4U7KA

Crystal structure of the clostridium histolyticum colh collagenase polycystic kidney disease-like domain 2a in the presence of calcium at 1.9 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
NSLPYGKINGTYKGTEKEKIKFSSEGSFDPDGKIVSYEWDFGDGNKSNEENPEHSYDKVGTYTVKLKVTDDKGESSVSTTTAEIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
molecule keywords ColH protein
total genus 18
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u7kA00
4NKDA 2P49B 4OLUH 1P7QB 5MEPB 3MRHA 4U1NB 5DLMH 2WUBL 4HJ0D 4U1JB 4X4XA 3QSKB 1NAKH 1RZKH 4N8CH 2UZXB 1HHHB 1AO7B 3BAEL 4QTIH 1ORQB 1I7RB 4BZYA 3ARED 4JFDB 1KB9K 2FIRT 4P23A 1QFWH 5IM7B 3MFFA 3EYVA 3R06A 4H0GA 1TTUA 5BVJA 1XCQA 2VUOA 4GXUN 3MGAA 4F7MB 2R1XA 4LASH 1K8IA 4GRMB 2VN7A 1LO0H 1GGCL 5CSGA 5IHZA 4UOJA 3ARBA 1U3HC 4IDJL 2NXZC 4KI5F 3SDAA 4EDXA 3RNQB 3VXQA 1IGTA 3O3UN 1EMTL 1I4FA 1YMHB 4PBXA 2NX5D 4L8SC 1N6QH 1KNOA 1C7SA 5C86A 4KU1A 5DK2A 1MWAH 1MFDL 1CDBA 4YBQC 1BOGB 3LDBC 3C5SB 1T21A 3Q1SH 1Q9KB 3DYOA 4PJ9A 3L5HA 1N59B 1I8MA 2VDQL 3KPTA 5BS0A 1LGVA 1MWAA 3ULSB 4EUPB 5I1GL 3OAYH 1U92A 1KGCD 3BN9C 5IB3B 2FX8H 3H9YA 4JRXB 5FCUL 4LARH 3RI5K 2OK0L 3QNZA 3VI3E 3B43A 3ARBC 5EA0H 4OFYA 3SDCC 5KAQF 1DBBH 4ODTH 3LRHA 4FZ8L 3V0VB 3SDDB 2VISA 2AS5M 4Y16B 1P5VA 1G6VK 2B4CH 5E1AA 1LE5A 1KXTB 3FQRB 1MIML 2X7LB 3C5JA 3MROA 2PETA 3GBNL 4KJPC 4N5ED 3CXDL 1DVFA 3VCLA 1RIHL 5K9QI 1F11A 3MRQA 4P2YA 1UWXH 4PJXA 3CLEH 4RGND 4JQIH 2OS7A 4PB9L 3VGFA 4Q9RL 4M5ZL 4NRYB 3VU2A 1YEIH 1R5IB 4PV9A 5GGSB 1HSBB 1BVLA 4QHUA 1BBDL 1H0DB 2V7HA 2WLZA 4ELMB 4F33B 1XGUB 4M8QB 1BECA 1UYWH 4P5MA 4YXHH 3IDJA 1NC4B 3CXDH 2DQCH 4R0LC 1BLNB 1CGVA 4NC2B 1MIMH 1U8JB 1UACH 3MXWL 4OZFG 1E6JL 5E2VH 1EA9C 4PJDA 4R26L 1PDKA 4JRWA 3PV7A 4EI5A 1VDGA 5C71A 2UVFA 4E9LA 3N1MC 3DVNA 3I75A 5GGQH 4OF7A 3DVGA 4AIXA 3P2TA 1ODAA 5IB2A 5HDLA 1EAPB 5ESAA 3MREA 4RAUA 5I18L 2X1XR 2GUOB 2EIZB 3P4OB 3BZEB 5L2JB 5D1XC 3VFVA 2IH1A 5BMFH 3VMPA 4ODUB 2ZOLA 1T2JA 2YOCA 3HAEH 4XC3L 3W0WD 4K23H 1O7VA 2A74B 1JGUH 4YUEL 3BXNA 4G8GA 5GS2D 1A1OB 1FDLL 4HUXB 1LEKA 3THML 3AS1A 3QZWA 4LOUC 2BVPB 3MRPA 3ARFC 1D5XA 4KK9D 5CJQH 1FSKC 4QO1A 4ELMF 1RULH 3G5VB 1JWSB 1KPRB 1QFWI 3BO8B 1QO3B 2BSSA 1KC5L 3PWUB 5BV7C 3L3KB 4WW1A 1A3RH 2ARWA 2D03H 5IVOA 1RPQA 1OTUC 3VFMB 1JPFA 5DLML 1T1WB 2OLDA 2HFTA 1U91A 5LGHH 1A4KB 4Y5VB 4ZG1A 1P84K 2GY7B 1CDJA 4OKVB 5JXEA 5KN5B 4XZUB 1MFBL 3OBAA 3FAXA 3BEWA 3V4VH 2Z8RA 5DHXB 5FFLA 2DQUH 4JN1H 4N8VA 5JO5B 2J88H 2E7LC 3EHBD 2BHUA 3HPJA 3QUYC 2AV1B 3ARGD 3MV7A 4X99A 3M8OH 4QTHB 3L7FB 4KHTH 5E6ID 4LLAA 2P8MA 1W72B 1S9WB 1RUQL 1CZ8H 2EH7L 4NKIH 4TTGA 3F58L 5EPMA 2RAMA 4PJEB 3TPUA 5CGYD 1A7NL 1TZGH 3QUMB 5C07E 1JL8A 2CSPA 3KXFD 1PZ5A 1Q72L 2DIJA 3MOQA 4Z0XA 2HFEA 3GSUA 4JAMA 4PJAE 5C0AB 5JW5B 3K8MA 4A2LA 1XH3A 3OG6B 2DBJA 2Y7QB 2ZG2A 3EO1B 5IGXH 3PQYA 1FZKB 1U42A 4PJ8B 3GGWB 4MLSA 2NY0B 5JQ6H 3LRSA 2O5ZH 3DI3B 1KN4H 5LBSL 1T2XA 5HYFA 2ZUWA 4Q2ZA 3WFBH 5IIEA 3M07A 2VDLH 4OF8A 2HFFB 4UT7L 4WV1B 1II4E 3T2PA 5JDSA 2EE2A 5HI5D 4HQQH 5C0RH 5B21A 3UC0H 2AJVL 4BZ2L 2W0PA 3P40A 2DQEL 5IOPA 35C8L 1U8NA 1KG0B 1YPZA 4OV6F 3V0AC 4ZOCA 3PWLA 4JPWH 4LEXL 2G60H 1FCGA 2X1QA 1ZT1A 5E0QA 3GKZA 1Z0NA 4L3CA 1UENA 2EDXA 4LCCA 3TGXA 2A6KA 3NFSL 4L3ED 4DQOL 3QYCA 1E4JA 5HJ3B 1DBMH 1QRND 1AE6L 2Q86B 2C3HA 1EFXD 4LKCB 3QDJB 1ORSA 1X5GA 4WWKB 3ZDXF 1BZ7B 1WICA 4GRLA 5IMOA 3G5YB 3HG1D 4LVHC 5E8DL 3JWNC 1CG9B 3FQXB 43CAA 3V4PL 5KSBF 2I60L 1T6WA 3CSGA 5HI5C 1O0VA 4RNRA 4OZ4B 3VFUA 1AKJD 4PGDB 4DJMA 1BP3B 4LLDB 4WFFE 1MI5E 4WRLA 2BX5A 1JNNL 3DBXB 4GBXA 1WISA 2Q8AL 1A6AB 4G6AD 1T3FB 4R7DA 3X14B 3QQ9D 4CN1A 1YYMH 1KCVH 4ODSH 5F97E 5F44A 1MNUL 2BNQE 4E5XB 3EYOB 2PYEB 2A38A 4HXAL 5AD0B 1UJTA 4NQDB 1JGDA 1WQVT 4XHQA 2XWBB 4MJ5A 3K8KA 3GIVB 3NZ8A 1BGXH 1U3JA 5JNYA 4JFEB 2A83B 5TQ0L 3QHFL 1V5JA 1A3QA 5E1HB 1B6DA 3UJIH 4HFUL 4FQXB 2Q7YA 1D5MA 3C2AL 4V2CB 3GMRA 4CADA 3GSOA 2BCKA 2DWDB 2FCBA 3MRNB 2BY0A 2ITDB 2PO6D 3DGGA 5E5UB 4DW2H 1AD9A 4DOHB 4FN0A 5LWYH 3RTQC 4LCUB 1CFSB 3GSWB 3CUPB 2HJFA 2K3TA 3HCVA 1CE6B 4NWUL 4GG8A 3KNBA 2ICWA 3EFDH 4XCFH 2JJSA 3PHQA 1Q94A 4XRCA 2EDLA 5JPNA 3ARVA 3EDJA 2M2DA 4QRQB 3FJTA 1YJDH 3DVIA 4ENED 3HN3A 1ZHLB 4L8CB 3RWCB 5C2BH 5CJ5A 5DRWB 1U8QA 5BZDB 1MCFA 1QVOB 3U0PA 1CL7H 4C83A 5M94B 5TQ0H 4DGIH 5E56A 3S36X 3BWAA 4GMTL 2CIKB 1WK0A 4KKAD 1G1YA 5I8KH 3QHZH 1MCOH 5BRZE 1L6XA 1QTYT 1PY9A 5HBBA 5M7QA 2B5IB 3VFWA 4D0CA 1YEGH 4OCLC 5K93A 4HIIB 4DVRH 2VDRL 3GSXA 4N90D 3NCCB 2XICA 4CMMB 1OLLA 3KPRB 4OCSH 1YJDL 3RTQB 3DX6A 5EBGA 3OKNB 3OTTA 2BRQA 2IAMD 4FFWC 1NCDL 1IM9A 4ODHH 2NQCA 3TVMC 3V52L 1YMMD 1FNGB 3F8UB 2PYFB 2HT2D 3PDDA 4FQIH 1FFPB 1IE5A 5E2TL 4NO5B 2DIAA 2OXGA 4NQCD 3QXWA 4DGYH 4GW5B 5I76A 2MFNA 4MXWH 3O0RH 5DJYB 3BPLB 1ZSDA 2C1PB 2QLVB 4UIMB 3JUYA 4KWUA 5DQ9B 3MYZA 4TN9A 1T7WA 3OZ9H 4LCIL 4QRRD 3ILQD 4YGVA 2FJGA 4PFEA 1QSFB 2VDKH 1A6ZA 1XT5A 5FKPB 5DJ0A 1W0VA 2BSTA 3GJFH 2EYSB 1NAMA 1B2WL 3N9GH 2G60L 1BGXL 1K5NB 4H25B 1OAQL 1OGAE 4L4VE 4X6DB 3VE0A 3UC0L 3MRGA 3QWRA 1IM9D 1L9NA 1T0MB 2IAMA 5CBAA 1RJYB 4MX7B 2XFXA 4EI6B 2YSSB 3K74B 3QIUC 2YD2A 3QDMA 4YX2H 3FOMB 1BEYL 1NLBL 2Z8WC 4ZFZA 1HQ4B 3W39B 1MI5B 1G7MA 1JWMA 4U05A 1SJEB 1AFVL 3O11B 4QRSA 1IAIH 2OM5A 5D7KD 3BIAX 2O93L 1OSPL 1YY8A 3QR2A 4NSKB 4O4YH 3P11H 2XTJB 3VFNA 5SWSB 3OV6A 4L8SB 1A7PL 1OCWH 1DDHB 1FL5B 3MA7B 2DAVA 4U1HB 2QKIB 4NFCA 4PLKD 5IVZA 1BM3L 1CLOL 3LKRB 4YQXL 5D71L 1F4WH 2F53E 1Y18B 2R1XB 3G9VA 4POYA 1QQDA 3LPFA 1K8IB 4BFEA 1T83A 3TYGH 2NY1B 1V7NL 2NW2A 3LKQB 4HIEB 1C5DB 1H8NA 4P3CL 3OPZL 2AJVH 2K1MA 1HCVA 3MTRA 3O4LB 4BZ2H 4Y19A 5D1XB 3LN5B 3KS0J 3OJDA 2OSLB 3R1GL 1FZOB 2VOTA 4OAWA 5HY9B 2WBJA 4JM4L 3HC3L 2QSCH 2FBOJ 4O58H 1YDPA 1YNTA 3NAAH 5EZIH 1IC4L 3F7PC 1UH3A 5HYJB 1AO7E 5FIEA 4EI5C 4YR6A 1IGJB 5H2BA 3TCLA 3RZCD 3O8XA 3I2CH 3DO7A 1G6RA 1Z9MA 2VISB 4KKBD 1FYTA 4MGXA 3C60C 4I3RL 2SEBA 5EU5B 4KRNA 4YGAB 5IMLB 1J11A 5MENE 5T1LA 1NGXA 1XF1A 1QLRA 3DURB 4L8DA 1WTGT 4WEBH 3WDIA 1RUQH 5IEHA 5DFVD 2E3VA 4NDMB 5I18H 5T3ZH 3WFHA 4XP5L 2C9AA 5MEOA 4QXGL 3QPXH 4OIBA 4M6OH 2EKSA 3DUUA 4MA8L 2R9HD 4U1LA 3TYFB 4ELMA 4AIZA 5E9DE 5MERB 1U3YA 1MFDH 3C6SA 4J3OC 1NANH 5D70H 3H9ZA 4S1RH 2FH6A 3KPLB 1IQWL 4Y2DC 2Z0BA 5GS2H 4FQXD 4OJFL 2K7QA 2A9NL 4EZMA 3S5LB 5AG9A 3TNMB 4IHOB 2H3NB 3F7VA 4M48L 4YH6A 1GCFA 1CGUA 1U36A 5JPMB 2PYED 4P46A 3PGDA 4YWGL 3FKUS 3L3JB 1JGEB 3RL1B 2EH8L 5T1DH 1A6UL 1TVDA 3CU7A 5LCVH 4JHBA 5IJKC 5D5MA 1NMAL 4QT5A 1WBXB 1XZ0B 4ZUUA 4TUJB 3GI8H 2CR6A 3QJHB 1B3JA 3CVIL 1ITCA 3UTTB 4CUCA 1PVHA 4JFFA 1AHWC 1IAII 2BDNL 1U8MA 3D3VE 3LV3A 3TBYA 1D6EB 1DVFC 4X5LA 4IMKA 2WUCH 3IB4A 4LPYA 1JV5A 4NNYB 2IMMA 1M4KA 5E2WL 2JCCE 1ND0A 3MGTA 4OQTH 4NZTL 2NXYB 2Y4SA 1GGIH 3NVQA 3S4SB 3V6ZA 5IFJA 3MLXH 3FB6B 4MXVE 3G9AB 4K71B 1JPGB 2VDKL 5GGVL 2D7MA 5FYKU 4Z8FH 5T33L 4ZYKB 2D0FA 4V1DE 2Z93B 3VXNA 1WWWX 3X3FL 5AWNH 2V2WB 4JKPH 4WHCA 4L29A 3MV7D 4MD0B 2DQIL 3BMWA 3GMMB 3HUJF 2AV1A 3BPNC 5IB5A 4FXKA 4XPFL 1BIHA 3T1FB 5CZKA 1U93A 4NN7B 4WUKL 4FQIL 5JR1L 3DX8A 3FRPA 2ICWI 1FLRH 1W0YT 2EDTA 5C08A 3UXFA 4XNQB 2JIXD 1RHHA 3GBNH 4X4ZA 3DSNA 3IFOB 4LLUB 5INDA 5DEFA 1UXSA 4J4PC 4G6JH 4QYOB 3U7AA 1CLYL 5L0QC 3ULUF 2YWYA 1GGBL 2HP4A 1FVEB 3DX7A 4FQQB 4K3JH 4RGNE 2X9WA 4O00A 1MCNA 2OJZH 5DS8A 3IETB 2CLVA 4PR5A 3E2HB 1J05A 1HWHB 4OZGA 3AMKA 1G9NC 2VDNH 3MFGB 3QUZC 4JZNA 2NY4C 5HYIA 4GRWB 1XF5B 3B9DA 5EIIA 4QY8A 4JRYA 4P3CH 3O9WA 1KELL 2APBA 3FQUA 4RFEA 1FGNL 3RVUD 3T2QA 4ZUSB 1MWAL 2DQTH 5E5MA 3IJHB 3DSFL 2A1WH 2ZUVA 4UT6L 1ZTXH 1T1ZA 4I0CC 1NJ9B 2FWOB 1F4HA 5IWLA 3N06B 1CE1H 1U8NB 1YPZB 1QSZA 2VABA 4ZUWB 3TBWB 3HS0B 3E3QC 2YPLB 4JKMA 5HDQH 6FABH 2VC2L 4M61B 3V6BR 2A77L 2EXYD 3HI6L 1WWCA 4JB9L 5FHAL 4FQ2L 3BVNB 1DFBH 3ZDXE 1IM3A 2XN9D 3U36A 4PJEF 1MFEH 1NEZA 3KYKH 3WSQL 1IGMH 5EBWA 3KDMA 4F80A 1ORSB 3ZZ1A 5FA3A 1RMFL 2UZYB 4NP4H 3IKCA 4H26A 3RWJB 1YNLL 3QDJD 1IGFH 2XPGA 2AJXL 3ROLA 3HB3C 1ZT4B 4XWGH 5HHOE 1QA9B 1Q9LA 4M7JL 1NCAH 3D69B 4FXLA 5LVEA 3B9KB 4WFEE 3WFDL 3SBWC 1MJ7H 3U7YH 1QZ1A 4KVCH 4TYUA 2WZPD 1XGPB 2R29H 4OT1H 3G6JA 1RU9L 3KWWB 5DMKB 4PRPE 3I3BA 4DN3L 4ZOBA 1AD0B 2HVJA 1R3JA 5J12B 3SGJA 1HH6B 3U1SL 2NY3D 3QH3A 4DUVA 2XZAH 3BE1L 1X44A 1CXFA 4PJIF 2CUMA 3EYQD 5E94A 5A2KH 1MCWW 2DYPA 3C8KA 2DJ4A 2EKJA 1FRGH 4KKNA 3WBDA 2XTJE 5EU7E 4X4MA 3O2DA 32C2A 5JOFB 3MLSH 3GIVA 3NZ8B 5JNYB 4LPXA 1P4IL 4AG4L 1P2CA 1S7TB 1PY4A 3Q48A 1D5MB 2AK4D 1J1OL 4P99A 5D2NA 1I85C 4L5FH 5CILH 4PJAA 3HUJA 1KJVA 3UP1A 2C4FU 1EVTC 5TF0A 5FYJH 5IMKB 3RWEA 4L9LA 1KULA 3LQZB 3ARFD 5E6IB 3HE7A 5E99H 2AQ2A 3BD3A 3QULA 5I17B 5B8CC 4DVRL 1Q9OA 1KTDB 4PRBA 3SO3B 4CVXA 3OX8A 5HYJE 5ACLA 3D48R 3IDGB 3ULVD 2CK0H 1R5WA 1VFAB 1ONQA 4NUGH 4UI2A 3HZVA 2GFBB 4OLEA 1OHQA 2H6PB 1B0GA 2QTEA 1NSNL 1WZ1H 3CSPA 5A40E 1ZHNA 4Y16D 4K8RD 3UTSB 4DGIL 2V9RA 2CQVA 1BD2A 4LSTL 5F9JB 2PYEE 2W59A 4P23D 5DWUL 2Q6WB 2PF6A 2WP3O 1ETZB 2BSRA 1KPUA 2J1KA 4HUKB 2OR9L 3IXTA 1TVBA 1UJ3A 5HPMA 4JJ5B 3QA3B 3BZDA 3TVMB 1UWGH 5L7XH 1RFDL 2ESVA 2DRUA 1I1YA 4NOFA 3BH9B 4NWUH 2H1PL 5EU6B 4OFYD 1TZGL 1EJOL 2J6EH 3HC0A 4N5UA 4CMMA 5BO1H 2VLRE 3SKUD 3HG1E 1EHLH 1ACYL 1AY1L 3H9HA 4NBYB 3RDTC 3ULVF 1QEWA 3W5NA 4HIXL 3QO0A 1HKLH 3VRJB 3G5XB 4AEEA 5FKAA 5H8DA 4FQ1L 2UYLB 2PNDA 4LLVB 2AAVA 1DR9A 1DTUA 4M1CC 4N0RA 1GGUA 3P4MB 3VXTA 1SYVB 3WXVH 1WWBX 5IBUB 1INQB 3QO1B 3GB7A 1I8IA 5DC9B 25C8H 4JO1H 1J1PH 5JORB 4FQCL 2BFVH 1BBJB 5D5ME 1QLFA 2IPUK 1A6PA 4OCYH 4GAGL 3EYFB 5KG9B 1U0QA 5E6YA 4XHJC 2D03L 5IW3A 1DQDH 3DMMD 43C9A 1K2DA 1I7UB 5CKAA 1WEJH 3H0TB 5DD5H 4UU9A 5F70A 3MACH 1ZLSH 4F15B 4XTRC 1JHLL 3MCKA 1MUJA 4NKDB 4PGZA 5I8OH 4DUXA 1A6VL 1NFKA 5DJDA 3RZCB 4PREA 5IB4B 1G7JB 5B22A 5JHDD 2A6DB 5CS7A 5HYQA 1LILA 4KUCD 3S6CA 4HS6A 2HN7A 1WVZA 4Y4KB 3OKMB 1PLGL 1WC7A 1DQML 1XGTB 2NTSP 5IM7A 1Z3GL 4GAFB 3V4UL 1IC7H 2X40A 1BD2E 3STBA 1CICD 5I6XC 3REWA 3ZKXB 3ECBA 2CDGA 3MOBL 1DBML 4ERSL 3HA0A 1XGQA 2XT1B 6CGTA 1OGTA 3K80A 2XXCB 4X7CC 5T3XL 4KMLB 3NZHH 4K7FA 4XTRD 2VLKE 2VR5A 1UADC 4YO0A 5IVZB 5FYJD 1DEDA 3EJYD 4HJGA 4WHTB 3VFTB 3QCVH 3ZKNC 1LMKA 4M6ML 1MQKL 4D0DA 5KVDH 4JFFE 2NMSA 4U1IA 4LPCA 4DKAA 3HR5A 3AY4C 2I9TA 1T04B 1KN4L 5LBSH 3P9LB 1IAIM 2L0DA 1F4XL 3QXAA 1LD9A 1YEIL 4H8WL 1GGTA 1I8LA 5JQ6L 3U4AA 4NGHL 1OTSC 2R0WH 5J9PB 5A2LH 1NKRA 4O2EA 4ETQB 3CFKA 4XCEB 2IBGA 2FX9H 4GT7A 2ICEB 3MXVH 4JCMA 2CDEB 5FGCE 5IMMA 2WBJD 2VH5H 5JLZB 4DCQA 3W0WE 4GW4A 1FP5A 1YN7A 2G9HB 1NCUA 3HFMH 3ZTNH 4XVJL 2HT4D 4JFED 1NUFA 3X3FH 5LQBL 4ODWB 1T0NA 4KQ4L 3GO1H 4Q58C 3F7RA 5EFIB 1DEEB 1YECH 5C8JA 1P7QD 4KUZL 4HAGA 5IB1A 2VXQL 1J0YA 1A02N 1T89A 3MBXH 5DD1L 4PRIE 5ALBH 4WI7A 1FC1A 2V7HB 1S9VA 1T7ZA 5CIPA 1MFAH 1P4LB 2ARJA 4MJID 4ZTOH 1GXEA 4M9PA 4XMPH 4KJQD 4HULB 2QHRH 1LO3H 4PJ5A 4TVPD 4I13B 4MA1C 4FTVD 1RD6A 2Q1EA 3ARZA 4JO2H 1KBGH 2YZ1A 4ENEC 5T3XE 1EGJA 1T5WA 1PX3A 2BOBA 3MRCA 5HYEA 3CDFA 1UZ8B 1EK3A 1K6QH 3ZSTA 3PWPB 5B39B 2HT4C 4LCWE 3ZL4H 3OGCB 3WLBA 3VXPB 3KR3H 1CGSL 1F3JA 4QGYA 5EB9A 5IG7B 3BDBA 2WP3T 4HKBB 3NFNA 4KMTL 2CLZA 4HW6A 1JHKH 5TDPA 3SE4A 5IV2A 3SPVB 2Z31B 3BEVB 2C26A 4OF0A 4KAQH 4A6YA 4UTBL 4C56B 1FDLH 3BZEA 3EGSB 4H0IA 4HZLB 4U3HA 1AO7A 2VQUA 4M3JA 3VXUA 4YUEH 4LP5A 4R90L 3DJ9A 4P4RA 3C6LB 5AZEH 3VXRE 5JPMA 4R7NB 2B1AL 3MBED 3T4AA 3TLRA 1WTLA 1CYGA 1H3PH 1EJ6A 3OB8A 1CWVA 1TZIA 4KZDH 5ECJE 5DXWA 3MRLA 3SDYH 5GGSY 1E28A 1FNEB 5HGAB 3EZJB 5LGJB 1J0HA 1T66D 1J88A 4BSJA 3SE4C 1YC8A 1NEZG 3BHBB 5B3JE 3QDGE 4X5WB 3T0EB 3L3KA 4OZFA 1B2WH 5EOTB 1TQCB 4OB5H 2XZQL 4RAVA 3FB7A 5I1AA 4Y19E 1NH6A 3W2DL 3WL9B 3MGOA 5ENWA 1KTKE 4NCC1 4XBGA 4WHYH 1JV5B 1MCPL 1QSEA 4EN3B 5KZCB 3LKNB 1S78D 2NY6B 2YUVA 4R0LA 1OB1A 4M7KL 5JMOC 2WINB 1RAMA 4BH8B 3VI3F 1D9KD 5EBMA 4NT6B 3QRGL 3V6ZB 5IFJB 1NAML 1AGEA 2R69H 4HMDA 5F1KC 3LEYH 1BQLH 2B1HL 4PRAB 4F2MA 4F58H 2PTTA 3LEXB 4NN7C 2WWMC 1JPTL 3FHAA 5BRZA 5BJTA 1S7QB 1G7IB 5GGRA 1FZJA 2AEPL 1LWRA 5L8JB 5MHSE 5D72L 1CVRA 3MLYH 3G08A 3DHJA 5IFAL 5JTWA 3HMXL 4E0RA 4M7ZB 4MS8D 4U0RB 3FZUD 4ONFH 2NCMA 4X5XB 5AYUH 3MO1A 2C1OA 1GH7A 2AXFA 1TCMA 2CDFA 3ALPA 3PWVB 1A14H 1VADB 5FECB 4RRPG 1EHXA 2DI8A 4NQUA 4NC0B 4LQ1A 4TPRL 3FHQA 2NZ9D 2JIXA 5FA4A 4JPIA 2AI0H 4U6HA 3S37X 1HXYA 1OQOA 1AHWA 3QUXD 2FYYB 5L2KB 3CSYA 2P1YA 1EMTH 3U2SB 1NGPL 3H8NA 2H41A 1D9KB 2DM7A 5AEAA 1HQRB 3LKPA 3FB8B 5FGCB 3UYRL 1FL3A 2EE9A 4OBSA 1LK3H 3BKMH 1B9ZA 3TH3T 3K2UH 5DRZB 2QQKH 3QUYA 3KLHD 5IB2B 3MJ7A 4PRHD 1ULVA 2AVGA 5KANI 4N1CA 1QHPA 1I1AD 2VIRB 4HSQA 1QP1A 1QRKA 5K59F 1FQ9C 3PNWB 5C0DB 1NCTA 4H20H 2BMKB 4U3XA 1KCKA 1A7QL 2C3XA 4JG0H 4MD5B 5DYOA 1U58B 3O6FB 5IW1B 2AK1H 4QOKA 4KVNH 4PRNA 1DQDL 4HX1B 2OMBA 1JNHA 1HSAA 5D1ZC 2WUBH 3GMNB 4KY1H 3PP3H 1DL7H 1J8HB 5K9KA 4HUNB 1RUPH 1C12A 4OCWL 1XF3B 5GHWL 5HHMB 3OF6A 1J1PL 1OP5H 5I30L 5EWIL 4N0FA 4P9HL 3B9AA 4HBCH 2CK2A 4XPGL 4IRZH 4J3TA 4LSSH 3WEXB 5EDXA 1QR4A 4CBPA 1TPXB 5DMKA 4UNVA 2HAZA 1MHHB 4NQDA 3FFDB 5GS0D 5I1DA 3ULUC 1U41A 2E7CA 2B8OT 3PGCB 5CHNB 1XCTB 4LHUG 1NDGA 3FB5B 3LH2L 5IBUG 3LAFA 3V5KB 4G9DA 4OFIA 3MLTA 4JQXA 4LCCC 5CP3A 1X4YA 3VFOA 3DARA 4U49A 1S9WA 1I9RH 2OP4L 4J3SA 3VMOA 1UCTA 4K3GA 3JBG7 1R3KA 1KJMB 3O4LD 5DHVB 2CIIA 1FGVH 4QXWA 3CUPA 1G7QA 4PUBL 2Y36H 1YEKH 5JIIA 2DICA 1G1CA 2DIBA 3GSUB 5B8CB 3ZT5A 5JW5A 2Y23A 4YHLL 3LQZA 2Y5EA 4QHMA 1LDPL 5F7EL 4J6RL 4JQXC 4WGVB 1FZKA 3GHEH 4UQ2A 3MR9A 4WI9A 5ACMA 3D5OF 2RFXA 1BF8A 4PRHB 3DHMA 2Y5TB 2XTJD 3G6DH 1ZXQA 3OKDB 4MA3B 3V7MA 2DLTA 3DI2B 1HHKA 3VRLE 2LTQC 2GJJA 3QDHA 4GKSA 2DL9A 2YD3A 3BGMB 4R4ND 4LL9A 1KLGA 4NUJA 2PXYA 4X7TB 1WAAE 3TPKA 5F9JA 3QJFA 5T1MA 2AJ3B 2BJML 3TBVB 2BRRH 5ITFA 1X4ZA 4KRPD 1J1OH 4WJ5B 1FHGA 4RDQF 3QZWG 3FQNA 4YHZH 3JTTA 4MMXC 3U79A 4GXVH 1A1NA 4NM8L 4PTTA 4Z7UE 3TA3B 3BMVA 4I3SL 2QR0B 1JZ5A 4GRLB 2OTPA 2ADIB 3W9DB 4PP2A 4Y0GA 4LSPL 1HEZA 3FQXA 3C9NB 1HIML 4HK3N 3C09B 1GOFA 1ZS8A 4I9WD 4UBDD 1S9YB 5GGVY 2ZOKA 5TH2A 3B5TA 3L3IB 4TQEL 5KTEL 1ZLVK 1QNZL 1EV2E 3FQTB 3SY0A 3MX0A 2BXZA 3E6HA 1C08B 3D18B 1ZANH 5BOZG 1A7RH 4EOWL 3HRZB 3NPSC 2RJMA 3BZFB 3CFEA 2VO5A 3D0VA 4MJ6A 2PW2B 2RIKA 4J4PD 3KLAB 5IQ9B 4JFYA 3SO5A 3QQ3B 3WNKA 1KCVL 1NAMB 1SYVA 1CVSC 2ENYA 1TJIL 4XC1H 3VFSA 1NUGA 2ADJB 1G7HB 4KHXH 3VGHA 1HZHL 1U95B 4ELME 3PIQA 1PBYA 4U1KA 3MMEA 1FLTX 3QDMD 2Z92A 1AGBB 4P3DB 3O81A 4Y88A 2BNQA 3V5DA 3TT3H 2JCCA 2XRAL 3I02A 8FABA 4PJCA 5CEZH 1KB5H 5HGHA 5EO9A 1UKSA 4Z7UB 4IRJB 5BMFL 4PGEA 1Z9SA 4KK8D 4F37F 3IVKA 5EC1A 3HLAA 3MV8A 2V7NA 2CUHA 3P0YH 4HFWB 4YK4B 5D7SH 5INCB 3GJEA 2F54A 1N3NB 5JIPA 1IL1A 4GO6B 2IWGA 2EYTA 5CZXC 3MLWH 1YY8B 3L9RB 1CE6A 1A47A 5CINL 1UT9A 4GJTB 1DBJL 4PJBF 2DI7A 2NY2D 3MA7A 4JHZA 1YMHA 4PG9B 4I2XA 1HN1A 1S7VB 5I16B 1VEOA 3QIUB 4G5ZL 4CNIB 4MJIE 3ESUF 1G7LA 3VDCA 1CU4H 4CU7A 2VDOH 2R2EA 4DWHA 5MEQA 5IVNA 5E8PA 1BX2A 1AGCA 4JQVA 3FT2A 1NBYB 3ULSA 4EUPA 3QNYA 4RA0C 2HVKA 5IB3A 4HH9A 4RDQG 2E6PA 1H3UA 4GQ9L 5ETUB 2GEEA 2XA3A 2B2XH 4FFVD 3X3GL 4FNLH 1HHGA 4P23B 1PSKH 3P9LA 2IFFH 4FQJL 4KJYB 1ZV5A 3OR7A 1GVIA 5T5FL 4XBEH 3HTLX 4B0MM 4XP4H 3TA3C 2EXWC 3CFDA 4WTXA 3WDJA 3SDCB 3MLVH 2UUDK 1NGQL 2J7LA 5E70A 5FCUH 3RNKB 1F6AA 5IHZB 1CFBA 4JQVC 4PYGA 3DO7B 2NY5C 1TETL 2UZIL 1E4KA 3GI9L 4P49A 4RMUA 4HUUA 4Z7VB 4Z7UF 3U4BL 2HWZL 1GHFL 2CMRH 3EDKA 5I66A 4NOBA 1DQJA 2C1PA 1T0NB 2NX5A 1WFOA 3D0LA 5D2LB 4HV8B 1M7IA 3SGKA 1T80A 4X9FA 1DBAL 3A67H 2X05A 1PGRB 3VXMA 2VLKB 3BSZH 3FO9A 4J1UB 2WBWB 1BJ8A 3AS2A 4Y5YB 4MCZB 5F9DC 1CXEA 1P4LA 1BJ1H 3QEUB 3MRFA 3PL6B 3RWIA 4QRTB 2HG5A 4X6DA 2ZWLT 3CMOH 1N8ZB 3DROB 1OW0A 1VEPA 3ZKQD 2BNUB 2DLGA 1UZ8A 5F9WB 2FSEA 4C55A 3P4OA 3RVVD 2YPVL 3CAFA 1NFDF 1CD9B 4UT9L 4HAFA 2WBJC 1DLFH 4K23L 4XC3H 1DVFB 2Y06H 3QDMB 4WTZG 1F11B 3MRQB 5I1CH 3TCXA 4OLWL 3I6LE 3ZT7A 3CK0H 4NHCL 3SE3C 4NO2B 4UBDC 5B3JF 3UMTA 5F88B 5IW6A 3KPSD 5JQHC 1G7PB 4M8QA 2FBJH 3G5VA 4NRZB 1NC4A 4DKEL 1XGYH 1MLBA 4YDIH 3PF2A 3SDXE 3OKLB 5E8EA 2XZCH 1D7FA 1KXVC 1FV1B 3LQAH 4RAHA 5C7XL 5ADOH 4XP5H 5SV4A 5FDWB 5DMIH 3BHBA 3WD5L 1RUML 4JDZB 5F6IC 1DCLA 2DQCL 3JSSA 5DK2B 1FYHB 4L3AA 1VEMA 3WKNA 2HTLD 2GIYA 4MHHG 1RZ8A 1MPAL 1F90H 1JIBA 3DV4A 5DMGD 1N0XH 4PRDA 1CK0H 1T20A 3O45A 5EC2B 1B0WA 4WTWA 1S7RA 3AMLA 2F9BT 4MZ2A 1OB1B 3ZDYF 3BDXA 1MHPL 3KPPA 1IC4H 5IB5B 4I0PD 3NAAL 3UTQB 2A73A 3BP5A 4K7PH 1CCZA 5J89A 3VH8B 4OZIF 5E00B 4PJIA 1KPRA 3BO8A 1DQLH 3T0AA 1U2CA 1R0AH 1XEDA 4O9HL 3MUJA 1VFMA 1U9KA 3GSQB 3T1WA 1LEIA 2HH0L 1G9MC 2NTFB 1OAUH 1KPVA 3RVWC 1GAFL 1IAKB 1V8HA 5DJCB 4OM0L 3ARFA 3IETA 1TTGA 3SOBH 3TBTA 3V6OA 1CGWA 3O3EB 4HMEA 1VHPA 1UH4A 4OUOA 1PG7H 4LRIC 1VGEH 5MEOB 3QUXA 4LSRH 1LE9A 2V6HA 1YQVH 4PJDB 4RFNB 4OM1H 3PHSA 4U6VL 1A7PH 1UGNA 5DI8B 4CU8A 2NY6D 5J6GA 1HI6B 3PV6B 4JM2A 3DVNB 4NM4H 5IHUH 4KQ3L 4LGPB 3OKOB 3L5XH 4MNGB 3CPLB 4XI5D 1T1YA 3KYAA 5DQJA 2R15A 5B39G 3U2SA 3BD5A 5IF0B 4DAGH 2L7UA 2WIIB 1OPGL 1UB6A 4ZXBC 3VFVB 2GJ6A 3QQ4B 5F7LB 3H42L 5KSVA 4UV7L 4BSWB 4PGDA 2JE8A 3UYOD 3RFZC 3GGWA 4E42B 3VMNA 2P46B 1QBLL 4BJLA 5GQBA 1SM3H 3CDCA 3GSRB 1RZ7L 2X4TA 2M26A 4Q2ZB 5D5MB 3RIAK 3U7WL 4WV1A 1N64L 4QOKB 2C3VB 2QQQA 4LHUD 3WFCL 1MREL 2YD8A 2DKMA 1S5IH 2F53D 4P3WA 5GS1A 1TPXC 1JPST 2NXYD 3QJHA 3VFMA 4Y1AA 3BUYA 1U91B 3C60D 3UBXA 1QSVA 1TXKA 3QFJB 1UA6H 2P5EE 4H5SB 1JPSL 1DBJH 1FVCA 2RCSL 1JGDB 4L3CB 1AGFB 5I8CA 1PYWB 4MJ5B 3ZDZF 2OTWB 5DRXA 3B5GA 3F62A 3O2DL 3R8QA 1GZQB 4ZFOB 4ZOAA 1L0QA 4BKLB 4Z0BL 3L7FA 4JY4B 2HT3D 1UEYA 1A9EB 2P8MB 4ZAKB 4WNQB 5EU4A 4MJIB 1BZQK 3L95B 4AL8H 4RIRA 4GG6A 1KLFA 2DTMH 4OZ4A 4GLRH 5D5MF 2DD8H 4OF3A 2XNAA 1UQSA 2VLRD 5KS9E 3C08H 1SMOA 2EECA 3N1FC 3H2WA 4QRPB 5DK3A 5D2NB 2P24A 1U93B 4R96B 3DXAD 4HK0B 4Z6AT 5I2IB 2CUIA 1S9KC 1RZGA 4OLYL 1RK0B 5C0AA 4NNXA 1HHIB 4KHXL 2FATH 5DC0A 4R7DB 1VPOH 3SN6N 1IFHH 4UB0H 3GMLA 4YXKL 1VKXB 5JMRA 3CFBB 3QUKB 3MBEC 3ZHKA 5EZLA 1XAUA 5GISH 2MPAL 1SEBB 5HHQB 3IS1X 3NCEB 2I9LA 2G2RB 2CIKA 2YD9A 3UZVB 1PEWA 3STZB 3VGEA 5HD8D 2AXGA 4JDTL 5LGKA 5DJZA 1KCUH 4M62H 5C6WH 3TO2B 2F15A 5CCKL 2BCKB 2DWDA 5FGBA 4OFPA 1HDMA 5GS0H 3OKDA 3SGJC 5C0ND 3V7AE 3PGFL 7FABH 1F02I 4NKMB 3Q0HA 1J8HE 3D3VD 4XAWH 1DE4A 2XKUA 1TDQA 5C0BE 2DBLH 3O3AA 4GRWH 1K85A 4LKCA 1KCRH 3TIEB 3AREC 1JF1A 3IDIB 4O2FA 5GRVK 3EFFB 5I1JL 4F57H 4UIKL 3C2AH 3MUGB 3U36B 5KW9H 2IADB 4HFUH 4QRQA 2H45A 3QPQD 4BH7B 4PTTB 1UM5H 1IC5L 3GRWA 4U6TA 3CH1B 5FA3B 3EOBB 1G9NH 2NPLX 3TN0D 1R3HA 4MNHB 3TIDB 2BSTB 4JFOB 3BT2L 3FL7A 3ARDB 2GSIA 5HHNA 1TQBB 1LO5A 4XPTL 1MI5D 1ZA6B 2O61B 3JV4B 1XGPA 4K55A 4XCYA 4JFYB 3LMJL 4X80H 5E9DD 5H35A 4OD2B 2FZ3B 4XI5C 1X5KA 1W72L 5F21B 2WWKT 4KKBC 4PY7B 3QCUH 4IM8A 2I24N 4ORGA 4YHOL 5GZND 1GRWA 1WFTA 3T4YB 1DP0A 3IFLL 3IDXH 4G6MH 3CFJA 4JLRB 3VFGL 4NRXB 2Z92B 4TUOA 4LLYA 3PHOA 3RVTD 3LIZL 2E27H 2ICCA 5EORH 1C16B 2Q87A 5D6DC 4PJCB 2Z4QA 1F2QA 2VQ1A 2ADGA 1WC7B 3CZJA 2VLKD 2R9HC 1NGYB 5D1QB 4PLKC 1XR9B 3C6LD 3K4AA 2LAGB 1OAKL 5IESL 1Y0LA 4GLRI 3QDGD 1QUNA 4LVOC 5IMKA 4WW2A 5EN2A 1BPVA 1IL1B 4HBCL 1D5ZA 4LIQL 1XGQB 2PR4L 4WO4D 5J0BA 4NQVA 1CDIA 1N64H 4OD1L 5GRWA 3GM8A 3EO0A 4K9EH 4WY7H 5JW4R 5D6DA 1T0MA 2IAMB 4YFLF 3V9FA 4F9LC 5SX5K 1ED3A 2FJHB 2EIBA 1A9BA 5I16A 3SDXA 4Y4KC 5E4EB 2LFGA 4HWNA 4G80B 5FYKL 3C09C 2OTUA 3MRBA 5F6HI 4YHYB 1HXMA 1MJ8H 2R2EB 5MEQB 1CFQB 1LO4H 5D4QA 3B5HA 4U6YA 1N2RA 5DJAA 3OKEA 1L7IH 4RGOL 5BW7C 2YEZA 1RZFL 4JZJC 1KGCE 1OM3H 3GMPA 4O51B 4NQCB 3KHOA 5J3HC 5I1IL 4M6NH 5H2BB 4I5BB 4HIJB 2Q8BL 2EH7H 3DETC 3NTCH 5AUMB 5C0GA 4K3EH 4PJXB 4HCRL 4DCQB 4PTUB 3ULVE 2IF7A 4HF5L 4S0TD 4JRXE 5GSVA 5ITBH 4U6VH 4FFZL 4F9PA 3LS5L 4GW5A 2F19L 5I75C 1S7WA 1M1SA 5A3ID 4Z18A 5T1LB 2R4RH 4IRSA 1QLRB 2V2TB 3U0WH 1JZ4A 3WUWG 2QADC 2ZUQC 1S7UA 4XCNA 3U0TA 1TJHL 3X13A 4M4PA 1UKQA 1BQHB 2MMXA 3HC4L 1CXKA 4JHAL 1M05A 1S9VB 5EOQL 2RHEA 1U92B 4L1DA 5HD8C 1A1MB 3FCTB 3BZ4A 3MV9D 5MERA 2XTJC 5EU7C 3OXRA 2HKFH 4Y2DD 1IKNC 5DZOA 3L1OL 3VWJD 1UB5B 2P5WA 5D7LD 4PJBB 3SJVB 2BY3A 4ZNEE 5CMAA 4Y16A 2ZKHL 4YPGA 1MLCB 2EE3A 5FYLE 3MLYL 5D72H 3OKYA 2UWEF 3DXAE 1KIPB 3AY4A 4IJ3B 4KRPC 1A4JA 4X9IA 4EBQH 5E8NB 2HG5B 4M8VA 2FLBT 4AL8L 1SY6L 4Y5XA 2Z31A 3BEVA 3O2VH 2NY1D 3IJSA 4B5EA 1KJ3L 4P23C 2BVEA 4NHUA 3PDOA 3WXWH 1GGYA 3IGAA 3R06B 4JRYE 3MJ9L 4FABH 4J8RA 3VFRB 3UDWC 1OP3K 4P5MB 4LMQI 5LXGH 3V6OE 2X2YA 1QO3A 3QUML 1XFPA 1LNUB 3D39B 4CJ1A 1XGTA 1I3VA 5T1KA 3DTXA 4YHPB 4L8SA 1KB5A 4XBPA 1I9IL 4K3DH 4D9LL 4G9FB 3EYSH 3MXWH 4QWWC 4PJFB 3SDXF 5EO1B 3SKOB 3OMZA 3BEWB 4LQFL 1KIQA 4YXHL 5CP7B 3G6JE 4X6FB 4TNWF 3WFCH 1A3LL 5I19L 2W9EH 5EO0A 5KVEL 1FVDB 4WWKD 2YKLH 2F53A 3NH7H 3BPOB 1EFXB 4M5ZH 3RHWF 4Z7WA 3WL9A 4W6WB 1SJVA 3V8CA 4HG4J 3MNZB 3DXAB 2OYPA 3CK0L 4FFYH 4N9OB 3ULUH 4JRXA 3I6GB 1FZOA 3TZVA 1RURH 2HTKD 4C54A 4O5LL 3L3JA 1P6AB 3FQWB 3LVEA 5JDJA 2R0ZL 1AKJB 3O2WH 3BIKB 5ANMA 3EZ8A 5MI0B 3CU1A 1FH5L 3VXME 1WF5A 3WNLA 5GZOC 1IGJA 4LK4A 4MNQB 1S7RB 5IUSA 1S7SB 1L6ZA 3F5WA 2FX8L 1CGSH 2AK4E 1PD6A 5C9KA 1TQCC 3E6FB 4PJ8A 3GMQA 4I48A 1N4XL 1DBKH 3F12A 4HXBL 4NFBA 2EDBA 5DRNA 5IROA 1D3CA 2AXJA 4OKVA 2WM0A 4PJFE 1RIVH 3DUSA 4PJIB 4OLXH 3RU8H 1E27B 1MHEA 4XNUH 3MCG1 5DEZA 5DJ2B 1LEGA 4I4WA 1NCWL 5L0QB 5GRJL 3RVXC 4LDEB 5DVNA 4UDTA 1X5JA 4BK4A 1FNSH 3RWHB 3MNWB 4OCXH 3JWOL 1G0DA 5FHBL 4KRMB 2VR9A 4Y2OA 4RZCA 4HKXB 3MLZL 3T65A 4ONGL 3GZKA 2AEIT 4HPOH 3P73A 1IZJA 3P77B 4M7LL 4LPTA 4UDUB 5GJSL 3MOAH 3T09A 1CBVH 4XP4L 5F1OB 1VGKA 4K7PL 4Z7WE 3T2NH 2YPLA 1JGVH 4P0DA 4KTEL 3CX5J 4C59B 4FNLL 4M93C 1WFUA 1QRNE 4XVSL 4K2UL 3I84A 4MAYD 3MLUL 3IFOA 4LLUA 5INDB 3PQYB 1Y6MR 5FK9B 3VW3H 1FFNB 1U8PB 2WIMA 5C0DA 4AMKH 4Q6IB 1B90A 4Y4FB 1FFQA 4P2RD 1MJUL 5IVXF 2EO1A 5DYOB 3RWDB 1CXHA 4M1DL 4LHJB 2YXMA 1A6AA 2R8SL 3X14A 4NQXA 1H3WM 2J12B 3S96A 4OZIB 4HEPG 2DQJH 2P8PB 4LEOA 5ICXA 4RA3A 5FYLL 5I73B 4LCCB 2ZPKH 2E7LA 3O6FD 1WZLA 2BC4B 5I1EH 3HG1A 5JO5A 2YPKA 5ESAB 4X7SH 4PJCE 4P2OB 3S3PA 1GZPA 3G6JF 5CZVH 1EGJH 3C8KB 3QEGL 4R97C 5TDNB 3HS0A 5EUOF 3C2SA 3MRNA 3D9AH 3TBSB 5TE6L 2IH1B 2F74A 3B3IB 3IFLH 4G6ML 5BQ7A 1PLGH 4LRIA 4RWYH 3WHXA 1KFAH 4LFHG 3IU4H 4JDVB 4U1MA 5KVGL 3QFJD 1HNFA 4WCYL 4YXLH 5CGMA 3NA4A 1NFIA 5L2KE 1KF9B 1A6WH 5JPNB 1G6RL 3B9KA 5GGTA 5F3BA 1UQSB 3KLSA 4FG6D 2ZCHH 1X6LA 4OGYL 3UZQA 2DLEA 1FVEA 1ZGLP 1PQZB 1AD0A 5FV1L 5IIEB 2EYRA 1J18A 3CXHJ 3EW3B 4KZEL 2CKBL 3LS4H 4HPYH 1LK2B 3T04D 2OL3B 3U0WL 4EXKA 3ULVL 5I1LB 1R5VB 5FECA 1R3IL 4MB4A 5F7WC 1FSKB 3GMRB 5IR1A 4QY8B 2IBZY 3UBXI 4EIZC 3CFCL 3KPSB 2D3VA 4ZUSA 3LKSA 1UJ3B 2ZUSA 4OZGF 2HRPH 3NIFE 1A5FH 1BAFH 3ARGA 5TFSH 5K9OA 2V9TA 1PAMA 1I8KB 3W9EA 4Z95H 2IG2H 1NMCB 1QBML 1E4XH 2VR4A 4HLJA 2YUXA 4ZTPH 2QSVA 2B0SH 1OTTD 4EVNA 1RY7B 3H3PL 2O5YH 4PJBE 1NCBL 2NY0D 1BFOB 4FP8H 3HE7B 3QUZB 5C09A 2X1PA 5KS9B 5EU6E 5I17A 1YMME 4MAYA 4PJFF 1UM6H 4C58B 3Q3GA 1LHZA 2AKRB 3P30H 3PP4L 1GSMA 1NMBL 1XF4B 1W0VB 4DN4L 3N85L 2GFBA 3MLPA 2IPKA 3MUGA 5D9SA 2R23B 3MQIA 2FIKA 1S7XA 3G6AB 1INQA 3BKYH 2AEWA 2DLFH 4HLZG 5L88H 1VPOL 1KEMH 3IYLW 1TQBC 4LRNH 2F5AH 5IFHL 4YFEA 4RGMB 4O02H 5DHYA 5K9JL 5DSCA 4NPYA 1KPUB 3W0WA 2O5YL 1YEKL 2VLMD 4P5KB 5HJ3A 2X4RA 4ZUTA 3L3DB 1QSFE 2NY0C 4L8BA 4D3CL 5E94B 4KTDL 1CDUA 5KVFL 1KCSH 4XP9L 5J1SC 4U1KB 3FFCB 3W39A 1A0QL 3DGGB 5DJDB 3GBML 4KUCF 2RBLA 5E7BA 4C4KO 2ED9A 1LO2L 5DQ9A 4EI5D 4F9LA 2VLJB 4ORGB 1J9CT 4YJZL 1R3IH 3PWPE 3EJJX 3BPLC 3MNVB 3QEQA 4ACPA 2NLJB 4TSAH 4PJAB 5DJ8B 5IP4A 1KTRL 5CEYB 4WU7A 3O6KL 1Q0YL 1QG3A 5K9JH 2MSPA 5DZLA 4KZEH 2CH8A 3OB0H 1RI8A 1N3NA 4BUGA 5BXFA 4PJGF 1ZHLA 4J3UA 1V3JA 3DIFB 1G7QB 3IAGC 1U8LB 4MQ7A 4NQCE 4AEHL 3EJYC 4XPAL 1CS6A 3T0DA 1FZMB 5TE7L 4MAUL 2P44B 4YAQA 4AMKL 4JVWA 3UPCA 5EN2B 2I5YL 3RTQD 3QWRD 4OD3L 2A2QT 5D1QD 4YIQA 2HLFD 5C08E 3HPLA 4TQEH 5ICYA 4UAOB 1NCAL 3HR5B 1JTOA 3G5ZA 1YPZE 3FN0L 2B0SL 2W0LA 4YHML 3HNSL 4XWGL 2ZUYA 4W6YB 1LD9B 2J4WH 3I9GH 1A7QH 3N1QC 3QIBC 4YZFE 3QEHA 4Z95L 1NBVH 5HPMB 1LP9A 2PN5A 2DOCA 2F5BH 2GCYB 1XCQB 2BNRE 1UEMA 2H32B 4ZPTB 3WN5B 1DANU 2LU4A 2DBLL 4MA7H 3KPNA 3FOLB 4G80A 1OT2A 1I9JH 4QRRA 3T2OA 1HYRC 2P7TA 3R4DA 3BKCL 3ZTJH 1FYTB 3K81A 1HNGA 3UYRH 1FFOB 2P8LA 4HBQA 4X6EA 1LVEA 2HYMA 4JFDE 2BJMH 1FG2B 3GEWB 4M1GH 3GKWH 1YQVL 1A1NB 1ZK9A 5I1HL 4X9HA 4I5BA 5ID0B 2LV4A 5F8RC 3MYJB 5T3ZD 1MVUB 4HPYL 4OLXL 5FKPA 1JWUA 2UYLA 4GW1B 4FZEL 4KK6D 2VITA 5HYJD 1OAZL 3NGBC 4ZO8A 5MEND 5JOPE 2V2TA 4NJAL 2X41A 3SDDD 4CVZA 1F3RB 3VRLF 1MOEA 1BZ9B 3GHBH 2YBRB 3QG6A 3S35H 5GGUA 1I1FA 1KJ2L 4QCIB 2FO1A 4HWBL 1M05B 1P53A 4KK5D 3FTGB 2DM4A 3VXOA 4MZ3A 1T5XA 5DK0B 4NBXB 2UUDH 4R4BA 4NZUH 2KQNA 1MFCL 2YD6A 4G6JL 4MX7A 4WCYH 1GC1C 3W11D 1I7RA 4R2GC 1JPTH 3IU4L 5TDPB 5IV2B 3WUWA 3RZWA 1G6RB 4YHYC 4QXUL 3QXUA 5IMMB 5CMAB 1EEZB 3WHE1 4YPGB 1G9EA 3MFFB 4WUKH 2X4QA 1L7TH 4OLVH 5JHLL 3AFLA 2G5RA 1J8KA 3DRQB 3L3GA 3E8UH 2VL5B 4FHBD 4RX4D 5CZVL 1FNSL 3O2DH 4GMSH 3CNKA 4QRSB 4W81A 3IS0X 3IDJB 3SDDC 2GTWB 5GIRA 3QDAA 1EZVY 4ZUVA 4K94L 3FAWA 5I8EB 2XG5A 3S7GA 5BW7A 1DUZA 1U2HA 5A3IC 2OR7A 1U3HA 2QEJA 3QXDB 5DEGA 3RNQA 3VXQB 3B4NA 1BVZA 5F71A 1FIGH 1U8MB 1W2KT 5JHDA 1NL0H 1J5OH 2MQ0A 1AIFA 3PWJA 5E9DA 1VA9A 3TN0C 3O3BB 3DVGB 3NA9H 4YPJA 1YEEL 3EOTL 4W4OA 3FO1B 3TJEL 4Q6YA 2F54E 3QUZD 3JV6B 3C5ZA 2FX7H 4HCRA 3VXUE 3DMMA 4RWHA 4G43A 4UILL 3PWPA 2QQNL 3SKOA 3RVUC 2AEQL 4R2GB 1AQKL 3UTTE 3MLUH 1G7LB 3LPGA 2AK1L 2XIDA 3P4LA 5EO0B 4I77L 2AXHA 1LEKB 4HUXA 4LSUL 3LQMA 1MF2H 1RURL 4S10A 4C56A 3U4EA 4GBXD 4YNYB 4DKFH 5L9DL 2AJZB 1KN2H 2BXYA 4WI5A 5CEZD 3O8XC 1U3HD 2OL3L 3C6LA 1L4IA 2GYSA 1RHHB 2YD1A 2A6IA 3T4AB 3PWUA 1EBAA 1QKZL 4X9GA 1RZIB 4PD4J 4Z7VE 4UUJB 5BOPA 4OCXL 3RQ3A 3MJGX 2JELL 1XGRA 2A9NH 3GBLA 3UPRB 3O6LH 4XZUA 4TOYH 4PR5B 1ZT7A 1CGTA 2UWEA 3HZYB 1XF2A 4S1RL 5EUOA 1S3KH 1QLEL 4M5YH 3SE3A 3OQ3B 1KN2L 4HUUB 3LPWA 2BVQB 5I1AB 3UTZA 2EZ0C 2VXTL 2NNAA 1JPGA 3C6LC 1MIEL 4QTHA 3TEUA 4E41E 2DL2A 3GI9H 5FA4B 4FQLL 1KIRA 1HINH 3UROR 3MV11 4PJ7A 3ZO0A 4HKJB 2NY3C 2NX5E 5LQBH 1M7XA 4FXKB 4DKFL 1X4XA 2VABB 4ZUWA 5TPWH 3OAUL 3PXJA 2IPTL 5D93B 2R0ZH 5HPOA 1BQUA 4FQJH 3MRFB 2JB5H 5EOCL 4HZAA 1WAAA 5ISZB 1F58H 4JR9L 5EUKB 3L3HA 1RJLA 3LY6A 3DGCR 3EJZC 4LCWA 2NR6C 2X09A 3F6LA 4ZS6D 1QBBA 2IAND 1BQLL 3IU3A 4AY0A 2EC9T 1F2XK 2G5BB 2GSGB 2PW1A 4OF6A 5ANME 1JNLL 2BVPA 4MDJB 3CDGA 2NY3B 1XGUA 4OZGB 3SCMD 2NYYD 2APWA 1EEQA 1CDCA 5IQ7H 1BLNA 1J0IA 2FJFA 5C6PB 3NA9L 4WFHD 3UO1L 2XWTB 3SCMB 3NIGE 3RUGF 5HI4D 2N1KA 3MA9L 4UZGA 2FB4H 3BH8B 1OAKH 3TO4D 2ZUXA 4E41B 5E5MB 2HVJB 4YDIL 2OJEA 1R3JB 3QISA 2E5EA 1KIUA 1AQDA 4AEIH 3A6BL 1WBZA 5IK3A 4N8PA 5LXGL 5D7IF 4XNXL 3VG0L 1DANT 3FB7B 4GKZA 4MQXD 1IGYA 2JK5A 2YN5A 1W72A 4YBLB 4PS4H 4ZYKA 3SCMC 4NBZB 3JTSA 4FMKA 5L6YL 2A74A 5CIPH 1JZ7A 1JCKA 4NWTH 4XPBH 3MLRH 4NJ9H 1GZPB 1IGCL 1L0XA 2VZTA 4B7IA 1EDQA 1W8OA 5GGTH 3QZWB 4G6KH 4MXVF 4IS6A 4DZ8A 3LMJH 1CN4A 4LVNC 4OGAC 2W0FB 2EDRA 4XNQA 4RIRB 5JUEH 4EDWH 1KJMA 1BIIA 1MHCA 4G8GD 4NN5C 4UTAL 1T1WA 2CKNA 3UTTA 1RZJL 4KV5E 1N26A 2VWEE 5KJRH 3HI1B 3CD4A 4UMGA 4YDKL 3BP4B 3GRWL 4M43L 5KN5A 2DQDH 4FQCH 1HHIA 4YHIB 1F00I 2A83A 4EOWH 3H7BA 3IFPA 1T03H 3UZEA 3KGRA 3MRIB 3N50A 3WXVL 4FTVA 1AXSB 4OTXL 4D9QE 5J13C 2UV3A 4YBQD 1JE6A 5I0DA 2EEAA 2CO7B 3K8LA 4X6BA 4HF5H 3KPOB 3OJMB 2BSRB 3JZ7A 5ITBL 4LPVA 1TETH 2UZIH 2XQBL 4YHKH 5ACZB 1P4BH 1FL6B 3VXNB 1IMHC 4X83A 1YUHA 4HC1H 3OZ9L 3RIFK 1P2CB 4OIIH 4NNPL 1AHWB 3GSWA 2X1WL 4PRPA 1F3DJ 2UWEE 5ID1A 3CSYB 5FCSH 4OBRA 2C3WA 4GBXC 1SJXA 5DGQA 1NKOA 3LCYA 2MKLC 3FB8A 4XPAH 1FORH 3OKKB 3U6RA 1K4CA 2FX9L 2YD4A 1IEBA 5E2JA 4ZSOE 3HE6B 1ADQL 4S2SB 2HTLC 5F8QC 3K3QA 1CT8A 1I1AB 4BSVB 5IF0A 1I8KA 2DLFL 5C3LD 3P0VL 3LRSB 4XH2B 2GJ6B 2XPGB 4K9EL 4AYFA 1N5YL 3ETBF 3L5WB 1S9YA 5F7FA 1ZA3B 2Z35B 5C6TH 2E6JA 4UQ2B 3EBAA 3JWDC 1TIUA 2DJUA 3ARQA 1NSNH 3RY5A 5EIIB 4LLWA 2FATL 1IC5H 2W60B 4GG6E 1BBJA 3I6KB 1C12B 1CIUA 1MCDA 4JFDD 5SX4I 4JM2D 3IXTB 4KDTC 2IPKB 4U1SA 4IIQC 4KXZH 5FOJA 1PKQB 1BOYA 4DVBB 2EDJA 5BS0D 1FORL 1YNKH 4PJ9D 2NY7H 4R3SB 2FWOA 1I9JL 3ZKXC 2X4PA 2DB8A 4HD9A 5IEKB 4J3WA 5CJXC 2EXWD 5EZJA 1MUJB 3HZKB 3HB3D 5EZOL 4EN3D 5F7UA 3W0WB 3S88H 4GAYA 3VFGH 3V8OA 1KLUA 4Y4HB 4RMQA 1XCTA 1ZSDB 3WV0A 3BKYL 5D2NC 3U30B 2YUWA 3NACL 1FNHA 3VWKA 4IIQA 4OQTA 3KNBB 2RCSH 3RGVB 5E4EC 4LOUD 4S1QL 2AV7A 2CDGB 3D85A 1NGZA 4HWZB 3PE9A 4Z5RA 1KT2B 2OXHA 4V1DA 3S36H 3AREA 2P24B 2BNRB 5D7IA 5MEPA 5IT2L 2I07B 3P30L 1CD1A 3SKJL 1C5CL 4OT1L 1A7RL 3QH3B 3H6JA 4FQXA 4OIIL 5C0AE 1VKXA 3H42H 3C08L 3MJ6A 3D87B 4OSUH 2DDQH 1CICB 2VE6B 2OCFD 4H20L 1NBYA 5FB8A 3EYVB 2R0KL 2PUQT 3IF1A 4P5TA 1U6AH 1RVFH 2YUZA 3KPRA 4L4VB 5DUBB 3QA3A 4XP6L 4PJEE 2CRZA 5LAXB 1KCSL 1HCFX 4QOKE 2QQKL 5DJ6B 5C0JB 7FABL 1NC4D 2GK0A 4U6YB 5F9AC 5T1LD 1X3DA 1UCBL 3V6FB 4PJ7E 3BPCB 4HUWA 4K7PY 2D0GA 1AXIB 1VGEL 4KV5F 4O02L 5JUEL 1M7DB 1G6RH 1UVQB 5HI3D 5EOCJ 2DQTL 1QSFA 3UCRA 1Z0MA 5FKAB 4HWEH 4RISH 1NDMB 1K3IA 4TPRH 4Y19B 2M1KA 4HJGB 2QQLL 1OAUL 4WHTA 2ZZUT 5GPRA 3VFTA 1AI1H 5GRUH 1JNLH 2GK2A 5TF1L 3CH1A 3HNTH 3CZFA 4QF1A 2IGFH 3BZFA 3D0VB 3VE0B 2VDML 5ILTH 1BWMA 3SDDA 5EZOH 1MFNA 4BA8A 2X1OA 1FN4B 2VDPH 1KEGL 2VXSH 3SEPA 3LQAC 1EGJL 4JZJB 3ZKMC 4WW2C 1MCQA 1FFRA 4KMQA 3TVMA 3C87A 4XMKL 3WJLC 5H94A 3RPIA 1JHTA 1K8DB 5SX4H 2WNGA 3TNNA 3PWNA 5FYLH 4UOW0 3LEYL 4QHKJ 2ZSWB 3MA9H 1VACB 5D96B 1T0PB 3V5DB 1G7JA 1W0WA 5DJYA 5KSAB 2DQIH 3VXUB 3DV6A 3QFDB 2R8SH 1RV6X 5EFIA 2HRLA 1F6AB 4P59L 5C0CB 2JJTC 4TRPH 1JTPA 4P2RE 3TJHC 3WO3B 4Y8DC 3VJ6A 3S5LG 3F7QA 3MV8B 2V7NB 1INDH 1UA6L 4JFDA 5HHXH 1J10A 4BUHA 1NFDB 1IT9H 1J0JA 4U6XB 4PGJA 1CXLA 5DF0A 2JB5L 5EOCH 4LF3A 5MENB 4HS3A 4JREB 1KENL 1JYWA 4N9GA 1JVKA 3KPQB 1EEUA 4EEEA 4IRSC 2QJDA 4HUVA 1N7ML 1AIFB 2QSQA 3PWJB 4YDVA 3C8HA 4ONOA 5L9DH 3SDAB 4EDXB 4RBPH 1IEAA 1IGTB 4TSCL 3VXRB 4K2UH 1R24A 4UU9B 2CKBA 5KBNC 2X70A 4A6YB 1T4KA 1OPGH 1G7MB 2DMKA 4QT5B 2PO6C 1YEFH 4FTVE 3CFKB 1T03L 5J1AA 1Z5LB 4WW1B 4ODBD 2W65B 2A6JB 4N0CD 1F6FB 5FUOL 3ZL4L 5CEXB 3BP7A 3SDAC 2DQFA 3AM8A 3DPBA 3QNZB 2SEBB 2QKIA 1K6QL 5EU5A 4XX1G 5CBEA 1E6OL 1ZGLA 3GMPB 2DI9A 4NRZA 5E8OA 4Y5VC 4PJGB 4R6UA 4G8IB 1BOGA 3ZMRA 2KDGA 1RZJC 4ZO6A 4HKZB 4R26H 4X99B 5GGTL 3B2UC 1ERNA 1N4XH 4HXBH 3GDBA 4JPVL 1UACL 4LKXB 3MJ9H 4U6HB 5CD5D 2EDWA 4OAWB 5EU6D 3HNVL 1CL7I 2NY4B 2VDNL 1EXUA 2VLRB 3O9WD 5DD6B 5HY9A 4EQ3A 5JXAL 3IXAB 2R2CA 2ZNWA 5IJKA 2J8HA 3WS3A 5I6XB 2YZ8A 1FE8L 4Y2DA 1FH5H 3I3EA 2QQNH 3T1FA 2NNAB 1QFUL 5DI8A 5MI0C 1BQHG 4MWFB 5KVEH 3F7VB 3MXVL 1I3RA 2VXSL 4XCEA 1KCLA 1XH3B 4D9RE 2PKDA 3CPLA 1G7IA 2EIDA 3FONA 1JZ3A 4QYOA 3CMOL 1WWAX 5F7DB 4CW1A 1MVFA 2B4CL 3HNVH 1OGAB 1MH5A 4X6DE 1HSBA 3SGDI 1H0DA 4U0QB 1NGWB 5F1IA 3QG7H 1BMGA 3C60B 5JDSB 2VXTH 4OKDA 2DJSA 5KSVB 5L2KD 2C4XA 4JFPB 2MKWA 2ZG1A 4EJ1C 1WCQA 3L7EA 4JFQA 1UFUA 3KPRD 4U1LB 3TYFA 3QIWC 1JBJA 4M1GL 4JPIB 2IQ9H 2EE6A 2P47B 2PCPA 5EU3B 3K2MC 5KOMC 2MNUA 4B50A 3OKLA 5E8EB 4I18B 1T5WB 2BOBB 3S96B 2EDFA 4UOW1 3REVB 4OZHF 1SVCP 2LE9A 1FL3B 1MHHA 4XP6H 4NO3A 4UINH 4U2YA 3FT4A 4ZDHA 5ILTL 3QCTH 4XBEL 1H3PL 5D6CA 2KBGA 2IANA 1WT5C 1FAIL 2DQHH 4NFDA 5JIKA 4PG2C 2DDQL 4HHAA 5CEZL 4I77H 1GZQA 4ZFOA 2EDQA 1AFVH 2XRAH 4X4YB 4Y4FC 1GOHA 1OVZA 3QB7C 3QIWD 2V5SA 2JB6A 4OUUB 1JHLH 2VMFA 1NLBH 2FGWL 3FO2B 2WSKA 5SWQA 3OG4B 2WK2A 2AJSL 4HX1A 2AK4B 5E24E 3L1OH 3WYRA 3JVGA 3FQWA 1NC2B 1EAJA 1AKJA 2KPNA 1D6VH 5ANMB 3G08B 3QI9D 3INUL 1JK8B 5FUOH 4E0RB 4ZQKA 4D9LH 2YC1A 3NTCL 5IESH 1BVKB 3A0OA 4AENA 2RQ8A 3UEZA 4JZNB 1PZ5B 4Z0XB 3TFKC 2OL3H 3HR6A 3IDNB 5HHOA 5KTEH 3WEXA 3ES6B 1NEUA 2Y5TA 2F19H 4R4FH 2ITDA 3HAEG 3QI9A 4QHLB 1G0YR 2N56A 2VN4A 2I9LB 4NQDD 2WWMD 4BQ8A 3GBMH 4I0PB 5FYKH 3VGAC 3LKNA 4CVUA 2AEQH 4OV5B 3MBEB 3NCBB 3MLTB 4YHOH 3TBVA 3GIZL 3SKJH 1RZFH 1OM3L 4B41A 3VI4F 4DGYL 2BY2A 5DURB 3MZGB 2I25N 4X7DC 4AEHH 4C56D 2XACC 3F65A 3PP3K 4XXDB 3RX8A 4A2MA 3O4OC 4HKXA 4PGCB 4X80L 1OGAD 3K4DA 3EOTH 3RRQA 4MSWA 3S35L 1X5AA 3MRKB 3O3AB 5L7XL 5IFHH 4WWKC 3O8XD 4PJGE 2QR0A 1UWXK 2C7UA 3KVQA 2BMKA 2EEBA 4H8WH 3PWPD 2VAAB 4CAGA 2CJUH 1BHGA 4P59H 3N85H 4QHMB 5TH2B 4RISL 4AH2B 4S2SA 1ZHNB 5I8KL 2WLYA 4WWID 5FEBA 2ED7A 2Z91B 1HSAB 1B88A 2BHZA 4G7VH 3E8UL 4WENB 4I0KA 4RFNC 4BZ1H 4L3EB 3KWWA 5B38A 4IRJC 2GQHA 1INEH 1XF4A 3HAEB 2GSIB 1IBGH 1OAXL 1YYLL 2R2HB 2EDHA 4CU6A 4GKSB 1UCBH 4PUBH 4N0FB 5C0CE 1HH6A 5DVOA 1TMCB 3BJ91 2Y1VA 1IAOB 2FYYA 5L2KA 4HCRH 5F1NA 3UBXB 3OSKA 5DJXB 4IOIB 5FO7A 4RX4A 3HI5H 4F7TB 4P2RB 3T0WA 3DX9B 1TFHA 3WLWC 43CAB 1AP2B 3IDXL 4S1SL 3PGFH 3V5HB 4NO0A 1NDGB 2APTA 3MJ7B 2FNBA 4RFOL 1KJ2A 4Z7UA 2E9BA 4JFHD 4PBWD 4PGEB 3BWUC 4POZD 3VRJA 3A6CH 3NPSB 1I7TB 3VG9B 5C0AD 3T0ED 3ABZA 4UAOC 1WUNT 4QXTA 1A7OH 2LAAA 4XB8A 5DD5L 3SJVE 4L9LC 4MAUH 2ADGB 2WMPA 4P9HH 3CX5K 1CDHA 1RZJH 4U7MA 5GS3A 3EJZD 3F6IA 3KYNA 4OCYL 4EDWL 5IQ9A 4J7RA 2IG2L 2N7BA 2AV7B 1G9NL 1ROWA 2LVCA 1D5ZB 4MAYC 4X0KB 4GG8B 4JKLA 2DKSA 4BFIB 2NYYC 3WFDH 3A6CL 1U8HA 2Q7YB 1N5AA 2RFXB 3H7LA 4JFXB 5D8JL 3MV7E 5J4MA 1QSED 4P3DA 5L6YH 2I07A 4KJPD 4N5EC 1S8DA 3WO4B 1QFHA 2Y25A 4OSUL 1ZLWH 4HIXH 3WNNA 2VLLB 3IAQA 3TO4C 5E08H 5HGHB 1OTUD 3HI5L 2GITA 5IHLB 2HN7B 2XWJA 1P69B 3OKMA 4XAWL 4NSKA 1ZE3C 4XNXH 3Q2CA 2B5IC 3K2UL 2A77H 3HI6H 4JB9H 4W4NA 3MRDA 4AEIL 3OKEB 3ZTJG 4MQSB 3HE7C 5T5NF 2CJUL 1IBGL 1YYLH 4YDJB 5F96L 4NQCA 3EHBC 5LAXA 5CJXA 1NBZA 2AJSH 4UT6H 1YMMA 1I7ZB 1Q9OB 3GSVB 1A7OL 2AI0L 4WIQA 1Z6JT 4YEFA 3FN9A 5E6IC 2YD7A 4ZPVB 5BZWA 4K8RC 3G6DL 4ELKB 1IM9B 4JGMA 4XNYL 5KSBA 3ZHDA 3K0WA 4M02A 4DN4H 2YHGA 2VRAA 1CD8A 1SM3L 2DS4A 4RFOH 3PP4H 3GIZH 1LO2H 2HLAB 4Z7NF 4RMWA 3QNXB 5E8PB 4UQ3A 3VXMB 1H3TA 1AGDB 4WDIA 4X98B 1YNTB 2AP2A 3U30C 2NW3A 2HTKC 5HHNB 4Z7WF 2YA1A 1MCWM 1A6ZB 2PXYB 2NY7L 4LLMA 5ISZE 4HJ0C 3AS0A 4CRPA 4XP1L 1KYOJ 1HHGB 2QSTA 3ZE2F 2A0LC 4F58L 5DHVH 5KSAC 4X4ME 4I1NB 3HMWL 4PREB 2F5AL 2XQBH 4FQLH 2X4RB 4PJXF 3UTPD 3L3DA 4PBVC 3AUVA 3WIHA 1DLHA 5IEHB 4AQ1B 2IAMC 4FFWD 3R0NA 4M62L 5C0GB 1P4IH 3CIQA 3TV3H 3TVMD 1RJYA 4JDTH 3VDAA 3EIFA 1VFBB 4XPHL 1CQKA 5IKCA 1U8IB 3HZMB 4WU5B 1VCAA 4P2QE 2OZ4A 4IRZL 4M43H 2H2PD 1K5NA 3CC5B 2FGZA 4H25A 3L3OB 3L9RA 2QV2A 3QEQB 3V4VL 4ZTPL 2J8UF 2X10A 3H9SE 3ZE1F 2YRPA 2ZUUA 3WE6B 3SDYL 3TNMA 2WQRA 1DL7L 3DYMA 2VYRE 5EO1A 5GJSH 2XA8H 3VA2C 1CBVL 5KOVC 4KZDL 3ARBB 3V2AR 3BYYA 2Q3ZA 2CR3A 1ZLWK 4PRHE 3JWDL 5DVMA 4G9FE 5IHUL 2WANA 2X6MA 2Q76B 3ZYZA 2ATKB 1NMAH 4I8DA 2BNUA 1IGFL 1FAIH 2DQHL 4R4FL 5CLWA 1VESA 4LNVA 1A6UH 2N4IA 1ED3B 3SKNB 4HIEA 2HVKB 3HHRB 3SDXB 4UINL 1Q9KA 1U8OA 2E8ZA 3ULVH 4EN3C 5E8NA 1IKFL 1S3KL 3ZDZE 1I8MB 4OCNC 5KSBE 1JFQH 2Q3AA 3Q6GH 2MJWA 4PJHE 4PJ9C 3SKMA 3Q6FB 1MAMH 5JLZA 1MCLA 1HILB 3GRWH 2X4SB 5HDQL 1YEEH 4DUWA 1I4FB 3WJLA 3VXSD 4JKKA 4TVPL 4P2QB 5C3TA 3RY6C 3VDBA 2DMBA 4XNZB 1MRCL 5HHOD 3WJJC 3DTXB 1A6WL 3N1PC 5IB1B 2X7LA 3C5JB 3MROB 5SX5H 1JP5A 1RUAH 4MA8H 3MRRB 3KS0H 1KTLA 4XBGB 1FC2D 3MBXL 5DUPL 3ULVC 1MJUH 3MLRL 3BGFC 4UV4L 4CN6A 3D85D 4OGZA 9CGTA 1UYWL 3T8XB 3U0TB 1KJ3H 4F3FB 1BFVL 3B9KD 4OLWH 4H1LH 5ESQA 4XWOD 1N7MH 3DV4B 3OXSB 4NDMA 3U46B 5HYJA 4LKXA 1Y6NR 2W9EL 4UNTA 4ETQA 3VXMD 3TN0A 3MV8E 4UTBH 5DGRA 1KJ2H 2VLJD 3DRTA 1FZJB 1Q1JH 3WS3B 4PJHB 2IQ9L 1UXSB 1X5IA 3RWFB 4Z76A 4PLJC 1MCIA 5CSZA 3HE7D 4ONGH 4NRYA 2BVTA 5IHBA 2VTFA 1H15A 1R5IA 3LQAL 4PV9B 4WW2F 3KPLA 3RJDA 4JPVH 2XZCL 2ATPB 4MD4B 4JO3L 4ODWA 2EO9A 2IH3B 2EDOA 2W07A 2KUTA 1C7TA 4KK9C 2OK0H 2VJXA 1U8JA 2QHRL 3QIBD 4X6CB 4KROC 3UTPE 3L3GB 3FQUB 1GGIL 1G7PA 4X6DF 3SE9H 5F89B 3AB0C 4OB5L 3O2VL 1Q1JL 1JGEA 1GHFH 5I1CL 1M7IB 2MCPH 2AQ3A 3MV01 1D5XB 5EOTA 1DUZB 2F58L 5ERWB 4L1HA 3BUYB 3LKPB 5IROC 4GUPA 4JFZL 3OB0K 4ZXBB 1IZKA 4M7LH 2ZOLB 4M7LT 3PL6A 2K7PA 4M03A 3ILQC 1NEZB 3MLZH 4APQD 4F7EB 4NJAH 3KYMA 5DQJB 4LLQB 3ZKMD 4ALAL 3JWOH 2NXYC 5HDBF 4MQTB 2HA1A 2ENSA 3BP6A 2MCPL 5A2FA 2YMXH 4NQEB 3O3DB 1RUAL 2X42A 4N8VB 4YDLC 2X89A 4F7PA 4FZEH 5CGYC 2R2BA 4CVWA 3MACL 1ZLSL 5T3XD 1BF2A 4UILH 4XPHH 1J8HD 3NH7L 4U1MB 3IRPX 3TV3L 3KPPB 3NN8A 1JPFB 4GRWE 3O6LL 1CGXA 4NO2A 1NAKL 2PR4H 5K9QG 3BP5B 2D31B 1JRHH 2HWZH 5D7LE 1U8KA 3FO2A 3HMWH 1A6TA 1MHCB 2IMNA 4ZTOL 1MJJA 1MSPA 3HPJB 1KSRA 15C8H 1NBVL 1P1ZB 4M93B 1JN6A 1IAKA 3O2WL 4GMSL 5HHQA 1PQZA 2EYRB 1A2YA 5D7SL 2G2RA 3L6FA 3UTTD 1PZUB 2OQJB 5JHLH 5EUOB 4R0LB 4JY6A 4YHNB 1OD9A 3DOSA 3HE6D 2X9XA 4I0PC 3BOVA 4L29B 4MD0A 1RHFA 5AAMA 1SY6H 3J8F7 4UV4H 3QCUL 3AAZA 4LGRB 5BO1L 5GRUL 3LSOA 1AI1L 3NOIA 5E2TH 3DX8B 2P43B 3F7YA 5SV3A 2J5LC 1DN0B 4QEGA 1XF5A 3MRJA 3OKOA 4J4PA 4KDVA 4L9LB 4NYLA 2B2XL 2FD6L 2XNAB 3ARDC 3GHBL 1SYSB 2BVOA 4XX1E 2CIIB 4Y7MA 3OHXA 3TIEA 4PLNC 3TZVD 4B53A 5ESVB 3DVFA 1MRCH 3DX7B 4NGHH 1OARL 3IRZA 1WT5A 4OCRL 5CD3A 3QQ4A 1WFNA 3EDDA 1IEBB 2QHLA 3W5MA 2E9JA 3HE6A 5J56B 3ARTA 4LARL 5L2JA 3G04A 5J1TC 1UM6L 4PRIB 3MRMB 4GRLC 3GMNA 4WFFD 1CI5A 2V2XB 3GM0A 3QQ9C 5F7YC 4MA3A 4NQDE 1MQ8A 4PJDF 4KKCC 4XNMA 1ZVSA 1OP3H 3GSNA 4IMLB 3KJ4C 2AJUH 2X4NB 1NBQA 4M3KB 3B9KC 1T1ZB 2Q86A 5C0BB 1NJ9A 4XWOC 3OR6A 1SEQL 2PTUA 4X8JB 3QDME 5IWLC 1HDMB 4MA7L 2BOCA 1HI6A 3HAEA 2H26A 1PFCA 4HUMB 2R2HA 5CHNA 1RUKH 4E5XA 1LO0L 2GTZB 2BC4A 4APQB 1AQDB 3OL2A 3B8YA 4P2OA 3KHQA 5F1NB 5IVXA 3X3GH 2X4PB 2R56H 4GQPH 5CFHA 3CFJB 2X89D 3FFCA 4RMRA 1OAYH 4HWEL 3H9SB 4LPWA 1JF6A 4NN5B 5D1ZA 2IADA 1WEJL 1T7XA 5FUZH 3SY0B 2DWEB 5KW9L 2W9DL 2R56L 1OLZA 2PYEA 3I6LD 1B4RA 2D7OA 4QHKI 3ARYA 4WGWB 4NNXB 2YWZA 4OFKA 1J0ZA 2VKXA 4JO1L 4X7FC 3K1DA 1LO5B 4HIHB 4M6NL 4J23A 3MR9B 1KJVB 4XP1H 2DYPB 5HHPB 1X7QB 4F7CA 2Q8AH 2R0LH 5DHYB 4YXLL 3HI1A 4YHKL 3P9MA 5KVGH 32C2B 5JOFA 1E4XI 4APQC 2P5ED 3D6GA 1KTDA 1INEL 4ZFFA 4WI3A 1TITA 3BN9D 2Z9TA 2EC8A 2OR8A 5ICYB 3ET9F 2I5YH 5ISZD 1HXMB 2XXMB 1CFQA 1CFNB 3PJSA 3WIHH 3RGVC 1OSZB 2MHAB 4RQQB 4IOFC 4YC2B 2ZCHL 1FL6A 5SWZD 1Q9WA 3PWLB 2AERT 3P0VH 1IFHL 1TZHA 1ZT1B 4X6CF 1N6VA 2A1WL 1CFVH 3S34L 4Z7QE 4WUUD 3UAJC 1HH9B 3U82B 4MYWB 5ICZB 4PP2B 1EO8H 4TSAL 5D7JA 4KKLC 35C8H 5I71B 4P4KD 1SHMA 1NMBH 4TNVK 1QR1B 3WIHL 2IEPA 5J3HD 1P9MA 1I1AA 3GNML 5K33A 1WZ1L 4RWYL 1D5IL 2E27L 1MCEA 4ZSOA 4FQHA 4NUGL 2GT9A 3KJ4B 1NCBH 1R3HB 3M17B 2PXYC 2VKWA 4LLDA 4Z0BH 1UM4L 2LVEA 3QO0B 4QWWD 1A1MA 3FCTA 2FJGB 1G0XA 3B83A 4ODXB 3T3PE 5I1JH 5DJ0B 1HYSD 3GUTB 2G75B 4R4NC 4I2XE 3B6SB 5FXCH 3QG6B 4NNPH 3QIUD 5CLTA 3W11C 4NO5A 5C0FB 1JPSH 1T5XB 5DK0A 4KI5C 2FZ3A 3S4SG 5CAYB 1KEML 4ZUTB 2NY2B 4JGUA 3MRGB 4XNZC 5D1XD 3IKKA 1ZWIB 5J6HA 5LWYL 5IQ7L 4UTAH 2W9DH 3T0EE 1ES0B 4O2FB 4F15C 3HZKA 3LB6C 4LLVA 3C9NA 5I66B 5HVHB 1DQQA 2ZSVB 3GMOB 1W0WB 5C0EA 3H0TA 4HG4K 2NX5B 2VLJE 3D2UA 5AZ2H 1GAFH 3RDTD 3RZCA 3D39A 4DK3A 3KPRE 1JWMB 1SJEA 2VSCA 4RSVA 1H5BA 4MJ2A 2IPTH 1T7YA 5TDOB 1RU9H 2GJZA 4WU5A 3FO0H 3FMGH 4QRUB 5TFSL 3WLBB 4U6XA 1F4YH 3O3BA 3LKOA 1SEQH 2NXZD 3REWB 5GGUB 3R8BB 3EUUA 2E8YA 1EHNA 3RVTC 1FJ1A 5FOBA 1YNLH 3QNYB 4QRPE 1FLRL 4JZOA 3ALWA 5TE6H 8FABB 4HH9B 1NLDH 1CK0L 1T21B 4BZ1L 4D94A 5KVMC 4Y4KA 5ADPH 3S98A 3NGBB 3SDCD 2YKLL 3BWAB 4MHHI 2H32H 2HJLB 2DQDL 3RBSA 3WKML 4OM0H 1AXTH 2OSLA 3K46A 1SBBA 3CLFH 2FECL 3H3KA 4U1HA 4OGYH 4LQFH 2NY5H 1RZKC 3CFDB 1QPXA 1XR8B 2FECI 4S0SD 3ZE0F 1S7SA 1DJSA 4AM0A 5GIRB 4LSSL 3DSFH 1DQLL 1MLBB 2NW2B 3LKQA 3FQRA 1ZMYA 2H2PC 4CJ0A 3VXUD 4PJCF 1TLKA 3GSNL 1LP9F 1MF2L 5E9DB 4WUUB 1FNGA 5GHWH 3CFIC 3OJDB 2L7JA 4XPBL 5D2LA 3BQUD 4XCNB 5GGSA 3U9UB 4WEBL 3J7HA 2P5WD 4PS4L 1KNOB 5D7LA 1MY5A 5DO2D 4OI7A 3VWJA 1FNAA 1KB9J 2FHBA 4HWUA 1EEYA 1NDMA 4KVNL 4PRDB 1NAMH 5C07A 1KTLB 4Y5XC 2N7AA 5J9PA 3C5SA 3UPAA 15C8L 3MRBB 4ONHB 1MCPH 1QLEH 4M5YL 2B1HH 5ESQB 4NO0D 5ADOL 3OR7B 4MB3A 1FIGL 5IJVA 4TVPH 8CGTA 5IMLA 3INUH 1A4JB 3V0WL 5I9QB 1E4KC 1TENA 3HC4H 1NGPH 3IDMB 4JHAH 4F37K 4NKIL 3R1GH 5CBAB 4HDIA 3IJSB 4KROB 2Z31C 1PG7L 3VRIA 4M1DH 4OGXH 5GSVB 1JFQL 3D25B 3VXPA 2EDYA 1L7TL 4OLVL 3E1F1 5HHMD 3DUSB 1ZT7B 2UWEB 3VW3L 1WJ3A 4QXUH 2PO6A 3CXHK 1MELA 5AZEL 1OWWA 3KAAA 2CRYA 2PXYD 4MDIB 4P4RB 2DM3A 2P8PA 1F4YL 3MNWA 3ROOB 1FE8H 1QFOA 1KIQB 1CLZL 4BM7A 4RGOH 1UH2A 1A4KA 2NY1C 4LIQE 5C09D 4LCWD 3SPVA 1LO4L 4WO4A 1IAIL 3PQYE 2XN9B 4J2XA 1NPUA 3REVA 1OAZH 4CN4A 3BX7C 2VUYA 4D8PB 4GKZB 1EAPA 3SE9L 4XGZA 1TTFA 4QNPF 1NL0L 5GRJH 1QFWL 3RY4A 5EZIL 1J5OL 4GG6F 2R4SL 4OZIE 4PJDE 2X4UA 3N0PB 3QQNA 3L5JA 3K1KC 3KYMB 1MWAB 4OGXL 1LQSR 5D1XA 4OFDA 4PLOB 3BW9A 3VXSE 4NHUB 1HWGB 2P42B 3U4EB 3V0WH 1E28B 1FNEA 4PYHA 5F88A 4YNYA 3QG7L 3EDFA 4OJFH 2E9IA 2J8UB 2WINA 4P57A 3BKCH 1JGLH 2C3VA 5C7XH 2W92A 1YDPB 2RR3A 1ND0B 3MGTB 1KXQE 5CSBA 4JM2C 3GMQB 4Y1AE 2PTTB 1FV1A 3O4OB 1CGYA 1QRNA 2X5PA 3BH8A 2X4OB 5FO9B 4YBHA 5C2UB 3LDBB 1MJ8L 4JDZA 1BVKA 1IC7L 2Q20A 4L4TB 1LEGB 4I4WB 2IALB 4N0UA 4P4KA 4HT1H 4HGWB 3O0RL 1OF2A 2MQ3A 3HFML 3GNMH 4F8TA 3TBSA 1J7VR 5F72S 4G6FD 3QIWA 3JWOC 3OF6D 4JM2B 3OGOE 5BRZB 5DD6A 3TJEH 2NZIA 3MV7B 1R3KB 3BUTA 2B39A 1TJGH 4WV1C 4AIZB 5SWZA 5ELIA 1D9KC 4HEME 1HOCB 3EYSL 4WI2A 1UXWA 1HXYB 4AT6B 2WIIA 1UKTA 2D7PA 3NZHL 5E00A 2W0FA 3MREB 4RAUB 1I3RB 4K94H 5BV7B 3IDUA 4JM4H 5I1KL 1AXTL 5CEZE 5FUCE 1MAML 2EIZA 5FGSA 3RVWD 3GSQA 5IMOB 3QUZA 1KBGL 3FRUA 5HGDB 5C09B 1PG7X 3KJ6L 4CW1B 4WHYG 1IKFH 5MHSD 4JRYB 3QUYB 4MDJA 3D3VA 4RFEB 4X8XA 3WXWL 5E08L 3BXNB 1IJ9A 2FR4B 4DZBA 1IC1A 1M6OA 4QGTA 1LK2A 4FFZH 3VGAB 4MLIA 4H26B 4XMKH 5EIQA 5D71H 4OQ1A 2BVYA 4LHUB 3L7EB 4JFQB 5IR1B 3MC0A 4G6FB 3DBXA 1JWSA 3AU1B 4L3EA