5BOPA

Crystal structure of the artificial nanobody octarellinv.1 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAASGGTFSTYGMGWFRQAPGKEREFVAASSWTGANTYYADSVRGRFTISRDNAKNTVYLEMNSLKPEDTAVYYCAARRWLGGSYFDPGNYDFWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The unexpected structure of the designed protein Octarellin V.1 forms a challenge for protein structure prediction tools.
pubmed doi rcsb
source organism Lama glama
molecule tags De novo protein
molecule keywords Nanobody
total genus 32
structure length 123
sequence length 123
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5bopA00
3VFTB 4JG0L 4ZTPH 2R8SH 1YMMA 3HI5L 2XZAL 1DQDH 4LCIL 4P2RD 1FHGA 2NLJA 3EO1A 1JNNL 1PG7W 1W72A 3U7WH 1A5FH 5D2LB 2NY2B 4LU5L 4RFOL 3RPKA 1AIFA 1OTSD 3GRWA 5D93C 4R2GB 4JZJA 4EUPH 1G7QB 1VACB 1KJMB 1OAYL 3VFNA 1U8MB 5MEPA 4NIKB 2CO6B 3F12B 5ICXB 4GSDH 5TF0A 4U1LA 3ARFB 3EO0B 1FO0H 3SKUD 3V4VH 3KYNA 3AREA 3KWWA 2GIYA 3MOAH 3AROA 3DETC 4HLZG 2R1XB 5K9KB 1YNLL 1JNNH 1JF5A 3C5SB 3WNMA 4GG6A 1FH5H 3VH8G 2ADGB 5CFHA 1FYTB 1D5XA 3OKLB 3BKYH 3ARQA 4QRSB 1P84J 3I6LD 4IHOB 4G43B 2ZUUA 4OLXH 3SGJC 6CGTA 2B5IB 3EYQC 5HVGB 3B2VL 4LNRA 1XGTB 4X4XA 2IMMA 1RU9L 5DMIH 1A3RL 4XHJC 5JIPA 3RWEB 2GK0B 2X6MA 5IVXE 3S3PA 1JWMA 4JDZA 3CZFB 5B39B 3BP5B 1ITCA 4MDIA 4WWKB 2IANE 4NNXB 2AXHA 1D5BB 4H26B 4IIQA 5BQ7A 3D69B 3G08A 5FOBA 2CR3A 4K94H 1E0OB 1I7UA 3LDBC 5C0IA 4RWYL 4ZS7H 1INQB 2DQGH 3MJGX 1FGVH 2C4XA 3CU7A 2O5ZL 1OWRM 3GO1H 4AIZA 4V1DA 4ZO9A 5BVJA 5MENA 4JFHD 3RGHA 5FFLA 3HAEB 3OQ3B 1HZHL 5I76A 4UUJA 1MCPL 4LSDA 1ND0B 4AIOA 4CADA 3SDAA 3CH1A 2KQNA 2XV6B 1CE1L 4GBXA 5E95B 1EHAA 2EDEA 4OGAD 1I9RL 1T80A 2DN7A 3EBAA 1ONQA 1NGYB 2QSCH 1AXTH 4KDWA 4BSWB 1B0GB 1UACH 4M8QB 3FB5B 3QUKA 4XBGA 3OL2A 1SYVB 3E2HC 1AP2A 2NPLX 3EYQD 3D39B 3GSQA 1X5LA 4KJQC 4RZCA 1J87A 2IBZY 4NO5B 4F7TB 2BNQD 2V7NB 4N8CH 3GM0A 3B83A 2NZ9D 4WY7L 3B3IA 3VXQB 4MJIA 5I1CL 1RZFL 1XGPA 5E9DA 5LCVL 5F9OH 1PLGH 4EUPA 4R0LA 2Z0BA 3VRLF 1FL5A 3VMNA 1F11B 5L2JB 4M02A 4QCIB 2C3WA 2D2OA 2FGWH 4FZ8L 4Z8FH 4HKJA 3EYSL 2XA8H 4QHUB 4QXUL 4GXUN 3BN9D 1OTTD 3T65A 3V6FA 4KRMB 3S8WA 3NIFE 4P2QB 5CEZH 3ULVE 2OTUA 3RTQB 5TQ0L 5E8NA 1CXIA 5BS0A 3D39E 3IVKB 2Z31B 3P9LB 5D2NC 2AK1H 2G75A 1QLFB 2IFFH 3BPOB 3PG2A 4CVZB 4OM0H 2Q8AH 4YHYB 4F3FB 1C1EH 2JF1A 1OSPH 5C0CB 4YHNB 4I9WE 2D7TH 3RL2B 5B38G 4ZFOB 1EV2E 1G9MC 2LVCA 4Q74A 2RAMA 1UZ6F 1FJ1A 4K3JH 5DR5H 2V2WA 3UYPA 2ICCA 4P23C 3EDEA 4OLVL 2ADIA 4MA1B 4NQUA 3PHQB 5CP7B 3QJFB 4LCYA 4ZG1A 3V5HB 4YHMH 4F15C 2EO1A 4L3AA 3QDJA 5L2KB 2J88H 1K4DA 3W11C 2XPGB 1WZKA 1QSEE 4M48L 3ARDD 3RWHA 3ZZ1A 2RQ8A 3QCUL 5D1XD 3MV8B 4Q0XH 3LV3B 2Z8RA 2XTJD 3PWPD 3CSYB 3KXFD 1Z3GH 4X6DE 1FBIL 5IF0A 4HJJH 5K33A 1DN2A 4YNYB 3TWCL 4S10A 2OR9L 3ORJA 1QUNA 3RGVC 4ODHL 4K3JL 4POYA 1WWWX 1I7RB 5EOQL 5BV7B 1RUQH 5DDHB 3VGEA 5D6CB 4A6YB 2YD8A 2F15A 1NFDF 4YXLH 2VE6B 2PW2A 3TA3D 3C5ZD 1I8KB 1UM6H 3ARFA 4I9WD 5BZDA 4K2UH 2DI9A 1KJ3L 1RD6A 4RAVA 4IMKA 4PY8I 5DTFB 2YD6A 2ZOLB 4WTZA 2MQ3A 4ODWA 1IEHA 2ENYA 1AIFB 4HULB 5ESAB 1VEMA 4MA3B 2Y7QA 3A6CL 2HKFH 3TYFA 1YNTA 3GMPB 4HIJA 2VDRH 1AXTL 4PP2A 4MA8H 3QO0A 3ROLA 4KKAC 3RU8L 2E7CA 3AS0A 4Y88A 4R97C 1N5YL 4JO2H 1OWWA 3R06A 1I1AA 4WRLA 4AEFA 3WL9A 4HFWA 2IPTL 4WWID 3JVGA 1J1XL 1MCCA 1YZZA 2D7MA 2V17L 2JE8A 5T1MB 1A0QH 1UM5H 1LP9E 2DM4A 3BPLC 4JM2F 1EJ6A 3GRWL 4JGJA 5T3XD 4D8PB 3HAEG 5DD3H 3LN5B 3RWIB 2YEZB 2DQDL 2OR7A 1KEML 4S0SD 2DQTL 3F7YB 4NZDA 3L5IA 5DRWB 5DK2B 1DUZB 5E8EB 4PJHF 5ID1B 1S7WA 5CUSL 5AZEL 3RJQB 1N2RB 2EDYA 1YYLH 3TCXA 5FYJH 1YQ2A 1RZJC 5DFVD 1MUJA 2NXZD 1Z2KA 3MSPA 2BNRD 4UDTB 5T1LA 4ONHB 4HPOH 1AKJB 5J12C 1G7LA 1BJ1J 3ZTNH 4KZEL 2BY0A 3WNOA 2P5ED 5BMFL 3JBG7 3F7VB 1WIUA 2B1HL 2N7BA 4I5BB 4HK3J 3EYOB 4QRUB 2QL1A 3QA3A 3MRDB 1V05A 4XCCH 1OQOA 3EOAA 4P9ML 2EE6A 5TQ0H 5GRVL 4D9LL 3FQNB 4LLDA 4DZBB 4Q6YA 1FG9C 4OF5A 2NY3B 2RIKA 4P9HC 2VXQL 2OR8A 1N59A 2JJSA 5E5UB 3V6ZA 4O2EB 2DLFH 3MLWH 5E6ID 3ALPA 3LRSA 3N1MC 1T7VA 1BFSA 43CAB 2O5XL 3HE6C 1YEGH 1X5ZA 4M6MH 4OIIH 1INDH 4BFIA 1RMFH 3OGCA 1OB1A 1PLGL 4O5LH 1J05B 4PJDE 5DDHA 2XWBA 5IKCA 2Y5EA 1HH9B 5J6HA 3MRNB 3NCJH 2F8VA 3TH3T 3W0WD 3NPZB 4MCZB 5CGTA 1RFDH 2QADC 4X0KA 4PJIA 4OGYH 4JANA 4PRNA 4J8RA 3FRPG 5CHNA 1TMCB 3S97C 4KAQH 5FCSH 3RDTB 4YUEH 3TBVA 2YA1A 5AAMA 4AEHL 2J8HA 2P8LA 2ICWB 3VGAB 1URLA 2OJZL 2ZG1A 4XVJH 3RTQA 4XTRD 2PR4H 1FO0B 4X4YA 5I8EB 4P46B 4O58H 1EEQA 1OAQH 5F44A 4HIIB 5F6HI 5D2NB 5DD1L 4F9PA 1N26A 3LS4L 3NIDF 4J3XA 4BKLB 3WHE1 3JTSB 1FAIH 3RAJL 1N6QH 5FV2A 2YD5A 4XCFL 4WNQA 3GSNA 3R1GL 3K2UL 5KSUA 4IIQB 4QRRD 3EYUH 1FIEA 4MAYB 2EYRB 1E28A 1ADQA 4R3SB 4OKVA 5D1ZC 5CMAB 4HC1H 4LGPB 3T1WA 3W5NA 2ATPA 1LK2A 2F53A 2W59A 5D96B 4D3CL 3ARFC 5C0GB 3CFEA 4LPYA 2NTFB 3MGOA 1G7HB 3FT3B 1YEIL 3VW3H 5EA0H 4PRDB 1KPRB 5TE7H 2IH1A 3G5XB 4CN1A 1XZ0A 4CADB 1GC1L 4LRIC 3SDCA 2APTA 4LIQE 3QA3B 3MO1A 4U6XA 3O11A 1JZ2A 3MRMA 4NN5B 3CSYA 3X3GL 4HWNA 3UTPD 1MLBA 5IM7B 5ADOL 1FYTE 2A6KB 5IK3A 1RJZB 3WXVL 3D3VE 2EIDA 4OI9A 3MROB 4FQHB 2OJZH 3DROA 3U83A 4YE4L 5EPMA 4RFOH 3GFUA 2OP4H 3QR2A 2OXGA 2FX9H 1BFVL 3X17A 2CLRA 1H3TA 5F88A 2PF6A 4BH7A 3MBEB 1NGPH 2DQIH 4RIRA 1F90L 5HY9A 3LS4H 4YH6A 3E6FB 1ZA3A 4Y4HD 3FO0L 1M7DB 3OKEB 5T5NF 5KSAA 3MRPA 5E8PA 2XZQH 5E4IA 1BGXH 4N5UA 3HZYB 1GH7A 4AM0A 2J8UA 2V9RA 1M71B 4NQDE 4KY1H 4BSVB 1EHLL 4LBEB 5D5ME 3BH8B 3VXUD 4M6ML 1JJUA 3F65A 4NQSB 3B2UD 4Y4KC 2BERA 3FB6B 4CVXA 4MSWA 1T22B 3RJDA 3FOMA 4LCWD 1D5ZA 2APXA 1RULL 4DN3H 4JFFB 2HJKB 1LO5A 2GCYA 4RMTA 1JYNA 1X5AA 4Y2OA 4URTB 2V5MA 4CMMB 5IG7A 1CR9L 2J8OA 2HLAA 2KZ1B 3TBSA 1NMAH 2NXYD 3I75A 1S7QA 4ODSH 4CBPA 1LQSR 3ULSA 4OGYL 2BJMH 3RNKB 3HR5A 3M8OL 3RP1A 2PXYC 4PJDA 2F74B 3N9GH 3HNSL 3PWPA 3IGAB 1F4AA 2EDXA 4OTXL 2WBJD 4X6FB 3GMLA 2VSDA 2YPLB 3BIBX 3NACL 3RHWK 1QNZH 2ZP0T 3QNZA 4WTZG 3WFHA 2EECA 1X9QA 3GI8H 4UQ2A 5MEQB 3O9WC 4M3JA 3U82B 3BWUC 3QG7H 4HWZA 2XTJE 4U1NA 1ZLSL 3T3PF 4KJYB 1AD9A 4OIBA 1UB5B 5ANME 4GAJH 4XCCL 4HUXB 3WMSA 4BQCA 1YEDA 3GJFB 1LO3L 2NYYC 1LE5B 1DN0A 2X1XR 4UQ3B 4JPWH 1FAKT 1RK0B 1LEKA 3RWDB 2VOTA 4KI5C 3DWTA 3QPXL 1I9IH 2XKNB 5I18H 3FQNA 4LLDB 3MO1B 5E8OB 5I1KL 3QXVA 4JRYE 4DCQA 2OLDA 4J6RL 2PXYD 4P59L 3UTZA 4MQXC 2J3SA 4LPVA 2WIIB 4PJ8D 4XCEB 2PN5A 3HC3L 4LCCB 2AS5M 1D5MB 1MLBB 1H5BC 3T08A 1RIUH 2VE6A 4TPRL 1X4ZA 1ZSDB 4OZHF 4IS6B 3DO3A 4X6CE 2WZPD 2AXJA 1UWEH 3IDXH 2VDPH 5ECJE 5KBNC 5DD5H 2HTKD 3DLQR 1FJ1B 1AGBB 1R5WA 3ZYIA 3VXOA 1MHCB 3B2UC 3K81A 1B6DA 3FCTA 1L7TL 2G5BA 5BMFH 5DI8A 3D39D 4Z77A 3RVTD 4FQXA 3O6LL 1YUHA 2QQLL 3QUYC 3ALWA 5J56B 4GXVH 2R0WL 2P24A 2WLYA 5EU4B 1CXKA 1JGDB 1AI1H 4XXDB 1JN6A 2SEBB 3THMH 5ISZA 1XFPA 5E2WL 2CR6A 1WBYA 3C5ZB 3S36X 3UPRB 3AS2A 4JHWH 1N6VA 4K8RC 3VI4E 5CIPB 5KSVA 2A73A 4YQXH 4PRPA 2YC1A 5EG6C 4TOYH 5ISZD 3GSRA 2HJLA 4XMLL 4Y19D 3RKDD 4P4RB 1DBJH 1BQHA 2VABA 4YBHA 1QA9A 3O8XC 1YDPB 1EEYA 4JO3L 1CS6A 3MJ9A 1H3WM 1T0NB 2E3VA 2XTJB 4QHKJ 3CDFA 5FYKH 1NGWA 1OTUC 1X3DA 3E3QC 4WO4B 1RVFH 5C0NC 1CL7L 3EFDL 3MRIA 2ZOLA 1GSMA 5I19L 1MF2L 5FYJL 1HHGA 5BZDB 1VGKB 4U7SA 5JORA 3OKOA 1RI8A 4HIHA 1QFWM 4XXDA 3BGAA 5D93B 3I3DA 4PRNB 3LPWA 4IDJH 2UUDK 1ADQL 3QQ9C 3WXWH 2P48B 4S1QL 2HH0H 1IGCH 1FL3A 4JFEA 2R0ZL 2VQUA 4EN3C 2XICA 2GJJA 2VXVL 3STZB 3VI4F 4GRLC 4PJXE 2Z35B 1QRNB 4GMSL 4HWUA 4ZO6A 3SDAD 4BK5A 5IK3B 5AG8A 5CJQL 1FZKA 2APWA 5FYKD 2LU4A 4M7LH 2Y6SD 5FDWB 2HMIC 4JKPH 2EEBA 2R4RH 4W4OC 1UZ8A 2X4TA 4TVSa 3U6RA 3MLUL 1VENA 1JRHH 4FQLL 4JHAH 4RMRA 4KHXH 4NPYA 3DO7A 5GGSB 4KK8D 4Z7WE 1YY9D 5TGBA 2HJFA 2NY2D 3GUTB 4ODWB 1D9KB 5D1QB 2D4DA 4JFPB 4P4KC 5IBLC 2YK1L 1UXWB 5CJOH 1NUFA 3MBEA 4MCYB 1KLFA 2P8LB 2OQJA 5C07D 43C9B 1NMCC 2NTFA 3MGOB 3QPXH 4WU7A 4ORZC 4Y2DA 4Y4KA 1ND0A 4MXWL 1T20A 5INCB 4TULL 1WTGT 4GQPH 2BSTB 1MEXH 4NOBA 5A16B 1U58A 2EXYD 2AW2A 1BFTA 2VWEE 3SE9L 4FABH 1A3LH 4K3GA 1OF2A 1WV7T 1I1RA 4NKIL 3FFDA 4WI4A 2EZ0C 1KG0A 4HUVA 1UT9A 3IFPA 2R56L 4JPVL 1KCSL 1WC7B 4TOYL 4PRAB 3JTSA 3ULUH 4AEIH 5GJTL 2Y1VA 4E41A 4NO3A 4JFFA 1H3XA 3IB4A 4MD5A 1FNLA 4PRPB 1R3KB 3LHPL 3I75B 5E6IC 4P46D 3NIFF 4MNHB 4HCRH 1BEYL 5D72H 1D5BA 5J89A 3CMOH 4UINH 1CF8H 3MODL 5C0GA 1A7BA 3TN0A 1CDHA 1V3JA 4U2ZA 4ELKA 4QRPB 1DANU 5I1JL 4ODSL 2J5LB 3MRQB 3H9HA 4XP5L 3VXRE 4TSAL 4OCNC 2Y06L 5DEGB 4P23A 5GS3A 1KTLA 1OM3H 3KYOA 4TVPE 3P77B 3TN0D 5DT1H 1PKOA 5BCAA 5C2UB 3HG1A 4G5ZL 5E70A 3WHXA 5LQBL 2NXZC 1AI1L 2X40A 1LP9F 1AC6A 3JUZA 3S34H 4PYHA 2FJFA 3H3PL 3UTSA 2APVA 3O9WA 4PY8J 1BZ9B 1KB5L 2DDQH 2PTTA 5C0AA 5H94B 1FE8L 1NBZA 1ED3A 1U3ZA 4OLEA 1D5MA 2NY4C 2QHLA 3KS0J 4ORGB 1ZLUH 5GGTL 4JPKH 1IAOB 1MH5A 1A1OA 2DQEL 1I75A 3FMGH 4G6FD 5DS8B 1H3UA 1MCKA 4HKZA 2VDNL 3IAPA 2AEWA 1RUKH 3PL6D 2BRRH 2DL2A 4UNUA 5IW6B 2CUMA 3QB7C 4I0PC 5D7JD 1CQYA 5MI0B 3BD3A 3OTTA 1J18A 5JW5B 2AAVA 3HNTL 4M7JH 4L8DA 3KPOA 1KB5B 3CFJB 4DN4L 4FQ2L 4LSTL 4CJ0A 3IU4H 4D0BA 5ICYB 3BH8A 4KKAD 4U1NB 4ZUVA 1EJOL 3MQIA 1CQKA 4D0DA 25C8L 3UAJC 2N4IA 4R2GD 2FJGB 3OZ9H 5IMKB 4L29B 2X4PA 3KVQA 4PJBA 1U58B 1BMGA 5F3HA 2XFXB 1A9EA 1NGXB 2HLFD 3K0WA 3L3IB 1ZLSH 4JEGB 3DV4A 4MNGB 3C5ZC 2F19L 3T0XA 2HT2D 4PJDB 1MFAL 3U0PB 2FEEI 3QDMD 4PGJA 4NRZA 4PRIE 5A40E 3IAGC 3S3SA 4Z5RA 3RPIA 1WAAF 2FO4B 2P5EE 4RRPA 3R8BB 3GUTA 4EIZC 1LP9A 1U42A 4TUJB 4XNXH 3M8OH 4X7FC 2BDNL 4W70A 4JRXB 1II4E 1FAIL 2RBLA 5FV1L 2GY5A 3RAJH 5DHVH 3QQNA 3RQ3A 3CDGB 1YEKL 2E9IA 2XNAB 3HPJA 1QSEA 15C8H 4YBQD 3OAYK 1XZ0B 4OIAA 1MFNA 1J0JA 4HKBB 2P5WE 4JFEE 4QXGH 5JO5A 1RK0A 2KKQA 3QCVH 1QRNA 2Q3AA 1ZA6A 1NFDE 4L5FL 1TENA 4QYOB 2DIAA 3DYOA 1TVHB 1A4JA 2A9MH 3TJEH 5T3ZD 5IJKC 4MZ2A 2DQHL 2Q86B 2QJDA 3BT2L 3BXNB 5BS0E 2O61B 1CD9B 1Y6MR 3GBNH 1WAAE 3H9SE 1L6XA 2ZG2A 4Y19A 1MCOL 2NY5H 1RFDL 3DROB 1AXSA 2EE9A 3C09C 1F6LL 2NTSP 4ELME 1N3NA 2DLTA 3G5YB 2ED9A 3U6RB 2G2RA 2VAAB 2I9TA 3K80A 2BNRA 3BUYA 2AK4D 3MV01 3PWPB 4ELKB 1X5FA 2DI7A 4DAGH 4XH2B 2IALB 1E4WL 2DMKA 4PFEA 2C3HA 2XNAA 2Y4SA 1NFDB 5AUMB 4M7JL 5EN2A 3U46A 4BQ9A 3BYTA 1YEJH 3RFZC 3G5VB 5IBLD 5C9JA 4P4KD 3RTQC 2GJ6D 4N5ED 4MAUH 1IC5H 4PJ5E 1WVZA 5J9PA 2W60A 1I4FA 2D0GA 4B53A 3FMGL 1JTPA 3EOBA 4KJPD 5LGJB 2YZ8A 4YXKL 2OJEA 2ZSWB 3MV9B 4CGTA 4XPAL 3OXRA 1XF5A 2DLHA 5C08E 2H1PH 4QNPF 3TV3H 5F1IA 5CEZD 2GUOB 3SDDB 3HNTH 4ELMB 2UWEB 5EBWA 1Q94A 1V7NH 3AM8C 3OF6D 3TT3H 4DOHE 4Z7NE 4N1CA 3SDAC 1EEYB 1Y6NR 3MRLA 3BIKA 1HEZA 3GMNA 4AK1A 1A7NL 4JFXA 1J8HB 1R5VA 1K5NB 3QIWC 3C09B 1OY3B 4X8JB 4G6MH 4QHLB 2H2SC 2VRAA 4RMUA 1VKXA 4LNVA 3TM6A 3PQYA 4UDUA 4KDTC 4U05A 5GQBA 3V7AG 5AZ2H 3EJJX 3QZWA 1MCHA 1QFOA 1EAJA 4ZUWB 5EOCJ 5I15H 1KJMA 2ZUYA 1Z9SA 3C5SA 1BJ1H 5IR1B 1RMFL 5I76B 2AJUH 1X5KA 3DX8A 1KJ2B 5CD3B 4MD0B 3GSNH 2VKXA 4H0GA 3U2SA 1T1YA 4U1GB 3U4EA 5GZND 5SX4I 3BW9B 1KC5H 2BRQA 3CFCL 5HHVH 3G6AA 2JK5B 3RA7H 1V8HA 2C7UA 4KKLD 1JUFB 4PJFB 3O8XD 3O45A 3P4NB 3EGSB 1EHXA 2VLJB 3QI9B 5FAAA 4ZUSB 5GJTH 3SDCB 1ZHKA 3FFCA 1E6JH 4PGCA 2ZJSL 5K9OB 2LQRA 3QUKB 2FJHB 4XBGB 5I1AB 4L8SC 4NQCD 2H9GB 1OP3K 1YEFH 2IPKA 4YZFE 5LXGH 4WV1A 1IC4H 2PTTB 3OKDB 1W2KT 5T1DH 4YGAB 4K3HA 2FLRT 1KJ2L 1MAKA 2IQ9L 3TVMB 1CCZA 5DD3L 1I85C 1CE6A 4GKOA 4LSPL 4UINL 3ARBB 3UDWA 3KPRE 5JA9A 1LDPH 5AYQA 4XPBL 4XZUA 2IANB 3EYFA 3FHQA 4MX7B 3GHBL 4PJCA 3RVTC 2DMBA 3LEYL 1BWWA 3O4LA 4Z7UA 4DJMA 2V2XA 3TYGL 1MFEH 2X1WL 3QDHA 3C5JB 3TWCH 4I4WB 5IGXL 1RUKL 5HI3D 1KB5A 3K4DA 3SE8L 2HTKC 4WUUE 2NY7H 4EZMA 5A2LH 2MQCA 4YGVA 5HHQA 3F58L 4YIQA 1FV1B 5IROC 4DFHA 2CDFA 3UPRA 3MGTA 5JMRA 1FL3B 2NCMA 4JFEB 2ICWA 3GIZH 1NGYA 4PYGA 2X89D 3Q1SH 3X12A 2XG4A 3GDBA 4M48H 5C0FA 1NGXA 3SDYH 3IYLW 1T89A 5HGAA 3S96A 5EDXA 2GUOA 4I48B 1NLDH 5T5NG 2X42A 1U8PB 1AFVL 3MJ7B 3VD7A 1TQBC 1H5BB 1EO5A 3GMMA 5GGUB 2AJZB 2E9JA 4NDMB 3S6CA 3U9UB 3QUMA 3D2UA 1PZUB 4U3HA 2AEPH 2ZPKL 5D7SL 3RGVA 2D7NA 1CF8L 1F97A 1KELL 2CKBH 2HYMA 3O9WD 3BP6A 3GGWA 1FL5B 3NN8B 2WBJC 4NQDD 1IGCL 1EERB 5JR1H 5GRJL 5JXED 5LAXB 1YNTB 2AJ3B 2N7AA 4AIXA 2VDOL 2Z35A 4I2XE 5IHUL 2KDGA 2Y07L 5H2BB 4GLRI 1XGTA 3NFNA 4YFLF 2HKFL 2MPAL 4OLVH 1G9NC 1W0WA 2RB8A 2YWZA 1DQML 4EXPX 1P7QD 4IMLA 5E5MB 1A2YB 4GRLA 1ZVYA 3KPSB 5BRZB 4M4RA 5L6YL 4TNWF 4PJ8A 4HF5L 5IV2A 1CGVA 3U30C 2C3VB 4GXVL 3KPMA 4LVOC 1JV5A 4KH2A 4PREB 2O93L 3F6IA 5SX5H 3MOBL 4HUWB 4ODXB 1OD7A 1C5DA 1MFDL 1V5JA 3CJJA 1K4CB 4AIZB 4YQXL 3QAZB 5IR1A 2CDEB 1T2QH 3L5XH 1U93B 4UAOC 3AAZA 1RZ8A 3V52H 5MP6L 4JZJB 1OGAA 3QDGE 4I18B 3GSXA 5HHPA 5J1SC 1Q9OB 1UKTA 1OSZA 1X4YA 4U4BA 1VB9A 4CAGA 1GXEA 3EYSH 1CTOA 1I8IA 3T3MF 3WFZA 4JR9L 1N6UA 1BD2E 4G8EB 4LCWA 2BHYA 2PO6B 3JSSA 3MZGB 2P5EA 1EDQA 1G9NH 5DQ9A 4Y5YA 1X5GA 3IJHA 5DEZA 4NQSA 3MRJB 3SDYL 1LDPL 4H20H 1Q94B 3UTQB 4E41B 3TC9A 2MHAA 5DFWH 2Z93A 3SGEI 1UH3A 3VMOA 4HFUL 5I6XB 1MVFA 4N8CL 1AD0A 2HH0L 4YDIH 2LAGB 3VXUE 3MC0A 4K7PX 1FVCB 2VLJE 2VQ1B 3O4OC 1ZTXH 3TYGH 3LIZH 4LMQI 4X5LA 5DS8A 4LP4A 1R24A 4I48A 4NQEE 4Z9KB 5IBUB 1OW0A 1ZVSA 4NRXB 1NCBL 1NANH 4MB5A 5IKCB 1TJIL 4XPHL 4XVUC 5I1DB 3QXDA 4GAFB 4X7EC 2AI0L 1S9YA 5IMMA 3QXTA 2FSEA 4M61A 1UYWL 3VWJA 5HDOA 3IDUA 3OWEA 1F6AB 5TDNB 2B1AH 5GISH 5F21B 1YQVH 3SE4C 4WI9A 1IAMA 3N9GL 5D1ZD 3HE7B 3L3HA 3HRZA 3MR9A 1R3HA 4YXKH 3O45B 5IMLB 4H25B 4PBXA 1DVFD 4L3EA 1FYTD 4ZS7L 1FH5L 1I9RH 4OF3A 4XMPL 1LILA 5BRZE 2BNRE 3DBXB 4WW2B 2HFGH 3D0VB 4OKDA 3QFDB 4C4KO 1AXSB 1IZKA 5KVFH 5FKAA 3VI3F 1PKQA 4R9HA 5HD8D 1FLRL 2E6JA 3PDGA 4MMZC 4KKCD 4GS7C 4CDGC 2CRYA 2YKLL 3BHBA 4XTRC 5C0CD 4UILH 5D2LF 2H41A 4UU9B 3S35H 2R69H 3E6HB 6FABH 1BGXL 4GLRH 2BJML 3HAEH 3BMWA 1IGML 3QJFA 2FR4A 1MOEA 3WN5A 2NX5B 4L1DA 1JNLH 4JAMB 1B4JH 4X9BA 1CIDA 3P40A 4MXQD 3EO9L 5E8DH 4FFZL 4ZAKC 4GAJL 2PNDA 4X7CC 2IGFL 1K8IB 3IXAB 4M3KB 3T3PE 4DN3L 2QADD 4HLJA 4P3WA 5K9QG 2CRMA 4R8WL 5A1AA 4TQEH 4JRXA 1IEAB 1T21B 3FCTB 2CDGA 1P7KA 3SO5A 1PW3A 2OJEB 1G84A 3JXAA 4TTDC 4M62H 3RNQB 3EOBB 3ARYA 1QFHA 1KIPA 3NPSB 2GITB 4QXGL 1PFCA 3TZVC 5IEHA 5BV7L 2WP3T 5K59E 1EHLH 1MCIA 3QEHA 5SV4A 2VLLA 3PQYE 1OAZL 2NY6B 2IFGA 1FNSH 2YBRB 5I0DA 4JCMA 1FORH 2YMXL 1A1MA 3B2VH 1RJYB 3WHE0 2YRPA 3IDJB 3HS0B 4KHTL 5DJ0A 4NNXA 4YEEA 3WFEH 5GGSA 3QFJE 4DK3A 1RURH 5HXMA 5DRXB 1H15A 2DQJH 3IETB 4XI5D 4DEPB 1U8LA 4PBVC 3RWEA 4UZGA 1VDGA 2CLVB 1FZJA 4M9PA 4ZOEA 3MXWH 2MNUA 1K4CA 4JHZA 2VTFA 4OQTH 4ODTH 4G3YL 2VITB 3KAAA 1XR8A 3TA3B 1A6ZA 4E42A 1RZ7H 5EZIH 3CUPA 5MERA 1DE4B 4X4ZA 2W0PA 3QUXA 4FMFA 2ICWI 5DJDA 3NCCB 4IRJD 3KPSD 3MRRA 3HI5H 5I0ZA 4B0MM 1EFXA 3DNKA 3MFGB 4OT1L 2VO5A 3FQXA 3KYNB 4OB5H 1KF9B 1RIVH 1PEWA 2ZUQC 3TH4T 3ABZA 3I6KB 1CBVH 2EH7H 4OAWA 2IG2H 4PJAB 1WT5C 5IHLB 1JCKA 4R96A 4QRRA 3MLSH 2FJHA 5ESVA 3DYPA 3HZVA 5DD1H 3T1FA 4JZOA 5M7QA 1P53A 2BFVH 3L3DB 1ROWA 1NC2D 1UH2A 4U0QB 5EA0L 5TPWL 2GTZB 5CBAA 3G6JB 1BZ9A 1NSNH 3VXUA 5L2KD 1JV5B 4LVHC 4X80L 3U9PL 1EX0A 2ADFL 4DVRL 3G5ZA 4DEPC 1L7IH 3VJ6A 1MCDA 2R8SL 4U1JB 3U4AA 1A6ZB 2OL3B 3T8XB 4H26A 1HXMB 5D8JL 4RRPG 1DE4A 2BXYA 1Z9OA 3DVIA 2X10A 4PJEE 3WIHA 1ULVA 1J8HE 1M6OA 3NCJL 4D94A 4JAMA 2HG5B 1JPGA 1LK2B 1CLYH 4FHBD 4M6NH 3SGKC 3VG9B 4OI8A 5DJXB 4FQ2H 3INUL 1HOCA 5BV7H 2UUDH 4HIEB 4U3XA 3C2AH 1QSEB 3HPJB 1QFUH 1SBSH 5ILTH 1FG2B 1T1XB 2GT9B 3NFPB 4NP4H 3U48A 5ICZA 3DXAE 1YEKH 1U41A 1S5HB 4OZGA 2FATH 5JZ7C 3IJHB 4H8WL 4X6EB 3GSWA 1HXYA 3BAEH 1A6AB 2YOCA 4IRZH 4HIIA 5T33L 2Z8WC 4FFZH 2AABH 2QQNL 4HEPG 3EO9H 1SM3H 4B41A 3VRLE 1JMZA 1Y18A 5C7XL 2OTWA 4YHOH 2PUQT 1T03L 1EJOH 1H8NA 1NGZA 1PQZA 2F5AL 3H3PH 1FSKC 1RZ7L 2FGZA 2V9TA 2YPVH 3AY4A 5HGGS 3EZ8A 1LVEA 5DK2A 2OM5A 2YA2A 4LLAA 4OF8A 5CHNB 2OL3H 3MLRL 3BUYB 1UVQA 2AV1A 1JGEA 4HD9A 1YYLL 3OXSA 4NFCA 2VAJA 2OSLB 3CFEB 2YXFA 4U0RB 1GGBL 3SDCD 1IGYB 2DL9A 4LASH 1T3FA 3ULUF 3K74B 5BVPL 1JVKA 3UBXG 3P73A 1NEZG 3KG5A 3RBGA 4NQCB 1P4LB 4X6DB 1HILB 4PJFA 4YHLH 5A2IH 3QI9A 2VLJA 4ZUSA 2EDLA 3BVNB 3D0LB 1WBXB 2X4SA 3BE1L 4N0FA 3G9AB 3V4UH 1BBJA 3MRHA 4Q2ZB 2EE2A 3KS0H 3QULB 3UTQA 2WIIA 4XCEA 1BM3L 2BCKA 2Q8BL 3DVNA 1BP3B 4C56D 3Q5OA 4MLIA 1BOYA 3FOLA 4XNYH 2GK2A 1U8LB 3QIBA 5BJTA 3KDMA 3RVVC 3V0VA 1KLUA 2EH8L 4D9QD 2XQBL 3PQYB 4UDUB 1KEMH 4KV5E 3BESR 2J4WL 1QSED 1KCUH 4IBLT 4KPHH 4P5TD 3MCKB 2ATKA 5E2UH 2EYSA 4EI5A 1P4BH 1XGYH 1G7HA 1A3LL 4QHLA 4ODVH 4FFYL 2DTMH 4YDIL 3QXDB 3FZUD 3QSKB 1P7KB 4KQ4L 4UILL 1Y6KR 2W07A 4O5LL 4XHQA 4UQ2B 1AGCA 4JFQB 2YPLD 5HGDA 5GRUH 3WS6C 3SDDC 1A7PH 4K71C 4F57H 1IEAA 1T21A 1NFKA 4QEGA 3ZKSD 4WCYH 1CFBA 3RU8H 3GSOA 3UYRL 1DLFL 4S1RL 3IS0X 5GSRA 3MRFB 3QAZC 2HFGL 3ESVF 4PUBL 4DTGL 4P3CL 4PJHA 4N8VG 3HUJB 3SE9H 5GSVB 1RHFA 5FGCB 5HGHB 1RZKC 4D9LH 1PD6A 1Y0LB 3ARPA 4OZGB 2R56H 3QUZB 1A6WH 2UVFA 1MCLA 3LQZA 2YBRA 5DJAA 1XF2B 5E7BA 1GGCH 4EDXA 5KSBE 2X4OB 4ONGH 3X14B 4LGSB 1T0MA 1TJHL 1CG9B 4J4PA 1U8KA 3MZTA 4XP4H 2X1QA 3O6ML 4MJID 1CD8A 1MIEL 1MRDL 2VISA 5IVOA 1CYGA 4JB9L 5GHWL 5F93C 4EUPB 3U7YH 1RUQL 2FCBA 3ULVL 4MA8L 1U0QA 1T4KA 1KFAL 3X11B 5A3ID 4JHWL 5DZOA 1GGIL 1K8IA 3JWOH 4YX2L 4OZIA 3MR9B 5TJWK 4ERSH 4L8BB 3VXNA 3O41B 1P84K 3RVUC 4GRMB 4ZFFA 2VZ1A 2VLKE 4K2UL 4NNYA 3O2WL 3GMRB 2DKSA 2PO6D 3NFNB 3QIUD 5IT2L 3HLAA 1RUMH 3X3FH 1NANI 4JKPL 3GIVA 4XCYA 1JMXA 4O2EA 4MNQD 1IGTA 1XIWA 4QTHB 1G6RA 1CFTA 1GOGA 5DA4A 5CWSB 4J4PC 2PYEA 2NY0B 2VR9A 5K9JH 1CLCA 3T77B 4OD2A 3OGOE 4P2RE 2OR9H 1I1YB 5DFTA 4PV8B 3WDJA 4TUOA 1T83C 4OZHB 1XF4B 4JO1H 4RNRB 4U6TA 5BW7C 3EDDA 3DMMA 3FL7A 5DQJB 1SQ2N 2AQ2A 1CWVA 5DR5L 2NNAB 5GIRB 1LWRA 3CCHB 3ZTJH 3WS3B 4Z7VE 3D2UB 1PG7H 3S7GA 4HF5H 5DHVB 1C1EL 1DBBH 3OKYA 5EOTA 5FO9A 4O2FA 3QFJA 1RUPL 2CLZB 3LMJH 4P3CH 1DBJL 4DZ8B 5F3HB 2SEBA 3OPZH 1CDIA 3WIHL 4EBQH 2Q87A 1G7MA 4FNLL 2I60L 4LK4A 5JW3H 5EH1A 1SJHA 3QPQC 4W6XB 3T0EB 4H1LA 4L9LC 1IT9H 2Z8VC 3ARVA 4JQXA 1UC6A 3WIIH 4XC3H 4OFDA 1MRDH 1AD0B 3KPSA 5DRZA 5F7WC 1LO5B 4R4ND 3P0YL 5HHXH 1N7ML 1MCPH 4TSCH 4PS4L 3JWOC 3NPSC 1MFBH 3VG0H 2ATKB 1I3UA 1F4WH 4F7MB 3VFNB 4OV6F 4XNUH 3B9VA 4PJCB 1ZT4A 5ICXA 1JPTH 3HE7D 2QSCL 3OAZH 1L7TH 2NW3A 3H7BB 1BX2B 1IC4L 4C59B 3NABL 1XH3A 4X9FA 3QI9C 1GGBH 3FAXA 1JHTB 5A2JH 4U1GC 2OI9C 1CDJA 3T3ME 3ALXA 2M8XA 3AAZB 3NN8A 1JN6B 5SWSD 4DGVH 5JQHC 1U8OB 1AQDA 4ONOA 3KR3L 4MVBD 3VDAA 1FFPB 1KBGL 2VXSL 2Z91B 1LO2H 4P2RB 4IRSD 4NO0B 5KVDH 3CAFA 1JUFA 4WW1B 4TSBL 3OX8B 2P43B 3MYJA 3VD4A 4JFZL 2CQVA 3D2UD 5DQDH 4J3SA 1VPOH 2E9WA 3IXTB 1JBJA 4GXUM 4M6OL 4U49A 2NR6C 4N9GB 1OGTA 2EKSA 4L4TB 1KXQE 5DHYB 3Q6FA 1UJTA 5IBTL 2XA8L 1UEYA 5LG1A 2GJZA 1IQWL 2CIIB 1PDKA 3ARBD 3GJFH 4PJBF 3WYRA 1C5CL 1BM3H 1ZEAH 3QWOB 1QFUL 5AUMA 1SEQH 2XWTA 3C9NA 4OLYL 4PGBB 3T0EC 1IAIM 5L8KB 4AQOA 4GW4B 1EO8L 3RBSA 4F2MA 2ATPB 4XAWH 4F7CB 2Q1EA 1TITA 2E7LA 4K07A 1JK8A 2YD1A 3DRTA 3O4LB 3HG1B 3BAEL 4LLWA 5FHBH 1XT5A 4I4WA 2XRAL 4MSWB 4JRXD 4YDJA 1FG2A 1J0IA 2FB4H 2Z9TA 2DM3A 1ZT7A 5HHOD 1XF5B 3O4OB 1NAMH 1CN4A 3NIGF 3BH9A 2BVOA 1SY6L 2RFXA 3DUSB 4H5SA 4NQDA 2WSKA 4KMTH 4N0UA 2MMXA 5I1IL 3D39A 3GSQB 4XXCA 3NFSH 4LPUA 3SE3C 5JXEA 4HQQL 2JCCB 4OF7A 5F6HJ 2IQAA 3ZKMC 4W6WB 1EH9A 2EE3A 3BZEB 4P5KA 5AWNL 3FO2A 3IFOB 4IJ3C 1ZLVH 1RHHB 3MJ8B 3LEVL 4L4VB 3QWOA 2ARWA 3BGMA 4J3VA 5EPMB 1OP9A 3K2UH 5ISZE 3CFJA 3MV7A 4JLRB 3I2CH 4NKMB 4MS8D 3PWLB 4IRSA 3VWKD 2NY5L 4Q6IB 3BWAA 3GMPA 2V7HB 1Q38A 1OOAA 3SJVA 3OHXB 3DHMA 1YY8B 4LL9A 1UJ3C 3BPCA 4RGMB 3OJ2C 1WBXA 2HKHH 2X4SB 4APQD 1V7NL 3FQUA 3NIGE 4LPTA 4OLZL 3VDBA 5DO2C 3T2OA 3PWJA 3GIVB 4XCYB 3QIUB 1FZOB 3L1OH 2A6DA 1K3IA 2BHZA 3JV4A 4CNIA 5F9JB 1DQDL 4LCIH 4HX1A 5TPWH 4M8QA 4R8WH 3TPUA 4LQFL 1T1ZA 4JKMA 2FIKB 3HUJA 3QO1A 4M93B 1QR4A 3TNNB 1H3VA 1F4YH 1HKLH 1CGTA 2JIXB 5FM5O 1CIUA 3RVWD 1BFVH 4NO0D 4QRTA 3MYZA 1ZHLB 1EBAA 1J0YA 1RJYA 3L1OL 3QEUA 2LTQB 4WNQB 2I5YL 2J5LC 5TE7L 2YPLE 2ZNXA 1HXMA 3O3BA 4LDOB 5DK3A 2VLME 1XF3B 1GZPA 2XWJA 3MV8D 5I30L 3DMMD 4G3YH 4U1MA 1DUYB 2XWTB 4ETYA 1HSAA 4M7ZB 5BZWA 2FL5A 2NY6C 5EO1B 5IB5B 3MXWL 5C3TA 1N0XL 2WINA 1W8OA 2MKLC 4NJ9H 1MRFH 4OT1H 1T1XA 3NFPA 4NC1C 2UZXB 3LKPA 5FUZH 3ARGB 3PUCA 2VZTA 4ZAKA 4XNZB 2VXSH 5HPOA 4HC1L 1BBJB 5ESQA 3IRPX 2BX5A 4OIIL 4Y2DD 1XGUA 4HDIB 5C0EB 1VGEH 2R2CA 4UB0L 4LVNB 5B3NA 2YHGA 1S7RA 1FVEB 1NC4A 4RWHA 4RZCB 4ZO8A 3MNWB 3HC0A 3MLZL 5DJ6A 3EKCA 2XRAH 4M1CD 1HHJB 3UO1L 3LKRA 4PJEF 3CXHK 3QUMH 4Y5XB 3G5ZB 2EYTA 4N8VB 4HHAA 1MCSA 1UA6L 2EDQA 4UT7L 3F12A 2H6PB 2UZIL 4MX7A 1U9KA 4WFGE 2YKLH 5LGKA 2YN3A 4P2OC 4I3RH 3QNXB 4DGVL 1FZMB 4OCYL 4BZ2L 6FABL 4HQQH 1T1WB 3MTRA 1QRNE 5D2NE 5IIEB 4WGWB 5DWUL 4GW1B 3HMXA 3F7VA 4N0FB 3PXJA 3HLAB 4KTDL 5GGQL 1N5YH 1U8HA 3EYOA 4QRUA 3S5LB 1QBLH 5IFHH 5HHNA 2KQMA 4FTVD 1HXYB 4WO4C 2H9GA 3DUUB 3NCYS 1IFHL 4JREB 2FJFB 4MXVE 4DGIH 3MODH 3B43A 1IKFH 1SYVA 5CD5C 3BDYL 1BIHA 1BQLL 3IDMA 4LLMA 5DJZA 4WVRA 3MGAA 4ZNEE 1KB5H 2DDQL 5DVMA 3RPIB 4YHNA 3FO2B 5C0CA 1CFNB 3FB8B 4BZYA 1JL8A 3T0WA 3GM8A 1QG3A 5GGRB 2DICA 4XNUL 4XP6H 3UC0H 1XEDA 3LVEA 3FQWA 1MIML 2ZOKA 4KROC 1MFCL 1U8KB 2B1AL 2DWEA 4MD4A 5GISL 4NKDB 1RZJL 1U8JB 1NGWB 1HKFA 4OLWL 3EYVB 4P5TA 3SY0A 4P2QA 3MREA 5D1QA 3MLXL 5BOPA 1RUPH 1HIML 1L0XA 3V0WH 3LDBB 3GGWB 3WLWD 5JW3L 1HSAB 2IADB 4JM2A 4ZFGH 4M1CC 1IAKB 4IRJC 1JK8B 3RI5K 4Y5YB 4PLKD 1DQLH 4PRID 2NW2B 1A0QL 1UM5L 4PRAA 1MEXL 3ZDXF 1D9KC 2ZUSA 4JRYD 4LSUH 2VL5B 4HJ0D 5DRZB 5CBAB 3BPLB 1KTDB 1KYOJ 4F33A 5DUMH 3FFDB 3PP3K 4QTHA 1U8PA 1A7QH 2VDQL 4Z7WF 3KYMA 4WWKD 5DC0A 5E8EA 4S1QH 4GAGL 4YHPB 1CDYA 1DFBL 5GGVL 3AU1B 3MA7A 4PD4K 3ZYZA 2IWGA 2YRLA 2DLGA 5GS0D 1S9VB 4J7RA 4XVTL 3WFCH 3LY6A 1CT8B 1PG7X 4MCZA 1VGKA 1RSFA 1NFDA 3MFFA 2R4RL 1D9KA 2ICEB 3KPLA 4OKVB 5GIRA 3SCMA 4D0BB 2DJ4A 4OCMC 3Q1SL 4TTDD 1SY6A 5HGBB 2IMNA 4JO3H 1FNHA 3UTSD 5FO7B 4K3EH 1DEEB 2LU3A 1PGRB 3GBLA 3UEZA 4MJ4A 2NW2A 3V5DB 4MD0A 4PRIA 4MQSB 4NYLB 3S37H 2BXZA 3LSOB 5CINH 1P1ZA 5L9DH 1TCRA 5I8OL 5EIIA 4NQCA 2XXMB 2P8PB 3FO9A 5MP6H 2L4OA 5F96H 1HE7A 4F7EA 3S36H 2BOBA 3OG4B 2Q76B 2VUOA 4YDLB 4KVCL 4ZSOA 2IEPA 1Z3GL 1KCVH 3HTLX 4JFOA 5B39G 5IVNA 4X8JA 3QUZC 3RY6A 3S35X 2PXYB 2WWMD 5FYLL 5I1LB 2VXUL 2UZYB 4PLOB 1OAKH 5J12B 3G6JE 4LMQE 4QHNA 1HNGA 5HD8C 4H0HB 4LSUL 4WFHE 3DGGB 4X7TA 5CMAA 1VERA 1GGCL 3MMEB 5CJOL 5ACZA 5E00A 3NH7H 4UMGA 3AB0C 1O5DT 1R24B 4NRYA 2UWEF 3HZMA 5FGBA 4O02L 4I13B 4G42A 5D5MB 3ZKXC 4Y4KB 2DB8A 4HH8A 5J13C 1KJ2A 5CD3A 2A38A 4KHXL 3BIAX 2XWJB 1T7YA 3S37L 3MRQA 3D5OF 1BVKA 4HH9A 2QQKH 5DUML 4HFWB 1QKZH 4XP4L 4XNZC 1CL7I 4XRCA 3OJVC 1NLDL 2AJVL 4NFBA 5I8EA 3QJHB 1JWUA 2XKUA 5CJXA 4HIEA 3BRDA 4P48A 4GRWB 1N5AB 1IC7H 4NN7C 5E8OA 1JZ3A 4O4YL 3V8CA 2VXVH 3L95B 1XGRA 4UAOB 4PJHB 3E3QE 5F89B 3I02A 5FGBC 4FFYH 3S4SG 4XP1L 1ORQB 3G5YA 1A02N 3MLZH 3SDDA 1KFAH 2W92A 4HGWA 5DD5L 3LN4B 1BLNA 4CW1B 5GZOC 4QNPE 3SE3A 4JDTH 5C07E 3S98A 4UBDC 4ZXBC 2V7NA 3RUGA 3GI8L 2H3NA 1LEIB 1J1OL 4WEMB 1I9IL 5I18L 4HC1A 1QQDB 5J8OA 4Q9CA 1RZFH 4X6FA 2DMCA 3GSNL 2GW5A 4JJHA 4XP9H 4K94C 4OJFL 1JZ4A 4LSPH 1FZOA 3F58H 3OB0K 5I1CH 1F8TH 1BFOA 2P4AB 4GG8A 1IE5A 3ARBC 5GS1A 1JNJA 5GS1C 3OB0H 3QUML 3X12B 3HAEA 5KSBF 4LSSH 4DZBA 3ZE0E 4XBEL 3MLRH 4TUKL 4TPRH 5JW4R 4X9IA 4Z8FL 4CMMA 5ILTL 2YXMA 4ZUUA 2A1WH 1DBAL 1L0YA 4BQBA 1SYSA 4NWTH 1HHKB 5GRUL 5BO1H 1A6TB 4YHOL 3BIKB 3X14A 4HAGA 2PYED 2ILLA 5BQ7B 4L4JA 3O3BB 5I71B 1J05A 2JTDA 5FOBB 2AABL 4NRZB 4Q9RL 3O81A 4MWFA 4PV8A 3WEXA 4L4VD 5GPRA 5C7XH 5ID1A 4ACPA 4L3ED 4P5TB 3SY0B 2HVKB 1K85A 2P44B 2CPCA 4EJ1C 1M7DA 3OKEA 4X5WB 4ZXBB 4NN7B 2JCCF 3W0WE 4LPXA 1N0XH 5AZ2L 3WD5L 5FYLE 1NMBH 4PP1D 3L5WA 3QHFL 1QNZL 5DWUH 4PD4J 5EU6D 3LKPB 3CDGA 5GGTA 3B9DA 4PJIF 2FNBA 3BD4A 3O6KH 4FXGA 1JI2A 1CLYL 1FCGA 3TFKD 5J11C 3MV9A 1XIWD 4I5BA 4UOJA 2YUXA 3T2NL 3O3UN 1RAMA 2DAVA 1S8DA 4D0CB 4YIQB 4R7NB 4LKCA 4TYUA 4O9HL 5DMIL 4G6JH 2J8UF 4KGJA 3I50L 3RZWA 2OYPA 1FFNA 4OFYD 4WUUB 1CGWA 5CCKL 1NMAL 3LQMA 7CGTA 2EDBA 1BOGA 4HUMB 2XQYG 4OV5A 2FATL 3CFBB 3VXPA 2R1YB 2B0SH 2VLRE 3O4LD 3S3JA 5KSVB 2OP4L 4MB4A 4XNXL 4A2LA 4L4VA 1EUUA 2JJTA 4EOWH 3SN6N 2W9DH 3SEPA 3ZE2F 4HUWA 4ODXA 3INUH 1JZ8A 2RCSH 2EYTB 3E6HA 4Z0BL 1TTUA 1S9VA 5IJKA 3O3AB 4OD3H 4MJ6A 5ETUB 1YUHB 3S4SB 5D7IE 3RGVB 3PWVB 4MJ5B 4GQ9L 1ORSB 4U1KB 2EH7L 4PJXB 3QDJD 3FFCD 3WJJA 4AENB 5E2VH 3P73B 4N0CC 3OV6A 5D70H 5I73B 1MJUH 2DIJA 4XGZB 2AEIT 4G9FB 3WKNA 4KHTH 1A4JB 1FNGA 3IFNL 3LH2L 2AEQL 3TJEL 3IS1X 3I50H 1FCCA 1E4XI 2W0LA 4G8FB 4F3FA 1PY4A 3B8YA 2EDJA 3HS0A 4XNQB 5T3ZH 4OQTL 4G8GB 4PLJD 3VXSB 3C8DA 4P4RA 4Z7VF 5EOCH 4LSVL 5FM8A 4PJ7E 1WCBA 1S9XA 4HMCA 5EWIH 3IKKA 4K7PL 2E27H 4KMTL 3LPFA 3STLB 4Q58C 2F54B 4OLUL 4RDQF 2BNQE 1UG9A 4KDVA 4NHCH 2IALA 2QBWA 5FCUH 3BQUD 1I9EA 2B4CH 4E0RA 3QDAA 5CSZA 2YS4A 1D5IL 4KKLC 1RZGB 5C8JA 1EEZB 3PHOB 3WIFB 3AS3A 2FIRT 4P9HH 1AGFA 1AGCB 4G9DA 2YZ1A 4OD1L 3QUYB 4DKAA 1TQBB 5I1IH 1I8MA 4R26L 3WNKA 2G5BB 2A9NL 4C56A 3T0BA 4QOKD 5DEFB 3KPNA 5KOMC 4LLWB 4RMVA 1IGYA 4X9HA 1FN4A 4YHIB 1S7XA 1FVDA 2QTEA 2J6EH 1I8IB 2F5BL 4GRWF 3DI2B 3L5JA 3FONB 5TF1H 5E2JA 4WJ5B 3F8UB 5D7LB 1S7TA 1S9XB 2QEJA 3JV6A 2VLLB 1ZHKB 5D70L 4ZMAT 3LEXA 4NZRL 1IZJA 3T0EE 3E8UL 4R90L 5DC9B 3S35L 1EO8H 5IM7A 5E03A 3DVNB 3VGGA 2X7LB 4EI6B 1B90A 5DMYA 5JOFB 4PREA 4YFEA 4XPFL 2GAZA 1J86A 4MZ3A 4Z95H 4XBPA 1TTFA 1NBYB 1UYWH 4N8VA 4LFHG 5IESH 1YMMD 3RIAK 4XC3L 1WLHA 3M1BA 3KPLB 2Y23A 2L7JA 3P11L 3RUGB 1JF1B 1KN4L 5HDLA 2HVJA 4Y2DB 2CKBA 1UADC 5TDOA 4JPVH 5C0RH 5B38B 4MJ6B 2YD7A 3OJDA 1DQQA 1YN6B 2XI9A 3BPNC 1UCBL 4CMHB 4C83A 4L1HA 3FQXB 4JJ5B 1YQVL 4OUUB 3VDCA 4FFWD 3M17A 3PHSA 5E24E 3BZFA 4F7EB 2VH5L 4H88H 5J4MA 1VFBA 5LAXA 4N0UB 3P77A 3RVVD 3FN0H 4PJBE 4HCRL 3V7MA 1MRCL 5DSCB 5DGRA 1N5AA 1XF1A 2NY0C 1IL1A 1N7MH 5KJRH 3O6FC 3OXRB 1RJZA 2VL5A 4AEHH 3MUZ1 4HUUB 3I02B 3WIIL 3GSWB 4G8IA 5HVHC 3UPCA 2IPUK 2VZSA 1HHKA 4RNRA 4NUJB 2X09A 4BKLA 5HDBF 4JN2A 1CVSC 5T3XH 3GEWB 3QDME 3LIZL 1ZT1B 4ZSOE 4LCUA 3QIWB 4FXLA 5DUPH 1EVUA 1FNEB 3LKOB 3VG0L 1O7VA 1K2DA 1T6WA 2AJZA 3EO0A 4NDMA 1ZGLP 2F58H 3EYVA 2OSLA 5F71A 5TDNA 1IGMH 3MOBH 1TVDA 5EUOE 4PRDA 3TGXA 1T7XA 2Y5TB 4O2CB 5C0JB 5DMKA 7FABL 4YXLL 5ISZB 3EW3B 4X9GA 4YBQC 3GSOB 3QUXD 3VRJB 1IVLA 1CXLA 4QRRE 5HHXL 2VQTA 1C5BL 3DIFA 1Z5LA 3MCG1 5E6IA 5HHOA 1QKZL 3RX5A 3QEGL 3NCEB 3WJLC 5FK9A 3ESUF 4KGLA 4FQCL 2OZ4H 3H9SD 3ZKND 5CZKA 3CU1A 2JB5H 3HG1E 3PL6B 5EU5A 4A2MA 4NZUL 1CXHA 5HHNB 1JRHL 1AKJD 5JZ7D 4IOSD 3GNMH 3HUJE 4L3EE 4NT6A 3W0WA 3VFUB 3K4AA 4NQXA 4ZSOB 5I1GL 3T77A 1VACA 3SO3C 3RL1B 5EOQH 3E2HB 4GRWH 4JY5L 3C8KA 2VLRB 2IJ0C 4K7PY 2NW3B 2ESVE 2DF3A 5GS2H 3AMKA 2MPAH 1DCLA 3MFFB 4NZUH 1EFQA 1HNFA 2EO9A 3SKMA 3JWDH 1JPGB 3IJSB 1NCAL 3HCVA 2F54E 4R0LB 2IH3B 3DX7B 4BQ6A 5DZLA 3O6FB 4OUOA 2P45B 1JGEB 1S9YB 1G7PB 4KK9D 3O3DB 1YEDB 1FYTA 4V2CB 3MRRB 1RV6X 3MRFA 3K1KC 2IAND 4U31A 1KNOB 1T66D 1QTYT 4MHHI 1MIEH 3UTTA 3JTTB 1NDMB 5K9KA 1JRHI 1OAUH 5C0DA 3D18A 2W9EL 1KCLA 1BBDH 2VB5A 3C08L 4N0YH 3GSUB 3QRFM 1YPZF 5F7DA 4YNYA 1ZA6B 4KVNH 2GY7B 4K8RH 3BRFA 3WLBB 4WUKL 1VA9A 1WZLA 4EI5C 4PGEB 4FQ1H 4N8PA 4QGTA 1P4BL 5KSAD 2C3GA 1KTRL 1C8PA 3PV6B 2AP2A 4MA1C 5I1LA 4EDWL 3TO4D 2HJLB 1S78D 2XN9B 3RWCA 4X6CA 2YC1B 4ZPVB 5L8LB 3KNBA 3JWOL 1HWGB 4YX2H 1F3JB 1BIIB 1HDMB 2B8OT 5C0AD 1PKQE 4PLJC 2CUHA 5GRJH 3GK8H 4DVBB 4NUJA 3UTPE 4GUPA 4ZDHB 1GYAA 1GPOH 4OM0L 2Q8AL 5F6IB 1A7QL 1NKOA 2VDQH 3QP3A 4J6RH 5C6TH 5ANMB 1B0RB 1ZHBB 5DLML 4OM1H 1NCWH 1G1CA 2R0WH 4TN9A 1BVKB 4HH9B 2EDOA 3ULVC 1M6OB 5C07B 3GZKA 5TE4L 4I0KA 3MREB 4M43L 4N0CD 2OBGA 3D0LA 4G9DB 5KS9E 3U4BH 1FSKB 1KG0B 4HUVB 4MAYC 3HNVH 1E6OL 3L3HB 1WBYB 1J7VR 1KV3A 1A6VL 3VRJA 4N0RA 1BFOB 4RX4A 4U6HB 2YPKA 2JJSC 3U36A 3UYRH 1WSST 1XMWA 3OKNA 4K55A 4UI2A 2CSPA 4I3SH 4OSUH 2VDOH 4EVNB 4WIQA 5DVOA 4WV1B 1UCTA 1MCEA 3KJ4C 3VGDA 5DUBA 3PP4H 1JYWA 1WCQA 3EOYG 1PKQB 4Y16A 5IWLA 3H9SB 2IBZX 1TVBA 3BYYA 5C0CE 7FABH 3DI3B 1B9ZA 3B9KD 3V4UL 2PCPB 1X5YA 2NY3D 1IJ9A 4OQ1A 3VFPA 5CJ5A 2HFFA 2X4UB 3D3VA 1JYVA 3EDJA 5IW6A 2BY3A 3ZDXE 2CH8A 1MFEL 5DUPL 3U0TB 4QXUH 2Y9RT 2A74A 3TPKA 1X5HA 2PTVA 1XIWC 3DVGA 5J1AA 1KYOK 4J23A 1FFOB 2ICEA 4YPGB 4P2CG 2CMRH 2PYFB 5DD6A 3ZDZE 5FO8B 4PP1C 1LGVA 2DRUA 5HI4D 1I7TA 1QSZA 4M6NL 4HK3N 4UV7H 1K8DB 2IQ9H 2ZUWA 2C3XA 1NAMA 3N1GC 5HGHA 4KKCC 1BQLH 3FO0H 2FECL 3E8UH 4R90H 1ZAGA 1YMME 3BKJH 3I84A 5B3JE 4X7SH 5HPMB 2DBLL 3PGDB 1JNHB 4PRHE 4GMTH 3VXPB 2H32H 3VXME 3EJYD 4RAUA 1P2CB 3OAYH 3IETA 1DVFC 2Y6SC 4QHNB 1BQHG 4X99B 1NBQA 2EIEA 1QA9B 1WICA 3ZT7A 1D6VH 5JHDE 1I7UB 4KUCF 1A7RL 3TP4A 5KOVC 3EAKA 4FQQA 4PJ9C 3VFMB 1INQA 1NLBH 1O7SA 3RWFA 3O6FA 4GUPB 4ZDHA 1EUTA 3DPBA 5ABDE 3PABA 3KLHC 3VWJB 1PYWA 1P4IL 4ZPTA 3SO3B 5E4EC 2PYFA 5DD6B 4FFVC 3VGBA 3VE0B 4G80A 1RY7B 1TCRB 1IEBA 1OAXH 2F5BH 4PJBB 3D85A 1SM3L 4KK6D 4TRPL 2D7QA 4PTTB 2BMKB 3MA9L 3MCLL 5J57B 2A77H 4XGZA 1CLZL 4LIQL 5GSRB 4NQCE 1FNGB 4K71B 4CVUA 4NT6B 2FLBT 5I66B 3L7FB 1YEJL 1BZQK 4QRSA 3C6LD 1NQBA 2IBGA 4AT6B 2YD3A 4IHOA 4HWBH 2X1OA 5HYQA 1PVHA 3JWDC 2HKHL 3EOTH 4LF3B 4PJ8B 3RX8A 3DV6A 3ZE1F 3QDMB 1SJXA 3B9EA 3HNSH 4FA8A 3X3GH 1KT2B 3DMMB 4X7DC 1XF4A 4MGXA 4JDVB 4NN6B 5C1MB 5D8JH 2W0FA 1RURL 4NJ9L 3N0PB 4PGBA 2EYSB 4EI5B 4IRSB 2AV1B 2JCCE 1ES0A 2HVJB 4NKOA 4LSRH 2CIIA 1GZQA 4HKXA 3PWNA 1CG9A 3KLHD 2MSPA 3QNXA 1QSFA 5GS0L 3IFLL 3BPCB 2HWZH 5FF6A 3ARDB 4NUGH 4UT9H 4OAWB 2CK0L 1F3DJ 3BP6B 3QUYD 4JM4H 4O00A 4PJIB 5EU7E 4Y5VB 2DQFA 1IM3B 2R2BB 3E0GA 3GSUA 4PY7B 4D0CA 2KH2B 4V1DB 3CVIH 3BQUB 1A1NB 3FFCE 3C60D 5CEYA 3Q3GA 3TO2A 3W2DH 3NIDE 1YYML 1U8IA 1NC4D 1FFPA 5CZVH 3EDFA 2BDNH 5C08D 5AD0B 2JELH 1NGPL 5E5RB 5B39A 4HGWB 3BT2H 3S88H 4QRTB 3L3IA 2ZZUT 2Q6WB 2HP4A 3LB6C 3UDWC 4FXKB 4OCSL 1IQDA 4M4PA 4PJ8C 3TLRA 3Q5YA 1HN1A 3SGKA 1G7IA 4RMQA 5HI4C 5L2KE 1UGNA 1E4WH 5IHZB 4NZTH 1LNUA 4EKXA 1BQSA 2GHWB 5CBEB 1K4DB 3G5VA 4L8SA 3SPVB 2ARJB 4KDTA 2B0SL 3L3JB 1S3KH 1M05A 2DYPB 2IAMD 4FQQB 3VFMA 4HXBL 4PB9L 3FQUB 1EK3A 3MRGB 2R39A 3TBVB 4LKXA 3W82A 2AJXH 2DQFB 2R2BA 3VFVB 4HBCL 5T1LB 4X7SL 2EDWA 3L3GA 2ED8A 4XX1G 3UP1A 1AGEA 4AZ8A 1YYMH 1JNLL 3FO1B 4P49A 3B5GA 4S1SL 4GT7A 3ARRA 4OD3L 1DDHA 1U91A 3MYJB 5A16A 4IJ3B 4YFLI 4DOHB 4G9FA 4HLZH 2E6QA 1B6UA 4HWBL 4PJAE 5ESVB 4DW2H 4LSVH 5E6ZA 4Z18A 4DZ8A 2JIXA 2BSRA 4JDZB 3C6SA 2IC2A 1TJIH 5C6PB 3BXNA 2ED7A 1ZLWK 2W9LA 1IQDB 2Q86A 4NQXB 2H26B 2DQUL 5H94A 4UNVA 2FO1A 2C3VA 2K3TA 4ONFH 5CLWA 1XR9B 4K9EH 5ENWA 2CKNA 2DQEH 2HJFB 4XBEH 5B3JF 3UJTL 5IJVB 3QFJD 4AMKH 3O2DL 4GKSA 5I9QB 4JN2B 1FIGL 4GKZA 4XC1H 1ZWIB 1FDLL 4U7MA 2N1KA 2A6JA 5HI3C 4LHUD 3WNLA 3DX7A 1DTUA 4AL8H 3DX8B 3WNPA 3QO0B 3BWAB 1DSFH 1T1YB 3TIDB 1AGEB 1JHTA 4KJWC 4XWOC 3OHXA 5KVFL 2BMKA 4LCWB 4O2CA 3NCBB 4Y4HA 4LKCB 4TUKH 2QKIB 4NM4L 3T2PA 2B20A 2O5XH 3I3BA 3B6SB 2GJ6E 4ZTOL 2ENSA 2VDNH 2APFA 3MRDA 3P9MB 5D1QD 3VXSE 1BOGB 2VXTL 4BSWA 5FYKU 2XY2A 3TO4C 3OZ9L 1AGDB 2UYLB 4M7LT 4JN1L 2XY1A 3QEQE 3H3KA 3PV6A 1RZIA 2BCKB 3V79C 3UTSB 5EU5B 3T0AA 3IDYB 3LRGA 5KVDL 3IRZA 5CZXC 5CJ8A 5CIPH 1OT2A 4ELMA 1QPPA 3KR3H 1CLOL 3KYMB 5JHLH 3KPQB 2UWEA 1NBYA 3STBA 1M1SA 1A7RH 1WQVT 5C6TL 5C3LD 4ZYKA 1ZEAL 3QEUB 5KS9A 1ZS8B 1SVCP 4UNTA 2A6JB 2DQCL 2VZVA 3WS3A 4L9LB 5FYJU 4AEIL 5C9KA 4OI7A 4KK9C 2VZOA 1HYSC 4XCNA 2FR4B 5BS0D 1H3PL 4XMPH 3IU3B 2V2XB 4X5WA 4RQQA 4KK6C 4GW4A 4CN6A 4PY7A 4F7CA 2V2TA 4KI5F 4G8EA 1YECL 5BOZG 4JPKL 4YGVB 3B6SA 4XP1H 4OFKA 4D2NA 2WBJA 4QHUA 5SWZE 4CVWA 1N8ZB 1ETZB 4QWWD 3QIWD 3DBXA 3KPNB 2D03L 3HPLA 4PRIB 4G8GA 3HZKB 1W0YT 1OAUL 4PJ9D 3S5LG 5BO1L 2HFEA 5TQ2L 2EC9U 3L9RA 1WC7A 5D7SH 4U6XB 4ZFOA 1KN2L 1FFNB 3HFML 3EJYC 4W68A 3MBXL 4JR9H 5IMOA 4F8TA 5JXAH 2PCPA 3RVXD 2B39A 3I9GL 1HH9A 2R29L 3VJ6B 4FABL 1UWGH 5HHMD 1BPVA 1MFDH 2P1YA 1AFVH 1MI5E 4RIRB 1FPTH 2FSEB 4M61B 1H9VA 1VFAA 4DGYH 3KJ6H 3V52L 1D7FA 1ZSDA 2CXKA 1T2QL 3L5XL 3TVMD 1F4WL 4N5EC 4NGHL 3HCVB 3O2VH 5EUOF 4Z0XB 1QPXA 1P7HL 5CILL 1YJDC 2V17H 1DLHB 3VXNB 2WQ8A 5JMOC 4N0UE 4XMKH 5HYEA 4K9EC 3VWJD 2J88L 2FJGA 2NY6D 1JHKL 1NUGA 1PSKH 3SKJH 3OR7B 2I24N 1MY7A 3T4AB 5HI5D 1LEKB 4FS0A 3EHBD 1ADQH 4GJTB 5JNYB 1EZVY 4U6VH 4ODUB 2C1OB 1JGUH 3CVHH 2VIRA 3QDGD 4KFZC 5GRWA 4Q0XL 5IB4B 5CEYB 1UFUA 2NY3C 5IHUH 4E9LA 5I8KH 4LAQL 3O6FD 5FK9B 3SDXA 4Z5RB 4NO5A 4F7TA 3ILPB 2JJUA 2FO4A 1IL1B 1CGSH 1P2CA 1SMAA 1BECA 1HI6A 4NBXB 1EGJH 1FRGH 1F02I 4IIQC 1SHMA 4XWGL 3FT4B 4FFWC 3GMLB 5DTFA 3ZDYE 3H3BC 1MQKH 3WXWL 2LVEA 4Y4FB 3HRPA 4NRXA 4M5YL 1YEFL 4Y8AA 4LLYA 4LP5A 3KLAA 1T7WA 5DI8B 3RWJA 3SGJA 5B38A 5I8OH 5DHVA 2R0KH 1AHWA 2ZCHH 5ITFA 3VH8A 5C8JB 2KUTA 2QV2A 5D9SB 2OK0L 4Y1AA 2QKIA 5BZWB 4FZ8H 3T09A 1A7OH 5EZOH 2Z31C 2Z31A 3P9LA 1J9CT 3V0AC 2C1OA 1IM3A 3N85H 4JHBA 5ITBL 3U4EB 4LBEA 4YHYC 4MS8C 4UT7H 5MENE 1P7QA 3VFRB 1FLTX 2A73B 3UTZB 2GJ6B 2X4NB 5ID0B 4JPIA 5F89A 4Q9BA 3HPLB 3IDXL 2EEDA 5T1DL 2AQ3A 2ZG3A 4JY6A 2ORBL 4FP8H 3OKKB 4R4BA 4PJ7F 5T1KB 2R29H 1LE9A 4IDJL 5D7LA 1S78C 2HLFC 5DJCA 3Q0HA 5CWSA 3ZKMD 1NGQL 2VAAA 2ZOKB 3W9EB 5F9WB 1HHHA 3ROOA 3W0WB 3FQWB 1UZ8B 3C60A 1LO0L 4LLQA 1VGEL 4UB0H 3CFDA 5HY9B 4UU9A 3BDXA 1A6UH 2DJUA 3HMWH 3MBEC 1FVEA 2PW2B 4UOW1 1OHQA 5FA4B 2C4FT 5KJRL 4LGRB 4WY7H 4UIMA 3QHZL 4ZD3H 4HJGA 4WI6A 1XR8B 3DOSA 4R7DB 4NN5C 3RZCA 3O2VL 5C92A 3T04D 1HH6A 1EMTL 5D5MF 1VFOA 5F7FA 2AK4A 4E41D 3MBED 3OMZA 4BA8A 3HI6L 5KZCD 3BQUC 3HZKA 3I9GH 3V9FA 5DHXB 1RIUL 1UKSA 1IFHH 4C56E 5EB9A 4YDKL 1DDHB 1U91B 3RWGA 3BUTA 1N4XL 2L0DA 1VADB 5GGQH 4OCYH 3QEHB 2NY4D 3TA3C 5T1MA 3WFBH 1MJJB 1K5NA 1Q72L 4KRPD 2NXZB 4QY8A 1S5IL 2OTPA 3U7WL 3GI9L 3NA9H 2AJUL 4LF3A 4I77L 3ZKQD 2J7LA 3V2AR 4LASL 3K8LA 4JG0H 5FUCE 1PX3A 1FVCA 3KXFA 1QFWL 1Q9LB 4LARL 2J4WH 4IRSC 4YHKL 5HGBA 1ZS8A 5F8QC 3MLXH 1WTLA 4JE4B 4NRYB 5EULV 2R15A 5GGRY 4PJGB 5IB3A 1GC1C 3T0DA 3J8F7 4WEBL 1M7IA 5EBMB 1I1CA 1B0RA 1ZHBA 3O3AA 2IBBA 2FD6L 3MRKB 2HN7B 1IEBB 1JTOA 3E6FA 4YC2C 1G7JB 2Q20A 3NOIA 1RU9H 3KWWB 2X9WA 3GMRA 4B50A 1ZMYA 5DYOB 4DAGL 3FN0L 1P6AB 3LKSB 5INDB 3N1PC 4P46C 4BH8B 5D1XB 1AY1L 2BOBB 2WQRA 5T3XE 2H2PD 5SV3A 4YHLL 3TO2B 4YR6A 1ZLUK 1XCTA 1B3JA 5IMOB 5D7JA 4WW2A 4V1DE 4BFGA 1F6FB 1TZHA 2GTWB 2R2HA 5JUEH 4HMEA 4GKNB 3U30B 4OZHE 3SDXF 3G6JA 2EDKA 4P3DB 4C4KT 4PLNC 2UY7A 3IXTA 3RX7A 5E2TL 4TUJA 2EKJA 3LKRB 1I85A 3K1DA 1JWSB 3CIQA 2FECI 4QHMB 3QDJE 3WE6A 4YE4H 3NACH 3MV9D 4QT5B 2MOVA 4L3CA 3LCYA 1NC4B 4WFFD 3V4PL 3ZT6A 4UOW0 1EO7A 3U9UA 3QYCA 1GCFA 4LVOB 1F4YL 2DM2A 4F37K 4YJZL 2AQ1A 4ALAH 1Q9WB 5E99L 4QO1A 1OAXL 4U0RC 4HKBA 2OCFD 2AEQH 3B5HA 1KENL 3MLSL 3OXSB 3TVMC 4HIHB 2NY2C 3MJ9L 4QLRA 5CGYC 5AG9A 4ZFOL 4HS8L 1FL6A 4YPGA 5EUOA 1BVZA 2Y72A 4G6JL 1HWHB 2G60L 3TBWB 4NFDA 4O58L 5D7KD 3RVXC 4DN4H 3TJHD 3CFBA 4BELD 3IDMB 3SDXE 3EOTL 1D6VL 2XYCA 2I9LB 5EFIA 2ITCA 5LVEA 2BFVL 1RJCA 5I16B 1GJIA 4BFEA 4MNHA 3LH2H 4KJQD 4PG9B 1BAFL 1TZIB 3IDIB 5EUKA 3U0PA 4JKKA 1KPVB 1P69B 4LHUA 4QWWC 5MEPB 5CBEA 2XN9A 3RWCB 4PRHD 2MCG1 2YR3A 4MHHG 4WHYH 3QQ9D 4OGAC 1M7XA 1U8JA 2JJWA 5AWNH 2X44D 2VDLL 4KRPB 3NAAH 4I8DA 2Y36L 4XNMA 4G6AC 1N64H 4KWUA 2K1MA 4HZLA 2D9CA 2HG5A 3RDTC 5DURD 3OKMB 1TTGA 2CDGB 4UTAL 5FECA 2FX8H 1HYSD 1NCTA 5KANI 5TE6L 5ADPL 3PJSA 3MRBA 5A3IC 4PJXA 3MPCA 4PRBB 2FD6H 3W9DB 1NEZB 1U8IB 4XPTH 3O8XB 4WI8A 1NPUA 3PWJB 3FT2A 3QFDA 2IADA 1TNMA 1FORL 2YMXH 1MCRA 3T0VA 4M6OH 4JQXC 5DJYB 1TVHA 1QFWH 4EUPG 2I27N 1F42A 1F8TL 2FBJL 5GJSH 4K8RD 3W9EA 5JW4N 3MA7B 2YD4A 1NUDA 25C8H 5C0BB 2FHCA 2G9HB 2HRLA 1P4IH 4XVJL 4WDIB 1YN7A 1PQZB 4XHJD 4M7ZC 1KBGH 3IU4L 1J11A 3ZDZF 4NCDA 4OLZH 1OGAE 3QDGA 3DHJA 2LTQC 3EO1B 4APQA 4BYHA 2X4QA 3L3KB 3WD5H 3EFFA 3VFPB 1GAFL 1ZT1A 3VD9A 1HH6B 2DBLH 5HTSA 1QQDA 5CEXA 3CX2A 2H8PB 2HN7A 1MCWM 1R5IA 3R1GH 1YC7A 1BD2A 1JHLL 4PG2A 3SKOB 1HHGB 3LS5L 3SDDD 3SPVA 3MRIB 4JM2C 1SJEB 2GEEA 3VXMD 1LO2L 3QUYA 4RFNC 1YEEL 1L6ZA 4Z76A 3L7FA 4F9LC 5DSCA 2MHAB 4X98A 3ZYOA 1U92A 5DT1L 2BVEA 2WWMC 1UJ3B 5LGJA 1NAMB 2FEDD 4HPOL 4S2SA 3U0WL 1TZGL 3GK8L 1YJDL 3WJLA 3AY4C 1H15B 4KMLB 1PZ5B 3CK0H 3ISWA 3L3OA 5GGRA 4NN6C 5AD0A 3MLTA 2W38A 2ZCHL 4L4VE 5IG7B 1ZANL 5AZEH 4P9MH 3IF1A 4JFED 4EDWH 5IB2A 4J3TA 3QWRD 3CVHB 4J12A 4YBLB 1U3YA 4PG2C 5FHBL 3MNWA 4TUOB 3Q6FB 4FQXC 5JHDA 5I1JH 2W91A 2OZ4A 1IM9D 3BPNB 3UBXA 4JG1L 4X5XB 5GRVK 3SJVB 1JZ5A 2BVQA 4IOIA 1TQCC 4GMSH 5MEND 4NWUH 4OGXL 2J8UB 1NCNA 2XTLA 2B2XH 3RZCB 1MHCA 3TBYA 3FJTA 4GG8B 4TNVF 4LAQH 5C2BL 1CICC 4XAKE 1NJ9A 3VRIA 1QFPA 3IVKA 1IM9A 4FNLH 3O3DA 4P99A 1NL0L 5EOTB 2NY1C 3UXFA 1ED3B 5FEBA 1T1ZB 2NXYC 4M6AA 1MJ7H 5F7HA 4OZIF 3CC5B 1LK3H 2B1HH 3DUSA 2XKNA 4PS4H 1OB1B 4LLUB 4M7LL 4NC2B 3BEWA 2BNRB 1QSVA 2W9EH 1U2HA 4BM7A 1QP1A 1G9MH 3C60C 4FTVB 5GRZA 5ACLA 2OK0H 2FZ3B 3GB7B 1INEL 4LCCA 4DKEH 2J8UE 4U1IB 3D3VB 4RFEA 1ORQA 1RZGA 3SKMB 3WJJC 1HINL 5E9DB 2MTPA 3SCMB 4M93C 4RBPH 4XT1C 1JIBA 4HUKB 4LEOA 3QH3A 4P0DA 4DVBA 1UB5A 3MLYL 4G6KL 4Q9QH 2R0LL 3KPPB 5BRZD 5C09B 4NNPL 5ETUA 2QADB 5TH2A 3VH8B 5IFAL 4YHIA 1MREL 2GITA 4KROD 1BBDL 5K9JL 1Q0XH 5E9DD 2QHRL 3CH1B 3DTXB 1CGXA 3R4DA 1NFIB 1AE6L 4YHML 1A9EB 2IFFL 5KAQG 4GG6E 1TLKA 3BDBA 3AREC 5I73C 1LK3L 3EJZC 2DJSA 5FGRA 4UBDD 2VWEC 3A6OA 4PJIE 5SWSA 4ZODA 4OV5B 3T0EA 5GZOD 1IMHC 3ZO0A 1R3LB 3BISA 1HI6B 5IFAH 1IGFL 1MAML 4F33B 3C6LC 4EI6A 5JOFA 3ZE1E 3FRUA 2XQBH 5JOPD 5L9DL 1ZLWH 1NL0H 1LP9B 4AH2B 1A6TA 5FYKL 1BQHB 2VABB 4GAGH 4YFDB 4DUXA 4WENB 3VXRD 5C2BH 3C60B 4LLQB 1XF2A 4N90E 3IDIA 4ONGL 3V5KB 4F7PA 5IB2B 1HHHB 3ROOB 4X83A 5CILH 1S7SB 4OGXH 3QG6B 4FFVD 5HSFA 3TYFB 5C09A 5KW9H 4JQIH 4C54A 3M45A 4JG1H 1OSZB 4HEME 1MY5A 1QEWB 8CGTA 1NBVL 1UKQA 2Z4QA 5J6GB 4RISH 5HBBA 3AMLA 2E9BA 4JANB 5D4QA 4DUWA 1QBAA 2AK4B 3H9YA 4U6VL 2FBOJ 4PP2B 3ZL4H 5L7XH 2MKWA 4PJEA 4KZDL 1DFBH 3MUY1 1ZANH 4D0DB 2VN7A 1YMHB 2M1KA 1NMCB 2WWKT 2E8ZA 3TIEB 1NEZA 3O2DA 4G9FE 5CINL 3SGDI 5HYJD 1HILA 3STZA 5E1AA 2D7TL 5IOPA 4XMKL 3P4NA 32C2A 1QO3B 4P46A 5HYIA 4ZUUB 3LN9A 4JVUA 3C6SB 3MOQA 2IPKB 2UZIH 3TT1H 3H42L 4XMLH 4W6YB 5CKAA 2FX7L 4WEUD 3ZSTA 3EUUA 4RWYH 1UWGL 2VLRA 3PWNB 2EH8H 2R0LH 1NGZB 2NLJB 2XPGA 4KPHL 5L2KA 1UWXK 3NCYP 3CXDL 2P5WA 4U1HA 2EDHA 2I25N 3MRCA 5EORL 5E08L 4F57L 5I1KH 5DK0B 4UDTA 5DEFA 1QYGL 1I1AC 2VH5H 3A0OA 3AM8A 1OL0A 3DRQA 4Y1AB 4FXGB 2O26U 4JRYA 1MRCH 4F58L 2DQGL 5JOEA 3BZ4B 3CXHJ 1KCKA 1IKFL 1JHLH 3D25A 5ESQB 5GS0C 5IFJA 2XG5A 1G7MB 1JWMB 1BF2A 3P4OB 1E6JL 3GMQA 5EC1B 2EKSB 4L4TA 4NM4H 1U95A 3V7AE 1XGQB 4HXBH 4D8PA 4OLWH 1S3KL 1F45A 4MNGE 3OKDA 4WTXA 4LHUB 4WWKC 2R1YA 2P47B 3WNNA 5TDPB 1C7SA 3SQBA 4OZIE 2ZCKH 3RL2A 3UZQA 4MA7L 4S1DC 5HJ3B 4BSJA 1MI5A 4QHMA 1OPGL 1S9KC 3PXHA 4AL8L 4KY1L 1FNEA 1GIGL 4OZ4A 2DWDB 1MUJB 2Y36H 3B9AA 2I26N 3BZDA 3N1QC 5JW4Q 1H8SA 2BC4A 5DFVC 4Z7UF 4BJLA 3U2SB 4KU1A 2X70B 3HR6A 1J8KA 3UTOA 1WGOA 5F7EL 1QSFD 5CLTA 5KSAB 2AJXL 5IHBA 2M2DA 5TE6H 3OB8A 1BAFH 5ADPH 1QR1A 2E7BA 3MXVH 1CFTB 1FL6B 2FX9L 3EIFA 3CC5A 4WFED 1J1PL 2A6IB 5F1KC 4Z95L 1J0KA 5EC2A 5DJ8A 2VDKH 1P5VA 1FVDB 1TPXB 4H8WC 3NAAL 5SWZB 4Z7QE 3SJVD 3MNVA 3PE9A 2FBJH 5GJSL 1HCFX 4LRIA 3TZVB 2V2WB 1JWSA 3OG6B 2B4CL 1CD1B 4HDIA 5C0EA 2A2QT 5EIQA 3WFEL 3I2CL 2DKMA 1H5BA 5D6DA 4YEFA 2FH8A 3HZMB 5CEXB 1SJVA 2IG2L 1W8NA 2ADFH 4DVRH 3EJZD 3C8HA 1I1FA 4YO0B 5I30H 4Z7UE 4ALAL 4CU7A 3IGAA 2V7HA 1RULH 5CS7A 5C0JA 1RZKH 1T04B 4MDJA 4WFFE 4FQJH 1Q8MA 3QXUA 2CD0A 4IRJA 4JM2B 5I1HH 2JIXD 4HW6A 2I5YH 3HB3D 4BH8A 3MGTB 4ZPTB 5EO1A 1JWUB 4LCCC 5IB5A 5TH2B 1FV1A 2XZQL 4LDEB 1HCVA 2R9HD 1Q9KB 3O3EB 5TFSH 1EEUA 4AG4H 2HJKA 1MJUL 4ISVB 3MA9H 2AXGB 2NR6D 5DF0A 1S7XB 3TCLB 4ODUA 2BVOB 2HAZA 2RFXB 5T3ZE 4L8CB 3VXMB 4H5SB 2ZUQB 2ZKHL 4KUZH 1YNLH 3I6LE 4RCAA 3JWNC 1OP3H 4MB3A 3CVIL 4KXZH 1R3LA 3RIFF 1JNHA 1E4XL 3DURA 1X7QA 5EOCL 1T0NA 5EC1A 1YPZE 2WBWB 3WN5B 4M1GL 3F7YA 2CK0H 3GSNB 4LFHD 4HMDA 4ENEC 5ENWB 4D3CH 3QUXC 2E7HA 5C09E 1A64A 1KPUB 2HA1A 4KTYA 5CJBA 5JUEL 2P5WB 5F88B 3PQYD 4MQTB 5FGSA 3MJ6A 3WBDA 4F2MB 5C9JB 3W11D 4OCRL 1C08A 5FO8A 3CCHA 4U1LB 3U1SH 1JF1A 3H7BA 4PBWD 1ZVHA 2WANA 4JFYB 4OFPA 5EN2B 3Q3GB 1OW0C 1T2JA 4AG4L 1DBMH 3VG9C 3VGAC 1CZ8H 1O0VA 5EU4A 1QRKA 3H2WA 4ZOBA 4L3EB 4R4NC 4TVPL 2PYEB 5LQBH 1OPGH 3MUJA 1NMBL 3MXVL 3QISA 5DD0L 3PGDA 3VXTA 4TNWK 3LQAH 4JZOB 1XCTB 2NY0D 4EQ2A 4WW1A 3HC0B 1X6LA 5BRZA 4P5KB 2ZCLH 4ORGA 4WEBH 2QLVB 1LO4L 1FNFA 3QO1B 4LSSL 1S7WB 4TQEL 1RJLB 4WWKA 1CXEA 5E8DL 1OAZH 5L88H 1EAPA 4UT6H 1ZVSB 3AGVA 2CLRB 3P4MB 4K7FA 5FB8A 5EBMA 4HKJB 1D3CA 4NCC2 1FZMA 4YHZL 1CGYA 4JZJC 4ZQKA 1U2CA 1OP5H 2DM7A 5C07A 2XACC 2CUIA 2VDKL 4WHDA 1CDGA 4X5XA 4APQC 3U0TA 5IEKB 12E8H 2K9UA 5JW4M 4JM2D 3PP3H 4XRCB 4M1DH 4YDJB 1I7ZA 3F7RA 4X6BB 4Z7OE 5J0BA 2Z4QB 5KTEH 3V6OA 1FLRH 4PRHA 2A77L 1IAIL 3BVNA 2PO6A 4JQVC 5BV7C 3O11B 4YDKH 1EA9C 2CGRH 3LQAC 4HUXA 3VXRA 2C1PA 3BX7C 4GOSA 5E94A 1AHWC 1FO0A 4X4YB 1NBVH 2GT9A 4YXHH 3R0NA 2DQDH 2ESVB 4N90D 3H42H 4O4YH 1EHNA 4MNGA 1V7ML 1YN7B 4NC0B 3T2NH 5I16A 3QIUC 4NWTL 1CICA 1DANT 4Y4FA 1MPAH 5JOPE 5FYJD 2YK1H 2J6EA 4NJAL 2ZNWA 3S36L 2OTWB 3RVUD 4JFDD 5IBTH 3CGTA 1JYXA 3DX9A 1FNAA 4LQ1A 5MEOB 5EORH 5E08H 4GBXC 5DJ6B 1Q9LA 4Z6AT 1ZWIA 4BK4A 4PJXF 1ORSA 3RI5F 2W65B 1OP5K 4P23B 3BQUA 3LMJL 3MRCB 4FP8L 1ZKAA 1CK0H 4CVXB 4XP9L 1MELA 4Z7UB 5TE4H 1DEEA 1G9NL 3DVFA 3KHOA 4G8GD 2H32B 4OZGF 4MXWH 5DJ8B 1T89C 3TT1L 5DGQA 1Q0XL 1A9BA 5KG9B 3V6ZB 2NY5C 2YUZA 5EIIB 2VR4A 3NTCH 5EU3B 4H1LG 1T5WA 3OKKA 4R4BB 5F7LB 3V95A 3CSGA 1J1XH 3VFUA 1U92B 2AV7A 2Y06H 3WUWG 5EZLB 5EU6B 5D2LE 2NX5E 3KPRB 2AJSH 3T8XA 2VDRL 5DJZB 5LBSH 4X99A 1JPTL 3DV6B 4TULH 3QWQB 4O02H 3PNWB 1BZ7A 3H9SA 4FQHA 3F62A 3RUGF 3OAUL 5ITBH 1MI5B 1TJHH 5KS9F 4HGKC 5FECB 2VLKB 1B88A 3LAFA 3L5WB 2X4QB 3ARUA 3L3KA 5BVJB 1RUML 3P0YH 3X3FL 1ZGLA