4U7KA

Crystal structure of the clostridium histolyticum colh collagenase polycystic kidney disease-like domain 2a in the presence of calcium at 1.9 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
b'NSLPYGKINGTYKGTEKEKIKFSSEGSFDPDGKIVSYEWDFGDGNKSNEENPEHSYDKVGTYTVKLKVTDDKGESSVSTTTAEIKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ColH protein
molecule tags Hydrolase
source organism Clostridium histolyticum
publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
total genus 18
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u7kA00
1JPFA 4ALAL 4AJ0A 3O0RH 5KSVA 3L5XL 4G6FD 1P4IL 4UV4H 4PGZA 5H2BA 1Q94B 2GSGA 3HE6C 1YEIH 1BZ7A 2V9QA 4I3SH 2NR6D 4RGMC 3MRIA 3NPZB 4YDKH 4XPFH 3UEZA 3G08B 1ZEAH 2MSPA 1EERB 5B39A 4X9HA 4TTDC 5EFIB 2Q7YA 3BO8B 5I16A 4YHZH 1S78D 3O2DH 1M4KA 1UH3A 1RK0A 1FORL 2GT9B 4LLUA 3QIBA 3HZVB 3VFUB 4WCYL 1B0WA 1AGEA 3Q2CA 2WP3T 1I9JH 3PP4H 4XNQA 1HN1A 4WGVB 4CADB 4FABH 4X4ME 5FGBC 4P2QE 1AKJB 1IRAY 3DYPA 2PTTA 1OM3L 2VDKH 1VCAA 2XZQL 5DJAB 2VH5H 4YFLI 5EU6D 2YKLL 3BVNB 4UDTB 1HHKA 1OSZB 2H32A 4I77L 1QEWA 3S35L 4XCNB 1P7KA 1WZKA 1EV2E 4NFBA 4LCCA 4NKDA 4RISL 3EOBB 4ZPTA 2VXQL 1MJ8H 4U1HA 2O26U 1PLGL 4ONGH 3ZKSD 4NN5C 1MIEH 4WHYH 2VDNH 5IMMB 1AGDB 5KVFL 4JO2H 1N64L 4LRNL 5D93C 4KUZL 5HHNB 1B4JL 1OTUC 3ZKXC 3QA3A 1J5OH 1UQSA 4JFYB 3WIIH 3GMRB 2AGJH 3IKCA 3VXSB 2YOCA 5IB4B 3UCRA 2R0ZH 5ICZB 5IT2L 3IDIA 3MREA 1E6OL 4U4BA 4OAWB 2FX8H 2CUHA 4IJ3B 1X4YA 2OTUB 2DL2A 2VLJD 5CBEA 3SE8H 4JPWL 3ZE1E 5KS9E 1FFNB 1JGEA 3QXAA 3TVMD 1G0XA 4KK9D 5CJOH 3BIKA 2RGSA 2XOTA 4YHIA 3KPQB 4PJGA 1FCGA 2GEEA 1MFEH 4X6CF 3OAUL 5H94B 2AI0L 4PJGF 4ZS6C 5GRUH 1JBJA 3FQUA 4I3RL 3P4OA 2JCCB 5C0IB 1FL3B 1E6JL 3LEVH 4OM0H 4NZUH 4P2OD 1J86A 1IEAA 1WBXA 1N26A 3W9EB 1H0DA 1KLGA 3SDAA 1AD0A 4Y2DB 1AGFA 1P4BL 1Q9OA 4XBGB 5I19L 4XWOD 5GGVY 2V5YA 2KH2B 2D7QA 4JJ5A 5D7IE 1FORH 1P5UA 3S88L 1Z0MA 3FO9A 3QNYA 5T1MA 4JFQA 2QSCL 5FYKE 2EXYD 3DTXB 4PRAB 1C5CL 1V05A 3ARGD 3GMPB 3MGOA 4FN0A 1FG2A 3VWKB 3LQAC 1LD9A 3MLTA 1TVHA 5K9QG 1AFVL 3UTTB 3DJ9A 3CDYA 2VAAB 5CHNB 3BH8A 1QSZA 2UWEB 2AKRA 1JZ8A 3CVIL 2YKLH 1D6VL 5EOCL 4KAQH 2V2XB 4M43H 2XWBB 1KG0B 3L5WA 3OG4B 1FN4A 5I76B 2VITA 4OZHA 5IG7B 1KPUA 1KCSL 4L4VB 2NX5A 1HXYA 3UDWA 4JFEB 4P2RD 2X1PA 5DRNB 1HSAB 2QR0B 1MAML 5FYLH 3BMWA 3VD5A 3H42H 4PY7B 3UDWC 3BEWA 2PKDA 4M7KH 2EKJA 4MSWB 5FEBA 4GUPA 3MXWH 1QLRA 2FATL 4PP1C 2R0ZL 5IT2H 3RVVD 3VXPA 3RJQB 4OCRL 4H25B 3GSNL 1N2RB 1WCQA 5E2VL 3KNBB 3EGSA 3RWHA 3FFDB 4M7LT 2OR7A 2CXGA 1ZXQA 2IFFL 2YWZA 4Q0XL 4O00A 5IK3A 1Q9LB 3ESUF 1OSPL 4YBQD 3EKCA 3U1SL 2BNQA 3V6BR 2X4TB 3WS6C 3CDCA 4XBPA 4NOFA 3BHBB 5GRUL 3GI9H 3L6FB 3MV9A 2R4RL 1FH5L 5B39B 5JTWA 2Z31D 4PV8B 3DRTB 2DQCL 3BP5A 1WEJH 4MWFB 1YEDA 3KLHD 1UEYA 5DEFB 3INUH 3FO2B 1ORQA 2UZIL 3THML 4JGUA 3NABH 4YR6A 3H0TA 5I1IH 3DX6B 3T3PE 5CILL 4U2YA 1J8HE 3WFDL 2GJZB 5DT1L 5HHXL 4NN5B 1QHOA 5E8PA 1KEMH 5AYUH 1P7QA 2OS7A 1CFVL 3HLAA 3VE0B 2AJ3B 5C92A 5HGHA 3X12A 1G9EA 5DJXB 1RMFL 1VFBB 2EE2A 4HLZH 2FL5B 4TVPL 2M1KA 5SWSD 3R06B 5D6DC 1QVOA 2JB5L 5CLWA 1UM6H 5T1LA 5CJ5A 1N6UA 3AXLB 2ENSA 2ICWJ 3EYFB 4EOWL 3VGDA 5TFSL 1CDCA 5FYJU 3U0TB 5IMMA 3S37L 4QOKD 4FQ2L 3F6IA 2VXSH 3JSSA 4XMKL 1NBVL 3JTTB 4Q2ZB 5E4IA 5EC1A 5LXGH 3FZUD 2YPVL 3NH7L 5DUML 5EO1A 2MQ3A 4OAWA 3UTQA 3FQXA 4M48L 3VRIA 1LO0L 4N8VB 3WKML 1YMME 2NPLX 5DVNA 2V7HB 5EU5A 5C08A 4NZDA 3VFSA 2NXYC 3W0WA 4M5ZH 4RGMB 2LVEA 3DSNA 1MI5D 4NRZB 4Y7MA 4QRRB 5D7LD 4FQQA 1D5XA 4L8BA 2E6PA 4PJ9B 3JVGA 1DCLA 1WBZB 4QRRE 3P3YA 4RZCA 2IF7A 2VN4A 1XGYH 3L3IA 5JUEL 2CRMA 5DZLA 3HMXH 1QYGH 4R0LC 4F57L 4F8TA 4F37F 5EBLB 3MV9E 4QF1A 3KYKH 3KYMA 1S78C 5IM7A 3OAZK 3C08L 3BWAA 3KR3H 4YHLH 4KKLC 4HIXL 4PJAA 3ZTNH 3MSPA 2R4RH 5DD5H 1FH5H 1BAFH 5FOBB 3LMJL 2Q7NA 5KVGL 4OZIA 4GRLC 3D85D 2FJFA 3CDGA 4OI8A 3LHPL 1NDMB 1MNUL 1JN6A 3RWIB 2NW2A 3BP6A 1GGBL 3GK8L 1A7RL 1OT1A 3QQ4B 1LMKA 1NUFA 1HCFX 2HJKA 3WFDH 5F1OB 5E9DA 3VW3L 3QCTH 4H1LA 1I8MB 4D8PB 1EO5A 4JO1H 5FYLD 1BJ1J 3W0WD 3LEXB 2VXTL 2AXHA 3QUML 2DBLH 3H7BA 3MRCA 1DBKL 5C6TH 2XWBA 3L5WB 3BYYA 1T22B 2ZCKH 1KULA 4LLYA 2LU3A 3UJTH 3IAPA 3VGHA 3T3ME 3VFOB 3UTTD 1URLA 4P5KA 2PUQT 4XC1L 4KRPB 3WE6B 4XPHL 5MEQB 3O8XB 4GW1A 2VDOH 1D9KC 3S37H 3KPNB 5HGDA 1ZVSA 12E8L 4M7JH 4M5YL 3B2UD 4JPVH 2AEQH 2VXSL 3SGEH 2KZWA 3FO9B 3BZFA 3IJHA 3B5GA 3AUVA 4OBSA 2ED9A 5I1EH 1QFWH 2P5WB 3MXVH 4JJ5B 4JFQB 4HH8A 5D1XC 1EO7A 4MNHB 2HFTA 3WJJA 2JIXA 1R3LA 3QHFH 2P5EB 4RWHA 3S3PA 2X4SA 4GG8B 3QFJA 2R2CA 3HG1A 5GGSA 3BD5A 5E8EB 2Y7QA 1JWUA 4H0GA 4NQXB 3S98A 3HE7C 3KPOB 4WI8A 1CXFA 4I0CC 1I3RB 2XZCL 3D48R 3FQUB 4YPGA 5C71A 3VXRE 5JDJA 5JUEH 1B9ZA 2NY3B 4EXPX 1FZJB 1C7SA 3LKRA 3SQOH 4LQ1A 4U0RB 5B21A 3C08H 2VABB 1PG7L 5C0AE 4KQ3H 4HD9A 4JHWL 5C0ND 2P7TA 2ADJB 4JZJB 3FFCB 5CJQL 4MJ6B 3P4MB 3PUCA 3VH8G 3WEXA 5EBMA 1FIGL 4FABL 5C7XL 3RIAK 3HZKB 2VIRB 2HJFB 4LGPB 4XNZB 1DN2A 4JM2D 3RNQB 1JNHB 3AS2A 3O3AA 3B2UC 4X7SH 5K93A 1ZLVK 4P5TB 3H9ZA 5GZOC 1MJUH 4N9GA 1JGUL 1XGPB 5F7LB 3OB8A 3DPBA 3MRQB 4F8QA 5EU6E 4J3WA 3D0VA 3N85L 1I9IH 3FRUA 3QNXA 2NZ9D 5BOZG 2X4TA 3VGAB 4DKDC 3EFFA 1NC2B 3VXTB 1ZT4B 5FA4A 5TDPA 1WBYB 2DBLL 3QUMH 2ZSWA 4HGMA 2MHAB 4M93C 2ZCKL 3FB5A 2D7NA 3TFKD 1DP0A 3OKNB 5FO9A 3TYFB 2GJ6E 5IMKA 1NGZA 4P2QD 2AGJL 1U8QB 3QH3B 4GAGL 4GAJL 3UTTE 2B0SL 5GJTL 2VDOL 2DI8A 5IVXF 4JFDE 3G9VA 3SE3A 4XXDB 2H9GB 4HJJH 1TVDA 2HAZA 1YEDB 4D0CA 3DX6A 3H3KA 4JN2A 8CGTA 3D3VD 4JPWH 5FHAL 4NJ9H 2ZCLH 4FTVE 1G9ML 3GIZL 5T3ZH 4U2ZA 2BCKA 5F7HA 1V3KA 1CDHA 4I5BB 4P0DA 1KIRB 2VRAA 2O5YL 3O2VH 4R96B 2AABH 3AS0A 3UTZB 4OBRA 1HI6B 4JKPH 3EYVA 1KV3A 2A6IA 3L3JA 2ZNWA 5DD6B 4ELME 1A0QL 1MLCA 3WHE1 4I4WB 3SDAD 1A6AB 4RFOH 3TH4T 3QUMB 1FV1B 3HI6L 4U6VH 4JFEE 4QNPF 4PGJA 2I60H 1RUAL 2F54E 5IB1A 3H0TB 3TBYA 4NCDA 1DLHA 3EDDA 5DJ8B 5EUKB 1RVFH 2P1YA 4MAUH 4XVSL 3I6GB 4FFYH 3VFRB 3GJFH 4HIEA 5C0FA 1QSFD 4ZFZA 4FZ8H 4K7FB 5L7XL 1YPZE 4JDVA 3DGGB 2R0WL 32C2A 4GMTH 2DMBA 1NCDL 3X12B 3L5XH 5HGHB 3MLZL 4RFEB 1S5HB 3KPSE 5DJZA 3N85H 4JRXE 2C7UB 4MD5B 5C0CE 4X6BB 4IRSC 3ULUE 1DBJL 4XPFL 1BD2B 2DS4A 1IZKA 2CDGB 3OKKB 5HYIA 3HUJA 5HHOE 1IJ9A 1DN0A 3DO3A 5KVMC 4JVPA 5ERWA 4X7EC 3C5ZC 2EEAA 5IROA 1JK8A 4LSRH 1FGVH 4PG2C 4CMHC 2FATH 2JCCE 3MLXL 3RQ3A 1GC1L 15C8H 4RMQA 3CC5A 2OSLB 4YIQB 5E9DD 1YZZA 1XCTA 3O4LB 5E2VH 4KVCL 3LQZA 5KG9A 1NCBH 4GLRI 4LVOC 1C5BL 3GIZH 4LVOB 2P5WD 3T77A 5KS9B 3ES6A 2V5RA 5LKNA 1CDBA 3X17A 5JHLL 3MBED 4UT9L 4K7PX 3HRZB 4O9HL 1S7VA 1PZUB 1XEDA 2XNAA 2Q8AH 1E27A 1LEIB 3D1MC 3ISWA 3DI2B 1FL5B 2QADD 2R69L 3ULSB 3ARXA 2FX7L 3O2WH 4MXQD 1MQ8A 3PIQA 3JTSB 4C58B 1B4JH 3A6CL 5EZLA 2VE6A 3VXOB 4EI6B 3MBXL 3N1GC 2CIIB 4GKZA 4MDJA 3NGBB 5D7LA 3N9GH 1RZKC 4PJ7F 4K3GA 4KDTC 2NY5H 4M3JA 4GXVL 2OP4H 2ARJQ 1KJ2A 4CUCA 1NGXB 3LN5B 1MWAH 2X4SB 4R9HA 3KPSB 3KPOA 2F54B 4PLOB 4QY8A 5FYKH 4HKZA 2A0LD 4GJTB 4RMVA 2W91A 2BXZA 1XGQA 3TN0C 4UUJA 4GMTL 4QHLB 1CL7I 3IJYA 4PJ5D 4M7LH 4OFIA 2MOVA 3V5KA 5FAAA 4ODXA 1U58A 3G04B 3I02A 3D39E 4LBEA 2F9BT 1T0MA 1HQ4B 1JHTB 1SY6A 2D31A 3TYFA 4UV7H 1BM3L 4FFVC 3T1FA 4JRXB 3RAJL 4G9FB 2P7TB 3GSWA 4Z7UA 3CMOH 5D7KE 3TZVD 1CXHA 3GIVA 3WKMH 3WO4B 4DVBA 3IDGB 5F8QC 4WJ5B 1EMTH 3TA3A 2GYSA 4HWBH 4P2QB 1P7QD 3PJSB 5K59E 4KY1L 1T3FB 3MOBH 15C8L 4I5BA 4K3JH 2DLHA 4Q58C 3DBXA 5J3HD 1JGLL 4WEUD 5E2TL 4G8GE 5IVZA 2ID5A 4KROD 2H32B 4F7EB 4N68A 4PBWD 1IC1A 1AO7D 4AG4H 4TNWK 1C5BH 5IF0B 1UM5H 3BZDA 3NCFB 3C6SA 4HV8A 2CSPA 2A1WH 1JWSB 2LABA 2IGFH 1JZ6A 2CJUL 1J0HA 2D4DA 5J9PA 3T4AA 1AGEB 1BAFL 1NGZB 4BH7B 1WF5A 3LMJH 2VABA 1MI5E 3OKNA 4LP4A 2D2OA 1NQBA 5KTEH 4PP1D 4ZQKB 3GNML 5FM5O 2P43B 2NY4B 3A6CH 1OGTB 3IFPB 4R2GB 1U92B 2V17H 3MXWL 5ADPL 3QJHB 3K4DA 2EIEA 1KIQA 2VZVA 4A6YH 4Q6IA 1WZMA 5I17B 3MRQA 2XKSA 3MROA 3QIWC 4BQ9A 3TN0A 1OSPH 3BP4B 3U1SH 1X7QA 2F58L 4WHCA 3BH9A 2APVA 2PW2B 3QUMA 1TTFA 1A6AA 4XGZB 12E8H 1A5FL 3OKKA 3T0EC 3QDGE 4HS3B 5L2JB 1I4FB 1YEJL 1DUYB 4UINL 3SDXE 5IP4A 2FIRT 3FAXA 3NN8A 2YPLE 2ZCHL 4LLUB 4LARH 4PJFF 3FB7A 3KYNA 3ZE1F 1IC4H 3RAJH 1BX2A 1V7NH 4MA7H 4Y4FB 4EXKA 1B6UA 2OZ4H 4DFIA 1QFHA 2QADB 1WT5A 5T3XD 4K7FA 1EMTL 5LWYL 1KEGH 3LDBC 4HIEB 1I7ZB 4HWBL 2QQKH 32C2B 1SJVA 2XKUA 5GGRY 2BVYA 4TYUA 5H94A 4JDVB 1XFPA 2AK4B 1HHKB 1OSZA 1PKQE 5DHVA 3KPMB 1CFVH 2IBBA 5DJAA 1NKRA 4OLEA 4BZ2L 3HC0B 2NX5E 1DSFH 2XTJE 3LRGA 2X4RB 2VZUA 5AZ2L 1FVEA 3NTCL 2RQ8A 5JOPE 3CFJA 4EOWH 2H1PH 3MLUH 4LVNC 1KCVL 1LEGA 4JZNB 4O51A 1WJ3A 4FQ2H 2G60L 2AQ3A 4X9IA 1G6RL 4EQ2A 4QHNB 1G7JA 1EAPB 2DAVA 3EUUA 1KJ2H 1XIWB 1QRNE 5AWNL 4WI5A 4QRPE 4JZOA 3GNMH 4GRMB 1XCTB 1K5NA 4GFTB 4L8SA 5KSAC 1MF2H 3ARFD 1YEGL 4OGZA 4UI2A 1LK3L 4EZMA 4QRUA 1CIDA 4HUVB 4X6DE 3CVHB 1OY3B 4OQTL 5ICXB 1JI2A 4F7TA 5J1SC 2WINA 3DX7B 4Y4FC 3BE1L 4CGTA 4NRYA 1U2HA 1QQDB 4X8JB 3REVA 1GVIA 3U7YH 3MCKB 5EZOL 5D2LB 4PR5B 2VO5A 2NY7H 4QHMA 2CDGA 2EDFA 5D70L 4NO0B 3KR3L 3BKYH 3BP5B 4HKJB 3HI5H 3P11L 1FBIL 3FO2A 3TH2T 5E94B 4YQXL 2IQ9H 4HJJL 5IWLA 1YEJH 4IRJC 5E8NB 3OMZA 2JELL 4ZOEA 2K7PA 3OKLB 2W65B 3O9WA 2BVPA 3UYRH 1UENA 3VGBA 3BRFA 3SHSA 2ZCLL 3DIFB 2VDKL 3LN5A 2X1OA 4PB0H 4MA7L 2DQUL 4U1KB 4GG6E 4GO6B 8FABA 2XQYK 4NQEA 1N59B 1KEGL 4KDWA 3PWPE 3OXRB 4EN3B 5FHBH 5GIRA 1WIUA 3PF2A 5TE4L 3G5ZB 4R2GD 5DD3L 1T20A 3OKDA 2YD4A 4NQVB 2ZP0T 4UT6L 4LIQL 4X4XA 5LVEA 3K74B 4GT7A 1FJ1B 2SEBA 2IPKB 4MWFA 2DF3A 4M9OA 4M7ZB 5EUOF 2HLAB 4NUGL 4R26L 3UXFA 3KLAA 2QR0A 1AY1L 1RZGB 3GGWB 5EC1B 2FHCA 4LSUL 4BSJA 2BHZA 3QISA 4UT7L 2NZIA 4HIJB 4HC1L 1HDMA 4JPVL 5LAXB 2W92A 4HIIB 4N0FA 3STBA 4X6FA 3VI4E 4U33A 2R2HB 2VLMD 3TJHD 1KIQB 3DO7A 4DUWA 4P2QA 5SX4I 2D0HA 4XNMB 5C0DA 3IDGA 1G6VK 2AJ3A 4JO4L 3ORJA 4Z7OF 3RWHB 1INEL 4NDMA 5I75B 4HDIB 2FL5A 4L8BB 1F11B 1KCRH 4F33B 5F1NA 1NCDH 3QRFM 5BRZB 2XA8H 5D1XA 1BECA 4GKOA 3RWJA 3VE0A 3WS3A 4GG6A 2DQHL 4OCWH 2VZTA 4J3TA 2AJZA 2ATKA 4OQTH 3SPVA 1X5HA 3O4OB 4C56A 3EDEA 3SKNA 3T08A 4XXCA 3BH9B 2HT4D 1T0MB 1CD1A 2B5IB 3CGTA 5JW3L 2ESVB 3B2VH 4M02A 2ZUXA 1JWSA 2ZOKB 4EKXA 4GQ9L 5DEFA 1CFNA 5IEKB 4Y89A 4CN1A 4KQ3L 2BNRE 4PJEB 1F90L 1FBIH 5E08H 3Q6FB 1CZ8H 5T3XL 2NY0D 1A6VL 1A9BB 2R23B 5DRZA 3IVKB 3HCVA 4BH8B 5F89B 5DC0A 4RZCB 1I8MA 2VZOA 3IDXH 5I0DA 4TSBH 2EYTA 5AAMA 3KDMA 3JWOH 4KGLA 1LE9A 5DJ2A 1DJSA 1FNSL 5GRYA 3ROOB 3DHJA 3ZTJG 2VQTA 2ITCA 1A6ZA 3GM8A 3HG1D 3CFJB 4QO1A 4LPVA 1N7ML 3ECBA 4PJAB 3IDYB 3MBEC 1J1XH 1F4AA 1KOAA 4Z7VA 5FOBA 4NC1E 3QXDA 4LIQH 5FKAB 3T0AA 1TJHH 1H3TA 4HS6A 3CVHL 2EIBA 1RK1A 4PRIE 2HG5A 1ORSB 4FQXC 2VLJA 4NQSA 3MBXH 4P3CH 2XPGB 5C0JA 5JOFB 1FC1A 1S7WB 2NLJB 2XQYG 5ENWA 1HE7A 1DBMH 4D8PA 1MFBL 5DD1L 5TDOB 4YDIL 3QCUH 3CFKB 5C07E 3U0WL 4IDJH 3TNMB 1MWAL 1G9MH 3CPLA 4PJXE 3SDYH 5C09B 3E6FA 3FL7A 1F58H 2DWEA 3X13A 4YDLB 1K4CA 5IKCB 2NY1B 3VRJA 4ELKB 5E99H 4QRQA 2UWEE 2EYRB 4PTTB 4KKCD 4FTVB 1IGYA 1IGIH 1JNLH 3U0PA 4V1DE 4PFEA 1LEGB 1U3HA 5LQBH 5JPMA 3TT3H 3U46A 3GJEA 2FX9L 1NFDF 1GIGL 1OP5K 4X5LA 1JRHL 4O2EB 2DD8L 4UBDD 2DM4A 4BJLA 1MIMH 2YD1A 3BJ91 4POZD 2XA3A 1J1PL 4U6VL 4GS7C 2FECL 4I0PC 2E5EA 4NUJB 5C6PB 3BSZH 1Y18A 4MQ7B 4CAGA 4GG8A 3QUKA 2YD2A 1R3LB 3P0GB 2V6HA 3EYSL 3T09A 4BFIB 1NCCL 3U48A 3BP6B 4UNTA 3BGFB 3QFJB 1R5VA 3STZB 1KUMA 5ACLA 5CP7A 5FOJA 3MLRH 3EDFA 3KPRE 4IRSD 4RMTA 5KVEH 3SO5A 4PBVC 2EIDA 2XY1A 1FZMA 4NRYB 2WUCL 1BBJA 1U8IA 1B88A 1TCRB 2H2SD 5CBAA 1JZ2A 1CGWA 4DN4L 3JWDH 4K9EL 5L2KA 2BXYA 4LNVA 4XMKH 1IKNC 1OARL 3CD4A 5DQ9A 5DSCA 5KSBE 5C08D 4CMMA 3AU1A 4ZS6D 3RI5K 1TETH 1J8KA 4HKBB 3G6DH 2VDLL 4XPBL 5E8NA 4I18B 2A6DA 3AVEA 4P4KA 1S7XA 4YBLB 4XVJH 3VXMB 4NZJA 3ILQD 5I15L 3HR5A 1I9EA 4ORZC 2MWCA 3QQ3B 1ZLWH 1ZA6A 3ZHLA 3RGVC 2YS4A 4OFDA 1VGEL 4RAVB 3IGAB 4Y4KA 5T1LD 3ETBF 1NCBL 2PO6B 4PRNA 4XHJC 4K7PL 4J3XA 4NKMA 4Y4FD 5SWSA 2RHEA 2W59A 3VFTB 1F58L 4G9DB 4HJGA 1ZS8A 1KPRA 4NO3B 4ZAKB 4NBYB 3PDDA 1JVKA 4EN3A 4ZO9A 2D03L 5J11B 4HGKC 2P8PA 1RK0B 3O45B 2FYYB 2R69H 2EDKA 4OCSL 1NBZB 2RBLA 3BKJH 3EBAA 1EFXA 3PABA 5B4MD 3T0EA 4S1QH 3MACL 4HIJA 2J4WH 3UZEA 3DO7B 3OKOA 3VFWA 1J87A 1YY9D 1QLFB 3DETC 3EZ8A 4KPHL 2XIDA 4KTEL 2P5WE 2NYYD 2P5ED 3BMVA 4JN2B 5DHXB 1YMHA 43CAB 3BVNA 4UDTA 2VXTH 2C1PB 3C5JB 2YA1A 5D9SA 1NAMA 2NXZB 3FN0H 1TXKA 4EN3C 5SWZE 4OF7A 4Z7WE 5ESQB 5DJ6B 2ATPA 3B8YA 4R8WL 3AGVA 2ORBL 4G7YH 3B5HA 2EECA 1P9MC 2AJZB 3F6LA 4X6BA 1D7FA 1MWAB 5F88A 3WS3B 3BW9A 1A47A 3B9VA 5HHNA 4XHJD 2F74A 2UZXB 4Y19D 1KB5H 5DK0A 4G6AC 1HKLH 3GMRA 4Q9QH 4LLVA 3DECA 5HVFB 3TGXA 3QWRD 5C0JB 4PJXA 2EDOA 1A4KA 1JHLH 3P4LA 3MXVL 5LAXA 4JO3H 1HSBB 2R2HA 5ALCH 2QLVB 2ZUQC 3BQUD 5CS7A 1TZHA 5EUKA 2DI7A 4X7DC 5GQBA 3BUTA 1W0YT 1NMAL 4GW5A 4X80H 1R3IL 2CDEB 3O41B 4R7DB 1KENL 2YPLB 2AQ1A 3WNKA 4MLSA 1K4DA 4X0KA 1BOGB 4LSVH 5FGCB 4YGAB 2ZKHL 4ESKA 2R9HC 3HE6B 5D5MA 4PTTA 1EJOL 1F4YL 2A74B 2V5SA 1EO8L 3QULA 2L7UA 3WO3B 1V3MA 1K8DA 1VENA 5F96L 1AC6A 4U6XB 1C7TA 4Z7WB 2ICCA 3BKYL 3MRMB 3PWNA 1NCAH 1NFDE 1X5AA 2C4FU 4HAGA 4LPTA 3VFPB 5E2WL 3W9EA 3X3GL 2HG5B 1L6ZA 3MV01 5IGXH 3WFHA 4NZTH 3O4LA 1EUTA 2ED7A 4PJ8C 4ZUTB 2VKXA 5DUBA 2AV1A 4PJIA 4IOFC 4QRRD 3L3HB 4S1QL 2J4WL 4LSPH 5E00A 5GZND 3VFGH 1LHZA 3OHXB 4PJ9D 1IC5H 3V0VA 4QRPB 5T5NG 1S7UA 5L0QB 4YE4L 1U8OB 3RPIA 1QLEH 4PJAF 1E28B 4G3YL 2R0LL 3C60A 3CZFA 3MRHB 3CX5J 3GSQA 4ZTPH 3AROA 5DJ2B 3AM8C 5E5UB 2AK4E 5TE4H 2FO1A 2OQJA 3E6HA 4HS8H 1S7VB 2XWTB 3ZDXE 1EHAA 2EDYA 2ZPKL 2A6JB 4K8RH 4JFFA 1B0RA 4AIXA 4RSVA 1F8TH 2R15A 1HXYB 4Y8DC 1Q38A 2HJLA 1KLGB 5DRNA 2IADB 3OX8A 1IEAB 4AL8H 3F62A 5F6HI 4N1HB 2CIKA 1EXUA 3TWCL 4UT7H 1ORSA 1HKLL 4Q9QL 2X1XR 1XF3A 2UZYB 3D87B 2XPGA 2IANE 5KZCD 1FSKB 3SJVD 2OSLA 4WW2B 2AJVL 3STLA 4OV5A 4TUKH 5JO5B 4YAQB 3MOQA 3ZKMD 2DQTH 4F58L 1FO0L 2VAAA 5CHNA 5IW6A 2CKBB 1NFIB 3MQIA 2PO6A 3MV7A 1NUDA 5FUCC 5L9DH 2AQ2A 1R3IH 3KPLB 4CVZA 4G8EB 5IHZB 4QRQB 5E70A 1I3GH 2EDHA 4LCCC 2JJTC 4PJ9C 1FCCA 5DC4B 3EJYD 4LVHB 1U6AH 3P2TA 5B39G 1KPUB 1TENA 5TF1L 3UAJC 1CBVH 3ARDD 3S35X 3BRGC 4NQCA 4EIZC 4JFDA 3L1OH 2QSQA 1DEDA 2I60L 1WBXB 1G0DA 4MA3B 4CMMB 5AAWA 3LDBB 1H5BC 3OKOB 3IDJA 1HH6B 3SDDC 3MR9B 2A9MH 1NDGB 3UBXG 4WJ5A 2MTPA 3BEVB 1NL0L 2HVKB 4LSDA 3H9SD 1S7TA 3SKMA 5ITBH 3WMSA 5E6IC 2DQDH 3VFGL 3KNBA 1CI5A 5H35B 1MF2L 1YECH 1DQML 3E1F1 4RNRA 3E0GA 1HHJB 2WV3A 4OGXH 3VFTA 4MJIA 1UADC 1RD6A 1VEMA 4Y4KB 1HHIB 1UG9A 1XGQB 5DVMA 3NCBB 5JA9A 1U8MA 4ZS7L 2DJSA 5TGBA 4EUPA 3CVHH 5E4EB 4TVPD 4Q97A 2W0LA 1ZK9A 3HE7D 4X6DA 5LGKA 5JDSB 1S7SA 3QJFA 5GHWH 1BEYL 2MMXA 3N1QC 4FXLA 4I2XE 2E9IA 1R6VA 3UAJD 3TWCH 5FGCE 5D7JA 4WTZA 4GW4A 1FNEB 1U8LA 5FUCE 1I7UB 3N06B 3RKPA 4IDJL 1CF8L 1P7QB 4KK5C 1TZIA 3GJFK 5ACZA 1YN7B 2N7BA 1P84K 3KPSD 1U91A 1CLCA 2VISA 4NNXB 1FO0H 3OKYA 4LL9A 2FJGA 4O9HH 5JHDE 1YMHB 5DVKA 4L3EA 1JNLL 4NKOB 3K2MC 2C3VA 5F7EH 4Y2DD 1CQYA 3KYMB 4K2UH 3VWJA 4HT1L 5D5ME 1QP1A 4XVTH 3U7WL 5BS0B 4KK8C 3QZWA 5D71H 3SE3C 3DMMA 1GAFH 5HHVL 3V6FA 2HRPL 3MRMA 3T0WA 2I5YH 3BW9B 3OJDA 3QG6B 4UBDC 4ZSOB 1QBAA 4HMCA 3OF6A 5JQ6H 2YMXH 3RL2A 4GXVH 3G6JF 2OP4L 3QUZD 3WKNA 5EU5B 1ULVA 5E5MA 3W81A 1AJ7H 2YPLA 1S7UB 1CE6A 4K7PY 1WSST 5DRWB 3GSQB 4KZEH 4MS8D 4U0QB 1J05A 3SCMC 5ITBL 1BZ9B 1NAMB 3H9HA 3R1GL 3QXUA 2DQDL 4X0KB 4HCRL 5GGRB 1MCRA 1X5YA 1Q9KA 3FJTA 1S9KC 1G9MC 3BP4A 4WW2F 3VFOA 1G7PA 4LCUB 1GOFA 1W2KT 1FO0B 2N56A 1NANH 3A67H 4Z76A 4OFYA 1BQSA 2GY5A 5F7WC 4LPYA 4Y16B 2AJUL 3SDXA 1DQDL 4KHTL 2PXYD 1ZGLA 3DHMA 5DK0B 3IDYC 5HYFA 3PWUA 2CIKB 1B2WH 4NC1C 4RRPG 4H1LG 4QHNA 1WZLA 4R97C 4LIQE 2W9EL 4NWUL 5CJXA 1U3YA 1WZ1L 3AS3A 3VRIB 4J4PC 2JJSA 2HJKB 1KN2H 2WLZA 1I7TA 2E7LC 1INQB 4PV9B 4JVUA 2ENYA 3OR6B 1F6FB 2UYLA 4R7DA 3OHXA 3V0VB 2AK4D 3SJVB 3RGVD 1JF6A 2Y06L 4AEEA 3O6ML 3BP7A 5DHVB 1I1AB 4NP4H 2X7LB 7CGTA 1M6OB 5C08E 1C08A 5DXWA 1MAKA 2CJUH 3ARZA 4JFFE 1VDGA 1DANT 4QF1B 2B5IC 1SMAA 5DWUH 3W2DH 2A9NH 3AMKA 4BZYA 3NOIA 5GGQL 5EBMB 3E3QC 1A22B 3PV6B 1OCWH 5DVOA 3I9GL 5DUPH 5E94A 4IHOB 1Y0LB 1BQHA 3QBTB 1S7QB 4MNHA 4HEPG 1PGRB 4OF5A 4HFUH 2Y5EA 2E9WA 3SKMB 4MD0B 1B3JA 4XNXL 2HVKA 1ZHKA 4ORGB 3DXAE 1UT9A 1E4XH 4QRPA 4YHOH 4ZUUB 3WFCH 1NCNA 1F02I 3DETD 1QRNA 4WFFD 1NPUA 1W8NA 4JQXA 4UTAH 1AR2A 2D3VA 2ZG3A 3MJ6A 4QRUB 3MGTB 3CVHA 4LLYB 5T1KA 1V3LA 1YDPB 4WEBL 2EH8H 1NC4A 3WNOA 1IC7H 1UB6B 1FE8H 4KK6C 2WWMC 3DWTA 4HKJA 4J3SA 1YN6B 2W9DL 2DD8H 5IEKA 3X3FL 2BSTB 4KHTH 1FRGL 3BZFB 3S9DB 4L3CA 1TQCC 4JG1L 2YEZB 3HE7B 4Z5RB 1A3LL 3HZKA 3TV3H 4YAQA 1A1NA 1T66D 5BRZA 4CU6A 1VESA 4NNPL 1G9NL 3HUJF 2C4XA 2EICA 4ODHL 4OLWL 4K71C 1AQKH 3BQUB 3VXUD 2L0DA 2XZAL 3EFFB 3UC0H 4XVUD 4XMPL 3I50H 4RMUA 2FWOB 3QNXB 3RI5F 2X4OA 4P4KC 3NTCH 4GLRH 4JE4B 4ZXBC 4X9FA 4E9LA 4V1DA 4Z7NF 5D7LE 5FA4B 5TDPB 1UACH 1MRCL 4PG9A 2IANB 4RA3A 1NUNB 4GBXA 1B0GA 1T7YA 4OLUH 1C12A 1HHIA 3JWDL 4NO0D 4PJ7B 1NCAL 3RL1A 1OHQA 1NAML 3LQAL 3K46A 2W0FB 3FQRA 2AEWA 4ISVA 4QRSA 4X8XA 3MJ8A 3L95B 5AZEL 2A9NL 4MXVF 1U42A 4N8CH 5ALBH 3W5MA 2WP3O 1AKJA 3CFBA 2BFVH 1JJUA 4MAYC 5K9JH 5MENB 1CDGA 5IB1B 5MEPA 5E5MB 4AY0A 5HXMA 2K7QA 3PWJA 3IB4A 3DV4A 1YEKH 4OZFB 3BEVA 5I15H 1ADQH 2CMRL 3LKSA 3FOLB 1YN7A 3OPZH 3NA9H 3BGMA 3QUXA 5F89A 1ZSDA 1E4XL 2NZ9C 3HS0A 3OL2A 4KRPD 4UOW0 1PW3A 5EBGA 4DZBA 3JV6B 2LAAA 4HS8L 5DQJA 1XGUB 3U7YL 1ZKAA 5F1NB 4TPRL 1SEBA 4R7NB 4R96A 1BFVL 2DRUA 1EX0A 3VWKD 3NMEA 5HI5C 1ZA3A 1KCUL 2JCCA 1NBQA 3DMMB 4D9LH 5D70H 5CMAA 3MRDA 5HYJA 1ZGLB 1IAOA 1NJ9A 2B8OT 4IDLA 1WISA 2ESVA 4FOMA 4JPKH 3LS4L 3QI9A 4R4ND 4WEBH 4EUPB 4XVUC 2EH8L 4YQXH 1S9WB 3BD3A 2VLKA 4WW2C 3D69A 1F3DH 2GITA 4P9HH 1DN0B 4Z18A 1K6QH 3CU1A 3DMMC 1D9KB 3S36L 1JMZA 4HH9B 2G5BB 3X3FH 2DQJL 5T1MB 2XTJC 4PGCA 4ZO8A 4DKEH 1SJEA 1KJVA 3REWB 1AC0A 1OAZH 1TITA 3N1FC 5FDWB 3TNNA 4HPOH 5INDB 4UQ2B 3KXFB 3K3QA 4PJGE 1PZ5B 4MB3A 1IM9A 1UZ8B 5F7DA 4Z7UF 4LKXB 2R29L 4OCLC 4G6JL 1IVLA 3T77B 5KS9A 4PJFA 2X4UA 4BSWB 3CIQA 4UT6H 1VGKB 4AH2B 1OL0A 3RHWK 1FO0A 4CRPA 1HZHH 2GW5A 3IETA 3O6KL 4NJAL 1CE1L 5TF1H 1CFBA 4CVWA 5JIPA 2XWJB 1FN4B 3EOBA 1AGDA 5JW5B 5GRJH 5FKAA 3A6OA 3CXDH 4YO0B 2VLRD 5HTSA 3OGOE 5F6IC 1P1ZA 2OK0L 4GRLB 1JK8B 1U3ZA 1ZT7B 3LKPA 4UQ3A 3FRPG 5DDHB 5FYKD 4QEGA 3VXOA 3WFBL 5HYQA 1NFDB 1T2QL 1PKOA 3BPOC 4DEPC 4UOJA 1UA6L 4OLVL 2HFEA 2VJXA 4Z7QE 3GHBL 4NQDA 2YZ1A 5CAYB 3DTXA 4PRAA 3MLWH 1DLFH 4DOHB 25C8L 3QIWB 4FS0A 3S6CA 4DGVH 2CMRH 3JV4A 4NPYB 3HFMH 5ADOH 5C09D 5I0ZA 3FFCE 3WXWL 4W6XB 4OLZH 3GEWB 3IJYB 2J6EA 4PJXF 2H6PB 2DIBA 5HJ3B 2V2XA 4MA1B 5INCB 2HKFL 4U7MA 4TPRH 5DMIL 3KS0J 1LEKB 3SEPA 2D7TL 2LU7A 4ZOCA 2V7NB 4ODUB 1DR9A 2MJWA 3B9EA 3HZYB 3OTTA 4OSUL 3B9DA 4JRYE 3O6FA 4C59B 1FZOB 1RJYB 2M8XA 5IV2A 3JTSA 3CH1B 1UWXK 4FFZL 2Y5TB 1IGCL 2K9UA 5JNYA 4H25A 5TPWH 4L1HA 5IGXL 4MX7A 2DKUA 2VUYA 4M6NL 3EO0A 1NC2D 2GHWB 1QRKA 1BVLA 3EJZD 2FD6H 2YEZA 1QR4A 5IEHB 2NTFB 4OF6A 1E4KA 1IGFH 3HR5B 3FQNB 1FNFA 4KJPD 4JJHA 4QY8B 3MRGB 3OR7A 3QB7C 4FQJL 4KK5D 4XCEB 4YDVA 4EDWH 4UUJB 4ZXBB 2CK2A 4ZFOB 4YZFF 3O3EB 4UB0H 1F13A 4HKZB 2NQCA 1N7MH 4PG9B 1KXVC 1G7IA 3MV9B 5FYKU 2APBA 2W0KA 4HMDA 4K07A 5C0BA 1C1EL 3TBVB 4U1JB 1MVUB 2Y9RT 2NR6C 4YDJB 3PABB 1HWHB 1DQJB 4JRXA 4NIKB 2MPAH 5A2FA 4XMLH 1NGWA 3ZT5A 2BNRA 4O02L 4DVBB 3V4UH 2R1WB 4EDXB 5MENA 4YR6B 4ZODA 5KANG 1CGSL 5EZJB 5DI8B 1RIVL 4TVSa 6FABH 4WW1A 2V2WB 1ACYL 2ADGA 1A14L 4Z5RA 4GRWF 2XT1B 4LNRA 3I6LE 1BIIA 4HZAA 2J8UB 5ANMB 4QYOA 1A7NH 1E4KC 3DBXB 3K1DA 3QFJE 3ULVC 2F54A 5DRXB 1BD2E 2YPKB 1CD8A 3WXVL 3VCLA 4UNUA 3GRWA 4GOSA 3LH2L 4IRJA 4KVNL 5DEZA 3L3IB 2YHGA 4NBZB 1I3GL 1V8HA 4MXVE 1MELA 4ZAKD 3L5HA 3DVNB 3NFSH 1Q0YL 2HLFC 3RGVB 2YUZA 2VQ1B 1BGXL 3ESVF 3W5NA 2D31B 1P4LA 4B7LA 2XXCB 3T4AB 4BH7A 4LASH 1EEZA 4HS3A 1YJDH 5EUOB 2Q87A 3BSZL 4X5XA 1HQRA 2Z92A 5GGTH 5JXEC 3BGAA 2YD9A 4KTDL 3TPUB 1H15A 3WO4C 3BKCH 2G5BA 1YNKH 1KN2L 3ZMRA 1T66C 1SQ2N 2CDEA 2BSSB 5IB5A 5BQ7B 1FAKT 1KJ3L 2QJDA 1NL0H 1XCQA 2NY6D 1BD2D 1NCUA 2LU4A 2BRRH 3H2WA 3KAAA 1YC8A 1IGFL 5IVZB 5DC9B 1YECL 5E9DE 3S96A 1SEBB 1AGCA 3L7EA 1VPOL 1T22A 4OGXL 5DJ0A 3PQYB 5C3LD 2A6JA 4YUEH 2IMMA 1CU4L 1LO3L 3CSPA 1XGUA 3LIZL 4RMWA 1C1EH 3P40A 1I4FA 5F88B 2B7DT 1TETL 1CXKA 3PP3H 5I6XB 1T5XB 1O7VA 2B4CL 1XZ0B 3D39D 4HJ0D 5HSFA 1NDMA 1J0IA 1XF5B 5EO1B 3HMWH 3AAZA 5DDHA 5GHWL 3HNVH 3WLBA 1KJVB 3ULUH 2IPTH 3V4UL 3MBEB 1Z5LB 5DUBB 1PYWA 2GITB 4DN3L 3UTQB 1D9KA 5IUSA 3L3HA 2VMFA 5E00B 2JF1A 1CF8H 3CCHA 4QT5B 2FO4B 3KPMA 4POYA 3MA9H 1JIBA 1QACA 2HA1A 1KPVB 5DFWH 3PHQB 4HLZG 3TIEB 5JLZA 5E8EA 3RZCA 4BSWA 4JLRB 3WFEH 5I17A 2AAVA 5F1KC 4XBEL 4IMLA 4G8FB 5CD5C 1NGPL 2G5RA 2HJLB 2I07B 1B0RB 4WEMB 3LH2H 4KVNH 1VACA 2A74A 1T1ZB 4WO4D 3MJ9L 3VI3F 3BKJL 3QEQA 4XNYL 1YEEL 4LGRB 3Q6GH 5BZWB 3O4LE 3GMMB 4O51B 3C5ZB 3QHTC 3CH1A 5J13B 1A7PL 2BVTA 1BGXH 5D2NB 2HFEB 1FZOA 1MCLA 1RJYA 2IAND 3MRKB 2H8PA 3GHEL 3JV0A 5MERB 1HH9A 4GS7B 2Y5TA 3C9NB 1C16A 1YJDL 4GRLA 1A3LH 1PDKA 3TJEH 2WWKT 3QPXL 5JQ6L 4LPCA 3BD4A 1IGMH 2CLRA 4S11A 8FABB 4D94A 1QKZH 5D2NC 4OF8A 5IFHH 1AQKL 4HBCL 4DQOL 2YRPA 2DTML 4H1LB 3EYUH 3VXUE 3VFMB 2OX5A 3NFNB 4N0UA 4HCRH 2H6PA 4M3KB 3D39A 3K4ZA 5IHLB 3EO1B 4RGNC 3TZVB 4D9QE 4OTXH 1CVRA 4F7MA 4JFDB 5I9QB 3RPKA 1YPZB 1RZFL 4LCIH 3SDDB 4ZXBD 1NLDH 1X5KA 1N5AA 5BV7B 1KF9B 3RVUC 4DGYH 1VA9A 4ZNEA 1IT9H 3T3MF 2Q76A 3NCYS 4N5EC 3MA7A 4OZFH 3WEXB 4NO0A 1A3QA 3QH3A 1GJIA 1CFTA 5JNYB 1N6QL 1NGWB 4TNWF 5ALBL 4F2MA 4RRPA 1QFWM 5J6HB 5IV2B 2BFVL 2VQUA 2R1WA 4EDXA 2IAMC 3HZYA 4LLMB 4GW4B 3WDIA 1ERNA 4WW2A 2ZWLT 1KN4H 1ZANL 5I71B 5FUZL 2BNQE 3X14A 1CCZA 3GB7B 5IIEA 4ETQB 4NQEB 4JRWA 3OPZL 4UU9A 4XNMA 3MUJA 2E7MA 1BFOA 4U1KA 4XC3H 4XNUH 5GGSB 2GI7A 4PGDB 3I3EA 3QCVL 3QUYA 4XCEA 3M1BA 2OZ4A 3MA9L 4ENEC 4TRPH 3LSOB 1U8MB 1PX4A 5D6DA 2E6JA 3IT8D 1X44A 4PLJD 4PJAE 3TPKA 4MCZB 1QO3A 1X5GA 4JAMA 1MHEA 3GSXB 5D2LE 3TO4A 4CJ1A 5IQ7H 4I0PA 1F2XK 2IPKA 3QUYD 2OTWB 4N0UE 4H8WC 2DLFL 3HNTH 4F9LA 5DWUL 4LPWA 5D5MF 1WTLA 2IH3A 2FEEI 2DI9A 4PIRF 3D3VE 4XP6H 4IRJD 4XNQB 4BSVB 1H3PH 5DQDH 3VDCA 2W9LA 5ECJE 1ITCA 1U93A 2Z31B 5C0DB 1NDGA 1Y6KR 3PGDB 1U3HC 5HGBB 1IAII 4XT1C 5HPMB 3P9MB 4JQXC 4HDIA 4TQEH 2ZJSH 5DA4A 4TVPE 3IRZA 4MJ4A 4ZTPL 4JKWA 4EEEA 4J6RH 5SX5H 4QYOB 3KVQA 4L4TE 4BQ8A 4ZXBA 5IMOB 3PWPB 2YPKA 3RTQD 5ICYA 1AGCB 4U1HB 3ROLA 3DYMA 2BNRD 2AXGB 3QXTA 2CKNA 3EYUL 2ITDB 2KL6A 3BPCB 3VWJB 3C8KA 1IKFH 4P23A 1IGTB 2BX5A 5FA3A 3QXDB 1CL7H 1FV1A 5JPNA 3ULVF 4ODWA 3HI1A 1YEHL 3B3IA 1CD1B 1CR9H 1IC7L 1GCFA 5E7FA 4O4YH 2WIIA 4JZJC 4P48A 5MP6H 2R4SH 1DBBH 1YA5A 1RUKH 4K3DL 3SE4A 1XZ0A 3DRQA 3HZVA 3E2HB 1U8QA 1N6QH 1P84J 3T65A 3RL2B 4GRLD 2Q8BL 5L2KE 4ZFFA 2DQGH 5J57B 3SGDI 4QCIA 3CPLB 5DO2D 5C2UB 5KJRL 2JCCF 3TV3L 1GGIL 3D18B 4F7CA 4JLRA 3VXRB 3KPRA 5J1AB 3WNPA 1K2DA 4QOKE 3KPQA 4PJGB 1ZWIA 4IMLB 4C83B 2G9HA 4ZPTB 5FCUH 2P8MA 1U6AL 3X11B 3VCLB 1Q9KB 1WITA 4XCFL 4HXAL 3I50L 2NYYC 3LN4A 3LN9A 2ICEB 3JWNC 3ZZ1A 1CBVL 4OIAA 4F15B 3UTOA 1B6DA 1TZGL 2DMKA 4PYHA 3WLWC 5C0AD 1MRCH 3ECBB 1YYML 4HS6B 1UFUA 5FUOL 4GG6F 4C4KO 1R3JA 5DURD 3LEYL 5IQ7L 2A9ML 4IOIA 2EE3A 5DD0L 3P4NB 5DK2B 3MREB 5TPWL 5IJKC 3IS0X 4HUKB 3GKWH 1KB5A 3TYGH 5IB4A 3NAAH 4JM2F 4IHOA 3V7MA 1J0YA 4QNPE 5IB2B 4L8DB 5BV7L 4X4MA 3IDNA 1RUPH 4MQ7A 1CS6A 3CFCH 3HCVB 4BELD 2BSRA 1T5WB 1QBML 3LPFA 1KPVA 3OBAA 2AXFB 3ES6B 4YX2H 3MJGX 2UWEA 2NY3C 3DNKA 1MCDA 2GJ6A 2X70B 4KJYB 1MI5B 4MVBD 2EKSA 3EFDL 3LZFH 1U8IB 4G6KH 3MRLB 1GSMA 4LMQI 1EFQA 2OXHA 5DEGB 4P46A 4I3SL 3WD5H 5EG6C 2E3VA 4JREC 3FRPA 3ME0A 4QWWC 1UYWH 3FT3B 4PJDE 2PCPB 4JPKL 1INDL 1BD2A 1QG3A 4PY7A 4S1RH 1U2CA 1BQHB 2OL3H 5F7MC 4S1SH 1CGSH 4MSWA 5IESH 1LGVA 4CNIA 3PV6A 2R4SL 4UTBH 1UZ6F 5F9JA 4M1CC 3HB3C 3S36H 3NZHL 4PGEA 5JMOC 1YY8B 1FLRL 3QQ3A 2XICA 2QHLA 3CFIC 1P7HL 3LRHA 1ZV5A 3P30L 5C0AA 3KPSA 4PGDA 1GOGA 2W38A 5F7EL 1T1XB 3HUJE 4ZAKA 2BVQB 3H3BC 3QP3A 2KBGA 3VFVB 1KLUA 5A1AA 2M2DA 2BNUB 3SCMA 3KPRD 3D0LB 2HYMA 4WU7A 1U3HB 1Z0NA 1UXWA 3MV8E 2HRPH 4PP2B 2PXYB 2I5YL 2IH3B 4G5ZL 2NY0B 1EHXA 4MVBC 1KCKA 1YYMH 1M1SA 3ALWA 2VXVL 3PL6D 1ZTXL 1CLOL 5ILTH 3FO1A 3KS0H 1N64H 4LRNH 3OB0K 1YNLH 3OKEB 4XBGA 3HMXA 4KTDH 5GIRB 2FRGP 4NYLA 3BPNC 4RQQA 4TUJB 4L9DA 1KSRA 2QKIB 5DHYB 1UA6H 1AJ7L 4BUGA 1H9VA 4AT6B 2WZPD 3NAAL 4KZEL 5D6CB 1QLFA 4IEFB 4JPIA 4HK3J 5B3NA 4NOBA 5DJXA 3QR2A 5HGGS 2HH0H 2IMNA 2MNUA 3RWEA 4G42B 4WI2A 5C0BD 3D5OF 3I2CH 3L9RA 4P5MA 3BZEA 2AI0H 2ICWB 4XP9H 5IVNA 4K3HA 5J1TC 1JHTA 4K8RC 4X7TA 1F4XL 4N5ED 5F9OH 5EO0A 3HI1B 1U8PB 1JTPA 3NACH 2W9EH 1ORQB 3GZKA 1WZ1H 3K2UH 5SWQA 2BSTA 4XB8A 1PJ9A 1O0VA 4KZDL 1TNNA 4FQHA 4FFZH 1TIUA 4MAYB 4P3DB 3SDXF 1HEZB 3FFCD 5B22A 1FG9C 2FD6L 3ZHKA 4UU9B 3T0XA 5DQJB 3WJJC 1JZ7A 1A7QH 3D18A 3K8LA 2IFGA 4JM2B 3V6ZA 3K0WA 4Z6AT 1VFBA 4OB5H 3MRBA 3QUXB 2Q1EA 2GSIA 1M7DB 5HI4C 3DUUB 4NBXB 2E8YA 1BPVA 1W0WA 3ZDYE 3L3GA 1M05A 1FP5A 4UDUA 1CD9B 1II4E 3C8DA 3RVXC 2PTUA 4JAMB 3AS1A 3Q1SL 2HFFB 5IW3A 5K9OB 4PJFE 2V9TA 2WBJC 1NCTA 1N5YH 3BPLC 1B90A 1PQZB 4RIRB 4G8GB 1YQVH 5JR1H 1U41A 3GHEH 1U3JA 2CLVB 1CLOH 1LK2B 4MNGB 3C5ZD 4XP5H 1KBGH 4D0BA 3A6BH 4YHOL 3BDYL 3VXRA 5IFHL 1BMGA 1EK3A 1A14H 4HUWA 4MD4A 4UTAL 3QIWA 4MGXA 5F7DB 1EZVX 5F3HB 2HVJB 3DX8A 2AJXL 4ONOA 3RVTC 4PJ9A 4WDIA 4OGAC 1QSEA 1UJ3A 4Y1AA 1DQTA 3VMPA 3MCKA 1RZFH 4LCIL 2A83B 5FA3B 4ZSOE 2OL3A 5D93B 4D2NA 5A2IH 2VDRH 4ODWB 5ISZE 1S9WA 4NHUB 3WFHB 4K3EH 3VGEA 1MLBB 2V9RA 5IBTH 1FZKA 5KVDL 1OAUH 3QDJA 5C8JB 5HVHB 1A64A 3INUL 4IRSB 5GISL 1Q0XL 4NRXB 1U8JA 1IQWL 3PGFH 1LP9F 4ZDHB 4R4NC 2KQMA 5HDQH 3WUWA 3QEQD 4QCIB 1AO7E 2VLKD 2VC2H 2XZAH 4OIIL 4P46C 1OAXL 1A6TA 3LEXA 3WHXB 4AEIL 3KXFD 3MNVA 4PRHB 4D9RD 3LOWA 5C9JB 1QSFB 1PZ5A 3JV4B 4NPYA 5D2LA 5IHZA 4L29A 5AUMA 5D5MB 2V2TA 4YDLC 3OKDB 4NQVA 1RZ7L 2A6KB 3LKOB 4YZFE 3C60C 2PXYA 4OM1H 4PR5A 1NAMH 2H26B 3LQAH 3CH8A 1FJ1A 3FT3A 4TNVK 5KBNC 1RIHL 4DFHA 3MRLA 3KPNA 5HGDB 5TFSH 3S5LG 5DEGA 1WICA 4APQD 3OXSA 2BNRB 1XAUA 1XF4B 3BOVA 3ARBA 3MR9A 2HTLD 4OZIE 4PJ8A 2GTZA 4PS4L 5JIHA 4M4RA 4Z7QF 1NCWH 5IHUL 3HMWL 1ADQL 5D6CA 1AKJD 4PGEB 1MCOH 3NBNA 4LMQE 1ZAGA 4TQEL 3LQMA 3IDNB 5HHQB 1WCBB 2DM2A 4YDVB 5FF6A 3GI8H 3P0YH 3ET9F 4HUXA 2R0KL 1OGAB 4N0RA 4P9MH 4J3VA 4GBXD 4XCCH 1S9XA 3U4AA 2BDNL 4KXZI 3KLHC 1EZVY 3QPQD 4X4XB 4RX4A 3GMNB 1CL7L 1AIFA 1TQBC 3HAEH 3O6LH 1YEHH 4YPGB 1YPZF 1S9YA 3VXUA 4ODUA 1ZHBA 1DQJA 3VWJD 3SCMB 5JQHC 1UJTA 5E8DH 3VJ6B 1FFPA 3ZKQD 1JI1A 3QZWG 4HIXH 4KRNA 3UTSA 1S7SB 1F4WH 3QJFB 3JZ7A 4HKXA 4YXKL 5FECB 2O5ZH 1FYTD 1HEZA 1XF3B 4AENB 1RUMH 1KNOA 1WTGT 4M1DL 4U1LA 5CSGA 4JPIB 2A73A 1FNGA 4HPOL 4OLYH 5KVDH 1OAUL 4Y2OA 3ULUF 1QNZL 4M7ZC 3T2NL 4XI5C 2QKIA 4PRPE 1I1YB 3PGFL 5DHYA 1SBSL 1Q72L 1A7RH 2DB8A 4Y19B 3D25A 2VC2L 2DYPB 3QCTL 5JOPD 1A6WH 1MCQA 4HXAH 2DTMH 2OR8A 2BY2A 1PY9A 2F54D 1LDSA 4N1CA 4OCXH 4XP4L 4YLQT 3RVUD 4MMZC 4Y5VA 4MB4A 1PSKH 3DVNA 4JO2L 3TH3T 2MHAA 5FYJE 2EDWA 3Q5TA 2DDQH 4U1NA 1T04B 3KLSA 1DUZA 1LP9E 2P24A 4NN7B 2HMID 3GBNL 3MMEA 4QRPD 4Y5YA 1A9BA 3VG0H 1F5WA 4U1MB 4J1UA 4JRXD 4L1DA 1SYSB 5I1EL 2HJFA 2HT3C 4P23C 1XCQB 4JDZA 4LCWB 3H9SA 3TO4C 1I85C 3V7AE 3L3DA 4NNYB 2FJGB 1BIIB 1SM3L 5H35A 3RWGA 5FDYA 2C3VB 5H2BB 1BZ9A 3QCVH 4Z7OE 3LZFL 1GGYA 3CK0H 2R8SH 4X98B 1M05B 4KK9C 1J0KA 1DL7H 5JORB 1R0AH 1A6ZB 1QFUL 4YGVA 4Y4KC 1GPOH 1AP2B 1V5JA 3QUYC 4BQBA 1O7SA 3KJ4C 4I48A 3RGVA 2WLYA 3ARDA 4JFYA 4FFWD 5BZWA 3QAZB 5I19H 5ID1A 5EFIA 4H8WL 4YXHL 3RX5A 4P2OC 4S1SL 1U8KA 5C0CD 5DMGC 3JWDC 5I73C 3W9DB 4GRWH 1U3HD 4CL7A 2O5XH 4F9LC 3CC5B 3PDOA 1S7WA 5LCVH 4MYWB 3CCHB 4QT5A 2O5ZL 5F9AC 3VFRA 1J8HB 1R3HB 1FIGH 2W0PA 5C7XH 4OZHE 1HILA 4WVRA 4OZ4B 5LGHL 2FO4A 3UO1H 2EXYC 5C0FB 4PV9A 1FYHB 3SJVA 1OAQH 3FTGA 3LAFA 2P44B 2PF6A 4L9LA 4RBPH 1MREL 4WI4A 2I25N 4MNQE 3LKOA 4WFHE 1IGYB 1YEIL 2EXWC 3F65A 3ROOA 3QG7L 5GRWA 1AH1A 1U9KA 4U6HA 4WDIB 3GMMA 4R4BA 3M8OH 4DGIH 3RWDA 4JHBA 4HG4J 4EI5B 5CIPA 4G5ZH 4NT6B 2ZUQB 3QQNA 5I1CL 1CN4A 4OKDA 1MLCB 4G6ML 5FYLL 1DDHB 4WUUA 1AGFB 1Q9OB 1VERA 2H2PC 4O4YL 3F8UB 1Q9WA 3P77B 1H8OA 3SKOB 4P4KB 1U8JB 3QUZA 5CSBA 4PLKC 4NHUA 4EUPH 2CK0H 2P45B 3UJJL 5DJ8A 1YMMB 2Q8BH 2YRLA 1FZKB 1PG7X 2J8UF 1U95A 1BF2A 4J23A 1QRNB 3I6GA 4GRWB 3WJLA 5F1IA 4ORGA 4HJ0C 5I1LB 1AXTL 5D1QC 5GJSL 2Y36L 5D1QB 2XZQH 5D7IA 5H37G 4TTGA 3OZ9L 1FZMB 5FGBA 5SWSB 1JGEB 3QXAB 1ZLUK 2XTJD 4L5FL 4B50A 1YPZA 4ELKA 5ISZA 1CTOA 4XCFH 5C9JA 4JG0H 1YJDC 2O5YH 3GI9L 3SDCD 1HQ4A 2VKWA 1R0AL 2DKMA 1LO5B 1RZJC 3TO4B 2I07A 2NX5B 3MRJB 4LLAA 4MJIE 2CRIA 4LASL 3T1WA 3IU3A 1MFAH 3WIFB 4LSSH 5FUOH 2E8ZA 4HUUA 3AB0B 5I1IL 4PYGA 5ELIA 3RDTA 1S3KH 2VR5A 1A7OL 1E4XI 1FNGB 5EA0H 4Z95L 3CDFA 5DT1H 1KJ3H 3C09B 4MHHI 1FVCA 5DA0B 3I85A 1HNGA 2BRRL 4LLDA 4MZ2A 5I2IA 4ETQA 2JJTA 3BQUA 4FFYL 3MGOB 3VWKA 1OAKH 3HA0A 3W39A 5LGHH 1X6NA 2DYPA 5IVOA 1Q8MA 5CEZH 1PKQB 4YUEL 1UM6L 2PO6C 1OAQL 1CU4H 5C6WH 3RY4A 4WI9A 4I0PB 5F7YC 3SGJA 3BPCA 4G6KL 1E27B 3QUXD 3DRTA 3V5KB 1T89A 1AI1L 1N5AB 1E6JH 4OM0L 2PNDA 4NM8H 1DANU 1A2YA 3MJ8B 2W60B 1OP3K 2W0FA 3FQRB 4NO5A 4XP1H 1JMXA 4PJXB 1UWGL 3BWUC 4RGND 1ZHLB 4UILL 4M48H 4AENA 3HZMA 2OL3L 1VHPA 1LO4L 3OB0H 5JXEA 3ARWA 2ZSVA 3IFPA 1BFSA 5TQ2H 2IH1B 5IFAL 3NZHH 4X5WA 5SWZD 3DV4B 4W70A 1CGYA 4Q74A 4UNVA 5ESQA 1A1NB 4YHKH 3VXPB 4NQED 3FFDA 5E2UH 3L7FA 5B3JE 5D9SB 5CKGA 4CBPA 2J8OA 4NKMB 1KT2A 2ATPB 3BN3B 5I8EA 3C8KB 2Y36H 1KPRB 4KQ4H 4LU5H 3VXNB 2X89D 3JBG7 1NKOA 4QHLA 2JJVA 4L5FH 1IGTA 1MCNA 4M43L 3LKQB 3PXJA 2E7BA 3BHBA 4LHUD 3Q6GL 3GSXA 1KYOJ 3I02B 4LBEB 2OMNA 2Q8AL 4ZFGL 4OF3A 5BRZD 1ES0A 1Z3GL 2WWMD 4ISVB 2IQAB 1QO3B 2D4FA 4QRSB 4MLIA 5EN2A 1SEQH 4KJQD 4PJ7A 5FO7B 4K3EL 3DX9B 2AS5M 4KKNA 5GXBB 4E0RB 2WIMA 2FYYA 1IZJA 1OTUD 3UTSB 1CWVA 3HC3L 1MUJB 2DWDB 4PLNC 2GKIA 4Y4FA 4Z7UB 2NY2B 5FK9A 3BDXA 1HIMH 3GSVB 4RFNC 3TNNB 5FDWA 1T03H 2F19H 1RUQH 4PJIE 1NAKH 5CKAA 4ZFFB 3W0WB 3BUYB 3N9GL 2GJZA 4AEIH 5C0BE 1E4WL 3CLEL 5T1KD 4YEEA 3C60B 1R5WB 5JZ7D 5DGRA 2ESVE 4KKAC 4P4KD 3VXQA 1J8HD 1F4HA 4QHUB 2I24N 1AR1C 2L7JA 1RZ7H 2YXFA 3T0VA 2GTWA 4OM1L 2Z31C 4PUBL 1QRND 4LP5A 5EBLA 3SE9H 4M7LL 1ZA3B 4XP9L 4GBXB 3BWAB 1NJ9B 2IADA 1U8KB 5DFVC 1MHHA 1Q9WB 3P77A 1Z9SA 3NZ8A 5HPOA 5HGAA 2V5MA 4MXWL 3MMEB 4NM8L 1CDUA 4L8DA 5IHUH 2XXMB 3MUGB 1XIWA 5BVJA 5ID1B 3NN8B 4APQB 1UWGH 3A0OA 4ZQKA 1KFAL 3QHZH 3O6FC 5DS8A 5FV1L 3VMOA 3QHFL 5KN5A 1T89C 5L8KB 5E2JA 5HHXH 3EDJA 4XNUL 2EDLA 5CWSB 1E28A 3L3KB 5IQ9B 4UQ2A 3T2PA 1EHLL 1F3DJ 1KEML 5AYUL 5I1LA 4N9OB 5T3ZE 4XCCL 1A7QL 3SGEI 4PRHE 2ERJB 2JB6B 1YMMD 3VI4F 2OYPA 4L9LB 3TBSB 2BVQA 4MA8H 2XZCH 1RMFH 2ICEA 4O2CA 2UUDH 3L3OA 1ONQA 2H32H 3HNTL 3DYOA 4YO0A 4PY8I 5IM7B 4NGHH 4NKIL 2XYCA 4PD4J 5JW4N 5CJBA 4Z7WA 4HSQA 5DR5L 4OI7A 3WIFA 1JZ3A 4NSKB 4PGBB 5CJQH 5DURB 4N8VG 4CJ0A 3PWNB 1KB5B 1RZIA 2QQLH 4HXBH 4LPUA 4IOIB 2DLTA 2JIXB 3TN0D 1AE6H 1QNZH 2NW2B 2NNAA 3WS6A 4KGJA 3QWRA 4O5LH 1OB1A 3O0RL 4OFYD 5IW6B 2YRZA 3WIHH 3ZL4L 4PJBA 3T0EE 1NMCC 4Y16C 3CZJA 2BOCB 3O3BA 1U8OA 3RPIB 1A6WL 4AIOA 1J9CT 1PAMA 2WUBH 3CSBA 1CFSB 1GHFL 1Q1JL 1WWAX 1T1XA 2FCBA 4LFHG 5F1IB 2Q6WA 2ARJB 1NGQL 4MDIB 1KLUB 5D1QA 4IIQB 5FYLE 3W0WE 4KFZC 4ZUSA 3CFEA 3FCTB 4PTUA 4MA3A 3UJIL 3KYKL 3ZDXF 5MP6L 2X44D 1DBBL 5J12C 3R8QA 2JJWA 1T4KA 3G5XB 1EXUB 1ZHLA 1DDHA 4WUUB 3NFPB 1CGXA 3I6KB 2V2WA 2QEJA 3O3AB 2FJHB 1RI8A 5DI8A 1CLYL 2B2XL 3NIGF 1F6LL 4X83A 5BS0D 3FQNA 3GK8H 1M71B 5C0CB 1HHJA 2NTFA 2OZ4L 3W39B 5B38B 3I6LD 4Z7VF 5EPMB 1OTSC 3L7FB 4I3GA 2R2BA 1OAXH 2VLME 3V8CA 1N59A 2R1XA 3L9RB 3O2VL 4L4TA 4JO1L 3GJFA 4G42A 4JKPL 3ZTJH 4EN3D 1X5IA 2HT2C 1PBYA 3TA3D 2OJZH 3VG9C 3ZKMC 4NZRH 4MA8L 2PYFA 4N0CD 4U1JA 3HN3A 3RUGE 1LEKA 4XPHH 5CJ8A 2VL5B 4YXHH 4X6DF 4G43B 4YHYB 4RIRA 3OKEA 1RUAH 1SY6L 3GGWA 4MAYA 4OUUA 4KRPC 4KI5D 3UPCA 1G7HA 4YFEA 1HDMB 2BHYA 2BJML 1H15B 4PJ5A 3SE8L 4K94C 2OBGA 3QEGH 3ARDC 5K33A 1DQQA 2XG4A 4MJ6A 5ETUA 4CW1B 1WFOA 1IMHC 3C2AH 1XGRB 1JL8A 5EIQA 5I1AA 4R90L 5F1SA 5K9KB 4FNLH 1CDJA 4JFPA 4XAWH 5EC2A 5EWIL 1IEBA 4JY6A 1M7DA 5D1XB 2NW3A 3ZYOA 2X4QB 3N1PC 3QG7H 5CSZB 4MNQD 2PYED 3TIDB 4KKBC 1DBJH 2P5EE 1CD0A 1JYNA 3F58L 3VXTA 2J8UE 2UY7A 3B4NA 3G08A 1JE6A 3BO8A 1P6FA 4KI5E 3FMGH 4NQSB 4PRBA 1XF2A 3TA3C 1ES0B 2N7AA 5E8DL 1LK2A 1VFUA 3EJJX 4MNGA 5E1AA 2X9XA 3MLXH 2H9GA 1GC1H 3LB6C 1DEEA 4XTRC 5J8OA 3MBEA 4WW1B 4AIZA 4P99A 5HDBE 1XF1A 4Y5VC 4OGYL 5ACZB 4FRWA 4P57A 1LVEA 2EYTB 5GJSH 1I7UA 4WRLA 1R5WA 3G6JB 3T2NH 3U9PL 2VLJE 5TF0A 1UJ3B 2PTVA 4JB9L 3MRBB 1G84A 4HWEL 5EZIL 3PG2A 5JHLH 4NC2B 5DJ0B 3DUUA 1I9IL 4RFEA 1KTLA 2Z93B 2NY5C 1KIRA 5J56B 3EYVB 4G8FA 5L0QC 4WWKC 3MFFB 4JVWA 2W1NA 2XTJB 5F8RC 4XP4H 5J4MA 3O2WL 1I7RA 2YWYA 4NZRL 2IQAA 1TJGH 5EN2B 4S1DC 3H42L 4LAQL 4WUKL 1PQZA 3C87A 5HD8D 2WBJA 1L0QA 3GBNH 1YQ2A 4HFWA 1AY1H 3KYOB 5GS1B 1I8IB 5TDNB 1SY6H 2WWKO 5TE7L 2P48B 4P2CG 4HC1H 1C16B 3MODH 3NCJH 1L7IL 4MD0A 5CWSA 1RHHA 2BJMH 1R3KA 2GFBB 2XQBH 5DRWA 4X4ZA 1R5VB 5T3ZL 1A6TB 2XRAL 3H9YA 4XPAL 3L3KA 1OGAA 4S2SA 1XMWA 4JO4H 1INEH 1QSFA 2DWEB 3X13B 3MNVB 5IB3B 4UIKL 4LCYA 4CU8A 2AABL 3WCYA 2CRZA 1F4XH 4OZGF 5J06A 1AI1H 1ONQB 2C1OA 4HAFA 1GL4B 5DQ9B 5DSCB 4GKNA 3PP3K 2E7LA 1EBPA 1K8IA 2UZIH 3OXSB 1F97A 2OCFD 5BMFH 1FPTL 1FFPB 4F3FA 5LGJA 1FL6A 4HWZA 2CIIA 4PG2A 2AJSL 2NY4D 4MZ3A 4JANB 4WCYH 2XACC 2J6EL 1X3DA 1S7QA 4JDTL 3GBMH 1EPFA 1FG2B 4RGNB 3TZVC 5T3XH 4ZOAA 5HDOA 1T0PB 4LOUC 2OTUA 3GMLB 3ZYJA 4HUXB 1S9XB 5EU7E 5AD0B 3STZA 4FZ8L 5HHPB 5FF6B 4CVUA 3C5SA 5I8OH 3U9PH 4HEME 5E8OA 5DMKA 4J4PD 4JRYB 1FNSH 3IFLL 4N0UB 4KJWC 3CFDA 5DLML 5T1KB 1WQVT 4YHMH 5TQ0L 3P4OB 2IGFL 1N5YL 1YY9C 1VB9A 1H8SA 4PTUB 3ZE0F 4HULB 1IE5A 3H6JA 4ZUSB 4HKBA 1JPGB 4LHUB 3ARBB 4DK6A 3MV7E 3T1FB 5CEXA 2QSVA 4KUZH 2VWEC 5F44A 4F7PA 3PIQB 5I18H 2K3TA 4WI3A 1HH9B 1T03L 3IYLW 2F19L 1WC7A 4OQ1A 4Y19A 5TE7H 1Z9OA 1E6OH 43CAA 1UKSA 4ZAKC 4U3HA 1KTRL 3U4BH 5DJCA 3T8XB 5T3XE 5ICYB 4F7EA 2XRAH 4XPAH 1QYGL 4U6YA 3SGKC 2ITDA 1ITBB 3LSOA 3G5YA 4N90D 3ROLB 3O2DA 3D39B 2WAHA 4XCYB 3PV7A 3L6FA 4YHLL 1W0VB 5DHVH 1IGIL 5DZNA 2FBJL 3BN9D 1T04A 4NN6B 2X41A 1GZPB 2FX7H 5I71C 5L88L 2ICWI 1FAIL 5MENE 4MNQB 4XWGH 3RY6C 1DUZB 4MB5A 1DVFA 1IC4L 3PWLB 3U30C 3QHZL 1S3KL 4YFLF 4W6WB 4GH7B 5LWYH 5C0RH 1MCKA 3L3DB 1ETZB 2C3WA 1TPXC 2HTKD 4WFED 4JDZB 4LCWA 3RWGB 2C1PA 2QSCH 2XKNB 5ETUB 4CW1A 5IMOA 5MEOA 4K55A 3H9SB 3MCLL 2JIXD 3TN0B 3VA2C 4E5XB 4A2LA 3SOBL 5GSVA 3UJTL 1VGKA 4AH2A 5CEZL 3X11A 3T4YA 2J88H 5I8OL 4JQIH 4HIHB 5EDXA 3G9AB 4XI5D 1WT5C 1I7RB 1D6VH 3AXLA 2F74B 4Z7WF 2WBKA 5EBWA 1J88A 1OP3H 5C0GB 4I48B 4OD3H 4XGZA 5D7JC 5I1KH 2B1HL 4YBQC 2VL4A 3FKUS 1DUYA 1QFWL 2APXA 4KDVA 2QQLL 5KSBB 3T65B 1T2JA 3REWA 2V7HA 4AIZB 5L8LB 1I8IA 2VDLH 5KOVC 1RHHB 4YBLC 4PGCB 3WDJA 3FQXB 4F80A 4U7KA 1HK6A 4NQCE 4OZFA 4WU5A 4LCWE 4OZGE 1HILB 1MHCB 4HF5H 3WIHL 1OP9A 3CUPB 3ZL4H 5HY9B 2HKHL 3T2QA 1IAIH 1JPST 2WQ8A 3VA6A 5D72H 4J7RA 3MOAH 5F7FA 2XN9D 2NXZC 3AY4A 4DKAA 4G8IA 4KJYA 1NGYB 1KTLB 2Z93A 2C4FT 3JV6A 1UCBH 3TIDA 3SQOL 3D85A 2YN5A 1EIBA 4R7NA 1PG7H 3UBXB 3U9UB 4ZTOL 3QRGL 3HI5L 2FSEB 4U1SB 3PWVB 4JFZL 1R3JB 4DVRH 1DQLL 1MEXH 3UZQA 5K9QI 5L88H 1IM3B 1V7MH 1ZHNB 2APTA 3P4NA 4OLYL 1W72L 3RVXD 5KTEL 2P5WA 1CLYH 5I9QC 4JM4H 3RX7A 1SJEB 4N8VA 4W4OA 3RKDD 4HFWB 2DQUH 2PR4H 4OZ4A 1RUQL 1CVSC 2DBJA 2CGRL 4NFCA 3RIFK 1CICB 1NEZA 1CGTA 1I8LA 5ICXA 4JHAL 3IDMA 1MI5A 3O81A 1AR1D 5D1ZD 4LSQH 4KI1A 1J11A 5C09E 2XFXB 2X4UB 1WBZA 2F53B 5E6IB 2P8MB 3HAEA 5IB3A 1G7IB 5GS0L 4CVXA 3JWOC 3SOBH 5C0NC 5INCA 2E27H 2IAMD 1T6WA 3WL9A 4KMTH 1A9EB 4YHNB 4JFXA 2HT2D 3V4VL 2J1KA 5CIPB 1P69B 1T1YB 4YC2B 4QTIH 3I3DA 2PCPA 4OJFL 3HTLX 4K23H 1UC6A 4CU7A 2B1HH 3IAQA 2FECI 1GZQA 3IFOB 1G9NC 3STLB 1NFDA 2X9WA 3DUSA 2YPVH 2FJFB 1FVCB 2IBZX 3C2AL 3G6AB 4PRHD 3B9AA 5BZDB 4LEOA 4JO3L 5JO5A 5ALCL 3RWCA 1YYLH 3TJHC 2VZSA 1QFWI 2H2PD 5I8KL 4I1NB 1J18A 1XT5A 4FNLL 1P2CA 4M5ZL 1DL7L 1O5DT 3V8OA 4ZG1A 1SVCP 4HZLB 3G5YB 2X70A 4OCYH 4IRJB 2MKLC 4HLJA 4OZGB 4LCYB 4OIBA 3C5SB 4YDKL 2ZKHH 3FQTA 3K1KC 5D96B 1WVZA 3KLAB 4EBQH 1BWWA 3BISA 4NN6C 1HHGB 1UCBL 4YHZL 3HI6H 3U2SB 4JHZA 1FLTX 4ZD3H 5B8CB 1BOYA 2EO9A 4U0RC 5HVHC 1H5BB 3RJDA 1XR9B 4S0TD 3H8NA 2YBRA 2MKWA 3FO1B 3P4MA 1F90H 3MPCA 4XXDA 3TT1L 6CGTA 5F3BA 3PQYD 1MCBA 2VAJA 1OF2B 3EO0B 4NM4L 4Q9BA 3IJHB 3ARYA 4HXBL 4JANA 1AD9B 4OI9A 3V52H 4M8VA 5MHSD 1KJ2L 1S7TB 5BW7A 1W72H 3IF1B 4MQSB 3UO1L 2ZSVB 1NMBL 3IJSA 3BUYA 1MNUH 4YXLH 3VU2A 1NEUA 1X4ZA 3DIFA 3N0PB 4LLDB 5I2IB 5BO1L 1IC5L 4HGWB 5C0AB 3CNKA 1F11A 3MLZH 4YE4H 3S35H 4ZO7A 2RFXB 4ZFOA 3IFNH 3HG1B 5SX5K 1JWMA 1SJHA 1ZT4A 1EVUA 1OWRM 3QT2A 4NQXA 2QQQA 1PLGH 4ONGL 4LSQL 3O3EA 3T4YB 1DBKH 3QYCA 4P5TC 5AEAA 3LKQA 3SBWA 5TGBB 1T7WA 1ZT1B 3LY6A 4KJPC 3EYOA 1I1RA 3MZTA 5KSUA 5B38G 2NY7L 3WIIL 2MFNA 3TEUA 4RAHA 2BVOA 4KU1A 2HLAA 1F42A 4QTIL 3P11H 4CADA 4UZGA 1QOKA 4KUCD 3UJJH 3WLBB 5HD8C 4RGOL 2VXUH 3GSVA 2AK1L 1D6EA 1DE4B 3C8HA 3V4PH 2B2XH 2W07A 4JM2A 2Z8WC 4PB0L 1DFBL 3DX8B 3QDMD 5GS2D 4IRZL 3PHQA 3TIEA 1WIPA 1YYLL 4MNGE 4PJBE 5M95B 1W72B 4KTYA 3PQYA 5I8KH 4FG6C 1YNTB 3BI9X 1OQOA 4NWTH 1NGYA 4U49A 2YK1H 5IBLD 1Q94A 1E0OB 2GSGB 4J3OC 3VXNA 3LEVL 1DZBA 1GIGH 1PG7W 2YN3A 1MFAL 2FB4L 1SJXA 1XIWC 3O3UN 2CD0A 4EBQL 5J89A 4NUGH 3O9WD 2J12B 1WUNT 4DZ8A 2DJUA 1L7TL 4DEPB 5I8CB 3F7VA 3S88H 1JTOA 3U30B 5ICZA 3AREB 4JDTH 4V2CB 4ETYA 4POZC 3UMTA 4X5XB 4TULL 4QRTA 3RGHA 1C5CH 3LRSA 3MUGA 3TT1H 3TBTB 3QFJD 5HHMD 5F6IB 4AEFA 3SBWC 1U8LB 2GY7B 1RIUL 3GMQA 4PRHA 1AFVH 1W8OA 3TVMA 4BH8A 3GUTB 2MQCA 3MLRL 5D8JL 4PJHA 3L7EB 4R90H 1JGUH 2IG2H 3BZ4B 2WUCH 3IFNL 3GJEB 2EC9U 5BW7C 1KCSH 3ARFA 1BLNA 3C09C 1BM3H 5D1ZB 2WBJD 3DOSA 1EUUA 4ZS7H 4Q7DA 4XP1L 2HFFA 2IAMA 4FG6D 2H8PB 3MA7B 4Z7VB 3L5JA 3AB0C 4GQ9H 4M7KL 5IFAH 1Z6JT 2AW2A 1WAAA 3IDIB 4ZSOA 5C1MB 1I9JL 2VLRB 1BVKA 1LE5B 4XAKE 5ENWB 5KN5B 4K3JL 4WTWA 3CFKA 1NGXA 1VGEH 1VFOA 1BFOB 4NJ9L 3OGCB 2IPUK 1PFCA 4U1GB 5J6GA 4KQ4L 3IDXL 2VH5L 1P2CB 1KGCD 4RMSA 5E56A 4PJIF 3GJFB 5EZIH 4HWEH 3KXFE 4HZLA 3W82A 3CLFL 3VDAA 3DARA 1ZLVH 3N50A 1M6OA 1RZJH 2YZ8A 2ARJA 1BBJB 2GUOB 2YSSB 4O2CB 5C07A 4R2GC 1F00I 2X4NA 1CDYA 1J1OH 1MRDL 1XR9A 1KIPB 5KVFH 2DQCH 5J6HA 2DTSA 3HAEG 2DM7A 2FSEA 1K3IA 1CFTB 4PJ7E 4LAQH 2YD8A 1GZQB 3RTQB 3NABL 3OKMB 1R24B 4WENB 1Y0LA 1G7HB 5JMRA 1A8JH 1ODAA 5L8JB 3ALPA 1QR1B 2FJHA 1NAKL 1L7TH 2Q3AA 5HHQA 1JYXA 1MOEA 1G6RA 4PPTA 4P9HC 3SGJC 5F93C 2YMXL 5FM4A 3EO9H 3U4EA 4AMKH 5JW4R 1PVHA 2Z91A 4KMLB 3KG5A 2RFXA 1MCWW 3MCLH 4HGWA 3LQZB 5KG9B 2ORBH 3M1BB 4NQUA 4BZ1H 4WV1A 1Q9LA 43C9A 2XFXA 3U83A 3FT2B 4G9FD 4Y5XB 3SE9L 4IIQA 1I1AA 4GAFB 4UIMA 3K8KA 5FM8A 3DVGA 2A6KA 3AMLA 4MAYD 1A5FH 5J13C 3QDMB 4BUHA 5D2LF 1TCRA 4I18C 3KHOA 2V5TA 2VWEE 2Q76B 3MUZ1 1X9QA 2HLFD 3QFDA 3ULUC 5GRVL 1JGVH 4N0YH 1J1PH 1MRFL 3BEWB 1D5MA 2AJSH 4A6YB 2B39A 3QIBC 2BZDA 4HPYL 3BAEL 1FGVL 5KAQG 1EHLH 4C55A 3D2UA 3V5HB 1XR8A 4P59L 2MCPH 4XXCC 5HI5D 1T83C 5CEZD 3IAGC 5D72L 4KK8D 2YD5A 3HLAB 1ZGLP 3R06A 1BHGA 1DSFL 3V95A 2VERN 4WFGE 4V1DB 1DVFD 4CMHB 3FONB 3ULVE 3CX2A 2Y06H 3CU7A 1N6VA 3HC4H 2DLIA 5JORA 1TJIL 1NUGA 1QPXA 2X4QA 3CLFH 3B3IB 3LKNB 4U1NB 1RZJL 3D2UD 3MV9D 4JY4A 5I74B 4YHML 3ARTA 4K9EH 5L2JA 4I9WD 5DD5L 4TUOB 5E1AB 4JFZH 1T80A 4DVRL 2BVOB 4L4VD 4HH9A 2YC1B 4J1UB 3VFWB 4D3CL 1R3HA 1K3ZA 4N0CC 5IW1A 2YUXA 4O5LL 4U3XA 3MNWB 1ND0A 1YEGH 2A73B 3B83A 1IARB 3I9GH 5DUPL 3VG9B 5JA8B 5J1AA 5GZOD 3GM0A 2PYEE 2NCMA 3HR6A 3VW3H 4YWGH 2G9HB 4GXUM 1W72A 4LKXA 1NFKA 2EDXA 4PJHB 1K2DB 2AEIT 3WJLC 4K71B 4JFPB 5EC2B 4PJFB 3W11D 1Z9MA 3MX0A 3MFFA 3M07A 1IEBB 4JY6B 1QFPA 4YJZL 3MRNA 4KMTL 3BN9C 1YUHA 3OJ2C 4XC1H 3ARDB 5HBBA 1MWAA 1U0QA 1RHFA 5JW4M 3GRWL 3V4VH 2C3GA 4M61B 1BLNB 5D1ZA 4WO4C 2FGZA 2VLKB 4NC0B 2O93L 2IQ9L 2KDGA 4JFED 5KZCB 2RAMA 2VB5A 1T6VN 1FL6B 3ARFC 2YA2A 3IRPX 4PJDA 1IGJA 5C0EA 3MUY1 5FXCH 4H5SB 4XWGL 1XF2B 1X5FA 1DEEB 4PJDF 2HFGH 2WBJB 5DVLA 3THMH 2E9JA 2HTKC 5GGSY 1UXSB 1GOHA 1BWMA 3WIHA 3O4OC 4Z9KB 3CMOL 4XZUB 4HX1A 4Y19E 2X09A 4F58H 1YMMA 2R1YA 2AXJA 1SYSA 4KTEH 5L6YL 3GUTA 2QQNL 5CUSL 5C07D 3SGDH 2DM3A 1I7ZA 4WGWB 1D5XB 5D96C 3F5WA 1H3WM 3OGCA 3MC0A 1UZ8A 4NRZA 5E8OB 1CICC 4APQC 3P9LB 5E2TH 4M6MH 4S2SB 2OJZL 3L5IA 4U6HB 2PYEB 1UB5B 4X6EA 1I9RH 2Z0BA 1XIWD 1AP2A 1EAJA 1QTYT 1UXWB 4P2OA 2APWA 3MNZA 4ZD3L 3EJYC 3O9WC 5F70A 1VKXB 1P1ZB 3FZUC 4UAOC 4RDQG 3BRDA 2JK5A 3WUWG 2F53E 1TTGA 5CEXB 1CLZH 4OD3L 3RY5A 3QXWA 3MRPB 3NPSC 3NPSB 1N0XH 5TDNA 4F3FB 5D2NE 1CFQA 3SKOA 3NH7H 5DUMH 4UAOB 2XI9A 4YXLL 1J8HA 3UTPE 4D3CH 1RFDL 5IB2A 1EEQA 3OR7B 4HF5L 5BO1H 2WQRA 2V17L 1K5NB 4UV4L 1JPSL 4X80L 5IFJB 4QOKA 1IAIL 4QGTA 5I66B 4RAUA 4A6YL 3KPLA 4CVZB 4E42A 1F6AA 3KPTA 3B2VL 1E4JA 4Y5YC 1BFVH 3DVGB 3ARFB 4PP2A 1L0YA 1LO2L 1NMCB 1CG9B 4W4NA 3TVMC 1MCCA 5F96H 4V2BA 5AG9A 2ZG2A 2GUOA 4ZTOH 2OTPA 4WO4B 3TFKC 3I75A 3TCLA 5I1HH 4LCWD 2X2YA 1DVFB 4PRDB 4UQ3B 4LHUA 4D0DB 4RGOH 2AK1H 3KWWA 3HZMB 4JFOA 4NZTL 3QUZB 4P4RB 4OGYH 1JP5A 5EU4B 2ZCHH 3MLSH 4JM4L 1AQDA 3D2UB 4PJCE 5F7UA 3O9WB 1GGBH 4JZOB 3ZE2E 1DFBH 3JWOL 2PR4L 4IRZH 5HI3D 4ONHA 5HHPA 3V5HA 1XGPA 5DJCB 3T8XA 4AEHL 1YEFH 1CDIA 4RISH 2QQKL 4JHAH 5SWZA 3UZVB 4OKVB 5HHMB 1KT2B 4F9PC 1BQLL 1MIEL 4ZFOL 1J1XL 2YA0A 4G6JH 4M6ML 2BNQD 2SEBB 5JXED 5CZVH 3QDMA 4Q6IC 4WU7B 1T7XA 2YSSA 2BVEA 1H3XA 1KB9J 1CE1H 2CLZB 2BNUA 3QFDB 5IBLC 3UTSE 4AM0B 4UIMB 1NANI 1RZ8A 3D3VA 2V7NA 5EUOA 2H1PL 5T1DH 4MNQA 5D7JB 1KCVH 1TNMA 1AHWA 3WV0A 3O6FB 2YR3A 1QA9B 2ZOLA 4K23L 4B53A 5A16A 5MI0C 3IDJB 4OLVH 2OJEA 4WWKA 3MNWA 5GS0D 4TUKL 3PL6C 2Q20A 4ZYKA 4NHCL