3PDDA

Structures of clostridium thermocellum cbha fibronectin(iii)-like modules
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
190
structure length
190
Chain Sequence
MVTIDSPVAGERFEAGKDINISATVKSKTPVSKVEFYNGDTLISSDTTAPYTAKITGAAVGAYNLKAVAVLSDGRRIESPVTPVLVKVIVKPTVKLTAPKSNVVAYGNEFLKITATASDSDGKISRVDFLVDGEVIGSDREAPYEYEWKAVEGNHEISVIAYDDDDAASTPDSVKIFVKQARLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Glycoside hydrolase, family 9
publication title Structure and function of the Clostridium thermocellum cellobiohydrolase A X1-module repeat: enhancement through stabilization of the CbhA complex.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 32
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17957 Big_7 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pddA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pddA01
4KK6D 1F6AA 2DM2A 4OBSA 4MB5A 4MMZC 5D96B 3MRDA 1NUNB 1EXUA 3DI3B 4GXVL 3I85A 5CP7B 4K3HA 1FN4B 4LSTH 3E1F1 1FNGB 5EA0H 2WUBL 2XICA 2BC4A 1NGXB 1G7IA 4LPWA 4LHUA 3CFBA 3EYFB 4K7FA 1RFDL 4XPTH 1OAQL 4TNVK 2H3NB 3NCYS 3TCLB 3HE6C 1RJLA 1OGTA 4CU7A 4KDVA 4FQJH 1RZJH 1KEGH 3GZKA 3IDGA 5ESQB 1T04B 2E9BA 4D0CA 5DJ6B 1F42A 4GUPB 2X4SB 1LEIB 4JRYE 3H42H 1TETH 1FRGL 4IRSA 2ZSWA 2NMSA 3UTOA 2A9MH 5E2TH 5MI0C 3P4NA 1MJ7H 5I19H 3QNYA 4JN1H 1PJ9A 2EC9T 1JNNL 1AP2A 1U8QB 5EORH 5C0GA 3WKNA 1QFWM 2HFGH 2HP4A 1YNLH 2AJYL 4OZIF 3QQ3A 4ZFOL 1P69B 4ZYKB 1MIMH 3LZFL 1UB5A 5FYKD 3I02B 2D9CA 1RJYB 4NSKB 4N68A 1QEWB 2D31B 3BIAX 1I7ZB 2VWEE 3JXAA 4C56E 4NQCA 4XCEB 1B0GB 1D5XA 2NW2B 5JQ6L 1F3DJ 1RK0A 5EC1A 1MLCA 4OCWH 3B3IB 5F7UA 3HNTH 4NKOB 3EZJB 3ULSA 1DFBL 1OW0A 4QHNA 3WD5L 4KTEH 2D7QA 3BEVB 3HI5L 2CIIB 1U8KB 2F53A 3QDMB 3QIUA 3VH8A 2FL5B 5C0JB 2G75B 2FIKA 1H3TA 5ANME 4LLWA 1S7RA 2RCSH 4DTGH 3O4LA 2NY1B 4PGEA 2XG5A 1XF2A 3FTGB 2YD2A 1PZ5B 1EJ6A 4TOYL 5ACLA 1FL6B 2EIEA 3RA7L 4MJIA 1EEQA 5LGHH 1QYGL 1MHHA 3MNVB 3B2UC 4MAYC 2AXFB 4NQEE 4OT1H 1BVZA 1FNFA 3ARBA 3PWUB 2E7MA 4KK9C 3WIHA 5FUCE 5F7LB 2W60B 1SHMA 1TZIA 4G8GA 2H8PA 3VWJB 1MJUH 3UZVB 4C83A 5J9PB 2Y23A 1VFUA 5CBEA 1A6VL 1NANH 5HYQA 5F6HJ 3WNKA 5D2LA 5JDSB 2DQIH 4WVRA 4DFHA 1KLUA 3FT2B 4F7CA 4XCNB 1AKJA 3GKWH 2MHAA 1G6RB 4FG6D 2UVFA 4HUUA 4LVHB 1L0YA 3OX8A 2ICEA 1RULL 3QEQA 1J8HA 3VFGH 3CFJA 1U92B 3MLTA 1EVTC 4Q6IB 2EYTB 3N1MC 4QHLA 1ZE3C 1G7HB 2FHCA 1LEKA 4BZ1L 4JKPH 2YK1L 3DRQA 5B4MD 4G8FA 3RKDD 3BZ4A 5I1AB 1UM4L 3B9KA 4JM2B 4LRNH 4OUUA 3I3BA 1F3JA 3MV9D 4DZ8A 3GBLA 1HYRC 1GC1H 3DX9A 2OL3A 1L6XA 1J0JA 4NO5B 5TE4H 4Z7VA 1T80A 5HVHB 1AQDA 4PRHE 5SWZA 1JN6B 4JO3L 3BISA 2PNDA 4ETQB 4YXHH 3CFDB 5C0FA 4G9DB 4DGIL 2PR4H 5EFIB 5FYKH 4OZ4A 4P2QA 1E4XI 4JKMA 5CP3A 4KK5D 3QUZA 4P59H 2DQEH 5D1ZA 6CGTA 4QCIB 3FFCE 4JPWL 3L6FA 1JGVH 2D0HA 4I3SL 4PJGE 4K23L 4OLYH 3BDYH 5BS0D 2CDGA 4I2XE 1V05A 1MCCA 1Z5LA 3PHOB 3RNQA 4QWWC 5EO1A 5IK3B 3KPNB 1W72B 5IQ7H 3RGVB 4D94A 5IJKC 5IFAL 1CZ8H 3K4ZA 4EI5A 3MUJA 2V9RA 2WUCH 3I9GL 3ZKNC 1WZLA 1KN2L 2ADIB 3NN8B 2V5YA 5IVZA 3MA7A 5DGQA 5LQBL 3I6GA 1F6AB 2RB8A 1BBJA 1LK3L 1XF1A 4LFHG 5IW6A 3MRDB 4PJEA 1EXUB 4KC3B 5FO8B 3R0NA 2FJFB 5KS9E 1TQCC 2DYPA 1UXSB 1OTSD 1MIEH 3B43A 1HI6A 3WEXA 2V5RA 2OLDA 4CDHA 1G7IB 1R3LA 2F8OA 4LHUB 4YX2H 4N1HB 3CFBB 2Z35A 3V5HA 1A3RL 4OZFA 2QR0A 4K7FB 5MEQB 3OKDB 1G9NL 2YHGA 4DN3L 2P8PA 5E2UH 5E2JA 1RJLB 1OGTB 2HN7A 1KEMH 4OGAC 3T08A 3GIZH 3OKEB 5FECB 5I9QC 4NN7C 1QA9A 3NGBC 4I2XB 5I1KL 2ICWB 1A7BA 3EYOA 3LEVH 4OCLC 1T0NA 4D0CB 1S7QA 1CXEA 2IG2H 3EHBC 1I9RH 3DBXA 2OMNA 2IAMC 5HYJA 5TH2A 3DYPA 2ZSWB 1VB9A 2CR3A 2R0WL 3P4NB 3U83A 3OB8A 3QNYB 5I18H 3B9AA 3U0TA 3SN6N 1AP2B 5D2NA 4HKXB 2A74A 4NJ9H 5TPWH 6FABH 5SX4H 5I1JL 1NPUA 1FO0L 2VXTH 1T7YA 1CDHA 4XBPA 1IGIL 5DVKA 4XHJD 1UB5B 3VG0L 1VGKA 3FJTA 3FONB 1LP9F 2PO6D 2CDFA 1OCWH 1MRDL 2EECA 4O9HL 1BBDH 3HR6A 2R1XA 2XA8L 2E6PA 5GRUL 5BMFH 5L2KE 4ZDHA 3AY4C 1EUUA 1RK0B 3C5ZB 5EC1B 1MLCB 4RBPK 3ULSB 4QHNB 3BPOC 5DD3L 5GGRB 3L3OB 2FX8L 2UUDK 3UPRB 2F53B 3QIUB 1NAKL 2D7NA 5TE6L 2FIKB 3T04D 3MZGB 3I75A 3O4LB 4ZTOL 4Z0BL 1NUFA 4PGEB 3RUGE 1XF2B 1UB6A 3L3HA 1ZLSH 5D1QA 4DGYH 3L5XH 2X09A 1N6QL 1IGYA 4YGVA 5DLML 2WM0A 3IXTA 5DS8A 1ZOXA 4MJIB 2JKXA 5T1DH 4CADA 1MHHB 2N56A 5D1XA 3WNOA 2FB4H 1CICB 4L1DA 3DX8A 3OZ9L 3DSFL 1TZIB 2DIJA 4HKBA 4C83B 3A6CH 5JHDA 4KI1A 3W9EA 5CBEB 2YKLH 2I9LA 1RZJC 5E94A 4OCRH 4X7CC 4U3XA 3PDOA 3C09C 3DO3A 3EO1A 5D2LB 2OXGA 1OAUH 1J8KA 2GSIA 4JREC 5DMGD 5E5RB 3RIFK 1KLUB 1B88A 1A6TA 1AKJB 3HB3C 1SY6L 2B5IC 1OP5K 1WBYA 5IMMA 4LPVA 3SCMA 5ITBH 2ICEB 3F6LA 3MRBA 4RISH 2MTPA 3B83A 1WTGT 3OKOA 4XMLH 5C6TH 3CFJB 4PYHA 3MLTB 1CGSL 1T89C 4QHLB 1C5BL 3FZUD 3IDYC 4GAYA 3BKCH 1LEKB 4OIBA 1T22B 3H7LA 4PRIE 4RDQF 4APQA 5B38G 2YPLE 1MCOH 1R5WA 3DRQB 3RL2B 4G8FB 3QIWD 2VAAA 3BZ4B 4GQ9L 1JI2A 1QBLH 4Y5VC 3DUHA 1AR1D 2A0LC 1EHXA 3GNMH 3Q3GB 3IU4L 1F3JB 3P9WB 3B4NA 4E9LA 2FYYA 4OIIL 3DX9B 4K7PL 1FQ9C 1CTOA 3BQUC 3MLXH 2OL3B 4Z7VB 3QQNA 5ILTH 1AQDB 4OKVB 5SWZB 3CIQA 3IJHA 3KVQA 1KBGH 5C0FB 2EEDA 4AIZA 1BZ9A 3REVA 4OZ4B 4YR6A 1KACB 4FQ2L 1A7RL 4P2QB 4WJ5A 3QUZB 4ZAKD 3TH3T 5D1ZB 3F62A 4E41E 2J88L 3AM8C 4X98B 1S9XA 5J3HD 1KULA 1KJ3L 3FN0L 2CDGB 4H26B 3UTSB 3GBNH 5F93C 4V2CB 2LV4A 4YDKL 2B20A 4PRIB 1EHAA 1F02I 5C0BA 2EKSA 2YPLB 1NCDL 4TULH 5GZOD 1EVUA 3QUMA 3IXAA 4RFOL 2YA2A 5IVZB 3MA7B 3I6GB 1QNZL 1IM3B 5IBUB 4HGKC 4XBGA 5IW6B 4PJEB 1I1AB 3ZYZA 4YFLF 2DYPB 4D0BB 4ZXBC 1KCVL 5I1CH 1HI6B 1WICA 3C2SA 1HYSD 3AAZA 4H8WH 2UY6A 1GGIH 1R3LB 2Z35B 3V5HB 5FHAH 3GK8L 3CZFA 4OSUH 5DUBA 4JFFD 5D5MF 4JFHD 1U93B 4NKMA 4JCLA 4UV7H 3JTTA 2Y5EA 3F8UB 4QRUA 2EXYC 2EDHA 2HN7B 1UYWH 1XGTA 1AO7D 1P7KA 3VFRA 4YFDB 1I7TA 5HI3C 1QA9B 2X4RA 1JCKA 4X5XA 2YD5A 2F19L 4U1NB 4FRWA 4EUPA 2IJ0C 2CKBA 5IW1A 3GSOA 3T0EA 3IAGC 3DBXB 1CD8A 3MLUH 5HYJB 3JWDC 4HUVA 5HHMD 4ZSOE 4OCNC 7CGTA 4GMTH 2X4OA 3T2PA 3ZHDA 3U0TB 5D2NB 5EA0L 1YQVH 2BZDA 4MNQA 4HS8H 5TQ0H 4PJ9C 1VGKB 4XPTL 5HPOA 2X70B 3BP4A 1NDGA 4FQJL 2R1XB 2IH1A 1RZJL 3IDXH 2HT2D 4ZDHB 3K2UH 1D9KC 4RAVA 5DMIH 4P3DB 3O3AB 5F9DC 1ACYH 3H42L 4QNPE 5D7LA 2A9ML 3D69A 5E2TL 5JXEA 4A2LA 1MJ7L 3L3HB 5DJZA 3D2UA 4JN1L 5D1QB 5BZWA 1NCTA 2IQAA 5EORL 1IGYB 5DS8B 2HFGL 1YNLL 4CADB 2Y07H 4XVUD 1MCDA 2WWKO 1MIML 4GKZA 5D8JH 1CFQB 5D1XB 3DXAE 2R56H 1VGEL 3OAZH 1C16B 3ZT6A 4MA1B 5F9JA 1IEHA 2A6JA 4HKBB 4OCWL 1C1EH 4LGSB 1WCQA 2I9LB 3NABH 4FQLH 4KTEL 4QXTA 3WNPA 4KRLB 2V6HA 1IGFH 4XNXH 1K85A 5C6PB 3Q5OA 2VLMD 2XRAH 2GSIB 2RCSL 2WP3O 3STBA 1A6TB 4GS7C 1ZV5A 3V52H 2BHYA 1WBYB 5IMMB 1U8JA 2R1YA 5GRJH 2F58H 3MNWB 3MRBB 3OKOB 3BO8A 5LGHL 3KG5A 5T33L 1CK0H 1MWAL 4LVOC 4TUKH 3SGJA 4OT1L 4GAYB 5EH1A 3U30C 1I8MA 2VAAB 3QQ9D 1P4LA 1EEUA 4IS6B 3ZSTA 1VEMA 1TQCB 1FZOA 1MJUL 4JDTH 2Y06H 4LLQA 3H6JA 2FYYB 4IMKC 3DI2B 3S35H 4K07A 2NXZD 5EUOE 1RZGA 2ICCA 4KHTL 4RGMC 3MGAA 5IVXA 2DQIL 4MQSB 5JO5A 2IPTH 2VLJA 3IJHB 2J8UE 4I0KA 4BK4A 1J10A 3RWFB 3LN5A 1KTLA 3REVB 4CMHB 4YR6B 5I9QB 4NN7B 4HWBL 4WJ5B 2JIXD 4WEBH 2DLFL 1KGCD 2HLFC 1JRHI 3HRPA 3VFGL 1OWRM 1YPZE 1S9XB 3HAEG 5I71C 3V0VA 1OLLA 1UJ3A 3GGWA 2D9QB 4I1NB 2V2TA 5LCVH 5CJOH 3SO3C 4HK0A 1X44A 4LRNL 5C0BB 2R15A 4JRXD 2EKSB 3QUMB 3IXAB 5LGJA 1NCBL 1TIUA 1GC1L 3QIBD 4YHNA 5TE4L 4XBGB 1DLHA 4NKIH 4YXHL 4U7MA 1U3HC 3V95A 4ORGA 4UTBH 3O0RH 5CZVH 2PR4L 1MCFA 3VI3F 4DK3A 3AAZB 1R0AH 3C9NA 3HI1A 1V5JA 3C5JA 5EN2A 4P59L 3H7BA 3NPSB 1IKFH 1JGVL 1U41A 3CZFB 3BPOB 3ZE1E 3BDYL 4NKMB 4H88H 2WMPA 3JTTB 5J11C 1CF8H 4QRUB 5KJRH 3RVTC 4P46D 1KIPA 5I76B 3N1FC 3VFRB 1P7KB 1GGTA 1I7TB 3NTCH 3N1PC 3MJ7B 2X4RB 4X5XB 2Y6SC 3ZKXB 1QG3A 4OGXL 2VJXA 3VXME 2DQJH 4KKBD 2WUCL 4QOKA 3RI5F 5D6DC 3MXVH 1S7XB 5IW1B 3GSOB 4ZOAA 1F8TH 4QXGH 2UUDH 4CRPA 3MPCA 4LF3B 1JPFB 2W91A 4G80A 2R1WA 3U1SH 3TBSA 1TJIH 4RAUA 4ELKA 4Z5RB 2X4OB 3UBXG 3P4MA 1MIEL 3HPLA 2P8MA 2VERN 2FWOA 1BLNB 2VN4A 4PRPE 4EJ1C 2XXMB 1I3RA 1MCWW 2VZ3A 4ODSH 4YX2L 1A1NA 2H2SC 1A64A 5FUZL 4O2EA 4RFEA 1P1ZA 2YMXH 5BRZA 3M1BA 2N7BA 3L5WB 4Y16C 1I9JL 3QNZB 4KI5F 1D5IH 1X5JA 2F54D 3C09B 3BP4B 2NY2C 1KEML 1NDGB 3QUKB 2IH1B 3GIZL 4JREB 5IV2B 3K4AA 1RU9H 2B5IB 1OSPH 4IHOA 4R0LC 3MRFA 2VLRD 3WHXA 5HHOE 4TVPD 1N8ZB 4AH2A 3SDCD 1JGEA 1BPVA 2IALA 4K3DL 5C0AE 1I9RL 5D7LB 5FB8A 3D69B 4OZGE 2EIBA 3E3QC 4DCQA 5F3HB 3HG1E 1NKRA 3D2UB 5I18L 3VXOA 4MAUH 2IQAB 5E6ID 3BOVA 5TF1L 1FG2A 4NJ9L 5TPWL 6FABL 2OXHA 4Z7WF 1KJVA 3AUVA 2NX5A 5IFJA 1X5FA 2VXTL 3VFPA 2VSCA 4GKZB 3VWKC 4DK6A 4WFGD 1MCSA 1NGPH 5DFTA 1ZHKA 1O7VA 4FFWC 4OZIE 4WU7A 5KAQG 1EFXA 4JG1L 4RNRA 1BBDL 3RWDA 4JAMB 5CEZD 4U6TA 1HH6B 2A6JB 5BMFL 3W0WA 4ZUWA 4GRLB 3GSXB 1DQJA 4RWYH 5FEBA 2QV2A 4QXTB 8CGTA 2G5RA 4DN4H 5L8LB 3QCVH 3HAEH 4LLYA 2XZCH 3S96B 4JZOB 4X5WA 3OJDA 3BGMB 4WW2F 1A14H 1JNHA 5DURB 2ZCHH 3BWUC 5KSBA 4DGYL 3L5XL 2R1YB 1MLBB 3PQYA 3WDHA 3HG1B 4O4YH 4QXWA 3BO8B 3QDGE 5F7YC 2Y72A 3NCFB 1AGBB 2NXYD 5T1DL 3WNMA 3L3KB 4OLZH 3IU3A 5IF0A 3M8OH 1EAJA 3AVEA 4H0IA 1QD0A 4M5YH 5HXMA 2YRPA 3VFVA 5GRZA 1BD2E 1I8MB 1TVHA 1P4LB 3QUXC 1MCHA 4OZIB 2I9TA 1FZOB 4LLQB 1DANU 3A6CL 3VFTA 1LP9A 1AXSA 2BSSA 5GQBA 4M7JL 2APTA 1UH2A 3NIDF 4OCRL 2Z93A 2FCBA 5GRWA 1RZGB 1CYGA 1LWRA 1EV2E 1ONQA 4PGZA 5JO5B 2VLJB 5JUEH 2OJZH 4H0HB 1BFOA 1VPOH 2AK4A 1L6ZA 3LN5B 3TH2T 2MQCA 5KANG 1KTLB 1WZMA 1YN7A 2YEZA 3U0WH 3G5XA 1FSKB 4MZ2A 2G2RA 1RHHB 4N0RA 4XMLL 2CPCA 5C6TL 4Z18A 3V0VB 3H9SA 1IEAA 3W5MA 3BKCL 1F6LL 1U9KA 3GGWB 3EDDA 4CGTA 4QRPA 1OAZH 1MCOL 1SEBA 2BRQA 4TVPH 2V2TB 2NY4B 1QBLL 3DETC 3BX7C 4HK0B 4XPBH 1PDKA 3FFDB 2QLVB 3DX7B 1TZGH 4PR5A 5LGJB 1EIBA 5J6GA 3MLXL 3C60C 4YHNB 2LFGA 4ZOBA 5HSFA 4M6OH 5GGVH 5ILTL 1JHKH 3UDWA 1DLHB 4KWUA 2OCFD 1KBGL 4M43H 1BP3B 2IMNA 2Y4SA 2X42A 2P49B 2QL1A 4I13B 4JPVL 3L7EA 1M7IB 3C9NB 3HI1B 4GRWH 2HTKD 5HGAA 3SY0A 3H7BB 1KB9K 3DMMC 1D9KB 4Y89A 1TCMA 3U7WL 1LQSR 4NKDB 1LO5A 1IGJA 3IDMB 1KIPB 1AE6H 2BVOA 4HMEA 2WBJB 3Q6GH 4R2GB 2KBGA 3RWJA 1ZA6A 3LQAC 1QFWI 4TULL 1K2DA 4QOKB 4GW5A 4PJ7A 4MNGE 3RJDA 4JFED 2ID5A 4G6KH 1FNSH 3LOWA 3P9MB 5C0DB 1HOCB 4G3YH 3TBSB 1FNAA 2LVEA 4U0RC 4LRIA 1OM3H 1S7WA 3D3VA 4P23C 1Q38A 2XY1A 3P4MB 3HPLB 2P8MB 1TCRA 1I3RB 1EGJH 1A1OA 5FHAL 4PLJC 1X5GA 4OSUL 5A43C 4O2EB 1JPSH 1F2QA 4RFEB 1P1ZB 5FYJH 5BRZB 2XA3A 3GFUA 1MFCH 4UV7L 2DB8A 1DVFC 3BIKA 5GS0D 1UYWL 3CK0H 2J8OA 4LU5L 3V79C 5DA4A 4PG2C 3BRGC 3CVIH 4GS7B 4IHOB 3IFOB 2QQNH 3HZVA 3KLHD 4AEHH 4AH2B 1VFBA 1JGEB 4YUEH 2IALB 1T3FA 3MLZL 3MLUL 4Q74A 1ND0A 2FO4A 2LABA 1Z0MA 3DGGA 1ZGLA 2FBJH 4DCQB 1M7XA 3O3EA 2OK0L 3V6FB 3VXOB 4GMTL 2B0SL 4LQ1A 4PBXA 4YC2B 1YUHB 1FG2B 3QUYC 1JFQL 1YQVL 1KJVB 4Z0XB 4E0RA 2NX5B 5IFJB 4N1CA 5DMJB 4HF5L 5TQ0L 3LCYA 1H5BA 1ZHKB 2VLKE 4S1QH 2AABH 4OCYH 4WU7B 3F58H 2VTFA 3TA3D 1FJ1B 1EFXB 3RWDB 3IDXL 3F7YB 1CTNA 3W0WB 1GYAA 4ZUWB 1LE5A 3K2UL 4FXGA 5D5MA 2C26A 3NCYP 4PLOB 1T7ZA 5DMIL 3FT3A 4QRSA 4AEIH 4DKEH 1KB5L 1QQDA 1VESA 1EAPA 1QRNA 4X5WB 2OI9C 2H1PH 1YC7A 3OJDB 2BNQD 5I71B 2FIRT 1XIWA 2V9QA 4HLZG 1JZ6A 1F5WA 1VFMA 2DOCA 3PQYB 3VXSD 4O2CA 3O9WA 4X4YA 5ESVA 4OGZA 2A6IA 5IF0B 5GS1C 5D8JL 3VFVB 2R56L 3IFLH 4NQEA 5I17B 4F9PA 4NBXB 4QLRA 2VLKB 3QI9D 3VFNA 1A6PA 3ESVF 1F58H 1FNEA 1U3HB 2I9TB 2CGRL 2C1OA 4K8RH 3ZZ1A 3INUL 3VFTB 1IGTA 1LP9B 2BSSB 5DDHA 4F7EB 1EO5A 3NABL 4FQLL 3C6LD 4M6MH 5KSAD 3MOBH 2Z93B 5D7KD 1IGFL 4XNXL 8FABA 3BT2L 4NNXB 2XRAL 4M8QA 2KUTA 4JFXB 1BFOB 4MXVF 3V52L 5K93A 2L0DA 5C08E 4J4PD 1VCAA 1YN7B 3LSOA 1ED3B 2YEZB 3NCJL 5GRJL 2F58L 1S7UB 3G5XB 2W0FB 3VFOB 2AAVA 3BP6B 2R2HB 2Y36H 2D03H 4MDJA 1CK0L 1UEMA 1IEAB 3LQAL 4TUKL 3E3QE 1ZLWH 1N59A 1II4E 1KG0A 4AL8H 4AEFA 4GKSB 1SEBB 4OZHE 4PRDB 5D7SH 5J89A 4P9MH 4YNYA 1RAMA 4JDTL 2P42B 2Y06L 4PJFF 4PR5B 4XNZC 4XI5D 1KCRH 4H1LG 2WV3A 1T5WB 3S35L 4N8VG 4O5LH 1B90A 4OLUH 2IPTL 1A4KA 4I77H 1EHNA 4ODBD 4OKDA 4PJIA 2QADD 5HGDB 4NNYA 4LOUC 1CU4H 4O2FB 4RAHA 1NBQA 4XAKD 5DGRA 3L7EB 4MQXC 2E7LC 1K5NB 3L5JA 4WEBL 4WWKC 1JHLH 1ZT1A 3SDAA 4JJ5A 3P40A 1KN4H 1IGJB 1NCCH 1QTYT 3OF6A 1CDYA 4PJAF 5LCVL 4EXPX 5CJOL 3RWJB 3VD9A 3BXNA 1ZA6B 4W4NA 2H2PC 4Y1AD 1XT5A 1K2DB 4GW5B 1I7RB 1CDGA 3ZKQD 1HCFX 2P5WA 1IAOA 4NT6B 3Q48A 4EN3A 1I7UB 1MCWM 3S37X 5JPMA 4NKIL 3T0BA 3G5ZB 2I60L 4WO4A 4Y2DA 3D3VB 4GH7B 4UTBL 5T1LA 4JGUA 5CZVL 2D4DA 1MEXH 1B4JH 1S9VA 2CDEB 1R0AL 1KC5H 1TCRB 3QCUL 1A1OB 1IKFL 3UO1H 5F21B 2UY7A 4HEPG 4YHIA 3S6CA 3GMPA 4H88L 1CF8L 5KJRL 2P8LB 4P2RD 4PPTA 3VA2C 3MLPA 4PYGA 3CMGA 4HLZH 4PLKC 1YEHH 2DQJL 3HZVB 5D71H 4JQIH 3SE4A 4LCWA 3MXVL 3MACH 1T3FB 4M8VA 4QXGL 2IGFH 1AXTH 1ND0B 3CSYA 1ZVSB 4FZ8H 2X1QA 3DGGB 1ZGLB 1IQWH 3ZDZF 2YRZA 3U1SL 1TJIL 2VDQH 3RY6A 3F7QA 1O0VA 4JKWA 1AGFA 2BDNH 5HGHA 2UV3A 4PP1C 2D2OA 2AV7A 4NCDA 3ZKMD 3ARBD 3VGDA 3HCVA 5DT1H 2R4SH 4U1IB 3BZFA 3L5HA 1H5BB 2YMXL 4G8GD 4KAQL 4K2UH 1D5IL 5DRZA 3UPAA 1BQLH 1AH1A 3W39B 1UC6A 4L3AA 1ZT7A 1LE5B 3P73B 1RU9L 2HJFA 2ZZUT 1OSPL 3MJ8A 4FXGB 4RMRA 5D5MB 1Z2KA 4D8PA 4X7EC 5DJCB 3FT3B 3MRKB 4QRSB 3Q2CA 4JFDD 4MS8C 5H2BB 5JW4R 1NMCC 4LSUH 4UV4H 1QRNB 3QEQD 1J8HD 5E6ZA 4NBZB 1XIWB 1KCUH 1HHGA 3VGAC 3ARGC 3MV8E 4MAUL 3OAYK 4N0UA 3MRPA 3T4AA 3O9WB 4X4YB 5ESVB 4NWTL 3L7FA 4YHMH 1R24A 1WBZB 3DGCR 4H1LH 5EU4A 4PP2A 4L5FH 3QAZC 4UBDC 3I6LE 4RGNC 5INCB 1NGZA 4IM8A 4NO0A 1WSST 3MREA 4HIIA 3U6RB 1NC4D 3O3DA 2C1OB 4TQEH 1IGTB 4RWYL 4IDJH 4PLNC 1UH3A 1OHQA 3CFKA 8FABB 4DN4L 3VJ6A 2ESVA 4FABH 5CGYC 5MERA 1FAIH 2XZCL 3PJSA 3HRZA 1KT2A 4EVNA 2X89A 2ZCHL 4X7SH 5J1AB 2X4PA 3P11H 3LSOB 3NCEB 2GKIA 1S7VA 4O4YL 3BPLB 1MCPH 5D7IA 4OLZL 4MDJB 4PB0H 2GAZA 2NYYC 3M8OL 1N59B 4M5YL 4EI5D 1KG0B 4AYFA 2YD8A 3H9HA 5TE7H 4JN2A 5C1MB 3QRFM 4WFHE 2H6PA 3GM0A 3LN4B 5BJTA 4U0RB 1J86A 3BKYL 1RIVL 4FXLA 4RQQA 2CLVA 1IRAY 1EUTA 3GDBA 1M6OB 2NTSP 5DVOA 1A4KB 2OJZL 1L9NA 4PJIB 4Y5YA 1VPOL 4UQ2A 4P4KA 3TIDA 3U0WL 4UINH 1ZTXL 4U1LA 2QBWA 4PJCA 1ZT1B 3SDAB 2JB5L 4JJ5B 4YWGL 3DX6A 4EDWL 1A7PH 2VXSH 5GGTA 4IRJA 4WW2A 4E41A 5C86A 2P5EE 1WAAE 5JW3L 2GITA 1OAZL 1DQQB 1RUAL 2FJGA 4ZS6D 4YAQA 2O5YH 4WTWA 1YEEL 4LPXA 3BXNB 3FN3A 4XPBL 4U6YA 4JM4H 1IM9D 4GMSH 5T1MA 1HIMH 3SBWA 3BW9A 4HKJB 4OLXH 4F80A 1BF8A 5F1NA 1EFQA 1KIQA 3FL7A 4JFYB 3PL6D 1R3IH 4M6OL 5GGVL 3ZT7A 4EN3B 4K8RC 1JHKL 1TQBC 1V7MH 5JPMB 2LQRA 4WO4B 2I07A 3TYFA 4M43L 1FO0A 5T1LB 5CIPH 1LNUA 1S9VB 4MXQC 5FV2A 1D5MB 5GGRY 4POZC 3LPFA 5JTWA 4YHIB 1J1PL 4HS3A 5EPMB 3GMPB 1N5AA 4P5TA 3FQUB 1AE6L 4KJYA 3Q6GL 4HPYH 5EU6A 1FYHB 2OX5A 4YHOL 2OI9B 5EWIL 2P5EB 3ARXA 1KPVA 3JWNC 2VKWA 3GB7B 3R4DA 2P45B 1I8LA 4G6KL 1FNSL 1H15B 3B2VH 4NP4H 3CSYB 5GRYA 3WHE0 4G3YL 4UI2A 2YC1A 2H32A 4PRBA 4GRMB 1OM3L 1V3LA 2V2XB 1AGFB 1PG7X 5HGHB 4ZSOA 3C8DA 1BF2A 3ZHKA 3HZKA 4TVSa 1FAKT 1NMAH 2AV7B 1OTUC 2B8OT 3TF7C 4IEFB 1EGJL 3EO0A 4J2XA 2GTWA 3HCVB 5EBGA 2L7JA 4NOFA 3DUUA 3BZFB 4V1DA 1S9WB 1JPSL 1YEIH 5FYJL 4QGYA 2NY7H 4NQDD 4KJPC 2VC2L 3P3YA 4G9FD 1C7SA 5JHDD 4KVNH 2R9HC 1PSKH 3A6BH 2IPKB 4WCYH 3GSUA 1ZT7B 2AQ2A 4UTAH 3ZDYE 3NVQA 5T3XD 5AG9A 2HJFB 1YMME 4CKVX 3LS5H 4HG4J 4ZUTB 1CQYA 4JQVA 2LTQC 4AEHL 3HZYA 1JNLH 1MELA 4D8PB 4YUEL 1E28A 1KSRA 1VKXA 1SY6A 1URLA 1JMXA 3ULUD 4TNVF 4Y8DC 1VACA 2KPNA 4XP9L 2FBJL 1HHGB 4KJQC 3BRDA 1OP3K 2DJ4A 2EDNA 5FUOH 5FYLD 2GJ6D 1L0XA 5DF0A 4N0UB 5BZDA 4APQD 3MRPB 3T4AB 3PWNA 5EC2A 4R96A 1T83A 3D48R 1I9IH 3JWOC 4M93B 2KZ1B 3L7FB 5GXBB 1DN2A 1Y6NR 4Z7WE 5EU4B 2X1PA 5FFLA 2AABL 4KDWA 4OCYL 3SDDA 3F58L 4HIHA 2EH7H 4P48A 5D93B 3IRPX 1NGZB 4NO0B 3TO4C 2NPLX 3MREB 4HIIB 1IAKB 5HI5D 5C0CE 5IROA 1W0WB 4FTVE 5IBLD 3RDTC 4L8CA 4AEIL 4DKEL 1YMMB 3VJ6B 4OTXH 1GGCH 5MERB 3SQOL 1YC8A 3PJSB 1ACZA 2H1PL 2AJVH 3ABZA 3IFNL 1EO8H 1KT2B 4XNUH 4EVNB 1TTUA 2X4PB 1IGCH 3V5KB 2FNBA 3G6JF 4YBLB 2HVKA 1MJJA 4BSWB 3VI4F 3MA9H 5IFHH 1S7VB 5CHNA 15C8H 2VZOA 5E7FA 5TQ2H 1J12A 2GAZB 1HSBA 3BYYA 4P0DA 3IFLL 3P9LA 3V5DA 3H9HB 2WZPD 4K55A 5DUPL 3GSNH 5BJTB 1F58L 1I1CA 3K1DA 3I6KA 5F9OH 4K8RL 4RQQB 4X4XA 1NDMA 2CLVB 4KK6C 2ERJB 3Q6FA 4GW1A 3UAJC 3NA9H 2VUYA 2V5MA 1U91B 4XZUA 1KYOJ 4LKCA 4S11A 2HFFA 2XOTA 2VISB 5CILH 3HA0A 3DVNA 1S7SA 1AC6A 4GBXC 1QFHA 4WUUE 2D7TH 2HAZA 5F70A 2CO7B 3PV7A 2AQ3A 4U1LB 4PJCB 5E4EB 1D7FA 2Y36L 5IBTH 3SKMB 1FVEA 1AGEB 1JF1B 2D03L 4K94H 5F1SA 4S0TD 4WW2B 2NCMA 5LG1A 5EO9B 1F90L 5T3XH 2YPKA 4M62H 3VXRE 4AL8L 2GITB 3WDIA 3DV4A 2YZ8A 2FJGB 5I16B 4R97C 4XB8A 3DV6A 5JW5A 1T03H 5D7SL 1FFOA 4DAGH 2EIDA 3ULUH 1JZ3A 2WW8A 4LAQL 1U42A 5EZIH 3BW9B 2AERT 3MV01 3X13A 1KIQB 4BYHA 1P9MA 1AI1L 5FYLH 4RGNE 2PXYA 5IHLB 4R9HA 3TZVD 5BOZG 4OLUL 4MNQD 4I77L 3MUGA 3TYFB 3MLVH 3KS0J 1CI5A 5IB5A 4NZDA 1LNUB 4ELMA 1FZMA 5F7DA 3VXUA 1JHLL 4LDLB 1NC2A 1J0HA 3R8QA 4HS3B 4X9IA 2XKUA 1A2YA 3UCRA 4P5TB 1CGWA 1KN4L 2NLJA 4ZUVA 5A16A 1NCCL 3LKPB 4KJYB 1WCBA 1UADC 2JB6A 3AS0A 3VGAB 4LCCA 3ARGB 3X11B 1MSPA 3N0PB 3KYOA 5I75B 5H8DA 4HFUL 1NMBH 3HN3A 1HH9A 3SGEH 1QFUL 3T4YA 4Z78A 4I3GA 3QULB 5DJDA 2WK2A 1UWEH 2YC1B 2H32B 5L8JB 2HRPL 1F2XK 5F7NC 4PJFA 4LCUB 1LK2A 1MEXL 2OR9H 4Z76A 2C4FU 1KC5L 4ODHH 3QQ4B 3EO0B 3ILQD 1HHIA 4GKOA 3DUUB 1DN0A 1JV5A 3G08A 1I8KA 2XFXA 4OV6F 1RUQH 1XF4A 5CMAA 2RHEA 5D7JC 5IWLC 2R39A 5FM8A 2YPVH 2CK2A 3GIVB 4X5LA 4E5XB 5D71L 1MHPH 3C2AL 4KRMB 1E28B 3G5YB 4XPFL 3MACL 2IGFL 1T2QL 5I8EB 1AXTL 3RTQD 4KJWD 1NAMH 4A2MA 5C0AA 4FZ8L 4FFVD 3M45A 1IQWL 4Z77A 5E1AA 2VDQL 4W6XB 4Y19E 3ARFD 3KPPB 5GJSL 3T8XA 5BZDB 1YNTA 1IILE 4R96B 3MBEC 4HKZA 5ECJE 2R4SL 3TFKD 4LCYB 4HH8A 3NA4A 5I66A 1A9BA 3TBTA 4K2UL 3RKDC 5KVEH 5I30H 4XAWH 1BQLL 3SGDH 2X4TA 3GMLA 1UH4A 2VITB 4KKAC 2CD0A 4ZXBA 2M8XA 3ZSSA 1INEH 1KCSL 1OLZA 4LKXA 4HX1A 1FV1A 1ZMYA 3LKNA 2VDKH 4LSUL 4UV4L 3STZB 2JJVA 5ERWA 5DC0A 1YECH 2C3XA 1IC5H 4KK5C 3F6IA 1MJJB 1S7TB 3T77B 2R2EB 1A5FH 4NWUH 2DMBA 3VFUB 5TDNB 5CHNB 5CD3A 3WL9A 3QA3B 3KNBA 4QHKI 1MFBH 5DR5H 5CS7A 1JGUL 3WDJA 2J6EH 2K1MA 4L5FL 2XN9A 3P9LB 3V5DB 5CD5D 2Q3AA 4L3EE 1MNUH 2H45A 1BECA 2RBLA 3I6KB 2PUQT 1NDMB 2Q20A 4FQXC 4X4XB 1JTPA 3Q6FB 1PBYA 1R3KA 3CXHK 1FH5L 4QEGA 4YHLH 3KXFE 4FABL 3MRJB 2Y7QB 3OG6B 2V7HA 1FAIL 1ZT4A 3IJYA 4LKCB 1AGDA 3MOAH 4YXLH 1QSED 4OI9A 5K59E 1S7SB 3P11L 5C70A 3UTTD 4MXVE 4KDTA 3WFZA 1MCPL 3IKCA 2JF1A 1A6AA 1Z6JT 1BREA 4WWID 4PB0L 1QVOA 4EIZC 3RHWF 5C71A 2YPKB 3QJFA 5AYUH 3RIFF 4K71C 3MTRA 1BVKB 3DV4B 5TE7L 3FKUS 4N8CH 4B7LA 3CC5A 3O11A 1BVLA 2UWEF 1MCJA 4X4MA 1NGYB 3IF1A 2OBGA 5T5FH 3MXWH 4YDJA 3X13B 4ZNEA 3V6OA 4E42B 1CXIA 4M4RA 1MI5A 5ELIA 5JDJA 3O6FD 4NUJB 5BV7C 3MUGB 2ZUVA 5E9DE 5DQ9A 3KXFB 3KPSE 5IB5B 2PTVA 2BY3A 5HPMA 4WHDA 2QKIA 1IC7L 5F7DB 3JBG7 1VEOA 3VXUB 2EDRA 3FB7B 1NC2B 2P7TA 2LE9A 4K3JH 1NGQH 5HHNA 2VXSL 1A2YB 3MYJA 1DSFH 3HZMB 3F7RA 5HD8D 4HULB 3BP5A 2NLJB 2NY3B 4ZUVB 4ONFH 4X8JA 2JB6B 4UMGA 5IP4A 1ZGLM 2O5YL 3LB6C 3ZE2F 1QR1A 2VXVL 4GMSL 5HHQB 1HIML 5DRXA 4PJAE 1MJ8L 2X1WL 5C09A 1HKLH 1HHHA 1FIGL 3QFJD 4CBPA 4ODXA 1ZWIB 2BNRE 3T4YB 1F13A 3SJVD 4Z78B 5A2FA 4WFFE 1R3IL 1UJTA 5HYSG 1V7ML 2JJUA 4D9LL 2IADB 5I8OL 4NFBA 3X12A 4PJFB 1FZKA 2COQA 3LIZH 3HMWH 1Q9LA 1KV3A 1RV6X 5E9DB 1G0DA 3MV7D 3X14A 1HHIB 2YUVA 4YLQT 2VQTA 1DN0B 1JV5B 2C3VB 1I8KB 2XFXB 3LKQB 3LKOA 1XF4B 4XH2A 4A6YH 1XCTA 4L9DA 1W2KT 2DKSA 3O81A 4L9LB 1XMWA 1KCLA 2OR7A 3VD4A 3T65A 5F7EH 4ISVB 4Q9RH 3MRIA 4W6YB 1U8PB 4HWZA 2MNUA 4YHYB 3B2VL 4WI2A 4ZO7A 1CCZA 1Q1JL 3RIAK 5IT2H 5DQDL 5E1AB 5CINH 1I3VA 4CVUA 5AYQA 4HZAA 1I1FA 5TDPA 4EOWL 4OGYL 4BJLA 3T8XB 2NY6B 1YNTB 3JVGC 1KPUA 1S8DA 3NFNB 2XYCA 4HKZB 3NIFE 2EDWA 5C07D 1DCLA 1YEIL 3ZYIA 4NQVA 3WO3B 5I66B 1BIHA 2NY7L 3GMOA 3TBTB 2QHRH 2Y1VA 3SQBA 1FGVH 1PSKL 3A6BL 1NCWH 3MR9A 2X4TB 4PV9A 3GMLB 4WCYL 4U7KA 3I2CH 4UTAL 3DHMA 4GRWF 3WCYA 3BH9A 1WWAX 5EIVA 4LKXB 1DZBA 1JNLL 2AK4D 2AJSH 2AXJA 3QXVA 3LKNB 4UAOC 4QKXB 5GZND 3EJJX 1YY8B 3O3BA 4LGRB 5ERWB 3WFBL 4F7PA 2HJKB 4MJ5A 5FUOL 2PF6A 2DMCA 4ZAKC 2GK0A 2JCCE 2HTLC 5IKCA 4NC1C 3TO2A 5DD6B 4M6AA 4QRPD 2FEDC 3RWHB 3WL9B 5J3HC 3MCLL 3D6GA 4PJHF 1J7VR 2BSTB 5KZCD 3KNBB 5I1LB 1WZ1H 5TFSH 3LQZA 3MC0A 1UVQA 2GY7B 4JQXC 3BHBA 5MEOB 1RURH 3WN5C 3TN0D 5ICXB 4X0KB 3ULVD 1LEGB 1TJHH 5E8OA 3HI6H 1AHWC 2BVYA 4HJ0D 4KRPD 4GG6F 4G6ML 4OTXL 1GGCL 2V7HB 3TJEL 4ODWA 1PG7W 2PO6A 5GHWH 2AJVL 2XQYK 3TVMC 1TZHA 4XNUL 5DZOA 3PABA 1HYSC 1BWMA 4RFNC 2VXQH 1IGCL 1FNLA 3UPCA 2PCPB 4N5ED 1YY9D 4S1DD 5IFHL 4IIQA 3O2DH 4ONGL 5E8DL 5F88A 15C8L 1XR9A 3IKCB 4PJ5A 5IHBA 2R23A 3F5WB 1RZKH 4TYUA 5KG9A 1QVOB 3S4SA 4RZCA 1K8DA 3QJFB 3UTQB 5J12B 3CC5B 3O11B 1KB9J 3GSNL 5IJVA 1BVLB 1IAIH 1Q8MA 3VXNA 4XNMA 5F9OL 1GZPA 3BJLA 2HT4D 4IRZH 4YDJB 1GOGA 4KXZH 3CVHH 1MY7A 4LP5A 4M7ZC 5T1KD 3RBSA 4XNYL 3EOBA 3A67H 3MUHL 4DOHB 4R3SB 1PX4A 4P2OC 3K3QA 4G42A 4WV1C 5DO2C 2VDRH 3GHEH 2J1KA 3MV9E 1CD9B 1PKQA 1QOKA 5HPMB 2D7TL 4MB3A 2FJHA 5HBBA 4F33A 3SPVA 4ENEC 2P24A 5J1TC 1U8NA 2P7TB 2Q8AL 1UACL 3HNSH 3OKMB 3WLWD 3ZT5A 5CGTA 5HHNB 2Z8SA 1VDGA 2MCPH 2ZSVA 3BP5B 4M62L 3I3EA 4X9FA 5EIIA 3EUUA 3OJVC 1ZLVH 4X8JB 1GAFL 2HT2C 2WP3T 4OFPA 4PJXF 1R5VB 1T03L 2Q8BL 1VEPA 3GSWA 5DK2B 2H26A 4NM4H 4IOIB 2CSPA 4JRYD 4M02A 5DWUL 3IYLW 3KAAA 5EZIL 5BS0E 4GLRI 1HHHB 2W0PA 4WTXA 3ROOA 1XF5B 2AJXH 2AQ1A 5BQ7A 1I9EA 5FYLL 3S36H 4I0PC 3X12B 3MLVL 3QIWA 4IOFD 2FR4A 4L8BA 3ARWA 1Q9LB 4Z7NF 1E4KA 3MV9B 3X14B 1LO2H 2OTUA 1XCTB 4C56D 3ULVH 3KPRE 3TH4T 1RUMH 1EMTH 2G9HA 1F4WL 2FGWH 4XCFH 4XP6H 5ICZA 3HE7C 2X9XA 3CLEH 2PYEA 4HMCA 4UT6L 5A2IH 4HWZB 4B50A 1VFAA 2IPUK 5T5NG 3UTPE 2B4CH 3BI9X 1AFVH 5ADOH 4F7TA 1JTOA 1NMBL 2XQBH 1JPTH 5B38A 3SDXE 4U6HA 4MD5A 5BS0B 2XZQL 5K9OA 4Y5XC 4GKNB 5J4MA 3VG9C 2OP4L 5HHPB 1I1FB 5TDPB 4UB0H 5F9AC 4DUVA 1NCUA 2ZOKA 4NQED 1S8DB 5EOTA 3MBXH 4FQXB 4QYOB 1YEGL 4PY7B 1RUQL 3TYGH 4NQVB 4Z6AT 3GMOB 3W2DH 1UQSA 2NY0D 2YPVL 3MJ9H 2D7MA 4LGPB 4JDZB 3MR9B 4PV9B 5E08H 3SGKA 1EX0A 4HHAA 2SEBA 4IMLA 3WKMH 3BH9B 1C5DA 2AV1A 1MHPL 2AEQH 1MHEB 2MPAH 1ZHLB 5IIEA 5FDWA 3KPLA 3GHBL 4JFFA 1NAML 3GRWL 1XGUA 4L4VE 3FB8A 4WI5A 3IT8D 2GJZA 3MRMA 1AO7A 1MCQA 4PIRF 4ZPVA 4F7PB 4LHUG 3D5OF 2GK0B 3SDYH 3TO2B 1GRWA 1NCAH 4JKLA 3BGFC 3G6AA 1KXQE 1N2RA 4H5SA 1KJ2B 3MCKA 4PJ8D 3RVUD 4J1UA 4U33A 3ZDXE 3LQZB 4PJDA 3BHBB 3D0VA 5E8EB 5I30L 5EG6C 3CCHA 4HWUA 1E27B 1T1ZB 4G8IA 4YDLC 1J0IA 2ORBL 4XP4H 5JMRA 1OAXH 1G9MC 3EYVA 4FP8H 1INEL 5E8OB 4UILH 1NFDF 4PRHD 1OB1A 1K8IB 1A4JB 1DQLH 2J2ZA 4CJ0A 2Z31D 2VDKL 1K3IA 2PO6B 2VZSA 3L95B 4CN1A 3LDBB 3P2TA 2CRIA 1TZHB 3UJJH 3TPUA 4L4VB 1YECL 3FFCD 1XR8A 1IC5L 1K6QH 2D7OA 2FATH 4HC1H 1A5FL 3OF6D 4NWUL 4DQOH 4Y4FC 5F88B 1XR9B 3G6JE 2R23B 3DOSA 5KG9B 1MFBL 3S4SB 3VI4E 4RZCB 1K8DB 4YBQD 5DR5L 4WGWB 2J6EL 2XQYG 2VDNH 3HUJE 4CN4A 2HKFH 4BFGA 1GSMA 2DLHA 2B1HH 2Z92A 5IJVB 1MCRA 3VXNB 1WISA 1UT9A 3T2QA 1GZPB 5CGMA 5C8JB 4KMLB 4OQTH 5DC4B 4OB5H 4YHLL 2R2BA 1JNJA 1QSFE 3BKJH 3RZWA 3D18A 3RP1A 3MOAL 4YXLL 1T7WA 4EIGB 5CBAB 4Z7OF 1FLRH 4F33B 3SPVB 3EYQC 1U8NB 2VE6A 2YN3A 3SE8L 3C5ZD 1PEWA 2M1KA 1ZVYA 4MCYA 4KQ3H 4WI7A 5EIIB 5I6XB 4LCWD 5ADPH 2AK1H 1WWCA 1NJ9A 4RMUA 1W0YT 4NC1E 2OJEA 1RUKH 2HKHH 3DLQR 4KMQA 3LN9A 5HTSA 3M17B 1P5UA 5DSCB 3MXWL 3U7YH 4XXDA 3ROOB 1XH3B 4Q9CA 2BSRA 4NNPH 4ZD3H 3ARQA 1XZ0A 5DUMH 1W72H 3A0OA 4FMFA 4MA8L 5JZ7D 3MOQA 3QIWB 2FR4B 4L8BB 4WI8A 3P4OA 4JO1H 5MHSE 1T2JA 2DI7A 1WBXB 4L4TE 3SKOA 1D5BA 5MP6L 3GSQB 2OTUB 1NGQL 1DSFL 2EDTA 2OZ4H 4Y4KD 5L2KD 5KVDH 4ONFL 4X7TB 2G9HB 3VU2A 4DGVL 2VABA 2J5LB 1VHPA 1RHFA 4CL7A 5DEGB 2VR4A 4NQXA 1RFDH 1OAQH 4Q97A 4MNHA 3S5LG 3MMEA 2FHBA 1VFAB 4ZAKB 1HKLL 4S2SA 2A83B 4F7TB 4U6HB 4MD5B 1S5HA 2ZCKH 1A02N 5K9OB 2CXKA 3RZCC 4WRLA 2KKQA 1AXIB 5EBWA 4AK1A 3HMWL 4JRXA 2IPUG 4F15B 4Q0XH 2ZOKB 2NXYC 5EOTB 3O8XC 1QUNA 3QIBA 1AHWB 1S78C 1A6UH 5JQHC 1UQSB 1GPOH 1IJ9A 2ZKHH 2R2CA 5F7EL 4Q9RL 2SEBB 4IMLB 2BVPB 1L7TL 3LZFH 5ALCL 1C08A 2AV1B 3HAEA 1B4RA 1QSZA 3HE6D 5KSVA 3X17A 1QHOA 3GO1H 3RRQA 5FDWB 4JANA 4JFFB 5IT2L 1RVFH 3CSPA 3AREA 2GJZB 5CINL 4XP1H 4KKLC 4PS4L 3QEUB 1DFBH 1AO7B 2YUZA 4W4OA 4ZPVB 3ES6A 5DHYA 2PKDA 4NC2B 4PRID 3RPIA 4H5SB 3MCKB 1CG9B 2YPLD 5JXAH 1EBAA 4PJDB 2VZVA 3S98A 2LU7A 3D0VB 4HH9A 4M7ZB 3FB6B 4TOYH 1HDMB 5HHMB 2X7LA 1FGVL 4WV1B 4G8IB 1Z9MA 3EYVB 5D96C 4XHQA 3AC0A 5J13C 1FCGA 1RK1A 1G7LB 4PRNA 3TCXA 3SE3A 3HMXL 2F74A 3CD4A 4P4KD 4AENB 4M1CD 1QBAA 2BFVL 2F54A 1DR9A 3QG6A 4Q2ZA 1SQ2N 1A6VH 5JIHA 4L8SA 3ET9F 4NYLA 1MCNA 2MKWA 4IRJD 4E41D 3MLYL 4GAGL 1ZK9A 1MH5A 1RIHH 5DMYA 1NSNL 3OMZA 1XGRA 2VLRA 5CSZA 2VLME 3SDCA 5EOCH 1E6OL 1WZ1L 1B3JA 4OBRA 4XMPH 3UBXA 2BY2A 3QH3A 1RURL 3WS3A 1RULH 2EC8A 1F45A 2Z92B 3S8WA 4MAYD 5GISH 1HE7A 1U2CA 1YEJH 2FSEA 1TJHL 1ZHNA 3HI6L 5DEZA 1LGVA 1GVIA 2DM7A 2R2BB 4HBCL 3KYNA 5GHWL 3Q5TA 1OY3B 2XWBA 4O51A 3L3GA 2HLAA 4TSCH 2VXQL 3QP3A 3T2OA 5I8KH 1O5DT 1CFSA 2AP2A 4KMTH 4M7KH 4HUMB 3O2DL 2VE6B 5FGCE 5EU6D 2DQTH 1RZKL 3MRCA 4G5ZH 4X80H 4MCYB 1I4FA 3DNKA 4YEEA 2V7NA 3P4LA 2GFBB 1NJ9B 5FF6A 4Y5XB 1IAIL 2OJEB 4PJHA 1KGCE 3FQTB 2NY1C 1I1YA 4IRZL 2UWEE 1KTDB 1U8LA 3H8NA 3CVHL 1A1MA 2BSRB 1C7TA 3MFFB 2DAVA 1IC4H 3A67L 4BZ2H 1XZ0B 3QDJA 3OQ3B 5F8QC 3PDGA 2VDRL 1EGJA 3GHEL 1X5IA 3P4OB 4EDXB 3J8F7 1PKOA 1M71A 3SKOB 1D5BB 2EDLA 3HNSL 4DWHA 4BK5A 2IANE 1CVSC 3UTZA 2NXZB 2MCPL 4OFYA 4WU5B 1FC1A 3EYSH 3QPQD 5EU5A 1HXYA 1A3RH 4D9RE 5L0QB 4NM4L 4YPGB 2VDOL 4RSVA 3RWEA 5ENWA 3MMEB 4DN3H 1F11A 5MENE 2JIXB 1F4YH 4I8DA 4S2SB 2BOCA 4QWWD 3ZL4H 4LVHC 4L3CA 1KOAA 2AJXL 1S5HB 4QHUB 1IL1B 3S36L 2UWEB 4WI6A 1HQRA 2ZNXA 1MUJB 4F3FA 3WE6B 4JRXB 2DF3A 4RIRA 4K9EH 3SDDD 3WXWH 4Y4HA 3DXAD 4JM2C 2VDLL 3KJ4C 1LO2L 3PHQB 3QIBB 2I26N 4KKCC 1GXEA 1F3RB 1EMTL 4RX4D 5CWSA 2FGWL 5I1JH 5F3BA 4PTUB 5H35A 4M1GH 5EULV 5HVHC 2A6DA 3ARDA 4NIKB 4Z7UA 1DUZB 3C5SA 3FT4B 2XQBL 1JPTL 3IDIB 4FOMA 1YEKH 1MPAL 3MV11 3RQ3A 1QSVA 2Q6WA 4P46B 5F72S 5DD3H 3EHBD 4J4PC 4OQ1A 3ULUF 3N06B 3ES6B 5DHYB 2IAMD 1U95B 4R7DA 4UB0L 2ITCA 4YHKH 1JWMB 3IFPA 5CJXC 2EYRA 4ZTOH 3MBXL 1TJGH 3RPIB 4JFEA 1N6VA 3TNMA 3V0WH 3DURA 5EBLB 3TYGL 4HH9B 3W2DL 3MJ9L 2X7LB 1I1RA 4GG8A 1OGAE 4QTHB 3LQMA 4YGAB 1GGUA 1DDHA 5I1DA 2AEQL 1IKNA 4CVZB 1RK1B 1MAMH 2Q7NA 3OZ9H 2F74B 4JFQA 1RZIA 5CEZE 5LAXA 3OGCA 5ETUA 3C8KA 2F54B 3LKSA 3QG6B 4Q2ZB 1X5LA 3EGSA 1TXKA 4L8SB 3BESR 1PQZA 2WIMA 3SDYL 1MH5B 4YE4H 3T0WA 2E27H 1XGRB 2VLRB 3SDCB 5J56B 1AY1H 1IC1A 4H0GA 3UBXB 5C9KA 3QH3B 3WS3B 3HC4L 5JA8B 4J6RH 1J05A 4IRSC 1T66C 4XP4L 1CGSH 2ARWA 5ISZE 2PXYD 4HJGB 5E6IB 4FP8L 2FSEB 5E0QA 1C5BH 3LEXA 4POUB 1CFNB 3S3JA 1ZVHA 5F7HA 1IVLA 1DQLL 1P53A 2EH8H 3I84A 4QRRE 2D4FA 4CU6A 4AEEA 3BVNB 3KYNB 2BMKA 4GRWB 4GG6E 2XWBB 1DE4A 3TA3A 2C4XA 1DEEA 3L3GB 4TTDD 2HLAB 3TESA 4JPIB 4KY1H 5EZJB 1K6QL 5BVPL 1LVEA 2EO1A 1CFSB 1G6VK 2VZTA 3B9DA 3HB3D 3MRCB 4PGCA 1I4FB 4UOW0 1FGNH 4JGMA 5J7CC 1OW0C 2VDNL 3HKFA 5F6HI 3VXMD 1G6RL 4YFLI 3QIUC 2VL5A 2B1HL 5FF6B 2J88H 4NUGL 3CX5K 4PJHB 4FHBD 5I1GL 2WWMD 1DUYA 3AS3A 1I1YB 4MMXC 4OQTL 5EDXA 5FIEA 3VXSA 1U8LB 4YZFE 1YYMH 1A1MB 1G7JA 2NXYB 1C8PA 4MA7H 2A0LD 4WENB 4NZRH 5T3ZE 1U8MA 3BKJL 3QWOA 1T7VA 4PRPD 1E4WH 4QRRB 3VFMA 3BQUD 4NHCH 3TO4A 1XGPB 3QI9A 2P47B 4PJBA 1QNZH 3BSZH 5BCAA 1CICC 4GG6B 1B2WH 1MF2H 3DJ9A 4ZOCA 5AUMA 3QR2A 1HILA 4BQCA 3C6LA 5KSAA 1CVRA 3UTZB 1MVUA 4KQ3L 2JLLA 1ZAGA 5DQJB 3U4EA 1FFRA 5ADPL 1YNKH 2W92A 2AK1L 5HHOD 4P9HC 2PETA 3RWIB 3RWEB 1RUKL 2VRAA 5C0AD 5ENWB 2HKHL 2EE2A 1F11B 4OM0L 4PJXE 2BOCB 1K4CB 3U7YL 1MRFH 1NFIA 5KSUA 4NNPL 2LAAA 4ZD3L 2F19H 2W0LA 2DBJA 5DUML 1HQRB 1W72L 4U1MB 3W9DB 4F3FB 5B8CA 4WY7H 4JO1L 3EYUH 3DIFA 5IQ9A 1DBAH 3B9KC 3GMQB 5A1AA 4R7NB 1OD9A 1A8JH 4F2MB 5J13B 3MRHB 4P49A 4ZXBD 2OZ4L 5KVDL 3BPNB 5CWSB 5LBSL 1IGMH 2WINB 5H35B 1RQ5A 2ADGB 2XKNA 2EXYD 3P77A 5HI3D 3U2SA 3HR5A 4HFWA 1NGWB 3QUZC 4PJXB 2ZCKL 5D1ZC 1MCLA 5CZKA 1ZHBA 1T0MA 3QDME 4R4FL 2DQFA 2Q6WB 5FO7A 4ZODA 4XCCH 3QDGD 5H94A 4OFIA 4H1LA 3IFPB 2XN9D 4Q0XL 4Y1AA 2X4QB 2EYRB 2YSSA 4DZBA 2CXGA 4N8VA 1BD2D 4JFEB 4WEMB 5I8CA 3DURB 1JE6A 2W9EH 4EI5C 2GTZA 4TSBH 3BZEA 3NZ8B 1A47A 4XGZB 1A6UL 4OD2B 1GPOL 4LSVH 1AC0A 2ZKHL 3RL1A 4ZFFA 4GG8B 4JHAL 4PJ9D 5AZEL 1DDHB 1CR9L 4G43A 5I1DB 3ORJA 1I1AC 5DTFB 2XTJD 1ZSDB 2YXMA 1FL3A 1VGEH 2E7CA 3GO1L 2NW3A 3NFPB 5IVXF 4U6XA 1LE9A 1RVFL 2R0ZH 3OGCB 5LAXB 1D9KD 5L9DH 3RWGB 4XP1L 1G0XA 3EGSB 4P2RA 1PQZB 2BSED 4BKLA 3LRGA 2AI0H 1FYTA 2LU4A 5JXAL 4ODTL 4K9EC 1F4HA 3PWLA 5I2IA 1J05B 2H9GA 4LLDA 5T33H 2JJSA 2QSQA 1MWAH 4HAFA 1MI5D 4OLWH 1D5ZA 3T0DA 3LEXB 3AS1A 4UDUA 5D2NC 2VYRE 2EE9A 1NFDE 1SBSL 5EO0B 2BMKB 1SVZA 5C3LD 1EEZA 4Y88A 3TA3B 1DE4B 2W1NA 1DEEB 5FCUH 4AIXA 4NRXA 1U3JA 4G8EB 4KHTH 1RIHL 1CD0A 4RMQA 4PTTA 2A9NL 4HGMA 4BQ8A 5EOCL 3VXQB 4P9HL 3VRIB 4XMPL 4JFDA 7FABL 4HWBH 5C09D 3P0YH 1LILA 2BNQB 4BUGA 4KUZH 2DLFH 4UIKH 3WO4B 2FO1A 5DVLA 3U9UA 5IB3A 2DWDA 2HJLB 3JZ7A 3A6OA 1DUYB 4UQ3A 2QJDA 4W68A 5CUSH 5GISL 1YEJL 5B39B 4L8DA 3OAZK 5IEHA 1ETZB 1QPXA 4X6DA 5D1QC 3VXSB 4U2YA 4WW1A 5DD5H 4NZUH 5CIPA 3KJ4B 3JWDH 5GSVA 1J1XH 4ZQKA 3S3SA 3VFMB 1NCBH 2J4WL 4TSCL 5D1XC 1NFDB 3QI9B 4QGTA 5I8KL 2C4FT 1NC4A 4KMTL 4M7KL 1WWBX 4MA1C 3NMEA 5SX5K 3RU8L 3RVWC 2OL3L 4Z7OE 2DQTL 4YHPA 3C6LB 4G5ZL 5KSAB 5JLZA 4X80L 3R0MA 4N0CC 1X4YA 3U4EB 2AJ3B 2JJTA 3I50H 2HLFD 4PBVC 4UU9A 5BVJA 2YWYA 4XRCB 3MQIA 3U9PH 1NFIB 3SCMC 5DJXA 1IC4L 5CEYA 4BZ2L 4OGXH 5F71A 3UC0L 4APQC 1M05A 5IR1A 3B5GA 5DVNA 1H0DA 4X6CF 5SV3A 2C1PA 1U3HD 2O93L 3HC0A 3DUSA 2XTLA 3E6FA 4F8TA 3PP4H 4FMKA 3EYSL 2BC4B 3CDFA 3PWJA 2QADB 1JP5A 5HI5C 1QO3A 4WGVB 4QO1A 4PGJA 2ITDA 1T20A 4KUCF 3QG7H 5FUZH 3K2MC 5IBLC 4NQCE 2CIKA 4PG9A 1NEZG 2XKNB 1I9JH 1XGQA 3RVTD 1F4YL 3P77B 3ZL4L 2A38A 4CMHC 2YUXA 3U2SB 4HFWB 2Y6SD 5E2WH 3IDGB 1ZHBB 1T0MB 2F53E 5FO7B 1ZANH 2EZ0C 5KSBF 3IJSA 4LFHD 1TTFA 3O4LE 1KF9B 4K3DH 5H94B 1CWVA 4H1LB 4IRSB 4K9EL 3WXWL 1IM9A 4Y1AB 4DZBB 1RMFH 4O00A 4P5KA 5I8CB 3L3JA 3BZEB 3T3ME 1BQSA 3CSBA 4MJIE 1UWXH 5BW7A 3PL6A 5C0GB 1WEJH 5TF1H 5SWSA 3RL1B 1QP1A 2W38A 5JIKA 3QQ3B 4M1GL 4C58B 2H2SD 5HDOA 4RDQG 4G43B 5LKNA 4Y16D 3VMPA 1FL3B 2AKRA 1YQ2A 4YXKL 4G8GE 2NY2D 2AXGA 1NBZA 4JG1H 4NN6B 3TPKA 1JWUA 2NW3B 4NQCB 3MGOA 1UZ6F 4U6XB 1D5XB 1LE9B 1YEKL 2NZ9C 3NPSC 5C08D 5D2LE 3WLBA 3QFDA 5DMKA 4PJ5D 4P2RB 5ITFA 2XZZA 3BKMH 3C08H 4RA3A 2RAMA 3VH8B 4YHKL 1AJ7H 3VMNA 5CJBA 1RZ7H 1V7NL 4LLWB 1S7RB 4LNVA 4P3WA 1TJGL 1IEBA 3ZKXC 3QEQE 1J8HE 4M00A 3V0WL 3ARPA 1AD9A 3EJYC 2EEBA 3PP3K 3PWLB 2W65A 5I2IB 3T0EC 4FFYH 5AWNH 2R69H 1JYWA 3EOYG 2H9GB 4YIQA 3VWKD 4QF1A 5BO1H 1D5ZB 5KOMC 4FQ1H 4YK4B 1NLBH 4UDUB 3ARBB 3NFSL 4M3JA 1MAML 5CZXC 3ULVF 2DWEA 4M48L 5KVFL 4G8GB 2H8PB 4NQDA 1C12A 4Z7VE 4G9FA 2EDYA 5SWZE 4X7FC 4M7JH 1M7DA 1MREH 5HYQB 3FO1A 4NRXB 4YE4L 2E27L 4MLSA 5FK9A 5J6HA 4PTTB 5JMOC 4F7CB 4P2QE 1KXVC 1AY1L 3GSRA 2MHAB 4HUUB 1RJZA 4IDLA 4JFDB 3OX8B 1N26A 5JPNA 3QEQB 1J8HB 5A40E 4J6RL 5KVMC 3DVGA 3HUJA 3UTSE 2CLRA 2DWDB 2OSLA 5EOCJ 4ZS7L 1A7NH 5JXEC 1I85A 4UQ3B 4PJ7F 2GJ6A 4HXBH 3JVGA 4QY8A 4JO2H 5IEHB 1HXMA 4WW1B 3QUXD 2EH8L 3B9KB 5CIPB 4OUUB 3LVEA 2X1XR 4G7VH 1J18A 3BRFA 4DZ8B 3R8BB 5IVNA 2R0KH 4KY1L 4PJEE 4XC1H 1NC4B 3RNKA 1ORQA 5FA4A 5D70L 1IMHC 4XCYA 4YHPB 4GRLC 5JLZB 4JPVH 1FGNL 2PYED 2JK5A 2MMXA 3ME0A 4FQPA 3BUTA 1IAMA 1U8OA 3L6FB 2VH5L 4F37F 1MOEA 3TJHC 3LS4H 3U7WH 3WIIH 2IBZX 3VRJA 1Z5LB 3RNQB 4U6VH 1QKZL 1NH6A 2O5ZH 3LPGA 3NH7L 5EO1B 1U6AH 1YYML 3DETD 5AG8A 4MA7L 4NZRL 4W6WB 2B1AH 4EI5B 5HYJE 3WN5A 1E4WL 2XZAL 3C60D 4NHCL 3SGJC 1UFUA 4WDIA 2DI9A 2XWTA 4NRYA 1M05B 3BSZL 1BBJB 3QWRA 2Q86A 1B2WL 1MF2L 1H0DB 2DS4A 5D2NE 1DLFH 5B22A 4J3UA 4HT1H 3AMLA 4XBEH 2C1PB 3DYOA 2E6QA 2AVGA 1BM3H 3HC0B 3DUSB 4RMSA 4JRWA 3E6FB 3ALPA 3WEXB 4MVBD 5EIQA 1YNKL 4ZG1A 3DMMD 3PWJB 1FBIH 2L7UA 1QO3B 4OZFB 3BMVA 1DBJH 1A7OL 1F3DH 2QR0B 4MHHI 2VOTA 1NAMA 2P8PB 5JIPA 3O2VL 1XGQB 4LU5H 1MRFL 25C8H 1FSKC 3BH8A 1SMAA 3EYOB 3MV8D 1T0NB 1S7QB 2NQCA 2BNUA 3IJSB 4GQPH 5D6CA 1Q9WA 1UJ3C 3MLZH 4WY7L 5TH2B 3EYUL 1IM9B 2NY4C 4LPCA 4HLJA 4YFEA 4HUNB 1DBAL 4XC3H 3LRSA 4J3SA 1HHJA 3I6LD 2OK0H 3E2HB 4P23D 1RJCA 2B0SH 4JFPA 3O4OB 3PL6B 2E9JA 2A74B 3TZVA 1JFQH 5EZLA 1IGML 3QEGL 3T1FA 4HF5H 4I18A 4U0QB 4PLJD 2DL2A 4XBPB 3LAFA 4HJJL 3SKJH 1DVFD 4P99A 2CDFB 4JHWL 5K9QI 1UWGL 3QXAA 5T5NF 1BQUA 1NBZB 5JHDE 3OSKA 4MA3A 4OM1H 4P5MA 1OOAA 5HI4D 4F9LA 3QFDB 3QZWA 4HUXA 1OAKH 5ITFB 3E8UH 4WHTA 3D9AH 4X9BA 4XCCL 2X10A 1KB5H 2A77H 3TIEA 3ESUF 2WBJC 1ORSA 2J6EA 4R2GC 1CFVH 2ZUQB 3I75B 1BQHG 5TGBA 3KYMA 1UB6B 3LH2L 4JFZH 2W9EL 1AD9B 4TSBL 4W81A 3RIAF 4ZTPL 1OVZA 3QUYD 4X6BA 2W65B 4LSVL 4YGVB 2VDMH 5F1OB 3IXTB 3OXSA 3FRPA 4ZPTA 4YIQB 1ADQH 2FX9H 5GJTH 4HXAL 3DX8B 1IFHL 2I27N 2EDEA 4ONHA 3O41A 2R0ZL 4NQDB 2CGRH 1C12B 4ZO6A 5L9DL 4PJIF 3INUH 4G9FB 5JHDB 3W9EB 3ELAT 4UT9L 1M7DB 4LK4A 2DLIA 5E94B 3FO1B 3PDOB 3BT2H 3EO1B 3GJEA 4G6AC 2RQ8A 2YR3A 3MJGX 3S7GA 2AI0L 5FK9B 5J6HB 2ZNWA 5SX5H 5A3IC 3GSRB 1HNFA 3UROR 1RJZB 3RTQA 4FXKA 3SCMB 5ICYA 4KQ4H 4TUJA 3NCJH 3L3IA 3FQNA 4LPYA 1ITBB 1VADA 3DVGB 2CLRB 2DQGH 3ARFA 4HAGA 2ATPA 2DKMA 4OLWL 2GJ6B 3LQAH 2JELH 1LHZA 4QY8B 5C0BE 1HXMB 4APQB 5TF0A 1R5WB 3CGTA 4YC2C 2HH0H 1RI8A 2EXWC 1TNNA 3GKZA 2V17H 3CDYA 3VMOA 1T4KA 5FCUL 5F7MC 3RNKB 1ORQB 3L3DA 2DRUA 1WT5A 5FA4B 4XCYB 3DO7A 3CXDH 2P44B 2DDQH 1CBVL 4AIZB 2E6JA 1BZ9B 1U2HA 3P0YL 1U8OB 1QBMH 4KUZL 4UIKL 5KVGH 2Z8VC 1NANI 5CUSL 3VRJB 4K3GA 5CJQH 1WJ3A 4XWOC 5DD5L 5E2VH 4NZUL 1FPTH 1WK0A 3T0EE 3JWDL 3QEHA 1X6NA 1B9ZA 1J1XL 1MCEA 5I0ZA 2K7QA 3SKNA 5IM7A 4WDIB 4NRYB 4A6YA 1CXFA 5GS2H 2Q86B 2P1YA 2I60H 4MNQE 5DRWA 4LOUD 5FM5O 4MQXD 1OT2A 3I50L 2DICA 4G7YH 4WWKD 3QCUH 5D4QA 1QSEA 3V6ZA 3L9RA 4L29A 4YO0A 2YN5A 5DUBB 1ZLWK 3UTTA 3ARED 4BFIA 2HVJA 5IOPA 1XGTB 3U9PL 1UKTA 1X5ZA 1U58A 3EFFA 2FH8A 5I73C 3OWEA 5D7LE 3H0TA 2BNUB 4AJ0A 4EUPB 2CKBB 3RUGF 2DI8A 3T0EB 5TDOA 1Q9WB 3UYPA 1SMOA 1H3VA 2JJWA 2BVEA 1YYLH 3RVVD 1KLGA 4HUVB 1OF2A 3LRSB 3AROA 4KHXL 3PP4L 2RFXA 3PP3H 4MNQB 5C0CD 3O6FA 2Q7YA 3CMOL 1P6AB 3MRLA 4FTVD 1CLOH 4BQ6A 3WS6A 3UDWC 3QG7L 2HFTA 3REWA 3TBYA 1KFAH 3E6HA 1T1WA 4KAQH 3WHE1 3GI8H 3MRGA 3QXAB 3D39A 4HDIA 1DTUA 3EDKA 5LGKA 3HS0A 1Q72L 4MA3B 5E2WL 5HDQH 3EOTH 1CE6A 4PLKD 3P0VH 3QZWB 4RAVB 1ZANL 4WHTB 3K8LA 5C0EA 1YY9C 2BCKA 4RMTA 1MFNA 1ORSB 5DA0B 3PWPA 5D7IF 4HIXL 1RMFL 1BGXH 2FECL 3QFJA 5TGBB 5E24E 5DJZB 5BZWB 1YJDC 2EDXA 5FA3A 3SJVA 5A2KH 1WEJL 1KTKE 4X6BB 4PP1D 1WFNA 4X6CA 2D3VA 4N9GA 4NWTH 3RX7A 2FD6H 2ADJA 2GCYA 2VB5A 2UZXB 2BVQA 3IDNA 3X3FH 4ALAL 4LRIC 1YMHA 3PV6A 1E4XH 1GZQA 3MV7A 2QSTA 1YN6A 1P4BH 5F9JB 4ONHB 3O41B 5IVOA 2B39A 4WUUD 3RPKA 2W07A 3O2DA 5CKGA 5IVXE 3C08L 2VLJE 3BKML 2XACC 2EKJA 5SX4I 5F1KC 3KLAA 4ZFZA 3RJQB 5L6YH 1AJ7L 2VR9A 1RZ7L 4PJCF 4D9QE 3GMNA 3VXRD 5HYSA 3S37H 1HWHB 3EW3B 3EDEA 4FXKB 5ICYB 1U8JB 1Q9KA 2KH2B 4TUJB 3UJIH 3L3IB 3EAKA 5D9SA 3RY4A 4HEME 4FFYL 5DEFA 3QXWA 5AWNL 2R69L 1VADB 4CVXA 3THMH 3CVHA 3OHXA 4NO3A 5BO1L 3QDJD 4FQ1L 2OM5A 4UBDD 1JZ7A 4RGND 3VRLF 1NLBL 3NACH 1AD0A 1ITCA 2I25N 5AZ2H 5C07A 3Q0HA 2VDPL 5FYJD 4P4RA 3D1MC 3BKYH 1RIVH 3ZYOA 2DL9A 1H5BC 2ED9A 1MREL 4XT1C 1BJMA 4M1DH 1U8HA 2OS7A 1NFKA 4OFYD 3L3DB 5CGYD 5IVXB 5DD1H 3VXTA 2CRMA 3DO7B 1J0KA 5IUSA 3LD8C 3EJZC 4U31A 3WFDH 2CQVA 1JUFA 3BAEH 1ZTXH 3FRUA 2JB5H 1TTGA 4YWGH 4LBEA 4EDWH 1A7NL 2NYYD 1XIWC 1INDH 4HXBL 5JW3H 1UJ3B 1L0QA 3KPOA 4JO2L 1RUAH 4MWFA 1EEYA 2OMBA 5MEPA 4QOKE 3N1QC 4Q58C 1YEEH 5I74B 3O9WC 1CDJA 4Y4HD 4G7VL 1SYSA 3SKNB 1BMGA 2IH3A 5IM7B 4U3HA 2R0KL 3TN0A 5GRVL 4TNWF 4XC1L 4A6YB 4F9PC 4S1SL 5ALBH 1DBMH 5CP7A 4MHHG 4ORGB 1FN4A 3DROA 4NQUA 1FNGA 3ARDD 3C5JB 5EN2B 2V5TA 5BRZE 3EYFA 1MCIA 1ZEAH 3V6ZB 4HZLA 4HUWA 1J1PH 3UZEA 2H3NA 1V3MA 3LS4L 2N7AA 3UTTB 3K7UA 1FORL 3OXRA 3WIIL 4BFIB 4U6VL 2HVJB 5IOPB 3JV6A 2O5ZL 1H3PH 1U6AL 5C0IA 4WNQA 1T04A 1U58B 4YHOH 1R5IA 5EWIH 3EFFB 4Y19D 1T2XA 2VZUA 1A7QL 2NY5H 2B1AL 3BPLC 2X4SA 3GBMH 2PTUA 4JG0H 3V4UL 2D0FA 4XVJL 2MFNA 4G80B 1KLGB 4K8RD 5ID1A 5LVEA 2R1WB 1DLFL 1OF2B 1XEDA 4HT1L 4B41A 3MJ9A 4RAUB 2GQHA 4XBEL 4ELKB 2OTWA 1I8IA 1BM3L 1PY4A 1U8QA 2NX5E 5T1KA 2H32H 3VGHA 2FWOB 4POZD 2HFEA 4NRZA 4TPRL 5L88H 3O6FB 2Q7YB 3MRLB 2VR5A 1FBIL 1A1NB 1DBJL 3RGHA 3I02A 2HMIC 2I5YL 3AU1A 3M1BB 1A22B 1PY9A 1J0YA 1I7ZA 2VC2H 3U4BL 3W0WE 4XVSH 3MRGB 3NBNA 1W0VA 4LSSH 3QHFH 4XCEA 2NR6D 3FHAA 4GSDH 2WBKA 2NW2A 25C8L 3HS0B 3SDAC 4LASH 3MRFB 3WHXB 1XF3A 3BEVA 2CIIA 1U8KA 5JOFA 5C0JA 2FL5A 2G75A 2BCKB 4WHCA 5FB8B 4XPGH 1BFVH 4JRYA 5KSBE 4XC3L 4XP9H 4YBQC 3QFJB 3PQYE 3LMJH 1PZ5A 3SJVB 3KPTA 4L3ED 1FL6A 5K9JH 1OTUD 5I15L 3MNVA 4X6CB 3VFPB 4WTZA 3WJLA 4EN3C 2GCYB 2BVQB 1U0QA 4WO4C 3G9VA 4Y2DC 2X2YA 4KJPD 3SKJL 5FYKU 3MLWH 1LO0H 1GZQB 3PWUA 3RVXC 2R9HD 3MV7B 3PG2A 4RNRB 2IF7A 1LP9E 4JY5H 3IETA 3STLA 2A73A 3VWJA 4OM1L 4KGLA 4C56A 5J9PA 4HC1A 1DQJB 1OAKL 5GGSY 1UZ6E 3E8UL 3T3PF 3D9AL 3QXDA 1JJUA 4M5ZH 4R4NC 4JZJA 2A77L 3KLAB 2AK4E 3C8HA 1X5KA 1CFVL 4LLYB 4XCNA 3SQOH 3IFNH 5HYSB 1WTLA 5ANMA 1JNHB 2OTPA 4JFZL 1Z9SA 5KSBB 3W82A 4DVRH 3SE4C 1Q9KB 4X83A 2DTMH 3H9SE 3B8SA 2VDML 3CLFL 4OQTA 5DEFB 3ZE0F 4Q6IA 4QRPE 1ADQL 2FX9L 3OHXB 3IU3B 1PLGL 4NO3B 1G7HA 5CCKH 5GJTL 3RY6C 3FCTA 2Z9TA 1MQ8A 5I1AA 1TVHB 5DUPH 3TBVA 3TO4D 5C07B 5I1IH 4P4RB 5E9DD 3KPSD 3C6SA 4Y2OA 4KPHH 1AXSB 4FS0A 1J5OH 4MQTB 5IMKA 3RDTD 4NO5A 4ELMF 1U8HB 1WZKA 5FKAA 2ZJSH 3BPCA 4JO4H 4JR9L 3NPZB 1ONQB 3VXTB 2DMKA 3CFDA 3R1GL 4DEPB 4G9DA 5EFIA 2AK4B 2QSCL 2DJSA 2HA1A 2ZUTA 3ZE1F 4KQ4L 1PG7H 4QCIA 1CE1L 2G2RB 5I73B 3IVKA 3FRUB 4M7LH 2WQ8A 2DQGL 1Q0XL 4PY8I 2ED7A 3H9SB 3PHOA 2BNRD 4TSAL 1F90H 2JELL 1G0YR 4WFFD 1Q94A 4AZ8A 5IK3A 4QRPB 4ZNCD 1W72A 4MWFB 1EEYB 3RGVA 4PJ7E 5KZCB 1JK8A 4PJ8A 2HH0L 1I3GH 2KL6A 1D6VL 4LAQH 1SYSB 4M93C 3NN8A 1WUNT 1JZ8A 2IH3B 5J6GB 2V17L 3TN0B 5KOVC 4WUKH 4AY0A 3UAJD 1AI1H 3D3VE 5D93C 3BDBA 2OZ4A 1OQOA 1TENA 2QSVA 5FO8A 2FJFA 4PRHA 1UXSA 3CXDL 5L8KB 2DDQL 4KRPB 4GBXD 4YDVA 3DROB 3H9ZA 2Z31A 3V0AC 4WI4A 5HGGS 4KI5C 4X7DC 5HGAB 3SY0B 1QBML 5HVFB 3ALWA 5MEQA 3OKDA 4HZLB 4MJ2A 4HUWB 1XFPA 5KVGL 1IE5A 4J3WA 3FFCA 3OXRB 4PJGA 3PNWA 1LO5B 3MLSH 1NLDL 4MSWA 5FECA 3JV6B 3OKEA 2BVOB 3G04A 4I2XA 5CJQL 5C0IB 2ICWA 4WNQB 5HDLA 3SE9L 4YBLC 1R5IB 5E2VL 1FPTL 2EYSA 3PHSA 3MRNA 3BD3A 1MFDH 4OZGF 4PJ7B 4HFUH 4NQSA 1QFUH 5E00A 2DQHH 1BZ7A 1KJMA 5ID1B 4N0FA 1XAUA 1L7IH 2OTWB 1I8IB 2HRPH 2WIIA 1S7WB 3JWOH 4ZFOA 5T1KB 1FVDA 4HKXA 1YDPA 4ODVL 4I9WE 1FE8H 5KS9A 2HFEB 2ERJC 4NRZB 1H3GA 4G7YL 4FQHA 3FONA 3AU1B 3N50A 4Y5YC 3W11C 1CGYA 3BIKB 4FZEH 1W0VB 1EZVY 3PXHA 5D5ME 4LL9A 1G9NC 4P4KC 4M1CC 1S3KL 3C5ZA 3FOMA 1EHLL 2C3WA 4Z7QF 5E4EC 5GGRA 2E7BA 3L3OA 3C2AH 1XF3B 3UPRA 4IRJC 1QRNE 5JOFB 1VFBB 4OLVH 4WW2C 1B0RA 1FYTD 5FAAA 4XPFH 4N5UA 4ERSL 1T2QH 2FO4B 1YYLL 1CDIA 4JRYB 4KK8C 4JVWA 1D6EA 3RFZC 3MNZA 5FGBA 3GJFK 3O3EB 3SBWC 5FGSA 5GJSH 3H3BC 4HK3J 1PAMA 4E0RB 1RSFA 4MZ3A 1CLOL 5D7JD 3WUWG 1KFAL 2B2XH 1CICA 3P0GB 3GI8L 2XNAA 5E8NA 1H3WM 3IETB 3STLB 2A73B 1JRHH 5HDQL 4C56B 3EOTL 3X3GH 3LD8B 3P0VL 5CAYB 4Y4KA 1KCSH 5L2KA 1J1OH 1NBVH 3QXDB 4P5TC 4JZJB 4AT6A 3OBAA 2RR3A 1QQDB 2MQ3A 5HY9A 3G9AB 1WF5A 2NY5C 1EAPB 2ZUUA 4YJZL 1F4AA 1BGXL 5IB2A 5ANMB 3RX8A 1MFAH 5I75C 3RUGA 4C4KT 4KV5F 2W0KA 2C7UA 1I8LC 4O2CB 3Q1SH 2A6IB 1FFQA 3MBED 3TEUA 2FD6L 1T22A 2CJUH 1JGUH 2VKXA 3X3FL 3FCTB 2QHLA 1CXKA 4XPAH 3RL2A 1B6DA 1PVHA 4NQEB 1E4XL 2N4IA 1P4BL 3TBVB 2F15A 3FO0H 3BUYA 3F7VA 3Q3GA 4KKAD 4LDEB 3VFNB 1EPFA 1FNEB 3C6SB 4MXWH 1JL8A 2NY0B 5DDHB 3S5LA 5IMKB 1JZ4A 4RGOH 1FH5H 4OKVA 3CJJA 4KROC 2PYFA 4PJIE 5FKAB 5L6YL 3BPCB 2IWGA 4MCZA 4WFEE 4M8QB 3HE6A 4PY8J 1CL7I 3TNNA 2F5BH 1KIRA 3S37L 4JQVC 5FXCH 3UJIL 5AAMA 3O6MH 4O02H 3QPQC 1TITA 3IVKB 4X98A 3THML 3VD5A 5IHZA 3J7HA 4EXKA 35C8H 4H26A 3UTSA 1Q94B 1VA9A 1HWGB 3CDGA 5ACMA 3NACL 4PRIA 5AZ2L 1JK8B 4PJ8B 2YPLA 4YNYB 2F8XC 1N0XH 2BJMH 3OB0K 4DW2H 2P5WE 1T83C 4FQXD 2FLBT 2A6KA 2APWA 4MQ7A 4LMQI 2R8SH 1IM3A 1WFUA 3SDDC 3QJHA 4M1DL 2NZIA 3IAQA 1I1AA 5DD1L 3V7AE 3KPRD 4FFZH 5J06A 4PRHB 4D0BA 4NNYB 4YDVB 3WFDL 5IROC 5KTEL 4OAWA 3EIFA 3BAEL 2Z31B 4RA0C 3BE1L 1IC7H 1G1YA 1U36A 3UTPD 2ENYA 1U93A 4G6JH 3FFCB 4KH2A 4PJGB 1INDL 4MD0A 3PNWB 4MSWB 4N90E 4NN5B 3G04B 5E1HB 5GGTL 5DFVC 2YD4A 4LCWE 4U1NA 4K7PX 2EYSB 2VXVH 4IJ3B 5C0NC 3MRNB 1MJ8H 1FIGH 5HJ3A 4CMMA 4KTDH 4NQSB 4OJFL 2P5WB 5E00B 4MAYA 1IAOB 1BZ7B 3S4SG 1KJMB 5SWSD 4N0FB 4I5BA 2VQUA 4D9LH 5I8OH 4Y2DB 5ALBL 1DBML 2WIIB 4ZFOB 1N5YH 1FVDB 1YDPB 5FHBH 4LVNB 5KS9B 5FV1L 5JHLH 4S10A 3UBXI 1ZEAL 3VI3E 4FQHB 4C54A 4N0YH 1RPQA 1LO4L 3WXVH 4DUXA 2X70A 4F57L 3NIGF 1CDUA 4L4VD 2PW1A 1H3PL 5HVWA 3FOMB 3LB6D 5GSRA 2NY5L 1HQ4A 5E03A 2X9YA 3GBML 4LEXH 3O3AA 4P3DA 2X05A 4LCWB 2DQCH 4G6FD 1B0RB 4JG0L 1TMCB 2HT3C 1Q1JH 1D6EB 3AB0B 5DQDH 3MNZB 1E6JL 4U05A 4N0UE 5I1HL 3ILPA 3OKKA 1P2CA 4JHZA 4EOWH 4OGYH 1JI1A 3U0PA 1P9MC 4NGHH 5L88L 2PXYC 4HG4K 3V2AR 1CFQA 2BOBA 4OF0A 1C16A 2Q76A 4XTRD 4XVSL 2XNAB 4LSDA 4LSSL 5DJYA 5E8NB 3QHFL 5DRZB 4OF6A 4GSDL 4XVTL 3OKLA 2WLYA 4KU1A 5F9WB 4KI5E 3MJ8B 2JE8A 3H9YA 1IZKA 4LASL 4TTDC 4Y4KB 2ESVE 5L2KB 3EDFA 4YHZH 3VE0A 1BJ8A 1YEFH 5JORA 2WSKA 3RHWK 4AT6B 2NY3C 4JPKL 4LAJH 5HY9B 3ISWA 4XPGL 1HSAA 1BFVL 3B6SA 4FQCH 5JOPE 3GM8A 5IB2B 1SJVA 4LCCC 1A3LH 3WFBH 1QBBA 3LMJL 5D7IE 3MNWA 2FRGP 3RUGB 5K9JL 2C7UB 5M7QA 5IJKA 5E8PA 3MCLH 4OZHF 2WWMC 4OF3A 1Z3GH 1R24B 4P2YA 3BEWA 4P57A 4PP2B 1AQKH 3MLWL 3ROLA 1KJ2H 1QSFD 1LO0L 3DXAA 4MX7A 4IS6A 3ARYA 4JY5L 3BUYB 3F7VB 1S9YA 3O3DB 1GCFA 3SEPA 1CD1A 1U3ZA 3BD5A 4RX4A 5BV7H 3S5LB 2R0LL 4M5ZL 4OF5A 5JR1L 3CFKB 3TLRA 4L9LC 2PYFB 3QBTB 2ESVB 2CK0H 2XIDA 3QO0A 4G6MH 1UM5H 4MCZB 3TJEH 3WFEH 3HE6B 3RWFA 3HRZB 3TNNB 1QFWH 1OTTC 1KIRB 5GS3A 4CUCA 4PJCE 3D85D 3QISA 4DVRL 1KENL 2HTLD 2DTML 3D0LA 3L1OH 1F6FB 2FEDD 4ONGH 5E8DH 4YHYC 5D7IB 5KANI 3WNLA 5IHZB 3G5VA 5CCKL 2IAMA 4JEGB <