1TQCC

Ovine recombinant prp(114-234), arr variant in complex with the vrq14 fab fragment (igg2a)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
b'DVVMSQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSRLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYFCWQGSHFPQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords prion protein
publication title Insight into the PrPC-->PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants
pubmed doi rcsb
source organism Ovis aries
molecule tags Unknown function/immune system
total genus 52
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2004-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcC01
1JRHL 3FB5B 5CJOL 4NQEB 5BZDB 2EC8A 1B90A 3CDYA 5FK9A 4EI5A 3RGVB 2F8VA 5DUBB 4C54A 4D0BB 4NM8H 3QO0A 5B8CB 4FMFA 5ISZB 1D6VL 3R1GH 3MRKB 1UT9A 3FN9A 4EN3A 4TVPE 3ABZA 2ADGA 2ZG2A 3T1FA 1CTOA 2R8SL 1RJYB 5CHNA 1AO7E 3LKRA 2HVJB 1FCCA 3OJDA 2CUIA 3HNTL 2VLKE 3T4YA 5FB8A 1U3JA 5HD8C 2YD3A 1YEDA 2UVEA 2I60H 1Z9LA 3ARFB 3OMZA 5IVOA 4LLMA 2VXSL 2APFA 5L6YH 4UV4H 3C2AL 1O0VA 4JO3L 5ESAB 3QJHA 2I5YH 3TESA 3BIAX 1UB5B 2X4NB 3DMMD 5JLZB 1KCVL 2PTTB 5IVNA 4LSPL 2C3WA 1KCUL 5J8OA 3MNVA 5F7DA 3MRBB 3NZHL 4JFOA 1QLFB 2JLLA 2RCSL 5KAQG 5TE6H 1T21A 4WUUD 2ATPA 3Q1SH 4GKNA 1INQA 5F3HA 3OAZK 5C2BL 3ILQC 4OKDA 5CILH 5C0CB 4FTVA 5E2VL 5H37G 3DVNA 1WZ1L 2VABA 1XR9A 3H8NA 5C0IB 1MHPL 4JKWA 2IPKA 2P8LA 4XX1G 2CXGA 3VGDA 4G6FB 1F4AA 4CU6A 1P1ZB 1YNLH 4HQQL 4U1LA 3TC9A 5JORB 1LE5B 4HKJB 1F02I 4UTBL 2R1XB 3OQ3B 4ZUSA 1OL0A 9CGTA 3VI4F 4CN1A 4RQQA 4YXHH 1FG2B 5EOTB 5BOPA 4KQ3H 1SJXA 5JDSB 1BQUA 2QQLL 3AAZA 4F8QA 1UJ3B 1LO3H 2PUQT 3G5VA 1ZLUK 4ZMAT 3OKOA 1MRCL 1F6LL 5CWSA 1HZHL 1KENL 1G7PB 5JHLH 2R0ZH 2WUCL 1QLEL 1HSAA 3QWOB 3TNMB 3DUHA 4OGXH 2AEPL 3E8UH 4XGZA 4Y16D 5BXFA 3WJJA 1BFVL 2B2XL 3EFDH 3MLSL 4GKZB 1QD0A 3T04D 4PJ5B 2VXQL 4V1DB 3GNML 1EO8L 1D5IH 1FFOB 4HMDA 4LRNH 2CMRL 4LSRL 4APQC 3QDJE 2NLJB 2ZJSL 3HE6D 2VXUL 3P4MB 4PJIF 1XIWC 4K8RL 5T3XE 5KS9A 1FFPA 1Q9WA 4J3VA 2JELH 1S7UA 2EEAA 5CFHA 4ZOAA 4NSKB 4M1GH 3NIDE 4JY5H 5B38G 1NEZA 3WMSA 3LQZA 5MEQB 1E27A 3SQOL 1VFUA 2F53B 3DI3B 5C0GA 4NKOA 3V8CA 4LGRB 4U0RB 1JGLL 1MCNA 4FXGB 1TCMA 5LXGH 5HGBB 4JFFE 4ZO7A 2OR7A 4PR5A 1L7TL 3MRQA 4OZFA 4PJGF 1U92B 5M94B 1YYLH 2GFBB 3QUYD 2NY3C 3KS0J 2RIKA 4U6HB 2V7HB 3LKPA 1A2YA 1FAIL 4N0YL 4M43H 5AZ2H 1MCHA 1F00I 4IRSA 5I1EH 2CR6A 1GSMA 1MCKA 4JM4H 3RHWK 4F3FB 4NKIH 1RZKC 2ED8A 5IVXE 1ZTXL 4A2LA 3TM6A 4DJMA 5DEGA 5IKCA 5C6TH 1HN1A 4OLVL 2FJFB 2DYPB 5FYLE 1S9YA 1MI5D 3OPZH 4OFDA 3GSQA 4KY1L 4UOW1 4DGYL 3MLZH 4LF3A 3TCLA 3N0PB 4G7YL 4MDJB 3EIFA 1BAFH 5FUCC 1FN4B 2IPTL 5A2FA 5HGAA 4JFPB 3B9KB 4G6ML 5EUOE 1KCLA 4I0PA 4C57C 2NX5A 1C08B 1OLZA 2R2BA 2GT9B 1DFBL 1X5AA 3VXSD 4ZTPL 5EZIL 4PD4K 4FNLL 1S78C 1FSKC 5ICXA 2HN7B 1FRGH 3QXTA 4U7SA 3MLXH 4RA0C 2QKIA 1VCAA 2E7HA 3IS0X 4YHLH 5DO2C 4MD0A 4AT6A 2H32B 5ACMA 1S9WB 3ECBB 4U1MB 2ADIB 2EDTA 2YS4A 5CJXC 3MJ9L 1MJUL 1GGIL 4ELME 4F2MB 2VDLH 4Z7WF 1QSFB 5IR1B 2B0SH 4M4RA 4ZS7L 2XT1B 3WLBB 1NBVL 1ORSB 1FZKA 1QACA 4RAUA 4WI3A 3ULUC 2P45B 1FL6A 4QT5B 3QDGD 2IFGA 4LL9A 4X6DB 4XC1L 3RDTD 2J8UB 3RIFF 1DR9A 3BT2H 2XZQL 2QADB 3ES6B 5FV1L 3RGVC 5DJYA 4QRRD 1Y6MR 1YNTB 5B8CC 5C07D 1XF4A 4RISL 5JNYA 3D3VB 3MYJB 3QFJB 4ODXA 25C8L 2O5ZL 4OCWH 4LDOB 2V17L 1TPXB 2VZUA 3TJEH 3VG9C 4MDIB 2BVOB 2UUDH 1EFXA 3ARFC 1BLNA 3NA9H 3WSQH 5BS0A 1YDPB 2BDNH 3MRJA 4PJXE 1QSEB 5ANME 4PJ8A 2W0LA 3VGGA 3NCFB 5KAQF 3LEVL 4NCDA 4GG6E 5I30H 4DZ8A 3M07A 3MRHB 1HH6B 1NCUA 1MCWW 4D0DA 4CU8A 4NP4H 2C4FU 3KNBB 5GZOC 5GRUL 5DD0L 5HYJA 2GAZB 5B39A 4HUVB 3H7BA 1NGPH 5CGTA 1JFQL 3THMH 2CKNA 1BOGB 3V4VL 4M6OH 3BKCL 1HK6A 3T0EA 3G08A 3KXFA 1D5MB 1MCDA 4X6CA 2VXVH 5EZLB 2VXTL 2QHRH 4PV9A 3QIUD 2C1PB 2DMKA 1AC6A 1MF2H 3WD5H 3TCXA 1JJUA 4WO4A 1JZ3A 4LDLB 3SJVA 4NQTA 1HYRC 1FIGL 4M7KH 5F96H 2YC1B 1AJ7L 4NM4L 3TIDB 1UJ3C 2PR4L 4FQXD 3CMGA 5HHXH 1U6AL 2A73A 2FGZA 1JGEA 1T1YB 1UKQA 5IB5A 3SDCB 4F33B 3MUGA 4JN1H 5DRNA 3FB6A 3RRQA 1T04B 4DVRL 1CS6A 5J57B 3FOLB 5DK2A 2XFXB 5TH2B 2J8UF 3S88H 4OLZL 1FE8H 2EDQA 1J8KA 1J10A 2AJZB 1I1YA 3OB0H 1WFNA 5F9WB 4MMZC 4Q2ZB 4QRPB 5DMGD 1YMHA 3O45A 3NOIA 4YPGA 2Z35B 4IDLA 3BKYH 1XR8A 2YWZA 4BELD 2OMBA 2FH8A 3L3GB 4C56E 1G7MA 5ADPL 4IMKA 1YMMD 1U9KA 4G8FA 4EVNA 1DEEA 1NGWB 1FGVL 2JK5B 1T80A 4WEBH 4QOKD 1VGEH 4MNHA 4WUKL 3WE6A 3MPCA 1AGFA 1FNHA 1PD6A 2W07A 3VXPA 4M1CD 2BOBA 4LHQB 4POUB 5GRYA 2NZ9C 5I1AA 1U3HA 3KPRB 3NAAH 3M17B 4NBXB 3HE7B 4U0RC 2H2SC 5AUMB 2EDYA 4P2OD 5IFJB 4U0QB 2PNDA 4AH2B 4Q97A 3LEXA 1IFHH 5C9JA 5MHSE 4FHBD 1LP9B 3SGDI 4Q6IA 4X7CC 4JQXA 2A9ML 3SGKA 1PY4A 1AO7D 3D0LB 4JDZA 3P0YH 1CE1L 5MEND 2VLKD 1N5AA 2W65B 3EYFA 3RU8H 4BZYA 1GGBL 3F6IA 3I75B 3S4SA 4DOHE 3QHFH 1R5WB 1TZIA 4I18A 1XF1A 2R0WH 4IOIA 5JW3L 4OIBA 2YEZB 4G8IA 4JPKL 1YY8B 4OKVA 5A40E 1Q94A 4MA3B 2AABH 1V7MH 1WJ3A 1HKFA 3B8YA 2ZOKA 1KGCE 2OJZH 3KPQB 1HCFX 3B9KC 4YR6B 3GMOB 4Y0GA 4HKZB 1B2WH 2NW3B 3WNLA 5D7KD 4XP9L 1BIIA 2EKSB 4Y16A 4H20L 1JPSL 4U49A 3HUJE 5HVHB 4XNMB 3D85D 1XGQB 1J0IA 3DVGB 2QTEA 2OZ4H 4R4FL 1ZHLA 2ZPKL 4LLUA 3QUXA 3CVHA 2LTQC 4K8RC 1N0LA 2V9QA 3C60D 5GGRY 1BFOA 3BKMH 4OLEA 5E8DH 1RU9H 1I9JH 1T7VA 3K1DA 1F4HA 4W81A 4YFDB 1BJ8A 2ZSVB 1TJGL 4JG0H 2HJFB 1J05B 1PLGL 5L2KA 1LDPL 3U9UB 4KVCL 5JZ7C 3JVGC 4NQCA 2NXYD 1M6OB 1RIVL 2BERA 3S96B 4RRPA 4PJHB 2QADC 1V7NL 2XNAB 3BD3A 1T7WA 4MNGE 4ODVL 3OR7A 4UB0L 2Z92B 4NO2B 3BEVB 5HGGS 5J1AA 5C0DB 5FV2A 3FQUB 4CN4A 2GSGA 4H26A 1OSPL 3QUYA 2BNQD 2XA8H 4E5XA 4FQCH 1XGPB 2GTWA 5KTEL 1TPXC 4HWNA 1T3FB 5FYKH 1J0KA 3RVUD 4L8SA 5HY9B 4L4TE 1A1MB 3CK0L 3B9EA 2GW5A 1YA5A 4HS8H 4MQXC 5BW7C 3EYOA 2H9GA 1SEQH 2EZ0C 2YD5A 1DLFH 4N68A 2YRLA 1A21A 4HK0A 5GRZA 4YZFF 5HI3D 1R5VB 5F7MC 3MJ7B 1FYHB 3TJHD 2ICES 4Z78A 1A0QH 3G04B 3FB8A 2PO6C 4JE4B 2VC2H 1Q38A 3S35H 1J11A 4PRPD 5ERWA 3VXSA 5C3LD 4XWGL 4YHMH 3CXHK 4BKLA 1T2QL 4WJ5B 4XMPH 5DRXB 1JZ2A 1YEJH 2K7QA 43CAB 2CRZA 3CX5J 2IAMA 3BIBX 4LCWB 4ZD3H 1LEGB 3L3JB 5FYLD 5IESH 1Z5LB 2PW2B 2VDQL 1YPZF 4Z8FH 3RWJB 5JXEA 1BQLL 5E99L 3BQUD 1A3LL 1CDUA 3KPLB 3CFIC 4OZGB 3V0VA 3ROLB 3KLHD 3VFVB 4LP4A 1W0VB 1FZOA 5CZVL 1TCRB 1UCTA 1BM3L 4JR9L 3QDGA 2VL4A 5DD5H 2HJLA 32C2A 5DHYB 1I8MA 3SDCC 4Y19E 3TBSA 3V52H 2W60B 5EOCL 3QNZA 3FOMB 4JRYB 2BC4A 5J6HB 5C08E 5C07A 4PJHF 5F9WC 3RTQB 2CDGA 3HKFA 1T89A 3RA7L 4OAWB 3SKOB 1T5XB 5F7HA 1K5NB 3KAAA 1NDMA 3GSOA 1A6UH 3IDNA 3KWWB 3QCTL 4R4BA 3IFPB 2AS5M 3V4PH 4WEUD 5C09A 3OAYK 5GGTL 4XNUH 1NGZA 4U6XB 4MWFB 4X5XB 4ZQKB 2ICWB 1LO4L 5JHDA 3ZZ1A 4X0KB 1MEXL 4FXKB 3WKNA 2PXYD 1OAUH 3K4ZA 4QHLB 4UBDD 5FGRA 4EBQH 1H3PL 3UTOA 3MX0A 2Z8SA 3OKEA 4MA8H 5GGQH 1HXYA 1NCDH 3HE7C 2AKRB 4K3EH 4CVZA 1KC5H 4Y4KD 3CSBA 4IMLB 3HNTH 4XCNA 5B22A 3KJ4B 3WFEL 5IROA 1CXKA 2VN7A 1TITA 2CKBL 2R9HD 4MA1B 5K9OB 3C2AH 4LSUL 4B7IA 5LJYH 4PG2C 2WZPD 2B20A 4OCNC 3LEYH 5EU7C 4WHDA 1KCUH 4OT1L 1R5IB 2X4OA 1QO3B 4QHNB 4DW2L 1KIRB 3MRLA 3QYCA 4LSVL 3QIUA 4HKXA 4Y7MA 5DVKA 2X41A 4YDJA 4M00A 3BP5A 1XH3B 3VD9A 4PLNC 5AZEH 3KS0H 1UB6A 2UZXB 3TP4A 5EBLB 3F7VB 5BCAA 5I74B 3WL9B 2W38A 1KFAL 1KN2L 1W72L 4JPWH 5FDWB 4MS8C 4OZGF 4Z5RA 2IH3A 1WZ1H 4G43B 1YEIL 2QJDA 1MHPH 4U1IA 3DTXB 5FYJL 5F21B 5HPMA 5C0AA 4LOUC 3MLYL 4L9LA 3MNWA 4HDIB 4UTBH 1BD2B 3BO8B 2YR3A 4PJEE 2JJSA 1W0YT 5HVHC 1BX2A 1OB1B 3VXRE 3ZE2E 4BQ8A 2MQCA 5E9DA 1Z9MA 3N1QC 3M8OL 4P5TA 5KW9L 4J4PD 5H37H 1TETH 1MRCH 2EXYD 2X89D 1JBJA 1G7LB 1ZLWK 4K23H 5KSVA 3D39E 3HC3H 4HJ0D 3V6FB 2AEPH 4PRBB 4QRSB 5F44A 5D5MB 5DTFB 4YDLB 2EH8L 4QOKA 3T4AB 3G6JA 2VLLB 4E41E 2LABA 4JFQA 3P0GB 4XXDA 4CNIA 2VXQH 3GSNL 2DBLH 2VMFA 5J1TC 4XVTL 2CMRH 1FL3A 1IC4L 4JQIL 1OCWL 4LASL 5ESQB 3VGFA 1FNFA 4LHUG 3TT3L 2ZJSH 3O4LB 4L5FH 4YBLB 2CKBB 4F57L 1RULH 3BKJL 4K8RH 1INEH 1MJJA 4YHOL 4EUPG 2BSTB 1JHTB 1NCAH 3LSOA 1JPTL 5FO8B 5BVPL 4YEFA 5IBLD 4JB9H 1AQKL 1DUYA 4WY7H 1I1AB 4GAGH 4XP5L 1VEPA 4KROD 3UZVB 5FECB 5A2JH 4AEEA 2VLKA 2GJZA 4OCMC 4C56D 3C5ZB 5FA3B 2AJVL 5ELIA 4WW2B 4UIKH 3SQOH 4U1GB 3NGBC 3KLSA 5DT1H 3L5XL 4DKFL 1JGLH 4WEMB 3GMMB 4QHUB 2H1PL 1A22B 1OF2A 3FFCB 3HR5B 5GRXG 5J3HC 1QQDA 3U2SB 1W72B 4NQDB 5DJ6B 3W11C 5KSBB 5EBGA 4ZUWB 2HRPH 2XZCL 3SY0A 3HI5L 3LKNB 3PWNA 1CDHA 5MHSD 3F5WB 2FECI 3SKNA 1L7IH 1ZT7B 1T20B 4U1JB 3FT3A 4JEGB 3D2UB 3LAFA 4TPRL 4UILH 4H1LB 5D7JB 1WC7A 4CDGC 3BX7C 4KK9D 4ZFFB 4LRIC 1E28B 3I6LE 4G7YH 3EJZC 3KHOA 5MP6L 5K9KA 2QSQA 2DTMH 5F97E 4HIIB 2NNAA 1OT1A 1U8JB 1K8DA 3TFKC 3NTCH 4XAWL 3OJMB 5JW4Q 1DFBH 2EC9U 3DYPA 5I1IL 5EZIH 3DETD 4MXWL 1DQML 1IT9L 3RUGE 3TYGL 3NFPB 1OTTD 2RBLA 1DLHA 3GSNB 1UYWL 2DAVA 2MQ0A 3RWEA 2P24A 1ED3A 5ADOL 5D5MF 3PXJA 1T22A 3TN0D 2BVYA 3LHPL 4OZHF 3CC5A 2YD1A 5ID1B 4O00A 1GGIH 3R06A 3I2CL 3BSZH 5SX5H 3RTQC 4RGNE 4WV1A 1FO0A 1G7JA 4U1HB 3UTSB 4KV5F 4M6ML 3U7YL 1WT5C 1VDGA 1JZ5A 5E1HB 2ESVB 2XY2A 1M7DA 3QDJA 4OZ4B 12E8H 1G7IA 2BNRE 1A7QL 3SDYH 4O58H 1B0RA 3EHBC 4EQ3A 4QYOA 4RNRB 3AS3A 3HCVA 4QXWA 1NC4D 3L95B 2EDOA 2FIKA 3RFZC 5TJWK 4CADA 3WXVL 3BVNA 1F97A 3FQTB 3HAEB 5LBSL 4YQXH 2IH1B 4KDTC 3IAQA 1KPVB 3ALXA 4MJ6B 2GUOA 4JFFA 4JVPA 1RUKH 5JW4N 1N59B 4A2MA 1HSBB 3KJ4C 5AG8A 5KSBF 1RZJL 3PDGA 3B8SA 4MA1C 3UTPE 1MFDL 3PQYE 2J88H 4CMHB 5F72S 2FL5A 5D1ZD 3MMEA 4Z6AT 3HZYA 1FJ1B 4L4TD 1G9NH 5IVXA 5LWYH 1QEWA 3VFNB 1YQ2A 3PWLB 1IM9A 1U93B 1Y6KR 1JHLH 5CSBA 2ZP0T 4P5MB 5KSAB 3SEPA 2HFFB 3NIGE 4S2SA 1GZPB 3LKOA 4GRWF 1JFQH 5IMMA 1NSNH 3RI5F 1PYWB 5I74C 1H5BB 3E2HB 4KTDH 4OSUL 1A6WL 3BKCH 4FFZH 5EUOA 2FGWL 1T0MB 2ARWA 1HYSC 3PHOA 5E6IC 4XWOD 4N5EC 4NO0A 3RL1B 4IDJL 3IGAA 5MEPA 1T03L 4ZFZA 2IANE 4O9HL 4M1DL 2XWTA 3OTTA 1Q0YL 4PY8J 2BSRA 3MXVH 4R4ND 1EXUA 1DQLH 4J1UB 3C6LB 3CCHA 3WNMA 2EDXA 1FIGH 1SY6A 3VD4A 3RZWA 4NM4H 3Q6FB 3AM8C 4IJ3C 1CDIA 1RMFH 1INDL 2OP4H 5E8NB 4YLQT 1Y18A 5FM8A 4K2UH 2DDQH 2UYLB 3GHEH 3HFMH 1JGVL 5K33A 3QCUL 1R24A 1DBJL 4I3SL 4PJIA 4U33A 1AD0B 1HI6B 2MCPL 3S3PA 4UQ3A 1U8NA 4QCIA 5FKPA 4YDLC 4YPJA 5IVZB 4IRZL 7FABH 2WUBH 4Y88A 3T0VA 4NUJB 5IJVA 1FL5B 2YD7A 4U6YB 3O2VL 3MFFA 1IAOB 5JQHC 3QH3B 2E7LA 2XA3A 4G6AC 4Y4KA 4TSAL 4YBLC 1RURH 4UV7L 2F5AL 5ADPH 1J86A 2AEWA 2VL5A 3KPSD 2ERJB 3P0VL 4N0CC 2EEDA 4KJPD 1IGFL 3BPOC 4X7EC 1G84A 15C8H 4J6RH 5FM5O 4ODTH 3RNKB 1FDLL 1I1AC 3OKKB 5CZXD 3FKUS 1FH5L 2V2TA 2L7JA 3C5ZC 1CFSA 4Y5YB 1MAMH 4WW2C 1OP5H 4JFHE 1AR1C 4U1GC 3SDDB 1MFCL 5I8CB 2BXYA 4PJXA 3T77B 4HIHB 4GG6A 5D1XA 4Z77B 4RMQA 4DWHA 1I4FB 4GBXD 1NH6A 4XPBL 1BGXH 3P4OA 5D1QD 3WNNA 1IEBA 2BNUA 3CXDH 4M7JL 4OF8A 3HB3C 4M61A 3UP1A 5HHOE 5T3ZH 1QA9A 5IEHB 1IARB 5LCVL 3DUUB 5EPMB 5SWQA 4JPKH 1AFVL 5D7JC 4X8XA 3E3QE 1NBYB 2VSCA 1NBZB 2AGJH 5ENWB 5B4MC 4NGHH 4PJ7E 5JW5B 4AMKL 4UQ2A 4S0TD 2FIRT 3MA7B 1ERNA 4N9GA 1QNZH 3U4AA 1AD9A 3EO9H 4HUUA 2OL3A 3HI6H 4KK5C 3QHZL 2BVTA 1OSZB 2VQTA 3BZ4A 1P2CB 5F1OB 3U0WL 1ADQH 4NRYA 3WUZA 1CK0L 1SJHA 1IQDA 4XPHH 4XP9H 4M8VA 2MMXA 4ZOCA 1G6RA 1LO2H 4XBEL 1JPSH 3G5YA 3O3EB 4ODHH 4ZPTB 1YECL 3IAPA 2ORBH 1VFAA 2HFEA 4MJ5B 3JTTA 3O81A 1DBBH 2ZPKH 3MV11 1FYTB 1FG9C 1HILB 4ZODA 3UJTH 2YWYA 5JOPE 4WFFE 1DZBA 1Y0LA 3DX8B 4X4ZA 4YIQA 1AI1L 3FQXA 4OD1H 1WBYA 4U1SB 3U9PL 4DCQA 5IM7A 2GKIA 1XGUA 5JOFA 5H8DA 4D0CB 5LGJA 1TJGH 1Q8MA 1YN7B 1PLGH 4B7LA 4C56A 4R97B 3DOSA 4OCSH 3LS5L 4LLVA 2OTUB 3D39D 4DN3H 1E4JA 1K4DA 2P49B 3IJYA 4FQLL 5F8QC 4JZNA 3S7GA 4LCCB 4LQ1A 1CDYA 2ZUXA 1EEQA 2DRUA 5ACZB 3RVWC 4XC3H 4PB0H 1OSPH 4WFHD 3VFOA 4P23B 3WNPA 4PY7A 3ARBA 2QBWA 4Y5VA 4KWUA 4KRMB 2HTLC 2IALA 3IDUA 4MYWB 3CK0H 3UO1L 1A1OA 5AYUL 3VD5A 5DJ0B 3O6FD 4HJGA 4NHCH 3EOBB 3L3DB 4CMHC 4D2NA 4Q9QL 5IWLC 3EYSL 1K4CA 2BMKA 3VH8G 3CFBB 4F7PB 5DQJA 3HC0B 4PP1D 1ZVSA 1WFOA 5DJCB 4NJ9L 2P46B 4OBRA 2MHAA 1JK8A 1IM3B 4OM0L 3BJLA 1OPGH 3AB0C 3VG0L 3S36L 4LPWA 1KELL 2Y23A 5CKGA 1RUPL 1FCGA 4W4OC 5KSAC 4JY6A 4D94A 4IIQC 1IKNA 5I8EA 1JCKA 1H5BC 3E2HC 2R56H 3JTSB 3B5HA 4UOJA 3GI9L 3SCMB 2FR4A 1FV1A 1AQDB 3GBNH 3ZL4L 2G9HB 1IEAB 5D93B 2DLHA 3TN0A 3VW3L 3DURA 4JRXB 3RWCB 5EN2B 5FGBA 3ULSA 2XN9B 2VDQH 3BH8B 3QPQD 3HUJA 1T7XA 1BQLH 3UBXB 4CL7A 2N1KA 5GZND 2OLDA 3VWJD 4JY4A 3H9HA 3MLRL 3I6LD 4OLXH 5FA4A 5JA9A 1D5ZA 1EGJH 1WBZA 3OGCA 3DMMB 4HS6B 1QFUH 1KACB 5DI8B 4K3DH 1T4KA 1O7VA 1V8HA 4TRPH 4JFZL 3P30L 1MCOH 4WFEE 2VLJE 5CSZA 5B38A 3MBEB 1DSFH 1ZANH 3CFKA 1MCQA 2NY2B 3VWKD 2C5DC 1MJ7H 3GM0A 4FQ2H 1W0WB 3P9MA 2HT2C 5D72H 1D6EB 3ZKXC 2EECA 2W9DH 1A5FH 4MNGA 5KVFL 1RZJC 2Z31D 1CLZH 3FZUD 5GGTH 3X3FL 4UNTA 2X09A 1P4IL 1A9BA 3O2DL 4OCYL 3D48R 4OIIL 2V5SA 4TULH 1MFBL 3ORJA 2DI7A 2ERJC 3MRFB 4OLYL 1MEXH 4KK6D 3EOAA 5IJKA 2R23A 4LPUA 4OLWH 1E4KA 1TQBB 1CFTB 3VA6A 2OTWA 3MODL 3FN0L 4L4TA 3REVA 4JG1L 4Y5XB 4Y5YC 3F65A 3QQ3A 4KRPC 3SDDC 3REWB 1M71A 4NJAL 1FC2D 3ZHLA 2Z4QA 4TN9A 3UTTB 1G9MH 3WFEH 5HI5D 1LO5B 2DTSA 1GVIA 4XB7A 3C9NA 2EICA 3JWNC 3WBDA 2GHWB 3B5TA 5BMFL 1KB9K 3R8BB 2OK0H 2I9LB 2EE6A 3NMEA 3QXVA 4P9MH 5GISH 2K3TA 2IWGA 3Q3GB 3TO2B 5HYFA 3PDDA 3EGSB 3NFNA 2ZCKL 3UTPD 3PQYD 1ACZA 2F58L 4OFIA 4PJAB 2VISA 1JF1A 3MBXL 1ZVHA 1C16A 3LKSB 2GEEA 1KN2H 1NAKL 1I7TB 1DVFD 3O6LL 2X44D 2JCCB 4Q9RL 2OSLB 4ZAKB 3ZDXE 5IW6B 3QDMA 1KJ2L 4LEXH 2D0HA 1HNFA 5DURD 2PYFA 4WI2A 3KPNA 1OGAE 5FYJH 4R90L 4RGMB 5F9JA 1DQTA 4O02L 4LVHC 3TNNA 2FO4A 1MCFA 2YOCA 2WBKA 5BJTB 5E1AB 3QI9B 2LVCA 2C1OA 3BWAA 3VE0A 4CJ1A 4DGIL 1J1OL 4Y19A 2FX7H 5MEOA 1RZIA 2EDDA 2IAND 3FTGA 1ES0A 1CDGA 2HG5A 3MGOB 3D25A 4XHJD 5D7LE 5C08A 5BRZE 5EG6C 3FFDA 4D9LH 3BJ91 2OXGA 4RAVB 4GRWH 5DD6B 4DEPB 4I4WB 1S5HB 2W91A 3S37L 2Y9RT 1P5VA 4GAJH 5TQ2L 2G5BA 1FNGB 3QEUB 1DQDL 1LD9B 3V6ZA 4N8VA 4HWBL 2VR5A 5C92A 1Q9OB 2B1HH 4R97C 1U8KA 3PP3H 4BUHA 1JPST 4JM2D 5GS0D 1EHLH 4XPTL 3IU4L 4O4YL 3ULUE 1IC4H 5DD1L 5LAXA 4LCCC 5J13B 2APVA 4K07A 5KVGL 3RJDA 3BKJH 4Q0XH 3CFJB 4NQEE 4P23C 1UZ8A 3MGTA 3VXTB 1KOAA 2BY2A 2F9BT 1AQKH 5HYSG 4MSWA 5M95B 1EA9C 3T3MF 4R96A 4XP5H 5D1QA 5ISZE 3HMXL 1IRAY 3RIFK 1N64H 3MCLL 5GGVY 1MCPL 4NQSA 3L5XH 3MCKB 1MH5A 5DZNA 5EBMA 5TPWL 3PWVB 1PKQB 4LQFH 3WIHL 4PJAF 3HPJB 1UA6L 4JFHD 1MWAA 3VXQA 4EUPH 1MVUA 4JCMA 1KJ2B 5HGHA 4OFVA 4P2RE 1MQKH 1QLRA 3IVKB 5I66B 1A6ZA 4OB5L 2XZCH 3FT2B 4OM1L 1J87A 3ARGB 5CGYD 1P7QD 1S5IH 2JJUA 4HKBB 2X4RA 3NCCB 1CD0A 3LV3A 2ZUYA 5DVNA 5I2IB 3SCMC 4NBZB 1N5YL 4AEHH 4OGZA 3QNYA 3T2NL 1OAKL 1GZQA 5C0CE 1A6VH 1AKJD 1DBAH 3RVVD 1BBJB 1S7TB 5CEXA 5CEYA 1N7ML 4HT1H 3O11A 3VRLF 4PJEA 3VXRA 1I8IA 5I1IH 2E9IA 1WK0A 4O2CA 4MXWH 5AD0B 3IXAB 1OTUC 3LQMA 3EYVB 3V7MA 4F7CA 1PY9A 4LLYA 1A4KB 2AQ2A 1UYWH 1N4XL 4WNQA 3P11H 4QHMB 2J8OA 1EEZB 3IJHA 3KYKL 4ENED 4QTHB 4NZUL 3FCTB 4XCFH 5GSVA 3U6RB 3DBXB 5BVJA 4N0FB 4JPVL 4E41A 1NDGB 5DK0A 5C7XH 3O2WL 4AZ8A 5DYOB 3BP7A 4XVJL 4M6MH 5SWZB 5EO0A 1OAYH 1T1XA 4KGLA 4RFEB 1A7QH 3QSKB 5TE4H 4NKDB 4WFFD 4JHZA 1WFTA 4PJ5E 2D9CA 3HG1E 3UROR 5ICZB 2G2RA 3O6FA 4H25B 3IFLL 3PWJA 3GKWL 1NKOA 2B7DT 2IBBA 1ADQA 1TQBC 4HXAH 4Y5XC 2LV4A 3N85L 4Y4FD 4XHQA 4PRNB 5LBSH 4PJFF 1JN6A 3BUYA 4G9DB 3U4EA 2VDKL 5DQDL 3GIVA 5MERA 5I19L 1YY9C 2MWCA 3I6KB 3ARZA 4LAQH 3HZKB 2G60H 3RWHA 2AERT 1BEYH 1LGVA 1KIQB 5CP7B 4DZBB 3QHTC 1GYAA 2GCYA 1U0QA 2M26A 5TF1H 4ODSH 2ZUQB 1IC7L 2W92A 2XKUA 4OBSA 2CLZA 3QG7L 4L8DA 5T5NG 1CLOL 1MFAH 1MELA 4YJZL 5DVOA 4FABL 4X4XB 2VERN 1LEKA 4LARL 3O9WA 4KAQH 4EKXA 4LIQE 1MHCA 1E4XL 2W0KA 2HLFC 1XCQB 3O6KH 5EORL 3JWOH 4ZAKC 4NZRH 1TQCB 2J5LB 4ZUUA 1QP1A 2FHFA 2H2PC 3UAJD 4LFHG 4RGMC 2NTFA 3CAFA 2X4UB 4MMXC 2YPVH 2NY7H 1JPFB 1L0XA 3OJ2C 4Q74A 3RUGA 1Q0YH 4GAYB 3NIFE 1UWEL 4N0UB 3VMPA 3H3PH 4NHUA 1FZJB 3QI9C 1A64A 1KXQE 1FNSL 1X4XA 3ILQD 3KYOB 1VADA 3HLAA 4PRHD 2I27N 4NN6C 3RY6A 3VJ6A 1WZMA 1WSST 1BVLB 1INDH 3QWRD 4LLWA 1SHMA 2ICEB 3SKJL 1LO0L 2Z31A 1NFKA 4K3JH 1MRDL 2VAAB 3VFWA 3ZHKA 2KKQA 4D3CL 4GKSA 1ETZB 4RWYL 4KZDH 3GMNB 3GSWB 3B2UC 4RX4D 4GSDH 2BNRA 2X7LA 5GS1B 3QEQB 3G5XB 1AY1L 1QSFE 4L29A 1ZHKB 1QR4A 5IF0B 5FOBB 4WU5B 4OIAA 4NNXB 3O2VH 4PGBA 4WFED 4ETYA 3VD3A 5J13C 1XF5A 4A6YB 5DWUL 3TPUA 4X6DE 3J7HA 4O2FA 5IHZA 3P0VH 4ZNEE 3G5ZB 1HHGA 2HLAA 3RPIA 3WIFB 1JZ8A 4RFOL 4GRLB 1P6FA 1BQHB 3EYUL 2ZOLB 3SGEI 4KKCD 2MFNA 4HXBL 3QFJE 1Z9SA 2EYSA 5INDA 4MJID 3SDAB 3D85B 3MRIA 1WIOA 5GHWL 1EGJA 3PQYA 4AEIL 1RZGA 1MFCH 4APQD 3B3IA 3ARYA 2WLZA 2X1OA 1XIWD 4C58B 1BZ9B 4PV8A 2W9EL 4PRDA 3ZKNC 3NCJL 1VACB 5GXBB 5KVEL 3VXUD 1DVFA 1GGCL 2IBGA 2MPAH 1QSEE 4X99B 5KANG 5ILTH 1TTFA 2AV7B 1CXIA 1Q9LB 4K3HA 5I17A 4L3CA 1LQSR 3ARGC 1D3CA 2NXYB 5LQBH 3S5LB 2A83B 3V5DB 3I50H 5J11B 3OR6B 3V6OE 1SMOA 5C0NC 1UH3A 2LE9A 1ZGLB 3WFDH 4HWZA 2NY3D 1R3HA 1D5XB 2V5YA 5I6XC 4I0KA 3DVIA 3MXWL 4OCRL 4XCEB 2IANA 1IGTB 1RK0B 2BRRL 4F7MB 5ITFA 5E70A 4YHYB 4FQQA 3MROB 3QHZH 4HFWA 4R0LB 4RWHA 2BJMH 3MFGB 3LY6A 3FO2B 3MUJA 3D18B 1NMBH 2HTKD 3CMOL 2DQDH 3CPLB 5DHVA 5KN5B 4IBLT 1OGAD 4H5SB 2YBRB 4YFLF 1I85A 1NGXA 2D03H 3WFHB 3WHXA 4GW4B 1MRFH 3L3IB 2FYYA 2NY1B 3ARDA 3LD8B 4NYLB 1G0YR 3U9PH 1S78D 3TO4C 1YUHA 3SDXB 5F7KC 1ZKAA 2FB4H 3P73B 2I24N 2H8PB 3BGAA 4OD3L 4JANB 4UU9A 5DO2D 4RZCA 1OP5K 4NRZA 4QRPE 1FNAA 3QJFA 4FQLH 1H8OA 2EIEA 2DWDA 5CINH 2E7CA 1X5YA 5ETUB 4MXVF 3RKDC 2DIJA 3SE4A 4WWID 3ULUD 5D7SH 2BCKB 2CJUL 1FFNB 5GPRA 3TA3B 3STZA 1BZ7A 2XQYK 3I3BA 5HYQB 3VXMB 2XG4A 4OFKA 3PNWB 1VKXA 1RUQL 2F19L 4NQED 3KPRE 1H3WM 4HUWA 2HP4A 3RGVD 4K7FA 1XF3B 2E6JA 3LN4A 4MAYA 4Q9QH 4X98A 2AJXH 5ISZD 2HWZL 1H8SA 2ITCB 1KPRA 4S1QL 4NJ9H 1LP9E 5C0BE 4BSWB 3L5JA 5DHXB 2VZTA 1NANH 3QUML 5HHOA 2ADJA 1A14H 1HXMB 3QNXB 3S36H 5GIRB 2CUHA 3U0PA 1KELH 3GJEB 4NNYB 4FS0A 3KYMB 5C0JB 3GSVB 3O3AB 5C0FB 3ARFD 2YD2A 4QXTA 1U41A 4PJ7A 4HG4J 2IBZX 2EYTB 3GHBL 4BSVA 4JO4H 1VPOL 2F54B 4XNYL 1A6AA 3CX5K 5C70A 3OKNB 4AEFA 2J5LC 3DX7B 3ZL4H 1JNLL 1FORH 4OGAC 4PPTA 4HUXA 4OZIF 3IDGB 3UDWC 1AGEB 2Z8RA 5GZOD 5JQ6L 1O5DT 4HH8A 3BI9X 4I9WE 5E7BA 2YHGA 4FQHB 5DJ8A 1F42A 5IB3B 5SX4I 2VIRA 5CLTA 1NUNB 4GG8B 3RX8A 5C0CD 2DLEA 4H8WH 4LHUA 3PGCA 1UENA 3LKQB 1MUJB 3D87B 4EUPA 3SDXF 3E1F1 4HFUL 1U8IB 2ZKHH 1QBLH 2HFGH 1H15B 5F88B 3FQWB 3C5JA 4ZSOB 1A3RL 4KI5C 4N1CA 4JFZH 3WFBH 2JB6A 4NRXB 4GW1B 1RZFH 1CD1A 5GS1C 1IGIL 1UWXH 4LPYA 2F74A 4JFDB 4QRQB 5EZOL 5JXAL 4S1DC 2CGRL 1E6OH 2A77H 3WEXA 4HJJL 4HC1A 4N1HB 1B9ZA 3WUWB 1P4IH 1Z9OA 5E8EA 1ZEAL 3MLVH 4GQPH 4HWEL 1F6FB 2VB5A 4P2CG 4PJHE 4OLYH 2R2HB 1EHAA 2P7TB 1RUML 4GRLC 4GXVH 1CF8H 1TZHA 3WO4B 3FQRB 3P77A 4PJ5D 4ODWA 4V1DD 3QUMB 3SDAC 3RY4A 1DBML 3C2SA 3MOAH 5DXWA 2FSEA 3GDBA 3ZDZE 4AM0A 5L9DL 3BE1L 3EFFB 4PY8I 1KIUA 1J0JA 2X4SA 5GGSB 4ZXBB 3VRJA 1EIBA 4NC1E 4LCYB 3LN5A 5I9QC 4P59L 5F9OH 1UXSA 4PRIA 3BMWA 2PW1A 3ZKQD 4MQSB 3BUTA 5TDOA 1QSVA 2WBJC 2NZ9D 2F53D 5BQ7A 4JPIB 2KPNA 4EXPX 2H2SD 4Q9CA 5J11C 1GGTA 2AEIT 4PJCB 4KMTH 1OQXA 2EIBA 1KG0A 4ZUVB 1A4JA 1YEGL 4XAKE 4NN7B 3O6LH 5C8JA 1S3KH 4JAMB 1WICA 3V7AG 4YHYC 3C87A 3KGRA 3ULVL 4PBWD 4R0LC 4RMRA 2NMSA 4TUKL 1N0XL 4Z7VB 4PRAA 4LCWE 5IGXL 3O6MH 1WEJL 5DQ9A 5FO7A 2DYPD 2X4PB 4FFYH 5F1SA 1J0HA 4QWWC 1QRNB 4RX4A 5EO9B 1I1FA 1OD9A 4G7VL 1CQKA 1KB5A 3GUTA 3A6OA 3ARRA 3UEZA 4LCIL 1KN4L 5IFAL 3WS3B 4QO1A 1CVSC 2YD4A 1J1OH 3D5OF 4IS6B 2ZSWB 3B9KD 5EC2B 5DUML 2VLJA 5EDXA 1QBMH 5E00B 1CDBA 2J3SA 5FGSA 5DMIH 2DM2A 2C3VB 2NY1C 5HDQL 1RV6X 2A6DB 3LD8C 1D9KA 4JRYE 4Z0XB 1UG9A 1LEIB 1JPGA 4LPXA 1F6AA 3O3DA 1J1XH 1PG7H 5T1KA 3ZE1E 2GJ6E 3GM8A 5E8OA 3DX9A 5H2BB 4LLAA 3K46A 5D6CA 3IU4H 4O4YH 2M8XA 4EI5B 4K8RD 1BF8A 3LVEA 4YK4C 3VGEA 4OI7A 1QSFD 4OI9A 4TTGA 5GGRA 5EWIH 43C9A 3T1FB 3QXDA 5GSRA 5CHNB 2VKXA 3LKRB 3FO9A 1IZJA 3IDJA 3MLUL 2A1WL 1ACYL 3WCYA 4G8GB 4OZFG 1YEDB 4YO0B 3MCLH 3EO1B 3KYAA 3CDFA 4LLMB 1OAXH 2QADD 2X70B 5I18H 1CGWA 1JWSA 2Y06L 3T0DA 1BECA 3D3VD 3LMJH 5FO9B 3H0TA 5GJTH 2B1AL 1P4BH 4JFOB 2SEBA 3KPTA 4JZJB 4LSTL 1A7RL 2AJUH 4OM1H 1FP5A 1INQB 3GIZL 1QFWL 1JV5A 3NA4A 4MQXD 3QRGL 1TVBB 3L7EB 3ZKSD 1WV7T 4Z7VF 4FTVB 5IP4A 1HEZA 1QSED 3A0OA 3O8XB 1FLRL 2XI9A 5DZOA 2VABB 2YD9A 2I26N 1CGYA 1OGAA 3L1OL 4UT9L 1N6QH 3F7RA 3T2NH 1MY5A 1S7XA 1OARH 4LLDB 1LE9A 3ZYOA 2DJ4A 5SV4A 4HGKC 1KSRA 4RQQB 3RI5K 4Y1AB 4P0DA 3B2VL 4UUJA 4NZJA 1BREA 4KQ4L 3OHXA 2FX8H 4ZFOA 5D7LA 5FDYA 5BRZA 1BD2E 3KPMA 2E9JA 2M2DA 1GOHA 3PP3K 3OKOB 1N4XH 4P4KA 5CWSB 1RUAH 1UZ6E 2DQTH 2RQ8A 3KYKH 5DUPH 1A7PL 1IGJA 4PP2A 5BXFB 3X12A 1N6UA 5IOPA 4XXCC 2BSSA 5B3JF 3S8WA 4RIRA 4GT7A 4XVJH 3AMLA 1G7HB 1F5WA 4KJYA 5ACLA 3S34L 2A74A 4WW1A 4UDUA 2Y4SA 3SDCD 3FB5A 4M5YL 1GPOL 1Q9WB 3B6SB 3MLTA 1S8DB 4WI5A 3RGVA 3IFLH 2R0KL 3SE8L 1YYMH 5ISZA 3T65A 4LSSH 1J12A 1NEZB 4FQJH 3LQZB 4XH2B 3WO4C 4QRPD 3N85H 1RAMA 3M45A 1FHGA 2HVJA 1KTDB 3DO7B 3CJJA 5T5FL 4PR5B 3K4AA 1HH9B 2WWMC 3ULVF 4B0MM 5GQBA 1A2YB 4P2RA 3K74B 1UB5A 2X4NA 5JLZA 1WTLA 4ZTOL 4UT7L 4IRSB 1PX4A 3FFCE 4JKMA 4NKMB 3STLA 3F62A 3BP6A 3F6LA 4NQDE 1C1EH 3KPRD 3O3BA 4UOW0 5IKCB 1DQJA 3MRBA 3QG7H 5C86A 2NXZC 4H88L 3HE7D 4JKPH 5F1NB 2DQEH 3BW9B 5D9SA 2P48B 1H3TA 3X14B 3ZTNH 3BPLB 3GSQB 3LB6C 5E4EB 4NN7C 1P7HL 3K2UH 3MREB 5C0CA 4J3SA 3TZVB 3JV4A 2VUYA 4P46B 2XQBH 4YUEL 5C0IA 4I0PB 4XRCA 2R2BB 1I8LA 5CJQL 2DIAA 4DKEH 2K1MA 1OT2A 2XTJB 5JORA 1LE5A 5TFSH 2R1XA 4ALAL 4WI8A 4ODUA 3AREA 1UWEH 2WNGA 3KPPB 4ETQB 1FG2A 5EOTA 5ICXB 4ZPVA 1RZ8B 4NN5C 4QXUL 4XCCL 1FNSH 4AT6B 5I1HL 2DKSA 4MS8D 1CFNB 4DQOH 4I9WD 4GBXB 2RHEA 3BOVA 1PQZA 1JRHI 1EO5A 5I8KL 1MRDH 1NANI 4WHTA 4LOUD 1VESA 5CKAA 2BFVH 1Q1JL 2CK0L 4D3CH 1FZKB 1M4KA 4QNPE 1HIMH 5KS9F 1CLYL 4F8TA 1FL6B 4YHPA 1AY1H 4PJ5A 5J06A 3MR9A 3HG1A 3UTSE 1FFOA 4P9HH 1MREH 4ZOBA 5EIIA 2E27L 3I02B 3VH8A 2AV1A 4EI5C 2IJ0C 4ZDHA 1C7SA 5DJYB 1BWWA 2CDEB 5L7XL 3V0WH 5DWUH 1XF4B 1PVHA 3U0TB 4EN3C 3MACL 4LK4A 1QR1B 4JDTH 4P2QB 3OV6A 4NSKA 4PJBE 4RFOH 1BVZA 4OTXL 4HPYL 3LZFH 4KPHL 5MEQA 3O3UN 1RIHL 3MC0A 1EBAA 4XMKL 3B9DA 2Y07L 3DHJA 2WP3T 4AEIH 4FXGA 4Y4HA 4M48L 5HGBA 3LDBB 3QB7C 4PGCA 5CZKA 3MRJB 4PJ8B 3VXOB 2GFBA 2WINB 2V7HA 3I9GH 3GJFH 5JOEA 3RL2B 4HGWB 1GGCH 4WRLA 5I15L 3ULVC 4JZJC 4F3FA 3EW3B 1FGNL 3TV3L 4DVBA 1U3YA 3CVIL 5B39B 5C6WH 3H7BB 2VH5H 5D8JH 2DYPA 4OF7A 4CMMA 2MQ3A 1U8HB 2AEQL 3RBGA 3HPLB 2DQFB 2DQIL 3G08B 3KXFB 4X6CB 4MDJA 2UY7A 5F7UA 4JFPA 3W11D 4JDVA 1C5CH 3RPKA 3U7WL 4FN0A 1KT2A 3SJVB 4YGVB 3ZDYE 3LH2L 4KJQC 3G9VA 2EXWC 4NM8L 3V5HA 2A73B 3D0VB 3R1GL 2XKNB 3WFZA 3EJZD 2H32A 4LCWD 3ECBA 5DRNB 2QSCH 5BOZG 5DK2B 5CS7A 4QGYA 3TFKD 4F58H 3LQAH 1V5JA 2HT4C 1I1YB 1QSFA 5IR1A 3MJGX 4NC0B 1TFHA 3WLBA 2I60L 2Q7NA 1ORSA 2YXFA 5L6YL 2MCG1 4UV4L 1YMHB 4TSCH 4YPGB 3QBTB 4RRPG 4E9LA 4QT5A 3QCVL 1XR8B 3CVHL 2VLME 3MNZA 5EU4A 4ZNEA 4G8FB 4EVNB 1DEEB 4HIEB 4JRYD 4I1NB 1YNTA 2D31B 4RDQF 1ZT4B 3IRZA 3RTQD 3VXPB 2ZUVA 3H42H 3QFJA 2CRYA 4KH2A 4Z7NE 1U3HB 5T33L 5CILL 4P49A 5TDNA 4MDIA 4OFYD 3LEXB 1RUQH 1IBGH 5C9JB 1JTOA 2YRZA 1YNLL 3OKDA 1YDPA 4Q6IB 4MZ2A 4KXZH 4TNWF 3MRCB 4KUCF 3CU7A 4YDKL 1QSEA 2XIDA 3HC4H 5ID0A 4YXHL 4IRSC 1I8KB 1KLUB 3IDMB 3MRHA 1FZMB 4KQ3L 3EYFB 1FVDB 1HH6A 2MNUA 3GB7A 3KNBA 3S4SB 1LO3L 1TNNA 4I18B 3V6OA 1NL0H 4X6CF 3UC0H 1PGRB 5T1DH 5DJZB 5CEZE 4OKVB 2Q8AL 1JTTA 3BPLC 3OSKA 2R0ZL 1BOGA 4MX7A 3GHBH 3GZKA 3TZVC 4OGXL 1WAAE 3E8UL 4DKDC 4P46C 3BEWB 5I75B 1PJ9A 4I0PC 3EFDL 1D5MA 3JZ7A 1HOCB 1JNLH 2XTJC 1D5IL 3MJ9A 2C1PA 5JQ6H 4KMQA 2KQNA 5EU3B 3X11B 3JWDH 4M93C 3RY5A 1KTLB 1ZS8B 2EO1A 4Z7QF 2JELL 3TIDA 1HYSD 5E6ID 4M1GL 4JY5L 1T1YA 5DFTA 5CIPH 5DEFB 3SDCA 8CGTA 3OZ9H 1T04A 5HYSA 3ZYJA 5TH2A 1FYTE 1A3RH 2V2WB 5LXGL 1BD2D 4ZO6A 4U3HA 2AJZA 5L2KB 3U30B 4OV6F 4Q2ZA 1YYLL 4QRPA 4NQCB 3VDBA 3CZFB 1R3IH 2Z35A 4M43L 1FAKT 3GK8H 5AZ2L 3WJLC 2J8HA 1HDMA 5GGVH 5I1EL 4OV5B 1Y6NR 3L3GA 4JM4L 4NKIL 4LVNC 4H26B 1ZEAH 3W5MA 1CBVH 3L7FB 1NGWA 4E5XB 4KRLB 2JK5A 2IG2H 4Z7UB 4MJ2A 2P8MB 1T6VN 3OPZL 4L8SB 1H3UA 5DMKB 1G9EA 3KPRA 3M17A 1DCLA 1BAFL 5F89B 4I3GA 3EYOB 1AP2B 2H9GB 3LDBC 3O4LD 6FABH 5IFJA 4AH2A 2YPLE 4PJ8C 3BE1H 3N50A 3QEGH 2OX5A 3Q0HA 4N0CD 5C0BA 1QHPA 3NFSH 3FB7A 5C0RH 4YNYB 3RZCB 4Z78B 3D0LA 4Y2DB 1I1AD 2O61B 2E6PA 1U8QB 4JJ5A 3C5ZD 2W65A 3MLXL 1AR1D 5ERWB 1F4YH 1R5WA 5K93A 3PGDB 1YY8A 3O4OB 3FFCD 4MA3A 3QWQB 2ZG3A 2VDLL 4B50A 3T0EC 2B0SL 5K59F 2IAMB 2YA0A 3CDCA 4BH7A 3KPQA 5IEKB 5FYJD 4WI4A 2OI9B 2R0LH 1JE6A 1P5UA 3ULVH 3HS0A 5D7IE 4WO4C 4YFLI 4TUKH 1N0XH 2NW3A 5IGXH 1QUNA 3HB3D 2V6HA 1JGUH 2XN9E 1UWXK 5D7JD 5D2LB 4LCIH 1KN4H 4XNMA 2IGFH 5B4MD 5IFAH 3DVGA 3TBSB 3X13B 1F3JA 4OCWL 5DUMH 4U6VL 2BC4B 1X9QA 4KK5D 2P4AB 4AENB 2C7UB 3MV01 4XPFL 3PHQB 3DECA 3S3SA 2YXMA 2CDGB 2VZ3A 1DUZB 3DXAB 3NA9L 1P7QB 3WSQL 2BDNL 4QXGH 4HCRH 1JWUB 1NDMB 2ZSVA 3GSOB 4YHNB 1J05A 2JIXB 2DMCA 2NY4B 5C09B 3BWUC 1NGZB 5EBWB 1NGQH 4XCYA 1UXWB 4IMKC 5JHDB 4LPVA 3W39A 3H9SD 4NP4L 5E6YA 4NO2A 3BEVA 5C0DA 5DSCB 3LRSA 5IUSA 3FQUA 3GI8H 2I9TB 1NLDH 3OKEB 2GK0A 3THML 3UTSD 1XGPA 1IZKA 1U3HC 2AXGA 3FRUA 4LU5L 2VZSA 4QRTB 4HHAB 2ESVD 3H9YA 5L2JA 4M6OL 3HI1A 3VU2A 5HY9A 1CICB 1EH9A 4XCNB 1ACYH 1PZ5B 2VXVL 2QHRL 1QYGL 4Q6IC 4JQXC 4TVPL 2Y06H 3WHE1 5ALBH 3SGKC 1MCEA 1MF2L 3WD5L 4PG9A 3RVWD 2VLRB 3SKMB 5FM4A 2X4OB 1U8MA 4GS7B 4M7KL 1CU4H 3GO1L 3OXSB 3RWIB 1H9VA 3IYLW 4I18C 4YDJB 3UPAA 2HTLD 1A7RH 1BQHG 3OG6B 1J9CT 3O0RL 1DL7H 4C4KO 1UB6B 4JZOB 1KCRL 4KHXH 1MIEH 4JN1L 4OZFH 4WJ5A 1CE6A 1XT5A 2RB8A 3H2WA 4LNRB 3HRZA 1FLRH 2IH3B 1FE8L 3S88L 2VTFA 4O5LH 5I75C 4KUZL 1BWMA 5HDBE 4L8BB 5C0AB 3CX2A 5D2NE 1N26A 3L3JA 2JCCE 3VXNA 1ZA3A 2FECL 1Z5LA 2PW2A 3GRWA 5KSAD 5DJAB 4MCZB 3GSXB 3KPLA 2GTZB 1CLCA 3ROLA 2KZ1B 3VFVA 3S5LG 1L6ZA 1W0VA 5E9DB 5GS2H 4P5TB 3C5SB 2I07B 3QUXC 4WEBL 5D6DA 1VGEL 3SKUD 5DHYA 3JSSA 3NAAL 5KSVB 1MY7A 3FOMA 4JRYA 2GY7B 4D8PA 1A7PH 1TZGH 3C6LD 3U30C 3G6JB 1DJSA 1IFHL 5A1AA 2GJ6A 4OAWA 3SKOA 3ZKMC 1T5XA 3CIQA 1W8NA 4AK1A 3KLAB 1X7QB 5C6PB 3IFPA 1FL3B 2AJSL 2E6QA 3P0YL 4FOMA 4U6XA 1MI5E 4MWFA 4X5XA 4ZQKA 1CXEA 3F7QA 1A6PA 1UH2A 4OFYA 3JV0A 3AGVA 4M5YH 1GPOH 5EO1A 4X0KA 1A6TA 3LSOB 1V3JA 1OM3H 1KXVC 5H94A 1FO0L 3CSGA 2R0WL 4QHLA 3SE8H 4POYA 3CDGB 4L8SC 2Q86B 2AABL 3U46A 2UZYB 5KJRH 2PYEB 2VR4A 2HT2D 2OJZL 3WS6A 5T3XL 5I1LB 3OKMB 1D7FA 4IMLA 3TIEA 4HGMA 1H3GA 2PETA 1QQDB 2QLVB 5K9OA 5J9PB 3RZCC 4Y2DC 2BX5A 4ZTOH 4WHCA 1PKQE 1MQ8A 5F1KC 3SY0B 1QO3A 3IETA 3PWNB 1KIRA 3SDDD 3SKNB 3VDAA 2OZ4L 5FM5M 5DRZB 4NFBA 1GAFL 3O4OC 1IAIH 3E6FA 5FXCH 5EBLA 1T5WB 3QT2A 4TTDC 2PTVA 1E0OB 3OXRA 3PDOB 3LPWA 5E8DL 5ESVA 1I9JL 4JFEB 2IAMC 4LSQH 5E94B 3QQ9C 2OI9C 4QRRE 2NNAB 1TVHB 1K8DB 3DTXA 4BFBD 1OTSC 5JXEC 4ORGA 3BDBA 4KK8C 4L8CB 4HDIA 5AG9A 4F80A 2ZG1A 1BD2A 3BO8A 2BVEA 2WMPA 5EFIA 2XZAH 1IAMA 2DQUH 1OB1A 2C3GA 2P24B 4XCCH 5A2LH 2CH8A 1ONQA 2XA8L 4FQCL 1ZAGA 2BVQA 4AIOA 3IXTA 5FYKL 3VFMA 1G7LA 4JO1H 4WV1B 2E7MA 3QXAA 2YUVA 1T89C 3V6FA 1A3QA 1X5JA 1AGCA 3VFUB 4XP6H 5FCUH 4QRSA 3QA3A 1SEQL 3Q5TA 4C4KT 2FATL 5DTFA 1M7DB 3QDJB 4RMWA 2CR3A 2NY4C 4ONOA 5IHUH 5IMLB 3T4AA 1JI2A 2VLLA 4PGEB 1U36A 3EJYD 3BP4A 4M5ZH 5SWZE 3HCVB 2X4TB 5ESQA 1FYTD 1ZSDA 4KTEL 1UADC 1A0QL 4CADB 1KXTB 2CKBA 5L7XH 2VC2L 3T0BA 4FQIH 3RVXC 3OX8A 2BSTA 2WLYA 1JHTA 3BVNB 3S35L 5KSUA 3EJJX 3MACH 4TUOA 4ORZC 4YHML 1JI1A 1QPPA 4XMPL 4XMLL 1ITBB 4OTXH 5FA3A 5DA0B 1YEJL 4WW2A 4XMKH 5IROC 4AYFA 1NQBA 2AXFB 5JIKA 4L4VB 4ZD3L 4DK3A 4GW5B 1JNHA 5IQ9B 5CIPA 5I1JH 5DFWH 4QHUA 3KJ6H 2YMXL 3MMEB 3FFCA 3HR5A 1ZK9A 5EOQH 1W72A 4P23D 5IVXB 3W2DL 4XTRD 4NQDA 4GS7C 1QEWB 2CQVA 3NACL 1N2RB 1I1CA 5DJ6A 1IM9B 2Z9TA 4ZUWA 1W8OA 4G80A 3V4UH 3LKNA 5DD5L 3CVIH 3F5WA 5IMMB 1ZT7A 2RAMA 4EEEA 4U1JA 3V52L 1RY7B 3D2UA 5IB4B 1J8HB 2N7BA 3SGDH 4H1LA 5D7JA 3PHOB 2FZ3A 1ZVYA 4ZFFA 4NO0B 1E28A 1SBSH 2QSTA 3IGAB 1YMME 3PP4H 4L1DA 1MHEA 4ZFZB 5KBNC 4L9LC 2IQAB 1F4XH 1U8JA 3V4PL 2BSRB 3TBTA 1C12A 4XNUL 2JJSC 3CCHB 1OD7A 3QUZA 1WTGT 3DGGB 3LH2H 1L0QA 4WDIB 5EULV 1OAUL 1ZT1B 4P5TC 4X6BB 3SCMD 4N0UE 3QIWB 3GSNA 4C59B 3IDXH 4EBQL 1Y18B 2EO9A 4MA8L 3ARWA 5GGQL 4YFEA 4JRXD 1SQ2N 4PJIB 2GSIB 1NCDL 4U31A 3T2OA 5ID1A 2XN9D 4K3EL 4BQCA 5CJ5A 1KC5L 2WQ8A 3V9FA 3VG9B 1UC6A 4X6EA 5MENE 4ZO9A 1G6RL 3P9LA 3GGWB 4M1CC 5T1LB 1I3VA 3TF7C 3NIDF 3UTSA 1OTUD 4KI5E 4FRWA 3V5KB 4OZ4A 3MFFB 5IB2A 1GIGH 3QEQE 4NFCA 3QCVH 3LEYL 4K7PX 3CVHH 3AFLA 4EI6A 4RNRA 5J6GA 2X2YA 3MRGA 4PJGB 4PJBA 4K71B 3MBED 5AZEL 3FQTA 3IKCB 1EUUA 2NY2D 3HAEA 3GJFK 2IH1A 5T33H 1KPVA 5CP3A 4JPWL 4MJ6A 5D7KE 5IVXF 4N9OB 5E2UL 2DM7A 2EH7H 1HSBA 4EIGB 4GG6B 5D1XB 5A2IH 3BAEH 4J3OC 3J8F7 1MOEA 1X5GA 3HA0A 1VFMA 3PL6B 4YDKH 1ZMYA 1FJ1A 3P4OB 4G5ZH 1HINH 3Q6GH 4X8JA 3RVTC 4MQ7A 5EUOF 4HCRA 3UTQA 4YBQC 1DE4B 4U4BA 1X4ZA 3PWLA 2EIZA 4M61B 2OCFD 1YY9D 1QA9B 3UTTD 2AQ3A 4HG4K 2J2ZA 4HX1B 1TETL 2HFFA 3ZSSA 5KSAA 5SWQB 3MV9B 2Q8AH 4H0GA 4JVWA 1YEKH 3BYTA 1KCSL 1PYWA 1H5BA 3MO1A 5KOVC 4K23L 3G9AB 3HC3L 2FLRT 5DR5H 5EUKB 3RL1A 3VGAB 3BZ4B 5HHVH 3D69B 2BNQE 2DBLL 4ELMF 4Z7WB 3C8KB 1G6RB 4L5FL 1EJ6A 4J1UA 3DUSB 3C6LA 3EO0A 4PD4J 3G5YB 1RULL 1JZ7A 4Z7OE 1INEL 1MCLA 1NCAL 2HLFD 2HFEB 4X9GA 4JB9L 5HJ3B 3JTTB 4WY7L 4ZAKD 1H3XA 5E8NA 3BH9A 4GAGL 4R7DB 2H2PD 4FFWC 4WV1C 4UIKL 1WBYB 2IQ9H 1KTRL 1AD0A 5DT1L 2QHLA 5IM7B 4DCQB 3ELAT 1EO7A 5JOFB 2J1KA 5IVZA 3QI9D 5IB1B 4PRPE 4NUJA 4U6YA 3QO1A 3QH3A 1J5OH 2X4QA 3S9DB 4BFEA 3RP1A 3QEHB 3BPCB 2HRPL 3OGOE 4YBHA 1Q0XH 3ARQA 5DZLA 2YKLL 3JXAA 4PJXF 3VFOB 1DANT 1L7IL 4MA7H 5DD3L 5E0QA 4M6AA 3B2UD 4GG6F 3ARBB 3RNKA 3OKKA 1ZHBB 2FD6H 4UILL 3E0GA 1MIMH 4DAGL 3RHWF 3L3HB 8FABB 3DSFH 4HZAA 2DTML 1HQ4B 4MXQC 3T77A 4HIHA 1GRWA 2BMKB 1CGSH 3NTCL 4K94H 4UIMB 1I4FA 1Z2KA 4X9HA 3C09C 3WDJA 1CTNA 1RJLA 4JY6B 1CFVL 2IADB 4R6UA 5I8EB 1X5XA 5IEHA 5EPMA 2FJGA 2LTQB 4MLIA 2FR4B 3WXWH 2D0FA 4TNVF 1LK3L 4HAFA 1UACH 3BSZL 5ENWA 4JN2B 4JGUA 3ZKND 2QEJA 4X7SH 4GXUM 2DBJA 5T1MA 2NY0C 3MA7A 2OBGA 1WF5A 2F54E 3DURB 12E8L 3SDYL 4O58L 1OSZA 2MJWA 2VDPL 1GGYA 1P2CA 3ARGD 5E56A 5GGUB 3H9HB 3SPVA 5D96B 1D5ZB 2LAAA 4JFYB 5C0ND 3BHBA 1JNNH 3QIWC 1Q9KB 1TJIL 1GHFH 4MJ5A 1T4KB 4YQXL 2ITDB 5CBAA 1FYTA 1S7WA 4U6VH 5F6IB 4WWKB 5B38B 1RIUL 4R3SA 1RUKL 4XPFH 3DX8A 4N8VG 2OJEA 1ZV5A 4MD5A 4NZTL 3DWTA 5IQ7L 4U1SA 4I48A 3S37X 4ZSOE 3P9MB 1IAII 2J88L 1LILA 4D0CA 1FBIL 3IS1X 4MNGB 4ZS6C 5JO5B 2E7LC 1HHHB 4NFDA 2NZIA 4UAOB 1G9NL 5JMOC 2FWOA 4JFDE 5LWYL 5K9JL 1P9MA 4LCCA 2R23B 1JHLL 4K71C 2PO6B 1LNUA 1WWCA 3NZ8B 2OTWB 3P4LA 1XGYL 4P23A 1NSNL 3CSYA 3TO4D 5DLML 4KTDL 3QQ3B 5SWZD 4LU5H 1RJCA 1M71B 3C8DA 4FFZL 2Z4QB 2YPLA 3ETBF 5SV3A 5D1XC 5DJ0A 1QYGH 3C9NB 4NUGH 4YHZH 3L3DA 4TVPH 3PL6C 5IW1B 3CFBA 4F7PA 1EFQA 3TH2T 4M7LH 4P3DB 3MXVL 1UH4A 2DQJL 1DQLL 4V2BA 5DJCA 2CIKB 3RKDD 3F8UB 5L0QB 1IM3A 3GO1H 4NNPL 1RMFL 2OP4L 1JF1B 3O0RH 4E42A 4K2UL 1KCRH 2DDQL 3GHEL 3HFML 1DN0B 2P8PB 2Y72A 4MJ4A 1CGUA 3JTSA 1OAQL 5FYJU 3HUJF 1BPVA 2LAGB 1MWAL 3IJSB 3SCMA 4PJCE 1NLBH 3W9EA 3QDMB 5ICYB 5D7IA 2G9HA 4KUZH 3KPNB 2H45A 7FABL 2WUBL 4G9FB 4LNVA 3TEUA 3VGAC 4WTWA 1NMAL 3BRDA 2VN4A 3MTRA 3RWCA 4HLZG 4M7ZC 5EN2A 2XN9A 4ISVB 3UBXI 3UBXA 4I8DA 1RURL 3IB4A 5JDJA 1R3KB 3VE0B 1IE5A 4Y19B 5MEOB 4MB3A 1AH1A 1AXIB 1ES0B 5I16B 1QRNE 2Q76B 2FEEL 4KRNA 4MD4B 3WKMH 15C8L 2HG5B 1BVKA 3D25B 4J6RL 4ODTL 5C08B 3WLWD 3DMMA 3IF1B 1IEHA 3RWDB 2DLFL 4OGAD 3CLFL 3W9DA 5DI8A 1MAML 1ZLSH 3U4BH 3CFEA 1A7OL 3QIBB 4OUUB 2G5BB 3MBEA 3HTLX 4FP8H 4WUUA 5I1KH 5JR1H 5EU5B 4KMLB 1KULA 1U8KB 3PIQB 1W0WA 1D6EA 1X3DA 1BGXL 2AJSH 3RIAF 3T3PE 1RHHB 2DQCH 2AJYL 4F9PA 5FUZH 2H41A 1RK1B 3CXDL 3MGTB 4KI5D 4MNQD 1FQ9C 1FO0H 2JB5H 3ARBC 5T3ZL 4MSWB 4Y5VC 1CFTA 4X7DC 3QEQD 4R96B 2R69H 5CCKH 4Y5XA 2HKFH 2DD8H 5JW4R 2AGJL 4NGHL 5F3BA 4S1DD 5C0EA 3REWA 5T3XH 4CDHA 3VRIA 1QNZL 1MH5B 3EO9L 3HI6L 5E5MB 2BXZA 4G8GE 1LO5A 1ADQL 2FEDC 4JHWH 3VXQB 5IG7B 5EC1B 3T8XB 4XPHL 4W6XB 1G1YA 4GRLD 1GCFA 1LO2L 2I9LA 1A6ZB 1IQWL 4ODHL 4F7EB 4XVUC 3SDAD 2D3VA 3K1KC 3UJJH 2ORBL 5HVFB 5DRWB 1YPZB 5F9DC 2AAVA 1DBBL 1GAFH 3LV3B 1BJ1J 3UJTL 1IAKB 3BN3B 3EDJA 3HE6A 4UMGA 4PLOB 4OD1L 3LKSA 4UI2A 5D2NA 1KJ3L 2JCCA 4FTVE 3FHAA 2OSLA 3NPSB 5IW6A 4FA8A 5FGBC 3O11B 2H3NB 3VFSB 2WBJD 5FYLH 5JW4M 4R26H 4QHKI 5GS3A 4OCSL 2QL1A 4DN3L 3SE3A 5D96C 1NUFA 5BJTA 4F7CB 1Z3GH 4LLYB 5DGQA 3QI9A 4Y1AE 2R4SH 3T2PA 3BXNB 4WNQB 1OVZA 1YEEL 4XC3L 4J8RB 4PB0L 4LDEB 4GO6B 1DN2A 4E0RA 1RZ7H 1BZQK 2VDNH 5MI0B 4N8CH 2BK8A 3O2DA 5F6IC 1GC1H 4WWKC 5FOJA 3EZJB 1I3GH 4RAVA 1KYOK 4PS4L 3RBSA 1S5HA 4E41B 4HPOH 4LKXB 1KTKE 2OM5A 4M6NL 1FNGA 3NGBB 1LD9A 5F7FA 5IBUG 4NHCL 3BP7B 4XI5C 5EO0B 3X3GH 1SY6H 2FATH 1I7UB 1Q9OA 1QBBA 1MI5A 4UAOC 3B43A 3Q2CA 3BN9C 1ZLUH 2G2RB 2Y6SD 4KTEH 5IJKC 1OPGL 4B41A 4G8EB 2NY1D 2LU4A 3CFJA 1JVKA 2WIIA 4BQ6A 5A43C 1JN6B 2R56L 1CT8A 1RQ5A 1F58H 1BF2A 2H6PB 3GIVB 4XMLH 3GSUA 3OL2A 3L9RA 5AYQA 3GBNL 4KU1A 1I3UA 2Q6WA 4KI1A 1IAIM 3PJSA 1UQSA 3RWHB 3TLRA 4CVXA 3PWVA 1PKQA 2YMXH 4FQ1H 3FONB 5B21A 3W2DH 2NY6B 4OLXL 5L0QC 1KJ2A 2CLZB 3NACH 3CNKA 1VGKB 4L1HA 3TA3D 2YSSB 3OF6D 3LS4L 1CG9A 2OR9H 3VXMD 2EE2A 1EGJL 1QVOB 1LEKB 5KZCB 3ARGA 1QFUL 4TNWK 3RDTA 4K3DL 2A6IB 4HKBA 5IMKA 4PJEF 2XWJA 4TRPL 5I2IA 1MCOL 3ZE2F 4QRRA 3AXLA 3R8QA 4M9PA 1DSFL 5IK3B 1NC2D 1ZANL 4NQXB 1R0AL 1C5BL 3KPSE 1MJ7L 2NTFB 3DX6B 4S1RL 4X4YA 4FQ2L 1BBJA 3LIZH 5D72L 2IBZY 2W9DL 1A5FL 4XP4H 1CLZL 5IT2H 1FNEA 2XTJE 4TULL 3IXAA 1PFCA 1S7SA 2F54D 2RR3A 2Y5TA 3VJ6B 1J1PH 4OLWL 1G9NC 4YEEA 4L3EB 5IW3A 4QHMA 4YDVA 2OL3H 1EEZA 4GXUN 5DFVD 3QIBC 4QTHA 3ZTJG 3IDIA 1MCRA 2VRAA 3U6RA 3LRHA 2X7LB 3DBXA 1G9ML 1IC1A 1G6RH 1NJ9A 3AS2A 4P5KA 4RMTA 4O2EA 5DYOA 5SWZA 1SJEB 3Q5OA 2OK0L 2FO1A 1DP0A 1YNKL 4P9ML 5GISL 3MRMA 3MYZA 1E4WL 4AIZB 5HHPB 3EOTH 4RBPK 3UTZA 3M1BB 3BZFA 3RPIB 4X7TB 5L8JB 3MJ6A 2CXKA 4JFDD 5EB9A 4PJ9B 3VCLA 4G3YH 1HHJB 3MRPA 4P2QE 1RZGB 3GEWB 1K8IB 3L6FB 4FQXA 4LEXL 1I7RB 5E2UH 5E6IB 4WU7B 2R39A 3I6KA 1QTYT 4PV8B 4KKAC 3VFRB 3DROB 4PRDB 3ZMRA 1KIQA 3EDKA 3UJIL 1RVFH 1TTGA 3LRGA 5IIEA 2KDGA 5I17B 4L3CB 3P3YA 1AHWB 1B88A 2DI8A 2FX7L 3DV4A 3NPZB 3B4NA 4IJ3B 4X4XA 2P5EB 2WWMD 4D9LL 5K9QG 1ZGLP 4RA3A 3RUGF 4ZXBD 1KCSH 1R3HB 4GAJL 3WN5B 1YMMA 4QRUA 1CFQA 4G6KL 5ITFB 3NPSC 1NCCL 1KUMA 5HGDA 2B1HL 4OZHB 2X4UA 4WFHE 2NXZD 1EHLL 1UCBH 4MAUL 1HNGA 1JPFA 4YWGL 3UXFA 1UVQB 4N0UA 1FZJA 4P2OA 1MLCB 3PV7A 2ILLA 3QP3A 4Q0XL 2Z91B 2FCBA 1T2XA 1T2JA 3BPOB 5MI0C 1BVLA 2WBWB 1AO7A 2ICEA 3K8KA 3TVMB 5DJDA 1NGXB 2RJMA 3WHXB 5MENA 3U1SH 4NWUL 1F4WH 1LHZA 1ODAA 4MB4A 3FHQA 3ARDB 1N64L 5EIQA 1ETZA 1JYWA 3GSWA 1QRND 3ZE0E 3FO1A 3G5XA 4M62H 5BV7L 1OGTA 4LQFL 1ZHKA 5FOBA 4UU9B 5IF0A 3IT8D 4M8QB 4U1KA 2D2OA 1MPAL 4NNXA 3BZEB 4WCYH 3QJFB 3MLPA 1LWRA 1MQKL 3PG2A 2DWDB 3DARA 4A6YA 1J0ZA 1QHOA 3QUKB 5FKAB 4ODBD 4LBEA 2YKLH 4DN4H 1S5IL 5DD3H 1ZXQA 2FLBT 1PSKH 4PLJC 1BQHA 5E03A 2ZOLA 3KR3H 3W81A 4AEHL 4OQTH 3SDAA 4DAGH 3D85A 4FFVC 3QAZC 1A6VL 1DBAL 4HUWB 3NIGF 4J3WA 3TYFB 4EI5D 3CUPA 3LN4B 4GRWB 4MAYB 4HT1L 1BZ9A 3C60A 3GMQB 1KPRB 4EN3D 1OW0A 2CDFB 2NY6C 1VACA 3TH3T 3GBMH 5HHOB 1JWMB 2AV7A 1S7RB 3U0PB 1Q9LA 4G8GD 3P11L 1FIEA 1CFVH 3S5LA 3BDYH 3O9WC 4Y8DC 5EIVA 4BYHA 3RX7A 3V5DA 4IOSD 5FHAH 4Q7DA 3H9SB 3DO3A 4OCXH 4PGDB 1RJZA 4XCFL 1LK3H 4BA8A 4XBGB 1D5XA 1X44A 5JUEH 3WNKA 5C7XL 4HUXB 2BNQA 4R2GB 4F7MA 1IGTA 1RK0A 3ULVD 3UYPA 1OAYL 3ESVF 5DJ8B 5GJSL 4L4JA 5M7QA 5TE4L 2XWBB 2VDPH 4UTAH 4X6FA 1K6QL 4X4ME 1EEYB 1EVTC 3D18A 3QZWG 1A8JH 4N8PA 1SJVA 4FTVD 4IEFB 3RY6C 2HKHH 3O8XD 4LHUB 1AGDB 3RNQA 4HH9A 4EUPB 4HXAL 1IGCH 4RGNC 1TJIH 5I76B 4QTIH 2YBRA 2YUZA 3C5JB 4UDTB 2JB6B 4U05A 1RIUH 5E7FA 3WFHA 1CD1B 4Y1AD 3FT4B 3L3IA 4NZTH 4Z18A 2GK2A 4C83A 4PRPA 4LAQL 5IQ7H 4NYLA 3ROOB 2F74B 1WVZA 4KJQD 2G60L 1FPTL 5DC9B 3P73A 5CBEB 1FBIH 1BEYL 4LGSB 3WEXB 1T83C 4X7FC 4ERSH 5TF1L 4ODSL 5CJBA 1TJHH 3MV7B 4K3GA 2AK1H 5K9JH 5F6HJ 4R7NB 1MFAL 3AB0B 3DV6A 3PHSA 1GXEA 5ETUA 2HT4D 1CVRA 4ONFL 1TZHB 3BQUA 1XGYH 4KAQL 4ODWB 4IIQB 4FZ8H 5DLMH 4PJ9C 2BCKA 3ILPA 1FFNA 4Z7UE 3TA3A 3O6KL 2O93L 1A1NB 3JWOL 3OF6A 1UM5H 4NZRL 1U8OA 2EDRA 1KLGA 3MOQA 2CSPA 4G42A 2X4SB 1X6LA 4PUBH 1HHKB 2YPVL 2NY7L 2HFTA 3LN5B 2MSPA 4HZLB 1MLBB 4PIRF 4PJ7F 2ITCA 4PRIB 3H3PL 2DQJH 2JKXA 1SYVA 4BSWA 4JCLA 1AHWC 3OAUH 4MZ3A 3CD4A 4NNPH 3QNXA 3L3OA 1KNOB 3GJEA 4O51B 2Z93A 4ELMA 4K3JL 5C0FA 1KG0B 1A4JB 5I8OH 1T1WB 2DMBA 5AAMA 3WN5C 1OAQH 4IRJB 2G75B 3CLEH 2F54A 4KZDL 1MWAH 2PXYA 4RGOH 3OKNA 1UJTA 4GSDL 4IRSD 1EHNA 3DX7A 1B3JA 2R1WB 3IDGA 4PRAB 3FMGL 1AGEA 1BJ1H 1NMAH 3ZT7A 5A3IC 2O5YH 3ZKXB 2CO6B 1G9MC 4FQHA 4RMUA 1I1FB 2L4OA 5CMAA 3BGFB 4XPGH 2UUDK 1U8LA 4W6WB 4GG8A 1JTPA 1AXTH 5DEZA 3TZVD 2ZCHL 1LK2B 3P40A 4P46D 3KPOB 2Y7QB 3GKZA 4YAQB 2VLJB 2UV3A 3LKQA 4FG6C 3TVMC 5D2LE 4I0PD 1I85C 2B39A 2DLFH 1KIPB 3CLFH 3HNSL 3VI3E 2XTJD 2JJVA 2HH0H 3ARDC 1A7OH 2UY6A 4KRPB 4YX2H 4PREA 2P47B 4KVNH 1C7TA 3GMRA 5DDHB 4NRXA 4GW1A 1EJOL 1F6AB 5ANMA 5IFHH 5E8PA 4ZFOL 5T1KB 1NGYA 4JFDA 1FC1A 4QRQA 5DS8B 3DXAE 2MPAL 5HVWA 4DGVL 3MJ8B 5C09E 2AJYH 3WUWA 5ILTL 5FEBA 35C8H 2D4DA 2R2EB 1AXSA 1ND0B 5GGRB 5JHDE 5LQBL 2R2HA 3SE4C 3I50L 3QXDB 2E7BA 4POZC 4QGTA 5L88H 3UPRB 2ZUTA 1TVDA 3FO9B 5HI4C 3FQRA 3WFDL 1ZA6B 3OAYH 3QUMA 1U2CA 1T7YA 2O26U 2XZZA 3NH7H 2FX9H 4MAYC 4U6TA 4F15B 4J4PA 2PKDA 3EFFA 2BJML 2DM3A 2X89A 3MRDB 5GGSA 2GI7A 4OQ1A 4ZXBA 4LVHB 4LCYA 4P2QD 4Y89A 2XICA 1NAMH 1NMBL 3RVVC 2DQDL 3OB0K 1KJVB 4TSBL 4HLJA 2F5BH 2VLRE 1IQWH 4I5BA 3E3QC 1JV5B 5GRWA 3RWGB 1PG7W 4J12A 1URLA 5SWSB 4PJ8D 1Z6JT 2D03L 3MZGB 1MRFL 1HWHB 3D9AL 3SE9H 3I3EA 4R2GC 4PJDE 1KJ3H 4JAMA 1QBAA 2CIIA 2FB4L 4QY8A 5L8LB 4KUCD 3C6SA 1NFDE 3VFTA 2VDRL 2X4PA 3QPXH 1BBDH 5BV7C 2WAHA 1OWWA 4ZFOB 2E9WA 2XPGA 4MB5A 5CINL 1I3RB 5BRZB 4AG4L 1IL1B 3WS3A 3KXFD 4P4KB 1YEEH 2ZSWA 5EC2A 2D7NA 5E2WL 5D7SL 1U8PB 1P7KA 1PZUB 1IKFH 1G0DA 1KBGL 3IRPX 2R29H 2YPKB 4WO4D 4PS4H 4F9LC 2C3VA 3SJVD 5INCA 2BSSB 3H6JA 4M6NH 2B8OT 4RIRB 4HUMB 1B0GB 4KJYB 5I1DA 2AJXL 2I25N 1AR2A 2A74B 3G6JE 3OWEA 3MLWH 5H2BA 3QG6A 3MLTB 5HHMB 1ZLWH 1R3JA 1A14L 3FN3A 3T65B 2LFGA 5TE7H 1FFRA 3JUYA 5DC0A 4RCAA 4JO4L 4X80H 2FHBA 2Q7YB 4NT6A 4G8GA 2M1KA 1FORL 4YO0A 2PYEE 3EO1A 1WBXB 3TWCH 3MA9H 3MGAA 4PRHE 2X70A 4X9BA 3PXHA 1HKLH 4P2RB 2J6EH 3PABA 3STLB 3BP6B 3ZDXF 3A6CH 1KB9J 1U3HD 5FO9A 3O3BB 3SGEH 3UAJC 1DQJB 1CGXA 2GITA 3R0MA 4H8WL 4JZJA 1UKTA 3LS4H 5D9SB 1JHKH 5FHBH 1F90L 4HV8B 2ZKHL 1QBLL 2HFGL 1TVBA 3L7EA 4IRJC 3JV4B 1NC4A 1AIFA 3O8XA 3WFBL 1EZVX 1RZFL 4I2XB 4XRCB 4NQVB 3C08L 1R0AH 1C5BH 2YD6A 4JFEE 4S1RH 4LLDA 4LIQL 1E6OL 2A77L 4ODUB 1RFDH 4OQTA 3JV6A 4AL8H 5CUSL 3AREB 3O41B 1M05A 3PUCA 3BGFC 3PGFH 1RI8A 4Y1AA 4ZPVB 5HHNB 2BSED 2UWEE 2AI0H 4MJIE 3MLVL 1DQQB 2ARJB 2DJSA 1S7VB 4BFGA 1PQZB 4GH7B 5D1ZA 4GXVL 3ULUF 1CF8L 4WHTB 3ZT6A 5I71C 3P4NB 1N6VA 2YZ1A 2HJKA 4TYUA 1WUNT 4IHOB 4ACPA 4NO5B 1D9KC 3VXUE 3MOAL 3IU3B 3QFDB 4JFXB 4X9IA 3RGHA 2BVPB 3NN8B 5B3NA 4YHPB 4KKCC 4OGYH 5DHVH 1JF6A 1CL7I 1HQRB 3VGHA 2X6MA 1ZOXA 3MR9B 2QR0A 3HG1B 3JWOC 4HAGA 1G7HA 5EIIB 3QUXD 3VH8B 2AV1B 5F9OL 5GS0H 3NABL 4ZDHB 3GMPB 4GKOA 1AC0A 1T7ZA 1YNKH 2P5WB 2XV6B 1E4WH 3B6SA 3DI2B 1DTUA 1S8DA 2CLVB 3ZTJH 1W2KT 4KMTL 2OXHA 4OLUH 1WWBX 5L2KD 4XH2A 4NQCD 3ZKMD 3DPBA 1J7VR 3N9GH 1TENA 4L3AA 2ZUUA 4GOSA 5FAAA 3PV6B 1CIUA 1S3KL 1KTDA 1VENA 4Y4HB 3DO7A 5FUOH 5IBTH 3WO3B 1QFWI 4PGCB 4F15C 1HH9A 4XPAH 3AU1A 2AQ1A 2K9UA 2AJ3B 2YRPA 3CH8A 4L4VE 5FUCE 1OAZH 3O6ML 3K8MA 4FFYL 3ZSTA 4ONHA 4GMSH 4NKMA 2A6KA 3UJIH 2PN5A 4DVBB 4CRPA 3TBYB 4NN6B 5F1NA 2HRLA 3BW9A 4CMMB 1IGYA 2HTKC 1QBML 3X14A 3QXWA 1KPUA 5DMIL 3MREA 3KPSA 3TZVA 2VDML 3VI4E 2EDEA 3AY4C 3RZCD 4Y2DD 1XMWA 1J8HE 4G6KH 4P46A 4JDVB 4BZ2H 1NCCH 1V3KA 5E6ZA 1J1XL 1EMTL 1PG7L 2B4CH 1KT2B 5F7WC 5F7NC 4MAUH 2DB8A 5FYKE 4YWGH 4TNVK 3KPPA 4ETQA 1WISA 1A7NL 3V5HB 1RZ8A 3A6BL 2V5MA 2WIMA 4TTDD 4P4KC 2LU3A 3OB8A 2IAMD 5EWIL 3QQ9D 4RAHA 1CFNA 2VDOH 4GBXA 1SEBA 1XGRB 4CVWA 1OTSD 5JXED 4NWUH 1IC5H 5CSGA 4KK8D 5SX4H 4PJIE 1OAXL 5I18L 4K55A 1PX3A 1N3NB 1UWGH 4X5WB 2DL2A 4OD2A 1HHIA 5BV7H 4PJFB 4J3XA 4FZEH 5I1GL 4Z95H 3LMJL 3MNZB 5EU4B 2NW2A 1MPAH 3I02A 2FBJL 5GJTL 3WJLA 1P4BL 2WSKA 4LCUA 1P4LA 4K9EL 2CDEA 2FBOJ 3DIFB 2ED9A 2AJUL 4KKLC 3U0TA 2OR8A 5ITBL 3DXAD 5TGBA 2IFFH 1QR1A 4PJGE 4P2QA 1YZZA 2JIXD 5TDNB 2NY4D 5C09D 3QR2A 1N6QL 5I6XB 5JHDD 4HC1H 1A9EA 4GRMB 2Q87A 3OKDB 4F7TB 5IMOA 1OARL 2DWEA 3U82B 5ID0B 4GUPB 3EDDA 3RVXD 3VXOA 3CSPA 4JLRB 2WINA 4CW1B 2R1YB 3RL2A 3GB7B 1JGDA 4HGWA 2FX8L 1EERB 4M4PA 3CGTA 4XBPB 5F70A 1CICD 4DFIA 2ZCLH 5GRJH 3G6AA 1JZ6A 1FVCA 4IOFC 3LPGA 4Z0BH 1RUAL 3NIFF 2EYRA 4DTGH 1EK3A 2DQTL 4MX7B 3F7PC 5IV2B 3D39A 5DUPL 1U8HA 4LPCA 3RWFB 5F93C 3MV9E 2VLRD 2DQFA 3HPLA 4AQOA 3PWUA 1I8LC 3WDHA 3KDMA 2V7NB 3TO4B 4NO3A 4RMVA 3FO0H 3AREC 5GJSH 2E3VA 5DA4A 5FF6A 1NFIB 4YGVA 4LLQA 4V1DE 1K6QH 1DBKH 1S9XB 1BOYA 4Z7WE 1WLHA 1T1ZB 1YYML 3D0VA 3IFNH 4ZUTB 4LSSL 4JQVA 4P48A 2XKNA 4FQJL 2Y36L 3GMLB 5C0AD 1NAMA 5HYSB 4X6DF 1H0DA 5HHQB 1OOAA 1I9RL 4M9OA 3N06B 1KB5H 2F53E 5E9DD 5LG1A 1FPTH 1I1RA 4P5TD 5GRVK 5H35B 2OQJA 4J23A 1HDMB 5DJXA 1F11B 2VNCA 5CD5C 1NCNA 1C1EL 4HIEA 1YN6A 4P4RB 2EDNA 4JKPL 1XZ0A 4CAGA 2DQEL 2NCMA 2D31A 3F58H 3U83A 2XQYG 1ZT4A 3ZTNL 1VFBB 4ONFH 5HD8D 2C3XA 4HBCH 5E5UB 3VWJA 4H8WC 3K2UL 3RIAK 3G6DL 5BZWB 1MHHA 5AAWA 4Y4HC 2EDHA 2XQBL 1K9TA 3ET9F 3VA2C 3CFDA 3QULB 3WIIH 2C9AA 2R4RL 4TVPD 4DKEL 5C0BB 2VITA 1II4E 3FB7B 3MRCA 5TFSL 5C1MB 5TQ0H 5SX5K 1I8KA 4U1NA 4JJ5B 4XX1E 1KLUA 3IDMA 1FZMA 1XCTA 1FVDA 2PYED 3PWPB 3VWKA 3N1GC 4DQOL 3L5IA 4P57A 5DJZA 5EU6B 3F7YB 2Q20A 2AK4B 3ZO0A 1UFUA 3W0WB 2BFVL 3I6GA 4BH7B 3NBNA 1HIML 1C5DA 4MNQB 1QFWM 1JUFB 3BEWA 3RVTD 5JPMB 1HOCA 3HS0B 4YBQD 2ATKB 4X4MA 2DF3A 1RZKH 3FMGH 4YHIB 2OTPA 4P9HL 1L9N