 2VZUA 5IVZB 5AWNL 4KQ4H 5I1EL 1FL6A 1IGFL 5GZOD 2Y07H 4O2EB 2G2RB 4JFEE 3RX5A 3VXMB 3KYNA 1W2KT 3QDHA 3PGCB 3D18B 2QKIA 3TBTB 3V4PH 3LHPL 3GSNB 2VC2L 3QXWA 4DVRL 4XCFH 2O5ZH 1CFVL 5FA3B 4U31A 2DICA 1BBJA 4PJBB 3WSQH 5C2UB 3NTCH 2ATKA 5E24E 2EXWC 3VRLE 3SGJA 4QNPE 4F15B 2PTUA 5DF0A 5DD6B 1CXEA 3MLYL 3F5WA 2DM3A 4F9PA 1KPRB 4M5YH 4PY8I 2H2SC 1LP9E 5GS0L 1QLEL 1VA9A 3BMVA 5DA0B 4ESKA 5B8CB 1CDUA 4PLOB 3ULVE 4PJDA 2PETA 4Y8AA 1M4KA 1U8LA 2FDBP 3N1FC 3ECBB 3MV9B 4NHUA 4RMQA 2WWKT 1JK8A 3QPXH 3MUGB 3UO1H 3GM8A 2BSED 2V2WA 5JMOC 3ARPA 4NZDA 4O51B 12E8H 3MLXH 5EBMA 5I1KL 5FUZL 4F3FB 2EKJA 3BZEB 4X6DB 2A73A 3HKFA 3MRLA 1G7HA 2IAND 2H3NA 4Q9CA 1HDMB 3X3GL 2ZNWA 3QSKB 4GUPB 4OCSL 1CT8B 1NGQH 4LHUB 3UC0L 4GAYA 4PRPD 3MRDA 5TQ0L 5T1DH 4YDLB 2FYYB 5GXBB 5ETUA 3U30C 4AMKH 1DQJB 5E6IB 4K7FA 3QH3A 4KFZC 2P46B 4Z7WF 1Q1JH 5E2WH 1OTSC 4NKOA 4QT5B 2W60B 4Q58C 4FZ8H 4UINL 5DRNA 4PGDB 4NDMA 3KNBB 3L3OA 3OPZH 4PGCB 3W0WD 1HINH 1YMME 3CH1B 4FXKB 3G5VA 1A6WH 1BOYA 2MNUA 4IRJC 3QUZA 1ED3B 3MLWL 3HE7B 2VDLH 1JGDA 2QSCH 5HYSA 5K9OB 3QFJA 3PWUB 1WFNA 4LPYA 2LVEA 4NQVA 1W0VA 4HIXH 1NFIB 2XZCL 3VXSE 2WV3A 4LCYA 3IF1A 4HC1A 3LAFA 4JFFD 4POUB 1LO2H 4ETYA 4Y5YB 3BH8B 4JFXB 2Q3ZA 3SQOL 4G8GB 5AAMA 5HD8C 1CTOA 4O2FB 5SWZE 1FFQA 2VDQH 3MV7B 3MLZH 2DIBA 4NKMB 2APXA 4HG4J 3BPOC 5KSAB 2XN9E 4ZPTB 1A6ZA 4P2CG 2D4DA 4LDOB 1HHJA 3SHSA 5F3BA 1BHGA 4A2MA 2WWMC 3HPLA 4GT7A 4EQ2A 1JNLH 2IGFH 1HN1A 4P5KA 3T3PE 1EEUA 3G5XB 4LLDB 4RMWA 2OQJA 4MNHA 3TWCH 1MSPA 2XZZA 3TLRA 4TOYH 2O93L 1XGUA 1A3RL 5LQBH 4W6YB 3UJIH 1KXVC 1I9JH 4JRXA 2DAVA 1P7QA 2IPTL 5IBTL 5ISZE 5F7EH 3WUZA 4C56E 2X7LA 2VDPH 2E27L 2I5YH 3DARA 1JRHL 2GSIA 2XWBA 1R0AL 3H9SE 4OD1L 4JPVH 3ZYZA 5CCKH 4PP1C 2XQBH 2JB5H 3RGVA 5L2JB 1YN6B 1DVFD 3L5JA 4D0BB 2J88H 1DQQB 2M26A 4L4TD 3D3VA 1MVUA 2IG2L 1FBIH 1DDHA 1MJUH 1RD6A 3D69A 3O3UN 2DM4A 3JTTB 3PDDA 1N6QH 4JKPL 1VFOA 3HLAB 5EULV 4MNQA 3MRBB 5B38A 1M1SA 3RZCC 3K8KA 5DJ0B 2V9QA 5GRJH 2XKNB 1CBVL 1U42A 3HR5A 5CILH 5F9JA 3ULUC 4YX2H 1A1MB 2CLZB 4OLWL 1GSMA 4HWBA 4KAQL 5DQDL 3FJTA 4G8IA 4TPRH 2ATPB 3RVXC 3IYLW 2UWEA 5C09D 3PL6A 5ANME 2BVPB 4PYHA 3GGWB 3FN9A 3MRMA 4JGJA 5JHDD 4EOWL 2XWTB 5EOTB 1BQHA 1TQBB 2CQVA 3MZGB 2P45B 4PJ7B 5A16A 3EYOA 1A1NA 1EEYB 1KJ2H 3LS5H 4H5SB 5C1MB 1A1OA 3L3JA 2ADGA 4XNUH 4UAOB 2C1PB 3E8UH 3WFCL 4HD9A 4WHCA 1E28A 4FA8A 5KVMC 2YR3A 1DLFH 4ELKA 4ZDHB 4DQOH 1I8MA 5CJXC 4N9GA 3O8XA 1KCKA 4G6AC 1RPQA 1ZA6A 7FABH 1E6OL 5ICXB 5FYLD 1NGXA 5TF1H 8FABB 4YHOH 3L3GA 2CIIB 1MIMH 1MCOL 4XCCL 3JSSA 2PTTB 4LVNC 2JELH 1OAKL 1S78C 1BD2B 1S8DA 4NKDA 1EX0A 1KTRL 1J12A 4FG6D 2ZCKL 4X4XB 2FD6H 2YXFA 1RZ8A 3CJJA 2H8PB 5DHYB 4S0TD 3DRQB 4LVHB 4MMZC 3WFHA 5CLWA 5IQ7H 2ICWB 5JOPE 1IAKA 2EYSB 3OF6D 3TH3T 1RIUL 3O6ML 4WHTA 4PJAF 4U1SB 3OKOA 4MAYB 5JMRA 1J11A 1PYWA 1OGAD 5J12B 4N0UB 2NXZC 4OZFG 4U0RB 4YE4L 3QQ3B 2HVJA 3MJ8B 5E94B 5KVGH 1VFAB 3QWRA 1P4LA 4QHLA 3W9DA 1AIFB 2FX8L 1G7QA 5E8OB 3LMJL 3MJ7A 1GVIA 4O58H 4X0KA 2ZCLH 4NC1C 1KB5L 4AJ0A 5LBSH 2HJFB 4Z0XA 1A7QH 3VE0B 4LPWA 4PJXE 3IAGC 1NMCC 4OKDA 3GB7A 1EBAA 1YA5A 2H1PL 2KBGA 3FFCB 3GMQB 4NM8H 5J13B 4JGMA 5MERB 4TNWK 4BH7A 4ZSOA 4DW2H 4CMMA 5MP6L 1UKSA 2CK2A 3ME0A 1CDYA 2C4FU 4QGYA 4RA3A 5EZOH 2NNAB 2PXYD 3RX8A 2F5AH 3TA3C 2GYSA 5JORA 4HFUL 2BFVL 5IGXH 1IAIH 1YJDH 5TFSL 2AJVH 3ZKXB 3PNWA 1NL0L 1INDH 3DV6B 1J0HA 3FB7A 1RZKC 1CD1A 4ZODA 4IMKA 5TDOB 2AK4D 4DK6A 4OLUL 4H1LH 1ZA3A 3A6CL 3U1SH 1KC5H 4R0LC 1W72H 4BSJA 3VFWB 3K81A 3QI9A 4U49A 1XGRB 4XZUB 3OHXB 3UROR 3A67H 3H9HA 4HIJB 3UZVB 1HOCB 4HJGB 4DVBA 4OGAD 5C0AE 1MH5B 5E6ZA 2GJ6D 3MRKB 3VXRE 2IBBA 1F6FB 1CE6A 2Y06L 3BDBA 2IEPA 5DUBA 1KCRL 3LEXA 4KY1H 5DI8B 2LU7A 1AY1L 4GG6E 4MCZA 3UDWC 2OTUA 1RMFL 4LLWA 5E2TL 3MLPA 4QO1A 3ARED 3DJ9A 1IL1A 2NLJA 4ZS6C 3AS3A 4XT1C 4HAFA 2IANA 3HZMA 5FHBL 2EEBA 5IIEB 3T1FB 1CFTB 5KJRL 3PDOB 3ARDD 2OMBA 3S3PA 5BV7C 1G6RA 4YH6A 3QUYD 4N5EC 3BIAX 3MACL 4PJ8B 5TH2B 4PRPA 3SE3C 1BECA 3HMXL 1KBGL 1NCNA 1ZHNB 4ZO6A 1IQDA 3V0WH 1MFCH 2W91A 2K1MA 3GSOA 3VRJB 1CQYA 4MXVE 4UIMA 3BEVA 4KI5C 3O3AB 1UWXK 2QQKH 4DGIL 4I9WE 4U1JB 3U7YH 4P46C 4ZD3H 5J1AB 3QNXA 1REIA 3ZT7A 1MCEA 3Q6FB 4RMRA 3WJJA 5IBLC 5IOPA 3O2WH 2ADJB 1NKRA 4YHYB 2D3VA 3BRDA 3W0WA 4ZYKA 1U92B 4OUOA 2C7UA 3MJ9L 3MROA 4OD3H 3TN0D 2W9EL 4K7PL 3W82A 1BJ1J 4RMSA 1FVDB 5C0DA 2JCCA 3QO1B 1IAII 1S7SB 4PJCB 1KIPA 3RX7A 4G9DA 1S7XA 4NNXA 4PRAB 4Y1AE 4LQFH 1T0NB 1T0MB 3SBWA 2EYTB 4LCWE 4OFYD 1UZ8B 2BSRB 4JFFA 4XX1E 5H37H 4C58B 3QJHA 1ZHLB 1ZT7B 2XG5A 2RHEA 3H6JA 5FECB 2D7PA 5BS0D 4OM1H 1MJJB 5DEZA 1FRGL 3QJFA 3RWHA 3SDDD 5JR1L 2R1WA 3GBML 3VFSB 1UYWH 1MNUH 2MCG1 1UM6H 2EIZA 4AEIL 4YXLH 3GMOA 1IGYB 4HIHA 3VFRA 4J3VA 4MA1B 5I1JH 3WO4C 1NGPL 5M7QA 5SWQA 4WTZA 5DFTA 2D9QB 1Y0LB 3MMEA 5C2BH 3HNSH 4BZYA 2VLME 1H8OA 4CN4A 2CRMA 2LAGB 1K4DA 3MYZA 1R3LA 1CK0L 4BQBA 2ORBH 5MHSE 3C8KB 3O3BA 5I66B 2GTZB 3VRIA 4XNZB 1A6TA 4S1RH 3QRGL 4R3SB 5LWYL 2HKFH 4MJID 3H3PL 1CXLA 1I1FA 2W07A 4UDTB 3SDAC 1DVFA 2H2PC 5LAXA 3QIUA 1FN4A 2BRRL 2VLJE 4L4TA 3LEYH 3L3HA 2HFEB 4JZJB 4BA8A 4XP9L 3KYKH 2IH1A 1D7FA 4AYFA 1U8MB 4NUJA 2Q8AH 3FB8A 1PJ9A 4KUCD 2VSCA 4JDTL 2FR4B 3WL9B 5C0GA 1QFOA 3F12B 1S9YA 5I71C 1E4WH 3FQUA 1YEJH 4PG9A 2NX5D 1KTKE 5IHZB 3DROA 3DSFL 3OZ9L 2XV6B 4X4YA 1ZHBA 2XY2A 3IU4L 2FWOB 1G9MH 2NY4D 5C08B 2IAMD 5C9KA 4QRPB 4OCRH 5C09A 4XGZA 3U2SA 5I1HL 4LQ1A 3LKOB 5JHDA 5AEAA 5I1LA 5J6HB 4LLUB 3AGVA 1D5ZB 15C8H 3SPVA 3VI4E 4TVPD 1JPSH 1UA6L 2GKIA 1K3ZA 1YNLH 3BI9X 2DWDB 4GS7C 3MNZB 1F2XK 4WFHD 1AXIB 3BO8B 1OD9A 4X7FC 1A7NL 2NY7H 4HK3J 4HBCL 4GMSL 1ORSA 3TO4C 4EI5D 3OKYA 3DMMB 5E9DB 5IT2L 5HVFB 1QYGL 1BM3L 1I7TA 4X80L 1L0YA 1P2CA 4OCLC 5KZCD 2FBJH 3EHBC 3NGBC 4CJ1A 4ONOA 3C5ZB 2HT3C 3L5WA 1QQDB 3MFFB 1FAKT 4KGJA 3O4LB 4PGEB 4HZLA 3NFNB 4RMTA 4C55A 4PTTB 2Y36H 4OZHA 5D7SL 4ENED 3OF6A 3RAJL 4LSSL 2WBWB 3KR3H 5EZJA 1OGAA 3V5HB 4XMPL 1AR2A 1LP9B 3AMLA 4ZG1A 1LILA 1L9NA 3C9NA 4Y5VB 2JIXB 4J3WA 3I6LE 3ZDYE 2IH3B 1Q94B 1D9KB 1U0QA 2F54E 3G6DL 1UM4H 1KT2B 1K4CB 5J7CC 3T4YA 1MQ8A 3ULUE 3LQAL 4JO1L 1WJ3A 2YN5A 4I4WA 2HWZL 4Q6IA 3QCTH 4L8SB 5DK2A 2ZUTA 1JZ8A 3NABL 4MS8D 4PB0H 4PJFE 3U4AA 3WE6A 1YNKL 3CLFL 2EE9A 5TPWL 4XNQB 4CADA 1IT9L 1DSFL 4PV9B 5CEZE 2EDBA 2PXYA 4U2YA 3LKNA 3NA9L 4Y4FC 1H3TA 4S11A 3HZVB 1OVZA 1NDGB 4XWGL 2YMXH 4YR6A 1OP3K 4Q2ZA 1A7OL 4HC1L 3EO1B 1FP5A 3BWUC 4OLXL 3MCLH 3OKMA 5HPOA 3EZ8A 2F53E 2AK4A 3EGSA 4PTUA 3GIZL 4Y2OA 4Q9RL 4JHZA 4QF1B 4A2LA 5AD0A 5CKGA 5HGAB 2WP3O 4X9BA 4CGTA 2NYYD 1XIWC 1YMMB 5KSUB 4GRLD 1FO0L 1SEBB 2VIRA 3U7AA 5EOQH 1VHPA 2GJ6A 2DQTH 3LEVH 4Y4HD 3D25B 4IJ3C 4JJHA 3TV3H 4OAWA 1HQ4B 1BGXH 1N59B 4ZXBB 2KZWA 5F96H 5FXCH 2CRYA 4RWHA 5GIRB 2BNQE 2BNRD 3KLDA 3VG0H 3VXSB 3AREA 5L7XL 4KJWD 5FDWB 3R8BB 1DFBH 2ED9A 4NC1E 4ODXA 1B4RA 4L3EE 3KPMA 1IC1A 3PP3H 3ARBB 3VFPB 1QSEE 4H20L 4ELMA 2OK0H 2FGWH 3ARDA 1JF5A 5B3JE 3F7VB 4EDWL 4LMQI 2WNGA 4FQHB 2GK0B 3QNZB 4WW2C 1CU4L 3C60C 1CI5A 3G6JE 1IAOB 5T5NG 3E1F1 5DK0A 4G7YH 2DRUA 3BGFB 4Z7QF 3OXSA 1HZHL 4L3CA 4OV6F 4NKIH 5JO5A 4K94C 1LK2B 3CFJA 4CL7A 4I18B 4HWBL 4IRSD 1DBJL 1FGNL 2EKSA 4OLYH 4M93B 4NT6A 1ZLUH 5ISZB 1WAAE 4Q6YA 5D1QB 4F7CA 2NY5L 1PLGH 4QRRE 1U8JA 5E95B 3TN0A 3MGOA 2HLFD 2J12B 3NFPA 3DX9B 1XCTA 4JDZB 4JM2F 3BGAA 3P4NB 4OZIF 4TSCL 1FG2A 1UXSA 1S9WA 4R7DB 1GPOL 1AR1C 4Z95H 4OFVA 1VERA 1H9VA 3KPRE 5DD0L 4D9LL 1NLBL 4JFYA 3MV01 3Q3GA 2SEBA 2ZPKH 4IDJL 4JVPA 1RZKL 1EVTC 1BLNB 4OFYA 2NTFA 2JJVA 1FYTE 1A4KB 3RWDA 4WY7H 4OLVL 1CCZA 1FZKB 1AFVL 1JHTB 5BS0A 1RUQL 3L9RA 1MPAH 2FJHA 1ZGLP 5JXEC 3SDDA 1X7QA 4JM4H 4YHML 3ZE1E 4F8QA 2Y6SC 4LPTA 3WNNA 2F8OA 3TZVB 4WWKA 4H25B 4K3DH 1J87A 5CS7A 3IT8D 3BDYL 5F21B 4M6AA 3GZKA 3JV5A 2BNUB 1VACB 2P5WD 5IWLA 4LCIH 4KI5E 4YIQB 5FV1L 4I3SH 4JGUA 4LF3A 5IFAH 1QBMH 3KLSA 2DM2A 3GSUA 4LVOB 4ZUWB 1WC7A 5C0CD 5FO9B 4MJIA 1TZHB 4NM4H 3NN8A 4ZTPH 4OGZA 1Z6JT 1YC8A 3OKDB 3PP4H 2CGRL 3VH8A 1CL7H 3O3DB 1KB5B 3NZ8B 2NY6B 3MNVA 1A3QA 2X9YA 4ERSL 1LNUA 1OTUC 2DL9A 3LDBB 1BQUA 4K3JH 1GAFH 3O6FB 1OP9A 3BPCA 3KPOB 4OF7A 3T0ED 2IADA 4NRXB 4Z0BL 1WWWX 2E6PA 4JN1L 5CEXA 2NX5A 1HXYB 2G75B 4ODHL 4K23H 4HGWA 1JJUA 3IFOA 2C3HA 3F65A 5HHQB 1ULVA 5HGHB 4KKLC 1INQA 5E2VH 2HRLA 5AYUL 2IAMA 3VXTA 2DQEL 4WUUD 5LGKA 4JG0L 3CC5A 5INCB 5CINL 3QDMB 1OAQH 4PS4L 1TPXC 3CDCA 2PO6C 3FQRB 5CHNA 1P84K 4BSWB 1NMAH 1NEZB 1G1YA 1ZS8A 5ITFA 1N0XH 1NFDF 2WSKA 5DJDB 2JF1A 1VFUA 3NCJH 2FX7L 4J8RB 2ZCHL 4KJPC 3VXOB 4EI5A 1MCNA 2OR7A 5F8RC 4OIBA 4P2OD 4DKEL 2NY2D 5J1TC 1CGXA 4XNMB 1M6OA 3QUMA 1CGUA 1IFHL 4WW1B 2VLLB 4OFDA 1G6RL 4G6KL 1CIUA 1UWGL 3JZ7A 2WBJD 5JTWA 3WUWB 4EN3D 3N85L 2P5ED 2VXSL 4IEFB 3K4ZA 3X12B 4FQJH 1E27A 5F9AC 4TUJB 3M17A 5EU3A 4HV8B 2R4SH 5GGRY 4QXGL 3LS4H 4P0DA 4P2QB 1QEWA 3D2UD 4YFDB 1I9IH 2AJ3B 3DSNA 2HN7A 5DRZB 5I0ZA 2WINA 4ZUUA 3VXRB 4QLRA 3OQ3B 3FT3A 4NWTH 3UYRH 3JV4B 2ZZUT 4KXZH 4YWGL 1T7VA 2NZ9D 4GKOA 4N0YH 5JHLH 4GG6B 3CVHA 1JWUB 1L7TH 1CL7I 4GAJH 4M61A 2WIMA 2DQCH 1H5BA 4JKKA 2EIEA 1HH6B 1IEBA 3CZFA 2XRAL 4RGOL 1RULL 1XR9A 3SDXB 3I02A 1ZVHA 5F7MC 3D85B 1L7IH 1IC5L 2BY0A 3C08L 5ACLA 5GSRB 1B0GA 4HWNA 4XMLH 5FKPB 3RY4A 2X9WA 4KZEL 2VDRL 4JFHE 3EOTL 2B5IB 4UNUA 3IDGA 1WBZA 5BVPL 2RFXA 3ILPA 2BSTB 4YGAB 5F93C 4IRZH 2KZ1B 1BAFH 1FAIH 2V17H 3FB6A 4YPJA 3CFDA 3MBED 3RBGA 3V8CA 5D7LD 2DKUA 4FABL 1TCRA 1NCCL 4HWEL 1K8DB 5KN5A 3TIEB 4GRLA 5GGSA 3NAAL 3TNNA 1JGLH 1U2CA 2R69H 4NO2A 2XICA 4Y4HA 4KRPD 3DPBA 1AGCB 4AH2A 1YYMH 3VFMB 2DMKA 3AC0A 3SY0B 3WIHA 4QY8A 1IGTB 3O9WB 3TBSB 4LRNL 1QBAA 1T4KA 3GMLA 2BNRA 4RIRB 4Y1AB 5E8DH 4X6FB 2HFFA 4X4MA 1D5IH 4ELMF 1PZUB 3PHSA 4MA7L 3K0WA 3S4SB 3C2SA 2CDGA 1MCIA 1CFSB 2AI0H 3V4VL 3BGMA 4LCWB 1Q9KA 1NAMA 3P9LA 2OZ4A 3RL2B 2VLRD 4U1HA 4KROC 2B1HL 5FO7B 1CLOH 1R3HB 5DQJA 3EYVA 2YZ8A 3OAYK 3IGAA 4MMXC 5HHXL 4AT6A 1GXEA 3C6LB 3TNMB 5EC1B 1OAUL 1CF8L 2BJML 2B2XL 1C1EH 1Q9WB 2P7TA 3BQUD 4Z7UE 4NJAL 4KXZI 3T08A 4S1QH 1JPTH 3L5XL 3DHMA 5F7HA 3PIQA 3GJEA 4U6VL 1R3JB 4K2UL 4JHWL 4XNYL 4YDIL 4E41D 4IRSA 3QXAB 1T7YA 4JDVB 4XAKD 3T2OA 4YXHL 3IFLL 2DQDH 4NN6B 4R4NC 3U30B 3CX2A 3BZFB 3A6BL 2Y1VA 3PV6A 3QEUB 1CICB 1VDGA 5DEGA 1CLYL 3FO9A 3I50L 3LRGA 3TFKC 3ARFD 2I24N 1UM5L 4J6RL 1UQSB 2IMNA 3QWOB 4WI3A 1ZLVK 2MCPL 4ETQA 5FYLL 3P40A 2DBLL 4S1DC 2CLVB 3O2VH 1QR1B 2BCKA 4XAWH 4IRJB 5B39B 2DI7A 5E8PA 2HT2D 3MGTA 1RZ7L 5KS9A 2EZ0D 2XTJC 2N56A 4XI5C 2KDGA 3VXUE 1J8HD 5T3XE 2WM0A 4G8FB 4KU1A 5DGQA 5D5MA 4PJEE 2C3GA 4YDKH 4XXDB 5IB5B 4MQ7B 3BUYB 1S7UA 1G9EA 4NQEE 3NCYS 3P2TA 5LCVH 3LN5A 4JR9H 4XP5H 1T04B 2D9CA 2QTEA 5CIPA 5EZIL 5DTFA 4YZFE 3U46A 3E2HC 5I73C 1VGEL 4X9HA 1BFOA 4O02H 2W0LA 1EFQA 1BX2A 1LDSA 3GRWH 2JB6A 1AXTL 1OSZA 4M9PA 4LCCA 2FCBA 1RVFH 5JUEL 5CKAA 3SE4C 2VE6B 1S7RB 2P5WA 1CDGA 4ONHA 2AJXH 2FB4H 4U2ZA 5C0CA 1NBZB 2B0SH 2D7MA 3UJJL 4X4ZA 5EBWA 2R23A 4FP8L 4N8VG 1EHXA 5D7IA 3T2NH 1CDHA 3G9AB 1RZFH 2Z92B 4L8BB 5T5FH 4XP1L 1T66C 5ICYB 4QHUB 2VUYA 5DC4B 2VXQH 3DUSA 2G5BB 5ACMA 1FH5L 1ZSDA 5GGUA 1G84A 2NY1D 3H9YA 3GSRA 1AE6H 2VXUL 4KJYA 5CP7B 2Y9RT 3PWNB 4M00A 4NCC1 3T0EA 1FCGA 2B4CL 4LLQA 4UQ3A 4F2MA 4ODBD 3CVHH 3M45A 3MRJA 2F54B 3RZCB 4G9FD 1MWAB 3NIFE 1IGIH 4XWOD 2H32A 4WUUA 3NCYP 2D31B 1A7RL 4YHNA 4UTAH 1PZ5A 4XPFH 3IETB 1QBLH 4TUKH 3SKMB 5D8JL 35C8L 4PJFB 1T83A 3V79C 4PG2A 4HUUA 4M6OL 1RJYA 1FNAA 1I3VA 2C1OA 4YBQC 4HKBB 2APFA 1H3UA 2AEQL 1K6QH 2O61A 1A3LL 3KXFE 1NUFA 1A9BB 4QRUA 1RHFA 3OAZH 3J7HA 2VZ3A 3STLB 2Y5TA 3CXHJ 5F8QC 3RI5F 5J89A 4P2OA 4U6YB 1ZLSH 3MRPB 1ORQA 5J3HC 4F7EA 3O2DH 5JW3H 2F53B 1K2DA 4HW6A 2XZQL 3VD4A 4F7TA 4F7MA 5MEQA 2O5XH 2WBJA 1C5CL 3B5HA 5GGVY 2BVOA 5KAQG 4EN3A 2P5EA 4LVNB 1AXSA 1YJDC 3OGCB 3ROLA 3WFDL 4G6FD 1JP5A 3WIFB 1MFBL 3FCTA 4P4KD 1PVHA 1MFDL 2D7OA 3ZKMD 4NNPH 1DQML 2AJSH 2P44B 4OZFA 3D2UA 3WNMA 3DX6A 1JMXA 1WZ1L 3JWOH 3WIHH 1K3IA 1U8IA 2APTA 5H35A 4F7PB 4OCYH 4KZDL 4NQSA 1BIHA 1T2QH 1FLTX 3G5YB 1A6AB 4KK5C 2R2BA 3QUZC 4F33A 4HJJH 3FO0L 5E2UL 1SMAA 2NXZB 2BNQB 1NAMH 3GBNH 1RU9L 2OZ4H 3IDYC 2YOCA 3CD4A 3GFUA 1HSAA 2ID5A 1JNHB 3TBWA 1KYOK 1FV1B 5J11C 4HXAL 4NZJA 1M05B 2YRPA 1EHAA 1BP3B 1OL0A 3V52L 2YPVL 3ARTA 1NMCB 4X7DC 3GMRB 3S35X 5IROA 2MHAB 2ICWJ 1A5FH 2A6IB 1YEGH 5IBUG 4M7LH 2H6PA 4HS3B 2Y7QB 3OTTA 2ESVB 2VYRE 2OL3A 1UVQA 3VMOA 1OGTB 5HI3D 3TEUA 4R8WL 3I6GA 2V6HA 2E8YA 1QFWH 2KQMA 3MBEA 4JFOA 4JFZH 2IWGA 5D7LA 3TH2T 1QOKA 2D0GA 4QRRB 4WFGD 3S37H 5EZLA 5BVJB 1LDPH 3FO1B 3VFGH 4HUXB 1X5XA 1E6JL 5TQ2L 4R0LB 4ZFFA 3U48A 2EC8A 1KFAL 3CFEB 1E4KA 3RGVC 2ZOLB 3DUUA 4UQ2B 1T1YB 2YPKB 5IMMA 3DV4B 4TULL 3QQNA 3D87B 2VLRA 3A0OA 3OKNB 3VXMD 5FGBC 2A9MH 3VGFA 3HUJA 2NCMA 4U6HA 2PR4L 3EYQC 4U1KB 4RWYL 3V4PL 1P6AB 1V7ML 1Z5LA 4UMGA 3E6FB 5CIPH 4AIZA 3BN9D 1BZ9B 3BQUA 4U1IA 4HEPG 5ESVB 3PL6C 3VXQA 3OR7A 3O4OC 4P48A 5HDQH 1N3NB 2DQIH 1G0YR 4Z7OF 4OBRA 1A9EA 1KN4H 2R2EA 4OQTL 1WTGT 5F1NA 4E5XA 3WHXA 3W2DL 1RZJL 2BVYA 1F4XH 4KJQC 2QHRL 5ID0B 3ISWA 3OXRB 3QCVL 2BVTA 1TXKA 3MR9A 4JREC 4WGVB 2ERJB 4GRMB 3IDIB 5IR1B 5JPNB 2F58H 3FQNB 4NSKA 1P7KB 3IJHA 3PP3K 1YYLH 4I48B 3O8XC 3MV9D 2OCFD 2V2TB 2F9BT 1CE1H 4XC3H 3SE9H 5FYKU 3ARFA 4R90H 1KLFA 3AU1A 1MUJB 4KHXL 2EDYA 4H0GA 3SO5A 1MHEB 1G9NH 3HAEA 1PQZB 2V7HB 3K4DA 3T2QA 5HYJE 3FT2B 1T89A 4LHUD 4R7NB 1IZKA 1QFWI 1G7JA 5EBLA 3QUML 3C6SB 3RNKA 5D5MF 3QNYB 1DL7H 4FQLH 5D6DA 1ZLUK 3KLAB 2JK5A 2RBLA 1JGVH 3GI8L 4RGNB 2BC4A 1J8HA 5E6ID 3FMGH 2H32H 3MUZ1 3BZ4B 2H26A 5GPRA 1OD7A 5F7FA 2CRZA 1ZOXA 3K80A 4DCQA 1JHLH 4X6CA 4MXQC 3MLUH 3S5LG 1XR8B 2P8MA 4QHKJ 3QXDB 4WJ5A 1LE9B 1HK6A 2F74B 2DQFB 3BE1H 5C07E 3TPUB 5IB2B 1G9MC 1MREL 4LSUL 4ODVL 3GHBH 4OJFL 3GKWH 2R0LH 2X6MA 3U9PH 5D70L 4IIQC 3WS3B 3DXAD 3WO4B 2VDLL 4G42B 2DWEA 3IRZA 4MD0A 3DX7B 2XZAH 2A6JB 1P1ZA 2LTQC 4PJ9C 3LIZH 1QRND 4LAQH 3WS6C 2WZPD 5IM7A 1DEDA 5GZOC 1TVBA 2CPCA 4YHZH 4YDJB 1UH3A 1KIRA 4AQ1B 5I16B 2HMIC 5INDA 4EDXA 2CXGA 2I60L 2IQ9L 2NW3A 4IMKC 4OZFH 3X14A 5FGCE 1LO2L 4E9LA 3MV7D 3F62A 1G7PA 3PWPE 1RURL 2R1XA 3SDAB 1EMTL 1F58H 4UOJA 5KSAD 3ARGB 4LP4A 1T5XA 2KPNA 5HHVL 2BSSB 2UVFA 4L8CA 4MAUL 3QA3A 3VW3H 4M1CC 2MSPA 3DTXA 4P3DB 3HZYA 4ZFOA 3B2VH 5BZDB 1FORH 5D2NA 3CX5J 3RL1B 4D0DA 3VCLA 4WV1B 4LLMA 2PNDA 5IV2B 4X7SH 1P4IH 4TOYL 4LBEB 5TE6H 1RUKL 2IPUK 5LQBL 4P4RB 3V5DA 1I9JL 1WCQA 4N8VB 1UT9A 4E0RB 3IDMA 3MJGX 4WI8A 2VDPL 1NSNH 4I2XE 3KYOB 3DURB 4PJAE 1XGPB 2GITA 1DEEB 1A14L 4HIIA 3UTPD 1GC1L 5ACZA 2ICEB 4O9HH 3I3EA 1HWHB 4AG4L 3UBXG 5F7DB 2QLVB 5IJVA 3TYFA 4IS6A 4RNRB 5DJ8B 5D93B 4I0PD 4FQXB 3WLWD 5AZEL 5GGQL 5FV2A 4PRIE 3C5JB 2X4UB 5SWSE 1J0YA 3T0WA 1MQKH 4PP2B 5I18L 4FQCH 4WTXA 4O2CB 2XY1A 4XCNB 5D2LA 3C5SB 1YDPA 5MENB 2DLIA 3BP7B 3EOBA 2YC1B 3P9MA 4P4KA 3ZZ1A 3WJJC 1SY6L 5I76B 4NQUA 3AROA 4R4BA 4IHOA 4JG1H 1AKJB 4G43B 1EERB 5GRUL 3T09A 2VKWA 4WDIA 4PRDA 4J23A 4WEBL 3RP1A 1KIUA 4LPCA 5I8KH 4CVZA 4ODWB 1IGJA 4XRCB 3DBXB 5CJOH 3U4BH 2J6EL 1DLFL 1IEAB 4YHKL 1EHLL 1AGFB 7FABL 1KEGH 3ZKND 1ZANL 3OR6A 1HNGA 4GFTB 3AAZB 4JY6A 2Q86B 1YEIH 4P3CL 4FQQB 1A6VH 4APQC 2WUBL 4OI8A 2FD6L 2Q6WA 4PJHA 3VGAC 1SJEA 1YZZA 4Z7UB 1BVLA 2YRZA 1MFEH 1FHGA 5EA0L 4WENB 1Z0MA 4RZCB 4MAYD 4NWUH 4JE4B 1MI5B 5EUKA 4Y4FB 2E7LA 1QLFB 3HB3D 4LRIA 4M8QA 2ZSVA 2IFFH 4WNQA 5CZVL 3WLBB 5ADOL 2R1YA 2WQRA 1ZEAH 2AVGA 1E0OB 3RUGA 2ZUQB 3BKML 3VDAA 5KBNC 2X4QB 3RWGB 5CBEB 4M43L 2YUXA 4J12A 5FM8A 1AGBB 2UYLA 1RK1B 3HMWH 1B6DA 1WWAX 4LLYA 1ADQA 4CU7A 4AY0A 1A7QL 5I30H 4ZPVA 4YNYA 3AFLA 1I4FB 3T4AB 3QO0A 2PYEE 1EGJL 1X44A 1EBPA 1XIWB 1V8HA 3SJVB 1DVFC 5HHPA 3OB0K 4G80B 3EDKA 5CJQL 3KWWA 3ZTJG 5HSFA 5EZOL 3SDCA 3EYFA 3HUJF 3JWDL 3FB5B 1FFNB 2F5AL 4IJ3B 4MZ2A 5IVZA 4FQ2H 1DBBL 5BQ7B 1GCFA 4ZUSB 2WUCH 3VXUB 2X4TB 4O2EA 5IGXL 2G2RA 3QPQD 4G8EB 3VXMA 1I8IB 1B0WA 1U93B 3PGCA 3D18A 3PJSB 3GSNA 1NCAH 3QFJE 4JFPA 2H9GB 1NBVH 4N1HB 5BRZE 1N4XH 5FA3A 1T80A 1BZQK 2BDNH 4U7SA 4NQEB 1J1OL 1IQWH 3ZLQC 3VGEA 3UAJD 1FZMB 5HVWA 5DD6A 4UNTA 3BKCL 1KPRA 5GGVL 2BERA 3A67L 1D5BB 3C60B 4J2XA 1BMGA 5B8CA 2X4PB 5IW6B 5ABDE 3WKML 1H8SA 1W0WB 2YK1H 2COQA 4TQEH 4D9RE 3BH9B 4HG4K 4TSAL 2D2OA 4XBPB 2EH7H 3ECBA 3MV9A 5KW9H 4O51A 4F3FA 3BZEA 4QWWC 4X6DA 3EJZD 2J5LC 3EUUA 5E00B 5E99H 4JRXE 4K3EL 1QFUH 1HDMA 3OKKB 5IESH 3BPNB 4F58H 3L7EA 4GUPA 2Z93B 1CT8A 4LHUA 1AHWC 4PJ8D 4Q9QH 3FKUS 1VFBB 2FYYA 2P8PB 1EA9C 3V0WL 2GY5A 3R1GL 2BK8A 3CXDH 1DQLL 5FYKD 3WNLA 1DQJA 3BISA 3D3VE 5E6IA 5IW1B 2KL6A 3HI1B 3QHFL 1M7DB 2A77L 1UJ3B 3H8NA 1EJOH 1Q72L 1KEMH 4QT5A 1YUHB 5GSVB 2W60A 3U4EB 3KJ4C 4PGDA 4DN4L 2DDQH 3KNBA 3I84A 4FXLA 1MCPH 4P23D 4PGCA 5FO8B 3MV8D 5MEOB 2X10A 4OGYH 3IFPB 3CH1A 4QCIB 4FXKA 3T8XB 3BKJL 1NC2D 3L5HA 3FONB 2IPKB 5C70A 2GTWB 1ED3A 4KI1A 3HE7A 4R97C 5HGBA 1HHIB 4DZBB 2PXYC 1GZQB 5I8CB 3PWUA 4LSQH 4J7RA 1TIUA 1P4BL 1KTDB 1PBYA 4KGLA 3BIBX 2YD1A 2GQHA 4XTRD 4Y16C 4Y5YA 3BH8A 4JFXA 1QLRB 4JY5H 4G8GA 4O2FA 4OZGB 3MV7A 2CSPA 1UH2A 5BZWB 1TNMA 2PKDA 5EBGA 4C4KT 1MCHA 5KSAA 2OL3L 2FEDD 5GJSH 5F44A 4RMVA 1Y18B 5LXGH 4X9GA 2EC9T 3NPZB 4DEPC 3F7YB 4YXLL 1W8NA 4XCYB 4OGAC 3D39B 1N7ML 4EJ1C 3HC4H 5IG7A 3G5XA 2R4RL 4LLDA 2R9HC 3RI5K 3R0MA 4G7VL 3V95A 1CDIA 1YMHB 3HNSL 2P43B 4OIAA 3AREC 4LKXB 1MJ7L 2BVEA 2YEZB 3S36H 1DBAL 4N90D 3QHTC 2OP4H 3WD5L 3X3FH 1JYWA 3WDHA 4JQVC 5L2JA 3JTSB 1AO7D 1YN6A 4D0BA 3CSGA 1WCBB 3CDFA 1U2HA 2L7UA 4TSBH 5CMAB 4J3XA 1TPXB 1X5HA 1B9ZA 3QUYC 4U4BA 3JTTA 3JVGA 5I8OH 3HLAA 3IU3B 3Q5YA 3UCRA 3BXNB 4X5WB 2I9TB 1JWMB 3K46A 4WHYG 4DK3A 5DJ0A 3FRPA 4ZSOE 3WXVL 2XKNA 4MXVF 4KDVA 2AQ2A 3IFNL 1E4WL 4Q7DA 1YEJL 4X9FA 3T65B 2CLZA 5HYSG 3EOAB 5I6XB 2KQNA 5C08D 3S37X 2ATPA 4QRPD 3GSXB 3B9KB 2BVPA 5C7XL 3BT2L 3FRUB 4EVNA 1TDQA 5LGHH 2XWTA 1J1PL 1IC4H 3GBLA 4PD4K 5I15H 4POYA 1KENH 1DANT 1T6VN 5JXAH 3OAZK 3TN0C 1EEYA 1HKLL 3V7AE 1PFCA 4H5SA 2VH5H 4JLRB 1BVKB 1LD9B 1F4YL 1G1CA 5EH1A 2RCSL 4GKSB 3BP5B 4ZDHA 1PY9A 4Y4KB 1X6LA 4L4JA 1OB1B 4Z7WB 5ICXA 1T3FB 3DMMD 4OB5L 5E9DD 8FABA 2NY7L 4V1DD 2CIIA 3GSNH 5FB8B 1AI1L 2PTTA 2FECL 5GS0D 1UENA 2J4WL 5GGRB 3C5ZD 4JVUA 3L3KB 4LMQE 4X4XA 1G0XA 5C0IB 3O4LD 5FYJL 2H8PA 1KTLA 4LIQL 5DHYA 2VZTA 3DRQA 2ICWA 3SDDC 3KPPB 2EYSA 4G6ML 3LKSA 2VITB 2HVKB 5ICZB 4L5FH 4U1SA 2IANE 2AXFA 1HHHB 4MAYA 4O5LH 5A43C 1MRFL 4N0UA 4F37F 2X4RB 1YEHL 1U8KB 2JIXD 1VFAA 1AIFA 4PRPE 1IBGH 25C8L 1D9KD 4UZGA 5E8OA 1KULA 2HFGL 5DMIH 5IWLC 2HJFA 3TT1H 2E6QA 5B38G 5D6CB 4YC2C 1MJ8H 1KPVA 1N2RB 1B4JL 3VE0A 4FQIH 3CUPB 1IGCH 4E42B 3QDJB 1IM9B 1ZT1B 3BZDA 3U7WH 5C0JB 3GMQA 4R26H 5MERA 1MFNA 3FN3A 4NHCL 4Z7QE 1I7RB 5H37G 2NY0D 1ACZA 3WHE1 2NNAA 5ALCH 1QKZH 5CUSL 1CLZH 4GXVH 3W0WE 1YY8A 1BQHG 1BQLL 5DR5H 1OSPH 5JW5B 1MIEL 2L4OA 2ZSWB 2HTLD 3QEHB 3D0VB 5T5NF 2R2CA 5I19H 2JCCE 2VSDA 4UILL 2VL5A 3DV6A 4JN2B 3MC0A 4LFHG 3RVUD 1OY3B 1GGUA 2DQJL 3MCLL 4DKAA 1IILE 3H2WA 5BO1L 4JB9L 4Z7VA 5L88L 2NY4C 4OZIE 3TGXA 1XGRA 4KUZH 4XZUA 3OHXA 4KROB 5F3HB 2DQHH 5C07B 1S9XB 2GY7B 4UIKH 4GG8A 4JFFE 3WFBH 4HIJA 2O5YL 1HOCA 4HJGA 1XF1A 4J3OC 2ZUWA 1MH5A 4HIEB 1N6UA 3MRKA 5C0NC 3ULUH 5FCUH 4MLSA 5HJ3B 1U95B 4ZXBD 1TCMA 2FZ3B 8CGTA 3TV3L 1T22A 5DI8A 1SYSB 4WUKL 4RFEB 3JWNC 3V6FB 1AGDB 4R2GD 3UTQB 5H94B 3EO9H 3TYGL 5DMJB 3TIDB 1JF1B 1NGZB 3K2UH 5C0BD 5IIEA 3ARBD 1T20B 1CFTA 3M1BB 3QCUH 3PDOA 4GSDL 2BVUA 3ZTNH 3C09C 3PWPB 2OK0L 1G7MB 5DVNA 4PJ8A 5TH2A 1JN6B 4ENEC 2HRPL 4JFDB 1ZHNA 3S35L 4YHPB 1NGWB 4H88H 2HG5B 5I1AB 4LHJB 4MX7B 1PDKA 1ACYL 2XYCA 3VMPA 4X99B 3O3AA 4L4TE 4JRYD 4U1JA 5ADPL 3S88H 4G7YL 2PCPB 1MCSA 4JY4A 5J1AA 2XTJB 2OJZH 4JVWA 3TF7C 1JV5A 3IS1X 4MQTB 4KKBD 3T0DA 5KOMC 4OLYL 4UT9H 2QR0B 4P23A 3IDNB 4P99A 4XB8A 4HS8H 5HDLA 1H5BC 3PXHA 3N9GH 3ULUF 2VWEC 4DOHE 3JUYA 1NC2A 3C87A 4PJAB 1FYHB 3SO3B 3OJVC 5D1ZD 1JHKL 1FVDA 4Z76B 3QO1A 5C09E 1C5DB 2X70B 3CDGA 1S7SA 4TNVF 5JHDE 4A6YH 1JIBA 3E2HB 4PJCA 4U1LB 1U91B 1T1ZB 3PF2A 4NNYB 2DS4A 2BOBB 3WXWH 1JGUL 4PRAA 5GJTH 2I07B 2FLBT 3QQ4B 5D96C 1T0MA 1X5LA 4W68A 2EYTA 1ND0B 1RV6X 5HI5D 1KJ2B 1FNEB 1UZ8A 4NGHH 2BSRA 3LN9A 4YXKH 1P9MC 1X5IA 1I3RA 1ZHLA 1ZT7A 3O41B 5FYLE 5FECA 2XWJB 5DD1H 4Y0GA 1XFPA 1MJJA 5I2IB 2X05A 2DQUH 3VFSA 4JM4L 2NYYC 1IGYA 3TZVD 1IKNA 4GRLC 2MJWA 4CU6A 4IMLB 3EYUL 1D5MB 1C8PA 4OF8A 3FFDB 3JWOC 3P77B 4G5ZH 2QQNL 3ARYA 3GI9L 5IFHL 1UKTA 3C8KA 3WIIL 1ADQL 1ROWA 4ZFGL 1YEFL 2QADD 2ZWLT 3CK0H 4MD4B 4LCIL 4PJIA 4R3SA 4IOFD 2E6JA 3ZT6A 3GHEH 4KJWC 1HWGB 5KTEH 3HNTH 5HYQA 4HT1L 2UZIH 2DJ4A 3TBYB 3HS0A 4UDTA 3QISA 4LSTH 1AO7A 1WBXB 4HKXB 2NY6D 5I75B 1LVEA 2HFEA 2V2WB 4JZJA 1KELL 1BOGB 1MCDA 5B3JF 3LZFL 1U8MA 3EJYD 4M7KH 2PF6A 3O6FD 4H8WC 2FR4A 5F70A 4OM0H 3WL9A 1VCAA 3G6JF 3F12A 5FF6B 2IMMA 4PJGA 4GW5B 1RK0B 5IHZA 4JJ5B 3HC3H 1BWMA 4HJ0D 2FWOA 4IRSC 3RHWF 3MRDB 3VFVA 4I3RH 5C08A 5DD3L 4QRPA 1YECL 1BFVH 4ZAKB 1PSKH 3LKOA 2VKXA 2AV1A 1FNHA 4S1SH 3QH3B 4XVJL 4XCEB 4LLUA 4YGVB 4R96B 2AK4E 3QDMD 1WISA 4IOSD 4GMTL 4NKOB 2PYEB 4HPOH 4KTYA 4KV5F 3HRPA 2E9WA 3WV0A 2FL5B 4AQOA 4M6MH 5DRWB 4ZS7L 4H1LB 1QUNA 2DWDA 5KANG 1W72B 1HI6A 5KVDH 3MNZA 3TCLB 1SBSL 3BO8A 1IC7H 5HI4D 1DUZA 1E4XH 3TT3H 2EDQA 3NCJL 4GQ9L 2F19L 3DMMA 5E9DA 5ID1B 4MA8H 4F9LA 5KVEL 3QUZB 1AQKH 4QTIH 4F8TA 4WTZG 3RQ3A 3LCYA 1JGDB 3PABA 1BEYL 1I3UA 3C5ZA 1QQDA 3MFFA 3IDYB 4N8CL 3O4LA 4PGEA 1DLHB 3NFNA 5BRZB 2ITDB 5J11B 3FN0H 4PTTA 5CGYC 4GBXB 1A0QH 2ED8A 3R06A 3RDTD 5I1CH 2D03H 5I1GL 2Z8RA 3DGCR 3D9AL 4L1HA 4LAJH 3ZE1F 3GK8H 2BX5A 2X4SA 4P2QD 4TTDD 1A7PL 1I9RL 3LKPB 1LP9A 4ELME 1WWBX 4Y5VA 2JIXA 3REVB 2C3WA 2IH3A 1Q94A 1D9KA 2C4XA 5B4MD 2DLFL 3MCG1 1O7SA 2LFGA 3BJLA 4HF5L 4HPYH 3ET9F 1KT2A 1K4CA 1BZ7B 2A0LC 4P5KB 5BMFH 4GAJL 2W9LA 3S6CA 4QXUL 5F1OB 4MNHB 1LK3H 1F42A 3BYTA 3V7MA 5ESQA 3F58H 4KRLB 2K9UA 1RUPH 1P7QB 3OKLA 2RQ8A 1LO3H 4CKVX 4YJZL 5L6YL 2FHCA 4PV9A 4HXBH 1ZWIB 2X09A 2XA8H 2GSIB 3BOVA 2R0ZL 1NDGA 2VABA 3EDDA 5FYKH 3VFTA 1OAZL 1KIQB 2VQ1A 4Z7VF 1JFQH 1G9NC 4P9ML 3T0EC 5DD5H 4RAVA 3P0GB 3KJ6L 5F1IB 1DDHB 2H45A 4KK6C 4DUWA 1GGIL 3OG4B 4Z7NF 3CVIL 1CVSC 3NCBB 5HY9B 1BAFL 2AJYH 2V17L 1LE5B 4GO6B 4ZTOL 3STZB 1MFAL 4QF1A 3LH2H 2Q8BH 5HGAA 2HJKA 2Z91B 3NACH 1VFMA 2CUIA 1MLBB 1NCBL 5KSUA 3N1MC 4HH9B 1SEBA 1E4XI 1DUYB 4M7JH 5JLZA 2DJUA 1T83C 4YO0B 3D25A 3PQYB 3O4OB 1HQ4A 1N59A 4ZXBA 4RFNC 5KVFL 3O9WD 3SOBH 5GIRA 4F80A 2N1KA 5ITBL 4XHJD 3QIWC 5K59E 1A1NB 1ZK9A 4Y1AD 4DKFH 4JPKH 4XVSH 3PGFH 3VXSA 1JNJA 3QG7L 4OUUB 1Q9LB 1SEQH 1E28B 2NY2C 4JPWL 4N9GB 1JVKA 2ARJA 2OI9C 2XA3A 3ARBA 3VFPA 4U1NB 1NGXB 3MREB 5FUOH 2WBJC 3L3GB 1C7TA 4EN3C 1IARB 1AH1A 3ZDXF 3C6LD 4K3HA 5FOBB 3QNZA 2VDMH 1F4AA 4ALAH 3ARWA 4MJIE 1S8DB 2D7TL 3G04B 4NKDB 2R29L 2I9LB 1RZ8B 4QYOB 2DYPB 2OTPA 3WEXA 4H26B 3MLSH 2FEEI 4JRYA 1LK2A 1KG0B 2A83B 3S34H 4I18A 3RFZC 3EFDH 3S5LA 1CFNA 2HT4D 1TJIH 4PV8B 2LVCA 5ISZA 1PYWB 2NZ9C 2VXVH 3INUL 3UJTH 4XPAL 2PW1B 1CICD 4PJCF 3S36X 2P24B 4MB3A 3DYMA 5T1MB 1MHPH 1OTSD 3MJ7B 2VERN 3DX9A 4G6JL 4JDZA 1Y6MR 3P4NA 3SE8H 1Z2KA 2A6KB 1XF5B 1YEKL 4OSUH 5DDHB 3F8UB 3MODH 4R7DA 3SDYL 1CXHA 4HX1A 2C4FT 2EC9U 3B5GA 3V5KA 4UV4H 4HLJA 2EDEA 1SVCP 1I1AB 4U3HA 1KCSL 5C3TA 4IRJD 3M8OH 4NFBA 1Z3GH 4TVPE 4XAWL 1OW0A 1CVRA 4ZSOB 4IIQB 1BLNA 4NFCA 4TUOA 1A4KA 5AWNH 2LTQB 4PJ9B 5I1EH 1FZKA 1JHTA 1IGFH 5DJAB 1Y6KR 4PUBL 4GXUN 1YPZB 1OF2B 3RY6C 2EIDA 3LHPH 4CMHC 3QZWB 2VC2H 4U05A 1URLA 2EXYD 3TZVA 1CFVH 1UB5A 1ZA3B 3EDJA 4MJ5B 4H25A 4QRSB 5DRXB 3Q0HA 4PJIF 4KRPC 3U82B 3MLYH 5DJCA 2BNUA 1E4KC 1VACA 5GS0H 4OV5B 1CD0A 4YIQA 3K2MC 5FO9A 5GHWL 1TZHA 3O6LL 1TTUA 1V7NL 3VWJB 3BHBB 1NCWL 1C5BL 3O3EB 4NQCB 5A3ID 4NUGH 4MCZB 3O3DA 1KB5A 5I1KH 5FUZH 4PJGF 3SKOB 4NN7C 5T3ZL 2VWEE 4RSVA 3I2CL 4LNRB 1ZAGA 1RY7B 5E1AB 3O6FA 3X3GH 3BQUC 1WUNT 3ARSA 4ISVB 5J1SC 4OCSH 4NRXA 3RWEA 1QFHA 1HXYA 2G75A 5TQ0H 3CFIC 3NA4A 2ZUYA 1TENA 5HHQA 5HGHA 2F54D 3LB6D 3UZEA 5CEYB 4ZMAT 3GSOB 4L8DB 1QFPA 3RKDC 4UIMB 3ZT5A 2EDNA 3KDMB 5J56B 5INCA 3QDMA 1IZJA 1T2XA 1MCFA 2EDOA 5F88B 1MCRA 4XPFL 1HE7A 2VDKL 2JJWA 4G3YL 4UINH 4HUVB 4BSWA 1NEZA 3SGKC 1U3JA 5F6HJ 5DJDA 4K8RL 2APWA 5J0BA 4ZYKB 4J8RA 3VXOA 1BREA 4F37K 1GJIA 5I1IL 4GAFB 3MLWH 1UZ6F 4HUWB 4EUPB 1IKFL 5C0DB 1KCLA 2HT2C 2UZYB 2DF3A 2EZ0C 2FHBA 4XNMA 1T7WA 4WW1A 4G6AD 5DLML 1TZGL 1NC4B 2V2XB 2XZCH 3S98A 2BNRE 4JM2B 3WUWA 4X4ME 1VGKB 4OZIB 3X12A 1OP5H 5TF0A 3RDTA 4BQ8A 1F5WA 4PJEF 2Q76A 4HV8A 3SQOH 4P2QA 2VISB 1F8TL 5DHVH 4APQB 5B3NA 1MEXL 2AJ3A 2GSGB 5LKNA 3HZKB 3RWHB 3VH8G 3VXRA 3JV4A 5F9OL 3RWJB 5IP4A 5J8OA 4LEXL 3Q5OA 1A6UL 4M4PA 4CN6A 1OM3L 4GG6A 4XP6H 3VFRB 2NXZD 1JWUA 3H42L 1RIVL 2ARWA 3DO7A 1JZ5A 5FKAB 1F02I 2IPTH 2WP3T 2X40A 1DCLA 3IXAB 5SX4H 3QQ9D 1R3LB 2HLAB 4Z7OE 3CFCL 3SDXA 1A8JH 1KACB 1R0AH 4OD1H 2EECA 2QSVA 5GSRA 1UXWA 2A9NH 3QRFM 5FKPA 3GMNB 3T0XA 4PBVC 3MJ9A 3ZHDA 1I1FB 1OTTC 2NY1C 1A02N 2IG2H 3N1QC 3QIBB 4BH8B 2PW2B 2ESVD 4L4TB 3VXPB 4I3GA 5E5MB 4JKPH 4JKMA 2BSTA 4QTHA 4B5EA 4P9HL 4MDJB 1PG7W 1DP0A 1OQXA 1S9YB 2VAAB 2WQ8A 4XWOC 2VAJA 2VR5A 1R3KB 1QRKA 4ZUVB 1F4WL 3OL2A 3DVNA 1K8DA 4OLWH 4X4YB 4KAQH 2GJZB 5DQDH 4DOHB 4ZUTA 1N26A 2Y5EA 3DI2B 5D5ME 4EOWH 4XGZB 3VFMA 3SY0A 4WO4D 3PUCA 1IGTA 5I1LB 1MY5A 3O9WA 3GO1L 4NPYB 3C2AL 1TFHA 2ZG2A 4RIRA 1CGYA 4Y1AA 1XF4B 1M7IB 2GUOB 3S4SA 3UTOA 1CFSA 3HPJB 4HFWB 2X44D 3VFUB 2VB5A 3RL2A 1IJ9A 3T0AA 4PLKD 2P5WE 5FO7A 2ZG1A 4XCCH 1MCOH 1U8HB 5EORL 2BOCB 1R3HA 2UY6A 4HWUA 1OAKH 4EI6B 1GGYA 4ZS6D 1INEL 4FNLL 4HGKC 1CLCA 3C6LA 3TNMA 5EC1A 5J9PB 2J5LB 5C0CE 1NFDB 2KUTA 5CP3A 1Q9WA 2ZCKH 1EV2E 3I6KB 4P4KC 3CIQA 2FRGP 3ZKMC 2LU4A 3HHRB 3GSWA 5C92A 4QRQB 4YDVB 2GIYA 4TNVK 1R3JA 3V4UL 3ZYOA 3KS0J 1AHWB 1RIUH 5DUML 2Z8VC 5DMKB 5D9SB 3QXAA 1F4XL 1U8QB 4JDVA 4D8PB 4OZ4A 1WIPA 4YE4H 5SX4I 4L4VE 2EE2A 3T0EE 2AXGA 3BZFA 2CIKB 4KTDL 2FX8H 4ZOAA 4JKLA 3QEUA 1CICA 1UB6B 3ARZA 4UB0H 1KB5H 4QOKB 1UQSA 3QI9D 5IBLD 3SE9L 1X5KA 3QWOA 3KJ4B 4R90L 2VDNH 4UBDD 4WUUE 3X13B 2V7NB 3AB0C 4XH2B 2H1PH 1HYSC 2CLVA 1QR1A 2DTML 1S7VB 1VSCA 4IRJA 3QXTA 5B39A 4R97B 1KN2H 1T1XA 4MSWB 4RGND 3IKKA 3IKCB 4FQLL 2PXYB 1JGVL 4HFUH 5CD5D 4LRIC 2BFVH 4ODUA 5HI3C 1MCLA 4G8FA 3Q1SL 4L3AA 4CVXA 1Z9OA 1J8KA 5GGTL 1NL0H 2HTKD 4XMKH 4XXDA 5IB5A 4XPTL 1UFUA 3BUYA 4MQ7A 2FSEB 4Y16B 4OLUH 3ZHLA 4I77L 3A6CH 4M7ZC 1KGCD 2DB8A 1T04A 3EGSB 3GSQB 4ODTL 1FZOB 4PTUB 3KHQA 5DT1L 1RJZB 3EKCA 3ULVL 2P5EE 3KGRA 1HXMB 1U8PB 1DBML 3KPTA 2VE6A 1S7RA 4M48L 4JO4L 4GKZA 4EIGB 4YHLL 2Y06H 3CFBB 3MGAA 3UPRA 5IB4B 3CSBA 4FFZL 4ZO9A 1KCRH 3EO0A 1NBZA 5D7KE 5K33A 5KG9A 3DIFB 3RHWK 1AY1H 1U3ZA 3SCMD 1RMFH 4ZOBA 2CJUL 4M1GH 1FVEB 1R5WA 5E2TH 1AJ7H 4L8BA 4QHUA 1HYRC 1WGOA 3RZWA 1RSFA 2G5BA 3WHE0 4KQ3L 2Q7YB