5BOPA

Crystal structure of the artificial nanobody octarellinv.1 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAASGGTFSTYGMGWFRQAPGKEREFVAASSWTGANTYYADSVRGRFTISRDNAKNTVYLEMNSLKPEDTAVYYCAARRWLGGSYFDPGNYDFWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nanobody
publication title The unexpected structure of the designed protein Octarellin V.1 forms a challenge for protein structure prediction tools.
pubmed doi rcsb
source organism Lama glama
molecule tags De novo protein
total genus 32
structure length 123
sequence length 123
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bopA00
3BT2H 3ZT6A 3TP4A 4YHNA 5ESQB 2DYPA 4GH7B 3ILQD 1ONQA 3MRDB 3V0VB 3O3DA 5E2UH 1OW0A 5E1AA 2MQ0A 3MRIB 2FEEL 2IQ9H 2YBRA 5T1KB 5IESH 1BJ8A 3VFGL 1S3KH 2B4CC 1EAPA 3BO8B 4G42A 1HXMB 1OVZA 1RIVL 1QO3A 4GSDL 3D25A 5D1QA 3IJHB 2Z31C 1TENA 5IK3A 4JN1L 4IDJL 5CBEB 3NN8A 1U93A 4P4RB 2F74B 5HGHA 1UCBL 2ZOLB 4MJ6A 1T5WB 3CVHL 4F9LC 3L5XL 1GGCH 2B2XL 2VL4A 4P3CL 3ECBA 4JGJA 3WIFA 3FB8A 5JIHA 3UMTA 4QRPB 4QHKI 1BFTA 3RGVB 4JKMA 1BLNA 1X5HA 5F6IB 5D9SA 4GO6B 2JB6B 3IFLL 1TVDA 4LAQH 5AZ2L 1B0GB 2CIIA 4M8QA 3PJSB 3OKDA 1KIRA 1XR8B 3BVNB 4D94A 1MHEA 4JKPH 5CZXD 1QFWI 1UACH 5IV2B 3SOBL 4YLQT 4MJ4A 3MXWL 4TTDC 4P46B 4I5BA 3ARXA 4OLUL 1QTYT 1GSMA 4XGZB 5DSCB 4FS0A 4G6ML 1F58H 3RGVC 3NN8B 4FA8A 1ADQH 5F6IC 4PG2A 2YD4A 1CXHA 1MCJA 4C83A 4JFHD 3WO3B 4KKBD 3S9DB 3ECBB 5EC2A 4IS6B 2P5WD 1AKJD 1BZQK 4PRDB 3UTSE 4UMGA 1BLNB 1LO4L 2RGSA 1QZ1A 4L4JA 1JNHB 1DZBA 1TZHA 1X3DA 4GMTL 5DC0A 4OAWB 2I25N 2N56A 2RJMA 2K9UA 1NMBL 5CJXC 1LNUB 4U1SB 2DKUA 4KVNL 2HG5A 3BKMH 5IQ7H 4XZUA 5DURD 4HXAH 4W4NA 3KPSE 3RVXC 4RGNE 2F5AH 4N1HB 4D9LL 3KNBB 4J6RH 4C83B 1IGCL 1FFPB 3DHJA 1K2DA 4PB9L 3IXAB 1U3ZA 2ITCB 3H9SD 3QNYA 5F1NA 2H6PA 2JJSC 1DTUA 4JFZH 1Q9LB 4NHUA 4M7LL 5GGRB 3BGMB 5C0AE 1TZHB 1DQTA 1NGPL 4PJIB 5DQ9A 4QF1B 5GRVL 4HS6B 3VXNA 2B5IB 3STLA 1VHPA 4WW1B 3MRCA 5I1EL 4XP1L 5C0EB 1JJUA 1NLBH 4BM7A 3JTSA 12E8H 1KN2H 4DN4L 3WD5L 4AMKL 4NWTH 4DK3A 4YHYB 3ILQC 2Q8AL 3IDYB 3MOBH 5IW3A 5GJSL 4M43H 3MJ9A 2M2DA 2R0KL 3SBWC 2B1HH 3RL2A 5EA0H 4HS3A 4OCMC 1C5CH 4QCIA 1JPFA 1CL7H 1XGUB 2B5IC 4AZ8A 4LSUL 3S34H 4HG4J 3LKQB 3DUSB 3F7RA 3DJ9A 3CJJA 1A6WH 1K8DA 3QJFA 1CU4H 4KQ4H 3IDYC 3PXHA 3FONB 5C08E 2YK1L 3MOAH 3SGEI 1MHPH 4J4PC 1ZT4B 1HILA 4XRCB 3WIHL 2F58H 3SDXE 1UWGL 4NBYB 2WINB 5GISL 4OCYL 4JDVB 2WNGA 4OCXH 4JANB 3AUVA 3DVIA 2VLJE 3FQUB 2XWJA 3ZKSD 1HQRB 4R8WH 4P5TD 4LBEA 2P5WB 3VXRA 3WE6A 1AKJB 1P4LB 4HKXA 2VE6A 3H9SA 5CZXC 1D5MB 2AEQH 4K23L 3AROA 4KTDL 3RL2B 4HS3B 4CMHB 4PJ5D 2VSCA 4JO3L 2DLIA 4OZIE 5E99L 2IJ0C 4L4TE 4OZHE 4XXDA 3VXME 1UWEH 5CJOH 3TLRA 4XVTL 5A16A 3TBWB 3ZKQD 1DFBL 1CE1L 5HJ3B 4DCQA 1I8MB 1ACZA 4NKIL 3QJFB 3REWA 1BD2E 1IEBB 2IALA 3VMNA 4KKBC 4BZ2H 3FQXB 2W65A 2Y7QA 4BZ1L 4UT7L 5DURB 5SWQA 3L3KB 5TFSL 3RX8A 1YNLH 5MEOA 1YEFH 3PIQB 1F4XH 2VTFA 3ARBA 4JO4L 1Q9WA 3ILPB 4O9HH 2D03L 4YE4L 3OXSB 1P84J 5AEAA 3JXAA 2SEBB 4I8DA 4C57C 2XWJB 2CGRL 4MNGB 4KKLC 5L9DH 3WE6B 2FBOJ 3LS4H 1MCSA 3H9SB 5L88H 2UWEA 4H8WC 1DBAL 4KZDH 5B22A 2X70A 3AM8C 3PXJA 4N5ED 1A9EB 1JWSA 3IU3A 3O2DL 4YJZL 1IAIM 3QDJD 2NQCA 5CIPA 4PJHB 1TETL 4NQVB 4MSWB 4A6YH 1FN4B 1I1CA 4OZ4B 4ZO6A 1A5FH 2VLME 2LABA 5F6HJ 5F3BB 5BOZG 1QFWH 3LH2H 4KH2A 1F90L 4N8CH 5DT1L 2XN9D 3D3VD 5SWQB 3UDWC 2H32B 3ZTJH 2VLKE 2FIKB 5KN5A 1LE5A 2X7LB 3QUKA 1HIML 5I18L 1BF2A 1Q9WB 2X5PA 2EIEA 3SDXF 1CK0H 1VEOA 3E2HC 4MLSA 5DR5L 2A38A 4WRLA 4QOKE 4G5ZL 1DQLL 4KV5E 2P8MB 4O2CB 4M9PA 1WAAA 5D5MA 4EIZC 1LO0H 4XPTL 1LQSR 4OZIF 1JWSB 5FUOL 4OZHF 3SQOH 2YPKB 3GMPB 5F1IB 2BMKA 4XVJH 2H1PH 3C5JB 3HI6L 4NN5B 3BJ91 3ROLB 1AGFB 1S5HA 4O51A 2XI9A 1T1ZA 1DEEB 3KLDA 1EGJA 4DVBA 2Q7NA 5GJTH 2B4CL 3W9DA 1AD9A 3QZWB 4R90L 3C8DA 1PVHA 4RX4A 4P5TB 4LSVL 4N9GB 1MF2L 1Z3GH 5I8OL 1G7LB 3HLAA 3T3ME 4PJ5B 1HHKA 4L1DA 4NZUL 1T2QH 4KJWD 2OL3L 4MQXD 3QP3A 1WIPA 2A6DA 1UB6B 2BRRH 4HBCH 3BE1L 1IL1A 3RKPA 5LXGL 4WFED 1A8JH 3L3OA 3HZYB 2CQVA 2X4QA 3PGCB 2P24A 2B0SH 2I9TA 1QPPA 2FX7L 1C7TA 1VPOL 1YUHA 4NUJA 2Q86A 2NXZC 3IETB 4L8BB 3BPOB 1RU9L 2IFFH 5CEYA 1CIDA 3X14B 4OLEA 4XMKL 2XNAA 3GMNA 3LPFA 5JA9A 2WW8A 2HMID 5EZIH 3LEYL 1WBZA 1A1NA 2A6DB 5ESVA 2ZCLL 2GJ6E 3QDJB 3ZO0A 3GKWH 3CVIL 4KV5F 5SWSE 1E6OL 3FT3B 1T4KB 3PABB 3QQ3A 3FB5B 5AZEL 2ESVA 2M1KA 4OKDA 2YWYA 4XNXH 4YNYA 4JG0H 1FHGA 2WM0A 2XN9B 3P30L 3D3VB 1I9RH 1EIBA 4Q2ZB 1C12B 1K3IA 3SGEH 2CUHA 5HTSA 1AR1C 5JIIA 4OSUH 4NUJB 2Q86B 4UT6H 3WHXA 4PGCA 1PG7L 3WKNA 1AFVH 3VFPB 4Y5VC 2JJVA 5EU6E 2ZKHL 1YEIL 3UROR 2WIIA 4OZFH 3MCLL 5ACMA 4NZDA 3MNZA 2UUDK 3PWNB 1ES0B 3T3MF 2FLRT 3V7AE 4ORGB 3GNMH 3NZHL 4ZUUB 1S78D 1NJ9A 3V9FA 4M62H 3ZSSA 4JPVL 4FQ1H 2FYYA 2JF1A 3AAZA 3V4PH 1A7PH 1CZ8L 4N0UE 4XNMB 1K5NB 3QUXA 2C1PB 4U6HA 5EUOE 3RAJH 1YPZE 4LLUA 5DO2C 4FP8L 1HSAA 4PY8I 3K1DA 1UB5A 3V0AC 2Z35B 5EU3B 3GBLA 4JHZA 5DI8A 4WWKD 5C09E 3IFNL 4FQIH 3U9UA 2WIIB 5GGUB 4UOW0 4E0RB 1W2KT 3I75B 3AC0A 1CDYA 4QHUB 1TJIL 2XT1B 5C0GA 3QDME 1FZJA 5JTWA 4PBWD 3HAEA 3G6AA 5SX4H 5JW3H 2ZP0T 2E7LC 2K3TA 4XP6L 4EDXA 4HUUB 5DRZA 1LO5B 4ZYKB 3RUGB 2R56H 4XWOD 1AXSB 1I8LC 1V7ML 1ROWA 5D2LA 1WZKA 4HFUH 2ADFL 1ZHNA 2EEAA 1A1MB 4KRPD 6FABH 1WVZA 3SDAD 3VXPA 1KYOK 4P2QE 1T7ZA 1U41A 1WISA 5C0CA 2UV3A 35C8H 4WCYH 2PW1A 4X7CC 4XAKE 2JE8A 4OLWH 1AP2B 1U8IB 4LRIC 1EFXD 4DK6A 4UINH 4Z7VA 2V5RA 4GG8A 5TDNA 3C09C 4P2RE 1NCBL 1JNJA 1ZK9A 4M6OH 1RJLB 4G6FD 2I07A 4UDUA 2CDFB 4EUPB 3MUHL 3CSBA 1RQ5A 3CUPA 2J12B 5DJ2A 1A6VL 1FYTA 3HNVH 1NL0H 2WQ8A 1S9VB 4M7JL 4KGLA 2BNRD 2A6KB 1NBVH 3CMGA 2EE3A 3JBG7 5EUOF 2V2TB 3IAPA 4NO5B 5I71B 1YPZF 5F7UA 1OAYL 1A6AB 1RULL 2Q8BH 3HZMB 2AK1L 1I1AC 2YC1A 1AY1H 1MEXH 2P5EE 5D1XD 3S4SG 4KUZL 4F9PC 1NANH 2IG2H 2EDQA 2VISA 4ZSOB 4EI5A 3T09A 4WU7B 4JZJB 4H8WL 2V2XA 3V5HB 4S1QL 3HB3D 4ZUTA 32C2B 3TYGL 5I71C 3FMGL 4GW5B 1I8IB 3DX6A 5DJ2B 4LPYA 4MVBC 1BIHA 4UTBL 2PTVA 4PGZA 4YUEH 1SVZA 1TVHA 4RRPG 1KELH 4CDGC 3HG1E 2VABA 3BXNB 3IFPA 4HKJB 1RUPH 4WWKB 2XZAH 1S78C 3CAFA 4KI5E 1I75A 3GM8A 5ANME 3UYOD 1IBGL 4JZJC 2QHRL 1L7IH 3NA4A 3QNXB 3MGOB 4ZXBC 3RWDA 4Z8FL 1QR1A 4XCNB 2J88H 4CNIA 3PQYA 3MLRL 3HS0A 2IBZX 2BXYA 4GUPB 5I8CA 1MCHA 3DVGB 3WXWH 4X99B 4LKXB 4LLAA 1VADA 2E8ZA 3BN3B 3LHPL 4KKCC 4JQVC 3TBTA 4WWKC 3ORJA 1BFVH 2J6EL 2FWOB 4QRUB 3DTXA 4OCWL 1MPAL 5F88B 2HJLB 5E5RB 4Z7WA 1HQ4B 1MSPA 1TVHB 5E9DD 4KRPB 4ENED 3SDAB 4HJJH 3IGAA 1N5YH 3GUTA 4WI6A 3VFSA 5D1XA 1KB9K 1Q9OB 1R24A 4LSTH 1KPUA 3WDHA 1EFXB 4GS7B 3O2WL 1AHWA 2WAHA 3VU2A 2V7NA 1A6UH 1E4WH 3TYFB 4CNIB 4L3EA 1IAOB 4XWOC 4G6FB 1SEBA 5B21A 1MCNA 4PLNC 4EDWH 4CADA 5I1CL 2HVKB 1XR9A 5JMOC 2J8UB 4UAOB 4KRPC 5IW1A 3SDAC 2E3VA 5TDOB 5CLTA 2BNRB 4H1LG 5GPRA 2L0DA 3DTXB 3VWJA 1YN6A 5MERA 1AI1L 5JOEA 4X8XA 3DVNB 5E8PA 2R0LH 4Z7WB 1IM9D 2DTMH 4LHJB 1LE9A 1QQDB 5D1XB 2ED8A 1R24B 1D9KD 5HD8D 3BGAA 4ODXA 1GH7A 3GIZL 1AHWB 5HYSB 1H15A 2A9NL 5EBMB 2B1AH 1T1YB 1G7PA 1QSFA 5I15H 2EDBA 3N1MC 2VQ1A 3VFNA 1K3ZA 5GZND 2BJMH 1JZ4A 2DKSA 4G6KL 1Q8MA 5JHDE 4QT5A 3LN9A 4OM1L 3QG7H 3ZL4L 3GJFA 3QUZD 1MIML 1OQXA 3BKCL 3T3PE 4TOYL 1BEYL 3RVTD 2XKNA 3I2CL 2VAAB 5FOJA 4GLRI 3HB3C 4LSQL 4NSKB 3S36X 3MV7D 3HMWH 1M71A 1O7SA 3EFDH 1Q94B 3O3BA 1NCAL 1KPRB 5H94A 4I9WD 2EDWA 3S96B 2FHFA 5MEPA 2GEEA 5JR1L 3V5KB 1IE5A 1G7PB 2OR8A 3O11B 3X12B 2OJZL 3H0TA 4Z5RA 2VQ1B 4FFZH 4OF3A 4YDVB 5E8DL 5IB1B 1H3PH 3H7LA 3VFVA 1YMHA 3T4AB 1AIFA 4IRSC 1LK2B 4QT5B 5E9DB 1Q72H 2C1OB 2NY7L 3INUL 1JF1B 5L6YL 4XAWL 3MYJA 3OSKA 4X5WB 4MHHG 3B2UD 3L7EB 5JNYA 5DTFA 3C60C 1KXTB 1KC5H 2EDLA 4JHWH 5FYJU 4KROC 4JFFE 4PRHD 1FZOB 3O3BB 4GQ9H 1YYMH 4G8FB 1TVBB 2VZSA 5H94B 4YPGA 1GZQB 3HC4L 2ERJB 4ENEC 4LQ1A 4TRPH 2DOCA 3BEVB 5C9JB 3L5JA 4JR9L 3E3QE 2HT4D 3UPCA 1NFDE 3MNWB 1XF3A 5B3JE 2QQNH 4XC1L 3O8XD 1IM9B 3MXVL 1ZTXH 2OMNA 4O5LH 4OCRL 3BZEB 4I13B 4ODVH 2ZOKB 1JF5A 1CR9H 5BRZA 4TTGA 1FZMB 3CVHA 3L3IA 1D9KB 4KRMB 4U1IB 1JTOA 3Q6FA 3T3PF 3O2VH 4X4XA 4HWZB 4NNPL 4HPOH 1YMME 4K7PX 4RMVA 3A6BH 2D9QB 5FA4A 5IUSA 4LSRL 2E27H 4LKCA 4JPWL 4X9BA 4MCZB 4YPGB 2R15A 8CGTA 3A6CL 2CLRB 5F3HB 3JWOC 4NQCD 4OQ1A 3DX7B 1FFNA 4OM0H 5ID1B 3QUZB 4NUGL 3F58L 4JN2B 1RZ8A 1TXKA 5ID0B 1F13A 2XZQH 2X4UA 4GW1A 5EO0B 2DQTL 3WLBB 3MV7B 3QIWA 4FNLL 1FL3A 3EJJX 3KYKH 5GZNC 1KACB 1G9NC 3ABZA 2ICEA 2FH6A 4TUOB 4UOJA 1FAIH 1IFHH 4F7MA 4ZFGH 3MJ6A 5IVZB 1RK1A 2H2PC 5IMOA 4DEPC 4PYGA 4Q7DA 3QUZC 2BRQA 5FA4B 1EBAA 1DCLA 2JIXD 5DRNB 3X13B 3AS2A 3RVTC 2F9BT 5CLWA 1JRHL 4HDIA 3RVWD 4Z7UA 4C58B 1SJHB 1HNFA 5D2NA 4R4FL 2O61B 4LVEA 2IF7A 1NFDF 4OUUA 1RSFA 3VGBA 3ZE0E 3GSVA 4ZDHB 5B3JF 5DEGB 4MHHI 4KHTL 4MAUL 4MNHB 3ULVE 3QUMB 5H2BB 4QRRA 1SYSA 1FL3B 1CICC 3WFHB 1S8DB 1AO7E 2DKMA 4L8CB 3R0NA 3HTLX 4PRHB 2PYEE 3QNZB 4JM2F 2NY2C 4RGOH 1RK1B 1KIQA 1NCWL 1SQ2N 4OJFL 3TBYB 5HYIA 2EC9U 3H8NA 1VSCA 4WU5A 3DNKA 4LASH 1S9WB 1P9MA 3LD8B 1J1PH 4NQCA 3UTZB 3B2UC 4YHZL 4HEPG 2H8PA 3AGVA 3U0TA 4J3XA 5I1LA 5IHZB 5DFWH 3O8XB 4MS8C 3KYMA 1R3IH 2GSIA 2YEZB 5A2KH 2XA8H 5D2NB 5GGSY 3KYOA 1A9BA 3ROOA 4TSBH 5HI3C 5LAXA 3V4VH 4UQ2B 2FO4A 3TZVD 4JO1L 3LD8C 3GSOB 3FO0H 4OGAD 5DMKB 5CJBA 5D70L 5BZDA 1OP3H 2XOTA 3U0WH 2HT4C 1HEZA 1IC7H 3HMXL 3MR9A 1I7TB 3Q2CA 1H0DA 1SJEB 4OQTA 4PIRF 3O8XC 1KIQB 4RFOL 1ZA3B 3UTTA 1NCDH 1U2CA 4NQCB 2JCCB 3WFEH 4JFEE 2V5YA 2VITA 2FATH 3MLTB 2AAVA 2AJ3B 5HYJD 2H9GA 4C4KT 1DBKH 4YHIA 2FSEB 4KI1A 3H42L 1T5XB 4XMLL 1ZAGA 1YEHH 5IBUB 3KYOB 1A9BB 3MRHB 5I74B 1K6QL 4Y5YA 3CSYB 3QIBA 5IG7B 2X1WL 1GXEA 5HDBE 3ULVF 3O45B 4X7TA 1SYVA 3MR9B 5K9JL 2JIXB 3RKDD 3QCUH 3K0WA 1T22A 4JHBA 4X6DA 1WEJH 3WUWA 2QHLA 3GB7B 3RZWA 2X41A 4NCC1 4WEBL 1N26A 5EO9B 4YDKL 5DJDA 1PY9A 1IQDB 1SMAA 1RZKC 3Q48A 4CW1B 1ZVYA 3BP6A 1ZANH 4X6FA 4YR6A 5E08H 5JW4R 2GTZA 2HFEB 4NT6A 1R3JA 4LMQE 1IQWL 2QSCL 4HUVA 1MFCH 4I2XB 4OLZL 4Y1AA 3EDKA 4Y5YB 3RVWC 5IEHB 4UILH 2X4PA 3D39A 1W0WA 2EO1A 5E2WL 2HKFH 2I27N 4P2OD 4R4NC 1I3GL 1UEYA 1ZLSH 3FHAA 3NCFB 3QXVA 4X5XB 1RVFH 5F9OL 4TNVK 1UM5L 2IQAB 3RWGB 4R96B 4RZCB 3PWUA 4AENA 3LIZL 5DDHB 3TZVB 1UA6L 4OGXH 5GGTL 4O2FB 3FT2A 5DMGD 1ZGLP 3HE6D 5DYOA 1FIGH 4NQEA 3CZFA 1BZ7A 4GBXD 4P5MB 1U8LB 1R3LA 1DE4A 1JPTH 3VDCA 4Z0XB 1MFNA 4JFQA 5T5NF 2QSTA 5IVXB 2GCYA 1UM6L 5HDBF 5H37G 1NH6A 4I3RH 4Z0BH 5FECB 5DHVH 5CP3H 5HYJB 1J18A 1CD0A 3PWUB 4ONGH 4OGAC 5C86A 1FGVL 2YD2A 1RIUL 2ZCKL 4X7EC 2NTFB 2A2QT 1KPVB 1RZFL 2KZ1B 3TIEB 2UVFA 2B8OT 2BNQD 3VFUB 1CLYH 3UZQA 1BJMA 4LCWA 3TVMA 5TE4L 4O02L 5GXBB 1BZ7B 1JE6A 1O5DT 3RPKA 5I17A 3QRGH 1DE4B 3BIAX 3ESUF 4X8JA 3IJSA 1OGTA 4OF8A 2EYSB 4IMLA 3IDIB 5F89B 1FFQA 1OSPL 1YEEH 4ODUB 4D8PA 4LHUG 3WL9B 1DBML 5HHQB 4JRXD 3QO1A 3JWOL 1TTGA 2ICWI 3OB0H 5DFVC 1IAMA 1FDLL 3RKDC 3V0WH 2NYYD 3QCVH 3DROA 3LKSB 3KWWA 3I6KB 4FTVA 2FBJL 5GZOD 4P2OB 3L9RB 4LGPB 4Y89A 3MGTB 4H25A 4OLVL 1VGEL 2A6JA 3VD3A 3EKCA 1G9NL 3IRPX 5JPNB 3OKNA 1HCFX 3PV7A 5DJCA 1EHAA 5INCA 3EYFA 3R0MA 4I3SL 3VFRB 1E4KA 2BC4B 3VRIA 1BX2B 4S0TD 4OD2B 5IMMA 1JHKL 1HH6B 2DWDA 5HDQH 3G6JA 5IMKA 1OWRM 2PXYD 2BCKA 4UIKH 4NC0B 3NAAH 2GK0A 3OGOE 4NRXB 5IQ9A 1ND0A 3LS5H 5JW5B 3QO1B 1EMTH 4Y4HD 1K9TA 1MCLA 3RGHA 3MA7B 4L8DB 3ARFD 5IW6A 3RNKA 3HE6B 1ZHBB 5GGSA 4GKZB 1X6NA 3PGFH 4GBXB 1RAMA 4QY8A 3AS0A 2Y72A 5E94B 4XX1G 3S97C 1G6RL 5JHLH 5IFAL 3KPMA 2CKBB 2DQJL 4MJ5A 4RGMC 3JV0A 1T1XA 2I60L 3DMMD 4WWID 4JFHE 2N7BA 4KHXL 4MDIA 2WLYA 4Y4KC 1AE6L 1KIPB 3DV4A 4YBQD 5DMGC 3STBA 2AKRA 2HRPH 2JJSA 3GSWB 5IMMB 1INQB 3IU4L 2DWDB 2VIRA 4WFFD 1OD7A 5I1GL 3EYUH 5B39G 1B0WA 1U92B 2BNQB 4HC1L 1KT2A 5HGDB 1RFDL 3GSXA 2BVOA 1B2WL 3W0WD 3T2NH 2EKSB 1JHLL 4PJBB 1G9MH 5HPMA 3G5VB 3QBTB 5C0IA 3UCRA 3SBWA 3TESA 4QNPE 5J12C 3S36H 4WJ5A 5F7WC 4NN7B 4BSWA 4BKLA 3MSPA 2F8OA 1KFAL 4WIQA 4JRXB 2AKRB 2XWBA 4LPXA 4Y4HA 3VXRE 5CWSB 3I85A 3H9SE 4EI6A 1CYGA 2G2RB 3EYSH 1BQHG 2APBA 3LCYA 4CU7A 2RAMA 4E42B 3UJIH 2YMXH 4XC3H 2BVOB 4ZAKA 1KIUA 4M4PA 4NN7C 1ORQA 3H3PH 4W6XB 1BAFH 1JNLH 5DD5L 2R1XB 1CD1A 4OLXL 5TGBB 4AJ0A 3EHBC 5CJQH 5HSFA 5BS0D 4NM4H 4MD0A 5KVEL 4JHAL 5DQJA 4MGXA 1LK3H 1I7RB 2V9QA 5E5MA 3BKJL 5B38B 3S35L 4Y19D 1ZT1A 4F7CB 1N59A 1A4JB 5I1KL 5EC1B 1F3JB 4NWUH 2ZG3A 2PXYB 1XF4A 5IBTH 5GZOC 2APTA 2XWBB 3TNMA 4Y4HB 4O4YH 1R0AH 3AFLA 3ARFB 4HJ0D 1RZKL 4KJQC 3O3EA 2ATPB 1JGUL 1EX0A 3P0VH 4JDZA 3RZCC 2Z4QB 2VXSL 1NAMH 3HPLA 4HLJA 2IWGA 5FGBC 5KVDH 3FAXA 4RWYL 4ELMA 2BOCB 2PXYC 2OQJB 3X11B 4CJ0A 3VFTA 1WUNT 2YD5A 3DMMB 5E24E 1R3HA 1XF2A 2R2CA 2NCMA 4FFYH 1RUQH 2YA0A 1T20B 2AJUH 2VXVH 3FRUB 5E8NB 2G75A 5FHAL 3ULUE 5JO5A 4OFYA 4QRTA 4K7PH 4POZD 5DQJB 4QNPF 4RMQA 2AERT 5K9KB 4YEEA 4JFPA 1KN4L 4LVNC 3KS0H 4XNYL 3G6DL 1G6VK 3W39B 1RZIA 2Z93B 5E6YA 1VA9A 2XRAL 2J8OA 1WAAE 3NFNB 5D5ME 3W0WB 5ICYB 2OTWB 2BHUA 2DM3A 1JWUB 3DMMC 2YD8A 4YBLC 3NCYS 4Q9RL 1BBJB 4RCAA 4PB0L 4J3SA 3GRWL 4YBQC 1N3NA 2BSED 1QLFB 5LJYH 4HAFA 1IC4H 4JLRA 3P3YA 4ELMB 5JUEH 3PWLB 4Y19A 1F2QA 4KXZI 5IB5A 2FZ3B 2R0ZL 2NY4C 5EBLB 1PKQB 2CXKA 4DGYL 2OX5A 1MRFH 2J5LC 4OCLC 1KJ2B 2R0WL 3CNKA 5E56A 4HHAA 3TGXA 3ZLQC 2Y5TB 4BJLA 1OAQH 3WNLA 3FTGA 3UBXA 3PHOB 1R3KA 3DOSA 3FKUS 5F44A 5T3ZD 2X1OA 4F2MB 3EZ8A 3F12A 5FYLE 4FN0A 1NLDL 3WBDA 3QA3A 3QO0B 3OBAA 3VXUD 2XN9E 1V8HA 2V5SA 1ZSDA 5BS0B 3VH8B 1BQSA 2AQ3A 3IAQA 4JLRB 4D3CH 3RWJB 4UTAH 3M1BB 4Y19B 2AJXH 1C1EL 1U8MA 5HHXH 4YFLI 3ULUF 3C9NA 4HX1B 5T5FH 2KBGA 4HHAB 3SJVA 3ES6B 3VG0H 1SVCP 3U7AA 4ORZC 2ADJA 5F7DA 1HZHL 5HHNA 5FUCE 4LQFH 4TSCH 5I1AA 2VDLL 3EDJA 4LCCC 1X5LA 1WAAF 3NFSH 5D5MF 1DN2A 3P40A 3TBVB 4K8RH 2VDPH 4KGJA 5BQ7A 3F12B 2ESVE 3L5WA 1OCWL 1JGDA 5FYKU 4F58H 5JDSA 5I30H 3DI3B 1GHFH 3PL6D 5EOTA 5JORA 2HT3D 4WW2B 2PCPB 1S5IH 4HJ0C 3EDEA 4PRBA 3LKNA 4U1KB 1JNNL 1N5AA 2GSGB 3UTOA 3JUZA 3MLSL 4TQEH 5GS0D 1FFOA 2NLJA 3GMMB 1NGQL 3C5SB 4NZTH 2VSDA 1EAJA 1B6UA 1CE6A 5E2TL 3MRNB 1LEGA 4XPBL 3WO4B 4WFEE 3K8KA 3U46A 3TV3L 4WW2C 5I1AB 4POZC 5J6HA 5JLZA 4ODHH 5DS8B 1F4YL 4LCYA 2HFTA 3SKNA 3SKOB 1JGDB 5FYJL 5EB9A 1GAFL 2AQ2A 5HI4D 1CLZL 4R3SA 3JWDH 3OJVC 2I5YL 3TA3A 1A7RL 1KJVB 1H3WM 4K94C 5EIIA 1JGVL 3WO4C 2HN7B 1GIGL 3AREA 1V05A 5LGHH 1I7UB 4D9RD 2QL1A 4NO3B 3B3IA 4PTTA 4UV4H 4FQLL 5TPWH 2QQQA 4AK1A 3F8UB 2DRUA 1T0NB 1AR2A 5C6WH 4P3DA 1CI5A 3U46B 1CF8H 1E28A 3VXUB 1ZS8A 5JLZB 1KLUA 1NBYB 5F9JA 1UXSB 4YDLC 1RZJC 1HSBA 1LGVA 4LCYB 4M6NH 1MFEH 1R5VB 1Q1JH 3VRJA 5F7HA 3SKNB 4L4VA 1KLGB 2ADIA 4JY4A 2PO6C 5GHWH 4BH8A 1DN0B 3SE4A 3L3HB 3RDTD 3HNTH 1N2RB 3WNMA 4Z95H 4NKDA 5F1KC 5C0BD 1FRGH 4OTXL 5DK0B 3DGGB 3BZ4A 1CFNB 1U58A 3HC3H 2GJZA 3U9PH 2RBLA 3L3GA 4YDIH 4LCUA 2E7LA 4DZBB 3NPSB 2UZIL 4E41A 2AXGA 5HY9A 4Z7VE 1I85C 1CGSL 4IDLA 4V2BA 4L8SC 1MJJA 3N85H 1KTLA 2QQKL 1YNTA 3QFDA 5IOPA 4KTEH 1PW3A 1U8KB 2EICA 3EUUA 1JZ6A 4U0RB 4OCSH 1FCGA 5GSRA 3PL6B 1RUKH 4K9EC 2UVEA 1FYTE 1HSBB 5CBAB 5GSVB 3W5NA 2E7HA 2DQUH 1TJHH 5BO1H 5IKCB 3BHBA 1OARH 2MPAH 4ODSH 4X80L 4KXZH 3NPSC 4ZOBA 1NDGA 1XH3B 5KSAD 3WEXA 4HUXA 1ADQA 3RWEB 1U58B 3SKUD 1RJCA 2G9HB 4U0RC 5LQBH 1MVUB 3L3GB 3PL6C 4X6CB 5DJXA 1DANT 1QR4A 4HF5H 2YXFA 4LCUB 1O7VA 3WYRA 5M95B 4ZUVA 3OKLA 4KVCL 1XCTA 4S1RH 3B2VH 4G9DA 3ZE1E 1MHHA 4MMZC 1X5AA 4WI8A 4NQDD 3T65A 3OX8A 4HS8H 5GS0C 1J0ZA 1FORH 4G7VL 2JJTA 2KQNA 3NBNA 2GTWA 1YYLL 3MRPB 4G8IA 4P4KD 2EDFA 3I9GH 3S7GA 3CDGA 3CXHJ 4OLYL 4U31A 5KS9B 1NMAL 1DANU 4AYFA 3TCLB 4HFWA 2OS7A 2D2OA 1QPXA 3NIDE 2R2BB 2X4TA 2WUCH 1A7QL 5I2IB 3MRMB 1W8NA 4W68A 5IFHL 1N4XL 2GITB 3PQYE 2Z92B 3P9MA 4D9QE 4AG4L 5E2VH 3NPZB 3O4OC 1QSEA 3BD3A 4OFIA 4PJCB 4Z7VF 3D85D 1PZ5B 1N0XL 1N8ZA 2EXYD 4MLIA 1MCKA 5MHSD 2VZ1A 3V2AR 1SEQH 3RDTB 3DO3A 2Z8VC 3UEZA 2AV1A 3EO9H 1YEGL 3FFCA 1MAJA 1RD6A 5C0BB 1CG9B 1XGRA 2EEDA 3CLEH 2O5ZH 1DBBL 4Z7WE 3RX7A 2IFGA 3QFJA 5KSAA 4PTUB 5F72S 1BVZA 5DD3L 3P4MA 3OAYK 1J12A 3DETD 4CBPA 4DVRH 2DQEH 5IHUH 5ICZB 3EYQC 3CFDA 4JQVA 2OTUB 3OG6B 1A7OH 1A1OA 5T3XE 1Q0XL 1RUAH 1HOCB 4L3EE 2QQLH 5ENWA 3GHEH 2ZCHH 2GI7A 2DQGL 3RHWF 4EJ1C 1U95B 2D3VA 1W72L 2O5XH 1AGBB 3HN3A 4X7DC 1UZ8A 4NNYB 5CD3B 4P4KA 2EDKA 2VLRA 5C2BH 5E4IA 5I66B 2Z0BA 4R7NB 1KJ2L 2ZNWA 5KSAB 5FYKD 3SDYL 3KLAA 2NY5H 1ZLUK 3MREB 1YNKH 1EO5A 1L0QA 4PJGA 4Z9KB 3C08L 3V6OA 1X6LA 5JQ6H 4I77H 4S1DD 3CFDB 3WJJA 3NIDF 4HGKC 4HLZG 3UTPE 3W11D 1QEWA 1XIWA 2K7PA 1QSFE 4AEEA 3IDMA 4ISVA 4NQDB 4LLVA 5ENWB 5FYLH 2B39A 2ICES 4M5YH 1OAXH 3KG5A 4MA7H 1LO3L 5K9OA 5E9DE 3SGDI 4P4KB 3T0ED 2AQ1A 4UNUA 4ODWA 3BPCA 1NAKL 4PRID 2YN3A 3PHQB 3L7FB 1ZVSA 1WBYA 4FZ8H 4QLRA 3EOTH 4Z7WF 1RZ7H 1MH5A 5AG9A 3S3JA 4M6ML 1DLHB 5J1AB 1FNSH 3NZ8B 3ET9F 4N90D 2A9ML 2BVYA 3C8KB 2R23B 4U1NA 5I75C 3CFJA 3VXSD 5DJ0A 5ACZA 3D85B 2HJKB 1QP1A 2R39A 4LLVB 1NUFA 1CVSC 5BZWB 1CTOA 3ALXA 5EBGA 1RMFH 4H20H 1ZE3C 4N68A 1P4BH 4JY5H 1I1FB 3HE7D 4RIRA 3MUGB 1GGYA 1X5YA 2HH0L 3BPCB 3L5IA 4NKOB 3MJ7A 1YN7A 4JY6A 4MAYD 4YHPA 5GRYA 2ADGB 3UYPA 3B9DA 4K94L 1YJDC 2ICCA 4B50A 4I48B 5E8OA 5ERWB 5EOQL 3L3JB 4IRSA 4WDIA 1JGLL 2V17H 2BY0A 5GGTA 4U1NB 1YEJH 4FQXD 1C16A 2WMPA 3AY4A 3IYLW 2VXUH 4FZEH 3T0EA 1I3VA 4WGVB 1UQSB 2FRGP 4G8GA 1TLKA 5DGQA 2LVEA 1H5BA 4G80A 3U36B 3O6FA 1RZJL 4MQ7A 3W2DL 3O0RL 4A6YB 3H3BC 4LPUA 5HXMA 5BRZE 3AXLB 3LKOA 1JFQL 2P44B 1YN7B 2Y06H 1NBQA 4HMEA 2DLEA 3P0YH 4JJ5A 5IB4A 4I9WE 1IAKB 4QHMA 2KUTA 4JFDA 4NJ9L 3CFIC 3U4EB 4M7KL 5FKPB 4HWBL 1U8HA 2RFXA 4AEIL 3BP5A 3UPRB 4LIQL 5E8OB 4LRNH 4PJ9D 5IIEA 1LP9A 1T80A 1A2YB 3MLVH 4EOWL 5INDB 4RAUA 2OK0H 3HAEH 1W0VB 4HD9A 4NC1C 4AT6A 3T0EB 2R9HD 4LF3B 5DJ6A 2DL2A 5FV2A 3LEVH 1EEQA 2Q1EA 5C0DA 1JI1A 4LP5A 4S1DC 4U1GB 5L8LB 2IH3A 4PRIB 3W5MA 4K9EL 3VXOB 3W11C 2Q87A 3KJ6L 3J7HA 3PWJA 4JREB 1Q0YH 1AJ7H 2HLFC 4U1MB 4LLDB 1KEMH 1S7TA 2ZJSL 1UXWA 5EZLB 3IDNB 3SGKC 4XCEB 8FABA 3KPSD 4S1SL 4OV6F 3QULB 3VXSB 4WTXA 4RGND 3CFEB 1CXIA 1T21A 3F7PC 4TUKH 5DWUL 5IIEB 1QA9A 1B4RA 4RAUB 4C54A 4RA0C 3VA6A 1FE8H 4GKNB 3CDCA 4XNZB 4JREC 4Z7UE 4HK3J 3HE7B 5D2NE 2MMXA 4WY7H 4M61A 2VWEE 1S7WB 3SDCD 4JM4H 4Y88A 3AS1A 2IGFH 3MLUL 5GS0L 2IH3B 5C0AD 1FNGA 4JDTH 1QLEH 4MAYB 4HCRL 2DQCL 5AWNH 1KB5L 2WBWB 3BEWA 4KRNA 1ZHKB 3WXVH 1W8OA 1NQBA 2VRAA 4NZRH 4R26L 4XNQA 1BREA 4YXHL 4FQXB 4FFWD 1MQKH 2QTEA 5B3NA 3HE7C 3IFOB 3O3AA 4HXBH 2ZUWA 3FQNB 4NQCE 2FD6H 3P4LA 4OD1H 4LGRB 5DUBA 3BKYL 4F7PA 1KEGL 2F19L 1G6RA 5CFHA 3T4YB 3MLZH 1VDGA 5HI5D 5IVOA 3WS6A 3CC5B 1J1XH 3FHQA 3A67H 3S37L 1CICA 3TPUA 1RIHH 1MLCB 4M61B 1LHZA 4AIXA 3I6GA 2E6PA 2ICWJ 4FQXC 5C08D 1ZMYA 5K59E 1FZKB 2P49B 1RHHA 5DRXA 4OF0A 3WN5A 4PJ9B 1HINL 1JBJA 4ZOCA 3GSRA 3BIBX 3LQAH 4DQOH 5CEZL 4I4WA 3FL7A 2VLJD 4HGMA 4HIJA 5DZOA 3UTTE 1MI5A 2CK2A 2NY6D 5DUBB 2WBJA 4OZFB 3DUUA 1FAKT 2PW2B 2QADD 5ETUA 5DF0A 4L4TD 5MEND 3VXMD 5KG9A 2CO6B 3PWPA 3IDXL 3F5WA 3TPUB 5DJ8B 1TNMA 5LBSL 1BD2D 4PJ9C 3DSFH 1ZEAH 2Q76B 3C6LC 3ZKMD 3P77A 1U6AH 5DA4A 3KPSB 3OGCB 4R6UA 4N1EA 1MCWM 4WUUA 5HVGB 4RGNB 2R9HC 25C8H 1RY7B 2X42A 4P48A 1CT8A 3U82B 2DLFH 5ADOH 1VENA 1YEKL 2EDDA 3GHBL 4AM0B 3GSRB 3NTCH 3ZMRA 3NACH 4CN1A 4X6DE 4ZPTA 3IDJB 4HIJB 3V79C 2IAMD 2ZPKL 3TWCL 2KQMA 1RK0B 1LVEA 5DJYB 4NKQB 1PG7X 2XTJE 3DXAA 3SDCB 5ILTH 3GSNL 5C0AB 4XP9L 4K3HA 3HNSL 1UH2A 5E8EB 5H35B 5ELIA 5FUZL 5KSBB 3MRRB 1FO0B 2XXCB 1JHTB 2VLMD 3GMLA 2V9TA 2QR0B 2UZYB 1PEWA 3D48R 3W9EB 3TFKD 1W0YT 1CFSA 5K59F 3D39E 5F96H 2VLKD 3QRFM 1KULA 3SDCC 1KCSH 2OXGA 3C2AH 3BISA 4KJPD 4HLZH 2VYRE 1UKSA 5CMAB 5MENA 5F7EH 1AQDB 1MCPH 1UZ6E 1CXFA 2YD6A 3GJFH 3K4DA 4P2CG 5IR1B 4NNXA 1QNZL 4FFWC 5C08B 2R29L 3CZJA 1OSZB 3G08A 4AQOA 5AD0A 2GY5A 5LCVH 1MHPL 1HDMA 3MBED 1FNHA 3U83A 5I6XB 3SDXB 1ZT7B 3GMLB 2Y36H 5GGVH 1A6PA 5JW4M 2CDEB 1U8OA 2I26N 3FO2B 1CFSB 2VLJB 3OKEB 1M05B 4PGEB 4HIXH 2NY6B 1YJDL 3D9AL 3KXFA 4RMWA 2QADB 4OZIB 2HT2D 1HWGB 4NDMB 4L4TB 5MENB 3VXMB 1BOYA 3JV6B 1N7ML 4OZGA 1IILE 3HFML 5I6XC 3G5ZB 1IGFH 1BD2B 4K3EL 5F9AC 1JF6A 1A3LL 1IGIH 2CRMA 1ZLWH 3QH3A 3G08B 4XPGL 1S7QB 5JPMB 5IMLA 3RTQC 3MO1B 3M8OH 2NY6C 4LCWE 1G0XA 3MRFB 5HGBA 4D0BB 4YWGL 2QADC 1IEAA 1K8IB 2MKWA 3QCTL 4PJ7A 3LEXB 3LKPA 4GOSA 2R69L 4O58L 3FB6A 2IAMB 4YAQB 3VFGH 2XWTB 1NEZB 5L2KA 5SX5H 3F7VA 1RIVH 4GSDH 2D7OA 3I3DA 1IC1A 2BVQA 5FYKL 2CO7B 4NM8L 4HIHB 4JN1H 4IDJH 5A40E 4OZGB 5C6TL 4Y2DD 2EEBA 2GJ6D 4I18C 3OAZH 4NPYB 5D7KD 1UENA 2QJDA 5I8KL 1CDBA 5D7JA 1UCBH 3E0GA 5E7FA 1V3LA 1UZ6F 3CVHH 3L5XH 2B2XH 1T7WA 4P3CH 3OWEA 1WIOA 1T1WA 2J8HA 5CSZA 1NDMA 2IAMC 1A47A 4FTVE 2VLKB 4P59L 1A22B 1MRCL 5IEKA 1GGIL 1FJ1A 3IFLH 1LO2L 4L9LB 5AZ2H 3U30B 2Q7YA 1LMKA 5EU6D 3FB6B 5IJVB 2ZUSA 5JOFB 4S2SA 3R1GL 1BP3B 3SOBH 2MNUA 1N0LA 2YPLD 3G6JE 3MXWH 1T0PB 2BVQB 1FNEB 4OLUH 4K3GA 1MCDA 3JZ7A 4G6MH 2P42B 5GS1A 5JXAL 4NO2B 1AH1A 1M1SA 3MBEB 4L9LC 4PJAA 5FA3A 3LV3A 3U30C 2BVPA 4JFOB 1D5BB 4Y4FD 5GS3A 1Z6JT 4U7MA 3TN0C 3BGFC 4FQJL 1F11A 1LO4H 1OF2B 3LQZA 1ETZA 5I76B 1FJ1B 3NFPA 4FMFA 3OZ9L 1RJYB 4GMTH 1GRWA 4JQXC 3OKMA 4HSQA 3BN9C 5C09D 4HK0B 2Z8SA 4JG1L 1AGDA 1NMBH 3UZVB 5B8CB 2BFVL 3MBEC 1QLRB 4KVNH 4GW4A 4WI3A 2W07A 3U2SA 3MROB 1KOAA 1M6OA 4N8VB 3RL1B 1ZWIB 1AD0B 1ITBB 2ZG1A 4IHOA 4RNRB 3Q3GB 2R4RH 1S7UA 1NC4A 4GRWE 4D9LH 5EBWB 9CGTA 2GAZB 4X98B 2HFFA 1IGCH 3CXDL 4LLQB 5TH2B 1DVFD 2HT2C 3X3GH 1XF5B 2H41A 4Y4KA 4PB9H 4QYOA 2VZ3A 3TH2T 1WICA 4M7LH 3DECA 4H5SB 3NFPB 1NGPH 1J10A 3SKMB 3HPJA 4HG4K 43C9B 4JGMA 2YPLA 4U6TA 4XP4L 3GI8L 4NQXB 4F57L 5I1EH 4XP1H 2HJFA 4HT1L 4Y2DB 4XAKD 1VGKA 2GJ6B 4DN4H 3CU7A 3WD5H 5EZOL 4AMKH 3U2SB 2OP4L 1V3KA 5EORL 2Q8AH 4P2RD 3PNWB 1WBXB 2JTDA 3G6JF 3STZB 5GJSH 3FQWA 3LKRB 2Q6WA 3ARDA 1D6EA 5TDPB 1F02I 2R0KH 1S7UB 5GIRA 3VGHA 1XZ0B 2DD8L 4KDVA 1G0YR 5I73B 3RVVC 4WO4A 4NQSA 4LSUH 4KMTH 1KCUL 1JV5B 2H2SD 4ZFOB 2LFGA 5EU6B 2KKQA 3D0VA 1MFAL 4NYLB 5EZJB 4YHML 3VCLB 2YPLB 4Q97A 4H0IA 2P5ED 2YK1H 1MWAB 5IFJA 2XFXA 3WIHH 1FL6A 3U6RB 1T89A 3JVGA 1UWGH 5DJZB 5GISH 3W0WE 4OCYH 4WI2A 4WV1A 1UM4L 2BZDA 1UWXK 1DVFA 4QKXB 3WV0A 4XH2A 2Q6WB 4WHTB 4Y4FB 1D6EB 4HUNB 2G5BA 3MLWL 5EWIL 2QSVA 5GIRB 1YPZB 5TF0A 4K23H 4KTDH 3TNNB 4GRWF 1F4WL 1HXYA 4JO3H 3DO7B 2H26B 5E99H 1J11A 4ELME 1FLTX 3HG1D 4YHLL 4XVTH 1DFBH 4FQ2L 5C09B 1CE1H 4KI5D 1PKQE 4MJ2A 2R4SL 4NKIH 3D69B 2P8LA 4PUBL 3MCG1 3ZT7A 3BH8A 4BZ1H 4UT7H 3Q6GL 3RZCA 4QRSA 4HJGA 2IBZY 5ECJE 5TFSH 1M7IB 1FQ9C 4PPTA 1NUDA 3MODL 2ZG2A 1IGJB 4JO4H 3RWFA 2CDGB 1FO0L 5DK2A 3QDGD 1JWMB 2D03H 4QXTB 4YE4H 3TIDB 4XVSL 1DVFB 2CGRH 4IRJD 3O6KH 1C7SA 1DBAH 2VH5L 4X0KB 4U1JB 1DDHB 5I1IL 4ZUSA 4Y19E 3GJEA 1ZGLA 3ZDYE 4BH7B 3O2DH 2GKIA 1TETH 4OLWL 2X1XR 3WS3A 2FGWL 4PJXA 3S4SA 1UT9A 1EHXA 5DEFA 4UT9L 4P2RB 4BELD 1F90H 3G5YA 3K8LA 5DT1H 2FEDD 5CGYD 3T77A 4MZ3A 1I3RA 5MI0C 2VZUA 3DSNA 3GMQA 1MY5A 1GGUA 1HIMH 1EJ6A 1PYWB 3WFCL 5I18H 3H9ZA 3F6IA 1EO7A 4RDQF 2CIKA 1UJ3B 5GRXG 3GKZA 5DR5H 1KYOJ 1DQLH 4RFEA 1XGQA 1L9MA 4RRPA 4WTZG 5E00A 2MSPA 3EJZD 4NP4L 3MYZA 1KJMA 4XPTH 5HYQA 1MEXL 3GJEB 4NOFA 1VACB 4ODBD 4ELMF 5FUOH 2P5EB 5JMRA 5HGAA 1H9VA 3HI6H 3KPOA 4G9FA 3QZWG 3WS3B 3BPNB 2FDBP 5LGJB 3B4NA 3QDGA 2AW2A 1UJ3C 3UTQA 2B4CH 3SJVE 3BSZL 15C8L 2DI7A 5EUKA 3ZE2E 5EN2B 3U4BL 1KTDA 5GS2H 4WNQB 3G04B 3GMQB 2DI9A 4LSVH 3QQNA 1MF2H 5I8OH 2V2WB 3VFMB 3VXTB 1HHHA 2R1YA 5JHDD 5HGGS 5KAQF 4CAGA 4NZUH 5IBLD 2OL3H 2FX9L 3HG1B 3IDGA 2VKWA 1FYHB 3DYPA 1FIEA 3BPNC 1CD9B 5ANMB 5C0ND 1IGYB 3V6ZB 3BE1H 1IKFL 5I8EA 5A3ID 5LXGH 1I9IL 5FO8A 3F7YB 4L3CA 3ZDYF 4BSVB 3VWKD 3KPOB 4DTGL 4LCCA 2FX7H 5JXED 2D0HA 1OB1A 1NKOA 1BWMA 3QDGB 1VPOH 1J05A 1RU9H 3FO9A 2Y07L 1AGEA 3HC0A 2BDNL 3BH9B 1JYVA 5EUKB 1KTDB 4JFYA 4IRJB 3QIUD 3BZFA 4XMKH 4P23D 2AVGA 4U6YA 4H1LA 1G7HB 5DZNA 3FQRA 3LEYH 4TVPE 1QFWM 4LPCA 4ZFFA 3WSQL 1KSRA 4NCC2 1T83C 2X09A 2ZCLH 2NW2A 3DX8A 4ZO9A 3CVIH 1E6OH 2YSSA 5C1MB 2N7AA 4ODTL 4HBQA 5AZEH 1JPGA 5I8EB 4ZFZB 3P30H 1I9EA 2DMBA 3AU1A 2IPTL 3GMOA 5D7IB 1YEDB 4DW2L 3QAZB 5LWYL 3ZYZA 2D7QA 1OOAA 1I7ZA 1PG7H 4PJEA 3WIIL 4JFYB 4O2EB 2ZKHH 3ZE2F 1YEIH 1KB9J 4I0PC 2NR6C 3MCLH 1WGOA 2OZ4L 1KXQE 3QWQB 1D5ZA 1R6VA 1S7XB 4L4VE 3QEHA 3EOYG 5KBNC 2D31B 3NZHH 2NW2B 4PJ8C 4EQ2A 1ZHLA 4JPVH 4UIMB 4JM2D 3QPXL 1U0QA 4YO0A 1T3FA 4PG9B 1OGAA 1Y6NR 1FCCA 4K7PY 1CZ8H 1DEDA 1YMMD 4FP8H 1QFUL 1KCRH 3EJZC 4X9IA 5ITBL 3CCHB 3MCKA 4GRWH 1OQOA 5DHVA 4E41E 2O26U 3DGCR 1Y0LA 2DQDL 5JHDB 3KPLA 1F8TL 1A7NL 1OPGL 4PJEB 3H6JA 3OHXA 1FVDB 2DDQL 3IFNH 3J8F7 2MCG1 4MD4B 4K71B 4D0CA 5D1ZA 1VFAA 2EYRB 1LDPL 5FV1L 2BX5A 3B9KD 4APQD 1REIA 1NGXB 4E5XB 4HWBA 3CX5J 4R0LB 4JKKA 4EXKA 5EPMA 1TJIH 3QEHB 1S7RB 5DRWB 4HMDA 3VWKB 2C7UA 4YO0B 2X89D 3SGJC 3IKCA 5KZCD 4XP6H 5HYFA 5I1DB 4KWUA 1SY6L 3GIVB 1QYGL 3RIAK 4K71C 3LPGA 4KPHL 4LNRB 1V7MH 1NCCL 4NRYA 4ETYA 4NRZA 2ADFH 1GZPA 3QIUB 3WKML 5DHVB 4P23B 1RURL 4R0LC 2R8SL 2WV3A 4PJCE 2PYFA 3V6FB 4ZFOL 4Y5XB 2DJ4A 3VWKC 5HYEA 1A0QL 3ZDZF 3OJDB 4EUPG 1OHQA 2F53A 2D0GA 1J8HD 1LEKB 1EO8L 1DBJL 3LDBB 4PLKD 3PP3K 1NCBH 5T1LA 5C0FA 4FXKA 3IDUA 3GMRA 5IJKA 1MWAL 1TZIB 1NGYB 4IM8A 5D6CB 2LVCA 1MLBB 1N6VA 4MX7A 1AO7D 4X4YA 1A6VH 4JZOA 2NW3B 4XP5L 1FG2B 3KLHC 2AEWA 4M7JH 5E0QA 1DQJB 2Z91A 1L6ZA 4LVHC 4Y5XC 2GT9B 5FKAB 4UDTB 4YPJA 4NRYB 1NFDB 1JUFB 1GZPB 1RULH 4XCYB 3LDBC 4RAVB 4F33A 1BHGA 4FG6D 1S7VA 2EDJA 2AK1H 1KB5A 4DFIA 2M8XA 4RSVA 3UC0L 1QSEE 4GAYA 4O5LL 1OP5K 3D0LB 3FZUD 4KUZH 4KUCD 1U8JB 5HHVL 2FJFA 2VL5B 3ARGD 4FFVD 1PAMA 3P4OA 3KHQA 4YK4C 3P4NB 4JM2B 2XXMB 4R7DA 3CFCL 3B83A 3S98A 4H8WH 3FFCE 3MV11 4HGWA 5DMIL 4S1QH 5EFIB 1CXKA 3QFJE 4GAGL 1YMMB 3TYGH 3FMGH 5KOMC 1M7DA 3E3QC 3I3BA 3DRQA 3K81A 4X4YB 3ZKXB 1FL5B 4JZOB 3ULSB 2RIKA 1Y18A 3NCJL 3FN0L 5F9WB 4UTBH 1T2JA 1U8NB 5C6PB 1IKNC 1FBIL 2J7LA 2BSRA 4JZNA 4IJ3B 3PF2A 4UQ3B 4JPIA 1IBGH 4JM2C 1DR9A 4OGZA 2QHRH 2VOTA 3B9KB 1U8QA 4APQB 5K93A 4Z8FH 3QUYA 2YXMA 3MLRH 1EEZB 4PJCF 2FJFB 3H7BA 4G43B 5F9WC 2VLRE 4R7DB 4XB8A 4ZFGL 3LRHA 4HGWB 4FQHB 4PR5A 3QEQD 3LHPH 5KZCB 3KLSA 4AEFA 2EYTA 4IJ3C 1Q9KA 3SDDA 2GFBA 5F93C 2J6EH 2H32H 4PJGE 3DRQB 4MWFB 4OCWH 5L2JA 1MPAH 3B9KC 3C5ZD 3V6OE 1HE7A 4APQC 3O9WD 4KY1L 5CEXA 1S7SA 2AJZB 2HAZA 4GRLA 5D7LA 2OI9B 3ETBF 1NCTA 2EIDA 4JJHA 4UNVA 3P73B 2OSLA 3SCMC 5MHSE 4R4BB 3QQ9D 4F7EB 1MIEL 3WNPA 3OTTA 1J8HB 3EYVA 3O2WH 2XPGB 1FVCB 1D5XA 5D93B 4QHLB 3FN3A 4WUKL 4PRNB 1VFBB 5I1CH 4F37K 1AO7B 3CPLA 3QEGL 2OI9C 3QXAA 4OBSA 1IEHA 1JTPA 4LSDA 2GJJA 1Q9KB 3PV6B 2GFBB 1K4CA 1J7VR 1INEL 3LPWA 1AI1H 1UH4A 2A77L 1S7SB 4PLKC 3OMZA 5D93C 4GFTB 3SE9L 3HRZA 3LRSA 3UAJD 4KK5D 3ULVC 1KGCE 5HYSG 1YQ2A 3W81A 3CFKA 1MHCA 1IAIL 4ALAL 3EOBA 5H8DA 3VFWA 1BOGA 3ARGB 1UYWL 4PGDB 5AUMA 2DYPD 3GIZH 4WHCA 5IROC 2A9NH 2DIAA 3QEQA 4RQQA 3FO0L 1NAMA 4M5ZL 4ELKA 1X5IA 5EH1A 3O81A 2MCPL 4G6KH 3C5ZA 4CVXA 3R06A 3M17B 4LLYA 5BV7C 5KOVC 4OM1H 5D1QD 3EO0B 3FZUC 3PGDB 5FO9B 3ZL4H 2AABL 3OKOA 2P7TB 1MIMH 4KMLB 3BKCH 4FFVC 4PJGF 1U3HC 3T1FA 1BEYH 5AYUL 3VE0B 3I2CH 3QEUA 5ADPL 1MFDL 2BHYA 3FQTB 4LSQH 3QI9A 4WEMB 5DHYA 3T0EE 2ICWA 3O6ML 3QWRA 1NCAH 4G3YL 4G8GE 4FQQB 1XGTA 5JR1H 3QEQB 5BVJA 1NAMB 4DUVA 3N0PB 4UU9A 5E8DH 2AEPL 4IRZL 4ONFL 3F6LA 1HKLL 3C5ZB 1HHIB 1JK8B 3UO1L 3O9WB 4N90E 4LLYB 3GSQB 2NY7H 3INUH 3GSUB 4U6XA 5L6YH 4JFDE 4XAWH 5CILL 4ZTOL 1JGEB 3H9HB 4RFNC 1P7QD 3FO1A 5KVMC 4HIEA 2WWKO 5GRJL 3BI9X 4MD5B 1ZKAA 3H2WA 3S35X 3OKKA 1G7IA 2ICWB 3O9WC 4NO0D 3HC4H 1CGYA 1XGTB 5FHBL 2UYLB 1KV3A 1PX4A 1F5WA 1L4IA 4HEME 2VLLA 4LEOA 1VEPA 4JR9H 4KJYA 2DBJA 3JTTB 3SY0B 3I02B 4Z7OE 4Q6IA 2XQYK 4XC1H 3MXVH 5SV3A 3MRBB 4OCRH 2BSSA 1JN6B 1I4FA 3BP7A 4G8EA 4X9GA 3FO1B 4B41A 1NGZA 1T0MB 1R5WA 2EE9A 4YHNB 2DYPB 2K7QA 4NNPH 4EXPX 1ONQB 4OGXL 3O3DB 2EXWD 4Y16D 5E1AB 4LSRH 2YBRB 4PP1C 4JPWH 4PV8A 3TBSA 3RWIA 3UAJC 1EAPB 4U1HA 4KK5C 4G42B 2VLLB 4LEOB 1QO3B 4HAGA 3D25B 5D1QB 4OI8A 2PTUA 4NUGH 2CRZA 1PFCA 4IOFD 3F58H 5IK3B 1P7QA 1KG0A 4YXKL 1U93B 2O5YL 3BESR 3RBSA 5HGHB 4GXUM 3U7WL 2PTTA 3D18A 4WI5A 4MJ6B 2DQTH 1OW0C 2EC8A 3BP7B 4FNLH 3LRGA 3WIFB 3FB8B 4U0QB 3I84A 4OI9A 2G5RA 4LHUA 4NO0A 5D9SB 2OJEA 5KJRL 4YIQA 5D1QC 4P46C 1BIIA 1JYNA 2CIIB 4M8QB 4EUPH 3OKDB 3HZVA 3R8BB 2JELL 1KIRB 2E6QA 1MHEB 1I1YA 3DV6A 1FGNL 3QRGL 1JRHH 3TBSB 3DLQR 3NIGE 1B0RA 3T8XA 5DQDL 1PY4A 4I5BB 4R4FH 3V4UL 2VR9A 1P7QB 3LVEA 2A73A 4Z7OF 4NKMA 4BQ9A 4MDJA 1T04A 2XA3A 4JQIL 1TCRA 2AJYL 1PQZA 4CMMA 4KHTH 4MAUH 1J5OL 4LL9A 2OM5A 2VUOA 4P57A 5EC2B 3VXRD 4Y16A 3HKFA 4YFDB 1WTLA 4NO0B 1NCWH 4OJFH 3B8SA 4CL7A 3MLXL 1EBPA 3GGWA 3PWPE 1S9XA 2V5TA 4J2XA 1J1OL 5KSBE 5FCUL 4PG2C 4HWUA 4YHZH 3QT2A 4ZS7L 3DV6B 2VN7A 2HG5B 3LOWA 3TJHD 3V8CA 4XZUB 3FN9A 4MZ2A 1BZ9A 4WUUE 3BMVA 4GMSL 3ARBD 2R1WA 4JO1H 4HK3N 4OF6A 5J6GA 1K2DB 5D70H 3SO5A 4N9OB 3KR3L 4Y16B 1QVOA 3HMXH 5C71A 5B39A 2JJWA 3C6LA 3QNYB 3DXAE 5F1NB 4YHYC 2BERA 2H6PB 3ISWA 4NHUB 1OAKL 4OB5L 4M9OA 4RFOH 5EU5A 5DQ9B 3BW9A 2VC2L 3UTSA 3VXNB 4JVUA 3STLB 4AH2A 3MRCB 3MRKA 2AGJL 1CN4A 3JTSB 5IBUG 3TPKA 1NMCB 2GUOA 2VDOL 2CD0A 2AV7A 2ZSVA 3NIGF 4RMUA 3H42H 1UCTA 3ULUD 5F70A 1C08A 3N50A 4HH8A 1K6QH 1CWVA 4QCIB 5J6GB 1JPFB 3RI5F 3CSPA 3AB0B 5MENE 3ARRA 3IXTA 2VDRL 4IOFC 3ULVL 5I1HL 1BQHA 1HYSD 5K9JH 4ZS6D 1R0AL 1HCVA 3MZGB 2YZ1A 1K8DB 3MRJA 4MB4A 4LLWA 1KCLA 4WEBH 4TULL 1DUYA 1GVIA 3BDXA 3FAWA 3SE8L 4YDKH 1ZGLM 4FXGA 3RWHA 1HILB 3U7YL 5KSBF 4CMHC 4M00A 2AV7B 5IB3A 3IJYA 3JV4A 5BV7L 3QHFL 5C3TA 4IOIA 4RX4D 1IQWH 2DWEA 1NFIA 2QSCH 2VERN 4LBEB 3VXRB 4OLZH 4HKXB 2VE6B 3KPRA 3KXFE 5FAAA 5C70A 1GL4B 3LN5A 5E2WH 4XXDB 5BMFL 1I3GH 4PJDA 4OZGE 2YUVA 5A16B 5F9OH 1DLFL 3IAGC 1UM5H 4DCQB 3H3PL 3REWB 4OV5A 4JEGB 3TO2A 4PYHA 3T0XA 4U7KA 2IALB 4QTIL 5FYLD 3GDBA 2W65B 2Y7QB 2LV4A 2HTLD 2BSTA 2EE2A 2B20A 3LIZH 4FQCL 5MEOB 4DOHE 2EECA 4J7RA 3M07A 3KDMA 2X4RA 3ARBB 4PREA 5DUPL 4Y8DC 3RX5A 1UA6H 4PJ7E 4HPYL 1II4E 3IJYB 5D7SL 5GGTH 5TJWK 3WNOA 1VESA 1N64L 4BK4A 4JCMA 1BJ1H 2UWEB 5L2KE 3TJHC 2W59A 2X70B 5F9DC 3RY6C 1WITA 4LLMA 3RTQA 3QISA 4PJDB 1LEIA 1UM6H 3IU3B 3L3DA 5CIPB 4K3JL 1A21A 3ARBC 1TZGL 3BP4A 4OV5B 2ZSWA 4YX2L 2ESVD 2AJUL 1FGVH 1RIUH 5L7XL 4C55A 2ZCKH 5KN5B 1RZFH 5CHNA 1LE5B 4YDJA 3QUKB 2KZWA 3P11L 2DI8A 2D4FA 1CDGA 5GQBA 3MV8A 4I18A 1BGXL 3SO3B 4DFHA 5TE4H 4O02H 5BW7A 4NN5C 1V3JA 2IADA 1KBGL 5D5MB 4P9HH 2FR4A 5EU4A 3CMOL 2EDYA 2A74A 5DLML 3MQIA 5AG8A 3ULUC 4NHCL 4P5TC 1TNNA 2AEIT 2BMKB 4OZGF 3K3QA 1S5HB 4O51B 4PJAE 1OSPH 1T1ZB 2ATKA 4XI5D 1FVEA 1H3XA 1DBMH 4DVBB 3S88L 3QUXD 3W9DB 3JWOH 1AD9B 4MQSB 1HYSC 1NCNA 1FDLH 4C56A 5ISZA 2AXHA 2F5BL 3LN4A 2J4WL 4JPKL 3HLAB 1HHKB 2FBJH 4PJ7F 2V7HA 1Z9MA 2XICA 1ORSA 1VGEH 3ARTA 4KAQL 4OLVH 1G9NH 4UB0L 5D7KE 3HCVA 4J3TA 1L7TL 4QOKA 4LEXL 3BPOC 4I3SH 1IL1B 2APVA 3L3OB 4YGAB 2X4QB 1JHKH 3NABL 3LMJL 1YC7A 2WK2A 2P24B 2L7UA 2I9TB 4LU5L 2NY1D 1T03L 4N5EC 1WFUA 1YUHB 4PGBA 4TNWF 5CEYB 5ALBL 2J2ZA 3BMWA 3UYRL 2A83A 3QSKB 2XNAB 3GMNB 2YPLE 5FB8A 1QD0A 1G6RH 5C0CD 2WUBL 3FB7A 1QBAA 1WBZB 1A1NB 3MFFA 5IFAH 1EH9A 5ESVB 1WT5A 3L95A 3MJ8A 2DQJH 1EEUA 2I60H 5HHPA 2E9WA 3ESVF 2CUMA 3QQ3B 4KHXH 2ESVB 4RISL 1AE6H 4YNYB 2ARJQ 3IU4H 3WLWD 1FYTD 5I1GH 1AXTL 4J8RA 4W6YB 3QXDA 4PJAF 5I16A 3DRTA 3TT1L 5GGVY 4HC1H 3WHXB 1RFDH 1UVQA 3THML 2FNBA 4KK8D 4V1DA 4PGCB 4TPRL 1B2WH 1N6UA 3QDHA 3UPAA 1JHLH 1LWRA 1VKXA 1U91A 1D7FA 3BWAA 3MBXL 3MNZB 4EVNA 2EKJA 2CR3A 1SJVA 4EI5D 1NJ9B 1H3UA 1MJUL 1X5XA 2FYYB 3AAZB 1KFAH 4OGYL 4KJWC 4MQXC 5SWSA 3QUXB 4U6HB 2VDKL 4C59B 1SY6A 4LLUB 1E6JL 1EJOL 1UH3A 5E5UB 1HSAB 5GGQL 4V2CB 4GT7A 1X5GA 4DN3L 1UB5B 1DJSA 2CJUL 4TUJA 5DI8B 5HHMD 3EGSA 3OB8A 4EEEA 5IHBA 2CLZA 3VFOA 2FJGA 5F7FA 3EO1A 4P49A 3U9UB 4XI5C 3EYOA 5DD5H 5B38G 3BWAB 5EU7E 4DGIL 4MCYA 4OLXH 3PQYD 3ZKND 5KVEH 4D9QD 5C0GB 4JHAH 3PDOA 1FZJB 3G5XA 1GC1C 4GKSA 3BKJH 3HAEB 4X5LA 3S35H 3G6AB 5I1KH 3IS0X 1CFVL 2X4OA 2NY1B 1E4JA 3QDAA 5DJAA 4EDXB 5DRZB 2HMIC 2OXHA 3NH7L 3DBXA 3HNTL 2OCFD 4Z95L 2EDTA 3MJ9L 1FPTL 1T2XA 5D2LB 4N0UA 3VXQA 1MUJA 1ZHNB 5EUOA 4GAJL 1JGUH 1F6AA 5C8JA 3VXPB 5ITFA 4TUJB 2VXSH 5C0CB 2NY0D 4G7YL 4YQXL 5F97E 2PW1B 4IOSD 3WFDL 4RWYH 4PJFA 4PJXE 4Z7VB 4EBQL 4GG8B 5TDNB 5T3XD 2P43B 3IVKA 1YECL 4L3ED 5FHAH 5CAYB 2I07B 4ESKA 4UDUB 1JIBA 2Y5EA 4GKSB 2AK4A 4HWEL 3CUPB 5SWZA 1KN4H 1LD9A 1FYTB 1QKZL 4XNYH 3VI3E 3G6DH 4ONHA 3QDMA 1GGTA 3B6SA 5F6HI 3OJMB 4H26A 2X9YA 2XRAH 4JFXA 3BAEL 1QUNA 1HHGA 3VWJD 3MMEA 1FNLA 1MRDL 4YXLL 3VXQB 3A0OA 4KTYA 1MUJB 4Q9RH 4HKZA 1F6AB 4PB0H 3DPBA 5KSVA 1RUML 4XTRD 2YC1B 2YRZA 3GRWH 3GI9L 4G9FE 3WLWC 2NX5A 1NC2A 3FFDA 5MP6L 4P2QA 2VISB 4EI5B 3QDGE 3B2VL 3MNVA 3UTPD 1NBZA 2V2XB 2R0ZH 1D6VL 4KK8C 1QSFD 4DGYH 4ZUTB 1DL7L 1X5KA 2R0WH 3DX6B 1VFOA 2XZCL 2A0LD 4AEHL 1MY7A 4IMKA 4U1LA 1DQDL 1B4JL 1HWHB 5CINL 2VABB 1WF5A 3IFPB 3DYMA 5HHMB 4H0GA 2WP3T 3RA7L 2WQRA 1IJ9A 3T0VA 1K4DA 3QJHA 3VH8G 4KK6D 1NLDH 3G9AB 1U42A 5E6IA 3RWDB 1QR1B 3PQYB 4HUWA 3Q1SL 2QKIA 1J88A 2R2EA 2VXTL 3HS0B 5DVOA 5D7IE 2AXFA 5I8CB 4OD3L 4PJXF 1VADB 2BVEA 1C1EH 3HA0A 4X7SL 1FNAA 3TBTB 1JPST 4P2YA 5FGRA 1MJ7L 2DQIL 2X2YA 5CP7A 3ULUL 4NN6B 3MLPA 4XBEL 4H88L 4GS7C 4J12A 1HI6A 3VI3F 4OUOA 1HZHH 3WFZA 3IGAB 4XHQA 3GUTB 1KLFA 3VFSB 2NY0B 2VDLH 3T0DA 3QXUA 4JRYA 2YD7A 3S37X 4U3CA 4UAOC 4KI5F 1KPUB 2ZUXA 2P46B 1OCWH 2YD1A 1FFRA 3RU8L 1EUUA 2V7NB 4Q0XL 4TYUA 4L3EB 3OF6A 1SEBB 4NN6C 4HQQL 2MQCA 4I3GA 5ESAA 1BVLA 2D7NA 1SBBA 1XAUA 4CADB 3NVQA 2L7JA 1XR9B 5MEQA 4XBPA 5IW1B 3VJ6A 1T83A 4ZQKA 1K85A 1EGJL 3PP4L 1JNNH 4M93B 4PJEE 5L0QB 4F8TA 2YD3A 4K7FA 2NY0C 5D1XC 3N9GL 3MLSH 3T0WA 4M3JA 4OKVA 3VWJB 1NGQH 1YN6B 1BFOA 4PD4J 5MERB 4ZD3L 1AHWC 2XG5A 5E8PB 5E2TH 3X3FL 1FG9C 1LE9B 3RIFF 4QHNA 4XPBH 2ZUQB 1MCQA 5BRZD 3TV3H 2X9XA 1F4YH 1G7JA 5FGSA 1OGAE 4ODXB 1H15B 2W9EL 5L0QC 5FYJH 1XEDA 5FYLL 3A6OA 1GAFH 1QSFB 1CLZH 4I0PA 4POYA 3VW3L 2ORBL 5ESAB 3VWJC 3VFNB 2I9LA 5D8JL 2I5YH 1G0DA 1A7RH 5D7IF 5ABDE 2FHBA 4XHJD 5FOBA 4L29A 4UUJA 1JGVH 4HIIA 1GIGH 2ZUQC 4XTRC 5HVHB 4EQ3A 5FK9A 3GJFB 1KCKA 3CH1A 4R2GD 5BJTA 4J3UA 4ZOAA 4FQLH 2A6IA 3U0PA 2NNAA 2XKNB 1OP3K 1UWXH 2BK8A 4ZG1A 1TJGL 3QIWD 2X4SA 2W60A 1M71B 2APWA 5C92A 1EUTA 3MV9A 4BFIA 5MEPB 3PWVA 3PG2A 2QLVB 2XQBL 3H0TB 4Z5RB 3ZTNL 4LDLB 4OTXH 2YKLL 1XCQA 3RIFK 1YDPA 3VFVB 1YMHB 3WFBL 2W91A 1AIFB 4XXCA 5DEZA 4Z76A 1CXEA 4XPAL 2G60L 1JP5A 3BRFA 5FM4A 4QTHA 4PJEF 4KZEL 3MYJB 3D1MC 4IIQA 3QYCA 3O6LL 2CLVA 2UZIH 2F53E 2DM2A 5JNYB 1P1ZA 1TFHA 1CGSH 1EERB 5DTFB 2Q20A 2ERJC 2QQKH 1OWWA 3CK0L 3BPLB 3V8OA 1P2CA 3BDBA 4KRLB 4QRRD 2EDHA 1WCBA 3MRLA 4RWHA 2VO5A 4AIZA 1IGTA 1YEJL 3CFBA 2MHAA 1F3DH 5KSUA 3TT3L 1MOEA 3PWVB 3SPVA 3C87A 4X80H 3FT4A 1D9KC 1CFBA 5HD8C 1SM3L 3NA9L 1GC1L 1MCFA 1X7QA 1XF3B 3CXHK 4QRQA 3BPLC 4RAHA 5C2UB 4QTHB 5CJ5A 4IIQB 5HHOA 4Z78A 5BRZB 5IT2L 3BYTA 3CVHB 3WJLA 2X4NA 3L3IB 4KVCH 1DQML 3Q6FB 1H3TA 4HKBA 4X4XB 4ZPVA 2AJVL 1I8KA 3EDFA 5KTEL 5F7NC 4G7VH 3CFBB 4LKCB 4E9LA 3KPNA 2ZUTA 2YA1A 1YYLH 3UTTD 5CUSL 2EC9T 3CGTA 4P9ML 5TQ2L 4OLYH 3T0BA 1FFNB 1NMAH 2HKHL 1QHPA 1BM3L 4R2GB 4N0YL 1NGWA 1RZ8B 3EOAA 1MCIA 1U8PA 1J8HE 4HULB 4QHKJ 5IFHH 1N4XH 2X4UB 4GW1B 4U3HA 5D6DC 5IF0A 3QIWB 1F4HA 4AG4H 1MJ8L 2ITDA 2VDML 2X4NB 5CEZE 2ICEB 4N0FA 4XHJC 1F97A 4F7MB 1N0XH 3QIBD 5IMOB 1HH9A 4HH9A 1P4IL 3ALPA 5A43C 4R2GC 4GRMA 1YEGH 2W0FA 1INDL 3F65A 1DBBH 3KPNB 4N0CD 5D7LE 2AI0L 4X4MA 5DD3H 4HDIB 3HUJA 3HI1A 4Z7UB 3V5DA 4DAGL 3IT8D 3Q0HA 4PRPA 1OL0A 3FOMA 2XTJD 2R2HA 1PEZA 5T1DL 4OUUB 5DVLA 1BJ1J 4Z7QE 5EOCL 3LSOA 4LSPL 1XGYL 1Q0XH 3GSVB 2A1WL 3DUHA 3JSSA 3OR7A 4ZTPL 4GLRH 4QRRB 1SYSB 1C5BL 2DQGH 3MRGA 3WMSA 1W72H 4Y1AD 1I9JL 1A4KA 2IBGA 2RHEA 1V7NL 2W0KA 4N0RA 3D39D 2BNUA 4WU5B 4PV9A 4UV7L 5D2NC 5GRUL 2DB8A 1DQQA 4CN6A 4MB5A 2W0FB 1KJ2H 2DLTA 3L1OL 5I1JL 3SDYH 4DUWA 2H8PB 3U0TB 1AC0A 5I1LB 3OB0K 3O4LA 3WIHA 3C08H 4CDHA 3KYMB 4WFHE 2GSIB 3GK8L 3TO4A 2FECI 4I0KA 2C4XA 1IT9L 3ROOB 2KH2B 2Z9TA 3BD5A 5LAXB 3RBGA 2FO4B 3QEQE 4XVUD 4PP2A 3ZE0F 4FRWA 1P9MC 2VR5A 4MQTB 2XKSA 5CCKL 7FABL 3BUYA 5B4MD 5BZDB 4MA3A 1HEZB 4ZUWA 4NQED 3WCYA 3MRGB 2FL5A 3IF1A 1H0DB 1LO3H 3KPQA 3BQUA 1YY8A 3UTTB 3HRPA 4KC3B 2PYEA 1NAKH 1S9YA 2RB8A 5I74C 5C7XL 4KDWA 2VITB 3SKJL 1A14L 2XQYG 4TVSa 2H9GB 4H1LH 4M6MH 4YHIB 5M94B 5EG6C 2DL9A 4P0DA 1TQBB 4KUCF 5FDWA 2JK5A 5ICXA 4GG6A 1WZMA 4Z7QF 1JZ8A 3QIBB 4TN9A 5T3XL 1XFPA 2ZUUA 4F7TA 4LNVA 4LCWD 3TVMD 1TPXB 4X7TB 1SYVB 1R5IA 2DM7A 3O2DA 1T22B 4X6DB 3WUWB 1WC7A 2HH0H 1TQBC 5DJDB 1XGPA 2W9DH 2XTJB 1ZOXA 2HWZL 2AXJA 4Y5YC 1SBSL 4MB3A 3QIBC 4EN3A 4K94H 2VXQL 3BP6B 4X6FB 4JFEA 4YR6B 5EOQH 1TPXC 1OAUL 2GTZB 4RMTA 3OXRA 4NT6B 1R3JB 1JGLH 4HUVB 2KL6A 5ICXB 4TTDD 4Y1AB 4N0CC 2FX8L 2BXZA 5J06A 1FNFA 1ACYL 2X4PB 2Q3AA 3D39B 4FTVD 1DUZA 1W0WB 4DKFL 1WZ1L 5ALCL 2XTJC 1YQVL 1DSFL 4QWWD 1RZJH 3PP3H 3TZVC 4YEFA 3W2DH 3O0RH 4RBPK 4CVZA 3L6FA 4AENB 1TTFA 1IVLA 1JFQH 5CSGA 2XACC 4ONOA 1C5DA 4PRAA 1ODAA 4GXVL 4NJ9H 4U6VL 4M7KH 4HWBH 2Z31A 4AEIH 4LIQH 1OD9A 4MJID 2HP4A 1H8SA 3ZHLA 3FT2B 5ESQA 4Q9BA 2GW5A 5DYOB 4EOWH 1NSNL 2YPVL 4NQEB 3CZFB 3DARA 2OL3A 2F54D 3MRDA 3V0VA 1R3LB 3RVXD 4F9LA 1OP5H 3TJEL 3MRIA 1T7YA 5T1KA 1PKOA 1DUZB 4JFQB 2GCYB 2WSKA 3BO8A 3S5LG 1HXMA 1F6FB 2ILLA 3IJHA 3KJ6H 2V9RA 5CBEA 4P4RA 2F74A 1UKTA 2ZJSH 3OPZL 5D71H 2ZOLA 1MCOL 1GGBL 1T5WA 4S1SH 2YRLA 4QRPA 3RGVA 5DWUH 2HVJA 4LCWB 3TVMB 2JB6A 3I3EA 2OL3B 4XNUL 1B0GA 5I17B 1Z2KA 3PJSA 1YZZA 3PHSA 5I19L 4HZAA 1XR8A 3BVNA 4X8JB 3IJSB 1OGTB 4NQUA 1YY9D 2PR4L 3AVEA 5IV2A 3ZYOA 4ZODA 3MLUH 4IMLB 5GS0H 1KCVL 4P46A 4HCRH 2DQCH 4XGZA 2FH8A 5DSCA 4D8PB 1KB5H 2MKLC 1E4XL 2PKDA 3CLFL 1Q38A 1OP9A 5CJXA 4P2OC 3TVMC 4MJIA 1VCAA 1Y6KR 3EDDA 4R26H 2OR9L 4YXHH 2F54A 4IS6A 3DROB 4J4PD 3KWWB 4PRDA 4FTVB 4LOUD 3BKYH 4ZAKD 4IEFB 1CGVA 2NPLX 2HVJB 1KEGH 2F19H 4HWNA 3ARZA 5DD6A 1JNHA 4H25B 4WI4A 2A6JB 4XX1E 2LE9A 2N4IA 4CVWA 4OAWA 3S37H 3OKNB 5DJCB 1LNUA 4U1SA 3IRZA 5INCB 3EYFB 4H0HB 3VRIB 3HE6C 3U1SL 2DLGA 4GBXC 3G6JB 5IMKB 2BCKB 4A2MA 2GK0B 5IQ9B 1ND0B 2VQTA 1KENL 3KNBA 4MJIB 3QUML 1KNOA 4KKNA 3SE3C 1FFPA 1HINH 5IW6B 3RNKB 4OZFG 4QWWC 5GGSB 5CEZH 2F54B 1WFNA 4QY8B 3S3PA 3IXAA 2ITCA 1BFSA 1E4KC 1Q9LA 5J56B 5C3LD 5DD6B 3KPMB 5GGRA 5A2IH 3BGMA 4PJIA 4MJ5B 4QF1A 3D2UD 4HS6A 1T1XB 3NOIA 4WW1A 4LPVA 5C0EA 4U3XA 4KKLD 3IDXH 2LU3A 4MDIB 1NUGA 4W6WB 5LBSH 3DV4B 4OFYD 2VIRB 5FGCB 4HW6A 3WUZA 2R4RL 1VFUA 4J4PA 6CGTA 1KT2B 1BMGA 1KNOB 3GSXB 4GRWB 2K1MA 2YOCA 1YEKH 3GHBH 1XGUA 4ZNCD 3X3GL 1AQKL 5HPMB 2ZPKH 3LKQA 3DUSA 1CDIA 3TWCH 5C0IB 3QXWA 5DD1L 1CQYA 4OIIL 43CAA 3GSNH 5A1AA 4WJ5B 3FONA 4DKAA 4XP9H 5ACLA 1M4KA 4OFDA 4BSWB 3HNSH 2CR6A 2NYYC 5J13B 4BKLB 4G6JL 1ZT4A 5FUZH 4XRCA 4PY8J 5KVGH 5CZVL 4MNQD 2WINA 4JDVA 4EI6B 3KPRE 2UWEE 4JANA 3B9AA 3FQUA 1HQRA 3DYOA 2L4OA 3UJTL 2P5WA 3RY5A 1AKJA 1P4LA 3MLYL 1YY9C 2C9AA 3PE9A 4PJDE 1D5MA 1EHLL 4ZAKB 1OY3B 1EA9C 2VZTA 5CKGA 1T66D 1T6WA 5JOPE 1ORQB 4B53A 5D72L 1A3RL 2YD9A 5J13C 4KMTL 1OAZL 3D2UA 4OQTL 3TBWA 2XIDA 1CD1B 5HJ3A 1I8MA 1P7HL 2YUZA 4Y4HC 1IEBA 43CAB 4MD0B 3ARFC 3P0GB 3AM8A 3QHTC 5E5MB 3FQXA 1QNZH 1ZT1B 2MOVA 2R29H 1N59B 3L3KA 1BPVA 2ENSA 3PIQA 2DQFA 1XF4B 4DGVL 2CRYA 3MTRA 4LOUC 4ZAKC 3ILPA 3TNMB 1OT1A 3VD9A 3HZKA 3OXSA 2SEBA 3SJVD 3O3EB 4MNGA 4G6AD 5KW9L 4JDZB 3UDWA 1TDQA 1YJDH 3BDYL 3D9AH 3HPLB 1A6ZA 4FQPA 2NXZD 1A9EA 3D2UB 4JVWA 3VFTB 3MA9L 4NFDA 1N7MH 4LARL 1R3HB 5DMYA 1XF2B 4PJHA 4YHKL 1FH5L 4MSWA 3HFMH 4NQVA 1FN4A 4OZ4A 2G75B 5JO5B 3K2UL 4QRTB 4K3EH 4MNQA 5F3BA 1A3LH 3RY6A 1CCZA 4JFPB 4XPGH 2J6EA 1CGXA 2H32A 2D9CA 3VMPA 2DQFB 2FIKA 4XCCL 1CDHA 3V52L 2X7LA 3LZFL 2CMRL 3MV8E 1Z5LA 1RZIB 4YWGH 4YFLF 3HZKB 3I50L 3QCTH 1NEZG 1PLGL 1MNUL 1CLOL 3MACL 2UWEF 4J1UA 5KANG 2P8MA 2WANA 2R69H 4O58H 3O6KL 4O2CA 1N3NB 1AR1D 1F45A 1A6ZB 4PJDF 1FLRL 1UGNA 4TVPD 5FYKH 4LVOB 2YPKA 3E2HB 4NM8H 3GMPA 4WTZA 5F1IA 5C6TH 5SX4I 5LVEA 5IB5B 3C5JA 3ROLA 3RY4A 1GOGA 1JPSL 1KF9B 1AGFA 5H37H 3EW3B 5I8KH 5DGRA 1DEEA 4MNQB 4K2UL 4C56E 5ISZE 1B9ZA 3TA3D 4K3DL 3QZWA 5K9QG 5DUML 5TE7L 4P5TA 3ARED 3FTGB 4P59H 3UBXB 1Z5LB 4N9GA 1MRCH 1MCCA 1R3KB 2HLAA 1GGIH 1G7LA 1LO2H 4PJ5A 2F8VA 4LVOC 1BF8A 1F3DJ 4J1UB 1UB6A 1WTGT 3E8UL 4HV8A 5DO2D 3QA3B 4OT1L 4Q9QL 3R1GH 1ZSDB 2Y25A 3E1F1 1JMZA 1N6QL 4L4VD 3HZYA 2Y6SD 4N8PA 5JXAH 3PGCA 5J11B 1U8MB 3C9NB 1T66C 1JYXA 4L8BA 3IETA 3SJVB 3X14A 5F1OB 1CFTA 4FQJH 1PBYA 1CLCA 1MREL 2ADJB 2CKNA 5F7DB 5HHNB 1QG3A 2HLAB 1XMWA 4E41D 3OZ9H 4POUB 2NXZB 4LP4A 1NANI 3VGAB 5BQ7B 4N8VG 5J11C 3BIKA 3L5WB 4JG1H 4HV8B 4Y5VA 2BFVH 3QDJA 5JDSB 3FT3A 3T1WA 1T4KA 3PABA 5EOTB 3FB5A 5JORB 1V3MA 5F7KC 5IVNA 4G6AC 2XN9A 3D3VA 4PRBB 4Q2ZA 1C12A 4QXUL 3LKNB 4V1DE 4GJTB 4NJAL 2D7TL 1N5AB 1G9EA 3CXDH 1L0YA 1FFOB 2NLJB 3VGAC 1J0HA 2RCSL 3C6SA 4AQ1B 3VFPA 4JO2L 1CE6B 1CFTB 2VDQL 1MFBL 3B5HA 4TSAL 1LEGB 5C0RL 4QXGL 5IB2A 5KANI 5J6HB 2BY1A 2CKBL 1J0KA 3PWNA 1ES0A 4XP4H 3GI8H 4F57H 4ORGA 3BIKB 4ZUUA 4Y5VB 4HT1H 3OL2A 1JL8A 3QB7C 5EZOH 1BQUA 2DTSA 2OP4H 5EORH 4R3SB 2CK0L 5D2LE 1I1AD 4NGHL 4XNMA 3TA3B 1K5NA 2C1PA 2YUWA 5EIIB 4NIKB 5C0CE 2DD8H 3AREB 3ZHKA 3BZDA 5K9QI 4OIBA 2Z35A 4PS4L 5EU3A 3B3IB 3ARUA 4PTTB 1KCUH 3C6SB 1I8LA 5BVPL 3V7AG 1MFAH 4P3DB 4MVBD 4YHMH 5IB2B 1E28B 1ZS8B 5GGUA 3LY6A 4E0RA 1KLUB 5F9JB 3TA3C 3I75A 1QSED 4QHUA 4FABL 4PLJD 3VRJB 2X6MA 4L4VB 4ERSL 4XWGL 3BFOA 2ADIB 4JY4B 3AREC 4BH8B 4F8QA 3VMOA 1CD8A 4LRIA 3FFCD 4ZXBD 4NKDB 1UM4H 4HUUA 1LO5A 4ZYKA 3RUGA 4LFHD 3QFJD 1AXSA 3BZ4B 4ACPA 3MLWH 5EWIH 3FRPG 1KCRL 2GJZB 1S9KC 1F4WH 1A1MA 5AAWA 2HT3C 4KKCD 4PJFE 2AXGB 4E41B 4YHLH 5HY9B 2Y6SC 4XPHL 1MJJB 2ZUYA 4FQ2H 5T33L 1KTLB 1YNTB 3QFDB 3SE4C 5IOPB 2R4SH 1AP2A 1U8IA 4PUBH 5GSRB 2AK4E 1B88A 5JQHC 5SWZE 1RJLA 3Q6GH 1I1AA 2CDFA