3PDDA

Structures of clostridium thermocellum cbha fibronectin(iii)-like modules
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
190
structure length
190
Chain Sequence
MVTIDSPVAGERFEAGKDINISATVKSKTPVSKVEFYNGDTLISSDTTAPYTAKITGAAVGAYNLKAVAVLSDGRRIESPVTPVLVKVIVKPTVKLTAPKSNVVAYGNEFLKITATASDSDGKISRVDFLVDGEVIGSDREAPYEYEWKAVEGNHEISVIAYDDDDAASTPDSVKIFVKQARLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase, family 9
publication title Structure and function of the Clostridium thermocellum cellobiohydrolase A X1-module repeat: enhancement through stabilization of the CbhA complex.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Unknown function
total genus 32
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17957 Big_7 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pddA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pddA01
3OG6B 1ZT7A 5KN5B 2MQCA 4GXUN 4EN3A 4XNUL 3VFUB 4JRXB 1E4XL 3MBXH 4MAUH 3VXRE 2X4PB 2WW8A 3LKOB 2GTWB 3OHXB 1ZLSL 1UH4A 4KGLA 2XACC 3IRPX 2ZCHH 2F54A 2F58H 2DDQH 1A6TA 4ZUSA 3LQAL 3U4BH 1XGRB 1HZHH 3CVIL 3LKRB 3ARFB 4S1RL 4F9LC 1G7PA 2FX9L 3DMMD 3MRHB 4L3EE 1TJIL 3QIWA 2YUWA 4MA8L 4WUKH 5JW5A 3BN9C 2GQHA 5A3IC 3OPZH 4I18C 5IV2B 3GMRB 3MV8E 4FQIH 1KLGB 3KPTA 4XMPH 5D7LA 4PGJA 4P2CG 1CXHA 3VXUD 4N0FA 2KBGA 4NZTH 4XCYA 5ICXB 1I1YA 1FIGH 2DQJL 5M94B 4PV9B 1YNLH 3B9KA 1CVRA 3AFLA 3I84A 5EA0L 3U7YH 1A7QH 4WI6A 3WUWG 2NLJA 2NY7L 1VERA 2Z31A 6FABH 2R4SH 1JPGB 2ORBL 2QSVA 3RDTD 1CS6A 5GRZA 2DMBA 4QRUB 5IMMA 1DBAH 3EBAA 1OAUL 1RUMH 4M7ZC 3RX8A 4PY8J 2AJYH 1M05A 1Y18A 4I1NB 2DLIA 1H9VA 5J11B 3ZMRA 5MERA 1D3CA 1MAML 5IB5A 4Z7OF 1ZE3C 2E27H 3F7YB 1FAIH 5DJDA 1A4JB 1FO0H 3C5SA 3H9HA 4Y2DD 1QQDB 2RAMA 1IT9L 2HFEB 3TYGL 3DXAB 5CFHA 2CXKA 1BBDH 1MJ7H 5J89A 3HG1E 5JUEL 4C55A 1EFQA 4WU7B 2NY6D 5L2KA 4JPKH 1OAXH 1Z9OA 3U2SA 5C0IA 4P5TD 7FABH 2XZQH 4PJXB 1JGUH 1BJ1H 1GC1H 5EO9B 4X80H 5F7YC 1YEGH 4P59H 2DAVA 3EYUL 5DD0L 2CRYA 4ZO7A 4JM4H 4JVPA 2FJFA 3NFSH 4P57A 4NQDB 5TQ2L 2F54B 2NY1C 1AE6H 4XWGL 3JUZA 5I76A 1A6TB 2VLJD 3AC0A 3NFNA 5BW7A 1HH9A 3G5YB 4U6HA 3RZCB 3FQWA 3O2DA 5KJRL 3BD4A 2ED9A 4MNGB 3ARZA 5I0DA 1ZMYA 2J88H 3AM8C 3B6SA 1Q9OB 4AEHH 1CDIA 3GJFA 4LMQE 3WXVH 4WFEE 2AEPL 4M6AA 5KOVC 3TBTA 2BXYA 1KPVB 3B9KB 5DVLA 2FO4A 2GT9A 3QULA 2RB8A 3FFCD 1YYLL 2GJJA 1OTTD 4LFHD 4NKMB 5DK0A 5A43C 4JFEA 3X14B 4DFIA 5C0BA 4C56A 4UIMB 1JVKA 3UYPA 3EJYC 1S9XA 5D7JD 2YXMA 2YD5A 4LNRA 5FV1L 1BREA 1Y0LA 5B3JE 4ZSOA 4NKDB 4KJPD 4WHTB 5GGUA 4OFKA 1Y18B 3LZFH 5GSVB 3CDFA 4HDIA 5DZLA 5K9KA 3V6ZB 4P3CH 4LCWE 4W70A 3BRDA 5IVXB 3C5SB 1EHLH 5D7IE 3D0VB 4MAYA 3NCJH 5HDBF 5D8JH 2HRPH 1UYWH 4KRMB 4N5EC 4TSCH 4WGWB 4JPVL 4U0RC 4KRPC 1GSMA 2J8UE 3ULUC 1RI8A 3MROB 2X1QA 1BEYL 3MLWL 2AK4E 3GK8H 4OZFH 1IEHA 4WI3A 3F58H 4KY1L 2IBBA 1EPFA 1XF5B 3SDAA 3I2CH 3WFBH 4LU5H 5DR5L 4P57B 3AU1B 5FYJH 4YPGA 5I76B 4RFNB 5TE4H 3RPKA 2ZSVA 1P4LA 1H3GA 3TJEL 3QO0B 4R0LA 5C6PB 1HH9B 2O5YH 2B4CH 3ROOA 2VQUA 1LO4H 1ZOXA 4LIQE 3LIZH 4KRLB 4XC3H 4Y19E 1C5DA 3AAZA 4LPXA 4WUUD 1RUAH 4KVNL 4AEFA 3SKNA 2HLFC 3SJVB 2BFVL 3B6SB 3JWOL 4XAKD 3MODL 3C5ZC 4Q9QH 3S6CA 4P23B 4YDLC 1MJ8L 3UYRH 5DFVC 3VJ6A 4LP5A 2EEBA 4NO3A 1X5AA 3BKJL 3HAEA 3QULB 4Z7UE 5E99H 4JFYA 5D1QC 8FABB 3O2WH 5J6HB 5DK0B 3BFOA 2XRAH 4JFEB 4LSPL 1NC4B 4UQ2B 4QRPA 1A02N 1IKNC 4OZGB 3QUYB 3JWNC 1QG3A 1IFHH 5F96L 3BO8B 4YXHH 3TP4A 2WQ8A 1U58B 3G04B 2Q7YA 2PW2B 3U0TA 1ZLUH 1FPTH 3DX8A 4UV7L 2YK1H 3X3GH 2IH1A 1WZ1H 4F33B 3BOVA 2YD3A 1ZVSA 2C7UB 4PJEE 1Y0LB 4LVHB 2ADIA 1VDGA 5D1XC 4ZSOB 4P5KA 5JA9A 3FHQA 1XFPA 1HDMB 4G5ZH 2VZ1A 1GPOH 4PJ9C 2ZUXA 2WLZA 3SDXB 2M26A 4POZC 2VLRE 3WNNA 4EDWH 3HR5B 5K93A 5IB3B 2P1YA 2IAND 2E8YA 4P2YA 1CDGA 1AIFA 3H3PH 4ZS6C 2YUVA 3HB3D 1HH6A 4M03A 3GHEH 3N85L 5DMKB 4LKXA 4ZXBA 5GS0H 1GGBH 3MNVB 1OP9A 5E6IC 4LVOB 4MQXD 2ATPB 2IEPA 2X10A 2WANA 3KS0J 1H15A 2GJZB 4OTXH 3W9DB 1BMGA 5EO1A 3GBLA 5C08D 1XGPA 5CBEB 4X6DE 3QFJD 1JIBA 1ACYL 1TZIA 4YPGB 3RX5A 5DQ9A 1DBBL 2ZSVB 2MOVA 4Y4KC 2A38A 1YNKH 3NACH 4PJ8A 5C0AA 3BPLB 3ROOB 2EDJA 4KQ4H 1QSEA 5DRXB 4JM2F 3LPWA 4I48A 5FM5O 1CGSL 4JN2B 5BZWA 2BVOA 2RGSA 2VERN 5CSZA 3QR2A 1EO8L 1ULVA 4X6FB 3FCTA 5TPWH 3MNWA 1YEKH 1YMHA 2ZPKH 3UTTB 4JJ5A 4PB9L 4XRCB 5K9OA 4HLZG 3MRDB 4JO4H 3O3EA 4NO3B 5A2KH 4Z77A 3EOTL 3KWWB 3HAEB 1S9YA 5CLTA 5HGDB 4JFYB 3OAUL 2R8SL 1HIMH 1MCCA 1D5ZB 5T3ZH 2NY4D 2VLKA 1FIEA 2NY3D 4DWHA 2VR5A 5IR1B 3HHRB 3O3AB 4PJGE 4EI5A 3LS4H 5DQDH 3O9WC 4OKVB 4XAWH 4NO2A 4OGXL 5KSBE 3VD3A 1GHFL 2FX7L 4PRHD 3ZKMC 3LB6D 2IH1B 5GQBA 4HULB 4GRLC 1CXFA 4CADB 4KV5F 3ARXA 3SQOL 1S7RA 3K4DA 3T0WA 4Y2OA 5D70L 4D3CL 5ESVB 4CVWA 3B5HA 2A6DA 3MRJA 4WEBH 1E4WH 1ES0A 1TCRA 1HH6B 2IAMC 1M4KA 1G6RL 3LPGA 4HH9B 4PJAE 4ZXBB 5CINH 2C3XA 4FABH 2P42B 4P46C 3ZT7A 3MLTA 4PJCA 1IE5A 1OTUC 3FL7A 5B38B 5DS8B 3T09A 1FH5L 1RY7B 2CMRL 1S8DA 3U30C 4NO0A 5EO1B 5E7BA 2I60H 3WE6B 1WFUA 3HE6D 2D4FA 3AMKA 4YK4C 1DUZA 3O3UN 2CLRA 4Z7WF 1EGJH 3RWIA 2BXZA 1NLDH 3DYOA 4JGJA 1A6ZB 1Y6KR 4FFZL 1FC2D 5GXBB 1X6NA 4HIIA 4Y8AA 2QKIB 5BZWB 2BVOB 5ITFB 4KVCL 2AJ3B 5CSZB 4FP8L 4LLMA 4Y1AA 3RIAF 1RUPH 5LKNA 3MNWB 4KPHH 6CGTA 1ONQA 3BEWB 4E5XB 2UWEA 3IDNB 5M95B 3SGDH 1P84K 3IDMA 4LSRL 4Q9BA 1RZKC 3QI9B 1KTKE 4IRZH 4R90L 5A2LH 5EULV 4HKZB 2R56L 2W60B 4HUXA 1MVUB 2ATKA 4JZJA 4CVZA 1JRHI 1F4XH 3RY4A 4MXQC 2JB5L 5GRXG 3NZHH 4WHYH 4YXLL 4N9GA 4EI5B 1K8DA 3BJ91 1G9ML 1RIHH 2F5AL 5HYQA 4I0PD 2P48B 5SWSA 1TITA 2CH8A 3S9DB 1N0LA 2F5BL 3H7BB 1X5JA 3C6LB 3RZWA 4WGVB 2XOTA 2BNUA 2B1HL 3V7MA 3VMPA 1S7RB 1UQSA 1BECA 4EDXA 1KYOK 4M93C 4YC2B 1EVUA 5EUOF 4LKCA 3WKMH 4HX1B 3W9EA 2W91A 2IQ9H 5D5MF 5E1AB 2X1WL 3MRJB 4ODSH 4U1SA 5GGVL 1MFAH 1UWXH 1TCRB 4LAJH 1A0QH 5CGYC 3O4OC 3O6FA 1BJ8A 1DL7L 5ACZB 3RA7L 4RMWA 5IMLA 4W68A 5J1AA 4E0RA 3L3JB 3MLTB 5KS9F 4DCQB 5DK3A 1R5IA 3MSPA 4O51B 5IW6B 1M7IA 1JRHL 4F7TA 2V5RA 3DRTB 1JHLL 5F1IA 2X6MA 2Q3ZA 1HHKA 2KDGA 2N56A 3FFDB 4G6FB 1RVFL 3GO1H 1EUTA 1A6UL 4D8PA 3RWIB 3VH8G 3BIBX 1WSST 1VACA 4ZUTB 2X70A 1D5IL 5E8DH 3I85A 1E4KA 4MD5B 4K7PH 3R8BB 4RAVA 3FOLB 1VGKB 1ROWA 3HC4H 1DFBL 5DVMA 4JR9H 1CICA 1ONQB 2O5XH 1JWUA 5CD3A 4M9PA 5KOMC 4NDMA 1HKLH 3IDMB 3IDGB 3OGCB 1I9JH 2FH8A 1UZ6F 4JQXA 1YQVH 3MC0A 4BQBA 5KSUB 3QJHA 1XZ0A 3GSXA 4QWWD 2VN4A 4PJHE 4JZJB 4X9FA 3V6OC 4CVZB 4ONFL 1OQOA 4XMKH 2ICWI 4LL9A 4NPYB 2A9NL 1F58H 1MRFH 4MGXA 4N9GB 4PS4H 2QQQA 2MMXA 4KU1A 1K8DB 1UWGL 2EDFA 2VDLH 3OJ2C 3OR6A 4FNLH 4K3HA 4JPWH 3TIEB 1G7JA 3FZUD 4BZ1H 2YBRA 3MACL 2DMKA 4N68A 2NYYC 3ROLB 4AG4L 3PP4L 4NC1C 4QRSB 4LKCB 3AB0B 4DGVL 5TE7L 2QJDA 3ZDYE 1I7UB 4U1SB 3KPMB 1KV3A 2EDXA 3VXMA 5FYJD 2J3SA 3QXDA 1AGBA 3O6FB 4UTAH 3G9VA 4OUUA 3U4AA 4XB7A 1U95B 3HZKA 2LE9A 1CWVA 5J1AB 3UZEA 4E0RB 2HN7A 8CGTA 1GZPB 4TN9A 4F8TA 1RIVL 5DEFA 1HOCA 1BWMA 3CH8A 1MNUH 4WW1B 5I19H 1M7IB 3MV7E 1QACA 1RZJH 4F7TB 5CEXA 2P8LB 5I30L 1I7TA 4CGTA 1KCRH 4DN3H 3ZYOA 3OKKB 4YHPA 5SWQA 2WBWB 4RMVA 3VXRD 3S36H 4D8PB 4ZMAT 1AFVL 4TULH 3GDBA 4OFDA 3OAZK 5I73C 3MLSH 5CZXD 2VDMH 1CF8H 3TM6A 4ERSL 1AGCA 3IFNL 1DANU 2PTTB 2AQ3A 3SDYH 3BZDA 3VWJD 3LKSA 5IFJB 2EEDA 1CICB 2M2DA 5CD3B 4Z7WA 1LK2A 4NDMB 4L3ED 1WWBX 4G8EB 3B9EA 3T77A 4WFHE 3WO4C 4Z9KB 1CD9B 1RJLA 3X12A 2FO1A 3MV8D 4KKBD 4JM2B 1KPRA 4G7YH 4ZDHA 1EHAA 1AR2A 3QWQB 3I6KB 1OM3L 3C2AL 3MO1A 5JHDB 5D93B 3UTOA 3I6GA 2H2PD 3BD3A 5DQJA 1PKQB 4ZFFA 2V9TA 4KJYB 1CN4A 1MFDH 4NBYB 2V9RA 4MCZB 4I77L 1JZ4A 3QSKB 5GS0D 1DR9A 1BD2A 2BNQA 3GRWL 1N0XH 1G7JB 4MDJA 5JHLH 1EFXB 3LN5A 3ULUF 2EDKA 2FSEB 3STBA 3QDME 2APXA 4HCRA 2UVEA 4JY5L 2VDOL 3T0BA 3K7UA 4OCSH 1I1AC 1TETL 2DLEA 1A3RL 5CUSL 4RGMC 3V6BR 3VW3L 1AGBB 2B5IB 4XH2A 4OUUB 2FD6H 4M6OH 4JQIH 3RY6C 1E6JH 3SDDC 3M1BA 3TPKA 2A77L 3GSOA 5EUOA 1QEWA 1HOCB 4X6BB 1PG7L 2IMMA 1I7TB 1KN2H 5CKGA 3HG1D 2ITCA 4YHPB 4M5YH 4MJ5A 4ZFZB 4NQEA 3EFDL 1T7VA 4J6RH 3WLBB 3D85D 3DGCR 1Q1JL 3GGWB 3KHOA 3ARTA 3AVEA 3BKCL 1NGWA 3DXAE 4JGUA 1U2CA 4JKMA 5KS9A 2EYRA 4ZUVA 2NZIA 1U8PB 3TV3H 3O45B 3QWRA 2CIKB 2EYTB 3TPUA 3LKSB 4PJXE 3UO1H 1KJ2A 3KYKH 4JDTL 4OCXH 3NIGE 3UBXB 4NC2B 4Z7WB 5D6DA 3S96B 4HMEA 4FQ2H 4P2OD 2IFFL 3TIDA 2B39A 4NQDE 1XCQB 2F54E 3BT2H 1OWRM 4NM4L 5CJ5A 4K8RH 3OJMB 1HCFX 4ZDHB 1EEYA 2HVJA 3OZ9L 4NBZB 4FQLL 4WFED 3REVA 2Y6SC 3T2PA 3SCMB 3EDDA 4MJ4A 4MNGE 4XPHL 2XFXB 3O8XB 2X1PA 5E5MA 2UUDH 1GOHA 5ETUA 4RISH 5J8OA 5C0GB 1P84J 1J87A 1X5GA 4M1CC 3LEXB 3MLRL 3D3VA 2BNQB 3ISWA 1MVFA 1T3FA 1G7LA 2D7QA 4MDJB 4N0CC 4L1HA 1TJHL 1CFQA 1GGUA 2K3TA 3HA0A 4CVXA 3MRLB 4NM8H 5HY9A 4HC1A 2XICA 5HI4C 1A7RL 1U93A 4RFEA 4XI5D 3QNXA 2Q86A 4N9OB 4TTGA 3QH3B 5E08H 1I9IH 1W0VB 2A73A 4L8SB 4JFQB 2YEZA 1BVLA 1IGTB 4HZLA 1MCDA 4RMQA 1FDLL 3CFKA 1RJZA 3ZZ1A 4MA1B 4CAGA 2FR4A 1QA9A 4LCWD 1IBGH 1EZVX 4KZDL 4I4WA 1DVFB 1IARB 4ZUUB 1KYOJ 1P5VA 5D5MB 4HXBH 1LE9A 2BMKB 4OGAD 1GXEA 5D2NB 1PX4A 3V6FB 1OAQH 4HUWA 2HKFL 3D5OF 2ITCB 2X7LA 5IVXE 4MJ5B 2NY5C 4EBQH 4XCFH 5FIEA 4DZBB 2AK4D 5F9OH 5C6TH 5LGHH 1B3JA 4MVBC 1KCUL 2H1PH 4MB3A 2BSTB 1NGWB 5KS9B 4RSVA 1N4XH 4ZUVB 1PLGL 4I18B 5CJBA 3CFIC 2B2XH 1EAPB 2XQBL 3GBNL 3TPUB 5DHVA 1KJ2B 5AZ2H 3SGJA 5E9DA 5KSAD 2WP3O 5MEPA 1RMFL 4Y19D 3S37H 4JQVC 1JUFA 2BZDA 1E28B 3V8OA 2QQLL 1JTTA 4HKBB 1CFVH 2DIBA 5TDPB 5IMKA 1EEYB 2HVJB 1MWAH 1INEL 3REVB 5EZJA 2DI9A 1NCWH 2HP4A 3VFRA 2YZ1A 3EDEA 3IFLH 3SJVE 4OFYA 5E5MB 4MA3A 3IDUA 3H9ZA 2PXYA 4FQ1H 5ETUB 4M7ZB 1FGVL 5FECA 2VRAA 5JORA 4QEGA 3R1GH 4WNQA 1G7LB 1R5WB 2NR6D 2J6EA 2D0HA 1FE8L 5B39B 2C4FU 3ARGA 5IBTH 3IJHA 2W0LA 1U93B 4RFEB 4JFEE 4M00A 2MPAH 1BQHA 4F80A 4OZGE 2Z9TA 4Z0BH 5EWIL 5C0BE 4NN6C 4Q58C 4C56E 4LSVL 2WWKO 4AH2B 1H5BC 2A73B 3QPXL 5GJSL 2YEZB 2W9DL 1BVLB 3DX6B 5FYKL 5E7FA 2QQKH 3CFKB 4HGKC 4YBQD 7CGTA 5HYIA 2VLRD 5DA4A 4KMTL 2FR4B 1QA9B 2VDRL 4OJFH 1EH9A 5GHWH 1JMZA 4ZSOE 1NMCB 4I4WB 5C0JA 3W5MA 1Q0XH 1BZQK 4FMFA 3SDXE 3MA9L 3QUXC 4NT6A 2EDOA 1RZ7H 5JQ6H 2NY1B 3WIHA 4HUWB 3CZFA 5L9DH 1CZ8H 1FGNL 4LSTH 2AVGA 4JFFB 2P47B 4QKXB 5F1NA 3TBVB 5FO7A 2AERT 3T4AA 1NGZB 1KIQA 1F4WL 4IMLB 5K9QG 2Z93A 1IMHC 3FOMB 5FKPB 3HMXH 2GUOA 4Y16D 3MLVL 2JCCA 1S7WB 1WWCA 2B0SL 3QEGH 5E9DB 5MEPB 4XVUD 4K3EH 1IGMH 3SE3C 4G42B 3HUJB 1UC6A 2R0KH 2ZG2A 1IGFH 4KJQC 2HTKC 4OQ1A 1W72B 2ZG1A 1SEQH 4BSVB 5ICYA 3PWJA 3GUTA 4LHUG 4TQEL 1IKNA 3HPJB 5HHOA 1CG9B 4E42A 1BIIB 2X4NA 1LO3H 4ZD3H 5AUMA 1XMWA 4ONGL 1DLFH 3M07A 3QUZC 5A16B 1R3JB 3UTTE 5IHBA 3QWOB 2MCG1 5JORB 4R26L 4V1DA 5GGVY 2FB4L 3QIUB 1TZHB 4HGWA 2VAAB 5J7CC 2HYMA 1EAJA 1HHIA 4LVEA 4PJ9A 3H42H 3L1OH 4RFOL 5EOCL 4JKLA 1NANH 3T0VA 2C1OA 2NW3A 3GKWL 4QRPE 3BPCA 3WFCL 1BQHB 2R1XB 1N3NB 3P4MB 3BAEL 3DTXB 4AEIL 5LQBL 1BAFL 4JKWA 3V0WL 1FBIL 4M5ZH 1MF2H 5E6IA 4X4ZA 4U0RB 2BDNL 4KRPB 4QHNA 4BUHA 3VFTB 4J8RA 1SY6A 5HVGB 4PBVC 5T3XE 2AXGA 1YN7A 4ZFOA 1DQQA 4R4BA 3C60C 2Y07H 1T5WA 4NT6B 4Z95H 2V2TB 3BE1H 4XP1H 1MRDH 3UTPE 4AYFA 5FYKU 3CZFB 4UUJB 4NWTL 3BXNB 2R0ZL 2HG5A 4EZMA 1YMMA 1P2CA 5MHSE 1KB5A 3HZVA 4U2YA 3T4AB 3NA9H 1KIQB 2Z93B 4BH7B 3DO3A 1GCFA 5DRZA 1OVZA 3VXQA 2GUOB 2EIDA 3C5ZB 1R3KA 1KJMB 3LMJH 2H41A 4YDLB 5DA0B 3WS3A 3MRPA 3C5JA 3KPPB 4NJAH 4PJBA 1F11A 4M7LL 2BC4A 4PLOB 3LKPA 5I1DB 4HLZH 3TBYB 4LDOB 3R06A 3EZ8A 3QFDA 5D1QB 3EYSH 3MBXL 5C0AE 2VLMD 3ZYIA 1N8ZA 3PWJB 1QSEE 4OSUH 3F5WB 4AIXA 2CQVA 4UV4L 5HHOB 4BQCA 4E42B 5C2UB 3G5XA 2X4NB 3JV4A 4B7LA 5IEHA 2NNAA 4Z5RA 3CU1A 3QIBD 1CGTA 2VNCA 5L2JA 2ZUWA 2ICWJ 4GRLA 1OCWL 3MJ9A 1HZHL 4O2FB 3MPCA 4X8JA 1IQDA 2CK0L 4IJ3C 5D1XB 3DETD 4YIQA 4H1LA 3MUGB 4HGWB 2XI9A 3KG5A 1RIUH 2E7HA 1G9NC 1OGAA 4FFWD 5I8CA 1T22B 1PFCA 4HWNA 4HW6A 2PO6C 4PJ9B 2B7DT 3TF7C 4KZEL 1BJMA 3KLSA 3MR9B 3OPZL 3O4LA 3TYFB 4D0CA 2C1OB 3BPCB 1QVOB 2VLKE 4NZTL 3SE8H 2IAMA 3OKOB 4HWUA 1FVEB 1YNLL 2Y72A 1QKZH 4KK5D 4P46A 4RQQB 5E6IB 2BSRA 3U7YL 6FABL 2CGRH 2G2RA 4V2BA 5I17A 4J8RB 2G5BB 3GJFH 4K2UL 4PLKC 3V5DB 2R2HA 3K8MA 2BCKA 1UACH 2KQMA 2VE6B 1MCWM 4R4BB 1DBAL 1T5WB 1A3LH 1D9KA 5HBBA 1RUML 4Y4KB 4ONOA 3W2DH 3ECBA 4OB5L 1P2CB 1K9TA 4NQXB 1CIUA 1KB5B 1HINH 5BO1H 3IETA 1FNAA 1FNHA 2LFGA 2OR9H 1PJ9A 3EOAB 1HQRB 2YWZA 2NY0D 4QRRA 2FGZA 4NHUB 3DUSB 1R3KB 4N1HB 3VCLA 3WS3B 3MRPB 3C5JB 3IXAA 3B3IA 4BQ9A 4JDZA 2BC4B 3LKPB 1OL0A 2VSDA 1QFOA 1JYXA 3R06B 1MJ7L 5HDBE 3QFDB 5GGTH 4U3XA 1QPPA 2ZG3A 3L3DA 3RHWK 1YEDA 4GKOA 1JGUL 1GC1L 4OZ4A 3G5XB 1DE4B 5HGHB 3C6SA 1PDKA 2YMXL 3O9WB 4HWBA 4JM4L 1NMBL 4EUPB 2NNAB 5JIPA 4I13B 1BBJA 2EO1A 5GJTH 4GRLB 2UWEE 3RRQA 3MRBA 3NH7H 1IQDB 4H25B 1U8KA 4PRBA 3T65A 5FUCE 5JIHA 1OLZA 1K4CA 3P0GB 2VZOA 2XZAH 4FTVB 3BW9A 1U8IA 4NP4H 1UJ3A 3T4YA 1U8MA 3O11A 4AEHL 5DJZB 1DBJL 1RHHA 4RDQF 2IAMB 1BQLH 5T5NG 1I9RH 5KTEL 2W9LA 3ARYA 1MQKH 5D1ZC 5JOFA 2AJZA 4P46B 4IRJC 3GIVB 2BSED 3QUKA 4EXKA 3HFML 4PP1C 1CDBA 3EHBC 1WZLA 5EORL 2XY1A 2GSIA 4KJWC 3NCCB 3U30B 3VXTB 4WFFE 2EDLA 1NL0H 3FO1B 4OKDA 1A9EA 3O3BB 4XVTH 5EFIA 2CLZA 3KXFA 5FA3A 4YK4B 1IAMA 2BVQB 3DNKA 5IHUH 4URTB 4OFPA 1NMAH 3UTZA 1WICA 3E3QE 5JR1L 1M6OB 3KNBB 5DJYB 4HUVA 1MPAH 3MV7D 3GHBL 4Z0XA 1T20A 1ED3B 4WW2C 3IETB 5HYSG 3LZFL 1QFWH 3OGOE 3MV11 3OKMA 5I1JH 5GRUH 1QO3B 1EHLL 3MCKA 2R2CA 4KUCD 5TF1H 3B3IB 4LGRB 4JDZB 3NCJL 4FFYH 3I3EA 2HRPL 4HIHA 1UYWL 3TNNA 4TSCL 4WWKC 5T3XH 4UINL 3E6HA 2HT3D 3NZ8B 3D39A 5CILH 3V6OA 1RV6X 5BS0A 3GK8L 3F58L 1YN6A 4WFHD 3UJTH 1K4DA 1EERB 3OXRB 2OP4H 4X4YB 2J4WH 3WFBL 2VDNL 1BBJB 3HN3A 4W4NA 3ARFD 3LN9A 5KBNC 4MNHA 3WSQH 4R97C 1CR9L 4NGHL 25C8H 1LDPH 5F1KC 3VMOA 1U8KB 4HIEB 3T65B 5CGTA 2EXYC 3V0VB 5EPMA 3LIZL 3WFHB 4M93B 4XC3L 3MCLL 4YHNA 5I6XC 1RUAL 1U3YA 3BW9B 4X0KA 3OKYA 5KVFL 3TVMA 3T4YB 3LS5H 1MCIA 3EJZD 1UH2A 2AXJA 2FJHA 4GRWF 2YD4A 2WP3T 4M6NH 3JWOC 3ZO0A 1EZVY 1F5WA 1RHHB 4PJ5A 3PDDA 4UOJA 1PY4A 1PKQE 3O4OB 5FF6B 1V05A 1U8NB 3I3DA 3RWFA 3QDMD 1T21A 4ORZC 2G75A 5JOFB 3RWHA 3MNZA 3QUKB 5GGSA 5E99L 2DQHL 3BX7C 1REIA 3T3MF 3O2WL 4PLJD 1KENL 2EE9A 3R4DA 5DO2D 2HLAA 1WGOA 5EFIB 1IFHL 4YQXH 4DGYH 4NJ9H 4YXHL 1I1FB 1YPZB 5FKAB 1UXWA 1WWAX 2YK1L 4B5EA 5DYOA 3UTZB 4XHJD 1AD0A 4GSDH 4HUVB 3VXPA 4Z76A 1KTDB 5I66B 3WNKA 3UAJC 4FQQB 1NAKL 4G5ZL 5EZIL 4KV5E 4M61A 1JWMA 3LHPH 5GSRB 3UPAA 1T7WA 3B9VA 1VEOA 1VPOH 1EBPA 3MREA 3RWDB 1FN4A 4OZIF 5FM5M 3OB8A 3H3PL 4H1LG 3ZKSD 2GEEA 1J0HA 2WWKT 4AM0B 3DXAD 3GHEL 1I3RA 4ZODA 5TJWK 1DBMH 1J1OL 4FFVC 4EN3D 3U82B 3OXSA 1H3VA 2XWJA 3U36A 1D5XA 4PG2A 2X9WA 4LPVA 2CRIA 5BS0B 3P11L 4NQDD 2F54D 1U3ZA 3GMOA 3WIFA 1K4DB 1YEFH 4L3CB 2YSSA 2FEDC 4PUBL 2DB8A 4Z7WE 1YNKL 3NACL 3QIWD 4KQ4L 4ZUWA 5INDB 5GIRA 1X7QA 4NO5A 5H2BB 2PW1B 3IJSA 4LLVA 2XTLA 3VFSA 4MJ6B 4QHLB 4QHKI 3AS1A 2VZVA 1INDH 4U7MA 1IGJA 1GVIA 1YEKL 2BVPA 5DJ6B 2ZPKL 5IF0B 4KI1A 3RAJH 3QUMH 4PJ5B 3B9KD 4JO4L 3RWFB 3I6LE 3BDYH 1T21B 1T03H 2W38A 3D48R 2G75B 3SDDA 5BZDA 3D69B 4L4TA 2E6PA 3GSVA 5ADPL 2XQYG 1BD2E 3KJ4C 2BNQE 4JY6B 4YHOL 1MCBA 2AEQH 4XCCH 4K3DH 3PL6C 4EKXA 2WWMC 4ZPVA 5T3ZL 2CKNA 2HLAB 5DQDL 5FDWB 5DLMH 5E5RB 3IB4A 3G6JA 5GGQL 5SV3A 1TVBA 2YN5A 3VH8B 3RDTA 5I73B 4RGOH 2DBLH 1RZ8A 3B5TA 3UZVB 2EKSA 4NYLA 4OF5A 1JWMB 1NSNH 3DVNA 4Z7NF 4K3JH 5EUOE 4APQC 1V5JA 3W39A 1ZHLA 1E4WL 2VWEE 4P2QB 5D5ME 5EOCJ 5AD0A 1CVSC 1WC7A 4KI5C 2BY1A 2KZ1B 1FNEB 4F2MB 1MEXL 1I3RB 2R2BB 4FXGA 5CINL 1ZLUK 4TUKH 3NCYP 3HCVB 4FABL 5L2KD 3OB0H 3IKKA 5LXGH 4NQEE 4OBRA 4PGDA 5F89A 4FZ8H 5K9JH 3WNPA 3U36B 4K94H 5I1AB 2DM4A 4MA7H 1T2XA 4UQ3A 5KS9E 4I0KA 2I60L 3KYOA 1R3HB 2ADGB 5DJCB 2V17L 4DGIH 4K07A 2BY0A 3WIFB 4GG8A 3PHQA 2YSSB 3FHAA 4QOKB 1TXKA 4P5TA 5T1KA 4D9RE 2ZUQC 3DRQB 1N64H 1NLDL 3O6MH 3TFKC 4ZUWB 1BLNB 3PE9A 3ULVH 4LQFH 5FXCH 2CLVB 3SJVD 5EC1A 3D2UB 2SEBB 4S1DC 1CBVL 3IJSB 1NDGA 3VFSB 4P23D 5MEOA 3INUL 5FGRA 2W0FA 3ARBC 1JBJA 5C86A 3WEXA 1I1AB 4OF6A 4KPHL 1RZIB 4XP6H 5F7EH 3WJJC 4RGMB 2DWDA 1Z0NA 3DUUA 5HHVL 5DMIH 3OSKA 5HPMB 4PJ7F 3WFEL 4XNMB 4IRZL 3SDDB 4JFED 3GSVB 1UZ6E 3BIAX 1T1WA 2YHGA 3DBXB 3Q3GA 5C0BD 4C56D 4X7CC 5E4IA 2X09A 1N5AA 1F4XL 1NCBL 1R3LA 1Z9MA 3FTGA 3NZHL 2D7PA 3OR7A 1JGEA 3ZHLA 5F3BA 4XBGB 3MJ6A 4Y5VA 3L6FB 3JV6A 1G9MC 3NCMA 4E9LA 1MH5B 3BGFC 2VXSH 4TOYL 3L3OA 5EIIA 4IDLA 1VFBA 1NEUA 3BDXA 1GGCH 3FQXA 4S1SH 5I75C 3VI3F 3DVNB 4CU7A 1A6WH 4M6MH 3G9AB 3VDAA 1WC7B 1R0AH 1CXEA 3BZFA 4PRPB 3UBXI 4G3YH 1DQDH 4JQVA 3VFVA 1VFUA 1VKXA 2D2OA 4GMSL 4PY7B 4YFEA 1KBGH 4JFFE 4ZAKC 1UT9A 3QRGH 3SOBL 1WBXA 3G08A 2IGFH 1Z5LB 2YA0A 3SDAD 4OZIA 3KYOB 4EXPX 4WDIB 4Y4FC 4GG8B 5DC0A 1Y6MR 5T1KB 1IEAB 5E9DE 5IMOA 4JO3L 3EDJA 4D94A 3BGMA 1DDHB 1F4YL 1R3IH 4TNVK 2BY2A 5E8DL 2AP2A 3HNVH 4K7PX 5DI8A 3QG6B 4WU5B 3LCYA 5EC1B 1YJDL 3FJTA 1IZKA 1S7VA 4MMXC 3IS1X 2VDKH 3BMVA 1P4IH 2AJSH 3UTTD 2W0FB 4F9PC 3HC4L 3WEXB 1DEEA 4AIOA 4G43B 4WUUA 1HKLL 1QLRB 3BPNC 3DUUB 1IRAY 4L8CB 4TVPL 1ORQB 3D9AH 5D72H 1YQVL 5C0DB 4QRPD 3DROA 1T1WB 1R3LB 4R9HA 3QEQB 1IQWL 1CXKA 1F58L 3BESR 3QUXA 3Q1SH 4RWHA 4GRWB 3BUYB 1JGEB 4PS4L 1BJ1J 5F3BB 4TRPH 2E9WA 2VDLL 4WCYL 2BX5A 2IALB 4JFDB 4FS0A 4WJ5A 5GZND 1YECL 2RBLA 5MENA 4FNLL 3RGVC 3HE7C 5T3XD 3GNMH 3L3OB 3MFFA 5ACLA 1WT5C 3WHXA 1S7XB 4U1LA 3UTPD 1A4KA 2B1AL 2OJEA 2YPKA 4H8WC 5C3TA 3ULUE 1RJYB 2N7AA 1HN1A 5MHSD 2CKBH 4KROB 5C0EB 4ZXBD 4BUGA 4MWFB 2VDQH 4MZ3A 1CLYH 3SE3A 2XA8H 3VFVB 1VKXB 1C12A 5SWZB 3PABA 3DX7B 4HJJH 5SX4I 4HCRH 2GCYA 1MNUL 4LQ1A 3G08B 2O5ZH 3MUJA 3SKUD 4OZIB 2DYPA 3MBEA 4NUGH 5CEYA 4NQSA 3D0LB 1FZJB 5C0AD 1Z3GH 3S36L 3V52H 4GMTH 3L5HA 1XF3A 1QSED 3HNTL 4QXGH 1S9KC 5IMOB 1S9WA 2FJGA 2GI7A 1J1PH 3EGSA 3T8XA 2VR9A 1LE5A 3MLSL 2H32H 4QCIA 5D6CA 4MS8C 3QFJA 3N1PC 4CW1A 1DN2A 4ZO8A 1MFBH 1S7VB 1XGUB 2FECI 5BRZA 4IOSD 4QTHA 1AQDB 5HHOE 3FT3A 1DEEB 4NN6B 5F88A 4M4RA 3QI9D 1H5BB 5E2JA 3TWCH 1G6VK 3FO0H 1DSFH 4LRNH 1CXLA 1B2WH 4WW2F 4N5UA 3KPSA 3L3GA 3DROB 2VLKD 2AABH 2ADFH 4JVWA 3K80A 5CJXC 1YEEH 4IHOB 5H37G 4P99A 4EI5D 3QUXB 1H3WM 3RWJA 2QQNH 3C60A 4L8DA 3BKYH 1RU9H 1MFDL 2X9YA 4DW2L 3C6LD 5JDJA 4LPWA 4PJ7A 1CGYA 1OGTA 4M48H 5MENB 4F37F 2A0LD 5ID1A 1I7ZA 1N0XL 2DM2A 4HAGA 3I9GL 4PFEA 4U1NA 5FO8A 1I8MA 1GZQA 4XP4L 5C0ND 3BEVA 3V7AE 2FECL 2RQ8A 5DD3H 4PG9B 3Q6GH 1Q94B 2P7TA 3DWTA 3SO5A 1S78C 4U7KA 2VUYA 4M6OL 3C9NA 4JQIL 1ADQH 2WUBL 1E6JL 3LH2H 2K7QA 4YE4H 1C12B 5IFHH 1YMME 4QXTA 1IJ9A 5IKCB 4NO0D 3E8UH 1EO7A 4H0GA 1NKOA 4YDIH 3SE4C 1OOAA 3B83A 5ESQA 1KN2L 1B4JL 3QUZB 3MV01 2HT2D 3CFDB 3OG4B 5ALCH 1UCTA 2Z35B 1J11A 3BVNA 3ESUF 2FJGB 4PJBE 5LGJA 1WISA 5T1LB 1GOGA 3GBMH 1UB6A 1LE5B 3G5VB 3CUPB 2BP3A 4OQTH 2PO6A 5IG7A 2C4XA 3MRNB 4CW1B 1T66C 4LFHG 1OSPL 3IVKA 1BFOA 5BRZB 1A21A 2FGWH 1LK3H 2GFBA 3UO1L 5INCA 1J8HA 4P9HC 1IKFH 2MWCA 2DLHA 4G6AD 1JE6A 2VC2H 4IIQA 1DQJB 5TQ0H 1MI5B 4WTZG 2QBWA 3BT2L 2ED8A 2ZWLT 4F7MB 2DLFH 1MCQA 2DL9A 5F97E 4K8RL 1W72L 2FBJL 3QCVH 5DHVH 1VHPA 1A7OH 5DMJB 3MA7B 3F65A 2NQCA 5HHMB 1P1ZB 3EYQD 4ZQKB 2UYLB 1ND0B 3C60B 4L8DB 1AJ7H 4RISL 3PWUB 3OWEA 2BVYA 4PJ7B 1MSPA 2I9TA 4WFFD 4GQ9H 3P4NB 3H3BC 3H6JA 1F02I 4U1NB 1KCVH 1I8MB 3RWCA 2OMNA 4I0PA 4HKJA 3DV4B 5IFAL 1VA9A 1TVHA 1RZFL 3O6FD 1TNMA 1FZOB 2GSGA 1OAYH 2P7TB 4D2NA 5C8JB 3E0GA 4G8IA 4H5SA 3SGEH 2J6EH 1SVZA 4MD4A 3CDCA 2X41A 1IBGL 3HI6L 4O9HH 5C7XL 2D03H 2HMIC 1FORL 3EO1B 4HXBL 2IPKB 2AKRA 4HEPG 4G6MH 4ODHL 4TUOA 3B2UC 5KVEL 1MHHB 4QRRE 4D0BB 3QDJB 3D25B 2Z92A 1XAUA 4EBQL 4XCFL 5C6TL 1UB6B 2H1PL 1UM4H 2PO6B 5DC4B 1N4XL 3EW3B 3GB7A 1QR1A 1AXSB 3CFJA 1CICD 4F8QA 1NBYA 1OTTC 1BFOB 4JO1H 4LCUA 3FONA 3MLXL 1F00I 4LSSH 1SQ2N 2IH3B 15C8H 3RTQC 1I8IA 3PIQB 4HWEH 4QHKJ 4XX1E 5DSCB 5IBLD 1F45A 5D7JC 3S37L 4YO0A 5D1ZA 4JM2D 5TGBA 4PJFF 3NMEA 4LSUL 1W8NA 5E8NB 4X5LA 1YEJL 3QG7H 4DQOL 1NFIB 3RVXD 1U8JA 1SBSH 2XTJE 1NCWL 3FB5A 5F72S 1ZLWH 2LVCA 5GPRA 2R0WL 2OQJA 3SKJL 4KI5F 3UPCA 3K2UL 3M17A 5FUZL 1OAKL 1EFXD 1KT2A 3VFPB 5GRWA 3TCXA 3KDMB 5J56B 4TSAH 2OL3A 2GHWB 3QHZH 1JHTB 5CJOH 1X3DA 5HDQH 3RWCB 3HR6A 1R5VA 1UM5H 3TBSA 1IAIM 2Q7NA 4OD2A 4UT7L 5FYLE 4XP5L 3QQ3A 3BWUC 4Z0BL 5AWNH 1T6VN 3MGOB 3KXFE 2UUDK 4WI9A 1VGEH 4WWKA 1FNLA 4GKZB 3QZWG 1TNNA 3ILQD 5GHWL 5EOTA 4M1DH 3BSZH 3DHJA 3DX9B 1KEGL 1JNHA 4PJDF 1CQKA 1QRKA 1Q0XL 1S5IH 1IGCH 3BN3B 4PJIA 4TUOB 4UILL 4FQCH 4RMUA 5L9DL 1PBYA 1CZ8L 1P7HL 4LSTL 2UZIH 2K1MA 3ELAT 4DUVA 1AY1H 3IDYC 1AI1H 3QQNA 2DI8A 5DK2B 1BFSA 1SY6H 1J7VR 1NANI 3K8KA 3RVTC 3GB7B 4S2SA 3KPRB 2R69H 3CFJB 3HMXL 2DQCL 1J0KA 3V6OE 1NBZB 1MFEL 4QY8A 1X5ZA 5BS0E 3IU3B 1FL5B 5JA8B 3LRSA 1I8IB 1CGVA 3IU4H 3NPZB 4K3EL 4DZ8B 1IGML 4IMKC 4I5BA 4YO0B 4HJGB 1T7XA 3VWJA 3WLWD 4IRJB 2R0KL 3DO7B 4JPIA 4M62L 1QNZH 2AJXH 4QRTA 3TJHD 3CXHK 4HH8A 4KTDH 3F12B 1U8JB 4XNXL 3IGAA 3I6LD 1LO3L 2NX5B 1ZTXH 2XWBB 3PWLA 4AT6A 1DLFL 2OQJB 3P77A 1BD2D 3U46B 2BNQD 1YEHH 3W11C 4BA8A 2NTSP 2P5EB 1MCOH 4PJ5E 4XVSH 2HT4D 4N8VG 4WW2B 1EEZB 1PX3A 1XIWC 5F7MC 1OLLA 3H42L 4OCNC 4XXDA 2Q8AL 3S8WA 3PNWA 2XNAB 1LHZA 5IB1A 1RUKL 1MFNA 5GGRY 2ICEA 1NEZB 3MRMB 3MJ9H 3LKQA 2KUTA 3HZYA 3SEPA 5F9JA 5GRVK 3ZLQC 3CMOH 4L4VA 4H1LH 4M43H 1P4BL 3SKOB 5HHXL 1MF2L 4MXVF 4WWKB 1KXQE 4PR5B 3QXAB 4P4KC 1S7TB 4KDWA 4G9DB 5FCUH 2VABA 3VRIB 1ORSA 1JNHB 3GSRB 1WCBB 3BH8A 1CLZH 3T2NH 3V9FA 1HHHA 1K6QH 1MAJA 3CK0H 1NC2A 3CSBA 1KNOB 2Y07L 4K7PY 4NQED 3BE1L 4XP1L 5TF0A 1NCDH 1D5BA 5CJ8A 2EH8L 4R97B 4WVRA 1G0DA 5DT1H 3PXJA 5EG6C 3BN9D 1J05B 1SBBA 2WQRA 5A3ID 3HG1A 5I6XB 1MLBA 3CFEB 3MJ7A 1IAIH 4D9RD 1LMKA 1HI6B 1L0QA 4QY8B 5C0RL 4R7NB 2A9ML 4ONHA 3OKEB 4NJAL 2H8PA 2Z8WC 4NOFA 4WI5A 3S3SA 2AV7A 4I5BB 4QOKE 4A6YH 3EO9H 5E8EA 3RPIB 2JJVA 1NGQL 5CEZE 3PL6A 4OSUL 3NBNA 2WBJA 1JV5A 2HFTA 3BWAA 1C5CH 4QF1A 3TA3B 1AO7B 3IGAB 1QFPA 3PWVB 1F3JA 4AT6B 3QXWA 3RU8L 4JDVA 3O6LL 3D3VD 3P77B 4YDJA 5C09B 4LCIH 3TCLA 3CFCH 1DP0A 4YDKH 3X17A 1UADC 3S35L 5LBSH 4OIAA 1ZGLA 4BFIB 2HJFA 1RIUL 4UAOC 4KUZH 3P73B 5HYSB 3K1KC 3BH9A 4L4TE 4HWBH 2JTDA 4APQA 4UT6H 4YZFF 1MREH 2P46B 2ICEB 4L9DA 4ODVL 5FHBL 2LTQC 3ARSA 4RWYH 5HHPA 2P49B 1G6RA 2D31A 4PRNA 1J18A 1A7NH 4M4PA 1CE1L 1O5DT 4QLRA 3I75B 4Q6YA 3WIIL 1FZKA 2VABB 2GK2A 1MHCB 1BM3H 3BH8B 5E2WH 5FYLL 3L3IA 2NY1D 4HKXA 1UACL 3GJEB 4X9GA 4ZO6A 5DJXA 2D0FA 5D7IA 1JGDA 2GTZA 3RIFK 3FKUS 4JFFD 2EYSB 3ZE0F 4FQJH 2Y06H 4PRPE 4XNYL 3RBGA 1HINL 5HGAB 5BO1L 3EJJX 4L8BB 1YA5A 1VFMA 2HWZL 5I2IA 2J8UA 4JG0H 5IBUB 1N6UA 4LSDA 3ARBA 4J3OC 5E9DD 4LARL 3ARWA 5D7KE 2X1OA 1JZ5A 3M8OH 2F74B 3BP5B 4FMKA 3BQUA 2EC8A 4P9ML 4KK8C 3VFOB 5E8EB 1C5BL 1NCTA 4XTRC 3KJ4B 3QNZA 5GGTL 4X98B 4O00A 3H0TB 3PL6B 4Y19A 3EJYD 4PP2A 1J0IA 2KL6A 4QF1B 2W59A 4OFYD 1U3HC 2C5DC 2HJKB 3QAZB 4WENB 1GC1C 1F3JB 3L9RB 3K8LA 1BVKA 5BMFH 4JDVB 5GJTL 2WLYA 4PJFB 5I8KL 1T2JA 1AD9A 4KKNA 2HJFB 4H26B 5CD5C 3ARGD 3A6BL 3SKMA 1QFWI 2XZAL 3BH9B 3BPLC 3DIFB 1B0WA 2P5WB 4YHMH 4NKOB 4APQB 3SPVA 1WAAF 4IBLT 3QEQE 1UCBH 4GRWE 1YYMH 4N5ED 1YC8A 2WINB 5HHPB 3ULUD 2DQEH 4JFDE 1G6RB 4PRNB 2QTEA 1LNUB 4ZAKA 1KOAA 3NABL 3T3ME 4M8QB 3IDJA 2VLRA 3L3IB 2CD0A 1NL0L 4HKXB 2FCBA 4Y4FA 5CP3H 3N9GL 5IHUL 1ERNA 5BQ7A 1MCHA 2ZUQB 2JJTA 1KLUA 4NQCB 1MPAL 2EDBA 4X7TB 4KTEL 1FFRA 2PTUA 3TN0C 5SWZE 4NHCH 1QFWL 4PJDB 3GKZA 3ARBB 3KPLA 5DFVD 2IPTH 4U1IA 5I1JL 1HYRC 3GJFK 2OMBA 3X3FH 3TBWB 4HBCL 5TF1L 2X89A 5HHNA 4KKCC 4OZIE 4J3XA 4GAGH 4Z8FH 4M8VA 5C2BH 3B2VH 2YD9A 2BRRH 3T0DA 3D6GA 5C6WH 3STLB 2O61B 5HHOD 5CILL 5IROC 5IM7A 4XBPB 1PEZA 2VQ1A 1FNGA 2YRLA 4GAJH 1NKRA 3EKCA 1SYSA 3ILPA 3UJTL 4YUEH 2J4WL 3O41A 4G7VL 1HILA 5D1XD 4NFDA 2XA3A 1L7TH 4MNQA 25C8L 1LDPL 1IGIH 3BGFB 4PJ9D 2E6JA 5T1MB 4WEUD 2YRPA 1WT5A 2BOCB 4POZD 4Y88A 5FUOL 2G9HB 1WEJL 4CJ1A 5I75B 4UDUA 4ZS6D 3CXHJ 1NBQA 3MOBH 3LS5L 3SY0A 4N0YL 2L7JA 4GKNB 3LV3A 3SPVB 1A47A 2N4IA 1FFOA 1XF2B 2C3HA 2APTA 1JWSA 4NKQB 4M6NL 4PJGA 1QLFB 3MXWH 2UV3A 5E6ID 5CEZH 1B0RA 2NMSA 5EUKB 2X42A 2Y9RT 1MIEH 5MENE 4HS8H 3LEYL 4ZAKB 5BVJA 3DGGA 3PF2A 2VZ3A 4ODWB 4M3JA 4U33A 3IDJB 4NRYA 3HNSH 1TMCB 3K4AA 4Y4FB 2DIJA 4DGYL 1S3KH 2O93L 2VL5B 2EDHA 2ICWA 3RNKB 1YMMD 3V4UL 4XVJH 1NH6A 2MCPH 5IHZA 5TE6L 2YD1A 1KLUB 3KLAB 4GSDL 2DTMH 3DV6B 3P9MA 2W65B 2OZ4H 3KPNA 1ETZB 3LHPL 4U49A 2IQAA 3KPLB 1VPOL 1MHPH 2H6PB 3G6DH 1FCCA 4Z7NE 2XPGA 3TO4C 3P0VL 1OPGH 4LBEA 4ZFGH 2Z4QA 3BPNB 1I8KA 1ZT1A 5DRWA 4U1MA 3FN0L 4ODTH 4UNUA 3RY5A 1T6WA 2IJ0C 3NA4A 5GS0C 3GSWA 3MRRA 1N59B 4EJ1C 5CJXA 2D7MA 3PGFL 2EDNA 5IM7B 3VGAC 1TJGL 1T2QL 3LVEA 2VQ1B 1FNGB 3MYJA 3ZKMD 1DBKL 1SYSB 3ILPB 5BRZE 4GRLD 5BVPL 5F7UA 3PJSA 3O41B 3EFFB 1CLOH 1HSAB 4ZTPH 2RFXB 4MQTB 1R24A 5MI0C 3GMPA 4MNQB 2RCSH 5HYJA 1NAMB 3RGVB 3ZDZE 3HE7B 5DD1H 1O7SA 4H88H 4X4XA 3GRWA 4N8CH 3L5WB 3EYOA 1T7YA 2AGJH 3KGRA 3KPSE 4UDUB 5IB2A 3NCBB 1DEDA 1NGYA 2IPUG 2FRGP 1INDL 2IAMD 4L5FL 2EICA 1A6VH 1KCLA 1FFOB 5D9SA 2JIXB 3HRPA 3QUML 4UU9B 4YWGL 2YUXA 5KVGL 4P46D 1LO0H 1OT2A 1B0RB 1OTUD 5B22A 1B0GA 1T03L 3ZHKA 2C9AA 4PJ7E 1QFUH 4MXWH 5E2TH 1V3LA 4IRSC 4XCCL 5BVJB 3V5HB 5LVEA 4OLXH 4ELMF 1MCPL 2FIKA 4X99B 3SE4A 4X9BA 5H94B 1L7IH 1WAAA 1QBLL 5FOBB 1FG2A 2J5LC 3ZSTA 1JK8A 4DAGH 4PRAB 2ICWB 4R2GD 3RJQB 5GS2D 4BSJA 5DLML 4MZ2A 1LO5B 5IHZB 1BGXL 4RGOL 1DQTA 5AZEL 2DBLL 1GAFH 4JFZH 2VITA 3P9MB 2QHRH 5HD8C 4QRRD 4GAYB 3QA3B 4KHTL 4UOW0 3GSNB 3C08H 1KJVB 3K81A 1QBBA 3RWEB 3VI3E 2NY5H 1KCSH 2OK0H 2XPGB 3AB0C 1IGYA 1I8KB 4I3SL 4U1MB 3O6KH 2DQUH 1KACB 2NZ9C 3RL2B 3L7FA 1VENA 1CTOA 4UI2A 1I8LC 4JZNA 4FZ8L 4LOUC 3MLYH 3GIZH 4MXQD 4OF0A 4MA7L 3OKLB 4POYA 1SJEA 3MRGA 3JWDL 3OJVC 5T33L 3MYJB 4DGIL 2HAZA 4OFVA 2BJMH 1AGFA 1IM3A 1KELL 4XI5C 1DN0A 1JGLH 1J8HE 1MCSA 3N0PB 4RRPG 5IK3A 3O6ML 5E24E 4HIXL 5J3HC 3ULVL 2XTJD 2E7CA 4L29A 4LQFL 4X4XB 5TDOB 4IS6A 1FNSH 1Z0MA 3GMLA 4QGYA 2IWGA 1JF1A 2DBJA 5IB2B 1G7MA 2D7TL 1NGYB 2CPCA 3MMEA 5JPMA 1BX2A 5CGYD 4J1UA 1FL3B 5F7EL 3FQRB 3FMGH 5D9SB 2YA2A 3QDGB 1VSCA 1F4HA 1UKTA 4ZOBA 5EO0A 3QNYA 4WHDA 1C1EH 5FYLD 4CU6A 3VFWB 4LEOB 2LU3A 3RHWF 4O4YL 3IJYA 3KXFD 1JNLL 2FIKB 2ZNWA 3PDOB 4Y89A 1LWRA 1JK8B 3V2AR 3ZKNC 1KFAL 3S34L 3VXUB 1PSKL 4POUB 1NFDF 2OTUB 1EIBA 1CCZA 2MKLC 4WRLA 4JHZA 5J06A 3GM8A 3TZVC 2VITB 4JZOB 3WNLA 1GGCL 5DVOA 2YKLH 5J9PA 5CHNA 4S1SL 3RVUD 5T5FL 4GW1B 5FHAH 1G84A 1XR9B 1WTLA 1A6WL 2AI0H 3LKNA 4M6ML 2X4QB 1GRWA 4NQVB 3RTQA 3VE0B 3KVQA 1YY9C 1V7NH 2ZKHH 5KVDL 4G3YL 12E8H 3CAFA 1FJ1A 1YY8B 2B5IC 1KBGL 5BS0D 5TFSL 3QHTC 3VXSA 2HKHL 2IGFL 4M02A 2VXTH 4JRXA 4XC1L 3A6CL 3KPRE 4F57L 1RFDL 2X4PA 2NXYD 3LKOA 2GTWA 3OHXA 3N50A 1XGQA 1DN0B 3NCEB 2PYEA 4Y2DB 4OV5A 2NYYD 1U0QA 2YPVL 2YWYA 2XZCH 3HNVL 1XGRA 3OB0K 1K5NA 2GK0B 3LKRA 4IS6B 3WJLC 3GSUB 1MFCH 5K9QI 1B6DA 1JF1B 2VDKL 3MRHA 1P4IL 3UTSB 4PJ5D 5IJVB 5IV2A 4DKEL 3GMRA 1KLGA 2DQIL 5GS1C 4BQ8A 5L6YH 4F7CB 3VDBA 5ICXA 5D72L 5EO0B 2VLJB 1G9EA 1SM3H 2P5EE 1F8TL 4PV9A 3CLEL 5T1DL 4BKLA 1ZVHA 3ARPA 3C8HA 3NCYS 4OLVH 3H9SA 1MJUH 3ZL4L 1AQKH 4MDIB 3VRLF 4OBSA 4TRPL 3SCMC 4C4KT 4QRUA 3O8XC 3UP1A 3TESA 5L88L 3GNML 3FFCB 1JMXA 5J9PB 2R1WB 5CHNB 1Q0YH 3IDXL 1O7VA 1CL7I 5CIPB 4JN1H 1UG9A 4MLSA 2CKBL 1S9VB 2OR7A 2VDQL 5B8CB 1RK1B 4JAMB 1A4JA 1P69B 4GLRI 1CLYL 4LDLB 4IMKA 5D7JB 3JUYA 2XA8L 2E9JA 5EIQA 1QQDA 3PP3H 5BV7H 2HFEA 2IG2H 4HJJL 3L95B 3QDHA 3DXAA 4LASL 1NCCH 3VXSB 4WU7A 5EZOH 1TENA 1TZGH 3NTCH 4OLZH 5L8KB 4QOKD 1C7SA 3L5IA 2FBOJ 4PJXA 3MRCB 1DVFC 1RZJC 4BK4A 5EO9A 5JLZB 4GMTL 5CEZD 1XGQB 2PYEB 4QXGL 5D2NC 4OV5B 1H3PH 4NQDA 2IADB 4XNUH 1E4XH 3DUHA 1K5NB 3G5YA 1G9NL 3RZCA 1QBML 2FATH 1J88A 1I1AD 5DJ8A 2QSCL 5E6ZA 2N7BA 2ARJB 4MNGA 1CL7L 3IF1B 5DDHA 5HGBA 1Q9OA 4WY7H 3LQAH 3SDDD 3CVIH 4L4TD 4S1RH 2FX9H 3FO0L 35C8L 1DSFL 1B2WL 4RAUB 3VGDA 3QDAA 4MA8H 3MOAH 2AABL 1KPVA 1TTFA 1S7SB 2R9HC 2DJSA 2V7HA 4BKLB 1UKQA 4NKMA 1DLHA 3H9SB 3BKYL 5F7LB 3X14A 1I85C 2DQJH 4UIMA 2V2XA 4M48L 2A83B 4L4VE 3IDYB 4QYOA 5DJAA 4U6XB 2IMNA 4XCEB 2ICES 2NY7H 4JRYB 3BJLA 1I1RA 4NKDA 2ORBH 2GIYA 4ELMB 4WHTA 5FEBA 1N7MH 5GSVA 3OX8B 4BQ6A 5FV2A 4PRPD 5DD3L 2MNUA 4Z18A 3V6ZA 5I71B 3V5KB 1IC7H 4EIGB 1IM9A 3QIBC 5IVXA 2PYFB 3D0VA 1MCEA 1ADQL 2VXVL 4YE4L 4BFGA 5D7KD 4O58H 5EZLB 2Y6SD 3DETC 2HTLC 5IVNA 5DEGB 3CX5K 5FFLA 5DVNA 3BIKB 1HKFA 4YDIL 5JPNB 3MROA 4D9LH 1NMCC 1CDCA 4FQXC 5T1KD 2IANB 1IT9H 1VFAB 3A67L 4N0CD 1CT8B 1XF5A 4PREA 3STZB 2EZ0C 3AXLB 2ZUYA 3ETBF 4ZNCD 5SX5H 5HVFB 3AU1A 5F7KC 5JUEH 1B6UA 3G6AB 5HI4D 1XIWB 4OQTL 3QO0A 1Y6NR 4F3FB 2EH7L 1JN6A 3K46A 2R1YB 5DJ8B 2APVA 1QLEL 5DD0H 1CD0A 4GH7B 2FGWL 3BZEA 2FHBA 5C08B 5DDHB 4XWGH 3SJVA 1IKFL 4NRXA 1WZKA 5HGBB 2E7BA 4P23A 2GJ6A 2VC2L 1UH3A 3RFZC 5JW4M 3PHOA 4P4KB 2LABA 5DD6A 2A2QT 5IWLC 3QZWB 2DLFL 2BHUA 3QEQD 5B4MC 4C83B 2V7HB 1A7OL 4K8RC 1NCAH 8FABA 5I1HL 5J6HA 4JFDD 1DLHB 2P5WE 1NC4A 4UQ2A 4OZGA 2P44B 3QUYA 2AEPH 2ARJQ 4MVBD 2V2XB 3U0WL 5D7SH 4KI5E 3BO8A 2CDEB 3U4EB 1U58A 3G04A 4QYOB 2PW2A 5DJAB 3AREC 4DKFH 4F33A 3CFBA 4OLEA 2C7UA 1KCVL 3IXTB 3QIUC 1HDMA 1QYGH 1FL6B 3UJIL 4N90E 3SDXA 3WKNA 1SYVB 2NY3B 4B53A 4D9QE 4XP9H 3HR5A 5IB3A 4L3AA 1OAYL 4NRZB 4GUPB 2JJUA 5A40E 1NFDB 1WJ3A 5CP7B 5SWZD 1IM9B 3WL9B 2KQNA 4NNPL 1L6ZA 4PRHB 5AAWA 2OL3H 4NNYA 4TTDC 1II4E 1JFQL 1WIPA 3K2MC 5DMKA 1CXIA 5F7DB 3MNVA 4O9HL 2P24A 5FM4A 2D03L 3C87A 1SMAA 4RMTA 4XB8A 2ZP0T 5JZ7C 2ATPA 4RA3A 4PJDE 3S4SB 2WK2A 4G6ML 4AJ0A 4BZ2L 4XCNB 2GJZA 3W9DA 5K59F 4U4BA 5CBEA 3WBDA 4PREB 5I1GH 3ES6B 4JPVH 1ZSDB 4UAOB 2R23B 3MTRA 4J23A 1UM4L 1BEYH 1GGYA 4YAQB 4PIRF 4B50A 1JN6B 5KAQG 1FSKC 1A5FH 4XXCC 5DRXA 4KY1H 3UDWC 1VESA 3WN5C 1T1YB 1D7FA 4X83A 2E6QA 4JN2A 1VCAA 5F44A 5KANG 3BZEB 2V5SA 2MSPA 2YA1A 2LTQB 4NRXB 1GGIL 4X6FA 1ZGLM 2W9EH 2GJ6B 3UTTA 1NGPL 3PHOB 4XRCA 1OB1B 2FHCA 5DD6B 3MRDA 3QG7L 1JNJA 5E8PB 1JZ3A 4KVNH 4XT1C 5HHQB 3ALWA 3KWWA 3AMLA 3QJFB 2HJLB 3QUXD 4OLWL 2L4OA 3TT3L 3VXNB 5HGDA 1HXMA 3K3QA 2VYRE 1D5ZA 1ZA6B 5MEND 1LQSR 5IR1A 2I5YL 3O3AA 2Z8RA 5GZOC 4OKVA 3BKJH 5ICZB 5E03A 3ARRA 4AMKL 2YUZA 4TSAL 2DN7A 3CFBB 4YFLI 2OSLB 4CADA 3RWGB 2AS5M 5IHLB 2ZCLL 4FQHB 5ESVA 2QLVB 2APFA 4XPFH 1FO0B 1HSBB 4UV7H 2COQA 4AQ1B 4KJQD 2OS7A 2HTKD 5DEZA 2Y1VA 3QCUL 3EYVA 3ARUA 1VGEL 4NNYB 3U48A 3CMGA 1JTPA 3QHFL 3RNQB 5C07B 4HH9A 1OSZA 4MXVE 2DQDH 2P24B 1A2YB 5JXEC 2DYPD 2DOCA 3MBED 3QUZD 4HV8B 1CE6B 1F3DH 1U3HB 1S5IL 5B38A 5LCVH 1V7MH 5DS8A 1X5IA 4LVNC 3MLUL 4FQCL 5AYUL 3N85H 2R2EB 3WE6A 3WXWH 4GBXC 1BOGB 1HE7A 1KGCE 2NTFB 4KXZI 1LVEA 1CIDA 1KC5H 5BRZD 5JMRA 2QADD 2R69L 1A6ZA 5FDYA 5ISZA 2QKIA 4FA8A 3QQ9C 1U36A 1T0NB 5ITFA 3HLAA 4M7KH 5L0QC 2AJ3A 1ACYH 3EDFA 1DBBH 1KEML 1A1OA 4NNXA 3BEWA 4JKKA 3KPSD 3IDNA 4E5XA 4JFPB 3MRIB 2IBZY 4MNQE 4PTUB 1QNZL 4RIRA 3VA2C 1MCNA 5HDOA 2AJXL 3QI9A 3DURB 4KTDL 2BVEA 1WBYB 4CMMA 1N5YH 4YBLC 1OW0C 3C60D 1SJHB 4HKZA 2W60A 4U1HB 2GY5A 1JL8A 1MVUA 1EHNA 1HXMB 1ZTXL 3JV0A 3NIDF 4PB9H 5IB4B 4QHMA 4UZGA 1YEHL 2X40A 5E1HB 1MCOL 4KGJA 1CQYA 3EOTH 3HI1A 3CVHH 4XVSL 4S11A 1JPTL 2F53A 3L7EB 3TN0B 3H7BA 3C6LA 1MUJA 2GAZA 1G0XA 1UJTA 5I16A 4X7SL 4UNVA 2EKJA 4HX1A 4YZFE 3TO4A 3MJ9L 5ABDE 5E1AA 1ZLWK 1GHFH 2FX7H 4Q0XH 3CMOL 5F7NC 1E27B 4M43L 1QSFA 4HWZB 3QXUA 3EYVB 3CPLB 5ACZA 1OSZB 3QIWC 4KH2A 1KG0B 5D70H 5E2VL 1SJXA 3VGBA 1CLZL 3T2NL 3L3JA 3BPOC 4DCQA 4OZFB 3F7VB 4N1CA 4KKLC 4O51A 1TTUA 5IW6A 1BF2A 3DRTA 1VADB 1HXYB 3FFDA 1JF5A 2BHYA 5DT1L 5CBAB 2PO6D 3ZE0E 4X5XB 1EBAA 2Z31C 4ZUTA 1FH5H 3TT1H 2CMRH 2Q1EA 4P5MB 3NN8A 3CX5J 1BPVA 3HC3H 4YHYC 4X6DF 1J8HD 2LV4A 4MD5A 4WO4C 5F1SA 5ISZB 5J6GB 3HLAB 2R4RH 3FOLA 1VGKA 1HHJA 1A1OB 1XCTB 4NNXB 4A6YL 2BOBB 1PZ5B 4FFZH 3PQYA 3EZJB 3IDGA 4RIRB 5HYJE 4PLKD 3OGCA 3CSYA 1F6AA 3VWKC 5EOQL 4CMMB 2GYSA 2FLBT 3X11B 5KSUA 3AS2A 3FB7B 1C5CL 4DOHB 3HZMA 4JHAL 4XPBH 1JHKH 4QHMB 4NPYA 1U6AH 1K2DA 4LSRH 4LCIL 2WZPD 1G7IB 3QDGE 4L3EB 4YDKL 4R90H 4DK3A 1SEBA 2JKXA 4LIQH 5LBSL 3HI1B 4U6VH 2ZCKL 2R56H 3SDCC 5EU7C 4KUZL 2VDPL 1FVDB 4LCYB 1JNNH 2F53B 5EU6A 3TIEA 1MUJB 2GAZB 3MFGB 4RBPH 4ZPTA 5I16B 1BFVH 3KYNA 2JB5H 5D71L 2YPLA 4YXLH 3ROLA 2CJUH 4QRSA 2ED7A 3TO4B 2P45B 2KH2B 1X4XA 2F5AH 1WAAE 4IOIA 4Y5XC 1H0DB 1I7UA 4OI9A 3KPMA 5FGBA 1QSFB 3IT8D 2MHAA 1Z6JT 4ZTOH 3I02A 3P2TA 4ZYKA 1UENA 2WSKA 1U95A 3VGAB 4H20L 1BM3L 3SN6N 4XNQB 1GZPA 3HC0B 3RVWC 4WW1A 2AJVL 3Q5YA 3RUGF 5MI0B 2P8LA 1DL7H 4FQJL 2Y06L 3HAEG 3OKKA 3KPRD 4ISVB 4HFUL 3C8KB 3F6LA 4XZUB 4BK5A 1JRHH 3SBWA 3NN8B 1JHLH 2EDYA 1H8NA 1E0OB 3M8OL 5LWYL 3V4VL 1ZEAH 2PTTA 4J3UA 1A6UH 5D1ZD 4QRQB 4IRJD 5HYFA 5IFJA 1HHJB 3F6IA 3P4OB 4PP1D 4K71C 1JYVA 3P0YL 2CR6A 3EHBD 3D18B 2ZOLB 5C0CA 1DQLL 4LRIA 4G8EA 1LP9F 3PQYB 3MRKB 2OI9C 4IRSB 3VG9C 3CSYB 1F6AB 4JM2A 4S1QH 1DFBH 2J5LB 3NFPB 3HZMB 3I6KA 2P5ED 3UTSE 5BMFL 3H7LA 5JHDA 1K2DB 5CGMA 1RURH 4MAYC 1PKQA 1PVHA 5EB9A 4KJYA 3PV6B 1HNFA 1SEBB 4MCZA 4P2OB 4L4JA 5JW3H 1NAML 2Z91B 2I07B 4P2RA 5EU6B 1M71B 4ONFH 3JTSB 3QRFM 5FB8B 4ZPTB 4YHML 1AGEA 2A9NH 4H8WL 1EFXA 2XQYK 3KYNB 1D6VL 2FSEA 2YPLB 3UTQB 3BZ4A 1UWGH 2DM3A 1AP2A 1T7ZA 4NWUH 1YYML 4IOIB 4WWKD 3CDGB 4D0DB 4R3SA 1A9BB 1LEIA 4R0LC 2MQ3A 3P40A 2AV1B 5DRNA 2MHAB 3OV6A 2C3GA 2CDFB 3I02B 4LLDB 4J4PC 5TH2B 4YX2H 1N2RB 3PP4H 4ZYKB 1JPFB 5TE7H 5HSFA 1FP5A 4X6BA 2ITDA 4LPYA 1FV1B 4UIKH 4B41A 2EXYD 5IESL 4JLRB 1A1NA 4HF5H 4ZFZA 1OTSC 4RA0C 2RR3A 4MX7A 3WJLA 3OTTA 3P30L 3WLBA 2EXWC 3GGWA 2X4UB 3HUJF 4NHCL 3UCRA 2W1NA 5I30H 2IPTL 1A1MB 1A7PL 4U0QB 3GSNL 3VXSE 3EOYG 3X3FL 1U8PA 4C58B 4NN5C 4JRXE 3O45A 3UPRA 2CIKA 3HMWH 1FYTB 2EYTA 1FFPB 5D4QA 5GS1A 1AFVH 1P6FA 4P3DA 2CXGA 2WAHA 2D7OA 3B2VL 3FQUB 3TH2T 4YEEA 3OJDB 4OM0H 3UBXA 5C0CB 3S96A 2PYEE 2AK4B 4ERSH 1RAMA 1XCQA 5I1LB 3DSFH 2DMCA 2JE8A 5F70A 1T1XB 5HXMA 4U1KA 4CDHA 4H0HB 4DVBB 3SCMA 5KSAB 1L7TL 2XFXA 3O8XA 3RI5K 3UAJD 4LHJB 4XGZB 4KMLB 1IEBB 3I50H 4LF3B 3TZVB 5C0GA 3FB6B 3LEXA 5FYKE 4P2RB 5ENWB 4QHUA 1OM3H 4KRNA 1AGEB 1UA6H 3MOBL 3MJGX 3W81A 2VN7A 3MRLA 2NY2C 2PR4L 5I1KH 4L4VD 2XWTB 3BZ4B 4FFVD 3UJJH 1PGRB 1AP2B 4FXLA 3BHBB 4GW4B 4G9FB 4I77H 2V2WB 3H9SE 5MP6H 2E3VA 4R3SB 3GRWH 4PJ8C 1LEIB 1KIUA 3QH3A 5DRNB 1W0VA 4L8SA 4JFQA 5MEQA 4O02L 4OGYH 1IGTA 4LLYB 3PWNB 3GMQB 4U05A 1I9EA 5GGRB 4OCYH 1AKJB 4ALAH 1A6PA 1NC2D 1XGTB 2VDOH 4JRYE 5E56A 4PRIB 1KLFA 1QOKA 2FEDD 3HNSL 5IVZA 1DVFA 4ZUUA 1A3RH 1S3KL 5H8DA 2ITDB 5D5MA 4HK3J 1JPSH 1JZ2A 1J9CT 4XVJL 2BMKA 3S5LA 5D2NA 1WFNA 3RJDA 4IM8A 3V6FA 2DTML 2QR0A 1A1NB 4OZHF 1KIPB 4ODUA 2OZ4L 2A77H 4MX7B 4DZBA 4ZS7L 4ZOCA 4F9LA 3HTLX 5E4EC 1PG7H 1FHGA 2BSTA 4NCC2 2K7PA 3G6DL 3RUGA 4I18A 3UPRB 1EAPA 2I25N 4LLUB 4MQSB 5GS1B 4P3DB 4ODTL 4P9HL 2D0GA 1Q1JH 2XYCA 3PL6D 2CDGA 4HS6B 4OCWH 2WBJD 4I3RL 3WNMA 1E28A 1C8PA 2W0KA 4HMCA 2WM0A 4MSWA 2CUHA 4HKBA 4U31A 4X6DB 3U9PH 5TDPA 5CZKA 3QISA 1YDPB 3N06B 5C0NC 4U1KB 1X4ZA 3KR3H 4RMRA 1CLOL 2M1KA 1BZ7B 1JCKA 4G6JL 2RCSL 4HUMB 5DD1L 1LP9A 1AR1C 2JLLA 2P5WD 4N8CL 4APQD 1FG9C 4QHUB 5ERWB 1R5WA 2X1XR 3DVGB 3UMTA 4XPHH 4G6KL 4KI5D 1ZLVH 5C9JB 3VGFA 4HK3N 5B39A 3K74B 1FLTX 1LO0L 1CDYA 5ILTL 4PD4K 4CRPA 4AH2A 5BJTB 4J2XA 1TJHH 4N90D 5MEQB 3DX6A 4MXWL 5E2TL 2ZUTA 4YHLL 4HAFA 1IL1B 4D9QD 4XWOC 4JRWA 1BVZA 3IYLW 4XHQA 5IVZB 4LLQB 43CAA 3VFGH 3O3DA 3RX7A 3MGTA 3TFKD 1FDLH 1HQ4B 3S5LB 4YHZH 2CK2A 3RBSA 2QR0B 1NFDE 1XF4B 4S1DD 4KZDH 1RQ5A 4ODUB 4JFZL 4X6EB 3ARBD 2XN9A 3IKCB 1E4JA 4JFFA 1B9ZA 1HHGB 5I8EA 3TBVA 3BQUD 3C08L 4F7PA 5DUBA 1NGZA 1IC4H 3RQ3A 4IMLA 5IT2L 2VISB 2OK0L 2HKFH 3FOMA 5FKPA 4CN6A 3AM8A 1W0WB 2ICCA 4HJ0C 2X05A 3REWB 3RUGB 1EHXA 3EYQC 1S7WA 3O6KL 4OF8A 4KROC 1KCUH 5HVWA 5IWLA 2CDGB 3MLYL 4G42A 3HUJA 3D87B 3B9AA 4W4OC 1PLGH 5DUML 1W72A 4MSWB 2XQBH 3GBNH 3FO2B 4BSVA 3PGDB 4OM1L 4YDVB 4OLYL 2P8MA 3JWDC 2QSTA 5GRYA 4X7DC 5H35B 3E3QC 3HPJA 1CG9A 1BIIA 3QQ4A 3RIFF 1T89C 2QEJA 2XKUA 4QGTA 2C3VA 4XBEL 4XNZB 3ARQA 5A16A 5F8QC 3AREA 1R3JA 1LP9B 2GJ6E 3QWOA 1RUQL 1FNSL 5DVKA 2F15A 3ULVC 1INEH 3QIUA 4Y4HC 1TZHA 3ESVF 2VAAA 4HT1L 4DN4L 4XPGH 2E7LC 4NIKB 5DD5L 4K3GA 4AL8H 5I8OL 4OAWB 3FMGL 3T3PF 1CGWA 3QIBB 1MCWW 2R1XA 1N3NA 5IQ9A 1U41A 3P4MA 4ZAKD 5DFTA 3DTXA 1C7TA 2A74B 3GSQA 1KXVC 1E4KC 1TVDA 1JI2A 2OJZL 4Y4FD 4EOWH 4XPTL 3BP7A 4FQXB 5EWIH 3VFTA 1I3GL 3UBXG 43CAB 4MJIB 4HS3B 3O3DB 3QPXH 5GJSH 1NCUA 2W9DH 3MGTB 4MQ7B 3VRLE 2C1PB 3QEHA 2V2TA 3MZTA 4UUJA 3BXNA 4YHKH 4ETYA 4DTGL 2XN9B 1KPUA 3GFUA 4CNIA 5LAXB 5C07E 4KHXH 4XXCA 1CFTA 3WN5A 4WFGE 1N6QL 5I8EB 4F7PB 2X89D 5DUBB 2AI0L 2GITB 4BH7A 4GW5A 1KGCD 2OXGA 4X8XA 2ZKHL 1FGNH 3R0MA 3C5ZA 1KJMA 3GM0A 1QHPA 4OZHA 3KPPA 4L9LC 2Q8BL 1F4WH 5I1DA 3TBYA 2VIRA 1GIGL 4NOBA 1WF5A 1WZMA 3QXTA 5DGQA 3MLVH 5D1QA 3WUWB 2P8MB 1DZBA 3F5WA 2HH0L 4MNQD 1NJ9A 3RGVD 3QQ4B 3HE7D 3Q6FB 1PY9A 2C3VB 3AREB 4ODXB 1OHQA 2XZCL 4RGNC 5FA4B 2H9GB 3GMNB 2KZWA 3NAAL 4O2FA 1NLBH 4BZYA 4TQEH 4CVUA 5D1XA 4GRMA 3WCYA 3ILQC 2WIIA 3MUGA 1MFCL 2BHZA 3T1FB 3E2HC 1IC1A 1F6FB 2JIXD 1T22A 1T0PB 4ONGH 3MR9A 4C59B 3BDBA 3O0RL 1J86A 4F58H 1KXTB 3TYFA 5L6YL 4R26H 1EXUB 1XGYH 1QVOA 5IQ9B 3R0NA 1YPZF 3OKOA 3GZKA 3RKDC 3GSQB 1FVEA 1EX0A 2H45A 3W82A 5JXEA 4RQQA 4LAQL 5L7XH 1JGVL 3BP7B 4OLVL 1N6VA 2ZOKB 3BAEH 2G5BA 4P48A 3MYZA 5HI3C 3V5DA 3HI5H 4GBXA 1BAFH 2G60L 2VE6A 3QEHB 5IIEA 2A6IA 2BDNH 4Y4KA 2DWEB 3EUUA 3WLWC 3ULSA 1KPUB 4CNIB 4NQXA 1FSKB 1Q0YL 3TJHC 1CFTB 4I9WE 3WN5B 5BXFB 3IFOB 1ODAA 4LP4A 1DUYA 3EOAA 3HMXA 4JN1L 4ORGB 1HQRA 2B8OT 1OT1A 4UB0H 4GW5B 4QT5A 3H3KA 4NWTH 1JYWA 4NHUA 3DUSA 4Z7OE 2R0ZH 3CC5B 3UROR 2BY3A 4OZHB 5BV7L 4S0SD 2IG2L 4ELKB 1VFOA 5B39G 3O2VL 2VIRB 1OW0A 1Q72H 5EZOL 3NTCL 4OLZL 1MWAB 4MAUL 3QCTH 5ISZE 3LRGA 1NJ9B 3UX9B 5HYJD 1DE4A 5HGHA 3JBG7 3O9WA 4EUPA 2ZCHL 4FOMA 4BFEA 1H3PL 1T04B 1T5XB 2F58L 2DDQL 3U4BL 1SHMA 2VOTA 4G8GB 4H25A 4GRMB 4UV4H 2FATL 2WIIB 2VWEC 2B20A 3QDGD 4FTVA 4WUKL 4EQ2A 3DSNA 4DOHE 1S78D 1WIOA 4WY7L 1OCWH 4FQIL 4XMPL 4MLIA 5DJZA 5I18H 2CK0H 3GMMA 4LDEB 1NPUA 3O2DH 1FIGL 4MHHI 3MOAL 4KZEH 4FN0A 3MOQA 2VO5A 3CH1B 2FWOB 5GGSY 3GIVA 2F53E 1A7QL 4HGMA 1MHEA 1E6OH 4LVNB 2R4SL 4I3GA 3VXTA 3OAYH 5D6DC 3FO1A 2J8OA 4GBXB 1FQ9C 3O3BA 5J1TC 2BVQA 5IIEB 5A1AA 2A6IB 3QDMB 4GS7C 1T66D 4PD4J 1QSFE 1M6OA 3KNBA 5DJYA 3ULSB 2JK5B 3G5ZA 2AJYL 4K2UH 3T0EC 2WNGA 1ED3A 4LHQB 1N7ML 1WITA 4WO4A 1DUYB 5L8JB 5L0QB 4OT1H 4QT5B 2E27L 1IC7L 1FAIL 1QO3A 1FO0L 1S5HB 4OB5H 4OIBA 4O58L 3VWKA 1TLKA 4CBPA 4YBLB 2CO6B 2YD2A 1BBDL 3NZ8A 3Q0HA 4D9LL 2ARWA 1BQHG 4JPKL 4NZRH 1OAXL 7FABL 2XZQL 3CCHA 3MV9B 4X80L 4BELD 1YEGL 1Q9LB 1SMOA 4P59L 1LEKA 5F1OB 5K59E 3OXRA 4X4YA 5B21A 3NFSL 1ZT7B 1J10A 5HYEA 1AE6L 3SDCA 4EN3B 3PP3K 2GKIA 3UTSD 4HIEA 3PQYE 4KC3B 4ZNEE 4R7DA 3V0VA 3WFHA 2YMXH 1NMBH 5DMGC 2D9CA 2V7NA 2J88L 4Y5XA 5T3ZE 4YGAB 2R0LH 4ZUSB 4J7RA 1SVCP 2DS4A 4HPOH 2YXFA 3WXVL 1G7PB 3GMMB 5FF6A 1U8NA 2HMID 3QIWB 4C54A 2RIKA 5JW5B 3B2UD 3BPOB 1NCAL 5EU6E 4HPYH 5EU5A 5D7LB 1DBJH 5F9WC 4N0FB 1MHEB 4XCYB 3SGJC 5DZOA 2YPLE 1I1YB 4YJZL 3WUZA 5KTEH 5D7SL 3NOIA 4OD3H 1I1FA 1YPZA 5FKAA 3HFMH 4RZCA 4DKFL 3HAEH 2NLJB 5EORH 2Z31B 4R8WH 5FAAA 3G5ZB 1KTDA 3RTQD 2AXHA 4YHYB 5I66A 1QYGL 4FQQA 4WO4B 4B7IA 3B9DA 5GSRA 5IMMB 1RULH 2Q3AA 3MUY1 2JELH 4XP9L 1CYGA 4P3CL 2PXYC 3RWDA 5CLWA 5JR1H 1W8OA 4S0TD 1UM6H 2OL3L 3GHBH 4AM0A 1M05B 4PJCF 3VXSD 5MERB 5I1EH 5D8JL 3VWKB 4JRXD 5IB5B 5J12C 5GGTA 3ARGC 3DOSA 3H2WA 3ZE1F 1KB9K 5DJDB 1T80A 3H9HB 3KLHC 3JZ7A 3WO3B 1X5KA 2PYED 3CCHB 4UBDC 4WI7A 4LLAA 2J8HA 1LEKB 4CU8A 3I2CL 4L3CA 1FYTE 4LU5L 5I1GL 2Y36H 4UINH 5FYJL 1BF8A 3SDCB 1KULA 5TE4L 3MLZH 5L2KB 3V7AG 5C0CE 3U2SB 1FZMA 5C0IB 1KTRL 2O5YL 1L4IA 2B4CL 3CU7A 1LO4L 1FNFA 5INDA 1A5FL 3B8YA 4R7DB 5H2BA 2PW1A 4MJ6A 2FJFB 2UWEF 2VDNH 4QHLA 2V7NB 4Y5XB 5FYKD 1JP5A 1CR9H 4Q9QL 3NFNB 4NGHH 2W9EL 4U6HB 5DJ6A 3ZYZA 2ENYA 3UYRL 5IF0A 5JHDE 3FQWB 5JXAH 1CFSA 4J4PA 4K9EH 5SX5K 3MCLH 3C2SA 3D69A 4AENA 5KVFH 3H9SD 3ET9F 3QT2A 1V3KA 4JY4A 5GISH 4P2RE 4JY6A 4WIQA 5AG9A 4JJHA 5EU5B 1IZJA 1HNGA 3GJFB 2XRAL 3HS0A 5B3NA 3TA3C 3NIDE 1N26A 3TBTB 4G9FE 3CSGA 2M8XA 2FO4B 2GT9B 3RVTD 4JRYD 3X3GL 5FDWA 2DQHH 4RZCB 1FPTL 5DHYA 3VH8A 1WZ1L 3WHE1 3FO9A 4QNPF 1KENH 1HWGB 1W2KT 5C0BB 4C56B 3F8UB 4YLQT 1GPOL 4EUPG 1U8HA 3VD9A 1S9XB 2R39A 4PRIE 4XPFL 4EDWL 4LNRB 1L9MA 4K71B 4P2QA 3MXVH 1FNEA 2YD8A 4F2MA 5GGUB 2WMPA 1NAKH 2OI9B 4NCC1 5EZIH 3CDYA 2R2BA 5GS0L 1GGBL 3VG9B 2DQDL 3ULVF 3HCVA 4HDIB 5K9KB 4J3VA 5I1AA 5DJ2A 5LCVL 1V7ML 3W11D 1D6EA 3ZE2F 5C3LD 4OTXL 1ZVYA 4LCCC 1WK0A 1CFNA 5I9QC 3WXWL 2V9QA 1EUUA 1R3HA 2ADGA 1J1OH 4MAYB 5DJCA 1XIWD 1WFTA 4YGVA 4QOKA 4DUWA 3RZCD 1PEWA 3LPFA 4Z78A 1KC5L 3DRQA 4OLUH 3WHE0 3GI8H 1FZMB 4TVPE 1BLNA 4IOFD 1OAZH 3P11H 1IC5H 2CLVA 4LMQI 3D2UA 1MLCA 1WLHA 2SEBA 3AUVA 3SDAB 4M7KL 4R4FH 4PUBH 4HK0A 4U3HA 3BYTA 4HMDA 4P4KD 1P4LB 1I1AA 5TPWL 4F37K 4R0LB 1RZIA 5FYJU 1JZ6A 2YD7A 2E7MA 1CFSB 3DVIA 3W5NA 5HPMA 4R4NC 3ZDXF 1C5DB 3AAZB 3RY6A 2IF7A 4XNMA 2WV3A 4J12A 4AENB 1N5YL 2X5PA 3SKNB 4JY4B 4NC0B 3DBXA 1GL4B 1HIML 3NGBC 3HS0B 3VJ6B 3QAZC 3LS4L 4XBGA 3L6FA 4XAWL 3CVHL 2ZJSH 5ADPH 4DVRH 4YHOH 5DHYB 3FRUA 3OKNA 1X5XA 3FO9B 1MH5A 4QRPB 4XX1G 4ZOAA 1ITCA 2AK1H 4CMHC 1U8HB 4NN5B 1IM9D 3PWPA 2Q7YB 3U0TB 4Q0XL 3DX8B 5E94A 5GGQH 4WEBL 1ZVSB 2FX8H 3FQNA 2ADIB 3SGDI 4P5KB 4PRPA 5D2NE 3EO0A 3L5XH 1QRNA 4PY7A 4PYGA 1B4RA 1AIFB 5DJ2B 1D6EB 4KKAD 4PBWD 1Z5LA 5CKAA 1CFNB 1MEXH 4LKXB 2PF6A 4WDIA 2DJUA 4U3CA 3RUGE 2EDTA 4YGVB 3IFPA 1EGJL 1IEAA 4BJLA 4Z78B 1CDJA 4HXAH 1H15B 1DDHA 5FGSA 3TT1L 3CD4A 3SO3B 3HC3L 3QG6A 1XGPB 4WU5A 2NY2B 2V17H 1MLCB 4DKAA 4GO6B 2R4RL 1KN4H 2GJ6D 1D9KC 4HK0B 1TZIB 5DQ9B 1RUPL 3QUMA 1EMTH 4PJ8B 4R2GC 5C0AB 4G43A 1OD9A 1QSEB 1QLRA 4JFXA 4L8CA 4I48B 1ORQA 1A64A 1LP9E 3KLDA 1CBVH 2NXZC 3INUH 5C0DA 1NC4D 2EECA 4V2CB 3FCTB 3QUYD 3AY4C 2VLME 1YMHB 5ITBH 4XPBL 1JHKL 4JJ5B 5K9OB 2ENSA 1U6AL 3QEQA 5HHVH 3O3EB 3WFEH 3BUYA 4JFHE 4Z77B 1PYWA 4LIQL 1NDMA 1S9YB 2IALA 4JFDA 4U6VL 1RIHL 4ZO9A 3L3HA 3PDGA 3FRUB 1P7QA 3OKNB 1JNNL 3PUCA 5E4EB 1NCBH 1XH3A 1OWWA 4QXWA 2VLKB 1BFVL 4KMQA