4U7KA

Crystal structure of the clostridium histolyticum colh collagenase polycystic kidney disease-like domain 2a in the presence of calcium at 1.9 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
NSLPYGKINGTYKGTEKEKIKFSSEGSFDPDGKIVSYEWDFGDGNKSNEENPEHSYDKVGTYTVKLKVTDDKGESSVSTTTAEIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ColH protein
publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
total genus 18
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u7kA00
2VLJD 3D39B 3WE6A 2W9DL 1H5BA 1RUQL 3CFCH 1CR9L 3PWJA 4HV8B 1BX2B 4MJID 2CSPA 1Y0LA 4X0KA 1X4ZA 3HPJA 2CLZA 3AAZA 2L7UA 4B7LA 1FORL 2UWEF 3F65A 1R3IL 1QNZH 4NSKB 3VRLF 1C16A 3UBXG 1KEMH 2WWKT 4D0DA 4S2SB 3UTZB 3UPRB 4PJEA 4XPAL 1OY3B 2B0SL 4LU5H 4MB5A 1U36A 5EFIB 4RWHA 4GS7C 1OAQH 4ZYKA 4I0CC 5J8OA 2XG4A 2BERA 4PJHB 1QA9B 3UEZA 2R0KH 2DL9A 3QYCA 5GRJH 1Y6KR 3EAKA 4GKNB 4HDIA 3MMEB 1UACL 1VPOH 2LE9A 1FN4B 1RUML 4GRMA 4L29A 4M7LL 5DJ8A 3DYPA 4H25A 3RZCD 1G7QA 4I48A 5IVXE 4X5WA 4RISH 2CKBL 1CE1H 2EKSB 1PG7H 3TFKD 3HR5A 1IM9B 2H2SC 5ICXA 2CGRH 4R0LC 3IS1X 1FL5B 1XIWA 3OKEA 1FZJA 4ZOBA 3D69B 5CZXC 4OZHE 1LDPH 5EZOL 2WP3T 3QPQD 5SX5H 2VRAA 4JDVA 4K71B 4HS8L 3OAZH 1ND0A 2Y9RT 4CN6A 3V2AR 3L3JA 1QVOB 3H2WA 4GOSA 2IMNA 4UBDC 5KG9A 2ADIA 1KC5H 4JRYD 3NVQA 3OAYK 2HTKD 1YPZB 3GSRA 1G7JB 2ADGB 2GJZB 4XAKD 3S34L 1HSAA 5SWQB 2W07A 4Y5XA 4UDUA 4OV5A 4UOW0 4LIQL 2EDEA 2XXCB 4HK3J 3O3BB 3NBNA 1DQJB 1OAKL 1TNMA 1TZIB 4LLWA 1BHGA 2WUCH 5D6CB 2G2RA 1NCDH 3BHBB 4A6YA 1NKOA 1B2WL 4OZIA 5ID1A 3B8YA 3L5WB 4DGIL 5HVWA 4UDTA 4GBXB 2P46B 5MENA 3RVUD 1FGVH 3MO1A 5H35A 4F15C 2E6PA 5CD3A 2Y23A 5C0CD 4G7YL 4UV4H 4Y19E 1NBVL 1A4JA 5B8CB 1YEFL 3QCVH 1UG9A 2DBLL 2X1PA 5GRVK 3VXUB 4JN2B 4W4NA 4P23C 4X7CC 5JQ6L 3BP7A 1YZZA 4X7SH 2AEQH 1NUFA 1CLZH 1MFAH 3QCUH 1MFEL 4LLQB 4X9FA 5FK9B 1KCSH 3VXSA 4G8FB 5JZ7C 1MH5B 3VI3E 2EH8L 1JTTA 5EC1A 1I3RB 1FIEA 2OK0H 2R2HB 1MAMH 3QUMH 1T04B 2ERJC 2G5BB 5SWSA 5EORL 1DQMH 3DUUB 1JYXA 3FOMA 4U31A 2VITA 4XHJC 5CGYD 5C6WH 4TTGA 1CTNA 2PCPB 2IPKB 4OF3A 3FO9B 5GS0L 1FGNH 5ERWA 3MGAA 3GO1L 1JGEB 2DMKA 4I4WA 1L9NA 1QFWI 1NLDL 3N1PC 5DJ0B 4EN3D 1JGLH 3DXAA 3DMMA 1F45A 4ODBD 1ZWIB 4FQCH 4Z7VE 2VSCA 5F21B 4NWTL 4S1SL 4TN9A 3W9EA 2XFXA 3I50H 3STBA 1T21A 1M1SA 4TVPD 3NGBC 4FP8L 4X8JA 4YBHA 1D6EB 1MRCH 3RIAF 5TE7H 5HYSA 3NCEB 4G6MH 3WMSA 5DSCB 3L5HA 1YEHL 4U1LB 3T4YA 5A3IC 1MFDL 1DUYA 4F58H 4MZ3A 3PWLA 3RIAK 2HMIC 4AYFA 3BSZL 1IZJA 3CIQA 4NN7B 2ZUVA 4YXKH 3TZVC 3U9UB 3ZZ1A 1C1EL 2BNRA 1CGSH 4KTEL 3RVVC 4RIRA 3ULUD 5SWZE 1AI1H 4KKBC 3NA9H 4V2CB 2QQKH 5DVKA 1VERA 4M43L 1O7VA 1YNTB 3O8XB 4IHOA 1HIMH 3RU8H 4JJ5A 3C5JB 1QLRB 2DF3A 3DROB 5C1MB 1JRHL 4ZDHB 2O5YH 4N68A 1A7QL 4I0PB 5IB1B 4XVTL 2LV4A 4KKCC 2B5IB 3CGTA 5DJCA 2BFVH 2YD4A 4TOYH 3IXAB 2Q7YA 1CZ8L 1KPUA 1E28A 2E7CA 2R23A 5E94B 3TYGL 3TNMA 2MOVA 1YY9D 3MXWH 2IGFL 4WI3A 3U46B 5CIPH 4KGLA 4RDQF 5HHPB 3G6JE 1ZKAA 2GTZA 4K23L 3VWKB 3F7VB 4PG2C 1CTOA 2XOTA 4U7MA 4PRDA 3G6DH 4ZPVA 5JO5B 4P0DA 4C56E 2EDNA 2X4RA 5E24E 4WW2B 4L9LB 4LHUB 4OIAA 4JFFB 2RJMA 3KLAA 4V1DA 4X6CE 4PRID 4GMTH 1IFHL 4ODTH 5D72H 1RK0B 4MB3A 2VLRB 3WIFA 3MACH 3KPRB 1QBAA 4WI4A 5IR1B 4J2XA 2AJUH 4LSQL 4JG0L 4K7FB 4K7PL 1ADQH 1RUKH 2J6EH 3TWCH 3JTSB 3FAXA 4PJBE 4P2OD 4HWUA 4EOWL 4WTZA 5F96H 3H9HB 4P3CL 1W0WA 4XNUH 5J6HB 4MAYC 1T1WA 1UWGH 2VLJB 4ZS6D 4OAWA 4Q74A 1B0GB 5CJ8A 1CIUA 1U8HB 2EXWD 3HG1B 4OCWH 4OZGE 5JHLH 5TDPB 1HHKA 1YEKH 1B3JA 1AGFB 1T1ZB 3I2CH 1LO4H 1S7TA 4LLYA 1EGJA 5FECB 3PHSA 5JXEC 3MRQB 3WS3A 2Z8WC 5I1IL 1YYML 3RWFB 3FQUB 3GSOA 4LU5L 4TUOB 4CKVX 1IKNC 5HXMA 4NC2B 2J8UF 4LASH 5DJ6B 1KELH 2QQQA 5FYKE 1A2YB 2VDLH 3WO4B 1CQYA 2R0KL 4BUGA 2R0LL 4HIJB 2A1WH 2MQ3A 2YPKB 2GW5A 4WWKB 2ZNWA 3LKOA 4JM2D 5HYJA 4ZTOL 2CRZA 1XH3B 4TUKH 4MYWB 5DRZA 4LPXA 1MFBH 4XPGH 5ACMA 1JWSA 2P8LA 4RISL 3EO0A 4IMLA 5DFTA 5BRZA 3ZSTA 3BH9A 5EOCH 1CFNA 3D3VD 3GMNB 4MJ5A 4DFIA 5LQBL 1JMZA 1YYLH 1MAJA 1IEAB 4ODUB 2JCCE 1X5IA 3U48A 1T66D 3FFCB 3HUJF 2PXYD 4P46A 2UUDK 4X6BA 2BHYA 1B4JH 3PDOB 3KGRA 2QQNH 3B2VL 4JRYB 2BOBA 5E2VH 2I07A 3ARGA 2DLHA 3SKOA 5IB4B 3FRPA 2F53E 1MAKA 3RGHA 1WTGT 4WTXA 2XZQH 4XPTH 5IFJB 2ZWLT 4BKLA 4FFWC 2PYFB 4OLYH 1AHWB 4YDKL 5DJZA 5CAYB 1RMFH 4YDIH 3N1QC 2WUCL 5C0FA 5KSBE 5TE4L 1BQSA 5ISZD 3LEXB 5EOTA 3O9WB 2NY5C 2ESVA 1SJEB 2QQLH 3AREB 3CZFA 4G9DB 4Z77A 1T03H 4D9QD 4NQEA 4TRPH 1FGVL 2BSSA 5EBLB 3NMEA 1JNNH 3BYTA 4UV4L 1EHLH 1WWBX 3TYFA 5F9DC 3MREA 3H7BA 4KGJA 3QCVL 2F74A 4G8GB 4MSWA 2HJKB 5L8LB 1EEYB 1JWMA 3T3ME 2YD5A 3JVGC 2FL5A 4L8BA 3U6RB 4X7SL 4NQCB 3NFSH 1F11B 1CLZL 2PYEA 4PJ7E 3QCUL 5TFSL 5L2KE 2XTJB 1OP5K 4NUJA 5JW4N 5JXAH 1XMWA 3L3GA 1RHHB 1CD0A 1WF5A 3L3HB 4JQXA 1N59B 4DGYH 3OX8A 4U0RC 3VG0L 3BP6A 4WIQA 4Y2DB 1DQML 3L5XH 3TH4T 1U6AL 1N3NA 3LV3B 2P5WB 3PGCB 1ZHLA 2HWZL 3HE7D 2HN7B 1FGNL 1FV1B 1KTDA 1FO0A 2CDGB 4PJXA 4PJ9A 3IJSA 4KTYA 1AQDA 1PLGH 3VD3A 5FGRA 3VD9A 1ZA6A 2A9MH 3DX6B 3O4LE 4GAYB 4LPTA 3VXME 4QYOB 3QG6B 1IBGH 3DX8A 3I50L 1XR9A 2A6JB 1WT5A 2A6DB 1MRCL 4U1NA 2DI7A 4B41A 4G6ML 1PZ5A 3STLA 1UM6L 2B4CH 4JFEB 5F1SA 2ATKB 4F58L 3ZDZE 1MIMH 4NRYB 5J6GB 4OFYA 4IRJA 4O5LL 1DBKH 1DQTA 1NANH 1FBIH 1S7UA 1U8PA 2AK1H 2HT2C 1IL1A 4Z7UE 4YC2B 3K8KA 4M6AA 3BMVA 1OSZB 1UENA 5I6XC 4OD1L 3GMPA 3QDGE 4YHPB 3QUMA 3UTTA 4GAGH 3LIZL 4J3SA 2O5YL 1AIFB 1N4XL 2DKMA 1NAKH 4MD4B 5FDWA 3VGAC 2BFVL 2OP4L 4KKAC 1BLNB 5KN5B 4E5XB 4JRXE 4K55A 1WIOA 4WTWA 3ULSB 5I1LA 4KZDH 2IANA 3DYMA 1NCCH 3VXNA 4PJFB 2CIKB 3UTSA 3MXWL 2VKWA 3SOBH 3FT4A 3SGEH 3THML 5DRWA 4PJ5A 4RNRB 1CDGA 5C8JB 1CLYH 5KVFH 4NNPH 3S3PA 3G6DL 4AL8H 1QO3A 2LU7A 5BVPH 4MHHI 5GGVH 5EU4A 4C55A 5FO7B 4OLEA 4ZFFA 1I8IA 1CFVH 4PRIB 4ODTL 4N5EC 5D72L 3ARBC 1WISA 2Y5EA 3PQYB 5T1DH 1A9EB 3V6ZA 4KUCD 2CIIA 4KROD 3TBSA 1KB9K 5F44A 4CW1A 1J18A 2AJUL 2FEDC 2VISB 3UDWA 3HI6H 1ADQL 3FONB 1GSMA 3CDYA 3WFBL 4XMKH 3BQUC 3TWCL 3KDMA 4BH7A 4JHAH 3BZ4A 5F96L 2NPLX 4HQQH 1JGVL 1KYOJ 1TPXB 1J9CT 4XNUL 3PGFH 4ODVL 1DBMH 1UWGL 3KYAA 5HPMB 1AGEB 1CXFA 3NIDE 1I8KB 5DTFA 3WUWB 1XEDA 2ARJQ 4OCWL 3RWJB 2IBBA 4HGMA 4X9HA 4IBLT 1YEKL 3MYJB 4GG6F 2BY2A 2OR9H 4QY8A 4DW2H 1G7QB 2I60H 5CIPA 2Y72A 1LO4L 4X5WB 3QI9D 4XCYB 3OR6B 3MCKB 4BZ2L 5I17A 1DEEA 2FB4H 1NC2D 4MDJA 4Z7WE 4NO5A 1ED3A 2FGWL 1QSFB 4LASL 2EICA 3PWNA 5DD0L 3VXQB 4U1IA 2QHRH 2P8PB 4WW1A 4Z95H 2ZCKH 1FYHB 4XI5D 5D6DA 3X13A 4JPIA 3MLWL 3PABB 1R3KA 1CXEA 5DXWA 5B3NA 3L3OA 4HKZA 3D9AH 4Y19D 2FSEB 1G7PA 2YMXH 1PY4A 1LEGA 1ADQA 1GAFL 1E6JH 5ALBL 3HAEA 1BFOA 2J6EA 3HNVH 1AGBB 4G3YL 1J1OH 3B3IA 3DVNA 2VC2H 5D1ZB 1J0YA 2YD9A 5FUOH 1YYLL 4BELD 3RGVB 3CFKA 1I7TB 1I8LC 1A7NL 1VFBA 3IVKB 4EVNB 1ZS8B 3WEXA 3QQ9D 3OJDA 3FQRB 3HZVB 3DTXB 3JWDC 3JZ7A 4Y4FB 2ED9A 1KFAL 3JTTA 2HG5B 4ONHB 4TVPH 2KZWA 3C6LD 4BQCA 5B4MD 5C08B 4HWNA 5I66A 2NY7H 3RWGB 4PLOB 4F57H 4JANB 2K3TA 2KZ1B 2XACC 2CJUL 4OZFH 2GSGB 1ZAGA 3KPOA 5A40E 4GXVL 3N1MC 1OL0A 1CI5A 1D5ZA 3CX2A 5HHOB 4K94H 1T5XA 2JJTC 2EDJA 3MRNB 4XXDA 4X6DE 4LRIC 5DHYB 4U1JB 1IEHA 1IKFH 3M1BA 4RX4A 3ULUH 1AC0A 1T03L 2F54B 3B9KD 3RUGB 4J7RA 2BVOA 4Y0GA 4F7MB 1N8ZB 3GJFK 5EIIA 3MROA 5EBWB 2ZUSA 3O3UN 2DRUA 3LH2L 4FN0A 4NFCA 5E5MB 3C9NB 2OTUA 4OV6F 5SWZD 3BPCA 1KPRA 4X7TA 3MC0A 2APFA 4FTVA 5I1DA 2NX5B 5EBMA 3NFSL 4KMTH 1S7SA 1NBYB 5IROC 2KKQA 3TVMD 1KEGH 3QO0A 1WFUA 4J3XA 2RIKA 3S4SB 2V7HB 5IESL 1G7MB 1G7LB 3QRGL 1F6AA 1BOGA 5DD6B 1JV5B 1BGXH 2DIJA 2R1XB 4ORGA 3L5XL 4NKMB 1LE5B 1DUYB 2VR9A 5IFHH 4M6NH 5EU6B 3PWLB 4EI6B 5HYSG 3GM0A 3HE7B 3QHFH 4BSVB 2LVCA 1PLGL 3QUYA 1UVQB 4KAQL 4W6YB 2MTPA 4PV8B 2DKUA 1CF8L 3ARSA 5ESQB 3VD5A 4K07A 1IBGL 5J7CC 3HS0A 4Y5VC 4C56D 2FYYB 2WM0A 1S7VA 2PETA 5FO8A 2B4CL 2C3XA 1URLA 2X89D 4PTUB 3MNZA 2CPCA 5AD0B 1I1AA 4KDWA 2W60A 1TTFA 3DI3B 2KUTA 2RGSA 3KS0J 1OT2A 4NRXA 3V4PH 1T6WA 5BS0A 1DBKL 3QEQA 4CRPA 1E28B 4AEHH 2CO6B 1FBIL 2WSKA 4QCIA 2EYRB 3TPKA 1NFDB 2EO9A 5HY9B 1L9MA 1BQUA 1MHCB 1VGEL 3WNNA 4K3JL 2DQJL 3PHQB 1MCJA 3EYVA 4GAGL 3QWQB 1NAKL 1MHEB 4PREB 4F7EA 3KLAB 2VOTA 4V1DB 1AR2A 2R2EB 4LLAA 4JPKH 2YSSB 4KXZH 2D7TL 1CICA 1CFQA 3ARDB 3AS3A 4KZDL 4JR9H 5IJVA 5F9WB 3ZDXF 2P8MB 4OFVA 3SOBL 1SYVB 3RA7H 2EZ0D 5DEFB 1AQKH 2YN5A 4LAQL 2EXYD 4K3GA 4ZXBC 3WKMH 5FYKD 3UZEA 4P59H 3BZEA 5T1KA 1CLYL 5C6TH 5KVFL 3P11L 2AQ1A 2PO6A 4AL8L 2VKXA 2DQUH 5BVPL 4PRAA 4WI7A 5GGVL 3ZKNC 3R0MA 1NMCC 3MBEC 1A7PL 2I9LB 3OR7A 4W6WB 3BPNC 2Z31D 1UXWA 3ARWA 5CJ5A 5IB2B 1CFVL 1T5WA 5F1NB 2FO1A 2NY6B 4W4OA 4WTZG 5CSZB 1SEQL 4MJIA 1NCWH 3Q2CA 5T1DL 1JN6A 3X17A 4KROB 1ZK9A 5DS8A 3SBWA 3O6KH 1FYTA 1J86A 1CL7I 4XMKL 1UXSB 2BY3A 2EIEA 4JHAL 1LP9E 3QQ3A 4XXCC 1L0XA 1OGAE 3GI9L 4RAVB 3C2AH 3PGFL 1ETZB 1DBML 3T04D 2NW3A 5C0DB 3NZ8B 4FXKB 4U33A 1GYAA 3EJZD 3UBXI 1FL3B 4P48A 3V0WL 2F53D 4JFXB 4WHYG 1C08A 4CMHB 1OTUC 1Z0MA 2OR9L 3FN0L 5K59F 2I60L 4PRPB 5DQ9A 4Z7NF 5IOPA 3RZCA 3DV6A 3QI9B 1T0MB 4LPYA 1XGRB 4XCEA 5J11C 4N0FA 3SQBA 1T22A 2FB4L 1VEPA 1WBXB 5AYUH 3WSQH 4AENB 3PP3K 3MV8E 5BO1L 1HHJB 1NMBH 4R7NA 1ZTXH 4L3CB 4FQ2H 1LWRA 4QXUL 2QHRL 1WC7B 4HUXB 5FF6B 4D8PA 3F7RA 4PJEF 1RUAL 1I8MB 1ZSDB 5ICYB 1YC7A 2A9NL 2H26A 5GS0C 1HSBB 2ZUQB 4A2MA 1J1XH 5T3ZE 4XNZB 4JQVA 5E1AB 1A14H 3S9DB 2ID5A 3HR6A 3D9AL 2X4QB 2YMXL 1TQBC 3QFJE 3D18B 4F33A 2AK4B 4G6KH 1E6JL 5I8OL 4JDTH 4EZMA 2D2OA 4ZG1A 3OKYA 1J1OL 4ERSL 2VC2L 2EDRA 1J88A 4LDOB 3WLBA 5FUOL 5DURD 1U8IB 1ZT7B 4YHOH 2L4OA 3FRPG 5D1XC 1WIUA 1NGZA 2QADB 4ZD3H 5L2KD 1ONQA 1GGTA 1ZLUK 1NKRA 1KTRL 3OB8A 4CVXB 4UMGA 4OQTH 4DAGL 5FAAA 4U6XA 4OF5A 4W70A 1P2CB 2ESVB 1DBAH 2VO5A 1C12A 5D70H 5FGCE 4N0YH 5E6ID 2AEWA 4MGXA 2NY7L 1V5JA 2AXGA 4QHMB 3U7WH 2Y6SC 3WNKA 1PFCA 4KJWC 5C0CA 3O4LD 3E0GA 1JNJA 3ZYIA 4WUUB 3VXMD 1RJCA 5IK3B 3MRKB 3CUPB 1P84K 3WO3B 3SPVB 2W9LA 2NXYC 4K94L 4Q9CA 3Q6GL 4HUMB 3RNKA 3C60B 3CC5B 3REVB 4FFYL 2VZOA 1NBQA 3QEUA 3ULUL 1SY6L 1JZ8A 3DGGA 1GIGH 1ULVA 2K7QA 4P3WA 1ZLWK 4KTDH 3HE6A 1UWXH 1YMME 1EVTC 3JXAA 3CLEH 3PWPB 4JY4A 1IGYA 1P4LB 1KACB 3GSWB 4OZIF 1Z0NA 3MJ9A 4Q6IB 1A0QH 3GSUA 1M05A 4NNYA 4Y16D 1JPSH 2Z9TA 3AFLA 3V5KA 1OAUH 4N0CD 4ONFH 1Q9WB 4EN3A 3QDGD 1KEGL 4DZBA 1MFCH 5I75B 2O61B 1CDHA 3SGJA 3V5HB 4Y8AA 5E2TH 1BJ1J 3MR9A 5ADOH 5DD3H 5HGGS 1U58B 4KC3B 4FFVC 1BEYH 2Z8SA 1UZ6F 5IHLB 4ZFZB 4JRXD 1BGXL 4NN5B 5CMAA 4P5MA 4PR5B 1VFAB 5IFHL 4M6NL 4OZFA 4IJ3B 2ZOKA 1EJ6A 3QHFL 1H3GA 1UM5L 4WUKL 2BCKA 4JZOA 2NY1C 2MQCA 3VMOA 1S7UB 3QDME 2EH7L 3CH8A 4P9HH 3D85B 8CGTA 4KHTL 3TJEL 4C56B 1PJ9A 4GW4A 5DRXA 2NMSA 3DUHA 3F8UB 3IYLW 5EUOB 1HCFX 3GSQB 1RZIA 4KVCH 1N64H 3F5WA 3BP5A 2MSPA 4GSDL 1YNKH 3GSNH 1PVHA 4HZLB 1DVFD 1M71A 3V4PL 5EZLB 1KT2A 5DQJA 4PV9A 3GMRA 3HZMA 3MRJA 1DSFH 3RWCB 5INCA 5BZDB 1FFPB 3DSFL 4M93B 3LQMA 2BC4A 1XZ0B 1ZA3A 2VQTA 1NJ9B 4N9GB 3V95A 3C09B 2NZIA 1TZHB 5F7KC 2YK1L 5HHQA 4OZGB 4XRCA 1FNHA 3T65A 3F12A 2BOCB 5HGBA 3UC0H 3ZE1E 2OSLB 2Y06L 3MRBA 3U0WL 4NZUH 4Y4HC 3WDJA 1MI5A 4JPKL 4ZFFB 2GSIA 5DD5H 5FUZH 4YHKH 4YHIA 2CMRH 4KRPD 1KIPA 4JRWA 4NPYB 4PJCA 1FH5H 4ELKB 5HI5C 4FG6D 4KMQA 2FHBA 3RNQA 4X9BA 4OI9A 1P5VA 3MA7B 2UY7A 4P59L 1TJIH 1OARH 4OT1H 5C6TL 3CSGA 1EV2E 1NCTA 4P2OA 4RQQA 3BP4B 5E9DB 4XMPL 2DQUL 1MOEA 2FJGB 4DN3L 1INQB 4ZSOA 1LHZA 4XCNA 4OZ4A 1KN4H 4ZAKC 1REIA 1G9EA 1ZANH 4Z0XA 3I6GA 4X4XB 4MX7B 3FHQA 1NCWL 4R4NC 4PGBB 3GHBL 4QY8B 3T1FA 1GGIL 3WL9B 4JG1L 3CDCA 3Q1SL 5GRUH 5FKPA 1FVCB 3CFEB 4LLVA 5FHBH 1NDGA 4NJ9H 2ENSA 3NPSB 3MV9E 2IH1A 1IGIL 1UJ3A 2JJWA 3C2AL 1NBZA 2CK2A 4OUOA 3CU1A 2DQFA 1A3RH 1J1PL 1OF2A 4L3AA 3T3PF 4CNIB 3C8DA 5IMLB 3CCHA 3IU3B 3U0PB 2RFXB 1IGCH 2AJ3B 2WBJC 3ZDYE 1WWAX 4JM2A 2FEEI 4HUUA 4F8QA 5JPMB 4L8SB 3HTLX 4QRSB 3L3OB 1G7HB 4DVBA 5C70A 3PJSA 1I7RA 1JJUA 4U1KA 4GRWE 5IQ9B 3PGDB 5AYUL 3VCLB 3P77B 1RUPH 3PNWA 2BNQE 5EO9B 5IBLD 1NMBL 3D3VA 3HAEG 1ZTXL 1D5BB 4L4VB 4HKXB 4PJ8C 4YPJA 1MCOL 3K81A 4FQ2L 5HYFA 1U2CA 2WUBL 3U36A 3FZUD 1NDMA 3H9SB 1PGRB 2Z91B 5CILH 2VAJA 2N1KA 4YNYB 4Y5YC 1A14L 3KPMA 4S1QL 2ZUWA 4UAOB 1WIPA 4G6KL 4L1DA 1ZT1B 4JDTL 3QEHB 1TZGL 3DYOA 5I66B 4HWBH 1Y18A 2HFGH 43C9B 2QSVA 1SBSH 4F7TB 3GMQA 4MLSA 4M1CD 4ZO8A 2CD0A 3L95A 5CWSA 3FQWB 4DUXA 4F7PB 1MJJB 3QZWB 4UQ2B 4F7CA 2C4XA 5DK0A 5IB3B 4UB0H 5ETUA 5HHVH 1Z5LB 1U91A 35C8H 1E4KC 5TF1H 5MEQB 3O6FB 5ISZA 4LBEA 3X14B 2JIXB 3W11D 1DBAL 4UIMA 4NJAL 4XP6H 1LGVA 5D70L 3M1BB 1YEIH 1SJXA 4WHCA 5DMIH 1U3HD 5E6IB 4AIZB 2VDQL 2W91A 2EDFA 5E7FA 1HHHA 1OQXA 2D9QB 2GK0B 5AYQA 5JW4R 4EBQH 3D0VB 2XNAA 5J12B 3C6SA 3G5YA 3O4LB 2F8XC 2K7PA 5E8NA 1N6QL 3HKFA 3V8OA 3HC3H 2IAMD 4XX1G 3LPGA 3MOBH 4S1RL 4P9ML 3IGAB 1CD1A 3CFJB 2P49B 1KJ2B 4LSRH 4OFDA 5IT2L 1LQSR 4X4ZA 3HZYB 3VRIA 3AXLB 2DB8A 2VXSH 5D8JH 5FOBB 2XN9E 5FYJE 3KJ6H 2D9CA 2VL5B 4PB0H 1YECH 1A6ZB 2ED7A 4HXAH 3U1SH 4G9FE 3TC9A 1TQCB 2Z93B 3TBTB 3DBXA 2FRGP 1FVDB 1A0QL 1KB9J 3BDYH 1A6WH 1JPSL 1U8OB 4AM0A 2C7UB 2QEJA 2X41A 4ZOCA 4GG8B 4OQTA 3X3GL 3S5LB 4ONFL 4K71C 3KJ4C 3QULA 5LGJB 1ZVSB 3IDXH 5E2TL 5JIHA 3FFDB 5ADOL 5DD3L 1F4YH 3CNKA 1RK1A 3FTGA 3U4BH 5I16A 2APVA 2SEBA 1RQ5A 5FYKH 3V7AG 3EGSA 4XBGB 2CDFB 5SX5K 1FDLH 3OAZK 2H2SD 4JFQA 4MB4A 5AAMA 3IS0X 3F7QA 5CKAA 5CZXD 2ZP0T 1FL6A 1J10A 1A3QA 2F58H 2VABA 4KI5C 1EXUB 4P9HL 1JUFB 1S3KL 5D1QB 2AGJH 5EWIH 4PJXF 1MLCB 4G8EA 3ZT7A 3MPCA 3VFNA 4UBDD 4CVWA 2GFBA 1ITBB 4U6YB 1N64L 1U92B 4G80A 4GBXC 4HC1A 1IC5H 2DKSA 2PKDA 1T7ZA 25C8H 4RZCB 3NN8A 3BGMA 5EPMB 3SCMB 3P73B 3UJJL 4HWEH 3ARVA 5B8CC 2JB6A 1CE6A 5JNYB 1CFQB 1IE5A 3RWHA 1P9MC 5D2NE 4GAJH 2BY1A 4KJQC 1OGAD 5JMRA 1TETH 5LCVH 5GGTH 5I74B 4QNPF 1X5FA 1NGXB 3IFLH 3QXAB 4GW1B 3TLRA 3SEPA 3TEUA 4NKQB 3AS1A 4MXWL 2MHAB 3PHOB 1FG2B 4X98A 3UC0L 4U1GB 6FABL 2W38A 5FUZL 1BIIB 4QRTA 4YIQA 5IVXA 4Z78A 1FE8H 4HS6A 3KR3H 4WVRA 3Q3GB 4P23D 3MV8D 3VU2A 4Z7WB 1NGWB 3AY4C 3IAGC 2UYLB 5T1MB 3BN9C 3BDBA 3CLFH 5C9JB 1TJIL 1OARL 4OT1L 3U82B 3P4NB 1DTUA 4UZGA 5JZ7D 4R97B 4F9PA 5T3ZD 1YEGH 1KN4L 3U0TA 3GSNA 4LCWE 1ZANL 4JPWH 3DO7A 3IDYB 3QFJD 4XHJD 3IDIB 3ILQC 4NN7C 2CXGA 3KPLA 4R96B 2RQ8A 3DV6B 4PTTA 2Y7QB 1NEZB 5IF0A 3OKLA 3S96B 4EDXA 1DQQA 4IMKC 2Q6WA 2WIIB 4G43A 3MLVL 2HVKB 5CJXA 5K9KB 1NQBA 1BFTA 3O8XC 1BFSA 1NC2A 1NCAL 4AEIH 4F2MA 4PJAB 4DFHA 4APQB 4QHNB 4JFZL 4I0PC 5A3ID 3W2DH 3TBVA 4H5SB 4TULH 2B5IC 3VFWB 1NGPH 4PRNA 3GFUA 1KJ2H 5LWYL 2W65A 3C8KB 3TZVD 3H42H 1IQWH 4Y4KA 2X4PB 4Y19A 3E8UH 2HJLB 5FA4B 4PGDB 3RVVD 4G6JL 1UZ8B 2E5EA 4N8PA 5E8EB 4CL7A 3LS5L 2IH3A 5J4MA 4X6DB 3VWKC 1INDH 2H9GB 3VG9B 2FD6H 4YDVA 5IEHB 2OMBA 4K3DH 3EO9L 2NNAB 3QRFM 3LN4B 4KKCD 4WW2C 4L9LC 2HTLC 1TCRB 2NXZB 1YMMD 3GDBA 4JEGB 1RVFH 3MLXH 3MGTA 3N1GC 1F4WL 3BO8B 4JKPH 15C8H 2GY5A 3Q6FB 4GQ9H 4KQ4H 5F72S 4G6AC 3C6LA 2R56L 3LKSB 4G6FB 3H0TB 4NO0D 4AG4H 2ZOLB 3CDFA 5M94B 4HWBL 5KSAB 4HBQA 2BNUB 2PNDA 3B6SA 1SBSL 2IC2A 4M62H 3SDDA 1A1MA 3B83A 3MYZA 4HFWB 1X7QA 5HVHB 2W0FA 4WDIA 3NCYS 5BXFB 5B39A 3H8NA 3EOAB 4NHUB 3FB8A 5HHVL 1QTYT 35C8L 3BOVA 3GZKA 1IM3B 2YD6A 2X44D 3MRPA 3AC0A 5EN2B 5I1CL 4PRHB 4XP6L 4U3CA 3OHXA 1YEIL 4E0RB 4HGWB 4EEEA 3B9KA 1OM3H 1MVFA 1FRGH 3B43A 5KS9B 5J1AB 4M5YH 4XGZA 3HE6B 1RULL 4XAWH 4EBQL 4K7PY 2VAAB 3KNBA 3RY6C 3QDMD 1M05B 3HC3L 5LAXB 1JFQH 2DQCH 3VGEA 3IDNB 2FHCA 1QBML 4PB9H 5SWZA 3D87B 3DVGA 4MAYD 4XBPA 1MJ7H 4LSRL 2B2XH 3WO4C 3ZHLA 5F88B 2PR4L 4WWKC 1BJMA 5FGSA 1JPGA 3MNVA 4JFDB 3TVMA 2IQAA 2VXSL 1IAOB 3KJ6L 4PB0L 4YH6A 1U42A 1YECL 1EJOH 1IZKA 1XF5B 4UUJA 3BKML 1IAIH 3KHOA 3ZE0E 3U1SL 3JWOH 5JXED 1QQDB 5TPWH 3SKMB 3ROOB 2FO4A 1I1YA 4J1UA 4UT6H 4QRUA 1KCVH 4YGVB 1I1RA 4NKIH 4G7VL 4I9WE 4JO3H 4WO4D 3LEYH 1SJVA 2OR8A 4HW6A 3G6JA 3BD5A 4OZFG 1FLRH 3JWNC 3KYOA 4FQHB 3JV6A 3IDXL 5J0BA 3U4BL 3LRSA 3T77B 1CXLA 3HA0A 1LEKB 1X5XA 4X6CA 1DJSA 1XGQB 4LIQE 5CJOH 5HYQB 5IMKB 2DDQH 2X89A 4CU6A 3MRMA 1J05A 4KZEH 1FNSL 1EHAA 1AXTL 1KNOA 4NGHH 4MD5B 4NQVA 2QJDA 4MNQB 3MOQA 1AHWC 5AZEH 4N1HB 3S7GA 5F8QC 5CEXB 5T3XE 4PJBA 2V9QA 4HKBA 1MQKH 2ZUXA 1UM4H 1WEJH 3HFMH 5EWIL 3O9WC 2Q3ZA 5KVGH 4LCIH 4NFBA 3AREC 5GGSY 3FOLB 3HCVB 3LQAH 1HWGB 4QXTB 1IC5L 4I13B 3DV4A 4XP1L 25C8L 3WN5A 2XRAL 3OJVC 3V52H 4YUEH 1IAKB 1QSEE 1MI5B 4HWEL 4ZFGL 2NTFB 3SE4C 4URTB 4XP9H 4FFWD 4LCCB 1IEBB 3T2PA 2NLJB 2CH8A 4GAJL 4LRNH 4Y1AB 4EUPH 1NSNL 3MV9D 4PJGB 1OGAB 1KTLA 4NQSA 5IMMA 1TETL 3LKQA 3O3AB 5KBNC 3N50A 4XP4H 1R0AH 3MUGB 2XTJC 1O5DT 5IFAL 1KJ3L 4LP4A 1T20A 1GJIA 2OLDA 2XT1B 1S5HB 4XCNB 4F15B 2E9BA 4Y2DC 4I2XB 2P24B 4NO3B 4CN1A 2Z31A 1UEMA 4P3DA 5FCUL 5CEYB 1T89C 1Q9OA 1U8JA 1PKQB 3KXFE 4WV1B 2JELH 2ICEB 5IM7A 4QT5A 1OW0A 2FECL 2BNQD 4HIEA 3CLFL 1P84J 1JZ4A 3BJLA 3BUYB 2JCCA 5D2LA 4Z8FH 3QIUB 2IH1B 2EDBA 3MUJA 4HJGA 5I8KL 5JHDE 4QRRE 5IVNA 4QTHB 1R3HA 2QKIA 1OF2B 4M00A 4LQFL 4R9HA 4QRPB 3I02A 2F53A 4M1GL 2BMKA 1EBPA 2YKLH 4KDVA 4R4BA 1F97A 4XPHL 3OKDB 3TPUA 4QHLA 4ZUTA 5GGTA 4M3JA 3QUKA 4TSAH 2CXKA 2Y07H 4YC2C 3PIQA 3NFNB 3SO3B 1OT1A 1CS6A 2QV2A 2OJZH 3X11B 5F7DB 3MRRA 5KSBA 4ODHL 3GBLA 3OKNA 4WI5A 3ROLB 5ACZB 4YZFE 2EDQA 2B20A 3MRFA 3U36B 1LEIB 1NDMB 4TULL 5HGHB 1J0JA 1FAIH 2QSCH 2YD2A 1A1NA 1KJ2L 5L88H 4LCYB 1I85A 3T0DA 1IQWL 2GTWA 4YQXL 3E8UL 3S35H 2Z4QA 2HT2D 4NDMA 3HC0A 1YY9C 2ADJB 4X4YA 1JHTA 3ARYA 5GIRA 5TDOB 3IFPB 4ORZC 4ZO6A 4YDJB 5E5UB 4QXGH 2CLRA 3IKCA 2OL3B 4GW5B 4UNTA 4NCC2 1FG9C 3P9LB 1INDL 5C92A 3MRCA 1C8PA 4ONGH 4LLUA 5FYKU 3PWVB 3G9AB 3O6MH 4PJ7A 4HIIB 2XN9D 5FYJD 4PG9A 5L2KA 1Z9LA 4Y2OA 1RAMA 4M5ZH 3ZT6A 4G9FD 4KKAD 2XWTA 1RVFL 3MLXL 1V05A 2GYSA 2YBRA 1MEXH 4OD2A 4JKPL 4MJ4A 2H32B 4GQ9L 5ENWB 4PJDB 4TUJA 1FSKB 2BSED 1KPVA 5L8JB 2R29L 1DQDL 1U93B 4P2QB 2XNAB 1Q72L 5HPOA 5IWLA 3MJ8A 3VXMA 1TPXC 1DN2A 1T0NA 3FB5B 5AWNH 4F9LA 1DUZB 2R0ZL 3QDJA 5IVZB 3EDDA 4N5ED 3VFTB 3ARBD 1A8JH 3PV6A 4HUNB 4LLMA 4ZTPL 1FRGL 2FEDD 2OTPA 4KY1H 4M5YL 4N0UB 2Y5TA 3QP3A 2Z35A 1NC4B 1I7ZB 32C2B 3LKNA 5DC0A 4MJ6B 3BQUD 3O41B 3RL2A 4ONOA 1P53A 1GRWA 3WCYA 4NC1C 4FXGB 4PB9L 4Y16A 1KJVA 2GCYB 4Z7UA 4YHYB 3TM6A 5F7UA 1MJ7L 2B2XL 3OG4B 4QRQA 3D2UB 1WWWX 3SKJH 1WZMA 2DN7A 3QDGA 2A2QT 4YE4L 5ABDE 1B0RA 5HJ3A 4AT6B 1RK1B 1IAIL 5DZNA 5BOPA 2BVTA 3L3IB 3JWOL 4LDLB 4BFIA 4OUUB 3QSKB 4JRXA 5B3JE 4HK0B 1GVIA 3RTQB 4UT6L 3ES6B 1AO7B 4XC3H 1MUJA 1KCVL 3KPPA 4NKIL 1CBVL 3NA4A 1BQLH 1GHFL 5D1ZC 4OBRA 4JO3L 2G60L 2PW1B 5IKCA 3RGVC 4WO4B 3QH3A 5IB5B 1Q38A 1F42A 1FLRL 1H8SA 4HF5H 3FCTB 3O45A 4G42B 4LLDA 1PKOA 5C07A 1HOCB 4G8EB 1E4XI 4P5TB 4ZFOB 4MAUL 3BIKB 3LSOA 4Y4FC 4RFOL 5HHXH 1P7KB 3U4AA 4Q58C 1T2QH 2DTMH 1HINH 4IOIA 4RAUB 1KOAA 5H94B 1FFRA 2ICCA 3BGMB 1KB5H 5T3ZH 2XWBA 4NZRH 3GBML 2VXUL 1DVFA 1AP2B 4WU7B 2A73A 3VXRB 2DL2A 4KVNH 2OXGA 3EUUA 3HFML 1WEJL 1EO5A 4YR6A 5KVGL 4LCIL 4U7KA 4LCWD 1A9BB 5I8EA 2QL1A 3FT3B 3OF6D 4O2EA 1PZUB 3QFDB 3F7YB 1KCKA 2OMNA 4ZUSB 4HS3B 3I75A 1BMGA 4QHUB 3V52L 4FQLH 4YUEL 5I1GH 4TQEL 3L5IA 4F8TA 5GISL 4RFEB 4XP9L 1D7FA 1O0VA 1PSKH 2FZ3B 1BFVH 4NCDA 4LRNL 3H6JA 5HGAB 3VWJB 3KPNB 1YDPB 3K1DA 3TESA 3EYOA 4DZ8B 3MJGX 5DQDH 5TE6L 4EQ2A 4JHBA 4QOKB 2OL3H 2CKNA 3U0TB 1LO5B 2P5EE 4NQDB 3DO7B 4XZUB 3TA3D 3HE7C 4OGXH 2JELL 3ILPB 4PGEB 3U9PL 1DDHA 4HT1L 4M6OL 5D7LE 3LAFA 3G5XB 2H32H 1PX4A 1DQQB 4Z8FL 3NH7L 2YD3A 4PJCF 3HPLB 3VFRA 3GMOA 1NAMB 4M7LT 3TBWA 1IGJB 5MEPB 1FLTX 3MLTB 2OZ4L 1ODAA 4UILH 1BWMA 4H0IA 1U8QB 2AP2A 3WFHB 3WFDH 3EYUH 1RD6A 4EUPA 5K9OA 5I76B 1Q0YH 3SDAB 5EC2A 1J8HB 2D4DA 3QNYB 3VH8B 3RWDB 4ZNEE 5EZJA 1E4JA 4ELMB 1QBLH 2Y07L 3FO2A 3CVHH 1P1ZA 4JFYA 3DHMA 3MJ7A 4PJHE 1JGDA 3CVIH 4UIKH 3TBYB 4Q9RL 4LOUC 1CG9B 3WLWC 1VEOA 1DL7H 3IXTA 4ISVA 1GGYA 2QSCL 3RP1A 1SJHA 3WFZA 4PY7A 1KLGA 3ARDC 5F9WC 1W0VA 1N5AA 1HDMB 2OS7A 3VXPA 4JM2F 4JCLA 4QXGL 1JF1B 1J11A 1B88A 5DMKB 3RX8A 1NUGA 3Q5OA 1IILE 5DT1L 5C09B 1DQLH 3MRIB 4R3SB 4BSJA 3FB8B 4U2YA 4LSVL 2HH0L 4M5ZL 1OP9A 4KPHH 1RIVH 2NY6C 2XA8H 1F4AA 1AD0B 3CFIC 1AR1C 4HKJB 4ZOEA 1I4FA 5ITBL 3WJJC 1MVUB 3MCLH 5B39G 1MEXL 1YPZE 2HT3D 2FX9L 4P9HC 5DVOA 1GGUA 2RR3A 3L6FB 1EFXB 2IG2H 1U3HA 1R3JA 3VRJB 4I9WD 3BKJH 3GSVA 4ZXBD 3WHE1 4MDIA 4JN1H 1W72B 2MFNA 3K74B 1YUHA 2NY3B 4KI5E 5DRNB 1YNLH 2WZPD 4KK9D 3ZKND 2IAMA 3MBED 2FBJL 2QTEA 5CHNA 1CT8B 3MFFB 2E8YA 4MQXC 1CVRA 4XBPB 4QWWC 5GGVY 4MA8L 1A1OB 4ZUUB 4B7IA 3S36L 3QNZB 5GS2D 3ARFB 4Z76A 1Q9KA 4POUB 4KUZL 1OAXH 2IQAB 4P2YA 1BIHA 4LNVA 3MRLA 4MS8D 4ZPTB 2FX7L 3PG2A 4CMHC 3GUTB 5FXCH 4OCLC 3CFBA 4KY1L 5A2KH 1KCLA 2H3NA 3IDMB 1T1YA 4PS4H 4P5KB 3OBAA 3VXUE 5FM4A 1EAPB 5T3XD 4ETYA 2F5AL 4MWFA 1DZBA 1ZHKB 2V9RA 5CINH 1X9QA 2VZ3A 2X09A 1F00I 2ICWA 5CJQL 1U95A 3MLZH 4NZTH 4NKOB 3SKJL 4J3TA 5KVEL 1C5BH 3P4OB 4S10A 4JQIL 5CZKA 2ZUQC 1AKJB 3W9DB 4XNZC 2EE9A 1QKZH 1QSED 5E8DH 1A6TB 5C0BB 4R6UA 2NY0B 4HD9A 2AXFB 5IHZA 1MPAH 1RJLA 1KBGH 5JOFA 2RHEA 3BEWA 5D2NB 4AY0A 1RHFA 4EIGB 3QIWB 1KENL 1Y6MR 4U7SA 3VI4E 1CLOH 3T0EB 5F70A 1AGDB 2QADC 5A2LH 3UTQB 3VFPB 3MLSL 4HF5L 2ZUTA 4GRWH 5JQHC 3AU1A 3CFDB 3MGOB 1S5IL 2D7PA 5GS0D 2AJZA 3GMMB 2HFEA 2FX8H 1U8LB 5L2JB 5JLZB 3B5GA 5F7YC 5D7SH 5T5NG 3IJYA 2DTML 1CDCA 1HINL 1D3CA 5B4MC 4KQ3H 3KXFD 4DKAA 2WBKA 4PUBH 4YDLB 1KB5L 4IIQB 4M7KH 5KSUA 2BVUA 5EUKA 2BRQA 1GCFA 1EPFA 5D1XD 3O11B 5ANMA 1LP9A 3IF1B 5JHDD 3LKQB 4O2CA 4QRRD 5EU5A 1F13A 1MREH 2XZAH 3C60C 3CX5K 5EO0A 5MI0B 2VDNH 5E95B 5GGUA 4OCMC 3ULVH 2R1WA 4Z5RA 3FQNA 4IS6B 4KK8C 1RU9H 1T6VN 5JPNA 4BZ1H 4POZC 4X6FB 1J8KA 4JLRA 3LKPA 1MHHB 2A6KB 4FQLL 1KF9B 5I1GL 4JPVL 2Y6SD 1QFHA 1VENA 4KJWD 4Q6IC 5CGMA 2LABA 3A6CL 1BECA 5EULV 4HWZA 3HNSH 4JZNA 2NXYD 4PY8I 1L0YA 5IHUH 4P23A 3MV8A 3G6AA 2GITA 3BXNA 4LPWA 1CGWA 5I75C 5LXGH 5D2LB 5C0EB 2HKFH 4LVOB 3PDDA 5DQDL 3GSXB 1BAFH 5I1KH 2OL3L 1YEDA 3GKWL 4JFFE 4RRPG 1YEJL 2ZSVB 1KB5A 5SV4A 4NN5C 3VA6A 2J5LB 3P3YA 2VLRE 4OD3H 2GAZA 3KPRE 3QFJA 5FYJH 5H37G 3TA3B 5C6PB 1KIRA 4HUVA 4IJ3C 4C58B 5CP7B 1NANI 2FATH 4H1LH 5A16A 3DRQA 1S7XA 1RJYA 4GKSA 4M61B 1WUNT 1RI8A 5GSRA 2Q86B 1N6UA 4FQQB 5IVXF 4YO0A 3DVIA 4D0CB 3CPLA 4BSWA 1ORSB 3X12A 5FO9A 1QFWH 3M17B 4KUCF 1UQSB 4FFVD 2V2TA 1JL8A 5LG1A 2XKNA 3HG1E 2M8XA 2NY4B 3ISWA 2DYPA 1FZOB 1XR8B 4LF3B 4O4YL 2C1PB 4WEBH 3EYUL 2VZTA 2XI9A 3IKKA 3JV0A 1Q0YL 4U1MB 2NY1D 3TZVA 1NFKA 4UU9A 3OJ2C 3QPXH 4OGZA 3C5ZB 4BH8A 4HCRH 2FR4A 1NGYB 4M93C 5INDB 3JSSA 4UT9H 3C09C 12E8L 1F8TL 1PYWA 2VQUA 4FQJH 5F89B 4RMRA 1QPXA 1LK2B 2V5YA 4C57C 1JBJA 2G9HB 1QUNA 1NMAH 1RZ8B 5KZCB 5EOCJ 4Q97A 5L8KB 2LAAA 3L9RB 4LNRB 5E00B 1RJZB 5EU3A 3F6IA 1YMMA 4N9OB 4U05A 5DYOA 1XCQB 4OD2B 2ZZUT 3PWUB 5DK2B 1U8NA 3ZE2E 1NUDA 3VXTB 2JB5L 4NO0A 1CVSC 4LKXB 4NNXA 3NCJH 2F5BH 2R2CA 3LVEA 3FFCE 3SGKA 1K9TA 1K2DB 3S36X 4PG2A 4OLUL 4IDJH 4O51A 2YD8A 5GS1B 1NH6A 4Y4HD 2ITDA 1RIVL 4HIXH 2J4WL 2XA8L 2HYMA 3MCLL 1QSVA 4AQOA 1WCBA 4N90E 3QHZL 4GUPA 4R90L 4FQXB 5HI5D 2IG2L 5IW6A 1JNLL 3VI3F 1HXYA 1FAKT 4ZFOL 3CVHA 2LAGB 3BKJL 4YHNA 5JIPA 5IQ7H 2AJSH 5JDSA 5F7LB 3LKNB 3MJ6A 4JN1L 3UO1H 3V6OC 4PJIB 1HXMA 4H26A 4L4TB 5FUCC 3NPSC 1YNLL 3CMOH 3QDMA 1R5IB 4P2RE 5D9SB 2AJVL 3VXOA 4LCUA 2LQRA 3BH8B 3E3QC 3SDCB 1LNUB 4ZAKD 1K5NA 1Z3GL 4MAYA 3RWIB 1FJ1A 5DJDB 3W0WB 3HZKA 3OKMA 4R4ND 2EDYA 4L8SC 1SEBA 3GK8H 3TN0B 1VACB 3JWDH 4PS4L 2YD7A 1INEL 5ESVB 5JXEA 2X9YA 4G8GE 3TH2T 3HI1A 1KSRA 5E4EB 1TJGH 2V5RA 1QLFB 2BSTB 3WHXA 3G08B 3WJLC 4NQCE 1IKNA 1AY1H 4YHLH 4X7FC 2OJEB 4NZTL 2XTJE 4AJ0A 3E6FA 1LE9B 2W92A 3IFOA 3P9MA 1C5BL 3RVTD 1JHLL 2WBJD 1JZ3A 4XBEL 1VSCA 2FJFA 4PP2A 1QKZL 5E8DL 3NPZB 5I30H 4UAOC 3BVNB 3TIDB 2P5WE 1MPAL 1KBGL 2OXHA 1BZ9A 2H1PH 4OFKA 4WEUD 1CCZA 1QD0A 1CGVA 1EVUA 2DWEA 5E6YA 4PJ8D 4WHTA 1KIUA 1H0DB 1GOGA 2UWEB 5E0QA 1ZEAH 4Q7DA 3NCCB 5F9JA 4KJYA 3ECBB 1A4KB 5FKAB 5IEKA 3O6FC 2FX8L 2P5ED 1VGKA 2BSRA 4JFEE 5GJSH 3G6JF 2DQTH 3T0AA 4KK6C 3MLRH 5D7SL 2F19L 2R9HC 3ARZA 5E6IC 2J2ZA 3VA2C 4PUBL 1P7QD 4M7KL 4CMMB 4K3EH 1HILB 4I1NB 5J12C 4X6CF 2HA1A 5D7LD 4DGVL 1T4KB 4J12A 1D9KB 4R7DA 4ENED 3IDJA 2DLIA 4G8IA 3QEGH 1KLUB 1NCUA 3MV9A 2W9DH 4NQTA 1CR9H 1MREL 3KWWA 1KG0A 2VDNL 3VFSB 5L9DL 3ULVL 4HXBL 4LHQB 2MNUA 4Q0XL 1S9WB 1T80A 3C87A 2C4FT 4PJBF 4BZ1L 5T5NF 3K8LA 5GZOC 5CGTA 4ZQKA 1PAMA 3OB0H 3WIIH 1TQCC 2GJ6E 1CU4H 3GB7A 4I18B 4J3VA 2BP3A 2VZ1A 2IMMA 2A6IB 4OB5H 5TDNA 4PJFE 4XPAH 4NC0B 2B0SH 5ALCH 3VE0B 2DAVA 4YHZL 1JNHA 3HNSL 3FB7A 1CWVA 4LGRB 2AJYL 3JVGA 2BNQA 1N6VA 4OIIH 1AD9A 4NM4L 5IBUB 5LXGL 3BIBX 5GRXG 4LEOB 3STZA 2ILLA 5DDHA 1XGPA 5K59E 3SKNA 1RUMH 1BWWA 1DBBH 5JTWA 3EYFB 2VZSA 3PQYE 2EYTB 4OD3L 3U30B 1IM9D 1A64A 2XWJB 1YJDL 1RZ7L 2FATL 5K9OB 1XF2B 4NT6B 1RZJL 1J0KA 3QCTH 4FZEL 4L8DB 4KDTC 5EZOH 4PJEE 2P7TB 4HS8H 3G5ZB 2BVQA 2X4UA 3JUYA 5D1QC 1QFWL 4EUPG 1IQDB 3D25B 2L0DA 5DJ2A 4FABH 4H0GA 4U1SA 1W72L 5DEGA 4JFOA 4MCYB 2JCCF 5D2LF 3C5SA 4ZUWB 4Y7MA 2HLFD 4WEBL 2VYRE 3SCMC 3N85L 3MV11 5BQ7B 5GS2H 3ZTNH 2JJUA 4LIQH 3TV3H 4N8VA 1OAKH 4HH9A 1K4CB 4KI5D 4NC1E 4HCRL 3EO1B 1AXSB 4YBQC 4UT9L 5I74C 1QSFE 1Q1JL 3R8QA 4KWUA 3U2SA 5ICZA 2A77H 2P4AB 5DR5L 3H9ZA 3R06B 3RPIB 2XPGA 4DGIH 4GBXD 5T3XH 3D6GA 3JV4A 1NMAL 5JW4Q 2XN9A 4U1GC 5ILTL 2OQJA 2V17H 5KSBF 2R4RL 4DTGH 4MA3B 4G9FA 4H1LA 1NBVH 3ALXA 3QXUA 3RIFF 2DBLH 2GKIA 3VXUD 5E7BA 1U8KB 1ZT4A 3IT8D 5MHSE 3RDTB 4KJQD 3T1WA 3QB7C 2OBGA 3A6BH 4P4RB 1BVKB 4GKZA 4LEXL 2ZCHH 3D48R 3RIFK 1GZQB 2DI9A 2F5BL 4RFNB 1YUHB 3T09A 3BPOB 3DURA 4R97C 1JMXA 2EDWA 4CVUA 4IDJL 2EH8H 5FV1L 1YN6B 4YBLB 3T3MF 4FS0A 5AWNL 5I71B 4HIXL 1XF4A 4LSSH 4OZIE 3TCLB 2OTWA 1Q94A 3LN5B 5GRWA 1G9NL 3ARBA 4PJ7F 1J5OL 5CSBA 5JA9A 5C08E 3GO1H 4HCRA 5HHMB 1WZ1L 4CADA 1HEZB 3L3KB 3BN9D 3LRHA 2AJSL 2AKRA 4O02L 3UO1L 4NUGH 3OZ9L 4X9IA 3BQUA 4S1SH 1HQRB 2VDML 4IRSB 5HHOE 1JWUA 1UZ6E 4Z0BL 2QBWA 3QJHA 4J8RB 1KCUH 4APQC 4JAMB 1R24B 1PG7W 2B8OT 3KS0H 4X5LA 3PP4H 3MV7B 1MFDH 4U49A 5ID0B 2F54E 1I3GL 3RBGA 3RX7A 3RUGE 4DKFH 3ILQD 4GH7B 2HFTA 2CRYA 5T1LB 2APTA 1EERB 2FH6A 2V2XA 4JQVC 3BSZH 1U9KA 3GK8L 2ARJA 4GO6B 1M6OB 3JWDL 2M1KA 5I8CA 4RMQA 1IGTA 4DCQA 1C1EH 4NM8H 1TJGL 4OKVA 1VFOA 5DHVA 4ZUVA 3P4MA 1KN2H 1I9RL 3ZDZF 3O8XD 2NX5E 5IUSA 1FZKA 5F1OB 3SO5A 1SYSB 2AV7B 1CK0L 5GSVA 1JTPA 3SY0B 1AY1L 3VG9C 3UAJC 4EI5A 1KCRL 1K8IB 1JRHH 1OP3H 4HX1A 4G5ZH 1K8DA 2D03H 1A7QH 3MOAH 4I0PD 2UZIH 5KSVB 3NTCH 4HJ0C 5EZIH 5FYJU 1HNGA 4KJPC 2NXZC 4Z7UF 1E27B 1XGTB 1CIDA 4LKCA 3TYGH 5EU6E 5J06A 4ACPA 5I1EL 1TDQA 2XTLA 1KXTB 5KSAC 3KPSB 5JORA 3PL6B 3INUL 3VWKD 3I84A 4K23H 1HHGB 3NFPA 1BBJA 3VFUA 5HVHC 1I8LA 1ZEAL 2YPLB 1VA9A 3TO2A 4JO4L 4LHUD 2HTLD 4JFFD 1G9MC 2MMXA 1MLBA 3QA3B 4F3FA 3QQ4B 1IFHH 5IHBA 2APWA 3IJHA 3T8XA 3OXRB 4LCWA 2NCMA 2VLRD 2DQTL 3KPRD 2X70B 1EH9A 4UI2A 5DUBA 3OF6A 5IG7A 3QUXB 4G6AD 3HB3D 2Z0BA 1XF3A 3HE6C 3HRZB 1SHMA 2J8UB 4K7PH 2HVJA 1BQHA 2J8HA 3AM8C 3GJEA 3O2DA 1IMHC 2KDGA 2HP4A 3FRUA 3DARA 4OLXH 3CMGA 3QEGL 4P3CH 5TF0A 1XGUB 2JJTA 4HBCL 1PQZA 4YFLI 3UBXB 4LRIA 2KL6A 3QNXA 4NO2B 2W0KA 2ZG3A 3HG1D 3ALWA 3CH1A 1IAIM 3SJVB 3Q48A 4V1DE 3WIIL 1G0YR 1CU4L 4OB5L 5I1IH 3NIDF 1D5MA 1VKXA 1YYMH 3V0VB 1I7UA 1BP3B 3HUJB 5ALCL 3SE9H 4V2BA 3FT2B 5CP3H 2VDKH 3SDXA 2VDRH 2GT9B 8FABB 5F3BA 3RKPA 2R0LH 4OIIL 5IROA 4WWKD 1S7QA 5BZWB 3ZTJH 1KJMB 4XNXL 3QWOB 4ZTOH 2HLAB 1HQ4B 2I5YL 4M4PA 1KLFA 4PGZA 2V2TB 1S7RA 1DBBL 4AH2A 4BZYA 4M4RA 1PEZA 5HHNA 2H6PA 3W81A 3C2SA 4HEPG 1YN7A 2ICES 4O2FA 4E9LA 1LK3L 3FO1B 3PDGA 5DO2C 5LQBH 3W5NA 2H8PB 3QCTL 1BD2B 4Q2ZB 3T4AB 1G6RH 1Q8MA 4OCNC 3FFCD 5AUMB 3K4DA 2XZZA 3KJ4B 1YMHA 4MCZA 1DLHB 1KGCE 4PBVC 2EKJA 3SDCD 1JK8A 3O3EB 5CBEA 4Y5VA 2Q76A 4FABL 1D5XA 1J0IA 1TVHA 1YQVL 3DX7B 1NFIB 4JGJA 3B2VH 43CAB 5F9OH 5FM5M 1JTOA 1MWAB 4N90D 3OXSB 1HI6A 3ARPA 4EXKA 5AAWA 2BJMH 3HLAB 4PRPE 3OGCB 4WWID 1U0QA 3ZTNL 3TV3L 3IDGA 3WS6C 4LCCC 3O3DB 4YDKH 5D7JB 2H45A 5CLWA 3WFEH 3RWEB 4P2RD 2A83B 5TE4H 3O9WD 5E8OA 3TNNB 4XTRC 2A77L 2EC9T 3N9GL 3ARED 4M8QA 5TJWK 4MNGA 2VIRB 4C83B 2CKBA 5C86A 5T3XL 1R5VA 4CDGC 2AV1A 3MBXL 1S9YB 2VLKB 4AK1A 5FB8A 5IMOA 4BFGA 4RAHA 3KPQA 2V17L 4JFPA 4DTGL 1MF2H 2AK4E 4G8GD 4K9EC 2VDPL 1NCBL 4WV1C 4YHML 1QRNB 5BV7B 3L3DA 4FMFA 1HXYB 3TJHC 4ZS7L 3FQXB 4NQCD 3QUZD 3A6BL 1MCPH 2HJFB 2ZCHL 2X7LB 5TFSH 4ZXBA 3QO1B 2XTJD 3QIUC 3AROA 4XH2A 3G5VB 4HLZH 3BWUC 3W39B 1AGCA 3CX5J 2XXMB 2ESVE 3MBEA 5J56B 4Y2DD 3VG0H 4NRZA 4LSSL 3TP4A 1U6AH 4XNMB 2P5WD 4BM7A 4OGAC 4U6HB 5C0IA 4X6EA 2HWZH 3RJDA 2X4SB 3P0VL 1KIQA 4JY6A 4WUUE 4NUGL 2ORBH 4YEFA 4WCYL 1L6ZA 3S98A 2CQVA 3SO3C 3QISA 1C5DB 3BW9A 1CL7H 4XXCA 4POYA 1KCUL 4ZOAA 3BZFA 2MCPL 1UM6H 5DFVC 1HH6B 4HUWB 2DWDA 3D0LB 4M02A 3PP4L 4WU5B 5KOMC 4JFED 3E6FB 3FO0H 4I5BA 5F3HA 2VXTH 4DKFL 4EJ1C 2Z92B 3OKOB 2FJFB 4YAQA 3PWPE 1CFTA 1QSEA 2DS4A 4O5LH 1P4IH 2EO1A 5BOZG 4NM8L 4WHDA 2NW2A 1B90A 3MRHA 3OQ3B 3QXDB 5H2BA 2XG5A 4JZJB 1KN2L 1YY8A 4IOSD 4OD1H 1H15A 5C0AA 3WXVL 4TNWF 1CD8A 5GHWL 2GI7A 3LIZH 5I2IA 3VW3H 4G5ZL 2D03L 3MOAL 5HDQL 1N4XH 5IW1A 1JPFB 2UZIL 3NTCL 4HFUL 5EZIL 4L3EB 3VFOA 3ABZA 1LO3H 2IADB 1DR9A 2OP4H 4TNWK 5JUEL 1UB5B 2GJ6D 3KG5A 3LQZA 1JHKL 4U3HA 2YWYA 1GOFA 1XGYH 3P40A 1ORQA 2FJHA 1OPGH 3SKUD 1FSKC 3GGWA 1T1XA 3NIFE 3THMH 3KXFA 2HRPL 4J4PC 3DX9A 5C0JA 3WXWH 4RMWA 2J1KA 3E6HB 1TCMA 4X5XA 2DOCA 3CK0H 4GG6B 5C2UB 3S6CA 2HKHH 2ATPA 1EIBA 1TJHH 3U79A 1RPQA 2ADFL 5DJXB 2EIZA 5EUOE 5JHDA 5MEOB 4QRRA 3HMWH 2VE6B 1G7IA 5FHAH 4GJTB 5DA0B 3IETB 3PQYD 3QQNA 1K4DB 1I9JH 2JF1A 3K4ZA 5JMOC 2FLBT 4PIRF 3BUTA 1S9VB 4GRLB 4P4KB 3WFBH 5I19L 1S78C 2AEIT 2CDEB 1SMOA 5E4IA 1CQKA 4L8CB 1JGVH 4QF1A 5CLTA 4OLXL 2PW2B 1T3FA 4CJ0A 3G04A 1FFNB 2A74B 4YHYC 4ODVH 2Q8BL 3T08A 1B0WA 4KKNA 4OSUH 4ETQA 3CSYA 3GIZL 1D6VL 4LARL 3FQTB 2C5DC 2R1YB 1UGNA 2MKLC 5HI4C 5GJTL 1LP9F 1TVBB 4M9PA 5CBAA 4BZ2H 3RTQC 4ODWA 3B9DA 1EZVY 2NY2B 1QRKA 2DQDL 3DRTB 3SE9L 3KYNA 4CVZA 4E42A 1OQOA 1S9XA 4WNQA 2FGWH 4XNQB 1L7TH 5GPRA 1QSFD 5DK3A 3WNPA 2VDKL 4WO4C 2VDRL 5HGDA 1NEUA 4YPGB 5C0GA 5DD0H 5ITFA 4HIHA 3L7EA 4NWUL 4OCRH 2YXMA 3L7FB 5BV7H 5E9DE 5F1IA 1VCAA 3MLWH 1SMAA 3REWA 3PV7A 4P5TC 4IRZL 4J3UA 2KQNA 5DJ2B 1ZV5A 4LSPL 1GAFH 2CLVB 4MQ7A 5ALBH 1U8MA 4OM0L 1I3UA 1N2RB 5MHSD 4G3YH 2C3VA 5E8PA 3TO4B 4Y88A 5D1ZD 1RZKL 5TH2A 1VADA 2D4FA 3RGVD 2Y25A 4XB7A 1F3JA 3GJFB 4MD0A 3V6OE 1G6RL 1A7NH 2DBJA 1GH7A 4MMXC 5FUCE 1KULA 1AFVL 2FWOB 1GZPB 3ORJA 2C1OA 1JYNA 4E41B 1HH9A 2YEZA 1EEZB 1RZGA 3E3QE 4BFEA 4N8VG 3DHJA 2IPUG 4Y4FD 2D31B 1MRFH 3H3KA 1KFAH 5J9PB 2IALB 5IV2A 5F9OL 1EA9C 2DJ4A 2EYSB 5C08D 1FNEB 3PF2A 1GOHA 5D7IA 4OM1H 2BJML 2HFFA 2CJUH 5E08L 2PTTA 1S7WB 5JW5A 1PW3A 4GXVH 3EOBA 4NYLB 4QO1A 5HHOD 3I85A 3EHBC 3WFEL 3VWJC 1LMKA 3I6LE 5FA3B 4P2RB 1A6AB 4H1LG 1WICA 4X99A 4L4VE 4IOFC 3GKZA 2XQBH 1UB6B 2F54D 1WBYA 1M7DA 3H9SE 5E99H 3N0PB 1E4WL 1EAJA 4FRWA 3S88L 1CGXA 4Y4HA 2VQ1A 2WINA 1MF2L 3LH2H 4ESKA 3R8BB 1G6RA 4LSUH 5I1AB 5B38B 1T7XA 2NX5D 3MRDA 3QIBB 4WI2A 4U1HB 2L7JA 1MCPL 3QUZB 2BVPA 1FZMA 3S37L 5GGSA 1BVLA 2LU3A 5B38G 4OLZH 5IESH 5BJTA 4UOW1 3TIEA 1QR1B 1ZGLA 4M7JL 1OD7A 4XNYL 2P47B 3CDGB 3QRGH 2AQ2A 4YXLH 4D94A 2JK5A 4W6XB 4ZAKA 3GMLA 1X4YA 1GC1L 5K9JL 5EU6D 3VJ6A 3TH3T 3KYMB 1JF5A 3MLUL 1JPST 3RFZC 4XX1E 3MRGA 1QACA 1HKLL 3SDAC 4KAQH 1CF8H 1TTGA 3ULVC 2ORBL 1UADC 4HZAA 1MCHA 1CL7L 5F6HJ 1FNGA 3H3PH 2WV3A 1BZ7B 1I1FA 2D0HA 3FO0L 1OB1B 1QEWB 2VXTL 1EEUA 3GIVA 5I73B 2WBJA 2Y36L 1R3LA 4PGCA 5HDBE 1P4IL 1U2HA 3V6FA 1BBDL 1HHIA 3QJFA 4PRBA 1V7MH 5JORB 5ESAA 1VGEH 4ZMAT 3MNWB 3EYSH 2BDNH 3MXVH 4K3JH 2DQJH 3NFPB 2YC1A 4LOUD 4PJ8A 5IIEA 3HMXH 1H3VA 3WLWD 3VW3L 4OFPA 2DQEH 1R5WA 1S8DB 4XPFH 1OAYL 1Q9LB 1YJDC 5DJAA 4D0BB 4V1DD 1LO3L 1MLBB 1RZJC 2GJ6B 1FFOA 2D7TH 3EDKA 3ARDD 2QR0A 2ITCB 4Y5YA 2P5EA 4K7PX 3VFVA 5TGBB 1XGYL 1OPGL 5BVJB 4NQXA 3EFFA 4XWGH 1ZHNA 4LAQH 4QGTA 3ZE1F 1P7QA 2FIKB 4NKDA 5BS0E 1DE4A 2V7NB 1XCTB 3WXWL 2BY0A 3P11H 2NY3C 2YRPA 5D7LA 1CFBA 3U4EB 3CK0L 3FB6A 2X4NA 1A7PH 3WE6B 2HKHL 1H5BB 1TJHL 3D39A 5GRZA 3PWJB 1E4KA 2NY6D 3ARFC 3HMWL 3ET9F 1BX2A 4X0KB 1Y0LB 5FHAL 1AR1D 3HPJB 1SEQH 2CLZB 3AAZB 2B1HL 2Y1VA 2IFGA 1AJ7L 4NSKA 1I9JL 4CDHA 1C16B 3MTRA 4I8DA 2AEPH 4D0DB 1MNUL 1MWAL 3B9VA 3O6LL 4PJEB 4S2SA 5FM5O 3UTZA 4Q6YA 4ZNEA 2F9BT 5EFIA 1H9VA 1KGCD 4WFGE 4U0QB 4ZYKB 3VDBA 2AAVA 3GI9H 4NBXB 4MQXD 3BIAX 3EOTL 3SDXB 4QWWD 1NGQH 2RB8A 4PJHA 4OSUL 1QA9A 3O0RL 3V9FA 4QHKI 4HDIB 3V0WH 4GKNA 3MMEA 4MA7H 2COQA 1FN4A 4GRMB 4L29B 1PDKA 3FN0H 4H25B 4PRPD 5D4QA 5DJ8B 2FGZA 4I48B 2NY0C 2EKSA 2EE6A 1KV3A 5D2NC 2JJSC 3HR5B 5FYLE 3BT2L 5ICXB 3QIWC 1IM9A 4X4ME 5BO1H 1L7TL 1FYTE 1RIHH 3T0EC 1XIWB 3OKEB 1FZJB 1FL5A 2BXZA 2YD1A 3D69A 4QXUH 4JDVB 4OCRL 1G9NC 5BV7L 1ND0B 1RUAH 2A9NH 1U3ZA 4GRWF 3L3JB 1QVOA 2B7DT 1TVHB 7FABH 1B6DA 5KG9B 2ADIB 2AK4D 1I1CA 4M8VA 5I8OH 3GSRB 1YPZA 4LPCA 4OF0A 3WN5C 1G7JA 1HSAB 2ADGA 2GJZA 4YDLC 4IIQC 1FC2D 4JE4B 5SWQA 4Y5XB 3BPLB 4UDUB 4ERSH 4OV5B 4RCAA 2WLYA 2QADD 3O3BA 1DQJA 3R4DA 1V3JA 1A22B 4DQOL 2CR3A 4LLWB 4DAGH 1TZIA 2G2RB 5D6CA 2YZ8A 4PJAE 4A6YB 5HYIA 5MI0C 2ESVD 3BFOA 3BHBA 5EH1A 1UWEL 4OZIB 4MNGB 5ID1B 1MRFL 5DVLA 2EDLA 3L5WA 4UDTB 4M6ML 3S97C 5MENB 1QZ1A 4GBXA 3T2QA 3MO1B 4PP1C 4OF8A 5H35B 4OM1L 5CD3B 4K3HA 3OGOE 1PEWA 3GBNL 1A4JB 4WUUD 1X5YA 5B8CA 2DMCA 3VFMA 3D5OF 4L9DA 1P9MA 3S37X 3CD4A 3VXUA 4JN2A 1N0XL 2E9JA 1OW0C 3BP7B 3Q6GH 3C60D 5DF0A 4FFYH 5EU7C 2XQBL 4LLQA 4LVOC 3VXSB 3LMJL 4RGNB 5FK9A 1SY6H 4KK8D 5M95B 2EEDA 4G8FA 1MH5A 1XF1A 5E99L 5EC1B 4POZD 2AJXL 1I3RA 2GY7B 3PWPD 2J5LC 2R2HA 5SWSB 1P5UA 1T04A 2G5BA 2IPUK 3FOMB 3TA3C 3DUUA 2VITB 4LSUL 4NN6B 5D71H 2PCPA 2IPKA 3FO9A 5ERWB 4I4WB 3S3JA 1JGEA 3DXAB 5DJ0A 3DMMB 3RL1A 3AY4A 1ZWIA 3RZWA 1QFWM 3W9EB 2XFXB 4OLZL 1T21B 2R15A 4X8JB 4LDEB 1IGFH 2WMPA 2DIBA 4OGYL 2C4FU 4XVSH 2V2WA 1D6EA 1U3YA 5HYSB 4YXLL 5DSCA 3T0WA 4PRHE 2NY4C 3T4YB 4U1LA 2R4SL 1LDSA 4H8WC 5KS9E 3EJYC 3K1KC 1UM5H 4WUKH 4IRJD 3A67L 3U9UA 2BNRB 1A7BA 1FFQA 3C5ZC 2EH7H 4JHWH 4RIRB 3D85D 3Q5TA 3NIGF 4KHTH 5EIVA 1VHPA 3TJEH 4PLNC 4IMKA 3RHWF 1WGOA 4IHOB 4JM4L 5H8DA 3H3PL 4JJ5B 5C0AB 1YNTA 1WVZA 3O8XA 4BK4A 2X10A 1V3LA 1QLRA 3C5JA 3DROA 4JFDE 4NOFA 4ZDHA 5IB1A 4I0PA 4X83A 4GSDH 3RHWK 5DJCB 2GQHA 2Q7YB 4N8CH 4X80H 3IXAA 1JPTH 1KPUB 1FNLA 5E6ZA 2YUZA 2FEEL 2R23B 3TNMB 5E94A 2BHUA 3U46A 3PE9A 2Q7NA 3DSFH 4QHKJ 1V7ML 4RMUA 1FVEA 3EYSL 2BDNL 3MXVL 1DBJL 2GTZB 4CJ1A 2YK1H 3UJTH 3VWKA 3F7VA 4PRDB 4ZPVB 3HMXL 4X5XB 3RVXC 2DQEL 5JO5A 2X4RB 4XPFL 5GS1C 2Y06H 4HPOL 3U0WH 4WW2A 4L9LA 4LHUA 4JFFA 2O26U 1RK0A 1L7IL 3SDYH 3WIFB 2EECA 2HT3C 2VXVL 2VLRA 1UKQA 3KPRA 4FQXC 5T5FH 5IR1A 4QGYA 4XWGL 1WZKA 4UQ3A 4MNQE 4K7FA 3JV5A 4ZO7A 4R2GB 4UNVA 5I18L 3JTSA 5JW3H 5E9DD 4XMPH 4KK9C 3H9HA 1W0WB 1QR4A 2O5ZL 3SDCC 4DN3H 1T1WB 5J6HA 2VLJA 2VNCA 3KLHC 2EDHA 4ETQB 4OAWB 2W59A 4P49A 1DN0A 1B0GA 1U8HA 3HG1A 5TDPA 1HHKB 4MS8C 3QWRD 4TSBH 3GHBH 1AGFA 3PXHA 1GGIH 2J7LA 3TN0C 1MI5E 1T1ZA 4LLYB 4JG1H 1S7TB 5SX4H 1CYGA 4WI6A 3Q1SH 2AEPL 3WS3B 5FECA 4K2UL 3RVWC 2BZDA 5E4EC 1MY7A 3RWFA 3GSOB 3FQUA 4Y1AE 3RY6A 3QDHA 1IC7H 1IGIH 4PJGE 4TUOA 1J12A 1NGQL 3DETC 5EA0L 1J1PH 1YQ2A 5DJ6A 2WIMA 1SM3L 4JKLA 2V5TA 3EFDH 4M7ZB 4HIJA 5FEBA 1F2XK 2YPKA 3LKOB 2DIAA 4WWKA 5HYJB 2N56A 4MA7L 2VXQH 1XH3A 5DRZB 3UPAA 2VJXA 1JWSB 4I2XE 2P8LB 3EO0B 4IMLB 4KI1A 4DUWA 2E27L 1ACZA 5BRZB 5KANG 5DD1L 1PKQE 3BH9B 5EIQA 1MRDH 3I6LD 1CFNB 4MJ5B 3GMNA 1RIHL 4L4VD 5J1TC 1MCOH 1IEAA 4ODUA 2YPVH 2WUBH 4FA8A 3FFCA 3H9SD 4P46B 3SDXF 4S1QH 4X6BB 1CDBA 7FABL 1TFHA 1CD9B 2BOBB 3PDOA 2I07B 3ARGB 3RKDC 4QRPE 3SKOB 4JRYA 5IB4A 1MSPA 1TZGH 5F1KC 4Z7QE 2PTUA 5IFJA 4BKLB 4L4JA 5CD5C 4UTBL 5DJZB 1D9KC 2PYFA 1AHWA 2VERN 3OG6B 1UA6L 3I3BA 2MPAL 1N5YH 2YRLA 5C0FB 1ROWA 5EOTB 3O6FD 1XAUA 3LEXA 3CXDH 2JIXD 3O9WA 1HK6A 4NJAH 1JYWA 4D9LH 3CZFB 1WAAE 1SJEA 4KK6D 3AREA 4Z77B 4G9DA 2R9HD 4NQEB 3ZTJG 2BSSB 2PF6A 4RGOL 5EBLA 1H3PL 2O93L 4QKXB 2VDQH 3BKYH 4I18C 3TYFB 3MREB 3H7BB 5I9QB 4NFDA 3SE4A 1N6QH 2F74B 4MSWB 1JWMB 4G8GA 2HJKA 1EEYA 4S1RH 2ICWJ 4P9MH 4FHBD 2FL5B 4H0HB 4L8BB 3U6RA 5IT2H 4NQCA 2PYEB 1F11A 5HTSA 4JKKA 4WGVB 4NUJB 3L3GB 2W9EH 5GZOD 2P48B 1RHHA 3L3HA 3OX8B 1MCNA 1N59A 4L5FL 2BXYA 3BP6B 4Y2DA 1HKFA 1N3NB 3U30C 1ZHLB 4HEME 3M07A 3LV3A 2P5WA 2W0LA 1T89A 3PGCA 4RA0C 4PJDE 5D71L 4DKEL 4KHXH 1KTDB 1FO0B 2VUYA 2HN7A 4PJ9B 4PJXB 1FV1A 2CDGA 3H7LA 3IJSB 4Z7OE 1AQDB 1FQ9C 1WFNA 3X3GH 1B6UA 2IFFH 4P2QE 3ZE0F 1ZA6B 1J0HA 3QAZB 3PXJA 4S1DC 5BMFH 3DX6A 4GAYA 5E2UH 1QFOA 3DX8B 4QYOA 3QG6A 2ZSWA 1XR9B 1JZ5A 4AZ8A 1IGFL 2A6JA 4XVSL 4U1NB 5MERA 2A6DA 3AB0B 1G0XA 3CSBA 1PZ5B 3STLB 4OFIA 4JFEA 2ATKA 1I1AD 1OAZL 2WANA 4TSCH 3HI5H 4N0UE 3V6BR 1TXKA 4NRYA 5F9AC 5BS0D 5T33L 5J6GA 2Q1EA 4IRJB 5LJYH 1U8PB 3B5TA 4JHWL 5D1QD 1IL1B 1S3KH 1SY6A 3SE8H 1EGJH 2VH5H 1OSZA 3IB4A 3LS4H 3GMPB 5D5MA 3QUMB 4FQIL 3UTTB 1EMTH 2E6QA 4YHPA 4HLZG 1AIFA 3SCMD 4WHYH 5FDWB 4MD4A 4WJ5A 3EDEA 3UJJH 4N8CL 1BLNA 1CICD 1VEMA 4X80L 1JPTL 4E5XA 5KN5A 5I1LB 2IANB 3ULSA 3VXNB 1AO7E 4P99A 4PJFA 2CIKA 3UTSB 3RDTC 4WFGD 3LZFH 1IRAY 3BWAA 3FT4B 5DEZA 3S3SA 5DRWB 4PJ5B 4YBQD 4HHAA 1E6OL 4RNRA 1GGBL 1DE4B 2E3VA 5C8JA 4GKOA 4RFNC 5GGRA 3UJTL 1F90L 3BPOC 4MXWH 5LVEA 1M7XA 1QO3B 4HMDA 1UH2A 5CCKH 2YHGA 4YBLC 1J0ZA 2DQIH 5EU4B 5F7FA 6FABH 5FFLA 5FO7A 5I71C 1RZKC 3KYKH 1I8IB 1UKTA 4PRIA 3BGFB 2DJUA 3NCYP 3V6ZB 3SDYL 2CIIB 2D3VA 3PQYA 1A9EA 5FYLD 3TBSB 4EIZC 5CS7A 5T5FL 4CW1B 3WIHH 1FYTD 3ETBF 2VISA 2WAHA 4HUKB 3FONA 5DUML 3VXRE 3KDMB 2EC9U 4IRSC 4BH7B 2MWCA 3BZ4B 3NABH 5JW3L 5KAQG 2F8OA 5ECJE 3BD3A 5HPMA 1AGEA 4FZ8L 5DTFB 1I8KA 3WDIA 3FAWA 3WUWA 3RWJA 2LVEA 4TSBL 3MYJA 4A6YL 5CIPB 4HG4K 3BE1L 4XCYA 5DZOA 3OR6A 3MCKA 3LCYA 5I17B 3QXTA 1DEEB 1IC7L 3MLVH 4MDJB 4NO5B 1ED3B 1NCAH 1T83C 1WFOA 5CEZL 1X5JA 4APQD 1QSFA 3PWNB 4U1IB 4WENB 2GEEA 2J3SA 4JFZH 3VXQA 3EFDL 4WW1B 2P8PA 4K8RD 1FHGA 3RVTC 3HC4H 3X13B 4QOKE 4JPIB 3WD5L 2VXQL 2E7LC 5LWYH 1R3KB 3PABA 3WFCH 4HKZB 4NQDE 4OCXL 1G7PB 4HJJH 1TVDA 1LEGB 2FSEA 4XHQA 2AERT 3UJIH 3HAEB 1BFOB 1OP3K 4YZFF 4Y8DC 4G6JH 1AGBA 3ZL4L 1F58H 1MRDL 4JVUA 3B3IB 3LS5H 3DVNB 3PL6C 5D1ZA 5DMGC 3UAJD 4R26L 3CFKB 1QG3A 4HSQA 3RGVA 1DANT 1I7TA 1GC1C 2YPVL 3RRQA 1VFBB 3NZHL 3EO9H 1H3XA 5F7EH 1FO0H 3K2UH 1P69B 3IVKA 5EDXA 5EOQH 4HJ0D 3WEXB 4EVNA 3JUZA 1ZS8A 4LGPB 4KJPD 2NXZD 1HZHH 2PXYA 3OJDB 5DC4B 4Z6AT 2XY2A 2WQ8A 3FQRA 3HZVA 3DTXA 1F4WH 2X4TA 3JTTB 4D3CL 5AG9A 4Y4FA 4S0SD 2HG5A 1E4XH 2M2DA 4ONHA 4JKMA 3QUXC 4G6FD 2R56H 5C08A 5KSAD 2R8SH 3RWGA 4JANA 1J8HE 4MVBC 4WY7H 4HH8A 3ULVE 3KPOB 3VFMB 4ELME 2GSGA 4YX2H 2E7BA 4OBSA 4ENEC 1D5ZB 1N5YL 5HHOA 1T5XB 4XXDB 3MRNA 3CXDL 5DHYA 4PRHD 5I1CH 4U1JA 4D9LL 2J8OA 3MODH 4LVHB 4LHJB 2F54A 3RUGA 5C3LD 5C0NC 3UP1A 3HE6D 5C9KA 4LSTH 2BVOB 3BKYL 1RULH 5EIIB 1N8ZA 4JKWA 4F7MA 3MROB 3NAAH 5EBWA 2C9AA 2GUOA 5E5MA 2OTUB 4XP5H 3BPCB 3C9NA 1KPRB 1QBMH 4X7TB 1X6LA 5D7IF 4FTVB 5I1DB 5EBMB 2NX5A 3RL1B 4OI8A 1S7SB 3WYRA 2YRZA 1NBYA 2PR4H 3QO0B 3BMWA 4JFDD 4PD4K 4N1CA 5C09E 1FP5A 3S4SA 2V7HA 3BKMH 5A1AA 1G7MA 2W9EL 4WI9A 2V2WB 3B2UC 1Z9MA 1QBBA 2GJJA 1F6AB 1BOGB 3BAEH 1HYSC 1G7LA 2XIDA 5DD6A 1JV5A 4FMKA 4ORGB 5J89A 2R1XA 4NKMA 1LE5A 5KJRH 5JOEA 1NLBL 5EU6A 4KHXL 4EI6A 1OTTC 4G7VH 2D7NA 2NYYC 3HE7A 5CUSH 3QUYB 4MQSB 4BSVA 2IFFL 1UVQA 3IU4L 5BMFL 4PV8A 5ESQA 5E2UL 4J6RH 5B3JF 3HS0B 4M1DH 1S7VB 4GXUM 1M4KA 2FYYA 1X5LA 1CDYA 1SVZA 2AS5M 4U6TA 5FO8B 3UZQA 4LPVA 2VLLA 1ZGLM 1FC1A 1LO2H 3MNZB 2FDBP 4PTUA 2D0FA 1I1AB 1FNSH 2HLFC 2W60B 5AD0A 2JLLA 4TSCL 3GNMH 1AXTH 3HI5L 3BESR 4NRXB 4MNQD 5DO2D 5BS0B 3QEQB 5D7JC 3DOSA 4QCIB 5IBTH 1OWRM 5BW7C 5KW9H 2DD8H 2EYRA 2NR6C 1NFDA 5HY9A 3MX0A 3SE8L 1EGJL 2VH5L 1MHCA 4QEGA 1FVEB 2B39A 4C59B 3LS4L 1F2QA 3CJJA 3SGKC 3OAUL 3PHQA 2ZJSH 1EMTL 3EYVB 2V9TA 1CN4A 4XP1H 3SGDI 2XKUA 2XRAH 5J13C 4F7EB 1MHEA 1MI5D 4PREA 2R2EA 5C0BE 4ZFGH 2YSSA 1Q0XH 1CICB 3EZ8A 4KK5C 5IJVB 3ARDA 5IGXL 4Y1AD 5BV7C 4DOHB 1NSNH 2P8MA 1WWCA 4LHUG 3LZFL 4C4KO 1SYVA 5DEFA 4RSVA 4UQ3B 3T0EE 4XTRD 3HAEH 3BZEB 1UT9A 5T1KB 2ZPKH 2PO6B 1BM3H 5IFAH 1MQ8A 1KJ3H 2JKXA 5CCKL 2I27N 4PRAB 3ZSSA 2G5RA 2DQIL 3OR7B 2I9LA 4JGMA 3KYKL 1UXWB 3CFCL 3MFGB 3C08H 1T5WB 5IB2A 3MQIA 5FCUH 5F1NA 1DN0B 2WLZA 3MZTA 4MJIB 5CSZA 3WJJA 4I3RH 1JN6B 1QNZL 3TJHD 2FNBA 3E2HB 3WIHL 5DS8B 1EBAA 4C54A 1FYTB 1KEML 2UZYB 3K3QA 4OZHA 1UXSA 3QIUD 3NABL 3QQ3B 3MUHL 2XA3A 1OAQL 5I8KH 4RAVA 4J3WA 2NW3B 1ZHBA 1ETZA 3RBSA 5C0DA 3NZ8A 4FXKA 4JVWA 4LQFH 4QRPD 5GRJL 1FL3A 4OGAD 1VPOL 4IM8A 1Z9SA 1C08B 2O5XH 4M1GH 4JFXA 2JE8A 2NQCA 5DQ9B 5IOPB 4XPHH 3RZCB 4PRPA 5K9QG 3QI9A 1CE1L 3QR2A 1PG7L 1T0MA 5HD8C 4XCEB 4N0FB 1XGRA 1T22B 3BEVA 2FBOJ 4JZJC 2CGRL 1WBXA 3P0YH 4AENA 5KAQF 4ODHH 4ODXA 3IRPX 1HHJA 4R7NB 5DFVD 2DM3A 4L3CA 1LDPL 5EU7E 5D2LE 4D8PB 1WC7A 4HUXA 5FF6A 3LDBB 3O81A 2WWMC 3HC4L 1I8MA 1OTSC 1ZSDA 2H26B 1Z6JT 5ICYA 3CZJA 3ARTA 4XCFH 1HSBA 3WFCL 1KUMA 4PJHF 5E1AA 3WIHA 2X4QA 4HJJL 4F33B 4YQXH 1KC5L 3UJIL 3D18A 2AK4A 4WFHE 3IDUA 4W68A 1F58L 3ZYZA 3WLBB 3DECA 4XPBH 3V7MA 1U8IA 1ZT7A 1VFMA 1NGZB 1V8HA 1ONQB 5F7EL 3B8SA 4FQPA 1FO0L 3K2UL 4AEEA 5EOQL 4CVXA 4DEPB 4U6XB 1NCDL 4XT1C 3H3BC 1HZHL 4LGSB 1P2CA 1C12B 3ESVF 1M7IA 1ZLVH 1E4XL 2R69H 4MXQC 1N7MH 3HB3C 2C3GA 2AXGB 4GRLC 4J4PD 1F02I 2R29H 4P4KC 1DQDH 4P2QD 4QHMA 2R8SL 5C0CB 1Q72H 4WY7L 4WUUA 4Z7VA 4YX2L 5IK3A 3MRKA 3CUPA 3SPVA 1YPZF 3RNKB 2R0ZH 2AEQL 4DK3A 3C60A 1YA5A 1MFAL 3CC5A 3REVA 3QEUB 4EXPX 3MODL 1KCSL 3DGGB 4KI5F 4ZTPH 2IBGA 4LSTL 1NC4D 2OK0L 1MAML 3QUML 4JY4B 3PWPA 1IGYB 1S78D 3NAAL 2NY2C 1P4LA 3GSWA 5FGBC 3GSUB 1EUTA 3SQOH 2N4IA