3PDDA

Structures of clostridium thermocellum cbha fibronectin(iii)-like modules
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
190
structure length
190
Chain Sequence
b'MVTIDSPVAGERFEAGKDINISATVKSKTPVSKVEFYNGDTLISSDTTAPYTAKITGAAVGAYNLKAVAVLSDGRRIESPVTPVLVKVIVKPTVKLTAPKSNVVAYGNEFLKITATASDSDGKISRVDFLVDGEVIGSDREAPYEYEWKAVEGNHEISVIAYDDDDAASTPDSVKIFVKQARLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase, family 9
publication title Structure and function of the Clostridium thermocellum cellobiohydrolase A X1-module repeat: enhancement through stabilization of the CbhA complex.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Unknown function
total genus 32
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17957 Big_7 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pddA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pddA01
4UT6H 4YDVA 2GUOA 2FB4H 3QDJD 1ZT4A 3TIEB 4AM0B 1IZJA 2ERJB 2ARJQ 2FO1A 3Q6FB 2EDQA 5K33A 3VFPB 1PZUB 3MLUL 1BOGB 2RJMA 3R4DA 4P46D 5D1ZD 1G0YR 3R8QA 4X80H 1YMMA 1MIEH 3VRLE 3U2SA 5DJ6A 3U48A 4KKCC 5E2JA 4N8CL 4MXWL 2XQBH 4HMDA 3MV7A 4GW4B 4ZAKB 1AJ7H 1T89C 2DM4A 3E0GA 4M7KL 1S9VB 4OD1H 4OLEA 3MNVA 4PJ8C 4RFOH 5LGKA 4XVTL 5EOQL 4TNWF 1DN2A 3QB7C 2WBKA 2XACC 4JFXA 1RIHH 3RNKA 4UIMB 1R5WB 3RVUC 2BSTA 4XPTL 4JR9L 3VXOA 2R4RH 1YUHA 4X7SH 5DK2B 1T89A 3V6ZA 5KANG 2CO7B 5ACMA 4PJ8A 4KRMB 3BH8A 2P42B 1UC6A 3NBNA 4PY8I 4FQ2H 1EXUA 3SGEH 4QOKE 1GAFL 3I3EA 4GAYA 32C2A 3BZFA 3VWKD 3BKJL 3QO0B 1OTUD 5TJWK 2HRLA 4LKXA 5D8JL 1AD0A 3RX8A 4R96A 1ES0A 3BHBB 3BFOA 5IJKC 1LO5A 3INUL 3MZTA 5TH2B 4PIRF 4JFEE 2ZKHH 3LV3A 1FZMA 3OG6B 1H3GA 3VGAC 4WHTB 4JFHE 5KSBE 3ABZA 4OSUL 5DMGD 4Y19B 1KENL 1DBML 4R7NB 4FQJH 1QLFB 2ITCB 5IJKA 2J6EH 4NQVA 5FOBA 3MA7B 2F5BH 1NDMB 3FT3A 4WEBL 3O3DB 4GW1A 4ORGA 5CEYA 3AAZA 3VXNB 4FQXC 1KN2H 4QCIB 1AGDA 5LGHH 3QUXB 3BDYH 2EDRA 3ULVL 4D9QE 5CS7A 5JHDD 4J3XA 1SJEB 2DQEH 1MRDL 1IC4H 1IM3B 1I3RB 2O5XH 4HUMB 1MLCA 3A67L 1RY7B 1D5BA 3HMWL 3OKEA 2WANA 1ITCA 1OT1A 1NCCH 5JHLH 4X6CA 1A5FL 4BFIB 1BJ1H 2GTWB 4WJ5A 1FZJB 3OAYK 1E4XI 4PJBE 1I9IL 3FTGB 3GUTA 4WI9A 4WUKH 4F7CA 4I13B 2E8ZA 2R0LL 3OL2A 4ZUTB 4RWYH 5IMKA 1BZ7B 1D9KB 2R0WH 2X41A 1SYSA 3VXUB 4YQXH 3T3ME 4QGTA 3HRPA 1J12A 2EE6A 1I7ZA 4RGMC 2J4WL 3D39B 3DX9B 1CFNB 1CL7H 2QKIB 4JDZB 1V3JA 2DWEA 2LVCA 1R5VB 4EI5B 4CAGA 5LWYL 4APQD 3RVWD 1VHPA 2YPLE 2XFXA 3E8UH 1LD9B 2H32H 4IEFB 1PQZA 2GK0A 3EDDA 5IMLB 3QDAA 3VGDA 2LVEA 2X6MA 5BO1H 4LEXL 1JHTB 5K9QI 1QRNB 4WUUE 2W1NA 1CFBA 2LABA 1CN4A 2MCG1 4G43B 3QIUB 1KYOK 3PWUA 4BSJA 1PEWA 3LS5H 4KKBC 5C0NC 4RMWA 1S7XA 3OXSB 1XGRB 1VKXB 4I4WB 5T3ZD 3UPCA 3CXHK 1HIML 2XY1A 4JGJA 5L2KA 1VPOH 3VDCA 1IBGL 4PV9B 2A6DB 1C8PA 2XZAL 6CGTA 3BE1L 5IMMB 1BD2D 1A9EA 5DUBA 5ICXA 4RMVA 2J5LC 5C0GB 5HGDA 4IRZL 1IAIM 3IFOB 2OK0L 4FZ8L 5HHPB 3V6FA 4Y1AA 2IANB 4K9EL 5D1XD 1I1FA 3DX7B 2R2BB 1JGVH 1OAZH 3OB0K 4E0RA 4OCRH 2W91A 5MI0B 4YHOH 2OSLB 3DV6A 1QA9A 4XPBL 2LU4A 3M1BA 4RMTA 4A2MA 2LAGB 4UDTA 4XBEH 4OZGA 3LQAL 1K8IA 5BJTA 1E28A 2ZPKH 1IAKA 3TM6A 1F90L 2ZCKH 3C5SB 1GGBH 2V7HB 4P5TB 5HTSA 4C4KO 2FX8H 2FIRT 3RPIA 1U36A 2YD7A 2BNQE 5E8NA 2RAMA 4JY4A 5I9QC 4KK9D 1R0AH 3QNYA 1DEEA 2CKBB 3EYVA 4Y5VC 5D5MF 5I74B 1INQB 4AIZB 4PRPE 5GISL 5TE7L 4C83B 2G2RB 4YJZL 2VUYA 2XNAB 2QHRL 4H5SA 4AENA 3D69B 1WFUA 4K7PL 5DJ2A 3H9HA 4PJ5D 4OCSL 1JWMB 4Y8AA 5I17B 4G42A 3PWLB 1KN4H 1FRGL 4H88H 4EIGB 1MHEA 3FB8A 4Y5VA 1UM5L 1ZGLM 3GSRA 3HRZB 5CZVH 5JTWA 1MCNA 4LAQL 4KQ3L 1Z9MA 1I8IB 5F97E 3LCYA 2ED7A 5H37G 1YEDB 2F54D 3IDMA 4JHWH 3VWJC 3QUZC 2VXTL 1HDMA 4F7TB 3QULB 3LDBC 1MJUL 4EDXA 1E4XL 2H2SC 4B7IA 1GOHA 2BDNH 3RKDD 4CKVX 3SBWC 5JR1H 1T6VN 5ISZD 2Q6WA 3DX8B 3I9GH 1NBYA 1NGQH 1EHNA 5TDOB 3RGVD 3VWJA 1Q9OA 5K9KA 2AABH 1FIGL 3QUZA 4LPCA 4X99A 4AG4H 1FFOA 4PJ7A 1TVDA 4M7ZC 4XNUL 5C08A 2Z93B 4CVZA 5J3HC 3IAPA 2R0ZH 3SBWA 3BN9C 1F4WH 3LS4L 3MROA 1QEWA 4WO4B 3AM8C 5KSAD 3RFZC 1JP5A 4IM8A 3FCTB 4AEIL 3GIVA 3P4MA 1P7KA 4Z7UA 3SDAD 2PTVA 3ALPA 5EIVA 3X12A 2W60A 3RUGF 4OF0A 5GSVB 5F7DA 5I71B 5IBUG 1M6OB 1W0YT 4XAWH 3RRQA 4W68A 3O4LE 1UKTA 3RGHA 4OLUL 3IU4H 3AM8A 4PR5B 2EICA 3RBSA 5SWSE 3CK0L 3H3PH 2VIRB 4P57A 2X05A 5EBGA 2BNRB 4JFFA 3VA2C 5C71A 3OGCA 1KB5B 5DJCA 1LE5A 3UZVB 4M8QB 5GGVL 5DD6B 3GSWA 3S5LA 1WLHA 3FN9A 4R3SB 4NYLB 2ESVB 3OF6D 4HULB 1HI6B 3BAEH 5HDQH 3ESVF 4NQCA 4MB4A 3L5IA 1NEZG 5L7XL 3TT3H 4CU8A 4F7PB 3BRGC 3ZKQD 5IVNA 2BRRL 4RSVA 5CGTA 4XPFH 1S3KL 5T1DL 4MAYB 3NFSH 4MJIB 5IW6A 1A8JH 2FJFA 3HE6D 1CGSL 4JY6A 1CD9B 5INDA 3V0VB 4EUPG 1QQDA 1C5CL 4NJ9L 5GRUL 5E99H 1F8TH 1A2YB 3JV6A 4MD0A 5KAQF 1PW3A 4JFOB 1U91A 3G6JA 5D2NC 4OGXH 4NQDB 5KSBF 3KPOA 3X11A 2KKQA 4KQ4L 3FB5B 3HC3L 4G7VL 4RFNC 3R0MA 3MBED 4FFWC 1U8IA 4K3DH 4AEHL 2J88L 1T21B 4L4TA 1LK2B 4J8RB 1CU4L 5HHVL 5T3XL 2CMRL 1ROWA 5D2NA 3RY4A 2YUZA 2HWZL 5D5MB 5DEGA 3IDIB 3QEHB 3TP4A 5FA4A 4WTXA 1UEMA 2MPAL 3N50A 2OJZH 1KPUA 2CDGB 1WAAE 1Z0NA 1CIDA 2LU7A 2Y1VA 5TGBA 4M7JH 2VOTA 2AEPH 1KGCD 1NC2A 1RK0B 2GFBB 4QT5A 1A6ZA 1JGEB 2UVEA 4Z7OE 1EJOL 4P2OB 3HMXA 3V8CA 1ONQA 4DOHE 4PJ9C 1RJCA 3WDIA 1OQOA 2AXGA 3K1DA 2EYRA 2DB8A 2X42A 3QUYC 1IGYB 4LHUD 4UNUA 2IFFL 4KPHL 4Y7MA 4YNYB 25C8L 2YD1A 4M4RA 5KSUA 2BC4A 5B22A 3EYUL 3EOBA 5HGBB 2V17H 4BA8A 1IT9H 4PJEA 1IGIL 3BKYL 4DZ8A 3QWOA 4NHUA 3LRSA 4PJ9A 3WYRA 3E6FB 1CGVA 5IBTH 3K46A 1GOGA 4C56E 1UZ8B 3FQUB 4XHJC 2BY3A 3QUYA 1AFVH 1F6AA 3TO2B 1DVFC 2E7LC 1FORL 3HI6H 4PREB 4AT6A 4MJ5A 5B8CB 5FHBL 4NN5C 4XVUD 2A1WL 3MRBB 2VDKL 4ZUSB 5J1AA 4P5MA 5DFWH 5FCSH 4R7DA 2B0SL 1IGMH 1IQWL 5ANME 2VXQH 4X8JA 1NEZB 5HI4C 1DVFA 5DI8B 2E7LA 2EDLA 2J7LA 4EOWL 2VAJA 5C07E 2HT3D 3S96B 5I75B 1XGQA 4XAKE 3CLEL 1JE6A 3HFMH 3HS0B 4X4ME 4YHYB 1KPRB 4G5ZL 1BFOA 1INEH 3MV8B 3RU8L 1J1XL 1PG7H 4HX1A 4OUUB 1KIUA 2J8UE 3FO1B 5DS8A 3RTQC 4LDOB 2NY7H 4ETQB 3H9SB 5DUPH 4H25B 4YDKH 1KJ2L 4Z95L 1AGFA 2CLRA 4HKBA 4UV7L 2P43B 1MCRA 4QRRA 1EEYB 1EGJH 1MQ8A 3K1KC 1I8KB 5IHUL 1KIRB 1OOAA 3TN0D 2HP4A 3O2VL 1WT5C 1QR4A 3BP7A 4LRNH 5ICZA 5IFHH 4M5ZL 4OZHA 4HS6A 4XWGL 4UTAH 4FTVE 4E41B 2R2EA 1T7YA 4MX7B 2Z91B 3SOBH 3O2WH 1N7MH 1OTSC 5ITFA 4HFWA 4U6TA 4L29A 5IKCA 4FNLH 4LSUH 2Z9TA 1QFHA 3BH9A 2JKXA 3CC5B 1WT5A 3QRGH 3TWCH 3VJ6B 3AB0C 2XWJB 5FYKH 4HIEA 1ND0B 4YDLC 1N8ZA 1NLBH 3JV0A 4UAOB 1LWRA 2R1XA 4NO3B 3QISA 5FCUH 5GGQL 3Q2CA 2WK2A 3BP6A 4M43H 4GMSH 4NFBA 1JNNH 4MD5B 1LO3L 4KJWC 1EFXA 5INCB 2DM3A 3G5YB 4HPYH 3AXLA 4IS6B 4JDVA 5T5FH 2VDLL 2R69L 1FE8H 1XF3B 2FX7L 3MXWL 3X14B 1B0GA 2Q76A 4IOIA 5D7KE 4WY7H 3MRNA 3FFCB 1HXMB 2D7TH 4BH8B 2X4RA 3T0WA 4YBHA 1I9RL 3ARFC 7FABH 3LSOA 3KDMB 4MLSA 1BIIA 2FGWL 1LILA 5J4MA 4LCWB 4PBXA 4Q9RH 4WV1C 4QRSA 2A6KA 5AUMA 3V8OA 1WITA 3H7BB 3P9MB 3ULVF 4J2XA 4X4XB 1YEIH 1K85A 3ARFA 3QDMA 3CXDH 3GNML 3UTQB 4G9FA 4GO6B 2V2WB 4X5XA 5D7IA 3TJEH 3SGEI 4CN1A 3FQRB 3MRFA 3N1MC 3TO4C 4KXZH 5KVFL 1AKJD 2M1KA 2IGFL 1YMME 4WV1A 1NKRA 4QRQB 5D1ZC 1YZZA 4L8BB 4P46C 4AMKH 1G7PA 4KVCL 3CVHB 4XC1L 1S5IH 3QDJA 4PJFF 3V5HA 3EO9H 3WV0A 1OP9A 5TDPB 3IF1B 3SKJH 2AXFB 4NWTH 3MV7E 1Q94A 1IKFH 5I1GH 4PRID 2C4FT 1HHJB 3X17A 2FL5B 5D1ZA 2F8VA 4P46A 1CDGA 5FYLE 3SGJC 1LP9A 2DQGL 4JFZL 3SO3C 4K7PY 4MNQB 1HYSD 4MJ4A 1L0XA 4Z18A 5J12C 3M45A 4RMSA 2EIEA 4XH2B 4F57L 3SGJA 3KPQA 3QXTA 3EOAB 3P3YA 4NSKA 3ULUH 1BLNB 2FEDD 4DK6A 3BPOB 3NPZB 1WK0A 2APXA 4JM2F 4YE4L 3VWKC 4DGVH 4FOMA 1OTUC 5DZOA 2CXKA 3E3QE 3CVIH 1NBVH 4IJ3B 4HZLA 3UAJD 4P4RA 4E9LA 1A7QL 3L5WB 3IRZA 4RAVB 5FV2A 1XIWB 1J8HB 1NFDA 2OR9H 4YBLC 5EU4A 3MOAL 3FQXA 1X5GA 4OFVA 3R8BB 4M62H 4GMTH 1EIBA 3Q1SL 5K59F 4Q0XL 1H3WM 1TJIH 5F89A 3VWKA 3S88H 1E4JA 3C8DA 5DMGC 2ARJB 5EC1A 2G5BB 4XCFH 3QFJB 5HHMD 6FABL 5DD1H 3SCMC 4KU1A 2A77L 4IIQB 3EOYG 4K2UL 5BRZB 1K6QH 1CL7I 1OGAD 1X5ZA 4GW5B 5CP3A 3LN5B 2PW1A 3WFEH 5LXGH 3UPAA 2HAZA 4FQQA 5C6PB 3DGGA 2F53D 2NY4D 5J0BA 3LKPA 3D18B 3STZB 1SJXA 2FB4L 4IHOA 1QOKA 1TQCC 3MGOA 2A0LD 3QXDA 3U6RB 4H20H 5GS1B 1KCLA 2XWBB 3EJYD 1UXSB 3EOTH 4YHIB 1NSNH 4FXGB 2G75A 4RNRB 4X6CE 1XR8B 3FRPG 4R2GB 1MEXH 3HPJA 4GKNA 4M93B 5C9JA 4WEUD 1ZSDA 1QVOA 1ZXQA 2ZG2A 3O45B 1KEML 4X80L 5GGVY 1ED3B 1JPFA 5D6CB 2C7UA 1B0WA 2FYYB 1G7MB 5JHDA 3VXPB 4JY5H 2V5YA 3ALXA 4DFIA 2XQBL 3QIWD 2H8PB 4U0RB 1AJ7L 4U1KB 2UZYB 4K3JH 3QH3B 3SDYH 4MVBD 5DTFA 3HI1B 1RZGA 4ELKB 3L3OA 5E8PB 2EDFA 3P11H 1RMFH 1RIHL 1U8LB 2A9NL 4JCMA 2X4SA 4O02H 4RQQB 2R4RL 1JPST 3UXFA 2P8LB 3WJJC 3T0EB 4NPYA 3PP4H 4GAJH 1GHFL 3RVWC 3KR3H 4APQC 3ZE2F 3PNWB 2ZUQC 1GGCH 1CQYA 4MAUL 1GGIH 2ICWB 2C3GA 4QF1B 3T08A 4AQ1B 3PWNB 5E4EB 3WJJA 4PJFB 1EAJA 4OQTA 4QXGH 3WO3B 1NUNB 4APQA 2E9BA 5IOPB 5C70A 4JRXB 3BN3B 4LLVA 1W0WB 3KPSD 5DLMH 5GGSA 1Q9KB 1KV3A 4H1LH 3QG7H 2ZKHL 3UBXI 4DKEH 3PHQA 1T66D 4YBQD 1CR9H 3I02B 4HUKB 3MNWB 1FVEA 2J6EL 3JTTB 2F5BL 4G8GD 2BSRB 1OLLA 5D1XC 1KN2L 5LGHL 4KK5D 2D0HA 2GSGB 2DI7A 2UZIH 4NT6B 2VYRE 3UTSE 1S7WB 5HHQA 1JMXA 4FQHA 1BD2A 3JWOH 1K8DA 5EN2A 2X4TB 4PJXE 1IC4L 3C09B 1DLFH 5IWLC 2LTQB 5TE4H 1HH6A 1VFAA 1WIPA 4L8SC 5D1XA 4ZPVB 1NCCL 5JHLL 2Z35B 3ARED 3PJSA 4MQ7A 2XTJB 1MAKA 2DBLH 2YMXL 1LO0H 2JJWA 4FRWA 5TQ2L 1IRAY 1UM6H 1P7QD 2PR4H 3ARDD 2EH7H 4ZXBC 4LEOA 3SDDB 2IAMD 3S8WA 2DI8A 2R2HA 5IWLA 1S7VB 4JZNB 4L8SA 3LZFH 5CWSA 3MCKA 1FL6A 1XGYL 2ZOLB 2WWKT 1RZFH 2OTWA 4AY0A 4TQEH 4TVSa 3ZDXF 1T3FA 4X5WA 4Y4KB 3SE3C 1PVHA 2DMCA 4ZFFA 3HTLX 2A73A 4C58B 3NPSB 4X6FB 1L6XA 4G6KH 5DQJB 3R06B 4ERSH 5C0RH 5LGJA 3E8UL 4PYHA 3FJTA 3HAEG 2WUBH 3PUCA 1D6EB 5I8CA 4RFEA 4KV5F 1EX0A 2XZQH 3HUJE 1CE6B 5BO1L 1AR1D 3SE3A 3VDAA 2OX5A 4DAGL 3I6KA 3GMMB 5C1MB 3AS2A 3FMGL 5F72S 3CFKA 3CJJA 4HG4K 5F3BB 1QACA 5CHNB 3WLWD 4E5XA 4YDJA 2EXYC 2F54A 3LS5L 1IAIL 3CFCH 1T04B 4XNYH 2WZPD 3RGVC 2VAAB 4O2EA 4PJ7E 3PP3H 2N1KA 4HWZB 2NY6D 3QCTH 1VPOL 1ZAGA 3K0WA 1PAMA 3KYOA 5L2JA 2D7MA 1VCAA 2NNAB 4XC3H 5KBNC 4WWKD 1DANU 5ISZA 1DBJH 2Y5TA 4Z7UE 5KSAC 3RGVA 1XH3A 1ADQA 4HWBA 3SDAC 2AXJA 3IDXH 5BVJB 1IEAB 4UUJB 4YHKH 3PABB 1JGVL 1OAZL 3EZ8A 5F7UA 4OCRL 1Q0XH 4YHOL 1MQKH 5DJ8A 4RA0C 4FQCL 5EU5B 5L8KB 5KSAA 4JFFE 4OF7A 2OL3A 4XBEL 3SDAA 4P2QD 2JCCF 2X4NA 1RUAL 2GY5A 3FT4B 1R3KA 3MREB 3VD3A 5C09D 4NQCE 4NWUH 4GXUM 2FX8L 3LKQB 1HHGA 2JF1A 3UMTA 1D7FA 2P8MA 5SWQB 3EBAA 3H42L 5IQ9B 3AMLA 1NCNA 1J5OH 1R0AL 4QHNB 1T1YA 5FOJA 4BUHA 3TPKA 5CLWA 5EB9A 1X3DA 5E2WH 1G7IB 3TVMD 4PGDB 3U0TA 3OF6A 4CVXA 4OZIF 5HGHA 3IJHB 4DKAA 2NXZB 3HE6C 3TA3B 4PJIF 4H88L 1BWWA 2F15A 5E95B 3T2NL 1S7SB 4OFKA 3W0WD 5CZVL 3G6JE 4QO1A 4LF3A 5T1MA 3NZHL 3MUGA 1MFEH 4X6EA 2X7LA 5CIPB 1EERB 4ONHB 5K9JL 4XCCH 3BESR 5E9DD 3HE6A 2OLDA 3JTSA 2VQ1A 4ESKA 4L4TE 2JELH 1JGUH 3MBEC 5D2NE 3SE4C 5HYQB 4QXTA 1AO7D 2BDNL 4IRSB 5FK9A 4ZUVA 1GYAA 4NNYA 4TNVK 3RWDB 4DN3H 3I9GL 4R97B 5ACZA 4A6YH 5B38A 1NGQL 4P49A 3T2PA 1J11A 2WP3T 2AABL 4QRPB 1G84A 43CAB 3QQ3A 4AG4L 3BIKA 4ODWA 3MBEA 3WIHH 5I1HL 1S9XA 3UPRB 1UM4L 3GMLB 5IM7B 2A74A 5A16A 1UB5B 2R0ZL 2DKSA 2PTUA 1F4WL 1INDH 2QBWA 4PTTB 4DTGH 4ZAKD 3FHQA 3UROR 1QFWM 2C3VB 3ZKMD 1BP3B 5HVHB 4XAWL 2GKIA 3ILPA 4G6FB 4Y16B 2DI9A 3ECBB 1T1WB 4UU9B 5CGYD 4FZEH 2YD6A 4WVRA 4TN9A 1H5BB 1SY6H 4YFDB 1N5YH 1RV6X 3L3IA 3GSOB 4HIXH 4QHLA 5GGRY 3IU3B 3O41A 4UQ2B 5CEXB 4ZUWB 4O9HH 3S3JA 2OXHA 1E0OB 2AJ3A 2CH8A 1TFHA 3BO8A 5DJAB 3BAEL 3B9DA 5HDQL 4JO1L 1JK8A 3E2HB 3MC0A 5MEOB 3OKLA 4LHUA 3TT3L 2EXWD 4LL9A 4GKZA 2ATPA 3KPRD 4FQ1L 2DQCH 4JM4L 4XVUC 4EUPA 5I1AB 3GMQA 3BGMA 4M1GH 3TBVB 2NY2D 4GRLB 4RAHA 2UWEE 2NW3B 3OJDB 4LLWB 3SY0B 3DUHA 2VZVA 4Y19D 5C0AB 5FDWA 1QKZL 5J6HA 2GITA 1DUYB 1XF4B 3P4NA 2HT3C 5E99L 3WE6B 3VMOA 3KLHC 1F6FB 1K4CB 5IW1B 3SE8H 3FO9B 3Q6GL 3DUSB 4OGXL 4XNQB 4QRTA 3AS0A 4HEPG 2JCCB 5H35A 1L7IH 3L3HB 3VFVA 5E7FA 3D1MC 4QRRE 4K71C 3WD5H 2W0FA 2VZTA 1C5DA 4K3DL 5IGXL 5D1QB 4AIXA 4PJDA 5FDYA 2WLYA 4C55A 4ZQKA 1DLHA 3TN0C 1BVKA 4LRIA 5JO5B 1VFBB 3EO1B 1FFNA 1Q72L 1BIHA 3RWHA 3OJVC 3WL9A 4OZIB 3HZKB 4IMKA 1OSPH 4PJIB 1D9KD 3TN0A 5J9PA 4M7JL 3H9ZA 3LHPH 3L3JA 4QXUH 2AEPL 2FO4B 3LKNA 4NHCH 3X13A 4LSQH 4KXZI 4P2YA 3QUKA 3ULSB 4WFFD 1S5HA 1JFQH 3EHBC 1FO0A 2APTA 1KJ2B 2R9HD 4EI5D 1MPAL 1N64H 3QEQB 2CR3A 4RGNE 4DCQB 4XCNB 4XNZC 3V9FA 4M8VA 1T7XA 4NJAH 2FATL 2RCSH 1MFDH 5IBTL 3MYJA 1IGFH 1E27A 3GRWA 1AFVL 3RVXD 2WBJB 1Z9OA 2NY5C 2E5EA 3D0LA 3HI6L 4NQSB 5EO1A 4NQXB 3MUZ1 4UNTA 3QG6A 3CSBA 3QIUD 2DQTH 3GHBH 4OF3A 5E8OB 3O2DA 5FEBA 3HUJF 4G9FE 3NA4A 2X4UA 4PJGF 4TNVF 3GSNA 1IGML 2VITB 2VXQL 3CMOH 3G5ZA 3V0WH 4G8IB 1P2CA 2Z8WC 5D70H 4ZFOL 1XR9B 1U2CA 3HFML 5BQ7A 5HYFA 1C5BL 3FOLB 1INEL 5KS9A 4TUJB 1TZGH 4J6RL 1ACZA 4LGRB 3G5VA 3UTPD 5DUPL 4HDIA 1AKJA 2IPUG 4XCEB 1F3JB 4YDKL 3W39B 5HHOB 3BPLC 1HZHL 5HDOA 3WHXA 3NFPB 1LP9E 5E70A 5DEFA 1YN6A 1EGJL 2BHUA 4O2CB 3S4SB 1U8OA 4TSCL 4LRNL 5E2UH 1HYSC 5IFHL 5E4IA 1M7IA 5J13C 1QD0A 4P5TD 4PRIA 1TJGH 3BVNA 2V7NA 3SOBL 3O2WL 5TQ0H 3TH2T 1G6RH 1X5AA 1F4XH 4WHYH 3OKNB 4KUZH 4XNMB 1CDHA 4LSUL 4GQ9H 1GPOH 2IQAB 4OF6A 3QRGL 3TWCL 1QSFE 2FEDC 4P9HC 3NN8B 4DW2L 1UB6B 4XGZA 1NLBL 2VISB 5FCUL 1ZMYA 3KJ4C 1KTLB 3UAJC 5SX4H 1NFDE 3FQNA 5TE6H 5IF0A 4OCXL 4QYOB 1AH1A 5BS0D 4MDJA 1SVZA 3IDYC 4HPYL 2E7MA 4PRDA 5GRJL 1SJVA 4JFPB 5C0JB 1JZ7A 1FE8L 2DS4A 5FYJH 4F3FA 1CTOA 4WY7L 5GRYA 3MJ7B 3DJ9A 5EZLA 2D7TL 5F6HI 5TF1H 2AJYH 3TIDA 2HN7B 7FABL 1PKQB 4TUKH 3QZWG 4XVSL 2C1OA 5ETUB 5E1HB 2OP4L 3IFNH 3NCEB 1KXTB 3ETBF 2NY4C 5EZJA 2KPNA 2CDEB 3N1QC 3NCJH 5BVPH 3L3GB 1YEIL 3CXDL 4JG1H 2A0LC 4WHDA 2I9LB 1K5NB 3TJEL 3KNBA 3EJYC 3C87A 3F7VB 1OGAA 5GS0L 3UZEA 2ENSA 2JJUA 3T2QA 3WN5B 2ORBH 5EO9B 3QAZC 1U8NB 2F53A 1NMAH 3DTXA 4OCMC 4U33A 1XT5A 1S5IL 3EO9L 4K8RC 4PRNB 3M17B 4F15B 3EGSB 1B4JH 1ZHNB 5I0ZA 2CSPA 1IKFL 2Z8RA 5I1GL 3QIWC 5DHVA 2Y72A 1ZHBA 3DHMA 3KHOA 4WI2A 1IAOA 5GRZA 2XY2A 4MVBC 2MOVA 4KY1H 4F33A 2JLLA 4NKIH 4DEPC 4FA8A 2X4PB 2HFEA 1U8KB 3QDGB 3WDJA 1U58B 2VLMD 1OSZA 2BNRD 4KAQH 1AE6L 3RWEB 4Y8DC 3GSXB 3QI9B 4JQIH 3QIWA 5ICYA 4O51A 4NKDB 4KJYA 1RUQH 2ESVD 3LKSA 4RIRA 4PJGB 3HPLB 3S36H 3MLVH 1MCLA 5ID1A 4MXQC 3SKUD 1J18A 4NKMA 2X44D 3ULUL 5KN5A 3V4UH 2XA8H 4WI7A 3IS1X 4XPGL 3TT1H 3BXNA 5CEZL 4OAWB 3ZKSD 4MAYD 1RU9H 1YJDC 1T1ZA 1TXKA 5F21B 5L0QB 3CVIL 1NBVL 3V5DA 5D7JB 4YUEH 4K23H 1JIBA 4WDIA 1WBXA 5I66A 1F2QA 4PPTA 4M62L 4GMTL 5ENWA 3IJYB 1TJIL 4FQLL 5FKPA 2WNGA 4YBQC 4NQDD 4XCFL 2VLLA 3O81A 4LSDA 3KPSA 5DD1L 4ODBD 5EORH 3T4YB 1EVUA 5F6IB 2DAVA 2Z8SA 1NL0H 2DLFL 3T4AA 1AQDA 1K6QL 3QHFH 4W81A 5T3ZE 3WFEL 1YPZE 3VGHA 5LXGL 1EO7A 3TNMB 1MFAL 4KK5C 1OWRM 1N59B 1HOCB 3QEUB 4POUB 1WFTA 1B0RA 5AD0B 1QZ1A 2O26U 4N0UA 3SQOH 4G8GA 3UEZA 1QG3A 2K7QA 4H20L 4Q9BA 5F1IA 2IBZX 3EOTL 1NSNL 5FYKE 1RIVH 1MEXL 3L3DB 2EEDA 3AREC 1LE9B 4JHBA 4HJGA 4QHKJ 1ZE3C 4HAFA 4JY5L 3VG9B 1AI1H 3ARDC 2HA1A 5DA4A 3C60B 3PV7A 1FSKC 5TPWL 4WW2F 5BV7C 4D94A 1W0VB 2CDFB 3AREA 2PN5A 4K3JL 3RNQA 2Y7QB 3SDYL 5KZCD 1AHWB 3BSZL 4ODSH 1QSED 3A0OA 3QEGL 2GSIA 1JPGB 4ZOEA 4ZS7H 1P7QA 1RMFL 3P11L 4O58H 3ARDA 5DR5H 5TFSL 3WO4C 4MA1B 3FT2B 1H0DB 4TVPD 4O02L 3BIBX 5JIKA 2IAMA 4K7FB 2KZ1B 4OQ1A 4GAJL 4POYA 2Z31B 3KR3L 3BP5B 5B39B 1EAPB 1FGNH 1DQDL 1F58H 3ZE0E 3HZVA 4JRYB 2ICEB 1F00I 4PRHE 1AR1C 4PLKD 1NC4B 5D2LE 5EUKB 2YRLA 3OV6A 3TNNA 4Y2DB 1PGRB 5DJ0B 5ADPL 3LAFA 4PJHE 4KI1A 4MNHB 3ZO0A 4RDQF 4GG8A 1FZKA 4OZ4A 3WLWC 5JMOC 5H94A 8CGTA 2EKSA 1RUPH 4LSRH 2GCYA 2NY6C 1HXYA 3PIQB 3U4AA 4DKEL 5FHAH 2HT2C 4XB7A 3QNXB 1XGTA 5ISZE 1CR9L 1BQLH 1UJTA 4WWKC 2FJGA 4Z78A 4Q9QH 2ZCHL 2VXSH 1JTTA 5IB1A 5KVDH 2DLGA 5FYLL 3BPCA 1YA5A 3T1WA 5IK3A 1RAMA 3TBSB 5IB5B 1WBYA 2APFA 2UZIL 4OFPA 4Z7VA 4LCYA 1XGPA 2PTTB 3PHOA 5HYSG 3JWOL 4WWKA 3FN0H 1NPUA 2IH3A 1G7LB 4G8EB 4E41D 3WIFA 1DLFL 3JV5A 5TE4L 4UIKH 1IAMA 5GZND 2QTEA 4XTRC 1A9BA 2F58L 4XMKH 3RWFA 3KS0H 1N3NA 2BOCA 2DBLL 1J05B 5DC4B 3WXVH 5FF6A 1PZ5B 4R4FH 3D3VB 1DUZA 3C9NB 4YHLH 5EG6C 3ARPA 4ZPTA 4P2QA 2Q8AH 3WUWA 3LZFL 5JW4Q 1QFWI 3MRKB 4FFYL 4GLRH 3SHSA 5C09A 3MJ8B 3TVMC 3GEWB 5FO7B 1RZFL 3JWDC 1AGEB 3C6LB 4TQEL 4P5KA 4HGWB 3P9WB 1IC7H 3HG1E 4YZFE 3B9KB 3DRQA 2PW2B 1Z9LA 4OB5H 3FFCD 4ERSL 5C0RL 3IXAB 1A0QH 3TVMA 5IV2B 9CGTA 2WUBL 4XP6H 1WC7B 2R39A 4IRJD 4D9QD 4GQPH 2XZQL 2KQNA 5HHNB 1RQ5A 3PWPB 3RQ3A 1S8DB 5DJZB 4QHUB 3REWA 2W9EH 3G04B 1NBZA 2R8SH 3W0WA 3O3BB 2HJLA 2BVEA 3CFEB 12E8L 1ZTXH 3RZWA 3UBXB 3PXJA 2G9HA 1ZGLB 4WW2B 5E9DA 3CFCL 4XNYL 4OIAA 1CXFA 5KW9H 3L6FA 4HH9A 3OQ3B 5AZEL 2R0KH 3SEPA 4LP5A 3P4OB 1T5WA 3QCTL 5DZNA 4YEEA 4DUWA 1QFUH 4LCUA 4XC3L 2X4QB 1I4FA 1DBJL 4RGOH 2BXZA 3Q6FA 2BFVL 1S78D 4ZAKC 4K07A 4FMKA 3VFPA 3ZE1E 1BOGA 5FGCE 4YHKL 4XPAH 1A6AB 1KTKE 3DWTA 5DMIH 4JB9H 1YEEH 4I48B 4MNQD 4XVJH 2E6PA 3VMNA 3WS3B 4QEGA 1KGCE 4GW4A 4ZAKA 2AV7B 4PG9B 1EH9A 4S1RH 2FD6H 2V9QA 3KXFB 4JO3H 4WUUD 4CN6A 2WQRA 4NP4L 1J0IA 3V0AC 3T04D 3D9AL 1UCTA 5IB2A 4UIMA 4F37K 1R5WA 3N85L 4HS3A 5IT2H 3KHQA 1ZGLP 2N7BA 5DO2D 2XOTA 1VACB 1J5OL 2EXWC 1HHHB 4OZFG 4L8DB 2ITDB 3NIGF 3MOBL 4MA3B 5EO0A 5E2WL 2HG5A 3U9UA 5I6XC 3JZ7A 4Y0GA 1KB5H 2UY7A 3RWGB 2NY2C 2FIKB 1I8LC 3STBA 1SHMA 2IJ0C 3QO0A 4I8DA 4LVNB 2CIIB 3MJGX 4QHMB 4KZDL 2ZUWA 3KPRA 4I3RH 4KVNH 5LJYH 3QFJD 3BHBA 3QQNA 5CBAB 5JXAH 1RJZA 2YPLB 1IGCH 3CX5K 1MFEL 1ZA3B 5TH2A 5BRZD 5C0FB 3W9DA 1I8LA 2H6PB 4AYFA 4BKLA 1AXTH 4Y19A 3MNZB 3DX6A 4PJDE 5GIRB 1DQJA 1EK3A 1QLFA 4PGBB 2ITCA 3AS1A 4KHTH 1QTYT 3VI4E 1YPZF 3VRIB 4DKFH 1T22B 1TNNA 1VGKB 3MJ9H 3QUXA 3WBDA 1QFWL 2DQHL 3WIHL 1MCJA 1ZWIB 5IG7B 4PRPD 4JVPA 4L5FL 3PGCB 2EDNA 1D9KC 1SJEA 1INDL 4DTGL 1VSCA 1IM3A 2MFNA 3VXMB 2IALB 3T8XA 1TZIB 2ADFH 2DIAA 2YS4A 1P9MA 4X6DF 1YEHH 2GTWA 1FZJA 3MQIA 1I7UB 2E7BA 5H37H 2BOBB 1A1MB 1MCFA 1OAKH 4IBLT 3FTGA 5DC0A 4YFEA 3V7MA 1HSAB 3VMPA 5FAAA 4ZUTA 1A47A 1D9KA 5F7EL 2R9HC 3VXUA 4H26B 1XGUB 4HIJB 1N5YL 3T0ED 2VDPL 2YWYA 4HIXL 3FB6A 4M5YH 1LMKA 1U93B 4ZO9A 1U8MB 2CLVA 1CFNA 5LCVH 2QKIA 4JDZA 5IIEA 4DVRH 1R5VA 2A83A 4EI5A 3RVXC 3CH1B 1N0LA 4GBXB 4HW6A 3GI8H 4BELD 1FH5H 1H3VA 1CBVL 1RHHB 3OWEA 1AXIB 3MRLA 2R1WA 2DQCL 3QIUC 4M7LH 3VFOB 2GAZB 5CSZB 3R1GL 1U8PB 1WSST 1M7DA 3NZ8B 5E00B 1Q9LA 1KXVC 4M1GL 2IWGA 3SKNB 5D2LF 1F4HA 4FP8H 4NZJA 3SDXA 3X3FH 1OPGL 4OZFB 2MQCA 3QIUA 5MP6H 1FCCA 3MRJB 5KS9E 5SX4I 4NM4H 1MCEA 3OXSA 4LIQH 1KCUH 1XGRA 1VKXA 1L7IL 1WIUA 5GQBA 5DRXA 2C3XA 3WD5L 2D4DA 4PV9A 2A6DA 5D6DC 5J8OA 1CFSB 3AC0A 4UV4H 3W81A 4JM2D 3ARBB 5C0GA 4JN1H 4LLYB 1CZ8H 3MV01 1ZVSB 1CQKA 3I2CH 3BZEB 4PRIE 5ID0B 3CNKA 2ZWLT 2C1PB 5B3JF 3DX7A 2CLZB 3BZ4B 4P5TC 1KFAH 2KDGA 4KHXH 3FO2B 4PB9L 5D6DA 3CFJB 3U1SL 1KLFA 4WW1B 2OSLA 5BW7C 4PGCA 2WWKO 4H8WH 3WEXB 3MRDB 3ULUF 4KDTC 1VEMA 3V7AE 4EVNB 2P4AB 4F37F 1MREH 3SDDD 4HKXA 3LHPL 4QXUL 1BX2B 1N6UA 1IZKA 1CGTA 2WINB 2V7HA 4NHCL 4P5TA 1RZ7H 2YBRB 4LSQL 5HXMA 4N8PA 2I25N 4YR6B 4HV8A 3T2OA 1X5IA 5BW7A 3UJTL 5SWZB 3KWWB 1JFQL 4KDTA 5JLZB 5AAMA 4Y4KD 1CDIA 3D5OF 2IH1A 3ZT7A 2CKBA 4DGYL 4MJ6B 3OHXB 1AC6A 4AIZA 4ZO6A 1T2QH 1TJHH 4C83A 2XNAA 3D69A 4OGYH 3DBXB 4NJAL 1JWMA 1TTUA 1MFDL 2P46B 4L4VB 3PV6A 5KJRH 3PWLA 1IGFL 5BS0A 1YMHB 2CUIA 3C8KB 1AY1H 4N8VG 1W8OA 4G80A 1TPXB 4GFTB 2DQTL 3GHBL 5DSCB 1C7TA 1OB1B 1I8IA 2WM0A 2X2YA 4ZFZB 1QRKA 3DMMD 4X6DB 4ZYKA 1OGAE 3PP3K 3ZMRA 5KG9B 2ZUXA 4F7TA 3QULA 3BUYB 1ZT1B 5K9QG 1CFTB 3CMOL 3MGTB 5JIHA 5L8JB 4NRZB 2P5WE 1N2RB 3WFHB 5D70L 1FL3B 1JPSH 4LCIH 4U31A 4CN4A 3DX8A 3GHEL 1NQBA 3HMXL 2QLVB 1F3DH 4UZGA 2D9QB 3BMVA 4YHZH 4BQ6A 2QHLA 1UWGH 3HNSL 1JV5A 5I71C 5IB4A 5K9OB 3QJHB 2QSVA 2Z93A 3K2UH 3MLWH 2QQQA 4M6ML 3TCLB 3L9RB 3ORJA 3FCTA 3CVHH 1BZ9B 4G8FA 5GSVA 2CPCA 3MV9B 1M6OA 5IEHB 3GZKA 1TTGA 1T2XA 1TJGL 2YN5A 3FB7B 3U4BH 5J6GA 2FHCA 5TQ0L 1AD9B 3ARWA 1U92B 3OSKA 4NOBA 1A1OA 3JVGA 4KUZL 2X4OB 4PR5A 4GQ9L 3O8XB 4PJAE 1GPOL 1UJ3B 1UEYA 5DQ9B 2VIRA 5K93A 2BNRA 2RIKA 3F12B 3EO0B 1X5XA 3GSNH 4E42B 1DQQB 5HHXH 5FO9B 4D0CA 4MAYC 4NYLA 2ESVA 1HI6A 5MEQA 3VFNB 4M6NH 4XAKD 1UZ6E 2VJXA 2C3HA 5TE6L 4OLYH 4CVWA 3TA3D 4X9BA 1SBBA 2AJZB 4CW1B 1NMBH 2E7HA 2OS7A 4F7PA 2MWCA 1MUJB 5HPMB 4JAMB 4N0CD 1EO8H 4MAYA 4JGUA 3DETD 4W70A 1UWEL 3P9LB 2EYTB 4MJIA 2IBGA 4ODHL 2RB8A 3WDHA 5TF1L 2AJYL 1HCFX 4KRPB 5BZWB 2W0KA 3ARRA 3LKOB 2R15A 2OBGA 4X0KB 3IFNL 1N6QH 1EEUA 4FTVD 2I60H 1A2YA 4JFOA 4XVTH 4NQDA 5EOQH 2FR4B 3N1FC 3RZCB 4DWHA 2DL2A 4G8GE 3NCJL 3CFDB 3FB5A 4AH2A 3IDJA 4JG1L 4TRPL 5EH1A 4ENED 3QPQD 3BIAX 4JR9H 3KPMB 4RRPG 3MRGB 1T21A 2N56A 2Z0BA 4J8RA 1QPPA 3F5WB 1A7PH 1NMAL 5C0BB 2YPKB 5D5MA 1ZT7A 1MLBB 1NCWL 3QEHA 1B4JL 4HZAA 1OF2B 4J1UA 4H0HB 3NCBB 4YHMH 4P9HH 5JORB 5D8JH 4ELMA 5DHXB 4ONOA 3LEYH 3RWCB 5T3XD 4HBCL 1E4WL 4V2CB 3RDTB 4OFIA 4KAQL 5E8EB 3S7GA 2V5TA 5KANI 4JQIL 2APBA 1A7OL 1JJUA 3P30L 1RUQL 2KBGA 2JB5L 3W5NA 1TTFA 4LVOC 3S36L 2B2XH 2Y25A 1QSEA 5DYOB 1JUFA 4WEBH 3V4UL 2XA8L 1JWSB 2NY1D 4RWHA 4PLKC 3RWJA 5B8CC 5HGBA 2A2QT 1I1AB 1ZA6A 3E6FA 5AG8A 5EU6B 1UZ8A 3FQUA 4PP1D 1Z2KA 4CVUA 3ULVH 3CDGA 3P4LA 3W11D 3UTZA 3TO2A 3DVNB 1MCWW 3F7YA 5C86A 5C0AD 1BAFH 2VLRB 5B8CA 3A67H 1QFPA 4G6MH 5I75C 3DO7B 1FJ1B 4JDTH 3MRBA 1P4BL 1SJHB 4F8TA 1MHPH 3G08B 5FFLA 3RUGA 2R0LH 4WFGD 2FJHB 5EORL 5EBWA 1NL0L 4K8RH 2DQFB 2AK4D 2NXYB 3QHFL 2BZDA 2HKFH 1Q9WB 4Z7VE 5D1QD 2GUOB 3L95B 4QLRA 1KPRA 3IFPB 4ZSOB 5I18H 4OUUA 5MENB 3FO1A 4UQ3B 3RJQB 2XXCB 3SQOL 2AJXL 1U42A 4OT1H 4H25A 5LWYH 1GC1C 1RIVL 1SM3H 5KOVC 2JJTC 2NLJB 1EEYA 4L8CA 4H1LB 2I26N 1I8KA 1KIRA 1PG7W 1U8HB 5FM5O 3L7FB 1NAMA 3LPGA 4UAOC 4LSSL 4E41A 1AI1L 4MX7A 4GRWE 3UTOA 5D96C 4ZDHB 3ES6A 1RURH 1TLKA 2C26A 3S98A 4HK0B 1V3MA 5FYJE 3GMRA 4ODSL 4POZD 3VJ6A 1XMWA 2XWJA 2BSTB 1UACH 4U6VL 3QEQD 1YUHB 1I7RB 1HIMH 4U1MB 5KSBA 4PJ8B 4MD5A 2BSSB 1IBGH 2CK0L 3TJHD 3UYPA 5INCA 1EXUB 1F58L 1P5VA 3BEVB 3G5YA 2YUWA 2VZ3A 4LLDA 4IRJC 5D93C 1T0NB 2G60H 2X89D 3BZFB 2XA3A 4EN3D 4HUVB 3W0WE 3X14A 1XF3A 3WNNA 5HVFB 3FFCA 1HXMA 1LO5B 3D25B 3KDMA 5E9DE 4N5ED 4IRJA 3LV3B 1FZMB 1QYGH 1RVFL 1RUPL 1EHLH 3T65B 4X7TB 4LSRL 1F90H 3LB6D 5DD5H 2WSKA 3BKCH 3BDBA 3P9MA 5FHAL 4X4XA 4ACPA 4NQVB 3B2UD 5C2BH 5FOBB 1EVTC 3UTQA 3EDKA 4PJBA 4Q6YA 1B3JA 4Q9QL 3FQRA 1GZPA 2VXSL 4GW1B 4ORGB 5KVDL 4LFHG 5I30H 2Y07H 1G9MH 5CJOH 4QRQA 3U4EB 4L8BA 1F97A 4XZUA 2QADD 5TDPA 2IPKB 4BFGA 2H2PD 3FN0L 4QRUB 1TITA 5IHLB 1DFBL 1FRGH 1NKOA 1MLCB 1VB9A 3TYGH 4IOFD 4HPOL 4FQXB 1T03H 1HHJA 1TQBC 1UM5H 2FL5A 4UIKL 4WJ5B 5HI3D 3ISWA 2FDBP 2VB5A 4XMKL 1C08A 4WFEE 1MH5B 1QBMH 4F7CB 4OQTL 1UYWH 5IMKB 1BVZA 3WXVL 4MNQA 1CDBA 4P59H 2C3WA 3BPOC 1F42A 2VDRH 3O4OC 4R4FL 1SYSB 1S7RB 2XV6B 3K8LA 5DO2C 1JYWA 3ARGB 2VXTH 5C0IB 2Q8AL 1PFCA 1I7ZB 2ZP0T 3IETB 4WUUA 4PJAF 2YXMA 4HJ0D 3EOAA 3K74B 2WLZA 1A1NA 1BLNA 1LNUA 2ATKA 3PWVB 3U7WH 1JI2A 4I2XB 3GFUA 1X5FA 2N7AA 4OB5L 1DDHB 5J11B 2XFXB 4RGMB 4XNUH 4Y89A 5KSVB 2ZUSA 1FL5B 2E9IA 1LEKB 5BMFH 3UTSD 1JBJA 1XCTB 3OZ9H 4Y19E 4AEIH 1RJYA 2Y36L 5ERWB 2ARJA 4X7FC 2G5BA 2R8SL 5GZOD 1G7QA 3PWJB 3QFJA 1MCBA 1ZTXL 3DURB 3EYFA 2YHGA 5GS1C 5BRZA 3VH8B 4JKWA 4YXLH 4GW5A 5JOPE 3LN5A 1U8QB 3CCHA 5KW9L 3CU7A 5L2KB 1F5WA 3LRGA 1GSMA 2R0KL 5GGVH 4WCYH 3D18A 4YIQB 3STZA 1IM9D 4Q6IB 1A9EB 5ICXB 1QFUL 3QFDA 1HNFA 3U6RA 2NW2B 5GS1A 2XWBA 1UXSA 4RGOL 4FXGA 3RL1B 4Y1AB 5CD3A 4RNRA 1XR8A 4U0RC 1I1FB 3HAEH 3S5LG 4NUJB 1S3KH 2NY3C 3FAWA 4XPAL 4E0RB 3O45A 5DMIL 2HJKA 4N1EA 1ED3A 4JB9L 3DV6B 1NH6A 5T1KB 4LPUA 4PRPA 3R0NA 5J7CC 1U95B 1YEEL 2EDWA 2FYYA 2J5LB 1G7MA 5A3ID 3VXUE 3VXPA 1IFHH 3OAUH 4XVJL 4M6OH 3QI9D 1TDQA 5CCKH 1CGSH 4UDTB 4OZGB 5I73C 3ZTJG 1K8IB 3JWDH 1E28B 4P3CH 1IAKB 2H8PA 2KZWA 1IKNC 5IVOA 3T77B 3WFDH 4NRXB 3T0EC 4S1RL 1IEHA 2FD6L 3CUPA 4F9LC 1C5CH 4JO3L 4PV8B 1A6PA 4TUOB 3RPIB 4ELKA 3VFUA 2ARWA 5E8NB 1MCDA 1U8LA 1KB9J 5IT2L 5IP4A 3QNYB 1DEEB 2AJVH 3MFFB 1L0YA 1IKNA 2P8LA 3T09A 3T0EA 1QLRB 5D7JD 4F9LA 3KPLB 3PNWA 1CU4H 1J8KA 4H5SB 1J86A 1MSPA 4OV5A 3I3BA 3BEWA 2CMRH 5JDSA 4NN6C 4G42B 1PYWB 1BWMA 4PGJA 1QRNE 2HWZH 4QF1A 4J3SA 1MHEB 5JOEA 1JYNA 5F1NA 4PJFA 3L1OH 4LOUC 1ADQL 3UTTB 4HWBL 4KVNL 5IOPA 5JXAL 2I9TB 4ZG1A 1IGCL 1W0WA 3I3DA 1Q9KA 3UO1H 4FQIH 2Q3AA 3CMGA 2HFGL 3DUUB 4NQUA 4JFFD 2V5RA 1LEGA 3IB4A 1AXTL 3P0YH 1EJOH 1MNUH 4WHCA 4MHHG 2CIKB 3I02A 4FFZL 2B5IB 3BZDA 3MNWA 4JM2C 4KKAD 5BZDA 2Z4QB 2BSRA 3D6GA 2IANE 3VWJB 1SMAA 5F7WC 1Q9OB 2HVKB 1OTTD 5ESQB 25C8H 3UTPE 3B8SA 1HILB 3LDBB 3EYUH 3CSYA 5C08B 2YN3A 3MJ9L 2GSGA 4CVZB 1S7WA 3O3AB 4JM2A 1KJMA 3WFZA 2X4TA 2J3SA 5I1KH 1CE1L 4Y4FC 3C60D 4ONFH 4L3AA 3HNTH 3SDDC 4J7RA 2ADFL 4ZPVA 1M4KA 2P7TA 2F8OA 4M7ZB 2Z35A 1YEHL 1HHIB 4WU5B 2ZG3A 4X8XA 4DQOH 1A6WH 2VDKH 2UVFA 5DURB 4N9OB 4Y4KC 1BQHG 3SDDA 3ARUA 1S7VA 3OKMB 4JZNA 1LE5B 3QWQB 3NPSC 4LPTA 2XYCA 2YA2A 3THMH 1GGTA 4M5YL 3A6CH 1A3LH 3LQAC 5JQHC 2JIXB 4JRYD 4G5ZH 1EJ6A 3DNKA 3GJFH 1EBAA 4MLIA 5LCVL 1V8HA 3HNVH 4Y4KA 2BCKB 4OJFH 5GS2D 1JNJA 2YWZA 1D5XB 3TBTA 5C0EB 4Z77A 1FH5L 5DQJA 1WWBX 3GO1H 3U79A 5IW6B 3VXRB 2Y6SD 4K94H 2FJFB 1S9YA 5IHUH 4FMFA 1CE6A 3DMMC 3RVVC 5LAXA 4FP8L 5INDB 4CNIA 1IEBB 2CKNA 1QSVA 4XWGH 4LLAA 2HJFB 1RD6A 3GMMA 3JV6B 1JGLH 4DZBA 1U91B 5F3BA 5CHNA 3CD4A 3HHRB 1T20B 3KPOB 2HFFB 3X11B 3DMMA 1T04A 5DGRA 2VAAA 1KCUL 4PD4K 4HWZA 2HT4D 1CLOH 2GYSA 3VXTB 2VDNH 4MS8D 1KEGL 4UV4L 3NCMA 2R1YA 4JN1L 5FGBC 1GVIA 2Y9RT 5DEGB 2BY2A 1A3RL 3I2CL 4JKKA 4RFNB 3S37H 4TOYL 2X1OA 1IEAA 4UUJA 1KPUB 5E1AA 3U46A 3PABA 1KFAL 1QBBA 2FX7H 3NVQA 4KHXL 1FQ9C 3WNKA 3NAAL 5TGBB 4AL8H 5EU5A 4H8WL 2VLME 1I9RH 3D3VD 5FGBA 2BNRE 4GRMA 1G0XA 1N0XH 4QT5B 3IKCB 2ESVE 2E27H 3FT4A 3U30B 4X9GA 1RZ7L 4AEEA 1CG9B 2QSTA 1A22B 3OKDA 3BP4B 3LKQA 2AXGB 2RQ8A 3C6LD 1U3HD 1E6OH 2EKJA 5SWQA 5IQ9A 3RX7A 1FG2A 3TA3C 4CMMB 1P84K 3B9KD 4QHNA 1PX4A 5ANMA 4PJEB 5KVFH 1T2QL 1G7IA 1TJHL 4MJIE 2BVOB 3DETC 3LRSB 3MLRH 4PJ9B 4N8VA 2K7PA 4JZOB 2WUCH 4OGYL 1YDPA 1AXSB 4NO0D 3IJHA 3QUYB 3TA3A 3PWPD 3WLBB 1LO4L 1ETZA 1A6UH 5I1CH 4ODXB 1I3UA 4MJ5B 3ZZ1A 1AY1L 5JDJA 1S7SA 2J8UA 2YD4A 5A2KH 5GRVK 1NBQA 4NQDE 1MCPH 4DK3A 1FNEA 4YX2H 4JFDB 4U1IA 1NGYA 5CIPA 1B6UA 4ONHA 4X8JB 5F7KC 3HI5H 1DVFB 4S1DD 4ZOBA 4ENEC 3SGKC 1JZ5A 3QPQC 4YK4C 1XGQB 5HYQA 1LK3L 4FTVA 4OKVA 1JPSL 4LCIL 5D5ME 3RWDA 5DS8B 4YHZL 4QRPA 3SGKA 4XT1C 1FO0L 2NX5B 43CAA 3CZFB 4P0DA 5EPMB 4F7EB 5HVHC 1BBJB 2CLRB 5M94B 2VUOA 3UPRA 3K2UL 4RGND 3GMLA 5IM7A 3RWIA 1A7QH 1UB5A 2P48B 2V2TA 3VFMB 1ZHLB 2QQNL 4PTTA 3BP7B 1H8SA 3RTQB 4OZHB 5F1SA 3Q1SH 2C3VA 3HE7C 1CFVL 4Q0XH 1CYGA 3ZKNC 2DIBA 5ITFB 4HFWB 3ECBA 3U4BL 1T1WA 5ECJE 1D5ZA 1NGXB 4CDHA 4EIZC 6FABH 1H5BA 2A77H 1TCRB 3O2DL 4K2UH 1BVLA 4TVPE 3GSOA 2FRGP 3IU3A 2NY1C 3GSNL 2R23A 4ZUWA 3O11A 5HHXL 2X9XA 1K3ZA 3VFRB 1T1XB 2NY5L 1J88A 4KMQA 4N0YH 4M6NL 5J57B 1JZ6A 2MTPA 4PP1C 4G7YH 5JOFA 3W11C 2LQRA 3AB0B 5MEOA 2AJUL 4OLYL 4YGVA 4YDLB 3O3EA 3AXLB 1NMBL 2BNUA 4LMQE 4LIQE 3BMWA 3VD9A 4IOIB 1EO8L 2Q76B 1JYVA 2H26A 4JREC 4Z6AT 3I50L 4Z7NF 1KEMH 3RUGE 3TBVA 1BIIB 3OJDA 4LLWA 2FH6A 5C0AA 2I07A 1DUYA 4GG6F 4PLJD 3MLTB 2A6KB 1N6QL 2I60L 3MV8E 4EBQH 1K4CA 2MJWA 4RRPA 4YAQA 5IW1A 3ZTNL 3A6OA 1K2DB 3ARFB 3QDMB 4XNQA 1J0YA 5D7IB 2JCCA 3H9SE 4S2SB 3L3HA 2Q8BH 1KTRL 2A9NH 3MRFB 5GJTH 3KLAA 4MB5A 1QSFD 2AK4A 5DMKA 3VGGA 1G7PB 5D1QA 2NR6C 1GHFH 3QDJB 4HIHA 3E3QC 3ARVA 2V2XA 4K7PX 1A7PL 5CD5D 2JJVA 1VFBA 3EO1A 4P3DB 4MAUH 4E41E 1UH3A 3ZDYF 4DN4L 4NDMA 1TETH 3TO4B 1T4KA 1EUUA 4WEMB 1G1YA 3LQZB 5EDXA 3LD8B 4YHML 4P9HL 4P46B 3HZKA 4I77H 3EFDH 3LEVL 3VG0L 1N5AB 4PJIA 4P9MH 1DN0A 4NBYB 1HEZA 3VI3F 4POZC 5ESAB 5D9SB 3LEYL 2FO4A 1UG9A 4BZYA 5FECB 1WF5A 2NYYC 2MSPA 4I18B 4X7CC 2UV3A 3KPQB 3TJHC 1JMZA 3SO3B 2B2XL 2P44B 1FYTB 1JGDB 5J12B 3QEQA 1LGVA 4EN3C 3FFCE 3T3PF 4HZLB 3TPUB 4XCNA 3EW3B 3KAAA 3WIIH 4BYHA 3TBWA 4LCWE 2W92A 1I75A 1W72H 2WBJA 4LKCB 2X89A 5I1LB 4NQSA 1BAFL 4NZUH 4EN3A 4WRLA 4G6ML 5EC1B 3LB6C 8FABA 2VO5A 5JW5B 2B1AH 3AUVA 4JDTL 2YMXH 1JVKA 1PSKH 4KK8D 3BWUC 2XICA 2NTFA 5TQ2H 3B2UC 1MHPL 4YBLB 1NUFA 2VITA 3DI2B 4YFLI 4F2MA 1FIEA 4K8RL 2PO6B 3PG2A 3LKPB 2HKFL 1XGYH 1XR9A 2QADC 1QBAA 3SCMB 1H3PH 3MGOB 4Y5XC 5I18L 2H2PC 1H8OA 1OVZA 2YA1A 2VQUA 4IOFC 3HPJB 2XZZA 1FLTX 4OT1L 1NGZB 3HC0B 1HWGB 3CGTA 4XCEA 5F9WC 5D7LB 3W39A 1SM3L 3ZHKA 5HI3C 4HUNB 5FM4A 4XB8A 3FKUS 1RK1A 4MNQE 3S4SA 1TQCB 2YZ1A 5JHDB 4Y5XA 4ZOCA 1IVLA 1OHQA 1WUNT 4DAGH 3QBTB 2ZUUA 3I75A 1RURL 1YY9C 4XNMA 3FMGH 3L3OB 1H3UA 4HJ0C 1YJDL 5JPMB 3QNZB 1P4IH 3LIZL 3VU2A 5C8JA 5JUEH 4GG6B 1S7UB 1UACL 1G7JA 2EDKA 1IAIH 2X1QA 2VISA 1JNLH 3KYMB 2IPTH 3D48R 1F4YH 3M07A 1KCSH 1KTLA 2VLJB 3HN3A 1J8HE 5T33H 3I85A 3QXWA 5IHZB 2X40A 4L4VD 4JHAH 2G60L 3HZMB 4OLWH 4Z7QE 2YSSB 3QFJE 3QXUA 1A7RH 4APQB 3OXRA 5FYKD 3OPZH 3MJ7A 1N26A 2EYSB 4HCRH 2ZUQB 4LLVB 1A7NL 3KVQA 4PBVC 5BRZE 1MRCL 2HN7A 3MO1B 3ZLQC 3UTSA 3QJFA 4FQCH 4V1DB 3AROA 2MQ0A 4DGIL 1QYGL 4LLMB 4OFDA 3MLPA 1AC0A 1EHLL 1V7NH 1NAMH 3NCYP 1TZHB 3WN5C 4PJXA 1U6AH 5LQBH 5DD5L 4OCWH 1KJVB 3BKCL 1RUAH 1V7MH 2VABB 15C8H 1GC1H 1H15B 2W65B 1KYOJ 1FFPB 4F15C 5C2BL 5I1DB 2RR3A 1P1ZB 3D2UB 3IGAB 3OJ2C 5EA0H 1K5NA 3H42H 3F7VA 5I30L 4D3CH 3HCVB 4XMPH 4WI5A 2Y07L 3WN5A 1G9ML 1U3JA 5EO9A 5CJOL 4D9RD 3CXHJ 1U8NA 2Q7NA 1I9JH 4I5BB 1M71B 2Y4SA 2PUQT 1IM9A 1IGTB 1BD2B 5ALCH 4PRNA 3M17A 1K8DB 5EN2B 3EGSA 1IJ9A 3GSVA 1OM3L 3ZL4H 4KJQD 1CICB 4LARH 3MV9D 3TYGL 1T03L 2ZJSL 4PRHD 2WIMA 3T2NH 1U41A 3SGDH 3GMNA 1MFCH 3O8XD 3NZHH 1QBML 2X4PA 1UYWL 1U58A 1R3JB 3OGOE 4P59L 3RWEA 3DO3A 5K9JH 2VDRL 3GSXA 4I0PD 3QI9A 3CDCA 5JZ7D 3ULVE 3MR9B 4LEOB 3T0EE 2R2HB 3TV3H 4L8SB 4RMRA 3HUJA 5L0QC 3MCKB 3RIAK 5D7JC 4PJGA 3HPLA 3ZHDA 1C16B 4O4YH 2AQ2A 1R24A 2OTWB 4QY8B 4D2NA 2EDHA 4NZRH 4JEGB 4ZXBB 3Q48A 5KVEH 5HSFA 4PJFE 3U7WL 4JRXE 5D7JA 2BY0A 1MCCA 5I1HH 4Z8FL 1UM4H 4CMHC 1KLGA 4PJ5B 4Q74A 3W9EB 5B38G 4KRPD 5BMFL 2BHYA 4KI5E 3WFBH 4GAGH 3OZ9L 2YA0A 3P73B 3IJYA 2OI9C 4LQFH 3ULUD 3Q5OA 3CFKB 3QRFM 1S7QB 3VFTB 4UTBL 4YDJB 5JW4R 2F54B 1F6LL 4JLRA 4S1QL 4YXLL 1OTTC 2QSCH 1BREA 4F80A 5ITBH 1FNGA 1CFQB 4G9DB 4YC2C 5HGGS 3QEUA 2QR0A 5C0BD 1U8JA 4WCYL 5L2JB 3DVGB 3EYOB 5AD0A 4U6HB 5I19H 1TVBB 2Y5TB 1FVCA 1UA6L 4JO1H 4UDUB 1J1OL 3RGVB 3C60C 5GSRB 2XTJE 1SEBB 3SJVB 2AV1A 3HG1D 1Z6JT 5IESH 4FQ1H 4JM4H 1LE9A 5K59E 1B9ZA 4PG2C 5DJ8B 4N90E 1JYXA 4LHUG 4D0BA 1D3CA 3BW9A 5KSAB 1IFHL 3OAUL 5HYEA 1PX3A 2H9GA 3HR5A 4M6OL 5DK0B 4NKOA 2YD9A 4MA1C 5CCKL 3C60A 3JWDL 4P3CL 5EU7E 3SDAB 1UT9A 2IBZY 3WFDL 2R56L 3QUMA 4X7DC 2X4NB 1QKZH 2J6EA 2YC1A 2Y7QA 1AHWA 4OLVH 4L3EB 4HC1H 4PG2A 1X6NA 3WNPA 1JPGA 1UQSB 3Q6GH 4U7KA 1VESA 4LSTH 3B4NA 3FT2A 1H0DA 1T1YB 5DRWB 2AJVL 1S7TB 3V6OE 2OJEB 1ORSB 3BP5A 5IGXH 5B39A 1EAPA 5CJ8A 4ALAL 4CVXB 3CFBB 5HGHB 5IFJA 2Y6SC 4JRYA 4QTIH 4AK1A 5E6ID 5A43C 1GXEA 5A2JH 2EH8L 5DRNB 2ICEA 2UUDH 2B20A 2C4FU 2E8YA 2VLRD 4FFVD 1Q72H 3IS0X 5EUKA 3MLXH 1J0JA 1NGWA 2FLBT 5DJ0A 3L1OL 4LF3B 3LY6A 5T1MB 5IFAH 5DHYB 3EDFA 4MNHA 1DE4A 4P23D 4X6EB 1PLGH 3NTCH 3BRDA 3C5ZD 1G9NH 3UO1L 4FQIL 3JTSB 1LDSA 2X09A 2NXYD 1CXKA 5HI5D 3VD5A 2HT4C 3ELAT 2XKSA 5EBMA 3P0YL 4QXTB 1MNUL 2QQKH 4JPIB 4ZUVB 2VKWA 3C6SA 5EZIH 3U9PH 5MEND 3O6LH 4LPYA 2AJSL 4OZFH 5B38B 3ZE2E 3H0TB 2H32A 3QQ3B 2FX9L 3BYYA 1MPAH 3TBSA 5IB5A 3MBEB 1CDJA 2A74B 5A16B 5IBUB 2PTTA 2FATH 4KTDL 5EBLB 1Q38A 4OLZH 4G8EA 4W6YB 5I1KL 3RI5K 2VZSA 3VD4A 4ONFL 4BH7A 3HNTL 4BSWB 1MAMH 1CD1B 1OAQH 3Q3GB 1BQHA 3RIAF 3WNMA 1SBSL 1IGJB 1Z3GH 4DQOL 2GK2A 1A6WL 3C6LC 1U3HC 3BKMH 2MMXA 1ZKAA 2O5ZH 3D3VA 5F7HA 4PY7B 4XP1H 2QQLL 5CZKA 4QHLB 1MFNA 1T0MA 2UWEA 3DOSA 1WIOA 4XP9H 3THML 4MSWB 2AJ3B 1CLYH 2ZSVA 3MJ8A 3A6CL 3KJ6H 1A3LL 5C2UB 2HRPL 1AGEA 3C6LA 1JK8B 1U3HA 1C5BH 1CT8B 4HGWA 1AGCB 1HQ4B 1UVQA 3HNVL 4J6RH 4OJFL 3B9KA 1DL7H 1N4XL 3F62A 4EUPB 4R0LB 3GO1L 1HZHH 3QPXL 5IV2A 4K94L 4NO0A 2ZUTA 4EJ1C 5F44A 4J3VA 2EO9A 4TSCH 3PWPA 4Z7QF 4S1DC 3PDOA 2DYPD 4FS0A 4M1DH 1WZMA 5E7BA 5J6HB 2GITB 3NH7H 3G04A 1FN4A 3O3BA 5HPOA 1JGLL 1Y6NR 4HXBL 3UBXA 3C5JA 4QRTB 1UKSA 4WW2A 4QRPE 2QEJA 2XT1B 5H35B 5HYJB 4XI5D 2R29H 4DW2H 3EIFA 1CLOL 1HNGA 3P4OA 3ILQD 1C5DB 3ZDXE 2VDNL 4RGNC 2GJ6B 1DLHB 2VZ1A 2X4QA 2IBBA 3V7AG 4OCXH 5LBSH 5E6ZA 4FQXD 3S37L 1NCTA 5GRJH 4MD4A 4KV5E 4K71B 1A6AA 3WL9B 1QBLH 2EC9U 3OB8A 1OLZA 1JZ4A 5BCAA 3TN0B 3MACH 2BVYA 4AL8L 5J9PB 5T3XE 1NCAL 3ARGD 4XVSH 2P8PB 1WEJH 1N0XL 3X13B 1MHHB 2OP4H 5LG1A 5ABDE 2E27L 5DWUH 3QUKB 1L9MA 3GB7A 5LVEA 1S5HB 5HBBA 1FO0B 1E6OL 4X83A 4XBPB 3GIZH 4M48H 1T83C 2OTUA 5E8DL 5GS0H 3C8HA 3NOIA 3RAJH 4KJPD 3MLRL 1A64A 5HJ3B 2WUCL 2XZCL 3RWGA 2YPVH 4OCYH 3MYJB 1E27B 2FIKA 1AGBA 1T83A 2RBLA 5C0AE 3HLAB 1RHFA 3DIFA 1A6UL 5I1CL 2D3VA 4LQ1A 3QG6B 5GJSH 5FV1L 5C92A 4PRBB 1A4JA 4KI5F 1MCPL 1JL8A 4YX2L 3S9DB 1I85C 1ZA3A 2JCCE 4WFGE 3GSNB 3H3BC 5C0FA 4WIQA 5DJYB 1YEGH 3HI5L 4YXKH 2H6PA 2AK4E 1AE6H 3MRPB 3VFGL 4PLOB 1P2CB 1HHKB 4X9IA 3JV4A 3MNZA 1GL4B 5GIRA 1BZQK 4PGBA 3RKPA 4Z0XB 5BQ7B 1I85A 1RIUL 1XEDA 4U3XA 3FFDB 5CD5C 2GTZB 3VRIA 4K3EL 3RI5F 1T22A 1VGKA 2H45A 4P4KD 4CRPA 4QNPF 4XPGH 1H8NA 4OZIE 4HDIB 5CEZH 1QSFA 2W0LA 4PRAB 4PJIE 5IG7A 5T1KD 1FNHA 3LN4B 5DEFB 1G6VK 1YN6B 2GW5A 1T7VA 1R3IH 3O0RL 1U8OB 3HKFA 3VXMA 1KUMA 1TZIA 1NJ9B 1X7QB 3KYKL 4Y4HD 1M7IB 2DM2A 3DSFH 2A38A 2DQDL 4N9GB 3BVNB 3BJLA 1I7UA 5CBEB 2V7NB 2BOBA 3BPLB 4BZ2H 4LPXA 3B6SA 4FQLH 1HSAA 1GJIA 1OAYH 4JKPL 1VFUA 3QEQE 5DT1H 1XGUA 4HIJA 4XGZB 2DLFH 4HS8H 2OZ4H 5DFTA 1MFAH 1EEZA 5CP7A 3IXTA 5DUML 5FM5M 3C08L 2P5WD 3FQNB 4N0YL 5EZOH 4EEEA 1OARH 4G7YL 3PQYB 2NY0B 2FNBA 1BEYL 1XFPA 1RHHA 3UTTD 4LBEB 4KDWA 3KJ4B 1MRFL 3VFOA 5CSZA 5EZLB 5JW3H 2VKXA 1U8PA 3NZ8A 4KK8C 1MCHA 3SKNA 3NMEA 3IDYB 2C1OB 3UJIH 3F65A 3E1F1 1IAII 4XXCA 5TPWH 2CQVA 3QHTC 3MRJA 4R6UA 4EBQL 2IC2A 2P24B 2X70B 3BSZH 5HHMB 5HGAA 4GT7A 1ORQB 4OI7A 3QEGH 4I9WD 3KNBB 1B6DA 1I1YB 2Q8BL 2VL5B 2D31B 5GJTL 5HHOE 5TFSH 1X4XA 2E6QA 5L6YH 1ZK9A 4TTDD 4NFCA 3VXSB 2F53B 3NIFF 1CFSA 1RFDH 1V3LA 4L3CB 2Q86B 4ORZC 4RX4D 1YC8A 2G5RA 1DQDH 2VWEC 4NCC2 4OD3H 1TETL 3ARTA 4K55A 2C1PA 2CLZA 3BZ4A 5L9DH 4F8QA 4PJCF 3FO2A 1VDGA 3CFJA 4WW1A 1LQSR 3U83A 1JRHH 3BN9D 4I77L 5ADPH 3EFDL 2I24N 3WEXA 3MRDA 4P9ML 4YFLF 5F9JB 2EC9T 3IDGA 4EVNA 2XTLA 1OSZB 4O00A 1RZ8B 1ZHKB 3QIWB 2WINA 3DSNA 4O51B 3RY6A 2CGRL 2MKLC 2JIXD 5AYQA 2W9DL 3CPLA 1K4DA 4DEPB 3MCLH 3KWWA 5JLZA 4ETYA 3GJFK 3GJEB 4OM1L 4MJ6A 2ZCHH 3WXWH 4EQ2A 3BXNB 4JKMA 1EGJA 5FYLH 1TPXC 3O9WB 1CLCA 4MZ3A 3FONB 5F3HA 3EYQD 3AVEA 2AERT 4Z5RA 1YPZA 3DBXA 4BK5A 3SGDI 3VFSB 4U6YA 3VXRD 3P0VH 4WDIB 1PKQE 4L4VA 3QXAA 3WIIL 5I66B 5C3LD 3C8KA 1W72L 4Z76B 2EDYA 3D85D 3P77B 1D5MB 1W8NA 4NZUL 4BSVA 1I8MA 4WTWA 5DSCA 2F58H 3V2AR 2B1AL 2VLLB 2VXVH 4ZS6D 1PSKL 1MJJA 1RZKC 3KPSB 5FUZL 4X6DA 2VR9A 5ALBL 4DVBA 5KG9A 3BUYA 4KK9C 1CFTA 3OKOA 3MGTA 4NRZA 3WFHA 1G7HB 2Z8VC 43C9B 1MVUB 5F70A 2XN9B 4FFYH 1B0RB 4MCZA 5EWIH 3BWAB 4PYGA 1G1CA 1H3PL 2ZZUT 4N0UB 1FNSH 1VFMA 1MAJA 1YQ2A 4KJQC 3HB3D 3WUWG 2E6JA 3QIBD 2EIZA 4PTUB 5DRZA 1FZOB 2FWOA 4HJGB 3VA6A 3QDGE 3L5XL 2E9JA 3L9RA 1JWUB 3NGBC 2ADJB 2UYLA 1C12A 2OR8A 2SEBB 5JZ7C 4I0PC 4HUUB 1BZ9A 3MV9A 4PJGE 1MJ8H 3E6HB 4L9DA 1UXWB 3AREB 4PRHA 3RNQB 3SQBA 5D2LA 1AD9A 1U92A 2XWTB 4JFYA 3RKDC 12E8H 3O8XA 3VGFA 4PJHA 1FVDB 3IDNA 5DQ9A 1P4IL 3F12A 5JUEL 2X10A 4I0PA 4E42A 4UB0H 1DQQA 1JNLL 1JZ8A 3Q5YA 4Y2OA 2IPTL 3OX8A 5AZEH 1BM3H 1OP3H 3RHWK 1F4YL 4NGHH 1KCSL 5E08L 5T33L 1IL1B 3HZVB 1KNOB 2YR3A 2AEQH 4KRPC 1WBZA 2AJZA 2BFVH 4U1GC 3WO4B 4JHAL 4OLWL 3TNNB 2F5AH 3ULUC 3JSSA 3P9LA 4AEFA 2WQ8A 1A7RL 2EYTA 2RHEA 4JFDD 5E5MA 3OPZL 4NN7B 1B88A 3PL6D 4HCRL 4KDVA 1T2JA 3T0XA 5H94B 5F93C 1JHLH 5BZWA 2EKSB 4PJCB 3DXAB 3BD4A 3LKOA 4X0KA 2ZOKB 1V7NL 1NAML 4BQCA 1U6AL 1WFNA 5LQBL 4OCWL 2BVUA 1XGTB 2C9AA 1V7ML 2FR4A 15C8L 1GC1L 2R4SH 4NP4H 2EDXA 2A6IB 2FJGB 4HG4J 5E6YA 3CFDA 3D9AH 5DXWA 5F8QC 1ZVYA 4F58L 4Z78B 5IB1B 3N85H 5FYJD 5EA0L 2NX5D 1L7TH 5J06A 2VE6A 3KPMA 4D3CL 4XMPL 4N0FB 1C1EH 1WBYB 4LLQB 3MOBH 4HGKC 5C0BA 1I9JL 1XGPB 2YPKA 4WWKB 5ALCL 2PXYD 4IMLA 3RTQD 1ZEAH 3GMPB 3ZL4L 1PY4A 4ZMAT 1ZANH 5IEKA 4LARL 5JORA 3Q0HA 1A9BB 4KZDH 3HG1A 2OM5A 1N3NB 4U7MA 1MFCL 2DMBA 3RWCA 2H41A 2OXGA 5E8EA 2DD8H 2J2ZA 4Z7WF 3DVFA 5E94B 4ZPTB 4P2QB 3TV3L 1OTSD 4HSQA 5DA0B 1BHGA 3UYRH 5C09B 4O4YL 4JRYE 5CKAA 5DYOA 3HAEB 1PG7X 2IPUK 2PYFB 1HQRA 4P5KB 4NZRL 5E6IC 5T5NG 5KVEL 4FQPA 3B43A 1QLEL 2L0DA 3DRQB 3IRPX 4FFVC 3BGFC 1MI5B 3L3KB 4M1CD 1XCQA 2XI9A 5DQDH 1QFWH 2DQHH 4KJWD 4GKSA 4LSVL 3TVMB 4NNXB 4P23C 4L5FH 2CRYA 3DVNA 3C5ZC 2DLEA 2A6JA 3WFBL 4GAGL 5E6IA 4HUXB 4U1LB 1UGNA 1KACB 2VLRA 2BERA 5HI5C 1NBZB 1X5HA 3ESUF 4ZD3L 3CFIC 5DJDA 4LQFL 3NABH 2HFTA 1RZIA 3FL7A 4P23A 1F4AA 4WFED 1ZLWH 2FJHA 3C5ZA 5C0CB 4XXDB 1HSBB 5F7EH 3FQTB 4IDJL 2QSCL 3L6FB 4HH9B 1REIA 4ZUUB 3EFFA 2K9UA 1YEJH 1Q9WA 2VDPH 2Z92B 3AU1A 4X6BB 5ITBL 1QHPA 1T5WB 3L95A 3RA7L 4TULH 3V79C 1AO7B 4LCUB 3IFPA 3KYNA 4ZSOA 2IMNA 3PGDB 4AQOA 1I4FB 5I19L 5MENA 4UQ3A 5IVXF 1GGUA 4D0DB 2BVPB 3TO4D 4HKZA 5GRWA 5CJQH 1CBVH 3IJSB 4JANB 2NLJA 1DBBH 3BUTA 5IESL 2F9BT 3SDXF 4H1LA 1B2WH 4NKQB 4PLNC 1U8HA 3R1GH 2MKWA 3D3VE 3L7FA 1YYMH 1Y0LA 4UOW0 2BJML 1RPQA 1KG0B 4ZDHA 4RBPH 5EIQA 3IDUA 3JWOC 3LQMA 1OPGH 3RHWF 4HK0A 4GUPA 1HN1A 3ZKXC 4OLVL 4HMCA 3BX7C 4HC1L 1SQ2N 3LKRB 5IB2B 1FYTD 3O3UN 4HS3B 3ARXA 4LRIC 3V5KB 3QO1B 4R4BB 3GSQB 2O61A 1I7RA 4LSTL 1U0QA 4J12A 2H3NA 5JOPD 4U1MA 5EO0B 3QUXD 2BSSA 5E56A 2HG5B 3HA0A 3U9UB 3OR6B 4PUBL 1RZJC 4IMKC 3BEVA 4LU5H 3PWPE 4WI3A 4GSDH 2LV4A 1DEDA 1T0NA 4QTIL 3VRJB 3FN3A 4HUVA 2FSEB 3KPRB 3MLXL 4OCLC 3SO5A 3EDJA 4PB9H 4MZ2A 1RJZB 3U1SH 5IFAL 5I6XB 3D25A 3ZTJH 1JPTL 3VCLB 1PLGL 3NTCL 2KUTA 4NQEB 4MMZC 2NY2B 3W9DB 1G9NL 1WGOA 4RAUB 5D4QA 5L8LB 3VXUD 4BKLB 4XI5C 4X7TA 3T65A 2DYPA 2PO6D 5JIPA 2GI7A 3DX6B 5FUOH 3ILQC 2XPGB 1DQJB 2XQYG 2L7JA 3HZYA 1MCOL 5CZXD 2DIJA 3FO0H 3GJFB 3QUMH 2QQKL 3SCMD 1FV1A 5CMAA 5C0DB 3D39D 3UJTH 3KPPA 4Z7WB 5EZIL 3U9PL 3O6LL 4X4YB 3BYTA 1JNHB 4M4PA 1R5IB 4UT9L 2AAVA 2OQJB 4DGYH 5D7LD 4KTEL 1KPVA 3U4EA 5DMJB 5ADOH 1MCKA 2IG2L 3S97C 3ZYOA 3MA9H 2IPKA 3QQ4B 5E0QA 3QYCA 2JTDA 2QJDA 5FGRA 4QRUA 4JG0H 4OLZL 3T8XB 2AQ1A 3KXFE 3U0PB 3ZDZF 4FQXA 1QRND 3ARGC 3CLFH 4S0SD 4LLUA 3AS3A 3G6DL 4XWOD 1MAML 1OW0C 3S35X 1BJ1J 1OAQL 5GS2H 4I3GA 1MH5A 1Z3GL 4D9LH 3BKML 5H2BB 2O5ZL 1S7RA 1GZQB 5E03A 5EUOF 4XP1L 3VW3H 5EU3B 3ARGA 2BSED 4DKDC 5C0IA 3FB6B 3IETA 5J11C 2VLJD 5EFIA 1OW0A 4XP9L 4TYUA 3GSUA 4KJPC 1CLYL 3K4ZA 4NOFA 2P49B 2CLVB 3KJ6L 1OY3B 3GHEH 3B9EA 3HMXH 3O6FB 3PWVA 4XX1E 5IIEB 4KFZC 2A83B 2R2CA 4I2XA 1UCBH 4NUGL 2IAND 3HNSH 4U05A 3MRLB 2R1WB 4HIIB 1DL7L 1DDHA 2BMKB 5KSVA 1KTDB 1KCRH 4Z0BH 4Q97A 5IVXB 1FL5A 1LEKA 1M7DB 1Q9LB 4M6MH 1XCTA 4V1DD 4N5UA 4YDIH 2VLKB 3MRHB 4Y5YB 4QTHA 3SDXB 1QPXA 3UYOD 4M1DL 5ERWA 3NH7L 1GCFA 4IDLA 3GI9H 3PWJA 4NC1E 4Q6IC 3RL2B 1H9VA 5HY9B 4UOJA 3DURA 3D2UD 5GGUA 2Q20A 5AEAA 3VH8A 4JZJC 4M00A 1U8QA 4LCCB 2R29L 4P4KC 5DRXB 5DVMA 1M05B 1NMCB 3PDGA 4YIQA 4Q6IA 2ED9A 3G6AB 1QR1B 3VXME 1MJ7H 4GXVL 3MODH 2EE9A 1AP2A 4MXVF 2NW2A 3TEUA 5LBSL 1CICD 4LPVA 4JZJA 4YHNB 3RL1A 3FZUD 2IMMA 4Y4HC 4P4KA 2D4FA 3MRRB 4NUJA 2FEEI 3I84A 3OR7A 1QBLL 1P69B 1UWEH 4TSAL 5T1KA 3ZYIA 4PGCB 4RISL 1U95A 4ODHH 1Z5LB 5CILL 4HJJH 3NACH 5CUSH 3VGEA 3MACL 3QCVH 1KT2B 4HKXB 3T77A 3SPVB 2AGJH 2O93L 4Y4HA 3MGAA 4NRXA 1WEJL 5JA9A 4PV8A 1ACYH 5I8KL 3VXQB 3TC9A 4TUOA 4HV8B 4A6YA 3NIDE 5DWUL 1MHCB 2RFXB 4ZXBD 4R26H 1ODAA 4FXKB 3GIZL 4M48L 2IH1B 3WIHA 4TRPH 3MFFA 5I16A 3DPBA 1QLRA 3KPLA 1BPVA 1FAKT 3RAJL 1B90A 1YECL 1JRHI 1PYWA 5GGRB 4HWEH 2P5WA 3PV6B 4WO4D 2YPVL 4OCYL 1O0VA 5BS0B 4ELMF 1NCWH 4UNVA 4QWWD 4LGPB 4KMTL 1WCBB 3JBG7 4G80B 5GXBB 1XF1A 2DQJH 1XF5A 2ZUVA 5GJSL 2FH8A 3UTTA 5DD3H 4K3HA 1UH4A 3MX0A 2I9TA 2B5IC 3DROB 1SY6A 4U1JA 4G6AD 3GBNL 1DQMH 4ZYKB 1LVEA 3QCUL 3DUUA 2FZ3A 1YEGL 1E4WH 3FRUB 4HBCH 4MNGB 4YXKL 1BGXL 1RUKH 2IADB 5FIEA 4TTDC 4KTYA 4L9LC 1A7OH 4CBPA 4U3HA 2CIKA 3P30H 2JB5H 1A4KB 4JE4B 5EOCH 2EXYD 2DQUH 3SDCB 5EOCJ 2Z4QA 5EUOB 3NIGE 4JO2H 1J9CT 2HVKA 5MEPA 3FOMA 4R4ND 5ESQA 4U1NA 3VE0A 1JV5B 3H7LA 4PJAA 3SJVD 5IB4B 1HILA 3U7YL 4L9LA 3P2TA 4MQSB 3O3AA 2EDOA 4MJID 1R3IL 2VWEE 2V5SA 2HLFD 4RX4A 2JB6A 4XNXH 4LPWA 2LU3A 4G8FB 3VRLF 3DSFL 2HTKD 5ACLA 4GJTB 4L3ED 5J6GB 1HHIA 5SWZE 4WU5A 4BZ2L 1WISA 3TZVB 1A1OB 1P4BH 1T66C 3DLQR 5E2TH 5BXFB 1OAYL 1FFRA 5DT1L 3OKMA 3EYSL 1ZS8A 3OKYA 4HS8L 4U1HB 4D0CB 2OZ4L 4W4NA 1S9WA 3EYQC 4L4VE 3NFNB 5MEQB 4EXPX 1TIUA 2JIXA 2I27N 1VADB 3EJZD 5EZOL 4WU7A 1OARL 1SYVB 4KMLB 2UUDK 2BCKA 3GMOA 1TENA 4MCYB 2AJXH 5GGTA 1D5XA 5C0EA 3QZWB 5IJVB 3NA9H 5I76B 4XPHH 5I2IB 3GDBA 2AKRA 5JW3L 1PY9A 4X6DE 3L5HA 4ZS6C 3VXRA 2YK1H 4B0MM 1IEBA 4D8PB 4LSSH 3MMEB 3UJIL 2HJFA 3OTTA 3D85A 2FEEL 3QHZH 2IAMC 4P2OD 3B9VA 3QWRD 4CJ1A 1T20A 2HFFA 2PYEB 4U7SA 4J4PD 1XZ0B 4AH2B 4G6JH 3IDJB 2P5EB 5FB8B 4U6VH 1QFOA 1KIPA 3HB3C 4XRCB 3QIBC 3VXTA 5L6YL 4D9RE 3JWNC 3H8NA 1FNFA 5CP3H 3T0DA 2CK0H 1R3LB 1W72B 4JPWH 1RFDL 4OM0H 1MWAA 1ZT7B 2HYMA 3KPNA 4ZODA 3MSPA 5KAQG 3D0VA 4RZCB 3MV9E 1TVHB 4J1UB 4NZTL 4OD3L 4DJMA 3QIBA 5L9DL 3U30C 5A1AA 4MDIA 5M95B 1JRHL 4GS7C 4ELMB 4PGZA 1RVFH 4PJBF 4G3YH 1J0KA 3IKCA 2VDQH 2C5DC 4CL7A 4HKJB 1CG9A 3MLSL 5KZCB 3BP4A 1WFOA 3T3MF 2AVGA 3MV8D 1QSEB 3MCLL 1JUFB 1HINH 2WIIA 4CMMA 1IC1A 4XBGB 3W5MA 1RJLA 4JPKL 3S34H 1T5XB 5MERB 3WXWL 1EMTH 3RWJB 4WI4A 3H9SD 4YPGA 1JTPA 5F7LB 2BVOA 4P2RB 1F02I 5FO8A 1ZA6B 2I5YH 4LVOB 4JZOA 2W0PA 5FA3A 3PL6C 5B3JE 1AXSA 3CDGB 1YN7B 3P0VL 1JF1B 3UTZB 2HLAB 1MCWM 3WLBA 5IB3A 3F7YB 4JN2A 1PEZA 4J23A 4ODXA 1DFBH 2AW2A 1G6RA 2ADGB 4HPOH 4WTZA 1MFBH 3ULUE 4YXHH 1YYLL 4O5LL 3EJJX 5ESVA 5CEZE 3U0WL 4JFDA 1J7VR 3I6GB 4O2FA 2VXVL 3PL6A 4OQTH 3TESA 3RUGB 2B8OT 5DDHA 5HYJD 3WHE0 5EBWB 3TF7C 4W6WB 5EC2B 3U36A 1DCLA 3MRIB 1YNTB 5EOTB 5C0BE 2GJ6D 3KLHD 2YUXA 5C6TH 3MJ6A