1TQCC

Ovine recombinant prp(114-234), arr variant in complex with the vrq14 fab fragment (igg2a)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DVVMSQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSRLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYFCWQGSHFPQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords prion protein
publication title Insight into the PrPC-->PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants
pubmed doi rcsb
source organism Ovis aries
molecule tags Unknown function/immune system
total genus 52
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2004-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tqcC01
5LG1A 1DUZB 2IGFL 1CTNA 4ZTPL 1T3FB 4GMSL 2V17L 3PF2A 4S1DC 1AI1H 4FABL 4GW5B 1CD8A 4NJAH 1FGNH 4RA3A 5DFWH 1GGYA 4M8QA 4LSPH 3UX9B 5GRVK 1DQJB 3D48R 3LPFA 3QCTH 4D94A 4IRZH 2RB8A 4PY7B 4NO2A 5E00B 1FCCA 4CMMA 3BP4B 2A77H 4RWYL 3X3GL 1XGYL 5J6HA 4JHAL 5EU7E 2AEQH 4LSUL 5CEYA 1H0DA 4U6VL 1A4KB 4PJCB 5T1LD 2K9UA 3CDFA 4WV1A 5CSZA 4WW2A 4A6YB 4BK5A 3P0GB 3VH8A 4PB0H 4RNRA 3WXVH 5AZEH 3VDCA 4NBXB 3DUSB 4R7DB 3MLYL 5FO8B 2FL5A 5I9QC 3GNML 3MGTA 3IDNB 2CIIB 1LD9A 4P2RD 1SEQH 3MYJA 3MLZH 2APXA 4IOIA 1JNJA 1KJ3H 4NNYB 3BX7C 4A2MA 1Y6KR 3O3UN 3SEPA 3QEHA 4DZBB 1OCWL 5F93C 3HMXL 1NBZA 4YAQB 4HHAB 2VDRH 4EUPA 3B5TA 2ZNXA 2WV3A 3MA7A 4PRAA 3RI5K 5C0BE 3ROLB 2LAGB 2XOTA 2Z4QB 2R2HA 4PJGB 3NACH 4KHTL 3G08B 4I3GA 3G04A 2D31B 3QIBD 4XCYA 1P53A 2W60A 1KIPB 2FX9H 3BHBB 4UV4L 1K6QH 4N8CH 5E5MB 1CL7L 4Y0GA 1IAII 2A9ML 4D9LL 1G6RA 1BIIB 4XVTL 2DWEA 2VDNH 3PABA 1CLYH 4WCYH 1ZSDB 4KK6C 4F9LA 5KSUA 1AQKH 1EEZA 2DBLH 5K9QG 3ARRA 5EC1A 1A7RL 5K33A 3KS0H 3LRSB 3SDDC 1A22B 3RBGA 4MVBD 5E9DA 5ISZA 3RPIB 5DMGC 4LVNB 1F45A 3GMLA 4KVNL 4UT9L 3AS0A 5JHDD 1IL1B 4G3YL 4L4TD 3CD4A 4DKFL 1FH5L 5KANG 5A40E 5EORH 4PGZA 5CUSH 3V2AR 1W0WB 4M7ZB 5JIKA 4JO2L 4LARL 2CGRL 3GMRA 4DAGL 3VWKB 3WUWB 4QTIH 1GCFA 5AZ2H 4ZMAT 3T0EB 3WLBB 1FE8H 4K3JH 1KYOJ 1Q9LB 2GTZB 4LQ1A 3QDGB 1KF9B 3GEWB 1ZANL 5KSAD 5DD5L 2QHRL 3L5WA 1FYTD 3C5ZC 4X99A 5EOCJ 3QEQB 2NZIA 4K23L 3BQUD 4H88L 4U4BA 5MENB 1FO0L 5B8CC 3MC0A 2EDWA 2ZKHL 4Y8AA 3OKLA 4EN3A 3BW9B 3X3FH 1WIUA 4DGVH 1CFSB 2WUCH 4XC3L 1ULVA 1NQBA 2Q6WA 5DMKA 3C8KB 4N68A 2BNRB 5CD5C 3T8XB 1HKLH 4Q6IA 4X6DB 4QOKB 3ZSSA 2GYSA 5FF6A 3IFNL 3MBEA 4TYUA 1ZKAA 3FO2A 1CI5A 3KPRB 4R6UA 1N6QH 1SJEB 2BRQA 3ULVL 2HT3C 4XMLH 1U8HB 1DBBH 3GGWA 5DO2C 5IB2A 3VXPB 2NW2A 5DC0A 4XWGH 1IGYB 1TQBB 4UOJA 4Y4KC 2XQYG 3HR5A 5FXCH 4JZOB 2PF6A 3FJTA 4NZDA 1FGVH 3JV0A 1XGQB 1J05B 1EO8L 4I0PC 5T5NG 3UJIL 2JELH 4ODVH 3WFHB 3VXRA 4K71C 4JPVH 3I75A 1NGWA 4LRIA 2JB5H 4PGDB 2CSPA 4N90D 4XBGA 5C0CD 2YK1L 4RISL 2NQCA 3MX0A 2Y23A 4MDJA 3WYRA 5LKNA 1U95A 4M6OH 4KTDH 5FYJD 4BKLA 1Z5LB 5DGRA 1T1YA 2NTFB 5K59E 5F97E 1U8KB 3RVXC 3TCXA 4N9GA 3ZKQD 4DVBB 1A6AB 3ARGA 2ENSA 3ZDYE 5KG9A 4U7KA 3HPJB 1NMAH 3GRWL 3O4OB 2VKWA 5MHSE 4J8RB 2HLAA 5C0BA 3Q6FB 3AC0A 2HMID 4M1GL 1TJGH 1BBDL 4OF3A 5FO9A 1EBPA 3AREA 3MLSL 4U2ZA 2J3SA 5E7FA 3UJJL 3KPNA 1HDMA 4MXQC 2B39A 2UZYB 4ODXB 2EXWD 4F7PB 4XAWH 4LLMA 1OAXH 1TFHA 3WUZA 4KXZI 4JRWA 4MCYB 4OTXL 1A6WH 1FV1B 1AR1D 3JWNC 4M93B 3MRNB 3VJ6B 5IM7A 1TVBA 2HJLA 4PJ5D 2FWOB 1MJ7H 3QQ4B 1J1PH 3IAPA 1WTGT 2VWEE 5DQJA 1A2YB 3DX6B 2EEBA 4G6AC 2H32B 4KFZC 4QEGA 2GY5A 2EE3A 2Y07H 3GB7A 3L5XL 1KENH 4HIIA 5KVFH 1N7ML 2YMXH 3B6SB 4Z95L 3BDBA 1OAUH 4G42B 4Q7DA 3V6BR 5DHVA 3NMEA 2RCSH 4DK3A 4ODUA 3PWJB 3CC5B 2DWDA 5CIPH 4ZDHA 2OR9H 1JYXA 1JYNA 1XF2A 1RFDH 5ICYB 32C2B 3OWEA 4LLDA 3L3IA 5J6GB 4XPHL 1ZVSA 3BGMA 4LCUA 2NY6D 1XCQA 3MO1B 5J1AA 5ITFB 5HHXH 5E24E 2F54D 4MXWH 3QRFM 1BFTA 4BQCA 3DJ9A 3B2VH 3I02A 1MQKH 5EB9A 3MV9E 4HT1H 2Z92A 4ZD3L 1AXTL 2Y5EA 1M7DB 1AXIB 5FUOL 3OKOA 2E7MA 3QQ3A 4PJAE 3A0OA 1AFVL 1NBVH 3U46A 4WU5B 4HFUL 1U8LA 1VADA 2CH8A 3F7PC 1KTKE 4Y2DB 3LKPB 4OZIB 4CJ1A 1AGCB 5DMIH 4ORZC 3KPOB 4RZCA 3BEWA 2ARJA 1I8KB 4P2RE 4IS6A 1GSMA 1MY7A 2BHYA 2CPCA 1KBGL 4YDIH 1CICD 2RQ8A 3D0LB 3VI4F 3L3OA 2PTTB 4TQEH 4YPGB 4GW1B 5IHLB 1ZT1A 2P5WB 5DFTA 1QEWB 1QBAA 4HZLB 4QRPA 3BAEH 5D7IB 2VABA 1FRGH 4CNIA 5IVZA 1ACYH 4LVHB 4MVBC 2CLZA 4X9BA 4GBXD 1FLRH 2VXSH 1Q0YH 5CP7A 2NLJA 1MCIA 4L1HA 2VERN 1VFAA 1HWGB 3CVHB 1MWAB 5FCUH 2GJ6B 3GJFH 4P2QB 4QT5B 1J8KA 1LNUA 4HQQL 1IM3A 3BUYB 2X05A 3C2AL 4M7JL 4UT6L 5ID1B 4GSDL 4XPTH 2Z31B 2DIJA 2EDHA 2NY4D 3KG5A 5CILH 3B9KC 4MMXC 2JCCF 4PJIE 4Z7VB 4WEMB 1QLEH 3HI1A 1GGCH 3QHFL 4XP6H 4LCWA 5SX4H 2ICEB 4NBYB 4MB4A 4R97B 1XF1A 4Q0XH 4YFLI 3E3QC 2PXYC 1S7XB 4NQED 3F7YA 4XNMA 4DK6A 3HI6L 4JG0H 1R5WB 3DYOA 3SDAD 5BCAA 2WSKA 2V2WB 5BS0B 1P4IL 2X70A 3NIFF 5EZOL 4MYWB 3RUGF 1QSZA 3LKOB 4PTUA 3IF1A 1ZXQA 4LLVA 3LSOB 5IJVA 4K9EL 3EOAB 3CFJA 1V7NL 4ZQKA 5DXWA 1WF5A 1TETL 3ULUE 2XZAH 1EDQA 4TN9A 4U1GB 3V8OA 4WWKB 1I3RA 1XGUA 2CO7B 4LKXA 3TO2A 5D1QA 4HIJA 2VNCA 1EH9A 4O51A 4XXCC 4WO4A 3J8F7 4JDVB 1JI2A 3FB6B 5ICZA 3NIDE 1XZ0A 3WL9B 3DX9B 2D7TL 3MJ7A 2G75B 3MV9A 3W82A 4OZHE 3WKML 3W11D 5E70A 1QSFD 2AXFA 3ULVD 5IEHA 1W8NA 1YEFH 2R4RH 5GRUL 3O3EB 4PJAA 3H7BB 3HZVB 1FNEA 3OXRB 2X4OB 3HI5H 2GK0B 2Q3ZA 3SKMA 4P3DB 4U7SA 2EE2A 3GZKA 3PNWB 3TVMD 4AH2B 4D9RE 4F3FB 2PN5A 4I5BA 4HUVA 3VMPA 2BX5A 2HMIC 1NGPL 1UJ3B 3GKZA 4CVUA 3KAAA 4OAWA 3QDMB 4PUBH 2FATH 2BY0A 1XR9A 1IFHH 4N90E 5C0CE 4O00A 4IMKA 4C83A 2YPLD 5ETUB 1DBMH 1N6VA 3CUPB 1AR1C 1OLZA 3ALPA 2YZ8A 3D3VD 5D2NC 5E2WH 3UMTA 2AERT 3LQAL 1BECA 3CZJA 3FB8A 4UNUA 4KJPD 2C7UA 4J3TA 4U3XA 4U6TA 3TYFA 4P46A 4U1KA 4PJFE 2YPVH 2LAAA 3O6FB 4U3HA 3F65A 3EOBB 1RPQA 3U2SB 1P2CA 1RU9L 3O9WD 4FZ8H 2NY2B 3NZ8A 3IDYC 4X7FC 1RUAH 3H3BC 1U6AL 1CU4H 3S36L 3EBAA 3A67L 3MYZA 1A0QH 4WFGD 5CLWA 3QG6B 1T2XA 2FHFA 2VLJD 3OAUL 3EDJA 1MVFA 5J9PA 3O2VL 3ZTNH 1D9KB 2ED8A 3DX7B 4NUJB 5BQ7B 3FRPG 4AEFA 1NBYA 3EYUH 1CFNB 1KXQE 2HLFD 2UUDK 3OGOE 3PWUA 1JTPA 3R8QA 2A9NH 3PQYA 2ORBL 4ETQA 2AGJL 2ERJB 4PJIA 1NFDB 5JPMA 4YQXH 1KT2A 3FMGH 1QHPA 2ZZUT 4PJ9D 5DLMH 2C4FT 1I1RA 2MPAL 4WFFD 3LAFA 5AD0B 3D85A 4AG4L 2CD0A 3GM0A 4KRLB 4JFHE 5FKAA 3BUTA 4UTAL 3FOMA 3AGVA 4MJ5B 3SDCD 2K7PA 1WC7B 4H25B 2HH0L 3IDGA 5LGJB 1HQ4B 4GOSA 4H8WL 1KTLB 4UQ2B 1I7RB 4M6ML 2WZPD 2XV6B 5EIIA 4N1EA 4OGAD 4M5YL 3B2UD 2IQ9L 2BVQA 3W0WB 4YE4H 3VFRA 1NCWL 4LMQI 4PJ8A 4ODBD 2R2CA 1BZ7B 2VB5A 4PRIB 4OF0A 4OZ4B 4XBEL 2BVOB 4XI5D 4M1DH 4GW4B 4BH7A 1IAOA 1MIEL 3DVGB 4TPRH 4CVXB 5F3HB 2ICWJ 1FJ1B 3Q2CA 5T3ZL 3SHSA 2V9TA 5KTEH 4EDWH 2XFXB 1C5BH 4FQIL 1A1MB 5F6HJ 4YFDB 1NGXA 1U92B 5HDOA 4MJ6A 1FORH 5E08H 1U8NA 4TSAH 4JM4L 2C3GA 1JNHA 3PDGA 3MBXL 3BKJL 5TPWL 4FQHB 4GMTL 1PKOA 4NQDB 5EBLB 2CKBA 1VB9A 2DQCH 4OZHA 1JGVH 5CKGA 1KTRL 1CD1A 3O0RH 3NFSH 5L9DL 4H26A 1NUDA 1HKFA 1N64L 1D5BA 2JIXD 3CZFB 5KS9E 4DUWA 5CEZH 3HRPA 5BZDA 3MV8D 5FUCE 5J8OA 5D7SL 3DYPA 3FO1B 4X98B 4F9PC 4AM0A 4ELKA 2EE6A 4EVNB 1NCDH 4GKSB 1H8NA 2DTML 2NY4C 43CAA 4S1RH 1WAAE 1JK8B 2NZ9D 3QEGL 3V4VH 3E6FB 2X89D 4OFIA 2PYEE 1HSAA 1B4JH 3VG0H 3BISA 1RHHA 3CVIL 4HAFA 3Q48A 4JREC 4IRJC 4WHTB 3LKNA 5KOMC 3HUJA 1NCAH 3KVQA 1C08A 4PJFA 1T1ZB 4IIQA 3TEUA 2A6IB 2BJML 1JV5A 1IQDA 1ADQH 3TA3B 4HIXH 2R9HD 5HY9B 5E8PA 2F8OA 3S35X 1TCMA 1HILA 2EIZB 1IGJA 1CYGA 3QRGH 3BXNB 4LK4A 4XNUH 3MLVL 1T21A 3MGAA 3IFLL 4O4YH 5DEGB 4LDLB 1AGFA 4OKVA 4PREA 2HJFA 1AP2A 4UV7H 3SBWC 3RKPA 5IHUL 1YNTB 5KJRH 1CGSL 4Z76A 5E2UL 1FG9C 4GKNA 1KFAH 2NNAB 4NQEE 4LSRL 5H8DA 5F3BB 5KAQG 1QNZL 3PWNB 1FC1A 3PL6A 5BJTB 5JTWA 3W11C 4R0LA 2OJZH 3ULVC 1NJ9A 1I9JL 5HHQB 4F7TB 5KN5A 3AXLA 4ZUTA 1WICA 5I8KH 1M6OA 5C70A 3TVMC 3MR9B 2P48B 5IB1A 5I8CB 2GITA 3PGCA 3BD5A 2PETA 4X7TA 5ERWB 1JPTL 5BRZD 2PW2A 3T08A 4TULL 4WI4A 1WUNT 3MRBA 4NC1C 4ZTOH 3G6JB 1CF8H 2XQBH 3QXDB 1I8LA 5BV7L 2ZJSL 4FNLL 4TTGA 3KJ6H 1NAMH 5D1XB 5EFIA 3C6LD 2MQCA 5JDSB 1BQLL 4KJPC 2VDPL 4P2OA 3RWCA 4XCNB 5CJQL 2ZPKH 1MFAH 1FNLA 2ZG2A 4JFFD 1NLDH 2ZUXA 4PY8I 1UYWL 2WANA 4X6CF 4GAGH 1KG0A 4NHUB 5F7KC 5HYJD 1VFUA 4G80A 4MSWA 3DVFA 3ARBD 2OTWB 2Y9RT 1KCUH 3KXFB 4ZFOB 1YPZA 3GO1L 1DDHA 4NGHH 3IGAB 2D0GA 2H3NB 5FOBB 5KS9A 3VXNB 5D2LE 1NGYB 2EH8L 3ZDZE 2XWJA 3NIGF 3ARFB 3V5DB 4K55A 1HXYB 2E7CA 3M1BB 4OZGB 4ODTL 1Q0XL 4ZUWA 5I8EB 5JZ7D 3CDCA 2P4AB 4JFEB 2BNRD 3WN5A 2HLFC 1MCJA 4QOKD 3QAZC 1OHQA 1WAAA 2VTFA 1TVHB 3KPRD 3P4OA 2VLKB 1IRAY 4PJ9C 2PYEA 2WINB 1RULL 1CR9H 3TPUB 4E9LA 5BVPL 3A6OA 1LO0H 3P30H 1UEMA 5FB8A 3CLEH 3SDCC 5IFHL 1UXWB 4AZ8A 4XVJH 1RZ7L 3LKQB 4ODWA 4YK4B 3TNMB 2L0DA 5T1KD 1B6DA 2DQFB 2YUZA 5HPMB 1IGIH 1VEPA 1AY1H 4MD5A 4OCNC 2VLJE 4HG4J 5FV1L 1F4WH 1S9WB 4OGAC 1P7QB 3IDJA 1OAZL 4KK8D 3GI8H 2A6KA 3BSZH 4LSTH 3IAQA 1I9RH 3MRIA 3ZYIA 1CE1L 1MCPH 5MP6L 1CDBA 3QZWG 5GS0L 1CFVH 1Z9MA 1I1FA 3VRIA 3D39D 4RA0C 3LOWA 3EHBC 3LPWA 3MLWH 5IJKA 1ZAGA 1G7JB 2WBJC 4JR9H 35C8L 4XC1H 2EDNA 2EDFA 3CFCH 2D0FA 4PFEA 1K8DA 1XIWB 2CQVA 5DRNA 2E7LC 3V5KB 1VFBB 1KLGA 1BF8A 4HIHA 1KNOA 2XA8H 1H3PH 3W5MA 1IAIH 1IKNA 3D25A 3NCCB 3T2NL 3E8UL 4UQ3B 1RUML 1AIFA 1KC5H 4U7MA 4MS8D 1UM6H 4D9QE 3MLUH 1OP5K 1A6TA 3ZLQC 2ID5A 1AD9B 4DVRH 2IPTL 1HHJB 5T3ZD 2NZ9C 3QPXH 1DN2A 5EU6B 1XAUA 4MNHB 1AH1A 3AMLA 3SO3C 5JA8B 3W2DL 4G7VH 4LSVH 1O0VA 2EIBA 5DC9B 1HYRC 4KGJA 5LXGH 5B4MD 5IHZB 4PB9H 4O9HH 4RFOH 3KYMA 1QKZH 4I2XB 3RL1A 4YNYB 1OB1A 1DZBA 1JGLL 2OMBA 1RIUL 4NRXA 3D87B 3D0VB 3V9FA 4NOFA 3QUYB 4LNVA 3HLAB 4R8WH 3N9GL 5DVLA 1SJHA 3GSUA 2Q8BL 1Q94B 2YRLA 2IBZX 2IPUK 4P9HC 1FL6B 2GSGA 1TNNA 3LQZB 1QFWM 5F1IB 4PJEB 4DOHB 1CXLA 2L7UA 3R0MA 2YSSA 2R4SH 5HHMB 4KVCH 2YZ1A 5JPNA 3TWCL 4LLYA 4Q6YA 1MY5A 2VSCA 1QTYT 5EDXA 1FLTX 2DI9A 3T4AA 4Y2DD 3DMMB 5GGSA 3EDDA 1P9MA 4NRYB 3FFCD 5K93A 5HHPB 5HJ3A 1EO7A 2AK4E 3TIEB 4HKBB 5D1ZD 3EJYC 2LU7A 6FABH 2HA1A 1E4KA 3KYKL 1XF5A 2HT4C 4K9EC 3U4EB 1BQHG 1U2HA 3MJGX 3Q1SH 4G8FB 4M8VA 3MROA 4X7CC 5C0AA 4DFIA 4KUCF 1BPVA 3QT2A 3WEXA 3NTCL 3DROB 2PNDA 1DL7L 4P5KA 2NYYD 1HNFA 1T0MB 3INUL 2FGWH 1RI8A 1SMOA 3U4AA 4YDLB 3EO0A 4LVNC 3DWTA 1ZA3B 2R56H 4GG6A 5JLZA 2J4WH 3L3DB 3IB4A 4WI5A 1AHWB 3HNTH 1OTUC 4M7ZC 4S2SA 5L2JB 4YGVB 2X4NB 2DTSA 3DV4B 3VWKC 2AJYL 3O6MH 3GSRB 4TUJA 3MA9H 1X3DA 3T1FA 1U8PA 1G7HB 1YJDL 4KZDL 2Z31D 3RDTD 2BSTA 2NY5H 2QL1A 3LRGA 2CKNA 3MRMB 2PO6A 2DQGL 3I6KA 4FFYL 5E5UB 3CNKA 4KXZH 3NPSC 1CCZA 4HWZB 5D5ME 4ZS6D 1D5XA 5JZ7C 5FYJH 4KKAD 4XBPB 1R3IH 3LQAC 1MPAH 4Z7UF 1INEH 2V9QA 5GQBA 3BH9A 3T77B 4NN7B 3L95B 4KROB 5IMKA 3GSNB 4KKBD 1K2DA 3EFDL 2X4QA 4UB0H 4OB5H 5SV3A 3VXMB 2I9TB 4LCYB 2IFFL 2A6DA 3DV6A 1TQBC 1MSPA 3QXTA 1N0XL 1HIMH 1YA5A 2G60L 2R23B 1F4XH 2VXUH 4G8GB 1JGDA 3O11A 3WIHH 8CGTA 3W9DA 3VXUE 1NC4D 5DWUH 4Y89A 3RWEA 2AQ2A 1CFTB 3TZVA 4KK8C 2IANB 3BDYL 1U8IB 3RPKA 5BMFH 2C3VB 1FL5B 1OSPH 3TBVB 2VKXA 3GI9H 4NO0A 1V3LA 4GG8B 1PZ5B 4C59B 5ALCL 5I74B 3O4OC 5C1MB 4JGUA 5FDWA 4JAMA 1ZTXL 4LEXH 5TE4H 3MMEA 4LPYA 4JPKL 1EGJL 1DBKH 3GJFA 3OF6A 4RSVA 2DB8A 4ZYKA 1FL3A 2BNUA 3MLTA 1R3KB 1L6ZA 1F11B 2ZOKA 3ZDXF 1SYVB 2EZ0D 4I77L 1PG7L 5DJXA 4MQ7A 1KLFA 2AK4A 1LMKA 2L4OA 3QIUD 2MQ3A 5C0RL 1D6VH 3QUZA 1HZHH 2H1PL 4EIZC 3QCUH 1DBJL 3H9SB 5LBSH 1MLBB 4M93C 3SGJA 2IGFH 4GRLD 5C08B 4ZTPH 2F53E 4GMSH 2DM7A 3OL2A 4FABH 3QDJE 2ZSVA 1F97A 4W4OC 5L2KE 5GS0D 1T1XB 3T2PA 1TTUA 4BQ8A 3KLAA 2VXQH 5DRZA 4J3OC 5ILTL 4ZFFA 1WFOA 4XZUB 2DM4A 1QSEB 3BE1H 3H6JA 4LPVA 3QXAB 1YEJH 4N8VG 3X3GH 2NY2D 5B4MC 2AK1L 4ODSH 3H0TA 4JGJA 3LHPH 1LP9B 4X7SL 4QXTA 4JHAH 1EEUA 4JO4H 1UENA 3C08H 5CAYB 4LVEA 4QRTA 1HINL 2VITA 3C5JB 4XPGL 3NPZB 2VXVL 1KJ2B 1I85C 3BEVB 2ITCB 4RDQG 4UILL 3VG9B 3QFJB 2NXYD 1D5MA 4HCRH 4I13B 3SCMA 5IV2B 5E1AA 3HZMB 1BWMA 2AQ3A 1EFXA 3M17A 4NP4L 1MHEA 4PJ7F 1UADC 4YHZH 4CVWA 4L3EB 2I07B 1S7QB 5DR5L 7FABL 3DVIA 3OAYK 1G7IA 5H35B 4AT6A 5GJSL 2A0LD 2B1AH 1P5VA 1FFPA 2BSRB 4OLUH 4X6FA 2EECA 5F88A 5KSBE 5DJYA 2ADFL 3RVVD 4Y2DC 3MRDA 5FYLL 1XGRA 1NCCH 2CJUL 2EYSB 2QHLA 3KYNA 4UTBH 1V5JA 1S9YB 4WW1A 1ZLSL 4P4KD 4HD9A 4N0CD 5CCKL 5SWZB 1VKXB 4EQ3A 3ECBA 4ZS7H 2X1OA 2WW8A 1IZKA 4XVUD 2A9MH 3OJDA 3CX5K 3MV7A 4PRID 1QO3B 4ZXBB 4QRUB 3T65A 3H3PH 3VXUA 3DOSA 2JJWA 3ARDA 4PS4L 3OR7B 3QSKB 5DRWB 5JHLH 4BZYA 1JZ7A 3MNZA 2FR4A 5C0DB 1Z6JT 3OB0K 1INQB 1UWGL 4DGIH 3MRJB 2NYYC 4ZFGL 5IW6A 1IAKA 3JBG7 4IRSA 2GKIA 2ZG3A 3TO4A 2JK5B 4LVHC 5GISH 5FGBA 1UVQA 4LIQH 2ZCHL 2PKDA 4HMEA 3AMKA 2DQHL 2Q7NA 4UT9H 4X5WB 4HXAL 2MCPL 4PRHB 2BSSA 2FEEI 5EU3A 3ROOA 1FH5H 5K9KB 4GAJH 2VDOH 5D9SB 4KRMB 2KZWA 4JO2H 1DN0A 4LARH 1G0XA 5EO9A 2NX5B 4YEEA 1SQ2N 3QDHA 4NQSA 2LFGA 4OFPA 1S9VA 5DD5H 5E8DL 3MNWA 2VL5B 4V2CB 2QHRH 1CZ8L 3C5SA 5IFAL 3R06A 2Z31C 3RDTC 4OFYA 5F72S 4K23H 3N1QC 3PV6A 3MV11 5C92A 5DJ0A 4NJ9H 4M5ZH 1FNGB 2X4TA 4WW2F 2W0FB 5IVXE 3QZWA 3RVUD 1RVFL 2E6JA 1RJLB 4R97C 1JCKA 2F53A 5BV7C 1ZHBA 4FQLL 1N8ZB 3QDJA 3P9WB 5L2KA 3U9PH 1RUQL 5B3JF 5CD3A 1I7ZA 3KYOA 4NN6B 3SDYH 2ITDA 3DURB 2P5EE 1MHPL 3O4LB 1N59A 5E6ID 5EBMB 3SKOA 1BBJB 3ULVH 1HYSD 2QSCL 1KN2H 3FOLA 4FQQB 2EO1A 1UZ6E 2DLTA 4MD4B 1Q1JL 4D8PB 3B9VA 3FAWA 4Z6AT 1ZVHA 2P8MB 2WNGA 4Z78B 4LKCA 4QXGL 1YY8B 1XF3A 5GRXG 3B5HA 4HUMB 5C8JA 3UJIH 3BZEA 1U3JA 1K4DA 1N3NB 1SY6A 1ZA6A 3ES6B 5DRXB 3D1MC 2XN9D 5DJZB 3FB5B 1I9EA 4FG6D 2DLIA 2OL3A 3F58L 3GKWL 2L7JA 3V0WL 4WTXA 3WNMA 5F9OL 3C9NA 3TBSB 4NDMB 4LF3A 2EYTA 4L4VE 3ILPA 3G6JF 3IRZA 3MCKB 4FTVD 2YRZA 5D71L 3SOBH 3GJEB 4X9GA 5C0FA 1R3LB 2VDKL 2OI9B 1F3RB 4QHMA 1UJ3C 5ABDE 3IFOB 2VN4A 2EZ0C 4E41B 4CVZA 1S8DA 1E6OH 1AQDB 3FO9B 1BD2B 5GGTH 4JFPB 4V1DA 3V0VA 4LBEB 3QO0A 2OYPA 3GIZL 3RY6A 3KPTA 4J6RL 4U6YB 5DS8A 1VACA 5DJAA 1IILE 5CJBA 3JVGC 3BO8A 4G9DB 2X9YA 4YBLB 1SYSA 5GS0C 4LPWA 3H9ZA 4P5TB 4XNQB 3FT3A 2N4IA 4R26L 1I8MB 3O6FC 5CHNA 2OJEB 2YOCA 1J1OL 2Z91A 5FUZL 3P4LA 1KELH 1R0AH 1ADQA 5DI8B 5JDJA 2NY2C 1F2QA 1EX0A 4U0RC 4CDHA 3VFOA 5EOTA 3STZB 1WFTA 1OAQL 2AJUH 4TVPL 3VGAB 5INDA 4L4JA 5IWLA 1L7TH 4YR6B 3QUMB 3SKJH 1MUJA 4F7EA 3SJVB 1MFBL 4Q9QL 4XPHH 3IDXL 3PP3K 1BQHA 5F96H 1TZIB 3O3BA 1C7SA 5DK2B 4LCCA 3SDDA 2AEPH 2AAVA 5FM8A 2Q87A 1U3HD 5A3ID 1YEGH 2P24B 2DKSA 1DQQB 4R4FL 5L8JB 1I3VA 2WBKA 1ZLVK 3MUJA 2V9RA 4RGNB 1OWRM 3V6OE 3EDEA 3D6GA 5IVXA 2A0LC 5IVNA 3N0PB 5TF1L 4D0DB 1AFVH 3FTGA 1RURH 3NAAL 4HFUH 4OQTL 4J23A 1DR9A 1T0NB 5KVGL 2P5EA 3CDGB 3EYSL 3X14B 2R15A 1VFOA 3O45B 4RMTA 5B8CA 4MD0B 4LLAA 2BRRL 2ARWA 4P4KC 4N0CC 1P7QD 5HTSA 2F58L 5GHWL 3DTXB 4XVUC 1H8SA 2W9EL 1ZHLB 1IEAA 3C2SA 1NAMA 4JRXB 5H2BB 4XNYL 3S4SB 2O93L 1LO4H 1SBBA 3FONB 3GUTB 3WNOA 2DD8L 4N1CA 3UYRL 5HHOB 3GMMB 4APQB 4FQ1L 2P42B 3HC3H 3K2UL 1CXEA 1HHHB 5SWSA 1QFPA 4S0TD 1I7TA 1X6NA 1LEKA 3VWJD 4BQ9A 4QRSA 4QTHA 4AMKL 5MEQA 4XMPL 4A6YH 4Z0BL 5FYLD 3FN3A 4L4VA 4RX4D 4ERSH 2OXHA 3HRZA 3NCJL 3SGEI 1NMBL 4KK9D 5AYQA 1DCLA 5I1LA 1RIHH 4KC3B 4Y4FA 2PTVA 4P9HH 5D4QA 3ILQD 4JRYE 4HQQH 2V2XA 3C2AH 3DUUA 4UT6H 3IJHB 4GSDH 5CINH 3A6CL 4ZUUA 1J18A 4H5SA 4JDZA 4JHZA 43C9A 1NUFA 2B4CC 5IKCA 4F8TA 2X42A 3QCVL 1HN1A 2VR4A 5D7LB 4I8DA 4MA8L 2O61A 3SDXB 3NA9L 4OQ1A 1ND0A 2AKRA 3D9AL 3C09B 1T80A 1BREA 5EU4B 5H94B 3ZYJA 3HI6H 1AKJD 1MJJB 1C7TA 3O2WL 1SVZA 2VR5A 2P8PA 4MNQD 1P4IH 3ARYA 4U1IB 5E6IC 1HHGA 1H15B 3B5GA 3TA3C 2RJMA 5EZLB 1NGZB 4O5LL 3LIZL 3UO1L 4K9EH 1FFRA 2QSVA 3EZ8A 2R0WL 5ICXB 1E28A 4QRRB 5IF0A 1UB5A 4FQXA 3QJHA 4TSBH 5HHMD 3OZ9L 5TDNB 3U30B 4U1HA 5HI3D 3OPZL 4TRPH 4P9ML 4WUUD 3VW3H 1EVUA 4FG6C 4O58L 4J4PD 3EYVB 1BJ8A 2D7TH 4M7KH 3UAJD 2Y6SD 1MREL 3K8MA 3GHBL 1EJ6A 3OXSA 4N8VA 2PCPB 4O2EB 3RIAF 2BNQB 3TT3L 5GRUH 2YKLH 3BIKA 2AV1A 5I2IA 3L7FB 4F33B 5DJ8B 5CGYC 3SKUD 2C3HA 1KPRB 1RZGB 4HWEH 3TN0B 1ZEAH 3V6ZB 4YBQC 3ZDYF 3BRGC 2R1XB 1A5FH 1QVOB 2IALA 5D1XC 1XGPB 4GAFB 5HYEA 3NH7H 3LQAH 4WEUD 1DEDA 2HKHH 4NKDB 3BPLB 5EUOB 15C8L 3TH2T 3OTTA 3VFWA 5IMMB 4K07A 4QHLA 1NDGB 3RHWF 5EG6C 2HN7B 1P6AB 1A3LH 3U0PA 2PR4L 3HE7D 4JFZL 1P7KA 4POYA 4TTDD 1MQ8A 2CRYA 5CIPB 4LPTA 4GRWB 4JY4A 1U8OB 3LS5H 2ZUSA 3KLHD 3LV3B 4QCIB 1AE6L 2UWEB 2VDQL 4NO5B 4HX1A 1U6AH 4NPYA 1YNKL 3S36H 5IMLB 1RMFH 3HNSH 1DVFD 2YN3A 1E27B 3X12B 3OAUH 2UY6A 3O2VH 5INCA 3ARFC 5BZWB 2OSLB 4JRYA 5HYQB 3MFGB 5HDBF 1U3HC 1H3VA 4PG9B 4IHOA 1R5IA 4MCZA 2ZUWA 1T2QH 3FQXA 3S97C 3ZYZA 3RZCA 2H8PB 2MPAH 3BP7A 5D70L 2QQLH 5MI0B 3AS2A 5JNYB 4UTAH 3SO5A 1GGIH 5CFHA 2FIRT 3V5HB 1P4LB 2HH0H 4YK4C 1JWSA 4M6MH 1J86A 1LEGB 3B9KA 2R1YB 4PRBB 1Q9OB 4TVPD 2R69H 1DANU 4M5YH 1XEDA 2IQ9H 1NDMB 3ZO0A 1XMWA 1F90L 4NQXB 3CXDL 1IARB 3F12A 3SE9H 2UUDH 3V79C 4CUCA 3ZSTA 3KGRA 5DYOA 3HKFA 2PXYA 1Z9SA 1MIEH 1RD6A 1ZWIB 2PW1A 2YA0A 3UPCA 2H32H 3EAKA 2V5TA 4JN1L 5F9DC 2CDGA 5T3ZH 5ANMB 4MLSA 3BJLA 5A16A 4JQXC 4PV8A 1O5DT 1EFQA 5E8EB 4JM4H 1XIWC 2HFTA 5M95B 2VIRA 3MBXH 3RTQD 2NPLX 3UTTA 5BW7A 5IHBA 3QEUB 1JPSL 4ELMB 1FP5A 5EPMB 4NSKB 3W81A 3QUML 3JV4A 1AR2A 1N64H 4BFIB 2QKIB 3DSFL 1MJUL 3WHXA 3F6IA 4KK9C 3QIWB 4HUXB 3ILQC 1LP9F 1QFWL 4Z7WB 4M8QB 5GRZA 1ODAA 4YDKL 2F15A 4MJIB 1MHCA 4W4NA 2DTMH 1XR8A 3E2HB 4ZFZA 4JFDD 2WQ8A 3TT1H 5ITBL 5J13B 3MODL 1RK1B 4M62H 1KCKA 3T0XA 2IAMA 4C56D 4W68A 2N7BA 3RRQA 5K9OA 1MEXH 5HHVL 4F37F 2C4FU 2LQRA 4JY6B 5ESAA 4X83A 4PJXB 5CSZB 1KJVB 1TDQA 3UDWC 4XT1C 5GIRA 3WIHA 2IH1A 4CRPA 3DBXB 2XNAA 6CGTA 5DJ6B 3QUYC 3ZZ1A 1IM9B 2I24N 1BAFH 3WJJC 5FECB 1VEOA 5CEXB 4KI5D 4L3ED 4MNGB 3MLVH 5SWQB 3IFLH 3ZTJH 5IB3B 2ZSWA 2GSIA 4NZTH 3REWA 3MA7B 2CDFA 5DJCA 5IHUH 2JCCE 1KCRL 3STLA 3VXQB 1OAYL 4G5ZL 2LU4A 4CJ0A 3O8XD 4NM8L 1J8HA 2VDML 5DQDH 3NBNA 5EOCL 1A1NB 1HQRB 4N0UE 1OM3H 1QRND 2VMFA 4EBQH 3DMMC 2IADA 2W60B 3ARTA 3IVKA 4U1SB 3MRFA 3PE9A 2DQDL 3KPPB 4WVRA 1GZQB 1UG9A 3CVHH 1MWAH 3ULUF 5SWZD 3PABB 5DDHB 2XTJE 1GZPA 1L0XA 4P3CL 3RJQB 3RUGE 1I9JH 3V4UH 3VD4A 1MAJA 4P5MA 5C07E 3SE8L 4ETYA 5DD1L 4NRZB 1BFOB 4Q2ZB 4YH6A 1HH9A 4YDVA 3WCYA 1DEEA 5EC1B 1YMMD 3FN9A 3Q6GH 1S7TA 1XH3A 3BWAB 1CG9B 4OZHF 4S1SH 3GMLB 4I4WA 4MMZC 2MMXA 4NUGL 4WUUE 3CPLA 4FNLH 4DKEL 1R5VB 3HB3C 5C7XL 4YDLC 5E6YA 4WGWB 2JKXA 1OGAE 2VDLL 4OUUA 3WUWG 5C71A 3QB7C 4WY7L 2VDPH 3DXAE 4AENA 5T5NF 4YWGL 2ESVD 1KPVA 4GKZB 3JSSA 4PP2B 4X4ME 4PRDA 2P8LB 4HS6A 2CK0H 2FO4B 3HE7C 1SEBA 1YNLL 3L5WB 4Y5YC 1WWWX 2DJUA 4TTDC 4U49A 3RGVA 5DJDA 4X8JB 2JB6A 2OTUA 4QHUB 4HCRA 4JM2B 5MEOA 5T3XH 3KLHC 4HC1L 1DQML 4ODHH 1RZKL 3C87A 5D7JD 4JVPA 5IP4A 5CBAB 4DTGL 5J57B 5C6PB 2OZ4L 4O2CB 1NAKH 2F5AL 3HUJF 4WDIB 2J8UF 2GW5A 2Q6WB 1CDHA 1MRFL 4P0DA 2EH8H 4M1CD 1KSRA 3BPCA 4ODTH 1PX3A 4QY8B 5FO7B 1M7IA 1HXMA 3LKRB 5EA0H 4JHWL 5HHNB 3ZHDA 5LCVH 3GGWB 5FYJU 5ACLA 2UZIH 3EGSA 5HYFA 1WZ1L 3TFKC 4KROC 4YHPA 4E5XA 1RIVL 4BK4A 5ESQA 3HR5B 5E56A 3BRFA 4B5EA 1RZJL 3GMNA 3WFDH 5ADOL 5BVPH 5T5FL 4PV9A 5KVDL 4R90H 2V5SA 1RZ7H 3OKEA 4F9PA 2YR3A 3I75B 1NGWB 2Q20A 2ICWB 2R0KL 4R7NA 1I9IL 4NNXB 3PXHA 5EO1A 2ADJA 4Z8FL 1W2KT 4Z7NF 1BEYH 1T1YB 5CMAB 2P44B 3O2DL 1WBXA 3U36B 3FFDA 2H26A 5E2TL 1DLFL 1CE1H 1QR4A 5GS0H 3MRQB 4NOBA 4LPUA 5KG9B 4BZ1H 3VDAA 4IRJA 1T1WA 1NC2A 2VLRD 2JCCA 4X4ZA 5I74C 5C0BB 4HS3A 1FDLH 5FCSH 3VFTB 4L8CA 2DBJA 1PBYA 1OPGL 5DF0A 4OIAA 1HOCA 5FO9B 4J3VA 1UFUA 3EFFB 4N0UA 1W72L 3VXSE 5JUEL 1EHAA 4M48L 1NCTA 1Z9OA 2VLLB 4XP5L 4E41D 5E8OB 4Z77A 4WI9A 4WU7A 2SEBA 1NGQL 3LPGA 3RUGA 4LCIL 3SBWA 3A6BH 2FX7H 3UC0H 2EYRA 1I3GL 4IMLB 5C07A 4B7LA 2C4XA 3E8UH 2C26A 1I1AD 4M61B 3HE6B 3QQNA 1RUMH 4JHBA 4GUPB 3O41A 3VFNA 1WCBB 2VAAA 4N0YL 4P48A 1KN4H 5IQ9B 3IDIA 2DYPA 4HIIB 2H9GA 1E4WL 1U58A 3U0TA 1EXUB 2IPTH 5MERB 3GM8A 5IR1B 2EDDA 1YPZF 1JMXA 1RJYB 5DHVB 1GGUA 2RFXA 3STBA 4JFYB 2DWDB 4PTTA 1OGAA 4KRPB 3SY0A 5FHBL 4JPWL 3DXAA 5FYKH 3UTSB 4NCC2 4LLDB 5HGGS 2IQAB 4X4MA 1RIUH 2R0ZL 3ZHKA 1ZVSB 3BGMB 4LCUB 2AV7A 4LHUB 1KB5B 1BGXL 4KAQH 5C0GB 4MA3B 3MRKB 1G7PB 1JUFB 4UDUB 1UGNA 2WUBH 4G6MH 5JW5A 1P4BL 1DSFL 3TCLB 5DD3L 2BVEA 5GS1B 4MHHI 1MFCH 1JF6A 1F3DH 1BX2A 5JORA 5HI4D 3OKOB 4KI5C 3MREA 4PJCE 4RGND 4KV5E 1U8LB 5AUMA 3VFPB 3TWCH 5C2BH 4JANA 1A1OA 4LRNL 1BVKA 3G6DL 5HDQH 1OQXA 2FLBT 4BH8B 3TF7C 3MNVB 3DPBA 3QH3A 2UVFA 1LDPL 1NFKA 4RZCB 3BEWB 3C5ZB 2XWBB 3FQWA 4IS6B 1L9NA 5DHYB 4DZ8A 1WQVT 2VZSA 1AD0A 1J1XH 2D7OA 4XNXL 5D7KE 5GGTA 1BLNA 5DZLA 4JN2B 1R3HB 3GBNH 4J7RA 4YZFF 2X09A 2AS5M 1QFWI 5IB4B 4JO3L 2B4CH 3DGGA 2HT2D 5KW9L 1JWUA 4APQD 3UYOD 1MI5B 5IG7A 1V3JA 4KUCD 5JW4N 1U36A 1CFQA 1JHTB 4BSVA 1YN6A 2XKNA 3MXVH 1EA9C 3SDCA 3KPLB 3FT2A 4Y4KB 4PRPD 2YPKA 1KCLA 3SKNA 2V5YA 4L29B 1LNUB 1FG2B 2AJYH 1DLHB 5IMOB 1SMAA 3DRQA 2GJZA 3SDXF 2V7NB 3VXSA 4K71B 1MCDA 3N85L 5DQ9A 1FFNA 3MRCB 4MA7L 1OARL 4P4RA 4FFYH 5D7JC 3EUUA 1M71B 1KEGL 3WIFA 3FB7B 4KQ3L 4N8PA 3HZKB 4M1CC 2WBJA 1MAML 4CW1A 4BM7A 4ZOEA 3IJYB 1LGVA 3T0EE 4AYFA 3V52L 4GRMA 3GDBA 2E7LA 2YHGA 2X70B 3QDGE 4LLWA 1EHLH 4YC2B 4XPBH 4NN6C 1TJHL 1F6AA 1G6RL 4JDTH 3RWGB 3MCLL 3PWLB 2DDQL 5MENE 3PP4H 5C0IB 4EI6A 1K5NA 3GSXA 1MLCA 2GT9A 2W65A 4P57A 4ONGL 1P1ZB 5EN2B 2BY2A 2CMRL 2IFFH 3FQTB 5I1EL 3FKUS 1T3FA 4JLRA 3VFVA 4X6CE 4GW5A 4P59L 2I60L 4GAYB 1ZGLM 4NC2B 3K4AA 4X6DE 3O3DB 5E99H 4DGYL 3LDBB 4KMTL 1GC1L 1OF2A 3P77B 1DQJA 2DL9A 1HCFX 4PY7A 3MV9B 1A14L 5E00A 3L3KB 2NY3D 3CAFA 3MJ9H 3EO9L 1AO7D 1A4KA 4PJCA 5ALCH 3QWRD 4A6YA 1DQLH 3BKYH 4NQCD 3BI9X 1DP0A 1EEYB 1ZTXH 3DUSA 3M8OH 3I50L 5FO8A 4JPKH 1EGJH 2WIIA 3IDNA 1QBBA 2CIIA 1LK3H 2Y36L 5HGAB 5A43C 2XRAH 5HYSB 4I77H 4H0HB 4S11A 4NNYA 4ZUVB 2X4PB 4P2RB 2WWMC 5CBEB 4RMRA 2H2PD 1YQVL 1U3YA 3H7LA 4GG6F 4K7PL 4CMHB 1BJ1H 3RNKB 4DZBA 1LE9B 2CDEB 1DBJH 1JL8A 4YAQA 4JB9L 3GFUA 4FFVC 4HHAA 4O02H 5I1GH 4JJHA 5DT1L 3ROLA 3RX8A 1HSBA 3LEVL 4YBLC 2Z4QA 2VLRE 1QBMH 4OLWL 4OLXL 4K3EH 4KHXL 4P5TC 2J88L 3G08A 2D31A 1IQWH 3TC9A 2NY0D 1KIPA 3HNVH 3BHBA 3EYFB 5I19H 2A1WL 5E5MA 4JZJB 1AGEA 3QIBB 1LO5A 5C09D 2AK1H 3SE3C 1T2JA 2MCG1 4OLZL 4X7SH 1U8JB 1IC5L 1NUGA 1ZSDA 1HINH 3BVNB 3KYAA 4OKDA 4GT7A 3SGEH 4XPGH 2VXVH 2BMKB 3VGAC 3G5YB 3CH1B 1PAMA 1FZJB 5F9AC 4OCYL 4K94C 3ALWA 3JWDC 3UTQA 3QHZH 1KT2B 3RPIA 5IGXH 5I1KL 1CD0A 2Z93B 3THML 4OM1L 2ATPA 1MCOL 2XXMB 5HI4C 1IL1A 2Z8RA 1H3GA 3TV3L 2MWCA 1NEZB 3BZFB 5JHDB 4RGNC 4GXUM 1W0WA 7FABH 3IDGB 3VWKA 3WUWA 3MOBH 1JZ5A 4DUVA 3T0EA 3WLBA 3HCVA 3HPLB 3PWVB 1Q9LA 2GTZA 3QDGA 2ADFH 2OK0L 4XP1L 3V8CA 1F13A 2BVQB 3QEQA 5KSAB 1R3JB 4PJ8B 5MENA 4FQJL 2AJZA 1FYTB 3CXHJ 4AL8L 3BQUB 1YEIL 1HEZB 3BW9A 1CFSA 1ZHNB 2XI9A 4WI7A 1JPGB 3HFML 4YHYC 2ZOLB 3C8KA 1UACH 3EOTH 4MXVF 4PS4H 3T8XA 4X6DA 3AS1A 4ELMF 3O6LL 2IC2A 3OAYH 2F74B 5EUKB 1JNHB 2HT2C 1UWGH 1SJEA 3FO0H 4APQC 1F3JB 3HA0A 1U8HA 3QPQC 3VXPA 4NZRH 4HBQA 3DIFB 2ZUTA 1IGYA 4OSUL 2R39A 2DQHH 2YBRB 2GQHA 4Z7WF 3BYYA 1JNLH 4HXAH 4KTEL 4XXDA 4H26B 3F62A 1D5BB 2Q76B 2EDLA 3DX8B 5BZDB 1XGQA 4OIIL 1J05A 2IPUG 1QBLH 2R8SL 5I15L 2P5WE 3WFHA 2X1WL 5CGTA 4PGDA 5E8DH 1MHHB 4F7CB 5KAQF 1MOEA 4UIKL 5TH2B 3OG4B 4ZOCA 4GFTB 1GGBL 5C0CB 4HW6A 2NTFA 3G5ZB 3OB0H 1SM3L 2AJ3B 4DVBA 3HPJA 2FHCA 3LH2L 1Z3GH 2W92A 4J8RA 1C08B 1ZS8B 1IGFL 5IQ7L 3C09C 1RUQH 3Q6FA 5EIQA 3LY6A 5JO5B 1WBZB 1LVEA 3V4PL 4Z7VE 2AJSL 4ODXA 2QSCH 2VQUA 1YEEH 4MCYA 1Q1JH 1FV1A 3MRNA 4X6EA 3VJ6A 3KWWB 4HPYH 2FWOA 3QQ4A 4KKCD 3VGGA 4W4OA 1KXVC 1VEMA 4L8DB 4PJ5B 5F9JB 3DX6A 5GGVY 3U30C 5EU5A 1R24A 5TFSH 5BS0E 1PQZB 4G43B 4YXLL 3IDMB 2CXKA 3CMOL 5BO1L 3S88L 2MOVA 1Q38A 4Y4HA 3RA7H 3UJTL 4HAGA 4ZO9A 5T1DH 5K9JL 2ZUVA 3B6SA 2XG5A 5F7DB 3GKWH 3PL6B 3V0WH 4G42A 3VFSB 4TUKL 5F9OH 4OCSH 1NJ9B 3NCBB 5T3XE 3CC5A 4Z7UE 4HG4K 4XX1G 4WI2A 4ZUTB 3BMWA 1JN6B 5IB1B 3ARQA 5D71H 4K2UL 5ICYA 1DUYB 2AVGA 4JCMA 2GITB 3PGCB 4XGZB 3I6LE 2J6EH 5J6GA 4HFWB 1RZJC 3P40A 2PW2B 1FBIH 4NHCL 3MO1A 3KR3L 3BZ4B 5ITFA 3GSVA 1RZIB 5HVFB 2NY6B 5LJYH 2ZUUA 5E9DD 4OM0H 5ISZD 4MWFA 2E7BA 5A2JH 1C1EH 3LEYH 2H2PC 2FJHB 2IBZY 3SGDI 4CDGC 4GQ9L 2NXZD 1QR1A 1M05B 4WU5A 4YHLH 5JXEC 4Q97A 2QSTA 5E03A 3BPLC 1AO7E 4FXGB 3LKPA 4AJ0A 3DETD 1IJ9A 1Y18B 3CFKA 3GSNH 4R26H 4DW2H 1SJVA 1A6UL 1D5IH 1AGCA 3QDME 2NY0C 4G80B 2G5BB 5FUZH 4DN3H 3KPOA 2HVKB 1I8KA 1SBSL 1DDHB 4HIEB 1KLUB 1JPFB 4EN3D 1N0LA 3VD7A 5LWYL 3D0LA 1I3UA 4LSQH 2PTTA 4TVPH 4GW1A 4YPGA 1CICB 4TOYL 2P5WA 3MRHB 4NKOA 4WGVB 1QEWA 3VFMB 4Q9QH 3IDXH 3TBWB 5F8QC 1FNHA 1U8QA 3MBED 4G6JL 1ITCA 1QFUH 3LKSB 3RU8H 2X41A 3BP5A 1R6VA 4YHNB 2MKWA 1MRCH 3H42L 4G6KL 4GBXB 1UH4A 5C6TL 1JE6A 4LLQB 4YX2L 4HV8B 3CVHA 1MWAA 4PR5B 5I66B 1P84K 5TF1H 2GJ6A 4ODWB 5MI0C 1MNUL 3N1FC 4P23A 4P2QA 4QT5A 4MD5B 1XF4A 5FGCB 4KJYA 3ET9F 3BUYA 3WJLC 3VXRD 4G8EB 1TZHB 5LQBH 2Z31A 1N4XL 3EYSH 3AU1B 4PLJC 2A6KB 4Z7VA 1YC8A 2NY4B 4LSSH 4LOUD 2ICEA 2DOCA 5C9JB 1MFDL 2I25N 2KBGA 3ARGD 4BSWA 1U42A 3CLFH 2FECI 1S7XA 5B21A 1NANI 2CIKB 3EKCA 4EEEA 2V2TB 1R5WA 3GHEL 4MX7B 4XCCH 1GOFA 1ZLVH 4PJ7E 1Q9KB 4MLIA 4M3JA 1QQDB 2PUQT 5C0BD 4JREB 2WM0A 1F2XK 4NQEB 5DRNB 1A3RH 5FYKE 4OD1L 5BS0A 5JIIA 4ONFL 1EMTH 3SDAB 4FQ1H 2D03L 3ARED 1KLGB 3LSOA 4HIHB 3AM8A 3BPNB 1FAIL 3EOAA 1J12A 4XMPH 4Z0BH 1KJ2H 3T04D 2ICWI 1RZFL 4WWKA 2ZCLH 5EWIL 5F6HI 1MCNA 1FO0B 1A6TB 1CVRA 2CLVB 4Y7MA 4HKJB 5HD8C 4JDVA 3X13B 3FB6A 1A7NL 2QQNL 3DX9A 3WL9A 3E2HC 3IU4H 4NQDE 2G75A 2HRPL 5JIHA 3RX5A 4OJFH 1A47A 4W81A 4MQTB 4TNVK 3WO4B 4AEIL 3QNZB 4LLUB 3H7BA 5AWNL 3RL1B 3NGBC 3OXRA 3NA9H 2X4OA 2GK0A 1QSFB 4P3DA 3PNWA 4KRPD 2B2XH 4F3FA 1X4XA 12E8L 3RWJB 4M3KB 1GAFL 1OVZA 1PG7W 4OCRH 4R4ND 3KNBB 3VFUB 1EAPB 5I73B 3QDMA 4PY8J 3L3HB 3BN9D 3BWUC 5DGQA 3ULUL 2BY3A 5ETUA 3CUPA 4O5LH 3LIZH 4BZ2L 3T0BA 2D7QA 2QR0B 5D2LB 2YPLB 1J0JA 4JO1L 2YD2A 1ZGLB 4F58H 3MUGB 2JF1A 4I18B 3HR6A 5ADPL 3O6FA 4KUZL 3RKDD 5L0QB 1G9MC 2CKBL 4X8XA 1T7ZA 3OPZH 3EOBA 5GGSB 3U2SA 4O2FA 2W0PA 3RWIA 2QADD 4QNPF 1IEBB 3UPRB 4EDXB 4RRPG 1A7QL 4H1LA 1MREH 3NFPB 3GHBH 3O9WB 4XCFH 3GBML 1FIGL 4X80H 2P43B 3RVWD 3LN5B 3GSOB 3HG1E 2DM2A 1D9KA 5I18H 4EIGB 4F9LC 4NUJA 3DX7A 5BQ7A 2VLJB 3TYGH 5GXBB 1CFNA 5HVHB 4QRPD 2EEAA 4KRNA 2FX8H 1CVSC 1E0OB 4RGOH 2FD6H 3QAZB 5AD0A 3BYTA 1GC1C 4PJ9B 1YDPB 3L1OH 2OR8A 1J0YA 4HXBL 1ZLWK 4H25A 5MHSD 3X17A 3HAEB 3T4YB 3E0GA 2HFFB 3GIVB 1KTLA 3DETC 4HBCL 1I7RA 3FCTB 1BFVL 1P69B 2AQ1A 3G6JE 3U6RB 3K74B 4FZEL 3W0WA 2PO6B 3I6KB 4JM2C 1BZ7A 4LCWD 4H20H 4OZ4A 4WHCA 4UDTB 5LGHL 2BVOA 4UUJB 4UIMB 4LU5L 4N5ED 1X5FA 2AI0H 3KDMB 4XNZB 1YNKH 4KMQA 4WFED 4MQSB 3DVGA 4CVXA 1D5XB 1ORQB 1FJ1A 5AAWA 5L88L 1A1MA 1K3ZA 4PJDB 4JVUA 2VZTA 1U92A 2CO6B 3P4NB 4UT7L 1J5OL 2OTPA 4QO1A 3BH9B 5I76B 2VXTL 4QYOB 4ZOAA 4FQHA 4MGXA 4FQCL 4NQDA 5EBLA 1K2DB 3G5XA 2X4QB 1NLBL 5CWSA 5CZVL 4BELD 3MXWL 3JUZA 3KXFE 1MCHA 3DHMA 4ZO8A 3RJDA 5IUSA 5EU7C 1AI1L 3CZFA 4XHQA 4NJAL 1FGNL 4HUUB 5EZIL 3FO1A 1RHFA 5D8JH 4RMQA 3BIBX 4X98A 5CP3H 3MV8B 4LSPL 5D1QD 3IKKA 1X5YA 4EVNA 5E95B 4LRIC 4GKSA 1FVCB 3QCTL 4IRZL 2QQKL 4WO4D 1JK8A 2O5XL 3IFPB 2A77L 1KEMH 1EEQA 2VLKE 3RX7A 2R2BB 3E6FA 2DKMA 4P3WA 3MV9D 1F90H 4HJ0D 2AEQL 4LOUC 3SO3B 1PJ9A 3ARGC 4YHKL 1WLHA 5AYUH 4M03A 3MLXH 4PB0L 4WHTA 4RDQF 4JAMB 2DICA 5AZEL 2Q86B 4ZO7A 3WXVL 4UNVA 3DNKA 4LASH 5F1NB 3ZKMD 1BMGA 5ELIA 1Q72L 1T1ZA 2CR3A 3VDBA 5TDOB 2A6IA 1S7WA 2DAVA 1SEQL 2VH5L 3MLZL 3AREC 3TA3A 1KJ3L 3VXRE 5KVMC 2EIZA 3G6AA 1PG7X 3BXNA 3QUZB 1SJXA 4PGCB 2XA3A 3S35H 2Y7QB 5DEGA 3QUMH 3RGHA 3Q3GB 4R96A 4K94H 2ZSVB 1YNTA 3HG1A 1JGUL 2G2RA 3DSFH 3JWDH 3HE6C 3MRPB 4P46D 3NACL 2EKSB 2NNAA 3PIQB 1QFWH 5DRZB 3WSQH 3IAGC 3MUHL 2EICA 4ESKA 5B39B 4GKOA 2FX9L 1K6QL 4I9WE 4FS0A 4M4PA 5ITBH 2X4SB 3PWNA 1HI6B 1MJ8H 2X4UB 3LB6C 3ZT5A 2VDNL 3CFDA 4L8BB 1CLYL 5F9WC 5HHQA 4F7TA 1YEDA 4WCYL 2BVYA 3MR9A 4KRPC 4JKMA 2X4RB 1OW0A 3S5LB 5ERWA 1D5MB 5E94B 4R4NC 5FYKU 3G6JA 2UYLB 4YHIB 5BRZB 3QXDA 4JJ5B 3M17B 3BN9C 3PQYD 3EZJB 5EU6E 4NZUL 1NH6A 2D9QB 1JF1B 3HMWH 3K1DA 2JJSC 2WBWB 5D1XA 2N7AA 1MVUB 5GS1C 3KPQB 5EORL 3C8HA 5CUSL 5JDSA 3D85D 4ENED 5D5MB 4I2XE 5I1IL 4QTIL 3C6LB 5AZ2L 3MJ9A 4X6FB 1FE8L 3BN3B 5F88B 4XCNA 1KCRH 2GTWA 1DQTA 2V7HA 5JOPE 1OTSD 4NM8H 4X6BB 1PGRB 3KYNB 3QFDB 1PX4A 3CCHB 4Y1AE 2DJ4A 1C5CH 4DJMA 4JFFB 2HKFL 3ECBB 2OTWA 4PJ8D 3KXFA 1NFIB 5HYJB 4ZFOA 3OJDB 4DGVL 5A1AA 1Z0NA 1T7WA 2E9JA 2WUCL 3S37H 1H3TA 3ARBB 3IGAA 5CSBA 1U0QA 4DKAA 5FOBA 3VXNA 25C8L 4YDJB 3ARFA 2ED7A 3SE8H 3V5DA 3NPSB 3KPSE 1HKLL 3WD5L 1F42A 3M1BA 5DD1H 4X4YA 3ULUD 5I8EA 4HWBH 1HH6B 5CSGA 4JKPH 4JFEA 3WFEL 1S5IH 2BSED 5HXMA 4XMLL 1DBBL 1WEJH 3TO4B 1TVHA 2VLKA 4OIBA 4XWGL 4NUGH 3PHQB 2WINA 5C7XH 1FN4A 3ROOB 1OWWA 3TPUA 1FGVL 2YRPA 4NWUH 2VDLH 3HC0B 1UXWA 5IIEB 3P11L 4WY7H 2O26U 2JELL 4HK3N 1B6UA 2VZOA 3TNMA 4JPVL 5HPMA 2DQFA 1OSZB 4D9RD 2JB5L 3ISWA 2FBJH 4OGYL 3WFCL 5T1KB 3NABL 1S9WA 1KGCD 3U7YL 4KTYA 1A21A 4QRPE 1TTGA 3PV6B 4KY1H 2JJUA 1NMAL 2W38A 4N5EC 2DMKA 2GI7A 1G9NL 1JHKH 1ZHBB 3FZUD 1MRFH 5L2KB 1G7JA 3OQ3B 4JQXA 1I7ZB 3D39B 3KYOB 1N5AB 5E6ZA 4ZNEE 4YUEL 1ETZB 1XIWA 3NFNA 4LP5A 3V5KA 4JHWH 4YC2C 1VFBA 4L9LB 4XAWL 1OAXL 5F7EH 1A6WL 2OP4H 1RIVH 5KVEL 4ORGB 2IBBA 1RZJH 1WK0A 5ADOH 1XF3B 4LCWE 1M1SA 4UQ3A 1D6EB 3TBYB 2FSEB 4WFEE 5D1QC 1CK0L 2Y07L 1KENL 5LVEA 3MRLB 5GGVH 3LDBC 3RAJL 5KVFL 1ZT7B 3QO1B 1MIMH 3AAZA 3EYOB 2YMXL 5FHAH 4WO4C 5DZNA 1HHJA 2UZXB 2OL3B 5EU6A 4Z8FH 4MNHA 1OAUL 4C4KT 2RCSL 5B38B 1L9MA 4LSDA 2C1PA 5C6WH 3VXME 5IHZA 3PL6D 3S34H 4HLZH 2EYTB 2HFGH 1DFBH 3ILPB 3WS3B 4HS8H 1A02N 4JFHD 5I6XB 4I2XA 3UDWA 4G8GE 4YNYA 1RFDL 4PGBB 5HDBE 1V3MA 3N50A 5KSBB 3ZKMC 1WBYB 3QUYA 1OPGH 4GRWH 3HLAA 5J3HD 2Q7YB 1HHKA 4QXUL 4X7EC 2WK2A 3B2VL 1MQKL 2IANE 1S8DB 4Y1AA 4JG1H 4M48H 3WJJA 1CGYA 3LQZA 4PJHB 5F1IA 4PJEA 1DE4B 4XP5H 1CIDA 4X5XB 1U9KA 1T22A 2Y1VA 4MHHG 1DJSA 1NBVL 4RFNB 2JJTC 5IROC 4CMHC 2F8XC 5BOPA 3JV6B 3DRTB 3KPSA 3RY5A 1UB6B 4P2OD 4P46C 3FT3B 4N0YH 5CHNB 4QRQA 3DMMA 4LAJH 3OB8A 4NRYA 4W70A 5HHPA 3TIEA 4HKBA 2A2QT 3ARZA 3C60A 3FFCB 3GMOB 4JZJC 4YDIL 5I8OH 3H9SE 3QIBC 4RRPA 5DJ2B 5EOTB 5D1ZB 3RWDB 4YFLF 3U7WH 5INDB 1WT5C 5KOVC 3U4EA 1ZOXA 3KHOA 3BAEL 3TJHD 2R0ZH 4LCCB 3DO3A 1ACYL 3DROA 1FLRL 2P7TB 1QSEE 2OMNA 2VXSL 2XKSA 3OJ2C 4OZFA 1B0GB 1Q0YL 2IPKB 2A83A 5DD3H 1NUNB 5FKPB 2H45A 2PYED 1LP9E 4ENEC 1ZA3A 5IVXB 5FCUL 3PXJA 3L3DA 1BOGB 2Q8AH 2EXYD 3BGAA 3H9YA 3D69A 5DD0H 1AHWA 1PEWA 3N1PC 1O7SA 7CGTA 4PJBB 2X4NA 3DV4A 3QULB 5CLTA 3QFJE 2P5EB 4XPTL 3SPVB 4DN4H 1OTSC 3GSRA 4LRNH 4ZNEA 2HP4A 5CILL 2J6EA 3T09A 2BXZA 1G7HA 3LCYA 2Z8WC 1QLEL 1RJZB 1GGCL 5DUPH 4XP6L 5DC4B 3HS0B 2B1HL 3MRMA 5KSAC 3BOVA 4PJ8C 4HJGB 3I9GL 3RDTB 1ITBB 1IEAB 3PQYE 3S4SG 2FZ3B 1OAKL 3BQUC 4HWZA 3MLRL 3NCFB 4JG0L 3ULUC 1F8TH 4DQOH 4Z0XB 5BV7B 3S9DB 3TNNB 4Q9CA 1X44A 3T77A 2O5ZL 1GH7A 5GRJH 3L95A 1I7TB 1LEKB 5C9KA 4YJZL 3GSNA 1UH2A 4QRSB 3I3BA 1MAKA 4FQPA 3VXMA 5CZXD 2I9TA 4LCYA 4JPIB 3MV01 2XZAL 3HRZB 2R23A 4G8GA 1VERA 1CL7I 4YXKL 5EC2B 2V2XB 4KJWD 1NC4B 1IGCH 5JW4R 1CFTA 4K7FA 5HI5D 2FCBA 3U0WL 2IANA 1FC2D 4JDZB 3T2QA 4AIZB 4P99A 3ULVF 4G6FB 1U8IA 1AGDA 2C3VA 3QYCA 5IKCB 4Q9RL 3D2UA 5I1AB 3SGDH 4GG8A 1PZ5A 3B9DA 2O61B 1G9MH 4Y16A 3HI5L 4I48B 4KQ3H 3ZT7A 5DVNA 4ZNCD 2NX5E 3HC4L 1MAMH 1L0QA 1QZ1A 1FFQA 5HYIA 3V52H 3UZEA 1OD7A 4OGXL 1CLCA 4F2MA 1R3KA 2FATL 1F11A 1SYVA 4RQQB 2DDQH 1DBML 2C1OA 1G7MB 1KGCE 2MTPA 3HZYB 1IT9H 4ONGH 1IBGH 1RK0A 3H9SA 2X9XA 3QIUB 1MLBA 2EXWC 5GGUA 5C08A 1U93B 5CS7A 2F5BH 2DQEL 4M9PA 4U1HB 3JWOC 1QLFB 2I60H 4L5FH 1WIPA 4GRLB 4KPHL 4W6XB 1MELA 1T1XA 1C8PA 5IBUB 2J12B 3O4LE 3AROA 4FZ8L 3HUJE 2J8UE 4XZUA 1QSEA 1YMHB 1S3KH 3QXAA 1RUAL 4PGJA 5EBWB 3PL6C 4WIQA 1LP9A 5D93C 4R0LC 4N1HB 5JOFB 2RIKA 4PD4J 3ZTNL 5I2IB 3C5JA 3KLSA 1CT8B 4U0RB 5TJWK 1KJ2A 3BEVA 1O7VA 2ITCA 1LE5B 4HEPG 3ULSB 3EYUL 1FZOB 3QFJA 5J3HC 1V7MH 1QLRA 3I50H 1IGTB 5IV2A 5C0AD 1C12B 2XXCB 2W59A 4KKLD 1FPTH 2NXYB 3HZMA 2GAZB 2Y36H 3VXOB 2M1KA 2EC8A 5J89A 2BCKB 2ZNWA 2NY6C 2FH8A 2I07A 3UCRA 2XPGA 1YQVH 4U1LB 3JUYA 4NKMB 1BJ1J 4HLZG 1S7QA 3BKCH 5H35A 2BC4B 4XCEB 4Z7NE 3F5WB 1NANH 1U8MB 3QUKB 2AJVH 4X7DC 3LEVH 3U0PB 5C0ND 4KHXH 2J88H 2EYSA 3L9RA 4YIQA 1S9YA 2B20A 2RHEA 2A1WH 1VKXA 3BZDA 4PJDF 2DQTH 3BKMH 4HX1B 4M1DL 2PO6D 2R0LH 4P4KB 1QO3A 1XGTB 5FA4B 4ZXBA 5EO0A 4TPRL 4QRUA 2HJKB 1G1YA 1SY6L 2IFGA 1UEYA 1UWXK 4EDWL 1QUNA 3BD3A 4YHMH 5DRWA 5FUCC 3RY4A 3TJHC 2P49B 5C0DA 5E08L 1NMCB 4TSAL 1CICC 2OL3L 5JQHC 4D9QD 1ERNA 1INQA 3KHQA 4HK0B 1BQSA 3MRJA 3GSWB 1YECH 4IHOB 1R5IB 3H9HB 4JFOB 1T6WA 1JGVL 1MCWW 3THMH 4LFHG 2Z9TA 3NFSL 1KCSL 4X5WA 3BP7B 1YEHH 4M6NL 4PRHA 3PDOB 4PLNC 5K9KA 4RFEB 4GBXC 3LN4B 5CEZL 2EXYC 1MFEH 3CDYA 2E3VA 5TGBB 2NX5A 2APFA 4Z9KB 1YPZE 4P49A 3TGXA 3SJVE 4OI7A 4MAYA 1NCDL 3U83A 2OK0H 4XP1H 2VL5A 4OI9A 1KPUA 3BPOB 3TZVD 4M7LL 3IXAB 3F12B 1B4JL 3VG0L 4PJCF 3UTPE 2AXHA 4KV5F 1FNGA 2W0FA 4NO0D 1RJLA 2PW1B 1ZGLP 1N8ZA 1NCAL 1AGBB 5IJKC 1OGTB 2O5YH 5A16B 3IXTB 1ZT4B 2KQNA 2ICES 3O4LA 1ADQL 2V5RA 5EBMA 4HIXL 3VRLF 3OF6D 5DHVH 1KJMB 2J8UA 5HPOA 3SDAC 1VPOH 3SGKC 4DFHA 4HF5L 1FNSL 2KKQA 5E6IB 4FQQA 3RWHB 1LEIA 1KIRB 4MD4A 2AK4D 3CSYA 3BPNC 4O4YL 4XAKE 3FT4B 2P8MA 3QUZD 4KTEH 3JV4B 4JKKA 4KK5D 4Z78A 4JRXE 4UV7L 1LDSA 5A2LH 5KJRL 1YY8A 1KB5H 4OIIH 5D6CB 4ZPTB 2HWZH 1KFAL 4PJGF 2R8SH 5I15H 1LO2L 5HGBB 1NSNH 1A6ZB 2M2DA 5ID0A 1N3NA 2NW3B 1MHCB 5HHOE 5DRXA 4ZFZB 1II4E 5DJZA 3FB5A 1U41A 1IC4H 3VD5A 3OX8B 4YO0B 4M00A 1F58H 4UIKH 1TZGL 3N06B 2XN9B 3IJSA 1AJ7H 5F7MC 4YZFE 5DSCB 3TBSA 4NDMA 3UTOA 1SM3H 4WFHD 1RZ8B 4ZODA 2XIDA 5ESAB 5I8KL 3WO4C 4AQOA 3TIDA 5GGSY 5C2UB 1CXFA 4KJQD 4P2YA 2FJFB 3GJEA 1S7VB 4FTVB 4XTRD 4I3RL 1IGFH 4Z5RA 3P0YH 3C6SA 2D3VA 2XNAB 1W8OA 1A9EB 1CF8L 2XQBL 3SCMD 2VUYA 3IFOA 3KJ6L 1NAML 3OKYA 5I73C 1AC0A 2AJSH 3K8LA 3FO9A 3VGDA 4ONOA 5J11B 1EFXD 1BD2A 5AAMA 4XH2B 1PEZA 4JFPA 5D7LE 3CFEA 5GS2H 4G8IB 4LBEA 3SDXE 2AABH 3REWB 4U6YA 4CN4A 1X5IA 3WIIH 1PYWB 2XKUA 3JTTB 3MRGB 4G9DA 3K1KC 1K4CB 1G6VK 1MFAL 5TF0A 5GZND 4I18C 4P5TA 4XNQA 1G9NC 2OQJB 1NLDL 1I8MA 5L0QC 2OJEA 4GAGL 4Q74A 4YXLH 5JMRA 1QG3A 5LBSL 1P9MC 3UJTH 1RUKH 2BOCB 4YXHL 1PVHA 5K9JH 1JVKA 5DI8A 4NGHL 1RY7B 2UY7A 3DI3B 5KZCD 2E27H 5D72H 1RJCA 4TUOB 4UMGA 3O9WC 3MV7D 2XZQH 1NCNA 4FQ2H 5E4IA 3STZA 4X6DF 1E4KC 4QRRE 1ONQB 5F44A 5ACZB 4K2UH 2FBOJ 3VXUD 2BVUA 1HH9B 3ARDD 2OBGA 3SJVA 4DWHA 4K8RL 2DN7A 1S7TB 1TZIA 4OLVH 4G9FE 5DK2A 4WHDA 3K81A 1JNNL 5HVHC 3QI9A 4LPXA 1MF2H 2P24A 5JW3H 4IRSD 3RBSA 1B3JA 1CR9L 1FHGA 1FVEB 1AXSA 1DQQA 1GHFH 1U3HB 2B7DT 5TDPB 5I17B 5DD6B 3P30L 2VZUA 4BFBD 4GQ9H 3CLEL 1MRDH 5I1JL 4OUUB 2IWGA 2BNQE 4XVJL 5I1HH 4D0DA 2BY1A 4TVSa 5C0EB 1VGEH 4NN5B 1T0NA 4KQ4L 1RV6X 1F4WL 1GPOH 5IESL 3RGVB 2GCYA 2GK2A 4LQFL 4NM4H 2OTUB 3GI8L 3O45A 3K4ZA 3BSZL 4LSTL 4MD0A 3E1F1 4RIRA 3U4BH 1BZQK 4LAQL 4OFYD 5FA3B 5C0AE 3FQNB 1MCPL 1KCVH 4OCXL 5JQ6H 4HWNA 2PO6C 4S1QH 3DTXA 2W07A 1ZHLA 3B2UC 4JRXA 4ISVB 5H2BA 4NYLB 3MLWL 3S4SA 1JHLL 1IC7L 4XNZC 1E6JH 4JR9L 1BVLB 2F53D 4XC1L 3MUY1 3CFCL 4XI5C 3L3GB 3QDJD 4TOYH 1B2WL 3FONA 3GUTA 3I84A 2WLZA 2DQUH 5L2KD 1S9XA 5IOPA 4GG6E 5HHOA 3GMMA 4ZAKA 1VCAA 2D7PA 3PHOA 1HHHA 3EGSB 3VCLB 4G6JH 4YHPB 1BZ9B 1H3PL 5ESQB 5CGMA 1IAIL 4WNQA 2UWEE 1F4YH 3VWJB 4G6KH 1LO3H 4YX2H 4ALAL 2VQ1B 1KC5L 2YD1A 2LU3A 1MNUH 1UM6L 5BXFA 3MLUL 3EW3B 3FN0H 3QA3A 4OUOA 4DVRL 4HWBA 5EO1B 2EE9A 1N4XH 3TZVC 3LVEA 5E4EB 1BWWA 1T5WA 5FGSA 5LXGL 1BF2A 4PB9L 3WS6A 4NC0B 2HFEB 1A8JH 5D7LA 1QKZL 3CK0L 1MFDH 1A7OH 1ZVYA 1NC2B 1H5BB 1MH5A 4RAHA 3SDXA 3S96B 2JCCB 5F6IC 5EU4A 3U1SH 2AP2A 4XP4H 1HHIB 4KKNA 4EOWH 4R8WL 1HOCB 3W9EB 4OD1H 5CEZD 4U1IA 1AKJB 4WENB 2D03H 1H15A 4MNQB 3I85A 5EZLA 1NGZA 4NWTH 3X11A 2SEBB 5E2JA 1FAIH 2C3XA 2R4SL 3QUZC 2R9HC 1UA6H 2CRZA 5C07B 4V1DD 5ICXA 1T5XB 3SGJC 4QRRA 1RZFH 3HHRB 3GMPA 3O41B 3W5NA 5TDNA 1WWAX 5ANME 5I30H 4OZIF 3CSGA 3VGFA 3IDIB 4G9FA 3UPAA 4E0RB 2DYPB 2EDYA 2P45B 1U58B 4BJLA 2BOBB 3QJFB 4HUNB 1V8HA 1A7NH 3EYVA 1U91B 2QQNH 5DTFB 4WUUB 1CE6B 2RFXB 4PRNB 4MXVE 4X4XA 4ELME 4XPFH 5JXAL 1X5HA 1OGAB 2PCPA 2A6JB 5GSRB 2BNQA 1VDGA 3DXAB 3L7FA 4XTRC 1OQOA 5D7IF 4K3GA 1CIUA 4LHUG 12E8H 3BP6A 4ZSOE 3CFIC 4F33A 1ZE3C 1GAFH 1T04B 5DJ8A 2X6MA 4Z7WE 2KQMA 3UP1A 3IDUA 4MJIE 3SCMC 1KPRA 2FGWL 3MRRA 3SDDD 1RZGA 5JW5B 3TN0A 3KLDA 1GIGH 5I16B 4PJBF 2AJXH 3L3JB 2Q3AA 2R1XA 5IB5B 4WJ5B 3FRPA 4U1JB 1QVOA 4BZ2H 4Y5VB 1XGPA 4Y19E 5JXEA 4PJXE 3HNTL 2KPNA 4NKDA 3RNQB 5EUOA 4WFHE 5IMMA 1PKQE 4JZNB 3C6LC 3E6HB 1A1OB 4JANB 3MOQA 3P9LA 5ADPH 4OCWL 1N6UA 4Z7VF 2P5ED 1X7QB 3EO1A 5CIPA 2X1QA 2NY5L 3V0AC 1TTFA 1U8OA 5F1SA 3HE7B 4Y5YB 4PYGA 3AY4A 5GRYA 3LV3A 5F7WC 4DZ8B 4F7MA 1UZ8B 4QCIA 2UWEA 1IEHA 3O3AA 1S7SB 4NO5A 4TNWF 1IGMH 4PPTA 4MNGE 4GJTB 1S7UA 5IMLA 5ECJE 1A7PL 4RAVB 3UEZA 3ARBC 4FHBD 1E27A 1GRWA 3VXTA 2EDBA 3ESUF 1ES0B 3ARDC 1R3IL 4NT6A 1P7HL 4K3HA 1DVFB 3I2CL 5BZWA 1FZMB 4KDTC 1PLGH 2AEIT 5HYQA 4FP8H 4PG9A 5SWSD 4UB0L 5T33L 1L7IH 4OB5L 3TO4C 2H6PB 5FOJA 1MCWM 3MOAH 2H8PA 4POUB 4QHNB 1CGWA 2KH2B 4OLYL 1ZHKB 3OR6A 3NN8B 1F4XL 3WIHL 4OI8A 5JNYA 4L4VD 2CXGA 3UBXB 5DWUL 3V5HA 3SKNB 4MB3A 4LGPB 5FK9B 3MV7E 1G84A 5I0ZA 1C5DB 4JFQB 2IG2H 1INDH 2I26N 2Z8SA 3GSQB 4Y4FD 3B3IB 1LEGA 1C16B 1BFVH 3FQRB 2R1YA 1T03L 4PRBA 1Q9OA 5ESVB 5DQ9B 2EDEA 5I1DA 1I1YB 4HKZB 1X5AA 5BMFL 4WI8A 5I71B 1OSPL 1NDMA 2FYYB 2XT1B 5TQ0L 3GI9L 3RVXD 4K8RD 3GK8H 4G6FD 2D0HA 1EJOH 3JWOH 5LGHH 1IC1A 4LU5H 5FM5O 3LRHA 3MJ8B 4AY0A 1GOGA 1GXEA 1YQ2A 1I7UB 2D7MA 4NQVB 4LEXL 3P9MA 2ATKB 5ANMA 3QWOB 1DBKL 4LLWB 2FRGP 1YZZA 3GMQB 3DI2B 4UT7H 5E8EA 1J5OH 1F6AB 1ZLWH 4MXQD 4DUXA 2NY7H 4HK3J 4EI6B 4MAUH 1K5NB 4L9LC 3BESR 1S5HB 3QEUA 1D6VL 1HZHL 2DIBA 4P57B 4ELMA 3BMVA 3QCUL 1UWEH 3B8YA 3RTQB 3JZ7A 5EPMA 2W1NA 5I75B 4JLRB 1Q8MA 4H8WC 3VFVB 4ONHB 4BFIA 2QKIA 1AC6A 3QIWA 2HRLA 4HUXA 3P73B 4FQXD 3L7EA 5EZIH 4ZSOA 1I4FB 4XRCB 4G6AD 2APBA 2VXQL 1UXSB 1UCBL 4Z7WA 5IEKB 1J0HA 1OF2B 4MJIA 2V17H 4U2YA 3BE1L 2QQKH 2PYFB 1A4JB 2YN5A 1KB9J 1YEJL 4MS8C 1RK1A 2O5XH 3BH8B 4ODSL 1T0PB 3LHPL 3QWQB 2QTEA 4JFDB 4JO4L 4N0FB 2J5LB 3C08L 4Y19A 4C56B 4JY6A 4PJXA 4YHKH 1KJVA 3QUXA 5I6XC 4RWYH 1PKQA 1QP1A 3CXHK 1YN7A 1TCRA 1LK2B 1ZLUK 1KULA 1XGYH 4HCRL 5LAXB 4LSUH 1WFUA 3I6GB 1VGKB 3IU3B 2WIIB 1Q72H 3DBXA 4U6VH 3U9UB 2A74A 1RUPL 1NFDF 5DJ6A 5HYSG 2UVEA 2VH5H 1IM9A 1EVTC 3W39A 2DMCA 5L7XL 4YHZL 3UZVB 1E4JA 2EDOA 1T7XA 3UROR 3MLYH 3F8UB 4U1MA 3GNMH 5GRVL 5FECA 3QHTC 5CEXA 4K7PX 4MNGA 5SWQA 2B1AL 4OD2A 4J1UB 3G5VB 5IB3A 4OLUL 4RFNC 3U79A 3RY6C 2Y5TA 3VXQA 4UNTA 1JGUH 1HSBB 1QOKA 2LV4A 4EI5A 1OCWH 3HMXH 1NCCL 1A1NA 1HQRA 3MLPA 4UTBL 3O8XB 5FEBA 5DK0A 4U1SA 4UOW0 1AGEB 4ZS7L 5CEZE 1QRNB 3KPPA 1GZQA 1LO5B 1CFBA 4DCQB 4KHTH 5DVOA 2NR6D 9CGTA 5DDHA 3H3PL 3P4MB 4UV4H 5JHLL 4NRZA 1BFOA 5D1ZC 4YEFA 1CL7H 2CK2A 4Q2ZA 1UT9A 2HAZA 2J8OA 4D9LH 5IWLC 4PG2A 4V1DE 4XVTH 3WNNA 5EH1A 4DGIL 2CUIA 2HVJB 2ADGB 4OT1L 4JRYD 3PGFL 3R4DA 4LCCC 3UTQB 1QA9B 1MCRA 5GISL 3BWAA 1YMMB 4I1NB 1CG9A 4LIQL 2ATPB 2RR3A 3RIFF 3ZKXB 3KJ4B 4NZUH 2QLVB 1NEZG 1R5VA 1A7RH 2GFBB 3KS0J 3Q5YA 4GAJL 2VDOL 4QHKJ 3RZCD 4L8SA 2GUOB 3KPMB 2FLRT 1NCBL 2BVTA 4KVNH 5I1IH 2QJDA 3CJJA 3DHJA 3UTSE 1T83A 4GKZA 3HCVB 4PP2A 5CZKA 4G3YH 2P8LA 4DKFH 3MJ6A 2FO4A 2ESVB 1FFOB 2CGRH 4DAGH 2VL4A 3B9KD 4X8JA 4QHUA 4JM2A 3MCG1 5HGHB 4D0CA 2AJZB 5IT2L 4JE4B 2HKFH 5H37H 1ZANH 4NJ9L 4M5ZL 3VD9A 4NCC1 5CBAA 1FVDB 1YUHA 4O2CA 5A2KH 5IW1B 4WDIA 4H88H 4X6CB 5D7JB 2PXYD 1FO0H 25C8H 4RAUB 3U9PL 2ZKHH 3D18A 3WD5H 1CXHA 3SDYL 4M4RA 1W0VB 4QY8A 5FO7A 3WFEH 3LKRA 4OF7A 4XC3H 5ACMA 5HHNA 3PWPE 4ZS6C 4B41A 1EHXA 3GBLA 1KN2L 3F6LA 2QV2A 4KKAC 2FJGA 3IFNH 3UTTD 1QFHA 4XXDB 1TIUA 4Y2OA 2C5DC 2ADIB 3AB0B 4ZO6A 5L8LB 4KKBC 1JGEB 1VHPA 3P11H 2I5YL 4QNPE 3LEXB 4HDIB 2ICWA 4Y4FC 1LWRA 3DLQR 4NNXA 4OGYH 3WFCH 3NABH 5E8NB 1EO8H 4H0GA 1MI5E 3NCYS 3QP3A 5ENWB 5CMAA 2DI8A 3U7YH 3VRJA 3U36A 4K8RC 3TH4T 3ZKND 2NY1D 2IAMD 2YK1H 3B9AA 3MRQA 5SWSE 4RISH 1D5ZB 1EIBA 1G9NH 1X5JA 2FEDD 3SOBL 3OKKA 1Q9WA 4NO3B 2VYRE 3QNYB 2G9HB 3VFTA 2VLRB 2HG5B 4YUEH 3EFFA 3AUVA 3GRWH 1GYAA 4OBSA 1S7RB 1E6OL 4UU9A 1MFNA 4LNRB 4MDIA 2VLLA 5GGTL 5GSVB 5E8OA 4M1GH 1G1CA 1BBDH 4X6EB 3ARWA 2CRIA 3MLSH 5KVEH 3UJJH 2OLDA 3V6FB 4X5LA 5ALBL 4IMLA 2CLRB 3QIUC 4M61A 4HMCA 3UYPA 1OL0A 3HE6A 4M9OA 5GGQL 2W0LA 4NKQB 4GUPA 4FQXC 1KIQB 4OTXH 1WCBA 1MCCA 1R24B 5EU5B 2XY1A 1I1AB 4YLQT 4R4BB 4GRLC 5IQ9A 1CK0H 5J1SC 4PGEB 1J8HD 3RAJH 2FIKB 4Y4HB 4E42B 3PGDB 1KELL 1EXUA 4Z7QF 1R0AL 2LTQB 5MERA 5IR1A 2ENYA 3TESA 5FV2A 1RJYA 3WXWL 1FZKB 4XVSL 4JFYA 5DUBB 3L5XH 4U3CA 3HAEH 2AJUL 3V6OC 1N7MH 4OZGF 3P0VL 2FNBA 4ZOBA 4Z95H 1L7TL 3SKJL 5EZJB 3UTSA 1P6FA 2IQAA 5F96L 4XHJD 2J8HA 2AEPL 3HTLX 4LHUA 1KB5A 1T7VA 3Q5TA 5C0GA 4MA3A 3MRKA 1G7PA 2YD7A 1JUFA 3GSVB 4QXUH 3OKNB 1YEGL 4UDUA 4DEPC 1CDGA 2JJSA 2NXYC 3QXUA 4MWFB 4M7LT 3TCLA 5GS1A 1T4KA 3F7VB 2YD8A 1QR1B 5EBGA 1WISA 1TPXB 4M43L 1RURL 4ZPVB 2VC2L 4ZUSB 4Y5XB 4ZD3H 3NZHL 3VFPA 1AXTH 1WZKA 3B4NA 2H41A 3CFKB 5FUOH 1WV7T 5DZOA 3OG6B 3PWPA 4BH8A 1ORSB 3MNVA 3RGVD 4OCLC 3RVVC 3C5ZA 2XWBA 5DHYA 4HKXB 2NR6C 3NA4A 3L6FB 4LEOA 4JN2A 1KTDA 1R3HA 1LO4L 4NKOB 4M6AA 2YXMA 5IB4A 1KBGH 4YHYB 3BIAX 3HC3L 4QGTA 3WDHA 1NMCC 1U8QB 1SVCP 3RWFB 1A6PA 1MI5A 3PG2A 1QRKA 3BP5B 4U6HB 1JHTA 4A6YL 3OJMB 1VA9A 5GGRB 3RZCC 2X7LB 4ERSL 3KPLA 4Y4KA 2VZ1A 1RIHL 1PSKL 4P23B 4P9HL 4L29A 1XF4B 2DMBA 4L3CB 1FG2A 4KJYB 4FMKA 3EOYG 5CINL 1DLHA 3JTSB 4HZAA 4I0PA 4PRPB 5IMOA 2V7NA 3CSPA 3QQ9D 3BPOC 3MRCA 4I3SL 2B1HH 3VE0B 4M7JH 4KWUA 3I9GH 1M71A 3FB7A 5GRWA 5JHDE 1OAKH 4BSWB 1XFPA 3HZKA 3MLRH 4L4TE 3QHFH 4IRJD 3REVA 4MJ4A 3G9VA 1NC2D 3IJYA 1LQSR 4KDVA 3WNKA 4F80A 1TJIL 2FDBP 2XZZA 3RVUC 1WWCA 4QF1B 2O5ZH 3RWGA 3PWLA 4PJEF 1XCTB 5C0IA 1FYTE 2WIMA 3TH3T 5BW7C 5SV4A 4X9FA 5EZOH 1P1ZA 4MA1B 5EN2A 4Z7UB 5H37G 3FQTA 1HYSC 4M02A 2NY5C 1ED3A 1K8IB 2XTJD 1JTOA 5TE6L 4TSBL 2KUTA 3FQUB 5C07D 4YXKH 4GAYA 4U6XB 3O3DA 3CFBB 2AXGB 1YJDC 1V7NH 3E3QE<