1TQCC

Ovine recombinant prp(114-234), arr variant in complex with the vrq14 fab fragment (igg2a)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DVVMSQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSRLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYFCWQGSHFPQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function/immune system
molecule keywords prion protein
publication title Insight into the PrPC-->PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants
pubmed doi rcsb
source organism Ovis aries
total genus 52
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2004-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcC01
3S97C 4ZNEA 3W39A 1VPOL 3PL6D 2DOCA 3QUML 2EYSB 4JQVA 4PRHA 1Y6NR 4XNYH 5HJ3B 3MV8D 2VAAB 3EO0B 3CXHJ 5CIPA 4K7PH 4NP4H 1TTFA 3KDMA 4HW6A 1MVUA 4IIQB 1RUML 1OP3K 3QDMA 4P5TB 3U2SB 1DL7L 3RZCA 3FQTB 2F8VA 4FFVC 2N4IA 4ZUWB 4OZHE 3SDCC 3MRQB 1YPZB 5C86A 1EUTA 5D5MB 3TEUA 1MAMH 3MTRA 3VXMB 2GJZA 3T77B 3O2WH 4JQIH 4BFIA 1AGCB 1T5XA 1KTLA 4M03A 4X4XB 5AZ2L 2X2YA 4NQUA 3E3QC 2FEEI 3LB6C 1QFUH 2BY0A 1S9YA 2W60B 1A9BA 5BXFA 2PR4H 1N7ML 4WUKH 4R96B 3DO7B 4X6DB 3VGEA 1T6WA 1SEBA 2PTTA 3M1BB 1I1AC 4I18A 4A2LA 1IGFH 4JPWL 4MHHI 3SO3B 4YXKL 3QG7H 3T0EC 1V5JA 1LK3H 1G7IA 5JORB 3D9AL 4FQJH 2OSLA 4NKIL 4NQCA 2V7HB 3EZ8A 2UZIL 4M02A 5H37H 1JUFB 1U58B 4EUPA 5FGBC 1MJJA 4IRJA 4AIXA 4AZ8A 5SWQB 1PG7W 5B38A 3MO1B 4HX1B 2ADJA 1P84J 4K8RC 4WI2A 3VRJA 4PRDA 4OKDA 1SYVB 4UIMA 1RI8A 4JAMA 1W8OA 4RAVB 2VL5A 2PTUA 5DUMH 5JUEH 3CZFA 1KB5H 1Q0XH 1YN7A 3GMNA 3QG6B 1BF8A 4OI9A 4Y4HC 4RFOH 3MJ9A 1BZ7A 1EEYA 2D2OA 3E6FB 5I1IH 4GAGL 1JGLH 4XVUD 4GRLD 4PJAF 3EOAB 4O2FB 3MLZH 1CYGA 2AK4E 4IOFC 4MWFB 3ZE0E 3K74B 3K7UA 2MCPL 2GITB 4PGBA 5A2JH 2IQ9H 3EYVA 2IQAB 2AXGA 4PP1C 2CDFA 2VDLH 3DURA 5DRWB 4LSPH 4HUVB 4OZ4A 3WFEH 1N64L 1J05A 3EYQC 2BVPA 3I84A 5H35B 2OZ4A 4NN7B 1H0DB 1JN6A 2FGWH 4NQDE 1VKXB 2AK1L 1I9RL 3TO4A 5ANMA 5FYLL 1A6PA 4ZUVA 3FJTA 3SCMC 5DJYA 1INDH 3KXFA 2ZG1A 3EKCA 1IGMH 3IDMA 4GO6B 4YBHA 3NTCH 2VOTA 4L4VE 1PEWA 2KZ1B 3SGJC 3N1MC 4O2CA 4I4WB 3NPZB 3VFMA 1BZ9B 4K8RH 3SY0B 2HTLD 5SWZB 3QDGA 1U8NB 2OX5A 4JM2A 1IT9H 1X5HA 2RFXA 4LLUA 1AXTH 3O11B 4YR6A 5I1EL 1LE9B 2XQYK 4POZD 1OOAA 3OR7B 2O26U 4YGVA 1W0WA 1EUUA 5C0FA 4RBPK 1DBBH 2Z31B 4Z78B 1ZTXL 5K9JH 4M3JA 3ROOA 4S1RL 4KH2A 4PRAA 3FZUD 4WHYH 3V95A 1GGTA 3BW9B 2HFGL 1PYWB 3R1GL 4H26B 4U1KA 1PY4A 3Q6GH 2B0SH 2X4NA 4U1GB 1P7QD 1V7ML 2X1WL 2H1PL 3TPKA 3V7AE 3BKJH 1DQQB 4I9WD 4P5KB 1G7HB 5BRZD 3ZKSD 5B8CA 4P46C 2F53E 4FTVD 5EWIH 3BHBB 3EJZC 2BY3A 4TPRH 1D5XB 4Z7VE 5FA4A 1NL0H 4HUUA 3SKJH 1MCQA 4JGJA 4W81A 3PP3K 2BVTA 4QRUA 5IEKB 3UBXI 3ZDYE 1V3LA 2R2HA 1KELH 4U1SB 4GRMA 5HXMA 1J0JA 4WO4C 3QNZA 1LQSR 1AO7B 4U49A 2QHRL 2DJ4A 4KQ4L 4LQFH 3FO2A 5IG7A 1I3RB 5IKCB 4R4BA 4QF1A 1HZHH 2P7TB 3QUYB 4JHWL 2ARJB 1KSRA 4WTWA 2B1AH 3HE7C 3I2CH 2VXTL 1NAKH 2JB5L 2HWZH 3EJYD 1TVBB 5HY9B 2GAZA 1YECL 4RIRB 4ODXB 2Q76A 3GUTA 2Q8BH 1KIQA 3MYJA 2P8LA 3RWEA 2Y5TA 4HD9A 3EO9H 4YBLC 2Q8AL 3P0VL 2VLJE 4H5SA 1ONQB 3CD4A 5DTFB 3W9EA 1L0QA 4U0RC 3AU1A 4U1MA 5JDJA 5KS9F 3H3KA 2EYSA 4EN3D 2I25N 4LOUC 5CEXA 2XKSA 1EO7A 1T5WA 4PJIB 2XT1B 2RB8A 5B22A 3OKDB 4YC2C 4M7ZB 5FA3B 4IIQA 4CNIA 3ZKXC 4XI5D 12E8H 4QY8B 2BOBB 4TRPL 3FQTA 4DKFH 4PTTB 4AJ0A 1OAUH 4QOKD 1IGTB 2H6PA 5DJDA 5GGTA 3SE8L 5I1JH 4L9DA 2HT4D 3BH9A 4LF3B 1LO0L 5HHNA 3GMLB 4X4XA 5ETUB 4P3DB 5J9PA 3VXQA 1C5DA 2DQTH 2OS7A 3OKYA 4F7CB 3NA4A 4I5BA 1NFDB 1ADQA 3RVVC 1DFBH 4RCAA 4CU7A 3M1BA 5DJ8B 5E7BA 3PWVA 3WL9B 1MHCA 1X5IA 3MBEC 5TDPB 2VQTA 3BQUB 1A6AA 1JHLL 4GKOA 4KJPD 5JXEA 4M1CC 5GJSL 4GW1A 3QULA 1CQKA 3ZKQD 4KWUA 1BBJB 2DB8A 4LASH 5FV2A 1A3LH 1F42A 4LPWA 5TPWL 1I8MA 1MWAH 1YEIL 4R7NA 3UJTH 2GJ6E 1RZ8B 2X1PA 4HUWA 4U1JB 4JFXB 3UTPD 3RL2A 3DUUB 5DHVB 3HFML 1E6JL 1HYRC 4ZS6D 3I85A 3WNKA 1NGQL 5A3ID 4OZGE 1CVRA 1F3DH 4JJ5B 2ED7A 3WJJA 5IQ7H 1G7JB 5GRYA 5FAAA 4TQEH 4G9DB 5D93B 2VLKD 3REVA 4JO4H 1PG7X 1R3KB 3P0YL 3VXSA 4E41A 1LP9B 4K9EC 4TSBH 2P8MA 4TOYH 3BZEA 3RWJA 5DFVC 1EHLH 3HUJE 4HUKB 4OKVB 2HJFA 1F3JA 3VH8A 1CI5A 4KXZH 2FLRT 3IXTB 4H20L 4MJID 4JFHE 4PJGF 3T1FB 5DRWA 4XRCA 5HHME 5FEBA 3V4PL 2A6IA 3BAEL 3VXTB 2G5BA 2HMID 1AH1A 1MH5B 1MJ8L 4R8WL 3LZFL 5EPMB 5GZOC 3MRNB 1EJ6A 3GM0A 3HLAB 3VWKB 2AVGA 5HGHA 3U79A 4OI8A 2CMRL 4N0YL 5C0AA 1U8MB 4ETQA 3GGWB 4JQXA 1NDGB 1XGPB 5JLZB 4YX2L 3IDJB 1TQCC 3LRHA 1YY8B 3SE9L 4HCRA 4XP4L 1HCVA 2Q3AA 1OB1B 1A4JB 4NC1E 3U30B 3HG1E 3LEVL 3BUTA 5D70L 4G6MH 1U8NA 4CVZB 1A14H 3RDTC 1NANH 2BXYA 2FGZA 4DGVH 1UKSA 3KAAA 3UYRH 1VA9A 2Q6WB 2ED9A 4QO1A 4PRBB 4YO0A 3PGFH 1LNUB 1QBLH 2YKLH 1BVLB 5IROC 2XTJD 4NUGH 4LAQH 1JGEA 3VXMD 4PFEA 3D2UB 4F33A 2EECA 1J87A 4K9EH 3NACL 3VCLA 3QJFB 1NMCB 5C9JB 5F88B 1TETL 4ZFOL 2YRLA 3GSXB 4AL8H 4ZFFB 1I7RB 2NZIA 2OQJA 1R24B 1N8ZB 2V5YA 3HC3H 5TQ2H 4R7DA 3IRZA 3RWIA 3T0XA 3O2VL 4W4OA 7CGTA 5ENWA 4P5KA 5CD3A 2XZCL 4OQTL 2GUOA 2PF6A 2WBWB 5CEYB 3KPRB 1CT8B 4NKMB 3BP5B 2C1PB 2YSSB 4HFWA 4LLQB 2OTPA 3O3AB 2Q7NA 5JIHA 5JZ7D 4F8TA 2E5EA 4XVJL 3ZTJH 4HIHB 2YD3A 4QLRA 1VESA 1BOYA 4Y4FB 5FM5M 2VERN 1NCWL 4RGNB 1Z0MA 5CZVH 1R3LB 5E70A 5CKAA 2Y1VA 3HHRB 1FJ1B 3LD8C 3IDYC 3IDUA 3MC0A 3DGGB 4PREB 3QUYA 4P3CL 3GMQA 1BECA 1DANT 3U4BL 2GFBA 2C4FT 3X3GH 3ARXA 1V8HA 1VEMA 2PXYC 4PJEF 3SJVD 1DE4B 1K3ZA 2BVQB 2X4RB 4RIRA 5T3XD 5FUOH 5SWSB 2UUDH 3U7YL 2E27L 1GGCL 3H9ZA 4UT9L 2Z0BA 1X4ZA 5DTFA 4M1DH 3WSQL 1LO2L 4LHQB 2YUZA 4ONGL 1PZ5B 3TYGH 1IBGL 3OGCB 5F9AC 1WIUA 3VXNA 2OK0L 2VLLA 4LNRB 3IFLH 5BVJB 3VFOA 1T2JA 4JY5L 4PPTA 4WFHD 3ZDZF 1F58H 3IJHA 2EO1A 5BV7L 3BZFA 1PLGH 3UTTE 3V0VB 5B38G 4YXLL 1JTTA 1FFQA 3ZTNH 4YE4H 1J0IA 1CTNA 4PG2A 1IZJA 4EOWL 4HUXA 2IAMB 2P5EB 4U0QB 3CC5A 5C0RH 3QEUB 3CFJB 4X7SL 4YK4C 1DLFH 2G2RB 4WEBL 2J4WL 3UTQB 1MHPL 1X6LA 2JE8A 4O51B 5TE4H 3ZLQC 4D0BA 4KVCH 5T1LB 1TJHL 1A64A 5C0IA 2CUIA 4NQEB 5E2JA 5SWZD 1OGAE 5ETUA 3MXVL 1JGVH 1YYMH 4XPAH 3PJSA 4JO3L 2VXSL 5C07D 5ICYA 1UZ8A 3PGCB 5FYKH 1T03L 2R4RH 2XFXB 4DGYL 3ARBB 2FATL 4DZBA 2Z31D 4LU5H 2BNRB 5JTWA 3H2WA 1FYTE 1P5VA 2DQEL 4RWYL 1RVFH 3RWFA 3QDJE 4JCLA 2VRAA 5DUPL 4HXAL 5GGQH 3ZYZA 5F96L 1JRHH 5KSVB 1CFBA 3ZKND 3VFSB 3T1WA 4GXUN 1F4AA 3DOSA 1FVDA 4L8BB 3RTQC 4PV8B 3HC0A 2FD6L 4Y5YC 1HHIB 1BWWA 2R29L 2YWYA 3WEXA 2OZ4L 4JCMA 5F97E 3L7EA 1N2RA 3N06B 2NNAA 1T2QH 3BT2L 3CVHH 1IGYB 3OHXA 5DK3A 1TNMA 2MOVA 3GRWA 1I3GH 1DP0A 3VFPB 4JM2F 2Z4QA 4L8CB 5D96C 1RUAL 2C9AA 2DQHH 3D5OF 5F1KC 1AO7D 3S37H 4M5YH 2J8UA 4HIEB 4G9DA 1ZSDB 1NUGA 1R3KA 4FFZL 2ZPKH 3ARED 5DVNA 4GXVH 5EZIL 5CHNA 5C08A 1NGZB 2AXFB 5GGVL 2D0FA 1TXKA 3NA9H 1G0YR 5I1HL 5HDBE 5EO1B 1Z3GL 5DI8B 1KG0B 2FRGP 5EULV 5EU3B 5HHVL 1DUYB 3RIAF 4Y88A 5F9DC 2ZKHH 1RAMA 1S7WB 3MRNA 4N0UB 1C16A 2VLRA 5F1NB 4YUEH 3C6LB 5E2UH 1A0QH 5IMLB 5HI5C 2QBWA 3QJHB 2XNAA 5JLZA 3IDJA 3A6CH 5BVPH 5AZEL 2FR4A 1DSFH 4U6VL 2HA1A 5B4MC 1OB1A 1KJ2A 1NAML 2APBA 2CK2A 2EXWD 3RNQB 2CRMA 2JELL 4X4YA 1UACL 3QO1B 5HTSA 2EE2A 1ND0B 3BISA 1GGUA 1HXYB 2OMNA 4CVZA 4LIQH 3GNML 3KYMB 3OZ9H 3MREB 5L9DH 3QQ3B 3E6HB 4J2XA 3INUL 3SPVA 2FIRT 2VDMH 3X14B 4F58L 4HKBA 4H0IA 1UKTA 5L2KB 1GGIH 5AYQA 4G43B 5DR5H 3O4LB 1FG2B 2J5LC 3DVGB 4PJ7A 1L9NA 1MLBA 5TDNB 2GKIA 3WO3B 4PV9B 1P4IL 3B2UD 2D7TH 4YAQB 3SE4A 3T0WA 3UZEA 1KYOK 3UX9B 4NUJB 1N3NB 2QADD 4ORGB 4X5XB 5F7UA 2X9YA 1KLGA 1AKJB 5ID0A 5D7JC 4P2RE 1CICB 3BQUD 5AWNH 5HHOA 5L8LB 4OSUL 1KLFA 2XKNA 3O6LL 4S11A 3HI5H 3IAGC 4D94A 3WE6B 5K59E 1MLCB 1HINH 3O3AA 1GHFL 3B9DA 5FO7A 4IRSC 4JN2A 1AXSA 3OAUL 4NQSB 3BPNC 2BFVH 4OQ1A 4PJ5D 4OCSL 5HVGB 5T3ZE 3EDFA 4KI5D 2O61B 1YPZF 4G8GB 2P49B 4Z95H 4K3DH 1QSED 1BX2A 2AQ1A 2EC9T 5CSZA 5AAWA 1FJ1A 3VFTB 3MRIA 2A9NL 4OFIA 4X4ZA 3PWLB 3PWPA 1D5IL 5GS0H 1XMWA 2VZUA 3GHBH 2A9MH 4G9FA 5GGTL 4TULL 4XWGH 1MFCL 3MLYH 1F2QA 1MRDH 1ACYL 5JQ6H 5EOCH 4G3YH 3DSFL 4L1DA 1UWEH 4OLZL 5EIVA 3UCRA 2P43B 4X6DF 4UQ3B 2ZSVA 3PWUB 4X6EA 2VMFA 2WZPD 1OL0A 2FZ3B 4IDJL 4DW2H 5LVEA 4H88H 1U3HA 4NO0B 3WIIH 4DN4L 3OB0K 1VGEL 1ADQL 2JTDA 4TVPE 4XAWL 3RAJH 1XF2A 1DBAH 1I8KA 1PZ5A 4OCNC 1Q72L 4JDZA 4NHCL 1MCDA 1HH6B 3HA0A 3RPIA 1YA5A 5JPMA 4UU9A 4JM4H 3UMTA 1U6AL 3LQZA 4N8PA 4QHMA 3H9SB 3CX5K 3I6GA 5D9SB 3T0DA 5ECJE 3JWDC 1SM3H 4YBQC 3VWKD 3QUZC 1OF2B 2IAMA 4GBXC 4NBYB 5FYJH 1EO8L 1I8LC 5A43C 4DKEH 1FNSL 2IH1B 2AABL 5JOPD 4POUB 2G2RA 2Y7QB 3NPSC 3UTQA 2P47B 3NAAH 4O51A 5GRXG 3IJYA 3L7FA 4K7PY 5HYEA 3TBVB 1MREL 1WEJH 4POYA 1DDHA 3OJVC 4O2EB 2MFNA 3S4SA 3BE1H 5DS8A 5E00B 2OL3H 5HPMB 3HI6L 3GZKA 4R2GB 1F4WL 3SDDB 5F7WC 4NRYA 3MFFA 4MS8D 5DVOA 4C56B 2F54A 3ARBA 2BNRA 2NZ9C 3I02A 4LSUL 2WBJB 3D2UD 1KEMH 2A77L 4PP2B 5IW3A 3O41A 1RULH 4E42B 1L7IL 5I73B 5EUKA 3WNOA 2LAAA 3L6FB 4BSJA 1A7RL 1OTUD 2P5WD 3LN4A 5MP6L 3ZE1F 4P23B 3MODL 4ENEC 1CE6B 1JGDA 2R4SL 1OARH 3CX2A 3KPLA 1QSFB 1MFEH 3BPOC 3KPRD 3WUWB 2IWGA 3MV7E 1EVTC 1IGYA 3RKPA 2LQRA 3VGFA 4JY4B 4LGRB 4CADA 2OI9B 3MR9A 3PWNB 4HCRL 3MNVB 3NZ8A 3MACL 4Y4FD 1JK8A 3UTSE 1M7XA 3HE6C 4HIEA 3SQOH 1BQLH 5IFAL 3GBML 1NCAH 4LPUA 1XF3A 4HSQA 4DEPB 3B9EA 4E5XA 1FH5H 3LIZH 4CN6A 5JXAH 1EEZB 3QFJE 3MLSL 3QAZC 1QFWH 4N8CL 2HFFA 1ITCA 3STZB 2Y9RT 3M8OH 1QEWB 4UB0H 1INQA 5DK2B 1KCUL 5J11B 5IBLC 4PJBE 1DUYA 4GQ9L 4JFFE 1G9ML 2CK0L 2NY5C 2NW3B 1IC4L 2XWJB 4MQXC 5EORH 2JK5A 2A38A 2H32H 4DVRH 3FB5B 3OF6D 4XPHL 5I19H 2G75A 3C6LA 3G5VA 1NEZB 1ZHBA 2DLGA 1OAZL 2XICA 3HCVA 3SKUD 3FQRA 5CSBA 5E4EB 1PZUB 3NGBB 4RA0C 2Q7YA 1YC7A 35C8L 2BSSA 4LBEB 1CE1H 4OZFB 5ACMA 4X9GA 3QIUB 2P5ED 3GSOB 3RY6C 3KYMA 4E0RB 4PY7A 3UBXA 3ARGB 1GZQA 4JHAL 3E6HA 1CBVL 4GKSB 5TJWK 5T1LD 3UYPA 4NSKB 1HSAB 3VGDA 1I7UB 4G43A 4Q2ZB 3O4LA 4NQED 3VXPB 4BZ1H 3DVGA 3WO4C 2BNQB 2VXUH 3RVWC 3MX0A 5DK0A 2IGFL 4XTRD 1I7ZA 1QKZL 3MRKA 4ZTPH 2DQIL 2J8HA 4S1SL 1FLTX 2OM5A 3BP6A 3UEZA 4KJYB 1OCWH 1A3RL 3MRDB 3NIFE 5TGBB 3RU8L 3IDXH 5J1TC 1FAIL 4JFEA 1FC1A 5IVOA 2VABA 4XBGA 1BD2D 1IM3A 1DEEA 1G7MA 3VI3F 4C57C 1AQKH 2NY5H 1QRNA 5JA9A 3MMEA 4Y8AA 4UMGA 3PP4L 3D1MC 3LMJL 4PJIF 4I3RL 3E8UH 2ZWLT 2A6DA 4WWKA 2A2QT 2ZUQB 4DFIA 4HC1H 4L8SC 5FYLE 3ALPA 4D9LH 5DJ6A 2RGSA 4RZCB 4JRXE 4TUKH 5GHWH 3MV8A 5DJXB 4ETYA 2O61A 2F74B 1TIUA 3D85B 3I3BA 4FFYH 5MEOB 4KUZL 3CFCH 3TH2T 4LCUB 1WTGT 2X4OA 4Y19A 2VXQH 3WN5B 1HOCB 2APTA 3QQ9D 2IBGA 3V4UH 3O45B 4Y5VB 3AS3A 1FFOA 5EC2B 3MXWH 2NTFA 3QI9C 4TNVK 1FNLA 3VFVA 5MENE 1QHOA 2ERJC 1NFDF 4P48A 3PWUA 1EEQA 1UCBL 2FZ3A 4LPTA 4NM8L 3EHBD 1MSPA 5DC4B 2AEIT 3VA2C 3DPBA 2C3VB 1ES0B 1HWHB 3FT4B 5JO5B 3MGTB 2DWEA 2K1MA 1U9KA 4LLDA 1U93A 1ZXQA 4Y16A 1F90L 1JWMB 2FBJH 3TWCL 1IGIH 3H9SA 5J13B 1NUFA 3PQYE 4PLKD 4L5FL 3EFDL 1FDLH 3FFDB 5EO0B 2X4UA 2Y7QA 2EKSA 3IU4H 4P2QB 3UP1A 5EOQL 5LGJB 4XCYB 4V1DE 5GGUA 3WNLA 1IEAB 2DLFL 3FQWA 2R9HC 1T7VA 4O2EA 1A4KB 3ZHLA 1N7MH 5E00A 1Q9LA 2HTKC 1LP9F 4YDIL 4XPBL 2X42A 4KKBD 3SDDA 1LEIA 2YK1L 3GO1H 4QRRB 1UA6H 3DMMB 3HPLB 1IFHL 4HK3J 4XPTH 1SJHB 4NWTL 5ESAA 4DAGL 5L2KD 2PYFB 2WBJA 4M93B 1ZGLA 4H0GA 2UZIH 3EJJX 4YHOH 5C0GB 2VZ3A 1G7QB 4O9HH 2HVKB 5D7LB 1HNGA 2XZAL 5CGMA 4QWWC 5E8NB 3HMWL 5J06A 3BXNA 2W0FA 3D18A 2PYEA 1G6RH 1UJ3C 2YPKA 3HZKB 2H2PC 2P24B 3DXAA 3UYOD 1MEXL 1MFDH 3L3DB 3WDHA 2VTFA 3O6KL 1CICD 5EOTA 2GCYA 2JJUA 3LS5H 2LVCA 5T5NG 6FABH 3LKSB 5T5NF 2IFFL 5MEPB 2DQCH 2GYSA 1I1FB 1KEGL 1KJ2L 3O2DH 4NO3B 4QTHB 4O58H 2FX8L 3G6AB 4NN6C 5TFSL 2HN7B 4XVTL 1QUNA 4BH8A 4MA8L 4G8GD 4M7KH 4PLJD 1I9IL 1HIML 5EU6D 4M61B 1PG7H 1J10A 4LCCB 3BZDA 4KV5F 3SGKA 4LSDA 4QNPE 3TJEL 2VDRL 3ILQC 4J3UA 4PRIA 4KK6C 4JRYA 1MNUH 2D7PA 4ZXBC 3RWDA 1BJ1H 3C60B 1CU4L 1MAJA 3PDOA 1ZV5A 1QEWA 4KHXH 1QG3A 1D9KA 2CDGA 1OPGL 3H9YA 4KUCD 3N1GC 4XVSL 4U6TA 2OR8A 5IW1B 1VCAA 3L3JB 3MLWL 4WY7H 3ZZ1A 1B4RA 4KKCC 2XWJA 4NO0D 2ZUSA 3D87B 3ARTA 2PO6B 5I18L 5I75B 1EA9C 3RGVD 5J7CC 1NEZA 1A6WL 1P7QA 1SMOA 5JA8B 5HI4C 4UZGA 1C12B 5BRZA 3S5LA 4YWGH 3FMGL 4MZ2A 4J6RL 3HRPA 3GSNA 3LKPB 2BSED 3C6SB 3GSWB 3P2TA 4G7VH 3QIUA 5EIQA 4NYLA 3BH8A 1LDPL 4OLWH 4ZS7H 4YHML 4K2UH 4OFPA 4GKSA 5T5FH 1C1EL 2Z93B 4PJCE 1D6VH 1RUPH 2FH6A 1JNHA 2MNUA 4HS8H 4LDLB 1IAKA 3FOMB 2MMXA 1F13A 3C08H 4R2GD 2OTUB 4ZMAT 4OCYL 2VQ1A 4C56D 4ZDHA 1PKQB 1XIWC 1YQ2A 4N1EA 5EBGA 2NR6C 3OAZK 5TGBA 5C1MB 2Q3ZA 1LDSA 3IDNB 3TH3T 2P46B 3VW3L 1F3DJ 1BIIA 3HAEA 2EIZB 4X9FA 3BGMB 2HT3D 3QNXA 4S1DD 1HHHB 4P23D 4DUVA 1P6FA 1LO5A 1X5LA 2H3NB 1MCHA 4LSSH 3P30L 3BD5A 4XZUA 5F9OL 1D5BB 3GJFA 3V52H 1QSFD 3MV9E 4P9ML 3BMVA 2VIRA 3TBWB 5EIIA 4ZSOB 4LSTL 2YZ1A 4LCWE 5L2JA 2F74A 2HT2D 3CUPB 1VGKB 3L5HA 3TYFA 2VXTH 3HMXH 4RMWA 5TH2A 1U0QA 3FTGB 5EU4B 3B83A 5I8CB 5F7DA 1MCCA 4NDMB 4MX7B 4XCNA 1G1CA 1XGUB 5I9QC 5EC2A 3P0VH 1J7VR 3DBXB 5BZWB 3QIWD 3G5ZB 3PL6C 5CKGA 1R5IA 2FO1A 4XCCH 1PKOA 2IPUG 3D0LA 4KMQA 3CLEL 1OY3B 2B4CL 5J12B 4ODTL 2LVEA 2DN7A 3B5TA 3MLUH 4Z5RB 4GG6E 2V2WA 5B21A 5C0BD 4OCLC 3Q1SL 1Q1JH 2FX9H 1U91B 2AV1A 1TZIA 4JR9H 5FOBB 4OLUH 4YDLB 1NLBH 3DUSA 4QRTB 1UZ6E 3O3DA 4ZNEE 3CZJA 4EDWH 4PRHE 1KYOJ 4OZHB 3FO1B 3REWB 2QTEA 4LLYB 2AW2A 1M4KA 4WU7B 1LWRA 2Z92B 1BGXH 1IEAA 1SEQH 2X1QA 4JZOA 3QDME 5FKPB 1JFQL 3VG0L 4D9QE 1S7RB 4RMUA 1OWRM 4J23A 3OXRA 3VGGA 2DWDB 3ARGD 3QZWA 2IH3A 1AGEB 4UNUA 4G7YH 3LKOB 3VI4F 1QQDB 3T65A 1INEH 2NYYD 2DBLH 5H94A 3JZ7A 1A6UL 2BNQD 5HI3C 2DJUA 5GISL 15C8H 2HVKA 3SDAB 5IVXA 1OM3H 3IS0X 1NFIB 1ZANL 4TSCH 4JZJB 1CCZA 2DKMA 3F7YB 4NN5C 1MJ7H 3H8NA 4X6BB 2CLVB 3KYNB 2JJTA 2UVFA 1RK0A 1NGQH 4X0KA 4W4NA 3T0BA 2APXA 1OVZA 1OAKH 2QQNH 4NQCE 4B7LA 4FS0A 5E6IC 5I6XB 3LKSA 1MCRA 3LQMA 1CF8H 4GRLC 3UC0H 2Z91B 1XCTB 3FOLB 3RI5F 4NO3A 1I85A 5D6CA 5KW9H 3G6AA 5A1AA 2HN7A 1VDGA 4BSWB 2R69H 5HHPA 3D85D 4QRSA 4M61A 4LCCA 1ZA6B 4R4ND 5AD0B 4LVEA 3WFDL 2AK4B 5ID1B 3U6RB 2CPCA 4FZEL 1B0GB 5T1KB 2EZ0D 1WISA 2ILLA 3MUHL 3GHEL 2E7HA 1EGJH 4ZNCD 4Y2DA 4IHOB 4GAFB 1S9VB 2CMRH 3ETBF 1UM6H 1YNTB 4FQXD 1ZLVH 4LRIC 4NQDB 1XR9A 5I15H 4P59H 5HDQH 3LS4L 2YD7A 3SE9H 2X6MA 2HTLC 4LVNC 1IAII 4HJJL 4KAQL 1TCMA 4OLVH 3RVUD 1KNOB 2HG5B 2FO4B 2YA2A 3L5JA 4LEOA 2F5AL 4ERSH 4POZC 4P57B 3FRPA 1AE6L 5D70H 2DQJL 3QBTB 4L4VB 3RJQB 1E4KA 1LD9A 4Z0BL 4XC3L 4GLRI 2DQGH 1T80A 5F7YC 4G80B 4RMRA 4TYUA 5EG6C 2Q86B 1UH2A 2B20A 3ARDD 3FHQA 1FBIL 5ANME 2AQ3A 4WTXA 3O4OB 3WXWH 4QXUH 3KXFE 2B39A 5HDLA 5T33H 4M7LH 4KU1A 4N0CD 4DVBA 3GBNL 4G5ZL 1JPSL 2CKBA 3QDGE 3MZTA 1TETH 4OT1L 3C5SB 4LPYA 5CEZL 3HPJB 3QCUH 4KUCF 3D3VA 2W0KA 3SKNB 1IGCH 2OTUA 4UNVA 3P4MB 2V5SA 4DUXA 4QRRD 2Z9TA 5K9QI 3DMMD 2HFEA 4GAJL 5FIEA 1X4YA 2F53B 1DQJB 4WHTA 3TNNA 1P4BL 3JTTA 1K4DA 2WQRA 4Z7VB 1N5AB 1NJ9B 2MPAH 1UXWB 1U8JB 5D7LD 3U0TB 1A6TB 3A0OA 5IK3B 5ITBH 2BMKA 5DJ0A 1U41A 4R0LC 4PD4J 2W9DL 3GK8L 1DVFA 4OJFH 2XZQL 2CJUH 5CJOH 5I1KH 4I77H 3JVGA 4WUUD 5TE7L 3EJYC 4P3CH 5IFJB 2EKJA 4XPFH 3VWJD 4PUBH 3NCMA 4PRPA 1N0XL 2D03H 4HWZA 1HYSD 3PHSA 3CNKA 3Q6FB 3TV3L 1XGUA 2R23A 1CTOA 3AMKA 1WWAX 3DBXA 5BZWA 1IKFH 2YEZA 1HE7A 1NMBL 4QXGH 5K9QG 5I16A 4EN3C 4LVHC 3H9HA 4H1LA 2H8PA 2VLJB 5D7SH 5D1XB 3VGHA 2XN9A 4MXWL 4OCWH 4P4RA 5C07A 3QWOB 1H15B 2VZVA 3K0WA 3C60D 4XI5C 4FOMA 4G6AD 2D4DA 2X44D 5FFLA 1I4FB 5FOBA 2IPKB 4I0PA 4HJ0D 4I0KA 3TN0B 3N1FC 2HT4C 4WEBH 4XX1G 3WUWG 3U9UB 2DQUL 1MHPH 3P11H 4WIQA 4HPOH 4HV8B 2PO6D 3NMEA 5HHQA 5IJVA 4OZHA 1CFTA 3MOQA 3QWRD 1P1ZB 1ZEAL 3NFPA 5L6YL 3AXLA 2ICEB 1QSVA 1GC1L 3G5XA 5DHYA 2HKHL 3MJ9H 4WFEE 4ZYKB 3X12A 3X11B 4I48B 3DX8B 2FATH 2ZCKH 1JTOA 1GGBL 4MSWA 4YZFE 2DAVA 1G0XA 3GMPB 3WYRA 1GH7A 4RWYH 2DWDA 2MHAA 3MRGA 4JKLA 3G08B 3DVNB 4HWEL 5I0DA 2ICWB 5L88H 1J0HA 5JIKA 1GOFA 4GMTH 1QQDA 1BOGA 3J7HA 2BNUA 3QISA 3U0PA 3AREA 3OKEB 4U3HA 3TZVB 3UAJD 2VDPH 5D7IA 4HS6B 5EFIA 1H8NA 3V0WH 4I1NB 4ZS6C 1DN0B 3MUJA 3WKML 3QSKB 4NFCA 2JJSA 1NFIA 2XWBB 5IHBA 5A3IC 3P9MA 3F7YA 4NO2A 3MOAL 2D9CA 4X6BA 4CJ0A 3C9NA 3QHFL 5LCVH 2APWA 4PS4L 1RZ7H 1FRGL 2GJ6B 1A6VL 2WAHA 5F7KC 2R8SL 4L3EA 4PBVC 5EOCJ 5TDOB 5DLMH 1OAQL 1FN4B 1FSKB 3CAFA 4OZFG 4YHZL 1EEUA 4OZGB 2BVUA 1UVQB 2NXYB 2LV4A 5EZIH 3RGHA 3GSNL 2EDTA 1KCSL 4TUJA 3VFWA 1N5YH 5GGVH 1O5DT 5F7FA 2Z35B 2HMIC 5LBSH 3C8KB 4MJ4A 3CVIL 4M1GL 3HUJB 1ZA6A 2VKXA 1ZT1A 3F58L 1WAAA 3TBSA 2FNBA 5ID1A 1CL7H 4OIBA 3VXRA 3P40A 3QHTC 3IJSB 3L5WB 5IGXH 3V2AR 2GY5A 5HHMB 3VXSE 4E41E 4TUOA 4Z7UB 5HYFA 4AK1A 1T1WB 5EBWB 1GOHA 3IRPX 1C5BH 2FJFB 2CLRB 1B3JA 3IXAA 2R1WA 4XNXL 4F2MB 5M94B 1A7PL 4FXGB 3TP4A 3JUZA 1HHJB 1HEZA 2E3VA 1ZVSB 2FO4A 4P5TC 4Z8FH 3BWAA 2B5IC 1S7QA 4QRPA 4UAOB 1H5BA 1UQSB 3BO8B 1G7PB 4NOBA 2P8PB 1DQMH 3BKMH 4HGWB 2AJSH 4IOFD 4PJ9B 3FAXA 1V3JA 3LVEA 4HXBL 3HG1B 4XMPL 1XGRA 4PJXA 5IVZB 5C0AE 3RX5A 2Q86A 1UXSB 1CVSC 5E8OA 1MRFL 3DHJA 4RX4D 1TJGH 5JR1L 2Z8WC 1NGPH 3C5SA 1QSEA 4ZAKA 4IS6A 4G42B 3WV0A 1A7NH 3SO3C 1CXFA 3QFDB 3BUYA 5D1QA 3P4MA 5EU5A 3UPRA 5JZ7C 3QNYB 4WHDA 1EFXB 3HZMB 4HHAB 3CXDL 2BSRA 5F6IB 5KN5B 4HIXH 1K8IB 4U1NB 1YUHA 3B6SB 4Y4KB 2OJEB 3SDAD 3VFUA 3RBSA 4MJ2A 3OKKA 1TZHA 2IBBA 3V8OA 4GKNB 3NIGE 4F3FB 4K3JL 4M6MH 2A6JA 3R0MA 2CXKA 5IFJA 3KPPB 3BMWA 5LXGL 1T89C 4XXCA 3O6FA 1J5OL 1TQBB 1T0MB 1JMZA 4DN3L 3JV4B 3Q6FA 5CZXD 3RFZC 3I6LE 5C3TA 2EE6A 5E2WH 4Z7WA 3MRRB 2H9GA 4LHUA 4NJ9H 5DD6B 2V5MA 3P4LA 1CGWA 1W72B 1WZMA 4NQXA 1F11B 4WO4D 4CUCA 1GJIA 4ZTOL 4NN7C 1YEJL 3V4VL 4K94L 4GG8A 3TGXA 1GOGA 3QWOA 1H15A 3LKQB 5T1KD 5DEFB 3IDGB 3MLXH 3QRGL 4G8EA 3VDBA 4K3GA 5F3HA 2E7BA 5ADOL 1AD0B 1MF2H 3QDHA 3UTTB 5L7XH 1P7KB 3P9LA 5D1ZB 3QXUA 2LABA 3Q48A 3BEVA 4BELD 5F8QC 2BC4A 1MCOH 3QO0B 4URTB 3IF1A 1VHPA 3LKNB 1AGDB 1FGNH 2PKDA 4L4VD 2J88L 1GIGL 2NY7H 4XPGH 3ARFA 1Z5LB 3HN3A 2Z31C 2Z8VC 2ICEA 1NCBH 4G8FB 2NY1B 4WU5B 1FQ9C 4ZYKA 1NBVL 4NM4H 1OGAB 3QXVA 3DX8A 3UTZB 1NLDL 2D7NA 4O02L 4LNVA 4MDIA 2VDNL 3ZKNC 2VC2H 2GSIA 3CFKA 3DVNA 3F7RA 4X7CC 4WW1A 4LDOB 4OLYL 4U1GC 2XKUA 5IF0A 1VFAA 5HSFA 4FQLL 5CS7A 2BJMH 3QDJB 3OKEA 2WUBL 4AYFA 4R90H 3WXVL 1CLOL 2EC8A 4NZRH 1LMKA 1X7QB 2FB4H 4HS6A 4BKLB 5B39B 2H45A 4OLEA 1RK1B 1CLZL 3L5XH 3OXSA 2F53D 3FRPG 5FKAB 2HVJB 5GJTH 1GL4B 1IL1B 2UWEE 3LQAL 5DC0A 1T0NB 4DQOH 1OQXA 3C8DA 4HZLA 4KK8D 3B5HA 1YNKL 4WJ5B 1IKNC 4OFVA 2YD9A 1MIML 4JDTL 4X8JA 3IFOB 4C55A 3WIHH 4IRZH 5E2TL 3RWHB 1KXQE 2FH8A 2R0LH 3K4DA 1KCLA 3LKRA 3O8XB 4N8CH 5E7FA 4UDUB 1Y0LB 1ULVA 3WLBB 1S7TB 4OV5A 4HKZB 5C0CA 2A0LD 5JQHC 4FMFA 3F7VB 1NEUA 1F8TH 4K3EH 4NFDA 2CKBL 4YDJA 5IB5B 2J8UE 2K3TA 4I2XA 3V8CA 3L5WA 1CGUA 3MRHA 1YEEL 4Z7UA 1KN4H 2VZ1A 5C08E 1KOAA 2ZOLB 5CWSA 1T21B 2FJFA 2IANB 3DX6A 2VLJD 3MCLH 4NNYA 1M05A 3VRIA 1MCBA 4PG2C 4RAUB 1R3HA 4M7ZC 5T3XL 4N1HB 4CGTA 1FFPB 3AM8C 4HKJB 2ZOKB 1X5YA 1S78D 2AEPH 2LAGB 4HULB 2Q1EA 3TN0D 3RWCB 2VLRE 5IVZA 1JNNL 2M1KA 1DBKL 2DMKA 1UXSA 3TNMB 3B2UC 4NHUA 4WI6A 4P2OA 3MCKB 3W11C 4YPGA 5KSBB 2O5ZL 1R3IL 3JV6A 2BVYA 1I9JL 4TSAL 2IADA 1P2CB 4GW4A 2ZCLL 2DQIH 1HHGB 1I7TB 4M8QA 3BN9D 1OAXH 4KHTL 1U42A 1WGOA 3RU8H 2EDXA 3BQUC 3STLA 3PE9A 1IQWH 1RZJL 3P77A 3GJEB 4KTDL 2RCSH 5C3LD 5JOFB 3PV6A 4PJ7E 4E9LA 3LPGA 1EFXA 3EOTL 3LMJH 4RAHA 2ITDB 4P2RB 4HHAA 4WHYG 4XNUL 3CGTA 2P42B 1L4IA 4OTXL 2WANA 3TZVD 5GS1B 1XGYH 4OUUA 2AJUH 3ULUF 4JLRA 2V17H 4MNGA 1EFQA 4ZPTB 4JG0H 4OCXL 5HYJE 2PW1B 4YHKL 5KOMC 1YEFH 3EYUL 1OSZA 2J12B 5KSUB 4OZHF 4F3FA 4RISH 1PAMA 1SYSB 3MRPB 5HHOE 4BFGA 2YD6A 3ALXA 2YPLA 2GJ6D 1BJ1J 4J3SA 4PGZA 5D93C 1JTPA 4D2NA 2DDQL 1WC7B 2ARWA 1KIRB 2FJHB 3GSVA 3FONB 4OFYD 3V5HB 1T0MA 2VSDA 5ILTH 5BZDA 1ZHLA 2NXYD 4KGLA 1ZK9A 5I66A 4JN1L 1TVHA 4MD0A 4KVNL 4MAUH 3QUKB 1F4YL 1MIEH 1O7SA 2X7LA 1F4HA 2FLBT 2EYRB 4Q0XL 1EERB 3PWPE 3GEWB 1IC7L 1ZHKA 3H0TB 3CJJA 1M6OA 3C5ZB 4G9FE 5DDHB 1WF5A 3HC4L 1WT5A 4F7PB 5IMKB 3VWKC 2DKUA 2DF3A 2AXJA 4LLAA 5FGCB 3TWCH 3IDGA 1JVKA 5HHMD 3IDIB 1Z2KA 4NO5B 4WNQB 5E2VH 1IJ9A 1UC6A 4JPKL 2OYPA 5FYKD 2KL6A 4M7LT 4UOW0 2BY1A 1P7KA 5D1ZA 3LOWA 3M17A 3U30C 1A7OH 4JO2H 1J8KA 5DHVH 4M00A 3GRWH 2ZJSL 2BOCA 3HI1A 5E0QA 1MI5D 3QHZL 4GSDL 2PCPA 3BIAX 3LKNA 3BDXA 3BIBX 3OTTA 2FWOA 3G6JA 4PJ9D 3T08A 4Q6IA 1EDQA 3F5WA 4G8FA 4NT6A 3HG1D 4UOJA 1KJ3L 2EDWA 4XT1C 5BS0A 3UTZA 1PVHA 4HWBA 1OTUC 3UJJH 3MRJA 4PYGA 1MCPH 4GOSA 4EI6B 3KNBA 4MAYB 4YHNA 1BFOB 3GMOA 3N0PB 2RR3A 3BEWA 2BVOA 2NW2B 4WFGE 4NGHL 5I1CL 3HMWH 2NXZD 3OKOB 3DX9A 4X5WB 1Q0YH 1E6OL 2Q20A 4KQ3L 4LSQL 3WJLA 4WTZG 2F54E 3V9FA 1JHTB 5B39A 4P4KB 3TVMA 5IWLC 2BNRE 2IC2A 3PWJB 3AGVA 4U2ZA 1QA9B 3RX7A 3MRCB 3QUMB 1RIHL 4Y4FC 4Y5XA 4PJ8A 3TO2A 1SY6A 4AEIL 4APQD 4EQ3A 2LU7A 4RGNC 1K4CA 3MV7B 5F1IB 2C1OB 4WDIB 1KJ2H 1ZHNA 5DWUL 4Y4KD 4OF0A 3V79C 5D72H 2WINA 2W9EH 1MRCH 4UIKL 1CG9B 1S7SB 3UTSB 4EVNB 2VDKL 3B8YA 5C8JA 4JZNB 1U8IB 2J8OA 2DLHA 1TFHA 1Y0LA 3D69A 4YNYA 5D2NA 3QFJB 1OPGH 3GKZA 3KJ4B 3F7VA 1GZPB 3UJIL 2I26N 5GRWA 1RIUL 1NH6A 2DTML 2W65A 5IB5A 1LEKA 3MA9L 2RQ8A 1NANI 3O9WA 2J3SA 4RWHA 3V7AG 3QPXH 4PJBB 4KC3B 4JFFB 5CILL 1RFDH 1VSCA 2L4OA 4KZEH 2IANA 3SOBH 1MFAH 4Z7VF 4UT6H 4AQOA 3T8XB 5JW3L 3JBG7 5KZCD 3FO9B 1N6QH 4JHBA 2D7QA 2NY0B 5I76B 2HJKA 5J6GA 4L8DA 4KPHH 4KRPB 4HK0B 3ZDYF 4CMMB 1OW0A 2ZOKA 5TF1H 5JW4N 2FBOJ 1FZJB 1LDPH 3UTTD 4F7EB 4PRNA 4WV1B 2YD4A 4HWNA 3RWCA 4KTEL 5CBEB 1DQTA 4LMQI 2AKRA 4BYHA 3CFBB 4LKCB 4XTRC 2J7LA 1N4XL 4NPYB 5LGKA 4UT7L 5KSBA 3ARBC 2R39A 2CUMA 5IESH 3OPZL 3TBTB 3EAKA 4WFFE 2NY1D 5KBNC 4KKAD 2HLAB 1OGAD 5DJZB 2FIKA 4MZ3A 4R6UA 1IGJB 1FNGA 1HCFX 2BERA 5B4MD 3GJEA 1RZFH 1QZ1A 4DZ8B 5I1DA 3O3EB 4BH7B 4GKZB 3O4LE 3NFNB 2E7LA 2HKFL 1WBYB 2D0GA 3QIWA 1FYTD 1PBYA 1OD7A 5GS0D 1ZWIA 3QDJD 4BUHA 1UB5A 3G5YB 3CPLB 4OBRA 4JFEE 3S36L 2E6PA 5C0BA 5C92A 1J86A 4LSTH 2XQBH 1QBAA 2F58L 1A2YB 1CD0A 2FYYB 3WS6A 4FP8H 4JRXB 1QRNE 1QO3B 5BJTA 1M7IB 2X41A 1A1MB 4XHJD 1ED3A 3NCJL 4LLVA 4FQIL 3JWNC 1E4WH 1PSKL 3V5HA 5F9JA 5D7JD 3L3GB 1A5FH 3KHOA 2ADGA 5DUBA 1YEGH 3MV8E 2WM0A 3ZE2F 5MENB 3RRQA 3CIQA 1UYWH 5ICXB 5H2BB 2D7MA 2QR0B 3O8XD 4Y19E 5CEZE 4IRSD 2PETA 2DQFA 1D6EA 4LKXA 5EBLB 1MQKH 2A1WL 3C5ZA 5JPNA 3B2VL 4EI5B 4PLKC 3THML 3SHSA 4XCFH 5IFHL 4GAYB 3QUXB 5J4MA 3B3IA 3C6LC 3EYOA 2O5XL 3PIQB 2EE3A 1SJEB 4NO5A 5LWYH 4WNQA 2HAZA 3BIKA 3N1QC 3SE3A 4AG4L 5HYSB 3PQYB 4RA3A 1GPOL 1FNEA 1I1YB 4OM1L 4C4KO 1KN2L 4XP1L 3GMMB 5DJ2B 5CP3H 2AJXH 3QIBB 1NSNH 4K23L 1XGTA 3VD7A 3IFPB 9CGTA 1JFQH 4XXDB 4OZGF 1JRHI 5K9OA 3H9SE 4V1DB 4XNQB 4FQCH 4M7JL 3MBXH 3OMZA 5DA0B 1DQLL 2VAJA 1DANU 3NABH 4KDTC 2C4FU 1EHNA 1NMAH 2RAMA 1R3JA 3HUJF 1LVEA 2WP3O 3G6DL 2F5BL 2UY6A 3FCTA 5CJQH 1EZVY 2YC1B 3N85L 1BFOA 3MRBB 2XA3A 3B8SA 3QUZD 2AJZB 1A9EA 1JWSA 4Z7UF 3OKOA 5DMKB 1WFNA 4X5WA 3BGFB 4P9HL 2FSEA 1ZANH 2MJWA 4NRXB 5I8OL 1CICC 1CDGA 2XG4A 1KC5L 2VYRE 4UV7H 5ITFB 4UBDD 5GGSA 5A2LH 1K6QL 3HS0B 3PWJA 2AJVH 1L6XA 5FHAL 2VXVL 5DURB 4L9LB 1QNZL 1AIFA 3M07A 4P2RD 3LDBB 1S7VA 4LVOC 4LPVA 1UM4L 5KSAB 3SDXA 5F1IA 2OR9L 4J4PD 4KY1H 4PLJC 3RY5A 5DJAB 2PYEE 1T04A 1MFBH 3CFDB 4NQTA 1GSMA 3EYFB 1MJUL 2R0KL 3DXAE 1CG9A 5J6HA 1F02I 3ZSSA 1X44A 4L29A 5T3ZD 1T1YA 4ELMA 4DUWA 5I1AB 1FO0A 1ZE3C 2DQDH 3L1OL 4IOSD 4JFOB 3WFHB 5I17A 1RIVL 4GMSL 5CBAB 2JIXA 1LHZA 1S9WA 2XRAL 3SGEH 4FNLL 3S96B 4JFDA 4JO1L 3RGVC 1NBQA 2G9HB 3AB0B 2QSCH 2NPLX 5INDA 1KFAH 1DZBA 3RBGA 2FHFA 4PRIE 4JRYE 1KIPB 1OHQA 2DQJH 1AQDA 4YDKH 1FL6B 4X80L 4BQCA 3SGDI 4M5ZL 5C0EA 3LAFA 4XH2A 3U7AA 3W9DA 3U7WL 1LO3L 5F7EL 1FBIH 4G6FB 4LRNL 2CIKA 4GW5B 1TJIL 2AXHA 1MPAL 2EDFA 5FB8A 4M62L 1U8HA 5CBEA 5GRUL 4J3VA 4G5ZH 4H0HB 5KVDH 5M95B 2QQQA 1CR9H 4C4KT 5BRZE 4R2GC 3CMOH 2NX5B 1AHWA 1MCSA 3KLAA 1A02N 5CCKL 1XCQA 2I9LB 4PJCB 3UTOA 3TBYA 5BQ7B 1U8KB 4WUUA 4AIZB 5B3JF 1BAFH 3H42H 2UYLA 4JPIB 5IQ9A 2RJMA 2K9UA 4F9PC 5K9KA 4OM0H 2WBJC 4MNQB 2HLAA 3LV3B 4NKDA 1IC5L 1UADC 4MA3A 4Q9BA 3DTXA 1IGJA 5I73C 2Y72A 5HYQB 2LU3A 2ZUTA 5IB1A 3O3EA 4ONHB 4HDIA 4P23C 4MAYD 2DL9A 1IAIH 1Q94B 2WWKO 3S36X 1G6VK 3ILPA 3KYOA 2VITA 4B0MM 3NCYP 3RIFK 4LCYA 1IM9D 1K5NB 3FQNB 1PD6A 4P4KD 4X7TB 4ODHH 2OI9C 5J0BA 2R2BB 1A2YA 2DJSA 3MV9B 5CJ8A 2O5YL 4OD3L 1HQ4A 1YC8A 4LCWB 4YGAB 1A1MA 1AY1L 2VE6A 2MKLC 3MV7D 3CCHB 1JHKL 1V7NH 3TIDA 3FN0H 4DEPC 5C0DA 1GAFH 2MQ3A 4ODUA 3BP7A 3QEGH 2IG2L 3WIFA 3UTSD 1FORL 5E99H 1EIBA 4ZO8A 1NGYB 2A73A 2XPGA 1B0RB 5J11C 4TNVF 1A6ZA 3Q5YA 4HWBL 3HNVH 4M4PA 4N8VB 4W6WB 1WFOA 5GSVA 3EYSH 4ZUSA 3QFJD 3KJ6H 3BN3B 4GG6B 5FO9B 4IMLA 3V6OC 4AENB 3JWOL 3QUXA 4KJWD 3VFNB 3PIQA 5JDSB 4YC2B 4OLXH 4YHLH 2OMBA 5MERA 2VISB 4JFFD 4RMQA 5E4EC 4QCIB 1KB5A 3ARUA 3S88H 2X4QB 2VDOL 4GUPB 3TA3B 1NCTA 3PQYA 3BP7B 3NGBC 3QXTA 3SDCA 1DUZA 1L0XA 3AVEA 3W39B 3VXOB 5EUOA 2G60L 4PRHB 2JLLA 3QIUC 1BPVA 4CU8A 4XP6L 4KRPD 1CWVA 4HAFA 3ARGC 1CDIA 3CK0H 5FHBL 5CIPB 3W0WB 3KDMB 2EC9U 1MVUB 1J1PL 4HUNB 4XNQA 1XR8A 1U3YA 4FHBD 3ULVL 4OF8A 3FL7A 3RZCB 2NYYC 3U36A 4M6NH 2B7DT 5CLWA 2OR7A 1I1AA 3LH2H 4HGKC 3MBEB 1FZOB 1CFVL 3T0EA 3IFNL 4OUOA 4UTBH 2YC1A 5D4QA 3Q3GA 2GJZB 4BFIB 5HDBF 5BOPA 1T5XB 1KTLB 1XZ0A 5DZNA 5DMKA 1FLRH 4NQVA 1S9YB 4WCYH 1A9BB 4XP9H 5BXFB 1OSPH 4PGJA 2AV7A 1KPRA 3FQUA 4GXUM 1DCLA 2C26A 2PTTB 2R9HD 5KANI 1YMMA 4I18B 2YRPA 4J12A 2ZUQC 4UV4H 5ICZB 1CDBA 5DVKA 3WD5L 3AY4C 3I75A 2EH7H 4YHZH 2WWKT 43C9A 1G7IB 2N7BA 2XV6B 2X40A 3QR2A 1ACZA 5BV7B 5DZOA 2OSLB 4Y4HA 4PGCB 3GIZH 4NQCB 5IVXE 1A21A 4J8RA 2Y36H 4R4NC 4EUPB 4OZFH 3CFDA 3DYPA 1MJJB 4IRJB 5FYLD 3TM6A 3WN5C 3WFBH 3BKCL 3DX7B 2GEEA 2J6EH 2EZ0C 4Y5VC 3A6BH 2ADJB 5KSBF 4EDXA 3GKWL 1K9TA 4PRDB 4JFOA 4UIMB 4JAMB 1C5CH 2VL5B 3CZFB 1LE5A 1YN7B 1JI2A 5CBAA 3N9GH 5DMGC 5F6HJ 1UM5L 2EDRA 4Q9QH 3KPNA 2X1OA 2OP4L 2Y07H 1ZT4A 1BZ7B 1EEYB 3RVUC 1RMFH 1YQVL 3HB3D 2G9HA 5MEND 1CXIA 1FIGL 4U7SA 4CL7A 1P4LA 3U1SL 3SCMA 4PGBB 5J13C 1QRKA 4JREB 4XBPA 2CDFB 4EI5D 3SGJA 3DURB 3N1PC 2W07A 2VL4A 3VD3A 4OZ4B 4FXKB 1J05B 1BFVL 4PB0H 3CMGA 2XTJE 4XMPH 5K59F 1F6AA 2BP3A 2BVPB 4QT5A 3BZ4A 4N0CC 4NZUH 2AJYL 5C6WH 1JN6B 2DYPA 4WGWB 5DT1H 4D3CL 1RY7B 3TO4B 5ANMB 3TFKD 1MRFH 3BKYH 4ZUVB 5E94A 4HIIB 4D9RE 5DJYB 3H7BA 3QIBD 3IDMB 1MFNA 3KLSA 2NX5A 3QEQA 3ZYIA 3ZMRA 5DQDH 4KROD 4O2CB 3O0RL 4V1DD 3VFMB 3DMMC 1U8KA 2EIDA 3QDGB 4JM2B 1DBML 3BPCA 3V6FA 3ALWA 2RFXB 4LLUB 1OP9A 4YR6B 4RBPH 4M93C 4MNQA 3LV3A 3MNZA 1DN2A 5ESQB 2MWCA 4YGVB 1W0WB 4P46A 5C6TH 5C0FB 4HMEA 3CDGA 1G7LA 3IKCB 2YA0A 4HH9A 4HG4J 2ICES 1SJVA 4PRAB 3D3VE 2QV2A 5LGHL 3MV01 4PJDA 4WI7A 1Y18B 3BSZL 4U1KB 5KVFH 3VWJC 1KT2A 2X4NB 3TJHD 1KENL 4OFKA 1U2CA 1HYSC 5B8CB 1S7XA 5T3XE 2R2BA 3LD8B 2GTWB 4HAGA 5DURD 1TITA 2E9BA 2FDBP 2R56H 5FA4B 5GS3A 4ONFH 4QRQA 5KSAD 4DN3H 4HUUB 3MNWA 1NAMB 1HSBA 3QCVL 4JFYA 4LLMA 4QRUB 3HE7A 4LARH 4CDGC 2PXYB 2CO7B 5C7XH 1UWGH 3R8QA 2HYMA 5IEHB 4G6JL 3QNZB 5FUCE 4FQ1L 4WFHE 1N6UA 3C60C 4G6AC 4PRPE 1NGYA 4QF1B 1AI1H 1FFNA 4M48H 2R0ZH 1B4JH 3FFCA 1AJ7H 4HJ0C 2WMPA 5F89A 3R06A 5C2BL 1MWAA 2XA8H 2GAZB 3NFSH 5ADOH 3GUTB 2PO6C 3Q5TA 1KIQB 3MYJB 2P8LB 4AENA 3RWEB 5I75C 5GQBA 2Y5TB 4R9HA 3MROA 3DETD 2X70A 3QCTL 2NMSA 1WBXA 4WVRA 4LCIH 1T1XB 1WIOA 3A67L 4QCIA 3W9EB 5JHLH 2XN9E 5ISZA 5C07E 3AU1B 5KVMC 2P48B 4ZFGH 4U1MB 4XC1H 1ZGLP 4S2SA 3VXOA 2IALA 4QGYA 5CEXB 2YMXL 1NBVH 5EA0H 4ESKA 4X8XA 3IVKB 5IHLB 3W0WA 1T5WB 4YHIA 4G6FD 3AAZA 1YNLH 3ULUE 4CNIB 4JFPA 5FK9A 5E9DA 4FFWD 1ITBB 1XGQA 5IBTH 3MUZ1 1WVZA 2MCG1 4CVXB 4OLYH 3UAJC 2H6PB 5F70A 3MBEA 5FXCH 3RA7L 5DJDB 1LO4H 1FZOA 1WQVT 3KR3L 2VQUA 3BPLB 2BHYA 2ZCHH 4ZD3L 1FO0L 5DQJA 5K93A 3BH9B 1WZKA 1BFSA 3DLQR 3I9GH 3BVNA 5HHNB 1F2XK 2R0WL 3VGBA 5JIIA 5J9PB 3VXQB 1C5DB 4PJBF 1DBJL 3VG9B 4ODSL 5IOPA 4I5BB 2DS4A 4MXVF 3BRDA 2B2XL 2BDNH 1RURH 3MRMB 3C8HA 3PWVB 3J8F7 1MHCB 1QR4A 3PDGA 5ICZA 1A6AB 3NH7L 1TTGA 7FABH 1YEHH 1AGFA 3T2NL 1YNKH 1JGUL 3KS0H 5D7IE 4GW1B 4ZQKA 3QULB 3EDJA 4PGCA 3KLDA 5ERWB 1RJYA 4I8DA 5E2TH 3ZT5A 1YJDC 4I3SH 5HI3D 5CGTA 1I8MB 4R7NB 3DX7A 5DD3L 2I60H 4HUWB 1MQ8A 2ADFH 3L3OA 3RL2B 4LAJH 3GIVA 4L3EE 3DHMA 4LCWD 2W38A 3BD4A 4ODVL 4H25B 5KVEH 1KBGL 3HRZA 5J12C 2ORBL 4MDJA 3REVB 4UTAL 5CGYD 3VXSB 3WHE1 4E41B 4YLQT 3NIFF 2IF7A 2P8MB 1RZGB 5CJXC 5E6ID 3BZEB 2WW8A 3RWJB 2YBRA 4XNYL 2HJFB 1F3JB 3QQ4B 3VH8B 1OLZA 5DD5H 1WAAE 4K7PL 4NP4L 4YDLC 3VXRE 4Y1AD 3KPSA 5A2FA 3PABA 3ULUC 4WW2C 4XRCB 4FXKA 2A6IB 4OD1H 2G5BB 1CD1A 4RQQA 4D0DA 1S7UA 4EBQH 3D39A 3JTSA 2CLZA 1G9NC 2CD0A 3T4YA 3RDTA 5GIRA 3TA3D 1MAML 5HGHB 4QEGA 4NNPL 1UH3A 4MD5B 5C0AB 4ETQB 3O2WL 4JQIL 1U8QA 3GJFK 4QRPE 2HLFD 5IROA 4HIIA 3TPUB 1UEMA 1QFUL 3MRFA 4PRHD 1YJDH 3U46A 1GRWA 2PR4L 4OV6F 2YOCA 5TF0A 1EMTH 1RUKL 5GGRA 1T6VN 4PJXE 1BM3H 2HJLB 1CGSH 3QDMD 1IGFL 3RZCD 4MB4A 4N9OB 3QG7L 4D9QD 4PGEA 1J8HD 2ADIA 5ESQA 3MJ8B 1J88A 4XHQA 5EO9A 5FO8A 2VZOA 2CGRH 4YO0B 2X4SB 3IKCA 4FQJL 1BQHA 1JGEB 4KI5E 1MCKA 4OTXH 3SDAC 4CN4A 4DCQB 4F33B 1QSEE 4JZJC 1CN4A 1CDHA 5I30H 3VCLB 4HGMA 1Y18A 4Z18A 2VDQH 5HYSG 2OQJB 2GK2A 3HNTH 1OGTA 2H26A 5D2LA 4R7DB 3CSPA 3Q5OA 1PGRB 3RWIB 1ZA3A 4EIZC 3ULUH 5ENWB 5CD3B 5DUML 2GUOB 2AQ2A 1KB5L 1Q0XL 5CZXC 5FYKU 1X9QA 1I75A 2GTWA 1G9NH 4Z9KB 3LRSA 2NY3B 3KPTA 3I3DA 4HFWB 1NAMA 5IHZB 5EU7E 2PXYA 2DM4A 4NQCD 4KVNH 1JGLL 2DICA 1EPFA 5IEHA 3MLZL 1MI5A 4IRJD 1KXTB 4KDVA 1B90A 5C2UB 2IQ9L 4KMLB 2JCCA 2VDLL 4LSPL 2X10A 3WFEL 2GT9A 3GMQB 1JZ8A 4PJFA 4X5LA 2GFBB 2FGWL 1X5KA 2FJGB 3TT1H 1IAMA 4Z7WE 3BRFA 4ELKA 1FZMA 3CVHA 4Y89A 3VD5A 2EICA 1INDL 4C83A 5HHXH 1IGML 3QDAA 1T1XA 3NTCL 3DUHA 1JYNA 4GSDH 1JF1A 1RPQA 4RFNB 3L3KA 4K8RL 2R15A 3VXNB 2CDEA 2VLLB 1T1ZA 2AEQH 1IT9L 3VFOB 4YQXH 1W0YT 3O4OC 1SVZA 2MKWA 2XACC 3IJHB 3IVKA 3BZFB 1DBBL 2R1YA 4RMSA 4HUXB 2VO5A 3CC5B 3TCLB 3BD3A 3TO4D 5IB4A 5GRJH 4CVXA 2I9TB 5EZJA 2YD1A 3KXFD 4QNPF 4D0BB 1BVZA 4MQTB 3U0WH 4Z7OF 4PB9H 5C0IB 4HT1L 5IT2H 1J0KA 3Q6GL 4KQ3H 2B0SL 3QDGD 3BKJL 4JM2D 5BMFH 4MJ6B 3RTQA 4X6CB 5EWIL 3PJSB 5TE6H 5ICYB 4JVPA 4Y5YA 1UZ8B 4TPRL 5JW5A 3WS3A 3ZE2E 2M8XA 4J3TA 5J1AA 4DZBB 1NL0L 4HKXA 3SKJL 3CFEB 3MRMA 4KK8C 2DIBA 3RWFB 3AUVA 1FVEA 1M7DA 2UWEB 3CSYA 4UIKH 4LQFL 3KYKH 4DTGH 1AFVH 1S5IH 1YN6A 1FVDB 3HC0B 1O0VA 2EDNA 3HE6B 1X5FA 5IB2B 5ERWA 1C08A 3WEXB 1HZHL 4R26H 2A0LC 1BJ8A 3RVTD 3OSKA 3L7EB 2B1AL 1N2RB 3I2CL 3MPCA 3WFZA 3PGDA 1NAKL 3K1DA 2HWZL 2NNAB 4JANA 3OHXB 2VWEE 1BIHA 2ENYA 4KKLD 4PJCF 2Q8BL 5IMOA 1REIA 2X89D 3DRQA 3S34H 5BCAA 4RRPG 2Z4QB 3EO9L 3H6JA 3T2PA 2BX5A 1S9KC 4OCRH 2CUHA 4H25A 4U1LA 5D1XC 1ORSA 1DQDH 2X4TB 1NQBA 3TT3H 4OZIB 2J8UB 4K7PX 5MI0B 1HQRB 2V5RA 4AM0A 3DECA 5CHNB 5C08B 4NZTH 1RZGA 2XXCB 4O5LL 5C0CE 3MLRH 3QQ4A 1S78C 1YYLL 4O4YH 3T09A 4L4TA 3TN0C 1NGWA 3VMNA 4ORZC 5FDWB 4I2XE 4ALAH 4Z7UE 1F4XH 1T7XA 4IMKC 2C4XA 4KTEH 4LEXL 1OAUL 5E5UB 1NC4A 5E5RB 1XFPA 1C16B 5I1JL 2VLRB 5FGSA 4MD5A 4LK4A 4HBCH 5HGAA 3BN9C 2XNAB 5F9WB 2XTLA 4MJ5A 3TPUA 2LTQB 2FR4B 3WO4B 2EDKA 1EHXA 5IHUL 5BO1H 2BSTA 1J1XH 4DJMA 5CINH 1KJ2B 4X4YB 3KG5A 2IPTH 1DFBL 1NGXA 4FQPA 2BK8A 2HJLA 4WFED 4P5TD 3VGAB 3QH3A 1S8DA 2YRZA 4GT7A 4N8VG 3SPVB 3ES6A 3MJ8A 3TZVC 1CD9B 5DC9B 3WHXA 4HKBB 2X4SA 2IBZY 3MSPA 5FYJU 4GG6F 3MLVH 2ZG3A 1CLYH 4JVWA 4M6OH 4PJ7B 5CUSH 4DCQA 1MLBB 1JYWA 1A3LL 1RHHB 5C70A 3DIFA 1NBZA 1MAKA 1MWAL 3UJTL 4G6KH 4HUMB 4U1HA 25C8H 2F58H 4U3CA 1UZ6F 1VADA 1KLGB 3HNSH 1FSKC 3KYAA 5ID0B 5HYJB 3VFRA 2NXYC 1PSKH 1QLEL 5HHOB 5IQ7L 2EXYD 3EFFA 1RJZA 2XKNB 4X9HA 5JXED 4TQEL 1EK3A 3B9KB 4JO4L 5FUZH 3W2DH 5FF6A 5IHZA 4MLSA 1BEYH 4J1UB 4MNGE 4TOYL 5FO7B 4JN2B 1EHLL 1AXSB 2GTZB 1H8OA 3TCXA 3OKLA 2APFA 2HH0H 1NCCL 2YPLE 3VDAA 1TCRA 4Z77A 1BX2B 2CH8A 5CSZB 5ADPH 4X83A 3B2VH 3MRIB 2QSQA 1T3FB 3PWPB 4D0CA 4QXWA 1V3MA 4G9FB 4M43H 1DLHA 1Z0NA 4PTUA 1YY9D 2YPVH 2FJGA 4NCC1 4AG4H 5B3JE 3VXSD 2NQCA 2ZSVB 4X6EB 5C09A 4E41D 1JZ7A 3OB0H 3QP3A 4F7MB 1QR1A 1CZ8H 3QUZA 4UAOC 2VR5A 2FX7H 4GBXA 4U33A 1I8LA 2ZP0T 1U3HB 4KK5D 1B6DA 1XF2B 4PJ9C 1CFSA 1I8KB 4JDZB 4NC1C 4DWHA 1KCVH 1B6UA 4D8PA 2YWZA 1KCRH 4G6ML 1NBYA 3WMSA 1A14L 3RPIB 3CXHK 2OJZH 4DGVL 4EUPG 1DQLH 5JPMB 4UU9B 3LN5A 3LQZB 4ISVA 5HBBA 4QHMB 3RZWA 3UYRL 5F8RC 3I6GB 4LSVL 4RMTA 3PGFL 3SKMB 1QBLL 2R2EA 5LQBH 4LAQL 4K7FA 5T1DH 3KPQA 3F7PC 5C0AD 1BQSA 3TCLA 2NXZC 3N85H 4K9EL 3CSBA 2I9TA 3IJYB 3L7FB 3T3ME 3G6JE 1JCKA 1VEOA 1DDHB 1D7FA 2CXGA 3ESUF 3S4SB 3HC3L 5TQ2L 5JHDA 3EO1A 5DS8B 3DJ9A 3RUGA 1TNNA 2L0DA 4MJ6A 5BS0E 4X6CA 4NRYB 4APQC 3MFFB 2AJ3A 4NBXB 2F54B 2ZG2A 3X3FH 4HPYH 5F6IC 1E4XH 3GI9L 5DGRA 4EXPX 3ESVF 3CFEA 3I02B 4Y4KC 2ESVA 3O41B 1RU9H 3MGOA 5EU6E 1W0VA 1CL7I 2Y06L 3CH1A 5EUKB 4HIJA 5CZVL 3KWWA 4EXKA 2UWEA 2F19H 3LN4B 3FQXA 4FZ8L 5I8KH 3HE6A 1JGDB 1RZKC 5IB2A 2L7UA 1TQBC 1MOEA 3KPLB 2XWTB 1P84K 4JG1H 3X3GL 5GXBB 1R0AH 5HGBA 2DM2A 5CMAA 2NY3D 2XRAH 4ZXBB 5FUOL 4CADB 2EE9A 4S1QH 3ULVE 3MR9B 1YEDB 4CAGA 4JO1H 4EJ1C 4M3KB 4QXTB 3NZ8B 4BUGA 2X4TA 1JK8B 2JF1A 2ZZUT 3PV7A 3TYGL 4OZIA 3I6LD 2EIEA 1HQRA 4YDVA 3SBWC 4X9BA 5ELIA 1XF3B 3B9VA 4E5XB 4AMKH 2WQ8A 1F58L 5D2NE 1LGVA 3GSUA 3LRGA 3QUYD 5IR1B 4F9LC 1UGNA 2XOTA 2UZXB 1PLGL 3KVQA 4TN9A 1RUQH 3U7WH 3ZTNL 2HFFB 4MVBD 3SKOA 4YE4L 5D1ZC 5FDWA 4LRNH 1HKLL 3TH4T 1O7VA 1INQB 1OLLA 5BW7C 4KZDH 4PJHA 5C0RL 5LAXA 1N59A 2EYTA 3OQ3B 4U6YA 1DLFL 1OAYL 2CIIA 2IANE 3QB7C 3RY6A 2E9WA 4PBWD 1YDPA 3FO0H 4AEHH 2JK5B 3LEYH 4OB5H 2G75B 1IM9A 2NY1C 3G5VB 1ZHBB 4Q9RH 4KKAC 2ATPB 3HCVB 1JGVL 1RZKH 3FQRB 2QSVA 4XPAL 2A83A 5C9KA 5FYKL 4ZUUB 2R4RL 2Q7YB 2BSSB 4LU5L 5TQ0H 4Q7DA 2EDEA 3NZHH 3V6ZB 1RVFL 1SBBA 4NKQB 5GS0C 4PY7B 4JHZA 3UBXB 1GZQB 1NC2A 5GGQL 5KSBE 3DROA 1W72H 3H3PH 1JRHL 3GI8L 5GGSY 3MA7A 3OKNB 3UROR 5DK0B 3SGDH 2NTSP 3MJ7A 1I7ZB 1RHHA 3MRKB 3RJDA 4QHLA 4L8SA 3W11D 5J56B 1QTYT 3BP6B 5D8JH 4XHJC 5DFTA 2ATKA 3WNNA 1T2QL 3CVHL 3ZHKA 4KMTH 5F3BA 4JFEB 2O5YH 1I3GL 5E24E 1SQ2N 3RWGA 2VABB 4XBGB 4HWUA 5HYJA 2WWMD 1IM3B 4N68A 1TVDA 1DEEB 1G7MB 4AT6A 3BJLA 1II4E 1QRNB 3MMEB 4Z76A 1M71A 3S37L 2I5YH 4M5YL 3B9KA 2IG2H 2A6DB 4WWKB 2XG5A 2ZPKL 2EDLA 3QI9A 4GXVL 4J1UA 5C0BE 2OLDA 3O8XC 1MCIA 5F6HI 3LHPH 5KG9A 4NJAH 5DJ6B 2GTZA 1NCDH 3S98A 1QACA 4YZFF 4LGPB 2ZSWB 2AI0H 5JIPA 3MV8B 3NA9L 1MCNA 1FCCA 5DYOA 3B9AA 1FVCA 2X4OB 4TVSa 4Y19B 1NCNA 2WUCH 1T3FA 1AP2A 2ZKHL 1FFOB 2NTFB 3VFVB 3SDYH 4F57H 2DRUA 3KPOA 4YUEL 5E2UL 1A0QL 4MD4A 1Q9WA 2DD8H 4U1IA 4F7MA 5C08D 3A6CL 3MLTB 2M2DA 5BVPL 2QQKL 3UO1L 1DSFL 2ED8A 1T7YA 5I8EA 1SY6H 3O2DA 5AYUH 5D6DA 5DMIH 1EH9A 5FGCE 3O3UN 2DWEB 4LIQL 3VXUA 3OZ9L 4LLDB 1U93B 5L9DL 43CAA 4Y16B 3L95A 5GPRA 4PJAA 5DRXA 2VDML 1PJ9A 2YD8A 1I3UA 4XBEH 2BHUA 1GGIL 2VH5H 3SKMA 5DR5L 2VLRD 3CLFH 5DMYA 1QVOA 2PW2A 5KJRL 2X4UB 2D7TL 2EKSB 1JPTH 1XEDA 1ZMYA 4JPVH 2AS5M 1U8LA 4C54A 5GGUB 3FQWB 3K2UH 4UBDC 3MUGA 1WITA 3D25A 5E08H 1GCFA 2NY4B 1JZ4A 1Q9LB 4NNXB 1E0OB 4MNHA 4TNWF 1WTLA 1LEIB 5AWNL 3RL1A 1RSFA 1UJ3A 3VH8G 1IE5A 4J4PC 5GS1C 4Z0XA 3OAYH 3HI5L 5ESAB 5E95B 1Q9OA 1HINL 1ZGLB 4HFUH 2NLJB 1T83C 1TZGH 3HKFA 4GRLB 3RVXD 1J1OH 2BFVL 3UDWA 5KTEH 5EH1A 3LSOA 4YFLF 1J11A 1VACA 1HDMA 1C8PA 5FCUH 3DVIA 4K3DL 3BXNB 2W0FB 3D18B 2PYEB 5KVGH 1TMCB 3PXJA 1JPFA 4Z7NE 2YPKB 3GHBL 2XWTA 3DXAB 4NCC2 4DGIL 4L1HA 4XWGL 3MLYL 1MRDL 4J3XA 3SDXE 5HHOD 5EOTB 2GCYB 5JQ6L 5EOCL 1ERNA 3MOBH 3UPCA 1UWEL 2HRPH 4ZXBA 1E28A 3VFGH 5DD1H 2J2ZA 4OAWB 1YEDA 4KRLB 2V2TA 1BLNA 5T1MA 1YQVH 3JUYA 1E27A 4QXTA 4DW2L 4M8VA 3S35L 4H88L 3WIIL 3RAJL 4RGND 4X99A 1DBAL 4BH8B 4ELME 2FEDD 4H8WC 3FB6B 1AC6A 2A6KB 4DKAA 1A1OA 4JM4L 4PRIB 3PWPD 5IR1A 5DEZA 4JRYB 3RWDB 1QFWM 4Q58C 3QWQB 4C58B 4N9GA 1SM3L 3PDOB 4JFDE 3JXAA 3V5DA 2XI9A 1D9KB 2CDGB 5FYJL 5SWSD 3D0VB 3RX8A 3C87A 4NRZA 3PUCA 3NIGF 4MXVE 3OJDA 1U3HD 1WEJL 5T3ZH 5IJKC 3RNKA 4QTIH 3BE1L 3VRLE 5EC1A 4AH2A 1P7QB 1EJOL 2ATPA 5IUSA 1KJVB 3NVQA 1B2WH 5BRZB 3S5LB 4CVUA 2R1XA 4ZUUA 3GSNB 2V9RA 2OTWA 4MAYC 1F97A 4YIQB 1XIWA 1KEML 1FCGA 2IAMD 2Y4SA 4PGDA 3V6ZA 3DV6A 4NYLB 5KS9A 3BH8B 2EH8H 5DQ9A 5DHXB 1MHEA 1NKRA 4TVPH 3KS0J 3OKNA 4HS3A 4WUUE 3BSZH 4PR5A 4P4KC 1JNHB 3T2QA 1OARL 5EZOH 1IAKB 2A74A 4H8WH 4EEEA 1YEKH 1MFEL 1ORQB 3OAZH 3IETB 1IEBA 1KLUA 2VQ1B 2F54D 4OGYH 4ZDHB 4JDVA 3ARBD 4XCEB 2D0HA 3JWDL 3K8KA 5DRNA 2BNRD 3DV4B 4P5MA 1WZ1H 2B1HH 3U9PH 5DD0H 1BIIB 3HAEB 4JB9H 4R97B 4MA1B 3WFCH 3ZDXE 4WI5A 4ONOA 3QNXB 3SQOL 1BQLL 4NFBA 5A16A 1NCAL 2IMMA 1LO5B 1AD9A 1FH5L 2JJVA 3LIZL 3PL6A 5E5MA 4XZUB 1UFUA 5JXAL 1FL3A 3GJFB 4XP5H 2ZSWA 3KJ4C 4BM7A 1QFWL 2VIRB 4HK3N 5EIIB 4XB7A 5E8EA 2Y23A 3FB7A 4JKPH 5L2JB 4XMKH 3M8OL 4KJWC 3TYFB 2J1KA 4U3XA 5TH2B 4NBZB 1EAPA 5F7DB 4LSRL 1CDCA 1FGVH 4CN1A 3LPFA 4XCNB 2HRLA 4X6CF 3C5JA 5GZND 1MCWM 4QOKB 1WFTA 4WWID 1NDMA 4LP5A 3LEXA 3A67H 1XF4A 2NY0C 3IS1X 4DVRL 5I19L 1IQDB 1R5IB 2ZUUA 1HI6A 4KRPC 2N1KA 3D0LB 1VPOH 3MZGB 3MLTA 1CGVA 4ODWA 3QUMH 4YPJA 3DWTA 2UWEF 2V2WB 4WV1C 3DYMA 5INCB 4R4FL 5I71B 2AV1B 3FRUA 1RUMH 4GH7B 1T66D 1TZIB 1DL7H 1EAJA 3DUSB 4IJ3B 3O3DB 5I1LA 3KR3H 4PJGA 5EUOE 4BZ1L 2VXUL 3C6LD 1EGJA 2KKQA 2D3VA 4ZTPL 5AZ2H 3E3QE 4HF5L 1E4JA 2EDQA 1OCWL 4JZOB 4OZIF 2J8UF 3IDXL 3O81A 4NNXA 1MCWW 3OXRB 4JPWH 3QZWB 1AQKL 4UUJA 2NY5L 2IH3B 4YXKH 3T0EE 2VZSA 4PLOB 3E8UL 2VLKB 3T65B 3O4LD 5H94B 3D9AH 4HC1L 4NKIH 3OAYK 5E6IA 2NLJA 4BQBA 4GRLA 4LGSB 3NN8A 2OCFD 4TUKL 2X4PA 5IVXB 4Y1AA 3G04A 4W68A 5DD3H 1YMME 3GSQA 3CFCL 4UQ2A 5IIEA 4JFED 4MYWB 2VXQL 4MB3A 3EBAA 1AKJD 1RK0B 3L9RA 4X0KB 3V4UL 1K85A 3P4NA 4LLWA 1JPGA 4ODVH 3NIDE 3S35X 1QRND 1VEPA 3MXWL 3HB3C 3QXAB 4MMZC 1A22B 2ORBH 4WWKD 1K8DA 4OAWA 2ZUXA 1U8OA 4U2YA 4UTAH 4Q97A 5GSRA 4GAGH 3F12A 3K1KC 5D6CB 4EI5C 5FECB 5GS2D 5HHPB 4LRIA 2FL5A 2MCPH 4QRSB 3QUXC 3FB6A 4PJ7F 4Q9CA 2A6KA 1N64H 4Y19D 2B5IB 4ZOCA 2DMCA 5CEZD 4Z7OE 2FBJL 1T20A 3R0NA 3ISWA 1IGIL 1UG9A 1J8HA 1NUNB 2WK2A 3TFKC 4TTDC 1FDLL 4Y2DB 2XTJB 1QLFA 4NNPH 4RNRA 2AK1H 3QIBC 1I9RH 3D0VA 5FYLH 3IU4L 1SVCP 1XR9B 4KROC 5DJCB 4PJEA 4LEOB 1RUKH 5JW4Q 1P7HL 1KJVA 4P49A 2V2XA 4FTVA 1LD9B 4Y16D 4MCZA 5I1EH 5FOJA 5HVFB 3GO1L 1I9EA 3H9SD 3EIFA 1UA6L 5ESVA 4XPTL 1MUJA 1QYGL 1HILA 4DK6A 3I6KA 4YIQA 2EO9A 1ZTXH 3BGFC 4YHOL 4S1RH 3QEQE 2NX5E 3HZYA 4DVBB 4O9HL 4GQPH 4BA8A 3TJHC 3IT8D 2KH2B 2P4AB 3KHQA 4CMHB 2CKBB 3PHQA 3QYCA 2HFGH 3R1GH 1G6RL 3D3VB 2ITCA 2NY4D 4MNQE 1V7MH 5E1AA 2H1PH 4FQHA 4L9LC 1ORQA 4R0LA 2GIYA 5CJBA 3LDBC 4R3SA 3IETA 1MFDL 3SDDD 5KSAC 1A1NA 3LS5L 2HFEB 4XCEA 3SJVB 6FABL 8FABA 5IW6A 3DV4A 3GB7A 2DQCL 1P9MC 3OR6A 4WHTB 3RIFF 3TNNB 2NY2B 3JTTB 2WBJD 1K4DB 2GW5A 1CXHA 2FEEL 4PJDE 3O2DL 4PIRF 4MHHG 4O58L 2JKXA 4NCDA 3ARZA 2QHRH 8CGTA 4M7KL 4KQ4H 2BMKB 5DJ0B 5IV2A 5JW4R 1PG7L 4ZPVB 2PYED 5C0JA 5I2IA 1DVFB 4EN3A 1AR2A 3U83A 3DXAD 1MNUL 3MRLA 4MQ7A 4JHWH 4PRPB 3S4SG 4KHXL 3AB0C 2JB5H 4L3CA 3DETC 4HWZB 3QT2A 1YECH 3IAQA 3L3IA 4XNZB 3P73A 4GS7B 4WY7L 2R23B 4QOKA 4U6XA 2Q8AH 3QXWA 2YEZB 2JB6A 5I16B 1IQDA 3H9HB 1BMGA 2H8PB 4H1LB 3FFCE 4QHUA 2KQMA 4YWGL 2XN9B 4P4RB 5C07B 3I50L 4PRID 1YMHA 2D31B 4JRYD 5HPOA 4FFWC 1K3IA 4XGZA 3ZO0A 2YHGA 1A8JH 3ARSA 4G7VL 4MCYB 5INCA 1AC0A 1D9KD 2M26A 1JV5A 2QJDA 4WI8A 3MQIA 4TRPH 4OLWL 4ZS7L 2Z8SA 4I0PB 5HVHB 1LEGA 4K2UL 5GGRY 5ISZE 5T5FL 3DRTB 1D6VL 1RUPL 4QHNA 4HT1H 1D5ZA 3SE8H 4HS8L 1KPUB 3QA3A 1HH9B 1TTUA 1LK2A 5HHQB 5IJVB 1CFTB 3C08L 2X09A 1LO0H 5H8DA 3W0WE 32C2B 3NFPB 4Y8DC 3AXLB 4EQ2A 3BP4A 3G5XB 5DHYB 4UINL 1J0YA 5E9DE 3O3BA 3X12B 3IB4A 4J3WA 4MSWB 1KUMA 2X89A 2X05A 3QIUD 4MA7L 4B41A 3ELAT 3AS2A 3MRGB 2MHAB 3VJ6B 1R5WA 1JNLL 1JHLH 4DOHE 1BOGB 2VLKA 5GJSH 2BNUB 3U0PB 3AREB 4F80A 4LSSL 4JFQA 1CXLA 3SGEI 1BVKB 5SX5K 3V52L 5D7IB 2F8XC 5TPWH 5EFIB 1YEIH 4MJIA 3HMXL 1CXKA 2ICWJ 2LFGA 3PNWA 3U4EA 4ZG1A 3P9MB 3HFMH 4NO2B 1E6JH 3C9NB 4S0TD 4NC0B 5AAMA 1RJLA 2PNDA 5CGYC 4L3EB 4MGXA 5EZLA 1JJUA 3QXAA 5GRVL 4XCCL 5C71A 3P0YH 3BDBA 1WSST 3UBXG 1QOKA 4TUJB 4O5LH 3VFWB 5HJ3A 4FG6D 3MLUL 5FECA 2VAAA 1YYLH 3EO0A 1Q1JL 4H20H 2FX9L 3OKMB 1QFPA 3CX5J 4LMQE 4P5TA 3U2SA 1ZT1B 3TBSB 3BAEH 3V4PH 4JR9L 1MCFA 4OLUL 5L8JB 1NLBL 3VXRB 4LEXH 3TA3C 1MJ8H 4ZUWA 4R8WH 3LZFH 3MRQA 1YPZA 4TUOB 2HLFC 5D5MA 3VXMA 4JQVC 4EDWL 4N0YH 5SX4I 3T77A 1L7TL 1AGCA 3IXAB 5F72S 2R1WB 4YX2H 5DMGD 5JW4M 1H3WM 4KJQD 1KGCE 3KPSE 5IHUH 2CRYA 1BGXL 1SEQL 4XAKE 4XP4H 5DJCA 2W60A 1HEZB 3BWAB 4QRPB 1S7QB 2QADB 3RZCC 3DSNA 1H5BB 4R96A 3DO7A 3LEVH 4X6DA 3D39E 3K3QA 3OG4B 2GK0B 4HZAA 4G7YL 1XGRB 4PJXB 4F37K 1ZGLM 1INEL 5JORA 3VU2A 2DBLL 2KZWA 1I1RA 3CDCA 2V7HA 15C8L 1JUFA 4P2QD 1U58A 5E8OB 3NACH 4PJ5B 3DO3A 1P6AB 5SWQA 1OM3L 4A6YB 1QSEB 3MO1A 4I18C 4TSCL 4ZAKB 4HX1A 4IS6B 2H2SD 1MJ7L 1PQZB 3O2VH 1SYVA 2XZCH 4RAVA 3BUYB 5D1QB 5L0QB 4OQTH 2VJXA 5EU5B 3S9DB 3QG6A 3UPRB 5BV7C 1QLEH 1OAKL 2QQNL 3SJVA 1CF8L 1T89A 3UC0L 3KLHD 3E6FA 4IRJC 2BSRB 4F15B 4XVJH 5KW9L 5CIPH 3EOAA 3ZL4L 4O2FA 1YUHB 1NCWH 2R69L 5D2LE 4MWFA 2OBGA 3VFUB 2GITA 3ZT7A 1NCCH 2IQAA 1L6ZA 4ZPVA 4OD2B 3OKKB 1TZHB 2QLVB 4HUVA 2A6JB 5FYKE 3U4BH 3V0AC 2OXGA 5H35A 1H0DA 3O6FB 1EGJL 3WCYA 1VKXA 4GRWB 1UM6L 3U7YH 1MI5E 2E27H 5ALBL 1GGCH 5I15L 1S9XB 2D9QB 4P59L 5HDQL 2LU4A 4JREC 4UT9H 4Z7WB 2H9GB 2JCCE 4LHUB 4OLVL 3WSQH 1LO2H 4ONGH 1IBGH 4ERSL 4X4MA 4I4WA 1BZ9A 3HR5B 3SY0A 5SWZA 2OK0H 4PJFE 5C6PB 4NQXB 4JY5H 4GG8B 3O11A 5F44A 4B53A 2DQGL 1LE9A 2D31A 3WIHA 3OR7A 2WIMA 5BV7H 4LSVH 3TO4C 4YXLH 2Z31A 1SHMA 4G8EB 4MCYA 4WI3A 4Z78A 4Y2DD 3WXWL 4EOWH 4QXUL 5F3HB 4EUPH 5T33L 4M7LL 3P9LB 4X7SH 2J4WH 1OD9A 3DRTA 2P5WB 3BEVB 1TJHH 3BW9A 4JM2C 1PYWA 2BC4B 1XH3B 3QCUL 4H26A 5J3HC 1KPUA 1HH9A 3S3PA 1H3PL 3IF1B 1IGCL 4N0RA 3VMPA 4D9RD 4UILL 1DQQA 1G7HA 3IKKA 3MXVH 32C2A 1WLHA 3ARFB 3BHBA 4JO3H 2VXSH 2YUXA 1T4KB 2VLMD 1JL8A 1D5XA 1T03H 1WWBX 4DGYH 3BESR 1OTSD 3GI9H 1A3QA 2WNGA 1ZAGA 1A7QL 3C09B 5IEKA 4OGZA 2DQEH 4MDIB 4U1SA 5CP7B 2MPAL 1JF5A 2GSIB 3CFKB 5DUPH 3VJ6A 2Y06H 4HXAH 4WW1B 5F96H 1AO7A 5ITBL 1CFQB 5MHSE 5IF