4U7KA

Crystal structure of the clostridium histolyticum colh collagenase polycystic kidney disease-like domain 2a in the presence of calcium at 1.9 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
NSLPYGKINGTYKGTEKEKIKFSSEGSFDPDGKIVSYEWDFGDGNKSNEENPEHSYDKVGTYTVKLKVTDDKGESSVSTTTAEIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ColH protein
publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
total genus 18
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u7kA00
4JFFE 5C09A 2OTUA 1HNGA 3UDWC 2Z91A 2N7BA 3MV7E 4Z76B 4PJ8A 5LGHH 3Q1SH 4I5BA 1KUMA 4HS8L 5D1QD 3SE8H 5C0CD 3KPSB 4QXTB 4N0UE 4ZPTA 5DGQA 5ICZB 3QQ3A 4PGEB 5K93A 3T0XA 4JFXB 4OCNC 3GGWB 2XN9A 3WDHA 1NC2B 4NDMA 1A6AB 3U4EB 3K81A 5E5MB 3EOTL 4ZAKA 4MGXA 2XZZA 3ZKXC 1UH2A 2YN3A 5FKPA 2DICA 1L0QA 3RTQA 4OD1H 5SWZA 1IT9H 4PV8A 3ZTNL 5KSAB 1T5WB 2DB8A 3TC9A 1Z3GL 1C08A 4XPBH 2OJEB 4Z7VA 3VFUA 5IEKA 1I7ZA 4BSWB 3T77B 3CFDA 1EAJA 2ZUQB 3D48R 3VFRB 3O9WA 4NQVB 2FO4B 4ETQA 4JY4A 3TWCL 3VXPA 1T21B 4KK5D 3NCJL 3Q6FB 3SCMA 1YN7A 2OM5A 5C0DB 4MXWH 3IFPB 3MNZB 3BH8B 2Z8VC 3LEXB 2BDNH 2QL1A 3MLWH 4JFFD 4R4ND 4DZBB 5I8OL 3VXMB 5FDWB 1UH3A 3WN5B 4F37K 2EDEA 4R0LC 3OJVC 1UADC 4IDJH 3MCLH 4LDEB 1KJ2L 5I6XB 1KCUL 3TBWA 3PDOA 3CX5J 4XPHL 2NCMA 5DVKA 2EYRB 4YO0B 5KVGL 5F71A 3DSFH 1K2DB 4F15B 4GO6B 3HRZB 3LH2H 1JL8A 3LDBB 3B9KA 1MHCA 3OL2A 4ZFOA 1FAIL 4OLUH 3S34L 5ANMB 1ORQA 2AK1H 3MQIA 3C09B 1IGJB 3VI3E 4Y2DA 1RZKH 5GRUL 5DZOA 5HHVH 5IVXF 5FIEA 4X4XA 4P2QA 5LBSH 2MFNA 5DEFA 1A5FH 1ZAGA 1QKZL 3PWVA 1S7WA 4ZS6D 4FN0A 1HINL 1U8LA 5FYJL 2DQEH 4LNRA 2R1XA 5EIVA 1NUDA 2IGFL 4QOKB 4DOHE 2BJMH 1P4BL 2ZCKL 1XZ0B 4UTBL 4G9FA 4HKZA 4GH7B 4P9HH 1I8MA 1S7UB 4L8DA 3QEQA 3C2AL 3JVGA 2EYTA 5CBEB 3E6FB 2FX9L 5EDXA 3VE0A 4JFOB 5C6PB 2FLRT 4U1HA 2IALA 1ZVHA 4XNXH 1DVFD 4PJAA 2J6EA 1MJUH 5D6CA 5TE4L 5HVWA 5I8KL 3CZFB 2OYPA 2YOCA 4EBQL 5E6IC 4NKMA 3O11B 3MOBH 4Z7UF 1NFKA 3FB6A 3O6ML 5T1LB 4CW1B 3T09A 4JREC 3QIBC 5CHNA 3MRDA 4M43L 4XVUD 1FVEA 1KJ2B 4UB0H 4IRJC 2AEWA 3X11A 3GIVB 1INQA 3FRUA 3ULUC 4H1LB 4UI2A 4M9OA 2A1WH 2J6EH 3PP3H 2YA2A 2LV4A 1CLYH 4JFEE 4RZCA 4HK0A 3PGCA 5AUMA 3T08A 3G5XA 4LARL 5K9OA 3RZCC 1K8IA 4WUUE 2XTJE 1IEBA 5C0GA 2Y25A 3VRLF 4J2XA 1LO0H 3I85A 1U3HD 2CO7B 3V4PH 2OMNA 3ULUF 4I3RL 3GMPB 3D6GA 2BNQE 2WM0A 2APTA 1G7LB 4H25B 1MFCH 4JFQB 2E5EA 4PY8J 3ULVE 2ICCA 1OAKL 4YH6A 1NCBL 2R0KH 1R3HA 5TH2B 1M6OB 4LCWB 3WE6A 4YHOH 4HIHA 4D3CL 1N7ML 3ZL4L 3TFKD 1TVHA 3ARBD 4M1DL 3A6BH 1NCAH 1CG9B 43CAB 2BRRL 1MPAH 4YHZL 3CD4A 3H3KA 5GXBB 3MUHL 3EO9H 1HIMH 4KJYA 2R4SH 4TQEL 2BOCA 4U3XA 3GB7B 4GRWF 4MB5A 1HCFX 3CFCL 2BVYA 1WBXA 1YMMA 2WBKA 4P2OD 2VL5B 1HQRA 2PTTA 3SKUD 3VXRA 3DV6B 4Z0BH 1REIA 5HJ3B 4CNIA 3QDGA 3VXTB 4KXZI 1NGQL 1C12A 1NJ9B 4MAYC 5DMGC 3TBTB 5GS1B 2OL3A 2X6MA 4L4TE 1A6WH 3TVMA 5CEZE 4X6CA 1CLZL 3OR7A 4LCYA 2ORBL 5BZDB 3O4LE 2AJYL 4XHQA 3SDXA 1YYLL 4CJ1A 4UIMB 4JVPA 1AR1C 4H0IA 2IH1A 4WCYH 5JW4N 2P8MA 4HZAA 3QWOA 3AC0A 2A6DB 4G8EB 4LVNB 4XBGA 3DGGA 4ZUVA 1CXEA 3WUWA 1XAUA 5DK2A 4JQVA 3VDAA 4G6AC 3RIAF 5FOJA 4ORGA 3H7LA 5HY9B 2OL3H 1QR1A 2BNQD 4NQEB 2NY6C 3BPLC 1NC4A 3BSZL 4CVUA 5D93B 3ALPA 1A9EB 4O2FB 4OLZL 2VQ1B 4P49A 1OTUC 3B8SA 2WWKO 5IM7B 5JZ7C 4OZFA 5GZOC 1IGFH 4XCNB 1IARB 3Q5TA 2YD1A 4P4RB 5T3ZL 5IFAL 2B0SL 3O2DA 5IJVB 1F8TH 2NY3B 4WY7L 5F1IA 3B5HA 4DCQA 4W6WB 1VEPA 4Q6IB 1KBGH 2VDRL 1LK3H 1UWEL 2VH5L 4PJGF 5L0QC 3L5WB 3KYAA 4GRMB 4RGND 4ZTPH 3NGBB 4JDZB 4OZIE 4I18C 2XOTA 4XCFL 2XZQL 5HHNA 4DKFH 3TV3H 1LO2L 1F58L 2OBGA 3VWKD 5JMOC 3FFCB 4MJ6B 5GGVY 3FO1A 5TPWL 3UTOA 4XVTL 1FYTE 2DI8A 1FL5B 3MJ8B 2UY6A 5CEZD 5EC1A 3MYJB 1FVCB 3CC5B 3O4LD 2ZUTA 5DHYA 2QQLL 1SJHB 3LKSA 2JE8A 3QO0B 4PFEA 3BUYB 3RVUD 4PB9L 4PJHB 3IDMA 1S7RB 3TT1H 4PYHA 3D87B 1MFEH 4HG4K 3OTTA 3V6BR 1GH7A 5IB4B 3NA9H 2FX8L 4GW4B 4FTVE 1IEHA 2GTWB 1FC1A 2IQAB 3HI6L 2I27N 4HKJA 1ZLUH 1CFVL 3HE7B 3INUH 2D7QA 5C8JA 5GS0D 4BELD 4ELKA 3U7WL 5J56B 1D6EB 1FC2D 4GFTB 3NZ8B 3UTTE 3JTSA 1I8LA 4G7YL 3U46A 4TVPL 4IRSB 2CRMA 5FA4B 1F42A 4TNWF 1WBYB 3D85A 2XKSA 1BX2A 12E8L 1IC7H 5F6IC 5HHPB 2XWJB 4PBWD 4OLXH 5EOTA 1S5IH 1IGCL 3K4ZA 1DQDL 5BJTB 3AAZA 2WP3O 3WNPA 1YDPA 4FQXD 1T66D 1JHLL 4M4RA 1NFDF 2ZKHL 1JF6A 3W11C 4P46B 2Y06L 3VA2C 4P5TD 4F7PA 4H0HB 3GSUA 2FX7H 4YGAB 3VG0H 1AQDB 4BQ8A 4PJIF 7FABL 1NGYB 1AGDB 4L3EA 1OW0C 3GSXB 3UJIH 3NCEB 3ROLB 3VFGL 1IC1A 4U1NA 3U0PA 5F3BB 2BOBB 3ARVA 3RUGE 4YXKL 4PUBL 1P7QD 3EGSB 4PB0L 1QOKA 1CGYA 2ZSVB 1TPXC 1SVCP 4NM8L 1M1SA 3MFGB 1NLBL 2Y23A 5I1EH 1XGYL 4PJ5A 5DJ8B 2Z35A 2X9WA 2BSSB 3IXTA 1EEZA 1CIUA 1VEMA 4Z5RB 1HHGB 3L3GB 1MFNA 2R0WH 2CUMA 1OQOA 1D5ZA 2HKHH 5F9AC 3HC4L 3BIKB 3UTTD 1A6PA 5CWSA 4LSVL 3WFHA 4EI5A 2PO6D 3ESVF 1GZPB 1TQCC 3PIQB 3UPRB 3AS2A 4JN1H 4GW5B 2VXVL 2VXUL 1T0NB 3AS0A 4FQQA 3KLSA 4HC1A 3BZEB 3HRPA 5D5MB 3O3EA 3WXWL 1NUFA 4NJAH 1LQSR 3V7MA 1EJ6A 1ZHNA 2V9QA 4XNYL 3BGFB 4K94C 2PYEE 4Y8AA 3D9AL 1DBAL 4JY6B 2XNAB 3BIBX 1FCGA 3GSRA 5CGMA 1QZ1A 1B4JL 2VDOL 5DC9B 3L95B 4E0RA 1CU4H 4GKZA 3FQNB 5F9DC 3MXVH 2V5SA 4QRPB 2FJFB 4P59L 1EO8H 3HG1E 1NSNH 5EBMB 5DJ6B 1FG2B 4UV7L 4HG4J 5FYLE 1FVDA 4HWZB 3BESR 4N5EC 2RIKA 5K9QG 2AV1B 3F7VA 4GAGL 1WLHA 1X5IA 3DGCR 3C5ZA 3TA3B 1S9VA 1MCOL 1A7PH 2UWEA 5FGBA 2ADGA 5BW7C 3HB3C 1GPOH 1A6UL 4UZGA 1WZ1L 3GM0A 4P57B 3JUZA 3I6LE 3GSNH 4OIIL 1HXMA 4N68A 5D9SB 1VB9A 2W9EL 1BFVH 1OTTD 4KTDH 5I73C 4NOBA 3WFBH 1I9JL 1YEJL 3DIFA 8CGTA 5I19H 4NBZB 1J0ZA 1VPOH 3ZMRA 3GMQB 3EDKA 4R97C 5ENWA 1DQMH 1TXKA 3WNLA 2E27L 4XB8A 4JM4L 5DYOB 4TUKH 5E2WL 4Z0XA 2XKNA 4P0DA 2NW2B 1QSZA 4XNZC 3T2NH 3FT4B 3AB0B 5GISH 2DQIH 2PYED 4G6FB 1RJLA 3UTQB 5HVFB 4N8CL 4XXDB 1U36A 3PWJA 3QQ9D 3QUMA 2YBRB 3S3SA 1FO0A 4NNPL 5GRJH 1NCTA 2YPKA 5CIPB 1TTFA 2NY0D 1BEYL 4X7DC 4CMHB 5EOCJ 3BXNB 2ZG1A 3HG1D 4MJ5B 4W6XB 1EXUA 1IC5L 4M7JL 4ZXBB 1E28A 2ENYA 1PEZA 5JW4R 3ULVL 3STBA 1CXIA 5HYJB 5B3JE 2Q76B 1LP9B 35C8H 3MRRB 3MRQA 4IM8A 4Z7QE 4S2SA 4JQXA 2D03L 3VCLA 1KJVB 5HDQL 5H8DA 1FO0H 4KAQL 3QIUD 5EWIL 4ESKA 4HT1H 1J05A 1JTTA 1YC7A 5L8LB 3UYPA 4M48L 4LK4A 5J9PB 4DK6A 1YN6B 1IL1A 4HIEB 1IEAB 2ARJB 3GMOB 3I6LD 1QSEA 3LKOA 3D0LA 3TH4T 4DEPC 4KJWC 1VGEH 2QQKL 2HJLA 2VLRB 2QADD 3LQZA 3MROB 5ECJE 2Z0BA 3QQ4A 1QLFB 3KPQA 5TQ2H 1KPVB 4UIKH 1AO7D 3F5WB 3B4NA 1WBZB 1CE6A 1BJ1J 2YKLH 3KXFB 3QXUA 2YUWA 5FECA 2BHYA 3GO1H 3GFUA 4V2CB 3U2SB 4FXGB 1V05A 5A2FA 1ZLSL 1G84A 5KSBE 3T0EB 1QBLH 2N1KA 1MCWM 5DJZB 4R26H 3B3IB 3G04A 5IVZA 1NEZA 3VFSB 4Y5VC 2VITA 3S36H 1L7IL 5F1KC 4A6YL 1PZUB 4HW6A 3A67L 5EBWB 4I48A 3LMJL 1XR8A 1YJDC 4CADB 4QCIA 4U6XB 1SY6A 1Q9LB 1A7QH 1EMTL 3VGFA 1KG0B 4EOWL 5CZKA 1LE5A 4CRPA 3W5NA 4AIZB 1KN2L 1I7TA 1Q1JL 4UMGA 1RFDH 1OARH 3KNBB 3MX0A 1FPTL 1RMFL 3OKEA 2EIEA 5BS0B 4F9LA 2M26A 3QG7L 4K23H 4K3GA 2F74A 1P4LA 1R5VB 2OTWA 3IDYB 2IPTL 2I9LB 2R4RH 5F7FA 1CGUA 4Z78B 1BBJA 1VFAB 3U30C 4KJQD 4C59B 3P9MA 1GAFL 4AENB 4O58L 3ARDB 4KPHL 4YDKL 2H41A 3DUUA 3W9DA 2ZP0T 1T1WA 3C8KB 3SGJA 4LAQH 2CDFB 4YBLC 4XMKH 3PQYA 2K3TA 5LJYH 5JHDB 3OJDB 1MVFA 4FP8L 1M05B 3QG6A 1Z9LA 3QIWB 5SWQA 1A6TA 5CJQL 1C5CH 4IJ3C 1M7DB 1UA6L 3MUJA 2FH6A 3DX7B 3HFML 5DF0A 1XF4A 4F9PA 4UDTB 2Y5TB 3OWEA 1NGPH 5IQ7L 4HUNB 4KWUA 3ARSA 4OGYH 3T2OA 5JOPE 1J11A 1BLNB 1ZHLB 3V6OA 2J4WH 2DYPA 5FCUH 3MV01 5TQ0L 3VXME 4LSSH 1KT2A 2Y36H 3ZZ1A 5KG9B 1QLRB 3EBAA 4JHWL 1MCDA 1FGNH 3KPSD 1U95B 1JGVH 3GKWH 2VDLL 1DUYB 4S11A 1PX4A 5D70H 5EUKB 1NC2D 3WIHL 5C0FB 3RWEA 4PGBA 1U3YA 1VA9A 1CFQB 5C0AA 1RJYB 3O8XB 4DKEH 1C5DB 3NIDE 1QPPA 1JNJA 2ESVE 2A73A 3HE6A 3V6ZA 5HYQA 1U8NA 1F6AB 5KSAD 1D5MB 3QCUL 2D4FA 4JFPA 4YX2L 4OKDA 4U1LA 4Z7OF 4TSAH 1QRNB 1CR9H 1AGEB 4HJJL 3T65A 4DZ8A 4HS6A 4LKCB 3VXUE 4GBXC 2HT2C 3WDIA 4X0KA 3VXSB 5HHOA 2CMRL 5B39A 5JPNB 4XH2B 3LPFA 1F3JB 2VZ1A 4FXKA 3AVEA 4JZOB 2YN5A 2CXKA 4P3WA 3TO4C 4KK8C 1CF8H 2AKRB 3L6FB 1NMAL 32C2B 3N1GC 4TSBL 2AQ2A 2BXYA 5I2IA 3KLHD 1V7MH 1DBMH 5C6TH 4ODWA 1U8QA 4G8GE 5JOPD 2WWMC 3WO4C 4HX1B 5IJKC 1RK1B 2R15A 1ZT7B 1H9VA 2ZCLL 4H20H 4QHNA 4Y2OA 3VXMD 5B38A 3ESUF 2Q87A 4PV9B 4QWWD 4UAOC 4D9RE 4P4KB 1JGLL 5BMFL 4NHUA 4GG8A 4TUJB 1I3GL 2I60L 3DX6A 5IK3B 2GJJA 3BGMA 1AY1L 5GJSL 3ISWA 3NH7H 4M6MH 2ITCA 4YK4B 3BPOC 3GSVA 4KKCC 3M17B 2X4SA 5IBTH 5CEYB 1HQ4A 4NC1C 2LU7A 2WLYA 2CR6A 2EXYC 1KTLB 3UYRL 1MHHB 1LO4L 4WO4A 4HH9B 3HAEA 3MLZH 1FV1B 1WFTA 3SDYL 4HFWB 2WK2A 1TJGL 1FFPA 1JN6A 4HHAB 4HKXB 2V9TA 1CQKA 4G6JH 4MXQC 4L3CB 1B6UA 3MJ7B 4U6VH 1Y6KR 3PGFH 1CBVL 4GSDH 3HZKB 4QOKD 3T1FB 3P4LA 4WHTA 4UBDD 3RDTA 4NNXA 1S3KL 1J8HB 1JWSB 5JORB 3SE4A 4KHXL 1SMOA 4Y5YC 1NFIB 4LRNL 1BBDL 4XPAL 4MA3A 3VWJD 3OXSB 2NXYC 5DO2D 5DJAA 3CMOL 4RMWA 2LABA 3CGTA 4M1GL 4HH8A 2AK4B 5C9JA 3MRJB 1U8JB 2C3VA 5T1LD 2NY1C 4QTIH 3AGVA 4Y4HC 3BH9B 3GSQA 4FG6D 4OM0L 5I1DB 3VJ6A 3NACL 3MBEB 1FFOA 2VXTH 3WUWG 3WKNA 1KIRA 2CK0L 2FB4L 3PP3K 1I1AC 2HRPL 2JJTC 4Q9QH 4XXCA 4OCXH 1MAML 3K1DA 4LU5H 5HSFA 3WSQH 4X4YB 3QULB 2FR4A 1X5FA 3TIDB 4PJBF 1KEGL 2ERJB 3IB4A 1E4XL 2JCCE 3SDDA 1DN2A 4NQDE 1OGAE 3QFJA 4B0MM 5CMAA 4FFYH 4ELMF 5L2KA 4WRLA 5HGHA 1GC1L 1RIHH 4XTRC 5ALCL 4XWOD 3DLQR 3I3DA 5D7IF 5F1NA 5CJOH 1NPUA 3T4YA 5LCVH 4EN3C 1FNSH 4S1DC 2YA0A 4PJ7A 3DBXA 2GITB 4S1RH 4LCWD 1QVOB 1C7SA 4LSPH 5KW9H 1K8DA 4NUJA 2V7HA 4NRZB 5KANI 1UFUA 3WJLA 2LFGA 4JO3L 3HMWH 4OGXH 1SJEB 2NY4B 5T33L 4M61A 5GJTL 5IHUL 5JW5A 3BJLA 2Q3AA 4K55A 2BC4B 4WV1B 3V7AG 1OB1A 3WFZA 3BQUA 1BVKB 5AYQA 3T0AA 3L3IB 4NNYB 4KXZH 2PW2A 1S7VA 1L0XA 4YHLL 3P3YA 2QTEA 4TNVK 2G5BB 3H9SA 2NLJB 1HEZA 2HMIC 1CDIA 3EYOA 2OZ4A 5HD8C 3WS6C 2DLEA 1WAAF 4J4PD 3PUCA 2XG5A 4XX1G 3KDMB 4RAUB 5BV7H 2D0HA 3JWDC 3OXRA 5DSCB 3QAZB 4J1UB 3UTSB 3ZKMC 3G08A 3HKFA 1IZJA 2EO9A 5I15L 3OZ9L 3CDCA 4MQXD 1IQWL 3VFOA 2VDQL 3PXJA 3ZE1F 1A64A 5HDOA 1BIHA 3VFVA 1U6AH 3PL6B 1XF2B 4H0GA 1T7VA 2XIDA 1I9IH 1OOAA 4MNQB 4IIQC 5D1QC 4PJHE 1HH9A 3FHQA 2UUDK 3MRKA 3O2VL 5C0BA 2L7UA 1OGAD 5DDHA 2VDKH 3P2TA 3C6LC 1ZHBA 1YMHB 2P8LA 1RURH 4D9LL 3MRHA 3UDWA 2AEIT 1JI2A 3DUSB 3OHXB 1MLBB 4WUKH 5IVOA 4NRYB 5IW3A 2JK5A 4MQ7B 2ZOLB 4U1IB 5DUPL 3SHSA 3SJVA 5TF1L 4HQQH 2A6IA 2NY3D 2AJSH 4QF1A 3IXAB 3BAEL 2UZIH 4GAYB 2BVEA 4RQQA 1D9KB 3DTXA 1QFUL 1HZHL 1R3IH 4PRIA 4IMKC 4FZ8H 2NZ9C 5CZXD 3OPZH 4YIQB 4QTHB 4RMRA 4UILH 1RAMA 1N2RA 3MTRA 1UB5B 2E6JA 1MFAH 1GOHA 4TULH 4CU6A 3DO7B 4JG0H 2YPLE 4WU7B 2FGWL 3DURA 3WD5H 4R4NC 3BP5B 5I1JH 1YEGH 5EU4B 3ILPB 4U6HB 4DN3L 4LSDA 4I9WE 2F5AH 3KPRA 3V5KA 4Y4KB 1CZ8L 1F4HA 4AEEA 4U1KA 1ZGLM 5F1OB 1F90H 3P73A 3PF2A 2ICWI 5JLZB 2KDGA 2XT1B 2B5IC 4LKXA 3L3JB 4Q0XH 2B1AL 1P7KA 3HE7D 3SKOA 4R0LA 3MGAA 1RQ5A 3X17A 5DMKA 1XGQB 2DQTH 1TVBA 5IVXA 4UQ3B 3HCVB 4HCRH 1W0VA 1KLUB 1T5XA 4JQIH 1RZGB 1RUAL 4IMLB 3VMOA 1YY8B 1D5IH 4IRSD 5T3ZD 1CDGA 2GJ6A 2BHUA 5F7WC 2NY2B 1Q9WB 5LGHL 1ZE3C 3GJEB 3BKCH 3U9PH 4DJMA 1J8KA 3L3HA 4U0RC 4UINL 1KF9B 2H2SD 1U8KA 3U4BL 3PNWA 1LDPL 4AG4L 2X4QA 3DJ9A 3F7YB 3BN3B 4RX4D 4EJ1C 4ZDHB 5K33A 3JUYA 4P46D 3PWUB 3KPLB 4NCC2 3IAGC 3UJJH 1DVFC 2P47B 4BK4A 3B5GA 3G6JE 4L29A 4PG9A 4OD1L 1CGWA 1KB5A 4Z7UA 4I9WD 4PLNC 2VLJE 2HG5A 1I8IB 1UH4A 3H9HA 4QRPE 2QHLA 3W9EA 3IVKA 3QDJA 3CNKA 5LG1A 1YUHA 4FNLH 4ZUTA 3ZYJA 3V6FB 1RPQA 2I9TB 2J8OA 3BFOA 5D71L 5E6IA 3WS3B 4F37F 3S9DB 4KROD 4HJGB 4QHLA 4PS4L 1NMBL 4LL9A 3KPTA 4PTUB 1KB5H 4XNUH 4RA0C 1OSZA 3E6HA 1OD9A 5FHBH 3TT3H 5CCKL 1V3JA 1ZLWK 5JIPA 1KCSH 3QIBA 5A40E 1K5NB 5SWSB 1YPZB 3IFOA 4TPRH 4IRJA 1K4DB 1RHHB 2JIXB 5ILTH 1ONQB 2V2WB 3ZSTA 4PPTA 3TCXA 2BY3A 3VI3F 1WIOA 3BP6A 3T4AA 1QTYT 3S7GA 3RZCA 2F53A 1DQTA 3FZUD 3ARBC 1FNGA 3DSFL 2JB6B 5IMMA 2FIRT 5IOPB 1N5AB 5IF0A 4GUPB 3TBYA 4CMMB 1AGFA 3ULUH 2AK1L 2P1YA 1T04A 2BZDA 3QZWB 5EIIB 2GTZA 3MLTB 3PWPE 5C09B 3HMXH 2OTUB 1S78D 2Z91B 2DS4A 4PJ8B 1J1XL 1FNEA 2VLJD 4HFUH 4HEME 4I5BB 4LASH 2DQEL 1P84K 4QRPD 4ZPTB 1HXYA 1RSFA 4BUHA 3CVHA 1A2YA 3QQ3B 1IC4H 4M62L 4DGYH 1MIMH 1CE1H 2XN9B 3V0WH 3QH3A 3RVTD 3RVXC 1TZHB 4O2CA 5SX5H 3TA3D 5FKPB 4R2GB 2XTJC 4MCZA 4MAYA 1WCBA 1NGXA 4XNXL 4AMKH 5SWZB 1G7QA 4PV8B 1NAMH 5FYKE 1FRGL 1A3LH 3EYUH 1BZ9A 1C08B 3GMMA 2MCPL 1H3PL 5IEKB 1I7ZB 1OAZL 3LV3B 3MOBL 3CFDB 1FL3A 4CGTA 3ULVC 1RZJL 2VLRE 4TOYH 4FRWA 3O9WB 1CTNA 1DDHA 4H26B 4ETQB 1VDGA 3VRJA 1IAIM 4JY4B 4UB0L 4QRUA 1C8PA 4ZODA 4X9HA 1BIIA 5T3XH 2RAMA 2J6EL 4G6FD 3SCMB 1YN7B 2WAHA 3ULVF 1CLYL 4PJGA 2VISA 2E7HA 3EDJA 4HD9A 4ZTOH 1AKJA 3VGGA 5I17A 3VWKC 1HI6A 4WEBH 4OBRA 1YQVH 1JK8A 4GAJH 3T0EE 4M6OH 3V4PL 2BVPA 4KQ3L 4TUOB 1DE4A 1EA9C 1INEL 4LLVB 1BZ7A 1GIGL 5HYJD 2R0KL 4I18A 4R8WH 3B9KB 4YHOL 1MHCB 4ZFOB 1IBGH 2VTFA 4ZOEA 4BQCA 1ORQB 1INDH 3OJ2C 1NCAL 1BD2A 5C2BL 1AJ7L 4Y2DB 2MCG1 1JZ6A 5A43C 1KCRH 4X4XB 2EDFA 3EO9L 1HIML 4P2QB 5FYKD 2R4SL 4FFVC 3LB6D 5DEFB 3CLEH 4QYOA 3PWVB 1S7WB 5BS0E 3F12B 2HYMA 1U8LB 2HH0H 1UCTA 4LNRB 2VLRD 2R1XB 1MREL 1ZEAL 5E2TH 4QGTA 3GEWB 5GS0C 1J0KA 3H0TB 5I76A 4G9FB 4HKZB 1MIEH 4LGRB 5J3HC 4FQ2H 4L8DB 3QEQB 1TVDA 5I1AA 2EYTB 1R0AH 3GHEL 4BQ6A 3VE0B 2CGRL 3H8NA 4LOUD 4UT9H 2IALB 4E41A 4PJAB 2HFEA 3O45A 2NY5H 1QHPA 3D3VA 15C8H 3CSPA 4OLVH 5JHDE 4AEHH 1U8PB 4NKMB 3T0ED 2DTML 3R0MA 3FB6B 1NFDA 2ARWA 5F93C 2O5YH 2FIKA 2OL3L 3GSWB 5E7FA 1JGEA 3UPCA 4KRLB 5E8EA 5CHNB 1JZ8A 1JHTA 1RY7B 3MPCA 1MI5A 1KC5H 4PJIA 4OZIF 1FVEB 1RZFH 1P84J 4JHZA 3X11B 1INQB 3FRUB 3DXAA 1SYSA 1W72A 1IGFL 4U0QB 1ZWIA 3QPQD 3IDJA 1F8TL 4LVOC 4MS8D 3PGCB 1KGCE 3G5XB 1RIVH 5K9OB 5FDYA 4LLUA 4HF5L 1K8IB 4L9DA 4WGVB 3ZT5A 1IEBB 1DBBH 4LQFH 4ZTPL 4Z9KB 5BS0D 1WZMA 2XZCL 3DETC 1OW0A 4NO3A 4DKFL 4I0KA 2P5WA 4G6ML 2V7NA 3VMPA 1A6ZA 2DL9A 2E3VA 1VEOA 4KI1A 4OQTH 3RWFB 3SE9H 1XFPA 4ACPA 2JKXA 5CSGA 1IILE 5LQBL 1KXVC 3B43A 5EZIH 4PR5A 1NDMA 5E8OB 4LHJB 1R5WA 5JDSA 3ARDD 2PO6C 1TVHB 3L1OL 1I7UA 5B39G 5C0EA 5MENB 5MI0B 1P6FA 1KJMA 3QHZH 4OM1H 5EC2A 4KJYB 4Y1AA 1I1FA 1DFBH 3R8QA 2BOCB 5E2UL 1QRNE 3HI5L 2ARJQ 2R0ZH 3RJDA 4E5XA 3TT1L 5JHDD 3OKMA 1WBXB 1UYWH 1YMMB 4N0CC 5FO7A 3QIWD 3VXSE 1H8NA 5HGDA 1TMCB 3NA9L 4NWUH 3RWCB 4CNIB 1PZ5B 1C12B 1R3LA 3GI9L 5B38G 3VG9C 3RWJA 3TVMB 1Q9OA 4X6CB 1XIWD 2ZJSL 5INCA 3RWIB 3OR7B 4LCYB 3UPAA 3PV7A 4XGZA 3SDXB 2A2QT 3BMWA 2VWEE 2X9XA 3EYVA 1NCCH 1CFBA 1KGCD 2IH1B 3BO8A 3UP1A 2P8MB 2FL5A 3QWOB 4XBGB 4ZUVB 5E9DB 1AIFB 3S5LB 5DK2B 4APQC 1AE6L 5M7QA 4ORGB 2IQ9H 3BT2H 1S5IL 3HAEG 1QR1B 5EU6E 1NC4B 2HVKB 3ARZA 1S7TA 3DYOA 3UCRA 3RUGF 1YYML 2V2XB 3ZLQC 2HAZA 1G9EA 4YEFA 5ETUA 1S9YA 3O8XD 5E5UB 2FX7L 4OZFB 1JHKH 1EDQA 3GBLA 3N0PB 3VG0L 5F44A 3MGOA 3UJIL 1ADQA 4J7RA 5AD0A 2YZ1A 1OTTC 4IOIA 4Z8FL 2EH7H 1QRND 4PJCA 5I1KH 1RJCA 3C5JB 5KOMC 5JQ6H 1YEKH 1IJ9A 2DAVA 3HUJE 3VXSD 5HHNB 5BW7A 1S5HA 4LIQL 4K9EL 3U7YH 2X41A 5ERWA 3F65A 1Y18B 5I1EL 3FO1B 4RRPG 1G9NL 2DQUH 3IU4H 1PX3A 1FLRH 4B41A 5HI5C 2HT3D 4WVRA 2R0WL 3QQ9C 5EC1B 5DHYB 2R2HA 4QRRE 1OWRM 3C8HA 4NGHH 3LKSB 3U0TA 3QDMB 4FQ1H 3N1FC 4I77H 5GRXG 3T1WA 2WUBL 5F88A 1RULL 4ALAH 3IDMB 2K1MA 3AUVA 2AK4E 4P4KD 1A8JH 5JO5B 1QACA 4JN1L 4B53A 4K3DL 5CJ8A 1KENH 3BDYH 1KPUA 1T20A 1L9NA 5CGYD 4EUPH 3VFWA 1MEXL 3PWLB 4DN4L 4RWYH 5DURD 3QIUC 4HKJB 1EEYA 3EJYD 4KKBD 3MNVA 1N0XH 2Y07H 4JRYA 1IAMA 2FATL 3MRCA 2VUYA 4MSWA 3KPOB 3JTSB 2VAJA 4XAKD 3SQBA 4X5WB 3QCVH 1U8MB 4K71B 3U46B 4LBEA 5DHVA 1F6FB 1RVFH 3BZFA 2QADC 3V4VH 5DQJB 3D85B 4LPCA 1BX2B 4V1DA 1CU4L 5EO0A 5EOTB 3BPCA 3RL2A 3MXVL 3SDAC 1MJ8L 5KSUA 3U48A 3AAZB 1YDPB 1NSNL 3MREA 4ZUSA 1BWMA 2Z93A 3RAJL 1T2QL 4PGCB 3U36A 3ZTJH 3GSUB 3KYOA 2C3XA 1HWGB 4PJ9C 4XNQA 4TVSa 3ZYZA 1A7PL 4L3EB 5FYKU 5BXFB 3MOQA 3U0PB 1FORH 3WL9A 5F96H 2AK4D 4O51A 4RNRA 1DL7L 1NQBA 1KTDA 2H9GA 3EO1A 5D72H 5I1LB 3W5MA 1BFVL 1GGIH 5J13B 4A2MA 4M6NH 3CSGA 5CSZA 5I19L 5DGRA 1OAUH 1VPOL 4X5XA 4HWBA 2Z35B 4AT6A 3IXTB 3MBED 1EEZB 2VZUA 3C9NB 1H3XA 5IWLC 4L8BA 3T2NL 5JNYA 1F02I 1D5ZB 4Y5VA 1AD9A 3UZVB 3UZQA 2AABL 5CWSB 5B3JF 3TYGL 2Z31C 4MVBC 4EI5B 3FL7A 4HXBH 2BP3A 4Z7QF 3FQTB 5GRJL 3VXOA 1MUJA 3MLXL 1OAQH 2CKBH 4M7LL 4FQQB 1CFSB 1Q94A 3BPNC 4KJQC 3JWOC 1DEEB 4HLZG 3EFDH 3G9VA 3O3EB 5AAMA 4JPIA 1MRCH 3AU1B 1HE7A 2FHFA 35C8L 1ZHNB 1UB6A 3QUML 2NY4D 1FO0L 4N0YH 5E8PA 4BA8A 4W81A 2R1WA 3PXHA 1FNAA 3BE1H 4NHCL 1WC7A 3GSRB 3OB0H 3OGCB 1P1ZA 4GKZB 1NBVH 1CD9B 1VGEL 4DKAA 3RBGA 3V0VB 4DFIA 4RFEA 1KEMH 2HFTA 1CICB 1BQLH 5KSBF 1FVDB 2YXMA 1VGKB 3F7VB 4WNQA 2V9RA 2VDPH 2M1KA 3C5ZB 3PL6D 4OFYA 1S9VB 1RU9L 2YKLL 4NKOB 1TITA 3ZDXE 2ADGB 3BKJL 1G0DA 5C86A 1DQJA 4BSVA 5J12B 5JXED 5ISZE 3NVQA 1N64L 4B7IA 5GRWA 1QBLL 3NPSB 1BF2A 2EXWD 3I02A 1K85A 2B1HH 5ENWB 3GM8A 4KGLA 1UZ8A 1VSCA 5HDLA 5DS8B 1J18A 4MDIA 3RZWA 3HR6A 2QKIB 4UTAH 1CDYA 1LVEA 2WBWB 3D1MC 1SYVA 3G6DH 1RJLB 3LKNA 1A7QL 4NZRH 3UEZA 4JGJA 5I18H 4XC3L 3QUMB 4QXUH 4GMSH 1D9KD 1P5VA 4FS0A 3IJSA 1U58A 2LTQC 5E56A 3V8OA 1OARL 2YPKB 3LKRA 1LNUA 3N9GL 1KELH 4KUCD 4G6KH 5DT1H 1SQ2N 1BAFH 3LRSB 3KLHC 4UOW1 5E00B 1KLGA 1EXUB 4JRXB 4OZGE 4X7CC 1E28B 4JO2L 3ET9F 4JLRA 1SY6L 3FT2A 1PJ9A 3LN9A 4GBXA 4L9LB 3MRQB 5AG9A 1G9ML 2FNBA 4S2SB 3VCLB 5L7XL 3EIFA 4XP5L 5FXCH 6FABL 2H1PL 3TO4A 4C56A 1J05B 4ZNEE 5IP4A 3MZGB 5ISZD 3CIQA 5JUEL 1IL1B 3AM8C 3QXAA 4LSTH 4Y4KD 4MD4A 1QSEB 3LKOB 3D0LB 4F15C 3OAZH 1LD9A 1S7XA 5IJKA 3LDBC 3QQ4B 1SBBA 1SM3H 5KJRL 5KTEH 3NN8A 1JPTL 3LIZL 1NGPL 4N90D 1CE6B 1R3KA 1G7PA 4PJFF 2NX5E 1MHPH 4OGYL 2HFGL 4Y19A 5FECB 5FCUL 1YPZE 1PEWA 5C0IA 5C7XL 3OR6A 5DFTA 2X42A 1ACYL 4LSSL 3NIDF 2NY2D 1MCLA 1LE9B 4DVBA 1CD1A 1N4XH 3MLRL 4UBDC 3DROB 5B4MD 5F89A 1FGNL 3QA3A 3G04B 5IVZB 1NEZB 1K3ZA 2VITB 4X6EA 5ITBH 4LLMA 1WV7T 2BVOA 3V95A 3VWJC 3HNTH 1A7RL 4DKEL 5DRWA 4QCIB 5GGVH 2ICWB 5JTWA 1UWGL 2C4FU 2P5EA 1S9WB 4X6DA 3H9ZA 5E8NA 1LE5B 3ZE2E 4NN5B 1I7TB 5DEGA 1ZGLB 4Y5YA 3TZVB 5C3TA 4FG6C 2CO6B 3KR3L 1XF5B 5D7LA 2H45A 4JHAH 2F74B 1P4LB 3VI4E 2MHAB 5EORH 2EDOA 5EOQH 1TJHH 1I3VA 3OF6D 1BBJB 5BRZA 1RZKC 1V7ML 5C6TL 4HUVB 4H8WH 4PJBA 2MPAH 4Y4HA 3DX9A 4MD0A 4RSVA 4JG1H 5SWSD 2APXA 1U3ZA 4PY7A 1T1WB 4ELMA 5CP3H 5D96B 1J7VR 4OCRH 4XWOC 2DM4A 1I1AA 1QR4A 2JJTA 4MNGA 1O7SA 4LSUH 5F6HJ 2Z4QA 3QG6B 4UU9A 3WDJA 2AXHA 5C0NC 1EFXD 4P9HC 1A6TB 1AD0A 2WQ8A 5J57B 1Z0MA 3C6SA 3NH7L 4XPGL 1XF4B 4X80L 2R0LL 4RMUA 1M71A 4ODHH 5E24E 5IBTL 3KS0J 5GS2H 9CGTA 4JKKA 3R4DA 2R9HD 1R5IA 3BW9B 2DQDL 4EN3A 4BKLA 3OJMB 1YEHH 2WANA 4M00A 4G9DB 3KLAA 5C09D 3NAAH 2E7BA 4PJ8D 5AEAA 3AMKA 1KT2B 2XA8L 2X1WL 3G9AB 4S1QH 1H5BC 3FMGH 4WDIA 4NN7B 1KULA 4LHUA 5GGSA 4GSDL 1S7SA 2XN9D 4K8RD 1X4ZA 1YNTB 2HT4D 2UV3A 1JRHI 3F7QA 4P2RA 3WNOA 2FGZA 3V79C 4PGBB 3WS6A 5SX5K 1OCWL 4R2GD 1FGVL 2A73B 3HE6B 3BOVA 5HYQB 4DAGH 1U8NB 2UVFA 5SWZD 4P5MA 43C9A 2SEBB 2Q8BH 4JFPB 2G75A 4U1LB 4ODUA 4M4PA 4KVCH 5J7CC 1MVUA 3GBNH 1IAIL 1MRFH 4DZ8B 3AXLB 5E99H 2XXCB 1EHXA 4NO0A 5HHOB 5B39B 3O9WD 4IIQA 5D1QA 3MLYH 5C0CA 2QBWA 3EYFB 3MZTA 2JCCF 1VACA 1Q8MA 2DDQL 2VXTL 2NY3C 4HIJA 5I2IB 2C4FT 5MEOA 5DJCA 5T3XE 2WWKT 3C6LA 3RIAK 3MBXL 4ODWB 4Q9QL 3SCMD 2O5XL 1HSBA 1RUKH 1QFWM 4OCXL 5F9OH 2C1OA 1DP0A 5EZLA 3WSQL 5DWUL 4KC3B 4QHNB 2UVEA 2P44B 2YC1B 4NHUB 4ZD3H 4GG8B 3BISA 2CK2A 3KPMB 1T89C 3DX6B 2Q7YA 3O6FD 1RIHL 3QNZA 2JJVA 3BGMB 2D0FA 4NT6B 5CJOL 3D0VA 4OB5H 4RGMB 2QQNH 1FNHA 4HJ0D 5T1MA 4S1RL 3AREC 3ARUA 4XAWH 3GJFA 1HDMA 5SX4I 3B9KD 4IMKA 2H2PD 5DMIH 1LGVA 2HLFC 5IB1A 1WT5C 4WO4B 2YK1H 3HMWL 5KAQF 3HAEB 4HMEA 4Y2DD 1IRAY 5TFSH 1QFHA 4F7TB 5DD1H 4XWGH 4P2QD 4U1MA 1J1PH 3QWQB 2EDLA 4JFFA 1KYOK 1G6RA 1KCVL 3MV7A 3K2UH 1MFBH 3HE7C 1XT5A 4PJHF 4YR6A 3V5HA 5E03A 4UV4L 4N0UA 4NQCA 2IBBA 4G9FD 5DD6A 1QUNA 3X14B 4NIKB 3MO1A 5DRXB 5T3XD 1BREA 5MENE 2D7PA 3MCG1 5DQ9A 1U6AL 4QY8B 2CPCA 1G6RH 3S96A 2BVTA 1I9EA 5DJAB 1KTKE 5CBAA 4NM4H 2H2SC 1VESA 1P69B 5T1KB 1V3MA 1UM5H 3VXNB 1YMME 4HAGA 5C9JB 2C3VB 2VDKL 4P46C 2R8SH 2IG2H 2AERT 2CLZB 3TIEA 4N8VA 1RURL 3L3KA 5I8EA 2DWEA 3SPVA 1T22B 2HFFA 3EYSH 4TNWK 4WUKL 2CUIA 4EXPX 2L7JA 3IF1A 1KIRB 2LE9A 1OTSC 2PXYC 3LRGA 4OLEA 3R06A 5AAWA 3O81A 4KRPB 3W2DL 3PP4H 6CGTA 4HV8A 4DGIL 4GT7A 2FR4B 2OSLB 2FHCA 2WW8A 3DV4A 5E9DE 5SV4A 2UYLA 3SDDB 1RZ7H 1DVFA 1HN1A 5J11C 1D5BA 1R3IL 3IKCA 5CMAB 4OD3L 1ZGLP 5L2KB 4FZ8L 3OPZL 5HGHB 4KROC 5FM5O 1U92A 5AZ2L 5F1NB 3E0GA 2IMNA 5DTFA 2R29H 3T4YB 3TJEH 4PJ7B 3DBXB 3P0VH 4JB9L 2AXJA 4TULL 2ZZUT 4JG0L 1UM6L 4NUJB 4GKSA 5MEND 4X7FC 3FOMB 2OI9B 1R3JA 3GSOB 1ND0B 5JW5B 3NZHH 1EGJH 3FO0H 1FZMA 4I4WA 1OB1B 3BQUB 3RIFK 5CLWA 2E8YA 2XA3A 4L8SC 5DD0H 2F5AL 2PW2B 1S7VB 4WTZA 1O5DT 3O41B 1YMMD 3FZUC 1HHJB 3EYOB 4YE4H 3QXVA 4EKXA 5DUMH 3RVWD 1FJ1A 5IIEA 3NTCH 3E3QE 4PRBB 5GSRA 3SOBH 4JO1H 5CSBA 1BFOA 3OXRB 3RX8A 3TGXA 4X6BA 2BNUA 2VSDA 2CDEB 3B6SA 3G08B 4XMLH 3TVMD 5F7MC 3OAUL 2DQTL 1LO3H 5TDNA 4M5ZL 3VFVB 1S78C 3PWNA 3GMRA 3HPLA 3O2WH 4PIRF 4JQIL 4GRLC 4WWKB 3ARBA 3QDME 3CFEB 5ESAA 4OIAA 1UZ6F 3ZT6A 1JIBA 5E9DD 2GW5A 5C0BB 3MRKB 3TN0B 1OL0A 2AI0L 3G6JF 3BKCL 5DDHB 1F4WH 1KXQE 1EEUA 4HZLA 4P48A 1PW3A 3WFDH 1ZHBB 2P8LB 3WKML 1KYOJ 3TA3C 1NDGA 4PRHB 3HR5A 1FFQA 4XMPH 1T03H 1B0GA 3K4DA 1CGSH 4OZ4A 4ONFL 4L8CA 1PD6A 2VZVA 5HI4D 2JK5B 5HGBA 2A9NH 1NCNA 3LN5B 3SJVB 5E4EC 4KDWA 4RFNC 4JVUA 5A3ID 5F8RC 3O6KH 4JFEA 4XBPB 1EHNA 2KQNA 1X4YA 1TJIL 3HA0A 4GOSA 4RQQB 1CFTA 4R7NA 3FB5A 1A1MA 2XYCA 3DTXB 3UO1H 5LWYH 2B20A 3LSOA 3ZKXB 4GXUM 1KPRA 4WUUA 2OP4H 1YEFL 1XGUA 5AYUH 4FMKA 2WBJC 1C1EH 4LLWA 1GGYA 3DVGA 4WFEE 4R4FL 1G0YR 3Q3GA 2ZUVA 4QRSA 3DVIA 1HH6A 3WLWD 3DURB 1KB5L 4XNUL 3DO3A 5KOVC 3TT3L 1DANU 1KCSL 2EE2A 1YY9D 1T7ZA 3QDMD 1OLLA 4RDQF 4CMHC 4TPRL 5DR5L 5KANG 2PUQT 3WEXA 5ILTL 3KPRB 4ONOA 3V5KB 1PKQE 4KY1H 3UTZA 3Q0HA 4U1KB 1NAKH 3T8XB 5D1ZC 3ALXA 3P73B 4QXWA 3VWKA 3REVA 3A6CL 5E70A 5BVPH 1P7KB 2A6JA 2P8PA 3RNQA 3ELAT 3SKOB 4R0LB 3U0WH 2G2RA 5DMKB 5KVEH 1TVBB 5IVXB 2I25N 5IB3A 2JELH 1ZA3B 1YNLL 3ULUL 1NEUA 4L4TA 1K6QH 3LB6C 4WHYH 5ADOL 1W0VB 1T5XB 3O4LA 1UWXH 4LSRH 1Z5LB 3FJTA 3MLTA 1FZOA 1T6WA 3SKMA 2GJ6B 1T4KA 2XTLA 3D85D 3S4SA 3V4UL 1AI1H 3CH8A 5E4IA 3WLBA 4UT7H 5IB5B 1LILA 4X5LA 1U8KB 4LASL 3PNWB 4K3EH 3D2UA 1CK0H 3SBWC 1PQZA 5DVOA 4ZSOE 4F57L 4WFED 1IC4L 3WXVH 1H15A 1MCHA 1MIML 5H2BA 3V0WL 2FBJH 1DSFL 2FO1A 1MCWW 2X4UA 3GBMH 4M9PA 3BD3A 2FH8A 1M7IA 4LCIH 5IFHL 4QLRA 5DLMH 4Z95H 4L29B 3O4OB 1JPSL 3VFPA 3S97C 2XICA 2AJXH 1OWWA 3T0EC 4OSUL 4PRPE 3LPWA 1CCZA 1A3LL 4FFWC 1MCPL 2Z8WC 2AJUH 4ZG1A 1EHLH 4OV6F 3CVHL 2HG5B 2ZUWA 5F7UA 3F58H 4HDIA 2YPVH 3H9HB 4OZIA 1PVHA 4TOYL 5CZVL 4OTXH 3QXWA 1YUHB 3WCYA 2DQJH 2G9HA 4JCLA 4ZUTB 1WCQA 4DVRH 1DBKL 4X9FA 5E6IB 4CDHA 4N0FA 2ATPB 4QHLB 4MS8C 5DK0B 2JTDA 3PJSA 1FYTA 3E6HB 1MWAH 4JREB 4Y16C 3DRQA 3IRPX 3KHOA 1EV2E 3QIBB 2EIZA 2QSTA 3TNNB 1A6VL 3VH8B 3IFOB 1TTGA 2LVCA 4WENB 4EI5D 1QRKA 4F7CA 2ZUUA 4YFLI 4YJZL 4GAJL 4GXVH 3K3QA 3X12A 1P7QA 3K46A 2VABA 3BP6B 1HKFA 2FJGA 3T4AB 1VKXA 3I2CH 1MOEA 1MJJA 1T7WA 2F53B 3CDGB 5DMYA 3T2PA 2B4CH 5ID1B 1DANT 1FNGB 2HJKA 4FTVA 5IMMB 4OFVA 3GRWH 2X4TA 4M6AA 5IF0B 1AGFB 1UKSA 1BQHA 2NYYD 2NTSP 1INDL 4X7SL 4U1JB 4GRWB 4R3SA 1KIPA 2O26U 3UTTA 3RGVC 3OB0K 1TZIA 5DZNA 3CLEL 1FNEB 2PO6A 3C08H 1A7OL 2HH0L 4PRAA 3QJHA 1HXYB 1X6LA 4FQLH 3CVHB 1A2YB 4JRXE 1XIWC 4JPWH 4LCCC 4NYLB 3LQAH 4EDWH 1CICD 2YA1A 5CLTA 4M7KH 5L6YH 4TN9A 4FQ2L 3LKQB 3LEVH 4WU5A 4D8PB 3ECBA 2F19H 1R0AL 4YDIL 5LXGL 2VB5A 4UT9L 1WCBB 4YHIA 1BFTA 4GS7C 1JFQH 15C8L 4JY5L 3O6LL 5A2KH 4D0BA 4ODSH 1FL3B 3M1BA 2IBZY 4F7MB 2J8UE 2BVUA 3O3BA 2O5YL 3O8XC 4YHYC 1DDHB 2AJZA 5DFWH 2RCSH 3UTPE 1KC5L 2NZIA 4APQA 3VRJB 1RZFL 3U6RB 1XGRB 2MJWA 4NFCA 1BIIB 1CVRA 2FD6H 2NY6B 4YQXL 3BPLB 3FCTB 1JV5A 4NQUA 4BZ2H 2VISB 1AKJB 1RIVL 4ZS7L 5I17B 4NSKA 1HI6B 1SEQL 4DFHA 3RP1A 1JK8B 1LO5A 1N8ZA 4S1SL 2BVPB 1HCVA 2X09A 1BM3L 4ZPVA 1DE4B 4JRXD 1W72L 4K7PY 2J3SA 3BP7A 4YXHL 1KJ3H 1TTUA 4OLWH 3OKDA 4HPYH 3P4MB 4XRCA 3LHPH 3T3PE 1XCQB 1ZT4B 1CI5A 2VWEC 5C08E 4ZYKA 5ICXA 4NQSB 5T5FL 1PY4A 4PY8I 5I71B 1JPFA 1BD2B 3P0YH 4OQ1A 1MJ7H 2R69H 5LAXA 3KJ4C 2X1QA 2H8PA 2PYEA 4OM1L 3G5VA 1FSKC 1UACL 3HTLX 1DFBL 2ZWLT 4QYOB 1QSED 3C5SA 3TNMB 3QFDA 5JHLL 1MCSA 2NXZD 3R1GH 3M07A 1NKRA 4HXAL 5HGAA 3EJYC 2F8XC 4NWUL 1JMZA 2Q8AL 5I76B 4OJFL 3UTPD 3HG1A 5DD5L 4HUMB 5CP7B 3ARPA 3CVIL 5I1AB 4AM0A 3WHE0 3QEGH 1DN0A 3NMEA 2H3NA 5I1CH 5T5NF 4E41B 4AL8L 2DIAA 1A1OA 3QIUA 3EJZC 2B7DT 2XG4A 3GK8H 2HFEB 3CSBA 1G7HA 3D3VB 3B9EA 5D7JC 5GZND 1AQKH 1NFDB 5BZWA 2IQ9L 3BT2L 4K3HA 1JGEB 2JJUA 2VKWA 5E8EB 4P23C 4BH7B 1MI5B 4PJIB 4OT1L 1X5XA 4PBVC 3HUJF 3H6JA 3ILQD 3TCLA 3DXAB 1NLDL 3SDAA 4LHUG 3P11H 3V6OE 5LKNA 3N85H 1GSMA 3DVFA 1T7YA 3FN0H 3IJYA 5D8JH 5FFLA 4K94L 4ISVA 4M8VA 3DVNA 4U7KA 1MCRA 4LLUB 1G7MA 2EH7L 5K9JH 5I1KL 3TZVD 5C6WH 1O0VA 4PJ9A 4WI8A 1XR9B 5JQ6L 1YEKL 1T0MA 4HWNA 3MBEC 4NO3B 3TESA 1A1NA 5EBLA 3U7YL 2X4RB 2P5WB 2R39A 1A6ZB 5FGRA 1JZ5A 1A7BA 5TE7H 4UQ2A 5ITFB 3IU4L 4KVNH 3MRFA 4PR5B 3JV5A 1J1OH 1TPXB 1ADQL 3A6OA 4KMTL 1NDMB 1R5WB 4JM2C 1WUNT 3RWDA 1I7UB 4M5YH 3GI8L 1KJMB 3MFFA 3QNXA 4I77L 3SKJH 5IWLA 5EU5B 2Q1EA 4W6YB 1UM4H 3P77A 4ALAL 4NC0B 4E5XB 5DRNA 3MODH 1FN4B 1D5XA 5FO7B 2KZWA 5GQBA 1UENA 4JO4L 5E2VH 3BDYL 4JM2F 5HGDB 4J6RH 2Z31A 4YHMH 1TQCB 3GZKA 5JXAH 4G7VL 4JHBA 1IVLA 4BZ1L 4RAHA 2J88H 4PLKD 1Y6MR 3VA6A 3RWJB 2GFBA 3WBDA 4TSCH 4Z77A 2Y07L 1YA5A 2YSSA 5JW3L 2J5LC 4O02H 3EYVB 2P7TB 5TJWK 3BO8B 3RGHA 3QCVL 1JRHH 3B2UD 5ESVB 2W92A 2EDYA 3V4VL 4CVZA 4POUB 3QAZC 3MV8B 3S6CA 5KSBA 2EDDA 2VZ3A 1S7TB 4GJTB 4PJXE 2FZ3B 2VN4A 4YBHA 3JWOH 2YD5A 4QRQA 1X6NA 4OV5A 5ETUB 5C0RL 1FLTX 1QQDA 3IS0X 4AQ1B 1X5YA 3HE6D 4TRPL 4YNYA 3KPPA 3Q6GH 1QPXA 4OF3A 5GGQL 5AD0B 2IFFH 3QUXC 5EZOL 2VE6A 1FORL 4PP2B 4PJCB 5TE6H 5F96L 2IANB 1JNLH 3LVEA 1BP3B 4Y4FB 1S5HB 5HHOD 5D72L 1GGIL 1QFWL 5ERWB 4CL7A 3STZA 2YMXL 1OAUL 2NR6D 1OAYL 5FUOH 5DUBA 3UBXA 2YWZA 4PGEA 4ZMAT 3VD4A 4JFXA 1T83C 3GGWA 3PABA 1GRWA 1NBQA 1C16A 4KKNA 1D3CA 3M45A 2HTKD 5GS2D 3NIGE 4HEPG 4TTGA 2XRAL 4N8VG 4R97B 2VSCA 5DI8A 4DW2L 2VR9A 2HWZH 4XNZB 5F88B 1XH3A 5SX4H 4L5FH 4HWBL 3ARTA 5T1DH 5BV7C 2EDJA 2X7LA 5M95B 2CKBL 3T77A 2F58H 4JZNA 4HWEL 4ZFZB 1KPUB 1T20B 1D6VL 1FE8H 3VFWB 4G3YH 4C83A 4X7EC 3EZ8A 5GGUB 4NQVA 2DQCH 3EFDL 1QG3A 5E7BA 1EEYB 4R4BA 4KUCF 1GGCH 4WO4D 1A0QL 4JRYB 2F15A 2VNCA 1RUQL 3MRCB 4N0YL 1YJDL 5C0DA 3VD3A 3IFPA 1H8SA 2A0LC 3MNZA 3BH8A 4FQIH 4FQHA 4LBEB 5DHVB 1LEKA 2A77H 3D25A 3BZFB 4RFOL 1WITA 1FFRA 1T1ZA 3VXMA 5FDWA 4V1DB 3ZDXF 1L4IA 4XP6H 5EO0B 1NBVL 4ODVL 3RL2B 2DQFA 1OPGH 5IBUG 5D2NB 1CIDA 5KSUB 2R1YA 2IAMD 3MREB 4ZUSB 4KTYA 1C5BL 3P30H 4ZUUA 4PJFA 3AM8A 2Z93B 1KEML 5ACZA 4DEPB 2E7MA 4KDVA 4WTZG 4HUXA 3U36B 2LU3A 3HRZA 5F1SA 5DFVD 2VDPL 4M7ZC 5DD3H 4Q2ZB 2C9AA 4XNQB 3OKKA 4HPOH 1QYGH 1JPGA 2ESVA 1MNUH 5EZJA 5KVDL 4P9MH 5EULV 5IHZA 5T1KD 4PJDE 3WL9B 1IGIL 4O51B 1X44A 3MRLA 4I2XA 4RNRB 2H9GB 1WVZA 4M3KB 3EO1B 2ZCHL 4LEXL 5HYSA 5BOPA 3WIIL 5CSZB 5BCAA 3VXUA 4X5XB 4BK5A 4AT6B 5SV3A 4FZEH 4JFDA 2QSVA 3PDGA 5F7KC 3WFCL 3TO2B 4LPUA 4J3VA 1F4YL 1HKLL 2DBLH 3EOTH 1QLEH 3BEWA 4J3UA 5CBEA 4KRPD 3E6FA 3G6DL 4WIQA 1AD9B 4OZGF 2VLKB 4G8GA 4JFOA 1NCUA 3DYPA 3VWJA 2VUOA 5F7EL 2C26A 3SDDD 1Z3GH 2X05A 2BHZA 4I8DA 3VXOB 4ODXB 1MUJB 4MCYB 3ZDYE 3BZ4A 1KELL 5DT1L 4CW1A 1CYGA 4PRHE 4I3GA 4JFYA 1OQXA 4JPIB 1DTUA 2F54B 5EUOE 5I30L 1UB6B 3NCJH 3BKYL 3IDGA 3MJGX 3BQUD 4HIIB 2R1WB 4G8FA 3SE3C 2IBZX 3U30B 1VFOA 1WC7B 2W0FA 2FJHA 3KWWB 5I8OH 1P1ZB 2FRGP 1YPZF 2C3HA 4ONHA 1C7TA 1KJ2H 3DX8A 4KKAD 1G7LA 4H1LH 4XPHH 1NCDH 1SM3L 25C8H 3BD5A 2JLLA 5KTEL 3LS4H 2DI7A 4WNQB 3L5HA 3SGKC 4HMDA 1FAIH 3S34H 3BVNA 1L9MA 4IJ3B 4WWKD 5E6YA 43CAA 1YECL 1DQJB 4YHKH 3WIFA 2KPNA 4MXVE 1BOGB 5GRUH 4OGAD 4L4VA 1CGTA 1U0QA 5C0BD 3KPRE 3FN9A 3TN0D 2E7CA 4NQTA 2W60B 4K7PX 1U2HA 1NGWA 4QT5A 2ZPKH 1TCMA 3ZE2F 2XV6B 1ZK9A 2EDNA 3I02B 2IGFH 4PRHD 3LPGA 4D9QD 2OMBA 5ITBL 2RR3A 1P4BH 1QBBA 1WZLA 2ZCKH 3S4SG 1H5BA 5CD5C 2YZ8A 1UZ8B 1NJ9A 1RIUH 5JIKA 4F7EA 3V9FA 3TBTA 4MDIB 2VLLA 3HNTL 3C2AH 3SJVD 3VI4F 2G60L 5BZDA 1SYVB 3C60D 1J0JA 2FX9H 1X5LA 2VR4A 5I1IL 1KN4L 3CAFA 1J9CT 4U7MA 4PRNA 4HUUA 1I9RH 1U58B 5TE4H 2PTUA 2A6DA 3LKRB 1LNUB 3QDAA 3FAXA 2JCCA 4NQDA 1OGAA 3O6MH 2W0PA 1ZT1A 2DKSA 2BK8A 1G1CA 1KIUA 4ZFGH 1E0OB 1AHWB 1A9EA 3QXDA 1JZ4A 5EORL 2CLVB 4M43H 4JLRB 4MMZC 4ZOAA 1TJHL 5EOQL 1WEJL 2CLRB 3FT2B 5IGXL 5HPMA 2AEQH 4GBXB 3WO3B 3K2MC 3I50L 5IM7A 4H8WL 5F7DB 3CFKB 1SBSL 4P4RA 3DI2B 5IJVA 1DLHB 3HC0B 4UDUA 1AGCA 3ZYIA 2OK0L 3O6FC 4NO5A 1S8DB 3KPRD 5A2JH 3QXAB 4ORZC 3WO4B 1BGXL 1CLOL 3DECA 1S7XB 2GSIA 3E2HC 3QUZB 3LCYA 4MJ6A 2A74A 2D9CA 4UAOB 4HBCL 3NN8B 1A7NL 2BY2A 1NCBH 4ODHL 3ARGD 1T89A 1FL5A 1HYRC 2GT9B 1R3KB 1G7PB 1UVQA 5HHXL 1FVCA 4Y19B 1UWXK 1YEHL 5C0IB 3BPOB 4RGNE 2BRRH 3AREA 3OR6B 3QO0A 2X1XR 2CIKB 2GJ6D 1IGTA 4MLSA 2H32H 4TQEH 1OHQA 5D2LE 4NC2B 4PJHA 4S1QL 1OP5H 4DVBB 1CD1B 3BWAA 1WT5A 5H37H 2GJZB 1BQHG 3FMGL 5F89B 4MQTB 5KVMC 1MCBA 3BGAA 4B7LA 2X4OB 4H88H 3BRDA 4X6EB 3EYQD 3W0WB 5IR1B 4J3SA 4LLMB 2BVOB 5JIIA 5I9QC 5ESQB 3EO0B 4X4ME 2W91A 3HE7A 1OM3L 1CLZH 4OLYL 1JMXA 1YNKL 4DAGL 1D6EA 4WFGE 5DJ0A 2P5EB 4JAMB 4X6DB 5E8NB 5DEGB 4YDJA 3GBNL 4Y5YB 2BNRB 5C1MB 4LLDA 3BKMH 5BJTA 5F9JA 5K9QI 4RX4A 1DEDA 4OLZH 3NFNA 3K8MA 3JWDL 5BRZB 4P46A 5GHWH 3RJQB 1JP5A 4Q9CA 3B2VL 4PJBB 4Y4HB 2YPLA 1RUKL 1AQDA 1NGYA 5T3ZH 2B0SH 1AGDA 1TZGH 3G6AA 4BH8A 1IAKA 4ELMB 4QXGH 5F70A 3P9LA 4OZHE 3F6LA 5ADPL 5IT2H 2H32B 4U33A 1I1AB 2VH5H 4MNGB 2PXYA 4FABH 1JI1A 2Z4QB 4ZD3L 2GSGA 4NN6B 5FGCE 4UU9B 5K9KA 3IGAB 4J23A 2ZSVA 2GEEA 4JDTH 1AD0B 1LO2H 3QB7C 1F58H 2F53D 4YGVB 3C6SB 4XBEH 3B5TA 3S37X 3S88H 5MI0C 1HHIA 1M71B 2AQ1A 4XVTH 5DMIL 3L3GA 5FUCE 2NY5C 1NKOA 2YK1L 4BKLB 2V5MA 4WFGD 4PLJD 2QQLH 4KV5E 3BIKA 3KLAB 3OAYH 1JUFA 2P24A 4PB9H 5HHMB 5JA8B 2GUOA 3UPRA 2DIBA 2H26A 4WDIB 3K2UL 3OKOA 5BO1H 3OQ3B 1MFBL 2FECL 1ZOXA 3LKPA 5GGSB 2BSRA 4L8SA 5E5RB 1S7SB 1CWVA 2FX8H 3QUYC 4P2RB 4X99B 3HI6H 3VGBA 1Q9KA 2DD8L 5DMGD 4U3CA 4O4YL 1G6RL 4P5MB 4LLQA 3G6JA 4YC2C 3KYMA 3X3GL 2G75B 4G7YH 4ODUB 3KPNA 4TVPH 1MVUB 2BRQA 4N1EA 5H35A 2A83A 1UM5L 3JV4A 4OGZA 3QRGL 1RJZA 2CH8A 12E8H 1PG7L 2VLJA 3L95A 4GRLA 4NO0B 1AR1D 3E8UL 1MH5B 4WGWB 3JWNC 2IG2L 1IGCH 4IIQB 5D1QB 2DQHL 5C0CB 1IKFH 4QRPA 5HI4C 2ICEB 1VACB 1JHLH 1LHZA 3CH1B 3MOAL 2ZKHH 4G6AD 4MB3A 3MLSH 4HIJB 5MEOB 5DJCB 2NY6D 3C6LB 1FYHB 2BFVH 1HSBB 2YD2A 3TA3A 1OTUD 1AH1A 1CDJA 2C1OB 4JPKL 5EZLB 3VFGH 4F8QA 2IADB 1F13A 2L4OA 3PE9A 4XCCL 3D3VE 2GKIA 1RZ7L 4PUBH 3E3QC 4P57A 1XF1A 4LDOB 1Z0NA 1WZKA 2CRZA 3RIFF 1QBAA 1W2KT 4NM8H 3QNZB 1Q38A 3L7FA 3MJ9A 2R29L 4F3FA 1OP9A 1XGYH 3TJEL 4LNVA 5T1MB 3BI9X 3P0VL 3GJFB 1HDMB 3S98A 5DYOA 4ONGL 2WBJA 3K4AA 5IB1B 1H3WM 3SDCC 4RWHA 3HC4H 3KYKH 1EGJL 3FO0L 4U1MB 4NPYA 3EDDA 3QEHB 3PWPA 3BHBB 3MJ9H 4L1HA 3MV7B 4UUJA 5TDOB 3BWUC 4AY0A 2ADJB 2VXVH 4YE4L 2P5WE 1XF3B 4XNMB 1EJOH 3BXNA 4N0UB 4JO1L 4NQCB 4L4JA 5DD6B 1WJ3A 3WXWH 2OJZH 4JGUA 5GGRA 1EK3A 5D1ZA 1I4FB 2Q76A 2X1PA 4EXKA 5E08L 2B5IB 5DQ9B 2GAZA 1MRDL 4XNYH 4JDVB 1KJVA 4E41D 4Q97A 3HI1A 5CIPH 5CBAB 3D3VD 3D9AH 3CPLA 1Q72L 2E9IA 1DQLH 1NGZA 2C1PA 2VDOH 3GSNA 4I0CC 5C92A 3TIEB 4F58H 4N8VB 4B50A 3L3KB 2VLRA 4XVSL 3SO3B 3MROA 3W81A 5I8EB 1N6VA 2OTPA 4RA3A 4XMPL 1T03L 2DWEB 3SPVB 2HFFB 4UV7H 4KQ4L 3DXAD 4U0RB 4A2LA 3IF1B 1WBZA 3SBWA 2A9NL 5FYKH 4BJLA 1MCOH 3IFLH 3W11D 4HKBA 3O6KL 4DKDC 1FH5H 2OXHA 2DMKA 2V5RA 1ZHKA 1A21A 3DV4B 3U2SA 1WZ1H 2UYLB 3QHFH 5DEZA 1DVFB 2ITDA 3UO1L 4FXGA 5FOBA 1HWHB 2NTFA 4OIIH 2OP4L 5GGTA 3MV8E 3T0EA 2W9EH 2P5WD 1C1EL 2B8OT 1AO7E 1U92B 1YEJH 3U4AA 1JYVA 2AV7A 5DTFB 1JYXA 5JA9A 1AC6A 4CVWA 4POYA 2E27H 1A3RL 5E2WH 1UQSB 1T3FA 5EBWA 4GKSB 5B8CB 3T3ME 4Z7WB 4JFZL 4FQCH 1UJ3B 2V6HA 4MHHG 2C7UA 4NWTL 1DUZB 4OAWA 1FZMB 4U6XA 5GGTH 2PNDA 4N8CH 3UBXG 2APVA 4PJCE 2IANE 4RISH 1MF2H 4Z7NE 4Y16A 3IT8D 1BHGA 3QI9B 3QPXL 3CXDL 1NAKL 3VRIB 4XHJD 5BS0A 4I0PC 1FJ1B 5IIEB 1UC6A 5GSRB 5DJDA 1Z6JT 2V17L 4F33B 1BFOB 4M7JH 2NYYC 5BVPL 3SY0A 2BNUB 4D2NA 3B6SB 3U0WL 3NA4A 3V2AR 3JV6B 1IFHH 3BDBA 2JELL 5C3LD 2EO1A 3PWNB 1U8IA 5HDQH 1IAOB 5EWIH 5KS9E 5EFIB 1N3NA 1ZANH 5ESAB 3FQXA 3C8KA 2CDFA 1AI1L 1LEIA 2HLAA 1CICC 3MV8D 3OJDA 4YHNA 3TPKA 4HZLB 4NKDA 2QQKH 3CUPA 2Q86B 3RGVA 1NDGB 3WXVL 4OF8A 1B0GB 5CEZL 3UX9B 1P7HL 2FBJL 4OZ4B 4L8CB 4N9OB 1X4XA 3GBML 5J12C 2DKUA 1EO5A 1SJXA 1XIWA 4LCCA 4XT1C 4Z95L 5DLML 3NCCB 1TETL 3PHOA 4N5ED 4KKLC 4JFEB 2MQ0A 2BXZA 1CFTB 4R7NB 3NIFE 2IAND 3LSOB 3THMH 4V1DE 3U82B 1KPRB 4MA1C 4ZUWA 4WUUB 4XPFL 1ZLSH 4Y4FD 2F8OA 1F2QA 1XGUB 1QSFB 2XTJB 3DSNA 1J0HA 5J6HA 4YFEA 5D2NE 4IOSD 1U8OB 1X3DA 4OTXL 1LEGB 3DVGB 2DQJL 3SO5A 3TJHD 5D7KE 4QRSB 1KIQA 5GS0L 1L7IH 4A6YH 3A67H 2CJUH 1AXTL 5F97E 1MWAL 3O8XA 5HYSG 1C5DA 2QHRH 2VXQL 2RBLA 1JWUB 3CU7A 3D69A 1F6AA 3KPSE 3WEXB 1Q1JH 3EOYG 3OBAA 1FPTH 1RMFH 3UTZB 1E6JL 4L9LC 3QG7H 3VXSA 3I2CL 4KU1A 2Y7QA 3CSYA 3REVB 2IPTH 3ORJA 4LF3A 3J7HA 2IPKB 3VDCA 4G5ZH 2P8PB 2AKRA 4JFHD 2G2RB 1NCWH 4RBPK 5IB3B 4JZJC 4L4TB 1GAFH 4LCUB 2VLKE 5IV2A 4KPHH 4YDKH 3O4LB 2NXZC 4HX1A 2YD9A 1FZOB 1RZ8B 1YZZA 2EDRA 1T4KB 3S4SB 3SKMB 1F11B 4V1DD 3C08L 4H1LG 3WLBB 4FP8H 3D2UB 1MFDH 1PQZB 4FQLL 1X5JA 3N06B 1GGUA 4K3JL 5EU6A 1H15B 4EDWL 5D7KD 5H2BB 1N0LA 3NFSH 2F54E 1A14L 2X4UB 3STLA 4A6YB 2J8UF 3BMVA 3LEVL 5IQ7H 2AEPL 3VD5A 1M7IB 1MCKA 2HRLA 1UT9A 4KFZC 4HH9A 1VADA 1OAXL 3I9GL 1H3VA 2HN7A 5TQ0H 4NFDA 1ZLVH 2B2XL 4P2YA 5TGBB 4L3CA 4HDIB 2ATKB 1MAKA 4JHWH 3X3FH 1HSAB 3HUJA 2BERA 4U4BA 4U1SA 4Q6YA 4G42B 4KK6D 4XP4H 5D7JA 3LD8C 2Q20A 1T7XA 5ANME 2E8ZA 4JR9L 1U91A 3WIHH 3DHMA 1JWSA 5JORA 3PJSB 1FYTB 2FD6L 2V5YA 3DRQB 1NFIA 3TZVC 4P23A 2VLKD 2EIZB 5EOCL 2EZ0C 2ZUSA 4BZ2L 4QRRA 3T3PF 4GQ9L 4D0DA 2EE6A 3QCUH 5ALBL 4QGYA 3ZKSD 2AGJH 3MRMB 4F7CB 4QOKE 2R2EB 4WEUD 4WFFE 4HJJH 1G7JA 2DJUA 2AK4A 5IFJB 3X12B 3MRJA 1U8JA 4LVOB 1P7QB 2UZXB 2VABB 4PGZA 2FJGB 3JTTA 2CMRH 1MJJB 1DLFH 1MCJA 4Y89A 4RGOL 1KJ3L 4OLWL 5DQDH 2EKSA 2HJKB 4FTVB 2F54D 5I1DA 5DJ2A 1NMAH 3MBEA 5D96C 1BQHB 1HYSD 1WFOA 3UXFA 3MRGB 2R69L 4R3SB 3JV0A 3D18A 1FL6B 4X4YA 5IBLD 1HHHA 4AQOA 1GOGA 1TZIB 4JM2A 2PO6B 1MCQA 5FK9B 3RL1A 1JGLH 1Y0LA 4M3JA 1WWWX 1UEYA 2I60H 2D7NA 4PLKC 4PRAB 3QJHB 5DHXB 3VGAC 3O3UN 4IOFC 2E7LC 5GJSH 3OKNB 3V6OC 1BJ1H 2CUHA 2GITA 2WIIA 4WU5B 1ED3A 3ECBB 3DMMB 3LS5H 3QEGL 3DWTA 1B0WA 4K7FA 3B2UC 1UCBH 4WFHD 5E94A 5I1CL 5CJXC 4YHIB 3RVVC 3NPZB 5H37G 2W65B 2WUCL 2DBJA 1BVKA 5BVJA 5KAQG 1TJGH 1P53A 2A6KA 5IB2A 4D0BB 4WFFD 3M1BB 3BIAX 2NLJA 5FYJE 1CT8A 3O3BB 5MP6H 1TNMA 4WEMB 5EN2A 4LCWE 3B83A 5FYLL 3NOIA 3OSKA 4EQ3A 5KN5A 1JZ3A 5F7NC 4H8WC 2EYSA 5D1XC 1GOFA 4APQB 1NH6A 5E1AB 2F5BH 4JRWA 4MNHA 4JANB 1U41A 3HC3L 4PBXA 2X70A 4Y19E 1JV5B 3FN0L 4PJEF 4RRPA 5I74B 2QSCH 5LGKA 1BBDH 2AP2A 4LVEA 1BFSA 4NC1E 3P4OA 4NSKB 5K9JL 2Q7NA 3RY5A 4M1GH 1J0IA 2NR6C 4X8JB 5DJXA 4Y8DC 4JKMA 4AJ0A 2DQGL 5I8CA 2CR3A 2XWBA 3QUXA 1YEIH 4ZPVB 3W0WE 1CL7I 3CCHA 5TE7L 2EDKA 3OKDB 1S9XA 3DUSA 4GBXD 2HT2D 3OHXA 1MLBA 1J1OL 2C5DC 3H42H 4XC1H 2HVJA 2WIMA 3BUTA 4ZYKB 5ICXB 4CJ0A 4NRYA 5CILH 3GDBA 4MQ7A 3HLAA 2ZOLA 4U1IA 4M5YL 2P5EE 5LAXB 1MAMH 4X6DE 1T83A 3SKNA 4BSJA 2H8PB 3FT3A 3G5VB 3IXAA 2XZAH 4M93B 4PREA 4GAYA 2BNRE 1KEGH 4NQEE 8FABA 4RGMC 2WWMD 4LFHD 3QFDB 3FTGA 4XP9H 4Q9RH 4UNUA 5E2VL 5HGAB 5FYJD 1GCFA 3QHTC 3QUZD 1GC1H 5ALCH 3HG1B 1UB5A 2A9ML 2AQ3A 2Y6SD 2YD6A 5C9KA 4AM0B 3VDBA 3DO7A 3G5ZA 4JPVL 4PJXF 4Y19D 2H3NB 1A1OB 1ZVSB 5GJTH 2VOTA 4PYGA 2YUVA 4U6HA 4KRNA 4GG6B 1G7HB 2OXGA 2ZG2A 2IAMC 1E4WL 3FFCE 5ISZA 1OT1A 1FZJB 4WHCA 3ARFC 5DFVC 1HOCB 3W0WD 4F8TA 5C07A 4MXQD 3ULSA 3L3JA 3JWOL 4UOJA 4HUKB 4HGWB 2P46B 4X98A 3TCLB 5I15H 2DLIA 3OZ9H 3SDAB 1IGYB 2D4DA 3QO1A 2Q6WB 2VDQH 1XGPB 3QISA 1J5OH 4X9IA 3RX7A 2FEDD 3IJYB 4PGDB 2P5ED 4MWFB 2XY1A 3DVNB 4IMLA 1I85C 3N1MC 1G7MB 2AXGA 1WTLA 2BNRD 5TE6L 4PJ9B 4NQED 3RA7L 3NIGF 2ZNXA 3O2VH 5C0JA 4XVJL 5IMLA 3REWB 3GJEA 2D0GA 4K2UH 4HUWB 4UQ2B 4KRPC 1XCTA 2P49B 4OZGA 3MRFB 5BRZD 4WW2B 1AR2A 3KPLA 3PWUA 4Y4HD 3RWDB 4OBSA 2MMXA 4M8QA 3X13A 1CLCA 1IM9B 3H9YA 3TEUA 3PGDA 4G8IB 3VU2A 2MKWA 5AZEL 5T3ZE 5TF1H 2AW2A 3MFFB 1EBPA 1T80A 4KTEL 5GRYA 2W9DL 2VKXA 3QNXB 3BAEH 4LPTA 1I1AD 3S35L 3Q5OA 2R23A 5DRNB 3FFCD 1E6OH 1KB9K 3M8OL 4KK5C 4YZFE 1HZHH 3SGEI 2F58L 2OQJA 4OD2A 2Z31B 4MA8L 5JPMB 4G3YL 2OI9C 4MD5A 4NZUH 4P2CG 3RU8L 2GFBB 4XTRD 4HJGA 4MQSB 3OF6A 2FGWH 1X5AA 1JTOA 3FONA 5IW6A 2YSSB 3A0OA 2NX5A 4HCRA 3OAYK 4FQIL 4DN3H 1N26A 1YPZA 2EEBA 2A77L 5HHMD 3EFFB 1RHHA 1ES0B 4R7DB 4CVZB 4KKAC 4RDQG 1VENA 1ONQA 1CZ8H 2V2WA 3DYMA 3G5YA 4P5KA 5KSBB 4QNPE 3SE3A 2DOCA 5EU3B 5ID0A 4PJDF 1ZLUK 1EFXA 5CS7A 3P30L 4P2RD 5A2LH 2I5YL 3V8CA 1OF2A 2B1AH 3OV6A 4N5UA 4WWKC 5E8DL 4QRQB 5HD8D 1QQDB 3NABH 3VD9A 4BUGA 5DD3L 4OGAC 2IWGA 4ZS6C 4YNYB 4XP4L 3KPPB 3TN0C 3B8YA 3EW3B 4MB4A 4P9ML 1RUAH 3QZWA 3Q1SL 4TVPE 2ZOKA 2X89A 3SE8L 3SGKA 2W07A 4D0CA 1F45A 1I3RB 1JE6A 4C54A 4NO0D 1P5UA 3H3PH 5D5ME 4UINH 3HNVH 4AG4H 3U4BH 1LDPH 3JSSA 3STZB 2OX5A 4NQCE 4FZEL 5DUBB 3UBXB 3C60C 3PABB 3ZDYF 2R56H 1ERNA 1C16B 3C6LD 4W4OC 1TZHA 1MAJA 2DBLL 4OF0A 1QLEL 3MUGA 1IT9L 1IGMH 4LDLB 1KTRL 2EDWA 5DI8B 4XPBL 4WW1B 5TF0A 3TYFA 4ZO7A 4XVUC 5EUOF 1XH3B 3P40A 5CD3A 2X7LB 3UC0H 3P4NA 3LV3A 3QSKB 4K8RH 4JZNB 4UNTA 1KNOA 2HKFH 2X4NB 4C83B 2LTQB 1CVSC 4MX7A 1W8OA 1D7FA 5DXWA 2NZ9D 4H26A 4R4BB 3FB7A 5D71H 4EZMA 1G1YA 1OGTA 1JF5A 1NMBH 4MXWL 4PS4H 1U3HC 2VJXA 2BDNL 5CCKH 3MLWL 3T0DA 2YD7A 2Y9RT 5FB8A 1GZQA 5I75C 4FQHB 4AYFA 5HGGS 3V52H 1LEKB 3D25B 4TVPD 4BFIA 4IDJL 3MCLL 4NJ9H 1T1ZB 3HMXA 4MJIA 3MV7D 2WV3A 1G7IA 2DQFB 4OUUB 3TFKC 4MXVF 2R1YB 3ARGC 1KV3A 3QWRA 3TBVA 3O6FA 1KB9J 3LH2L 4NQCD 4TUOA 4ZUUB 4PD4K 4PJFB 1NCDL 4OIBA 25C8L 5ACZB 4OLUL 2RB8A 1GL4B 4LLVA 4HUXB 1EX0A 3LS4L 3CFIC 2BMKA 3MRBB 4Z7WE 1RZKL 5HHVL 3OKKB 4P2OC 2X4PA 5LBSL 1JPGB 2CRYA 2ESVB 3SN6N 1A5FL 4K07A 5EZJB 4YHKL 1WWCA 5IHZB 1JVKA 5EB9A 1NAMA 1MELA 2L0DA 1UEMA 2KL6A 3MRLB 4I2XB 1J1XH 5FYJU 3EYQC 3F12A 5F9WC 2BJML 5HYSB 2ZPKL 5HYJE 3VXUB 4NDMB 4P9HL 1HHKA 1LP9E 2X40A 1T2JA 1H8OA 3NFPA 4JFDB 4ZAKB 4M62H 3H0TA 3O4OC 2GIYA 1RIUL 3LOWA 3RTQB 3BEWB 1RHFA 1MJUL 4RMVA 4G8GB 5L9DH 4K7PH 4Z7VB 3VFUB 4CVXA 3VWJB 1I9RL 1FRGH 3HNSH 1NUGA 2MCPH 1H3PH 1U8PA 1OAZH 3BZ4B 1RZJH 2YUXA 1DBJH 4OCWH 3GSWA 5B22A 3VXPB 4ZFGL 3OG4B 4PRDA 1JBJA 4JFYB 2A1WL 4PTTA 3KXFE 3DNKA 1ACZA 2GHWB 1N6UA 2AEQL 2Z8SA 1IAII 4Z6AT 4RGNC 1I75A 2ED8A 1I8KA 3MLUH 3N1QC 1JWMA 2FCBA 3IDGB 3LAFA 4G8FB 2CIIA 5FHAH 1LO0L 2Y72A 5EO1A 2W0FB 2FJHB 3CDYA 3TBWB 1QSFE 3PDOB 3QI9D 2VLME 4RAVA 1MFCL 5JR1H 1O7VA 4X7TA 4ZXBD 3F8UB 4ONHB 3DX8B 2QV2A 4KQ3H 1BQSA 2ZNWA 5D2LF 5I16A 1ITBB 3RWFA 1INEH 5IG7A 3RVUC 1GIGH 4CN6A 2XPGA 4PLJC 3A6BL 1F4XH 3QP3A 2YR3A 3HPJA 2VC2H 1MPAL 5E8OA 5J06A 3BVNB 5J4MA 3FB8A 3ZT7A 5MENA 1QHOA 4B5EA 2ADFH 1AJ7H 5C2BH 3WIFB 4LQ1A 1QO3A 3ALWA 5DZLA 4L4VB 1A47A 2DN7A 1NBZA 1CGXA 4Z0BL 1NGWB 4QT5B 3FFDA 4AZ8A 1RUMH 1MREH 1ZEAH 1I8MB 4H88L 4Q7DA 3RWCA 1A6WL 3MRIA 1PZ5A 3MV9A 4JE4B 1H5BB 4LVHC 3KXFD 4U2YA 4F7EB 2DMCA 2VLLB 4U1HB 3LEYH 3EUUA 4PD4J 3RWIA 3GHEH 4WCYL 2BSTA 5D6CB 3QUYA 3C87A 2CGRH 3RVXD 4JFED 4FQXC 2WMPA 4YDLC 1T66C 4UT6H 4PRNB 4HUUB 1PG7W 3HZMA 4OCSH 5T5NG 5MEPA 4WUUD 2B4CC 2XTJD 1QSFD 2UUDH 3DUHA 4P5TC 1AIFA 2JCCB 2VLMD 2VL4A 5E9DA 3S5LA 4NQDB 1OGAB 2DTMH 3MRDB 5AG8A 2N7AA 1ZT1B 2BCKA 3BKML 3WV0A 4HBQA 4OZHF 2HVKA 5FUCC 1VFMA 5KBNC 3QXDB 4OQTA 2V2XA 3ULVD 1MSPA 5HPMB 4RZCB 5GHWL 4HK0B 5AUMB 4XZUA 3OB8A 4KK9D 3D39A 4ZNCD 1KBGL 1LK3L 1TZGL 5CINH 5C0GB 4NP4H 4UDUB 1AGCB 3EHBD 5IKCA 2D7TH 4QXGL 5DRZA 4NO5B 4RIRA 4HF5H 3TV3L 5IT2L 5KSVA 4FABL 3LQAC 3C5JA 3NCMA 2XZCH 4KV5F 4JDTL 2GSIB 1R3HB 3IDUA 4G6MH 3WE6B 4XBEL 5I71C 1Y18A 2A74B 4HIHB 3S88L 4NZTH 4OZFH 1ULVA 5F6HI 3R8BB 5FKAA 5DVNA 4EIZC 2Y5EA 1ITCA 3O2DH 5LQBH 2QLVB 4L4TD 3UZEA 5L8JB 1UVQB 1I3UA 3L1OH 3TH2T 2D3VA 2R2BA 5FCSH 2BY1A 1E27A 4WI3A 3AREB 3QDMA 1IGTB 1MFEL 5IROC 1L7TH 5E2UH 3JZ7A 3HI5H 5AWNH 3BWAB 3WFEH 1HQRB 2PTTB 3S37H 3SDCA 3N1PC 3VXRB 3RPKA 1SMAA 3QDGB 5JO5A 4I13B 3D2UD 5BO1L 3OX8A 2EIBA 4FFVD 2OL3B 3INUL 3MACH 3PWLA 1KLFA 3GI9H 3BRGC 5J1AA 2ZJSH 2GK2A 2W0LA 4HK3N 4BM7A 5BQ7A 4W68A 5J3HD 4POZD 5J6GA 3MYZA 3DGGB 5DJ0B 3KPOA 3WUWB 1IC7L 4X5WA 1U8MA 4YDJB 4OLXL 1ZLVK 4LLYA 3TH3T 3EDEA 5HVGB 4CU8A 5DQJA 1AE6H 5CKGA 2EC8A 2DLFH 2WNGA 5FM8A 1JNNH 4LLDB 1MCEA 4GMTH 1CN4A 5F9JB 1A4KA 1IKFL 3F7PC 4DK3A 5HYEA 1YYMH 3NFNB 3MLSL 1FYTD 4PGCA 4XAKE 5F1IB 3J8F7 4DCQB 3RY4A 2BFVL 2YPLB 3G6AB 5BXFA 4BH8B 1IAKB 4U6TA 3P9LB 5JW4M 4Z8FH 1DJSA 4FA8A 2PF6A 2PXYB 5L88H 2GSGB 1CFNA 1U93A 1JTPA 5K9KB 1PKQA 1J8HE 4LIQH 4K9EH 2GYSA 5I1LA 4XPTH 3ROOA 4EUPA 4FTVD 3HHRB 5J11B 1G9NH 1HHIB 3DETD 2HKHL 3C9NA 5GGSY 4KROB 5FO8A 4FFZH 1KFAH 1W0WA 2KQMA 2NY0C 4U1GC 5EU7E 1ZLWH 1WQVT 3KYKL 4XHJC 1JUFB 1K3IA 1PSKH 2P24B 3AFLA 2WUBH 1I7RA 1RULH 2GUOB 3MJ9L 3FQTA 2H26B 3OKOB 4K3DH 2DLHA 3LKPB 2BSRB 1CFSA 1EJOL 4L8SB 4NJAL 1NMCB 4ZSOA 4AH2A 1MEXH 1DEEA 4OUOA 4DN4H 5C8JB 4N0CD 4ELKB 2VZOA 2OJZL 4MLIA 3QUKA 4NRXA 1QNZH 1VFBA 3DMMD 3I6KA 4KJPD 3AU1A 4I0PA 1Q9KB 5I1HH 5IEHA 4QHKI 2FATH 5GSVA 4LLQB 3MMEA 3G6JB 4JEGB 3KYMB 3RNKA 1JYNA 3KPNB 4WI4A 1FDLH 4PRPA 2A83B 5H35B 3JV4B 1DQLL 3VGDA 3TPUA 4HC1H 1EO8L 3OGCA 1RJZB 2E9BA 3RHWF 4GRLB 2VLJB 3KYNA 1J8HD 1RZIA 3MC0A 4KI5E 4F58L 1MJ8H 3RY6C 4Y88A 1MCNA 4F7PB 4ZFFA 3V0VA 4YXLH 4APQD 1CICA 2DWDA 3RAJH 1T2QH 3ZYOA 1VGKA 4N0RA 1GPOL 5DC4B 4U1NB 5FYKL 5B3NA 1RI8A