4U7KA

Crystal structure of the clostridium histolyticum colh collagenase polycystic kidney disease-like domain 2a in the presence of calcium at 1.9 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
NSLPYGKINGTYKGTEKEKIKFSSEGSFDPDGKIVSYEWDFGDGNKSNEENPEHSYDKVGTYTVKLKVTDDKGESSVSTTTAEIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ColH protein
publication title Structures of three polycystic kidney disease-like domains from Clostridium histolyticum collagenases ColG and ColH.
pubmed doi rcsb
source organism Clostridium histolyticum
molecule tags Hydrolase
total genus 18
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.24.3: Microbial collagenase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4u7kA00
4OF0A 4F15C 5DJ0A 3QEHB 1CXIA 5MP6H 1BOYA 2PCPB 5T1LA 1A9BB 4F58H 5IB3A 3IXTB 4YR6B 2VDNL 5LXGL 2QQNL 1NAKL 5E8PA 4PJDA 1AHWB 3D0VA 1T21B 5KAQG 2BY1A 4J3UA 2Z31D 1X5AA 1RUKH 3RVTD 3DX9B 1TQBC 5AD0B 1E28B 2A6DB 1IEAB 4Z5RA 2VSCA 1Q9KA 1HINL 3B5TA 3WFDL 1S8DA 4Q6YA 1XGYL 5EO0B 1A4KB 3SE3C 2A2QT 1KCKA 2HJKB 1S9WA 1QQDA 4U1KB 2G75A 5DFVD 3HKFA 1NL0H 5CLWA 5EC2B 4I1NB 1LDPH 1U8OB 2IQAB 2CUHA 4MDIA 4I48B 2DYPD 1UXSA 4YX2H 2YD7A 1T0PB 1IM9A 5I1HH 1BOGB 1P5VA 1GHFH 3TNMB 1I8MA 2CSPA 2DLIA 3GMMB 4I3RL 5I19H 4MVBC 4NHUA 2YKLL 3QUYA 5BJTA 3L1OL 4RA0C 5FV1L 1KULA 4X7DC 3K0WA 1KG0A 1OPGH 1S5HB 2YPLE 1RU9L 4WNQB 3ARDD 4LK4A 1RUAL 4M4RA 2FL5A 4PREA 4MDJA 3T0XA 1NSNL 4ZODA 1J0KA 2UYLA 4QWWC 4JO1L 5HDOA 5CEXA 1OVZA 2WLYA 1A14H 5I75C 4LSPH 1B2WH 3TJHD 2R23A 2VR5A 3B9KD 3PQYD 4RISL 2A77L 3UBXG 2H9GA 3SOBL 1VCAA 3IU3B 1HSBB 2PYFA 2FO4B 4U3XA 4X9BA 4JFED 3TBWA 1KIQA 4U6YB 3AS1A 4PTTB 3CXDH 1NUFA 2GJ6A 5DJZB 1UWEL 3ZE1F 5I1KL 3AU1B 3QEUB 4U6TA 5DD3L 2FH6A 2JB6B 1KIUA 4WEUD 2NR6D 3LKNB 3GJEB 4XMLH 3F6LA 1MELA 3BKCL 1IC5L 4IIQA 4TPRH 3TA3A 3ZKNC 4LSSH 1QFUH 3GMLB 4OCRL 1J8HD 3K7UA 2OS7A 5HYJE 5BRZD 1YN6B 2JIXA 3U0TA 5MHSD 1MLBB 5HI5D 3MCLL 5ESQB 2UWEF 3CX2A 4NCDA 3O6LH 4XC3L 4CJ0A 1QA9A 4KJPD 1U95B 3E3QE 4MYWB 4OFIA 4Y4HD 2GUOB 1A9EA 5CZXD 3QPQC 2BVEA 4KTYA 2ITCB 3ABZA 4ELKB 3HI6H 2KKQA 4RAVA 3T1WA 1IMHC 3OGOE 3IF1B 5TF1H 5I8KL 2XIDA 4Y19A 1LE9B 3MXWL 4LCWE 3U7YH 3IETA 3MCG1 1J10A 1XIWC 3MJ8B 3EDEA 4KJQD 3WFCH 4NJ9H 2W9EL 4LSRL 3WIFA 2OSLA 3BIBX 4DTGL 4FQXB 4UINL 2DWEB 1YEIH 3H9YA 4YZFE 3PF2A 2DDQH 3NZHH 3LCYA 4PJGE 3QI9B 3OR7A 2DL2A 5FCUL 5F6IB 1ZT4B 5I18H 5EFIB 1TZGL 3HI1A 3V7MA 5ACZA 2Y07H 2Y1VA 3CX5J 1NBYA 4TTGA 4OUOA 1MFAH 3BGAA 1YUHB 4HXAL 4PJ7E 5J7CC 4NRYA 1KC5H 1PG7X 3CDFA 4MA7H 1CFQB 1GIGH 4O9HL 3QDJB 2D03L 3UTPD 2COQA 1F4AA 1VGKB 4YHYC 2NY2B 4OF7A 3TN0C 5FDWA 2VLJE 2X4TA 3LS5L 3VXTB 4L9DA 5E8DH 4F7CB 2X2YA 4NQCB 4S0SD 4MQXC 3DIFB 4JB9L 4X4MA 3T4YB 3RVVD 1QEWB 3UBXB 3SE8H 2HJFA 2WBJA 3OF6D 3QA3A 1CDCA 5F9JB 1QKZH 1IQDA 4YPGB 4LPXA 5C2BL 3EAKA 3O2VL 1F90H 1CLCA 5JO5B 3S5LA 2FECI 4JKPL 5JMOC 3NA9L 4X4YA 2X4SB 4F7EB 4MNQE 3IFOA 3NIFE 3P4NB 4XNUL 1MHPL 1MLCB 4ONGL 3RBSA 3KLAB 2AW2A 1PKQA 1MI5A 3BKML 5HPMA 3JBG7 2LTQB 2VL5B 4L4TE 1KUMA 2X4RA 1HYSC 1KB5A 2B1HL 1BBJB 1TQCB 2D9QB 3UZVB 4NKQB 4XNZB 5E08L 5DJAA 4W68A 5A2JH 4G8FB 5C0AE 1IZKA 4KFZC 4LARH 5ECJE 4AG4H 4GXVL 3S4SA 5CZVL 3FQTB 3OAYK 1F6AA 2BMKB 1IAII 5KSAD 1KB9K 1BFVL 3ISWA 2EDLA 4CU8A 3UTTD 2NPLX 5IMKA 3GI9H 4HF5H 4EKXA 5KTEH 2M8XA 3VDCA 1E4WH 4OI7A 2E5EA 4QHUA 3MJ6A 3AUVA 5A3IC 5F7MC 2D7MA 5DQ9A 2BY0A 4OT1H 5FYJH 5ALBH 3WNPA 1CXHA 1MWAL 1T1XA 2J8UF 2BVPB 4YHNA 1D9KD 3RDTB 4WV1B 3QIUA 1EFXB 1DCLA 3BHBA 4YDJA 5T3XL 1FZJB 1DBJL 3L5JA 5EU4A 4HHAB 2CLVA 5I1EH 4EDWH 5IIEB 4I9WE 3NMEA 4LLDA 4WFFE 4Z18A 2NY2D 3V5KA 4CU6A 1S9VA 1RULL 2PETA 2CDFB 1MQKH 3GMQB 4BSWA 4OGYL 4OD2A 3QXDB 5J12B 4Z8FH 2CKNA 4GQ9L 1KJ2H 3LS4L 4JGUA 2GHWB 2FBJL 3HRZB 4HC1L 1PGRB 1UM4H 2EDKA 4QOKA 4XVUC 2JJUA 4MA1B 1I85C 5C0CA 4U1NA 5C7XH 2YPKB 2F19H 1AJ7L 4HZAA 4M6NL 1BIIB 5FYKH 2H8PB 2VLLA 3ARPA 1OSZB 3K4ZA 5T3ZH 4Y2OA 4JFFB 3WS6A 4ISVB 3BWAA 1IGTB 2VISB 4ZFGH 4XP6H 2NY5C 4Y4KB 4NKIL 4PRDA 4JG1H 3QCUH 2ADIB 4RWYL 3QAZB 3BD4A 1RZKC 1WFNA 1U8IB 4WHYG 5D70H 4CAGA 4ESKA 5K9OB 3EHBD 2IGFH 4OJFH 3KJ6L 1E27B 2HG5A 2E7LC 3VMOA 3VI4F 4QY8B 3HE7B 3TVMB 1WBXA 1MPAH 3PWJB 5T5NF 1TJGL 2VIRB 2VYRE 1HEZA 2NY3D 1ZWIA 4G5ZH 4OZGE 1E4JA 3NFSH 3ZHLA 4LRIC 3VFWA 4HPOH 2Y7QA 4AEIL 2I24N 3HC3L 2ICWB 5EO9A 1U8QA 4XX1G 2W91A 2AJXH 4K3DL 1YMMD 3QUXC 4X6BB 3IFNL 3BMWA 5GPRA 1W0WB 2D7OA 3QQ9C 1JZ4A 1EHAA 4OBSA 3FFCB 2OJEA 1I3GH 1EEZB 3MRKA 4FXKB 4WEBL 5C07A 4LLQB 3IJSB 3DBXA 3QO1A 4HUMB 3IDGA 3BW9B 1J0JA 1I7ZA 3ZE2F 3VFVB 4QGYA 1ACZA 3P9LA 1YECH 2QR0A 3ARGD 2ESVA 5D1XC 3SDAC 3MBEC 1ND0A 4NQDA 2HTLD 2QQLL 1FJ1B 4DKEL 3QISA 2RR3A 3ARBA 3C60D 3TA3C 1G9NL 4UT6L 4V1DA 4RGOH 1TZHB 2JCCA 4A2LA 3LEYH 2HYMA 3V95A 3VWJB 1JHKH 3GSXB 2D0FA 4JFYB 3WLBA 3Q6FA 5EBLA 5FAAA 4LDOB 4GW5B 4WJ5B 2GSGA 3MRBA 4I18B 2X9WA 3KPRD 1XT5A 1NFIA 3TT1H 3X12A 4WEMB 3EDDA 5TE4H 1PEWA 1C1EH 1BD2A 4Y5VB 1DANU 1JGLL 3F58L 2AXGB 1ACYL 2GK0B 5JW4M 1CIDA 4L8BA 2XWJB 3KYAA 4YQXL 3P4OB 4PJXB 1LO3H 2PR4L 4UIMB 4G8GA 2XTJE 2DI7A 4OGZA 3QEQB 1OTUD 3V0WL 4AENA 4JM2A 1ZLUK 1NCWL 2F58H 2VUYA 4X6CE 4JFDB 1EERB 4JRXB 3TZVA 2JELL 3FOLB 1A1MB 1HDMA 1N26A 1WITA 1CICA 5HYSG 2GSIB 1HOCA 2AGJL 1KCUH 5ADOH 2YC1B 4ZTPH 4PRPE 4H25A 1CF8L 4KDTA 3VRJA 1RHFA 1AXSA 5KSUA 5DHXB 1G7QA 4G3YL 1T2JA 1I7UA 1WUNT 2ZCHL 1FAIL 3MMEA 4JO2H 4L5FL 5D96C 5E2UL 5C1MB 2IAMC 1RK0B 5EZOH 2Q87A 2IALA 1ZGLM 2QJDA 4HMEA 3TO4D 4LIQE 3MODL 1NGQL 1G7HA 3V5HA 4K8RL 5DC0A 4WY7L 5F89A 4FQ2L 3QDHA 1Y6NR 4YK4B 1IJ9A 4ZS7H 4LSUH 4WRLA 5GRYA 2OX5A 1LVEA 3BP6B 4YGVB 3R1GH 4X7TA 5DT1H 5CS7A 3VFUB 4Y4FA 4WU5A 3HTLX 4U3HA 1A47A 1SEQL 3MRHB 4N8PA 3LHPH 3U36A 4S1QL 5DJCB 3X14A 4JFHE 2A83B 1RZ8A 4XVSL 4ZD3H 2WMPA 4HUXA 5FO9A 1IRAY 1PG7H 4K94H 1F4WH 3IFLL 4MNGA 2Q3ZA 5IB2B 3VWJD 4XBPB 5KS9A 1KPUA 4Q97A 5HYSA 4A6YB 3QDGA 4NWTL 4MXQC 1MCPL 2QHRL 1ULVA 4Y89A 1B6DA 3V6OC 1W8NA 4PJ5D 3JV5A 3DSNA 1AKJB 4G80B 5JZ7C 1PZUB 2N7AA 4M5ZL 4Q9CA 1YEFL 2A73B 4IRSB 4BQBA 4OIIH 1MFDL 4NQUA 5HDQH 3UTSA 1WIPA 1YNLH 4H0IA 1IC1A 1QRNB 1SY6H 1RVFL 3UXFA 4YHPA 4GBXB 4H8WH 1X9QA 1BAFH 3MLYH 2C3VA 4MAYC 3GFUA 2J8OA 2R1XA 3EYVB 4I2XB 1S5IL 4YZFF 4OV6F 4XB8A 4HULB 2HH0L 2VXVH 2DICA 4X8JB 4QLRA 4HD9A 3MNWB 1T22A 4EVNA 1VHPA 3TC9A 3DVFA 4XVJL 4ORZC 4ZAKB 2B5IC 1B3JA 3QHZL 1C16B 4M62L 3WHE0 1EK3A 4CMHC 2ITDA 5L88L 3F7YB 5FUCE 1OARL 1RUML 3KPQA 2FLRT 4PJ7F 4POZC 4L4VA 1K5NB 3WXVH 2AJSL 5D1ZB 1T66C 3MA9L 3NH7L 3H3PH 5E6IA 1ADQL 3JSSA 3U4AA 1OB1B 4K3JL 4LCWD 4JZJB 3AREA 4ZOCA 4DUXA 1YQ2A 3HMXA 5F6HJ 4MX7A 4XI5D 2Z8VC 5EC1B 4O02H 5IEKB 5F44A 1BVLB 3HCVA 3I6LE 4HX1B 1OAYH 2V7NB 3Q1SH 4Y0GA 4ZS6C 1U2HA 1OCWH 3E6HB 1BQLL 3MLTB 5HGAA 2EDXA 3PG2A 3WDHA 3MROA 4F3FA 4X6DE 3TBSA 2UZXB 1IGIH 5CJOH 4GQPH 3WIHL 2E7CA 3NIFF 4OZ4B 4PRIB 1N8ZA 2QQKL 3LIZL 3OZ9L 5ELIA 1T3FB 5FUOH 4ZXBC 2DBLH 4FTVB 3EYOA 5I1AA 1CK0L 1QVOA 3PWNA 3GIVA 3MRJA 1X3DA 5B8CB 2VLJD 1OAUL 4U33A 3VXMB 1CGXA 3BUYA 1AKJD 2DS4A 3RWGA 2XYCA 5ICZA 3GSWA 4KGLA 4NCC2 4ZNEE 1F58H 3FRUB 4U6XA 5FO8A 3ARWA 3OKKB 3QDME 4C59B 5DJ2A 1G0XA 1QNZL 1UZ8B 1C5DA 2O93L 1EAPA 4RRPA 4TVSa 4BKLA 3MX0A 4OD1L 5TE6H 5IBTL 3VXRB 4OD3L 2AVGA 1DL7H 2Z35B 3CCHB 1UM6H 4D0CA 2W0FB 3QRGH 4HJ0D 4MNQD 2R9HD 1JYVA 4W6XB 2VXUL 5D7LB 4AT6A 4QRUA 5EOQH 3V4VL 2Y72A 5EZJA 2YPVL 2V2TB 1RUQL 4OFDA 2OL3H 4YE4L 3MRFA 2OP4L 4DQOH 1WAAA 1KTDA 2EXYD 1QP1A 3ULVL 2HFGL 3PL6B 4WI8A 1BM3H 2VLRB 1YEGH 3G6DH 2HT3C 1K3IA 3O6FB 1FQ9C 1S7UB 2ARWA 3ARTA 4PRAA 4XPHH 5D2LE 4LSTH 4ODHH 2A9ML 3QNZB 3QUML 5B39G 2PYEB 2W0LA 4HS3B 2AABL 3GJFH 3DXAA 1R5WA 4JFXB 4PY8I 5H35A 3QWQB 4LCCB 1YYLL 3U1SH 1I7TA 4CDHA 3N85L 2VITB 2WAHA 3ME0A 4KWUA 1NLBL 5IFJB 2GJZB 4LKCB 4FFZL 1VFAA 4D9LL 2P24A 1FYTE 4O2CB 1HHJB 3BN9C 4HWNA 3PNWA 2Y36H 4MMXC 4EBQL 5D9SA 4PGEB 1OT1A 1W72A 5CD5C 4XNYL 4OCSH 4ALAH 3OV6A 3IDJB 4PJHE 5GGVH 3KXFE 2KUTA 1CDJA 1RJZA 5DJDB 2H2SD 2DD8H 1JWMB 3MUZ1 1L7TH 1QTYT 4HKXB 1MHHA 1X5GA 4J4PC 4FXLA 4GW1B 1ZV5A 2NY6D 2VH5H 4F2MA 1IVLA 3ZLQC 5L8KB 1PSKH 4IS6A 3FT4B 2IPKB 3OXSA 5B38B 4MD5A 4JM2C 4G7VL 5T3XD 4NBXB 4R7NB 2IFFL 2P5WD 5L2JB 3VXRD 4QEGA 3FN3A 1NGYA 1IGFH 3R06B 1UJ3B 4PJEA 3MV7A 2F8XC 4FS0A 4HJJL 5IJVB 1MFCH 5K9QI 3BZFA 2B1AH 5F93C 1KN2H 3PP4L 1HI6A 1W0VB 3VFOB 1VEOA 4ZUUB 3GB7B 4KJWC 5I30L 3OAUH 1MCOL 3BQUD 4NO2B 4P57B 1ZGLB 1Z9MA 4OZFH 2DQTL 4FQ1H 3WNKA 4NZRL 4L8CA 4ODSH 1LNUB 2EC9U 2YD1A 4LL9A 2N1KA 2EEAA 3DRQA 3P11L 4NRXB 5C0EA 4IDJH 4ODWB 2NXZC 4J8RA 3RZWA 4WVRA 4X7CC 4ZTOL 1T03H 4XTRD 3VD7A 3HE6D 2VDRH 4DN3L 4NNPH 2BSED 4PV9A 3O4LA 2VC2H 1QLRB 4OCYL 3GSRA 2OCFD 4MNHB 3NGBB 1PYWA 5B3NA 1CLYL 4P2RE 4TSAL 2XICA 3P9WB 1G7JB 4P4KD 3REVB 3VW3L 1BQHG 3D2UA 1XF2A 4XCFL 3STZB 4NT6B 5L2KA 3CVHB 3L3GB 3BPCB 1RZKL 4Y5XC 1FGNL 3QWOA 4M6OH 2CDEA 5KJRL 3QG6B 5J13C 3MNVA 2ED7A 1MJUL 1HHIA 2HAZA 4WW2B 1YQVH 3O81A 2IF7A 1Z5LA 2VZ3A 3T3ME 2DQCH 1I1FA 3ZT7A 1MCJA 2PW1A 5JQHC 2H3NB 5JW5A 4Y16B 4JANB 1OWWA 3C5ZD 2J8HA 3MV9D 2ZKHH 5TFSL 4JR9L 4F15B 1IC4H 2VQTA 3WKMH 1OQXA 4X6CF 4RBPH 1ZXQA 3WN5C 1N59B 4PYGA 3WFHB 1A6TB 5EB9A 5EU6D 3FFDB 1TENA 2M2DA 3RJQB 4Z0XB 5F97E 1DP0A 1GGIH 1TQBB 2H26B 5GGUB 3WYRA 4DGIH 1MEXL 3BUTA 5TQ2H 1BQHA 4PJFF 4M61A 3HC0A 1FRGL 1T2QH 4CU7A 1RV6X 2OM5A 2CR3A 3QRFM 1LP9A 4JREC 4KI5E 5DI8A 3FB6A 4NBYB 4X5XB 3AREC 5I8EB 5CP7B 3MRLA 3O2DA 5GRWA 2N4IA 3LN4B 1IARB 4L1DA 3I9GH 2X44D 5DUBA 2IADA 3BKJH 3HZKB 5JW3L 1WVZA 1K6QL 4FMFA 3A6BL 3BJ91 1NJ9B 1DUYA 2FGZA 4PRBB 4PRPD 1Z9LA 4EIGB 2EH8L 4BK5A 3A0OA 1I7RB 1A1OB 3BXNA 4L29B 3EZJB 4C55A 5EU5B 1U58B 1D6EA 4LIQH 4JKKA 3E1F1 1NANH 2Z8WC 1TXKA 5I75B 3LQMA 4LQFL 4APQA 2CPCA 1J0IA 5BZWA 1BVZA 1YJDC 3IDUA 3QDJE 1FC2D 4GLRI 4L1HA 2Z0BA 5EBWA 3NTCH 2D4FA 4LLWB 2CMRL 4YEEA 4JG0H 4NQCE 4BH8A 3VFPA 5I1JL 3QXTA 5TDPA 1CZ8L 4KY1H 3QH3A 1SJEB 4K8RD 3RGVC 3TIEA 5IVZB 1VDGA 4WTZA 2H6PA 2YRLA 3PABA 3HFMH 4TYUA 4FA8A 2ZSWB 1RZJC 5HYFA 2XQYK 5FA3B 3G6JB 1MIEL 1ZGLP 3O9WA 4GKNB 4XRCA 4NZTH 1HYRC 3GMNA 2X4NB 4WCYH 1IGMH 1KN4H 4Z7OE 5IP4A 1I8KB 4LVOC 2DKSA 4PPTA 4JRYA 1PDKA 1AP2B 4ODXA 1A7QL 2HFEA 2FX9L 1DN2A 1ZLVH 4G8IA 3AS2A 4AH2A 4U1HA 4X7EC 4PGJA 3CFKB 4NWUL 4DGYL 4XNXH 5FDYA 1KCRL 2O5ZL 1R24B 1WWBX 1I4FB 4MCZB 3MRDB 1QYGL 2LV4A 2VMFA 3SHSA 1DN0B 4K2UH 3BEWB 1CDHA 4XPAL 3PHOA 5L6YL 1JFQL 1MCEA 3O45B 1KB5L 4BQ6A 3MUJA 4P59L 1CLZH 2NXYD 4XWOD 4X6DF 4RIRA 1IEBB 3G08B 4ELMB 1FGVL 4TNWF 1H9VA 2NNAB 1HILA 2KZWA 1GOHA 5GIRB 1CE6B 3CK0H 2R0KL 4TVPL 1KIPB 4HWEL 5EOTB 2APBA 1P1ZB 4D9RD 4MA8H 1U8LB 4FZEL 5FOBB 1GGCL 4LOUD 1JNNH 1TJHH 1T89A 3U9PH 3GK8H 3EUUA 4QRRD 3EGSB 4HUUB 5C09D 2QKIA 5DQJA 3BRGC 4G6KL 2BNUA 4YHYB 3TN0B 4NO3B 2FJGB 4O4YL 2DAVA 3NFNB 4XNQB 3TCLB 1M7DB 4PD4K 3LKOA 1HK6A 1OAQH 4I5BB 3ROLB 3LKRA 3NCMA 2APFA 1EIBA 2HKHL 3ET9F 3H7BA 5F7DB 4HS8H 3T0EE 2ARJQ 2EDYA 2FWOB 2WUBH 2GYSA 1QRKA 3MJ9A 1KXTB 1G6RH 3RNQA 2H1PL 4U1IA 3CLFL 1MY7A 12E8H 5SWSA 1XGRB 4KK9D 4BM7A 4KQ3L 3BEVA 4JFFE 5F1NA 3STLA 3WL9A 5F7KC 4R96A 3QXWA 2ZUYA 1XH3B 2DM2A 3RWFB 3P73A 5DK0B 2AI0L 2BVTA 2X05A 3A67L 4PJ9D 4U1SA 1QBML 2F53A 4PBWD 3CSGA 4IMLA 5E95B 2CUIA 4XGZB 5D2LF 5D5ME 2J6EA 2FRGP 1OTTD 5GS1A 2EH7H 4DN4H 3QJFB 5IW6A 3PWPB 2CIIB 4MS8D 1DEEA 5IEHB 5DF0A 4EUPH 5DHVB 1ROWA 3V8OA 3LSOA 4GAYB 4X6FB 3DYPA 4O58L 5HYEA 4WENB 1UCBL 1IILE 5ENWA 2D7NA 2AJ3A 5ERWB 4F7PB 3SCMD 3NACH 4RX4D 4P2QD 4J3VA 1KBGH 1PBYA 1WEJL 4LHUD 2EDJA 1A7PL 4IRJA 5HJ3B 3DVGA 4PJHF 3L3IB 4KQ4H 3B6SB 1UA6L 2I9TA 5JIPA 3FFCE 3HA0A 1UB6B 5DDHB 2HFFB 2VE6B 3BWUC 1VACB 4IMKC 4R26L 5I8CA 3TJEL 3AROA 1YPZA 4E5XB 5HPOA 5K59E 1B0WA 1HHGA 3CNKA 5E8NB 1CGVA 5K33A 5I15L 3FB7A 2YHGA 3D85A 1QBBA 5E2VH 5DJ0B 3ULVD 3SKOB 5T1LB 2WP3O 5IB3B 3VRLE 4QT5A 2JJWA 4XPFL 1TVDA 1ZSDB 3HUJE 5E8PB 2APVA 4N8VA 3D0VB 5BV7L 3AGVA 1JGEB 2Y06H 4QYOB 5DK2B 3G5XA 4HXBL 2Q7YA 5HVWA 4KPHH 1U3HA 2OK0H 4PGCA 1VFBA 1S3KH 4M8VA 2ENSA 3GNML 3KPSB 3KYOA 2I5YL 4YDKH 2XQBH 4GUPA 5DRWA 4K23H 1HXYB 2G9HA 4P2OC 8CGTA 2YN5A 3NCJL 1GGUA 4QHLA 1FNEA 1UFUA 3OXRB 4OSUH 4XWGH 1KFAL 1LDSA 1FFNA 3X3GH 3H9SB 3W39A 3LRHA 1PKOA 4NZUH 1CFSA 5T1KB 5E5MB 4Z7UA 4PJXE 2IEPA 4LCIL 4DEPB 5IHZB 3B9AA 2DRUA 5TQ0L 1E0OB 1UB5B 4U7SA 3QEQE 3DO7A 4K3HA 2RFXB 2P42B 1I8MB 1UG9A 4JFDE 4JAMA 1XGPB 5HHQB 4OLXL 4JRXE 4XP4H 2GQHA 4OFYA 3WFBL 4DKDC 4N0FA 1A4JB 3UTZB 5CMAB 4NUGH 2DQFB 5MEPA 3VFGL 4HUWA 1KG0B 1CIUA 1J87A 5HY9A 1DZBA 3JVGC 3CFDB 3DWTA 2FL5B 3W9EB 4PREB 4N5EC 4GW4B 2FYYB 3FO1A 2UYLB 5CEXB 4HPYH 4I0CC 3PWVA 4LAQL 3VXUB 5KZCB 5GSVA 3SQBA 3WE6B 3UJJH 1LO0H 3MO1A 3OX8B 4UIKL 4HWZB 4K94C 4XXDA 2PYFB 1U8HA 3T3MF 5CJXA 3TBWB 3ARFA 3OKDA 4Y2DC 1NC2A 3GIZL 4LSVH 4UU9B 4XX1E 3V9FA 3ZMRA 1OAKH 3GO1L 4G9FA 2OTUA 1P7KB 2W07A 3BE1H 1TZIA 3WHXB 3WIIL 4P2RD 5D1XB 5T1LD 3SDAB 3MBEB 5CD3B 35C8H 3V4PH 4NRZA 3N0PB 5F71A 5IB4A 3TA3B 1BJ8A 3FN0L 1A6UL 3QULA 5C0NC 5BCAA 3RKDC 2JIXB 3DMMA 2WWMC 4FFVD 1I9IL 4MJ6A 1IZJA 3PDDA 1NCBH 4C56B 4PYHA 5FKPA 2GJJA 1U8KB 3T8XB 5KAQF 5I2IA 1A9EB 4L3EB 2OLDA 2FX8H 2P5EB 1MRFH 3MOQA 3MLRL 5F3BA 4X5LA 4Y19B 2BHZA 2XRAH 5FHAH 1QRNE 4KVCL 3HN3A 4WIQA 2VSDA 5E8EB 3VXQA 1WJ3A 4HFUL 3RVXD 1ZA6B 2EE2A 1IM9D 4X80H 3L3OA 2D3VA 3UYRL 2W0PA 2CRZA 2BC4A 5ADPH 2ZCLL 3QUYD 4JPWH 3OPZL 4P3CH 1XZ0B 3OB0H 1JF6A 4M3KB 15C8H 4J6RL 3CH1A 4O51A 4P9MH 3FQXB 1CD0A 4U6VH 3RUGB 3B2VH 4NNYA 1FV1B 1J5OH 3NCEB 1T7VA 3RTQA 2EICA 4KI5D 5D96B 1IGYA 2IAMB 4OLWL 3GMPB 5F88A 2FX7H 1L9MA 4E42B 1N7MH 4NZJA 1VFMA 5IT2H 4JPIA 4YJZL 4DVRH 4GG6E 1AI1L 2P8PB 1WZKA 3HR5A 5C9JA 4HIHA 2R0WL 5FDWB 5KVFH 3V4UH 1JZ2A 2ZG3A 3LQAL 3T65A 1BMGA 3UZEA 2DJUA 2GJ6D 4HK3N 3OQ3B 5EWIL 1MHEB 3I85A 3DTXA 4LPUA 4YDVA 1G84A 1S7QB 4RDQF 5EUOA 1U3YA 1S78D 2AV1B 1TVHA 1W8OA 4RGNE 3CC5B 1EMTH 3L9RA 3S5LB 2X41A 1NGXB 4OLUH 3S35L 3V8CA 1Y18B 1YEKH 5A16A 3SE9L 1NBVH 4P99A 4JGMA 4CMMA 1MSPA 1IGCH 5C0JA 3CDCA 4Z7OF 3VH8G 4CRPA 3GGWA 4FTVE 4W4OC 1MRCL 4OM0H 2NY0C 3HMXL 3SY0A 1FNSL 1IBGL 5DJAB 3VXME 5IVXA 3MUY1 4H1LA 1U8NA 1GAFL 4Y1AA 1IAOB 2Q6WA 4OM1H 5BW7A 5I8OL 3AMLA 3LN5A 4WI6A 4EEEA 4UTAL 3P0YL 2A6KB 1EVUA 5GJTH 1MFEH 5JUEL 4BZ2H 2F8VA 1FYHB 2ZUSA 4ERSH 1DSFH 1EZVX 3VGFA 1KJ3H 5SX5H 4Z78A 2KBGA 5D7LE 3S97C 1FLRL 3EFDL 2PO6A 4OZHB 4O5LL 1J05B 1TTUA 2B5IB 1INEL 4EI5A 1AGDB 4CN1A 2X1PA 3FO2A 3W0WB 4NPYA 5GZND 5EU3A 4CMHB 3QNXB 4IRJC 1N5YL 5FF6B 1H15B 1AQDB 3KNBA 4X4XA 1XR8A 4PY7B 5I0DA 2ZP0T 1Q1JL 2VLRE 4YDJB 3BHBB 1CU4H 3VH8A 1U8PA 4OUUA 1KENH 3P4LA 1NFDB 1VGEL 1P4LA 3QXAA 3MACH 2DQIL 3V5KB 1GJIA 2NY7L 1XR9A 4BSWB 4O2EB 2X7LB 2R4RH 3JWOL 1K3ZA 5IWLC 2WBJD 1MIML 2I60L 5DURB 4NHCL 1YC7A 1D5ZB 4QOKB 2H2PD 1VADB 1MAML 1E6JL 1NGPH 4U1NB 4M9PA 5T33L 5DTFA 5FECA 5LQBL 5DLML 1T2XA 5BO1H 5K9JL 2VLLB 4Y5YA 3NIGE 1KCVL 1MI5D 3BSZH 4XXCC 4QTIH 1P4BH 1H5BC 3JUYA 2DTML 1OTSD 1JNHA 3HB3C 5DWUH 1BQUA 1ZHLB 2PXYA 3IB4A 4KK8D 4KZDH 3ZYZA 5FGCB 3VWKA 3INUH 3WV0A 4TVPD 5HHOA 2A38A 5DR5H 2HG5B 2VDQL 1BZ7A 4AZ8A 4NQEA 1IQWL 1F8TL 3T08A 2AKRA 5BXFB 2HVKB 4YBQD 4P5TA 4BFGA 1H3PH 4OLZH 4M5YH 3LD8C 4PB9H 5ANMB 3IYLW 3UJTH 2HVJA 2EDWA 1MJ8H 1GXEA 2W38A 5KW9L 3DYOA 5LGJB 5FYJU 1W72L 3O11B 4OGAC 2JJSA 3BRFA 1JYNA 2HMIC 2NTSP 4OKVA 1T5WA 2Y7QB 5EO1B 1GC1H 5BOZG 4PRHB 1A3QA 1KB9J 1UWXH 4NQXA 2R2HA 5JR1H 4M1DH 5BV7B 2CGRH 4X6EB 1DUZA 4NGHL 3SDDA 1REIA 3Q0HA 3QIUD 5GS3A 1S7VA 1KIRA 4D8PA 3TWCL 2W9DH 3P0VL 1BJ1H 4M1GH 3O3DA 3X11A 1NUNB 4CJ1A 2YEZA 3QO1B 3IDGB 3C5JA 5MI0C 3W11C 3BH9B 3V0AC 3P9LB 4OCWH 1UT9A 5TH2A 5HVFB 3LEVH 3HNTL 4CNIA 3EYUH 1FAKT 3VRLF 3O8XA 2BVOA 3OR6B 2BSSA 3ZT5A 2DF3A 2LAGB 2V2XA 3HUJF 5D1QA 3L5HA 2FEDC 5KG9B 2QQNH 5FYKU 2ZNXA 2JCCB 2QEJA 2YR3A 2BHUA 2XWBB 3FOMA 3PHQA 3RA7L 3FO0L 1J86A 5DJ8A 5C0CD 3WLBB 3S37L 1Y0LB 5LCVH 1NFIB 3X12B 4ZYKB 4M7KH 1U2CA 1BBDH 1BD2B 3WFDH 1U42A 1XGYH 3IFPA 4XZUA 5DMYA 3HNSL 1XCQB 4PJXF 2V7HB 3TGXA 5J6GA 1ZS8B 5DJ6A 2JLLA 4HAFA 4DVBB 5CJ5A 3HZVB 3ZDYE 3LRSB 4WHTB 3DX6B 5CBEA 5HHNA 4JM2B 1A2YB 2CXKA 2DQDH 4TQEH 4NUJB 4I3RH 1JPSL 1KCSL 2Z92A 1FORH 3TZVB 3I6KB 2HJLA 4HFWA 4M6ML 4ZQKB 3U4EB 1AH1A 4CVZA 5E9DB 3FZUD 5CEZE 4L8DA 4AEHL 1RUAH 4URTB 4H25B 3VRJB 1KEMH 5IFAH 3CDGB 4ZNCD 5KSUB 4J3XA 2E6QA 5HHVL 4GRLD 4PP1D 1FO0B 2IALB 5GRVL 2EKJA 3ZE0E 4RISH 3SOBH 5F89B 5EOCJ 2R0ZH 3F7QA 4Y4HA 3UC0L 3D69A 3U79A 5C07D 1Q9OA 2NXZB 1V7MH 2VZ1A 5FB8B 2CK0L 1DLFL 4DOHE 5GS0C 1PVHA 5E94A 5I1KH 2J7LA 2ESVD 5DD3H 4NQDD 4NQVA 1RZ8B 1OGTB 3ARBD 4HUXB 1IC5H 3ARQA 3UDWC 4V1DD 2OQJA 4U2YA 2BX5A 1UACH 5AYQA 4OCRH 4ZFFB 4XCCL 2UWEA 2Z8RA 3OKEA 1EAJA 3O2DL 5JORB 3MCLH 1OAXL 4PRNA 1Z3GH 4U1GC 4Y5XB 1C12A 2XKNA 3TO2A 1KT2A 1A0QL 1X4XA 4WWKA 5J13B 1BD2D 5SX4H 5F1SA 3MRRB 2J12B 1ZEAL 3MGAA 3KR3L 1DQML 3RWDB 2ATPB 4JY5L 3S36L 3SBWA 3O3EA 5TDOA 5BW7C 3DURA 1K9TA 4KTEL 4ZFZA 3T04D 5DEZA 3IS1X 1RZIB 2CJUL 1FFPA 4G8GD 5B4MD 2CK2A 4ZOBA 2BSRB 2R2EB 4CW1B 2QADD 2W9EH 3BDBA 3EJZC 3WS3B 2ILLA 1JV5B 5TDNA 4DTGH 3ALPA 1FN4B 3WN5B 2F54A 4L9LC 2R69L 2YRPA 3TZVD 4A6YH 2VN7A 1MH5A 3MOBL 3H0TA 3UBXI 2C4FU 1T22B 3G6JE 2O5YH 2MQ0A 5I76B 3WXWH 1CICD 3X13A 3ZHKA 3K2UH 1TZGH 5J06A 1JPTL 5F7NC 3V6FA 1SVZA 2AJYL 1F3DJ 3WD5L 2QBWA 5IMMA 2D9CA 3R0MA 5CILL 4JREB 4GG6F 1PLGL 3SPVA 4DW2H 5D6DC 3AREB 1JTOA 2VTFA 3EFFB 5JOEA 2CD0A 2B2XL 4TSBL 5SWQB 5DRXA 3LDBB 4PGBB 3WLWC 5J1AA 2R2BB 1HH6B 4MMZC 4QRPA 4Y4FD 4JB9H 4I77H 4ZUWA 3CPLB 2I9LA 4Z95L 4WI3A 4Z77B 2YK1L 1U41A 3VDAA 4KI1A 2EDEA 4QXWA 3TBSB 3O2VH 4BUHA 1IL1A 3BPOC 5GGRY 4JKPH 3RWJA 1N8ZB 3D18B 1V7NL 1OF2A 4XNUH 4KUCD 4MB4A 3QDGD 2EEDA 3EYOB 4NOBA 2B1HH 5I1AB 1ZKAA 2CUMA 4EJ1C 5E08H 4KVNL 5KOMC 3SKJH 1CLOL 2FSEA 5JDSA 4EXKA 5GISL 1QOKA 4R0LC 4U6XB 5FO8B 4Q2ZA 2F5BH 5JA8B 3UTSD 5CZVH 1RK1B 4P46A 4DKFL 5DD1L 1A64A 4HV8A 3V79C 1QHOA 4P23C 4BKLB 4Q9RH 3L3JA 4RFEB 4P5TC 4NFDA 3IRZA 3SJVA 2BVUA 4R6UA 3RGVB 5J0BA 4R90L 4RGND 1RIVL 2EYTB 1KJ2A 5KVDH 3WFEH 1Q9WA 4F7TA 4XCNA 4ETQA 4HKJA 2Z31C 5DEFA 3RVTC 2J4WL 3RL1B 2J8UA 3FN9A 4L4VD 4LVOB 1KTDB 3HMWL 3RWEB 1LO5A 3JTSA 4PTUB 3QBTB 1JHTB 3QFJA 4ZUVA 4MQ7A 5E6ID 3D3VA 3LV3A 3WNMA 3HS0B 5DFVC 1CGSL 3S7GA 2J88H 2OZ4A 1RJLA 3MPCA 1WLHA 2F5AL 5DD5L 1OP5K 1JGDA 1KLUA 1P4IL 1YEHL 2P7TA 2VZTA 3MJ9L 4JM4L 1F2XK 3D0LB 3B3IB 4OLYL 1R5WB 3D39B 2IJ0C 5HBBA 5F96H 2EIBA 3ULSA 3KPOB 1I7TB 2FBJH 4JQXC 1VEPA 2D31A 4ENED 3RZCA 2P47B 1VFAB 1UGNA 2P24B 5IVOA 3ARDC 3SDCA 4BELD 1ZVSA 4WI2A 3QCTH 3NIGF 3PXHA 4N0CD 2C3GA 4M7JH 5F9WC 2VXSL 5HHMD 1BREA 4NYLA 2ICWI 2J6EL 1RFDL 3TJHC 3UYPA 2EDOA 3B9KC 2VXTH 1NC4A 3C2SA 3BOVA 5IGXH 1I3RA 3KYMB 4IHOB 2G60H 4EDXA 4K7FA 1EEYA 5I74C 4NKIH 4PG2C 4RWYH 1GGTA 3K81A 4KZEL 4P9HC 5FO7B 3JTTB 5K9QG 4KMTH 2R56L 4JDTL 4RMUA 1I9EA 2M1KA 2AK1L 4K71B 4YPJA 5DMKA 5FHBH 1AGEA 4PJEB 2NR6C 3QYCA 2VLME 4OV5B 3C60A 3VFNA 3BZFB 3KPSE 4E41B 5EU7C 1S9XB 4F7MA 4QHMB 3HC3H 5TF0A 1HNFA 1OM3L 3RVWD 3OJDA 4Z7NE 1WSST 1EJOH 4JPVH 3MNZA 5HI5C 4WFHE 3H9SE 3K80A 3IFNH 3DV4A 2NTFA 4U7KA 3MJ7B 1C5BH 4L8CB 4Y4HC 2V17L 1KTLA 5FV2A 5CZXC 4G6JH 3MLZL 3RPKA 3CIQA 3DUHA 1NDMA 2R8SH 2XKUA 2UUDK 2AEQH 3KYNA 1QFWL 1WQVT 2FCBA 4KC3B 4KJQC 1FVEA 3O0RL 3DXAD 3UZQA 5DGQA 1JP5A 1G0DA 3BAEH 3F62A 1WBYA 5CHNB 3L95B 3L5WB 5GHWH 2IWGA 2DLTA 4LCYB 3D2UB 4K3EL 1XF2B 1ED3B 1X5IA 1GVIA 2WIIB 5GGQL 3LKPA 4N0UE 3KHOA 3VXUE 4H0HB 2AJVL 3QWOB 4XP5L 2CDEB 5LAXA 4YHOL 5DFTA 4WW2F 1AGCA 5CSBA 1HHIB 2LQRA 4WW1A 4N68A 1P53A 4D0DB 3UPCA 1K2DB 2APXA 1F11A 1IFHL 1I1FB 4G6FB 2VDOL 3BPLC 4HEPG 2X89A 1C08B 4YQXH 3U46A 4XHQA 3ZDYF 5HGHA 4I4WB 4WTXA 1CBVH 2E9IA 2BOBA 1U3ZA 3V0WH 3T77B 3I75A 4GSDL 5SX4I 4TUKH 1SQ2N 1NCWH 5KOVC 3RVVC 3BZ4B 1CFBA 1HQ4B 2CLZB 4L3CA 3E2HC 2YPLA 3VGDA 3MV7D 5D7JA 3KPPB 3QFDA 3L3DB 3EIFA 3I50L 5ITBL 1NUDA 4XBGB 2HLAB 4NM4L 5HGBB 3SQOL 2AGJH 4CVUA 1CF8H 2DBJA 2ENYA 3MFGB 5JXAH 4C56E 3O3UN 1EVTC 1R0AH 4W4NA 2ZCHH 4L5FH 4MLSA 5E2UH 4HDIB 1Z9SA 1NCDH 4P2OB 4R3SB 4L3EE 1R3LA 2Z4QA 1OSPL 5CIPB 2P5EE 3EJJX 1LP9B 4BZ1H 3ROOB 3ARYA 3CZFB 4K8RH 5LJYH 3U2SA 5CSGA 2WM0A 1SEBA 3MLXH 2ZZUT 5IMOA 1BZ9A 4PJIE 1N64L 3JWNC 4YHLL 1SBSL 1JWSA 2YZ8A 5KSAC 1SEQH 2UUDH 3PGCA 3O4LD 5CEZH 3NN8B 2EECA 4X0KB 3SGJC 4J1UA 5E2WL 2ADFL 2MKLC 3BXNB 4XVSH 5HYJA 5I66A 2AEPH 2I26N 3RUGE 3IFLH 3D2UD 1D6EB 4M48L 1G7LA 4XAKD 3DRTA 3HPLB 1SJXA 4Z76A 5L2KD 2GEEA 5DJYB 1MCPH 4UILL 4MSWA 4E0RB 5BZWB 4JFOA 1D9KC 4UT9H 3IRPX 3KLDA 3ULUE 5EBWB 1RMFH 5BQ7B 5BVPL 1C7SA 4LCWA 4Y2DB 3IDIA 5EBMA 4CUCA 1MFDH 3IU4L 1F4HA 1NKRA 4C83A 4Z7VE 1N0XL 2NY2C 1J1OL 3THML 5K9KB 1RVFH 4XPGL 3RL2B 4JFPA 1UYWH 3OKOB 3VJ6A 4PJGA 4XPBL 1M71B 1RPQA 3PABB 1X5FA 3W82A 2AV7A 2BNQB 2HH0H 2P4AB 1R3IL 3G6JF 2BSTB 3V7AG 2G5BA 2Y6SD 4LNRB 3O9WB 5I1IL 3QHZH 1FVDA 3BX7C 4NO5A 4DAGH 4M62H 4OBRA 4PJCE 4JQIL 3GMNB 4PJ7A 1JN6B 5L88H 1M1SA 1OARH 3V6OE 1NEZA 4JRYB 4MJ4A 1T7WA 2HFEB 5GS0L 3NH7H 3QIBA 2K7QA 1ADQH 3QQ4A 4AH2B 3S9DB 4LCUA 5CP3H 4KKCD 1VA9A 2VLJA 4K3JH 3RY4A 5TGBA 1F4YH 2FR4B 2P8MA 3EHBC 4EIZC 1UENA 5ITFA 4JKLA 3VCLB 3VFTB 1L0YA 4Z7WB 3AS0A 2OTWA 1HIML 2VABB 4ONHB 1QBLH 5ID1B 3ECBB 5E5UB 3PHOB 5E4EC 4LP4A 4H88L 5ESAA 4PGDA 1E4XH 4J12A 3HAEA 4MWFA 4OZHE 4LBEA 2NY3C 1PY4A 3CFEA 4FNLL 2WP3T 1A3RL 1X7QA 4XP1L 4MNQA 2X40A 3W0WE 3C6LA 4POUB 1AIFA 1LO4L 4ZUSA 4OCLC 1HILB 1F4XL 5C6TL 2G2RB 4L4TA 4D0BA 1MNUH 4NNXA 3F6IA 3HR6A 3DPBA 5C0BB 1YNKL 3LIZH 3OZ9H 2Z93B 3BH8B 5CINH 4APQD 5C0AA 5D8JH 1G7MA 2VWEC 2X4OA 1NFDE 4J23A 1OAUH 3O3AA 1MUJB 5DQJB 5IR1A 3BGFB 3DVIA 4X98A 2FB4L 4L8SA 2Q1EA 2IPTL 1FNLA 3BGMA 5ALCL 1K85A 3S34H 4YHZL 3LKOB 3VXPA 3VMPA 1FL3B 2VAAB 4S1SL 4OD1H 5DD6A 3WUWG 4YXLL 1SHMA 1TNNA 4HK0A 4OD3H 5IQ9A 3ARGC 5JHLH 1UM5L 2HTLC 1NAMA 4RFOL 1T80A 5KSBB 2KQMA 3LZFL 3C60C 2VXUH 4JZNA 1IAIL 1BFOA 1OAZL 2DWDA 1V3JA 1JMZA 1AGBB 3O9WD 5LBSH 3V4VH 3MR9A 3WL9B 2X9YA 3MQIA 3IDMB 4OZFG 2JJTA 2I07B 5CGYD 1C5CH 1CFNB 1F6FB 1EBAA 1OQOA 2NY0B 4GKSA 5GRUL 3BVNB 4JLRA 4JRYD 2PF6A 3V0VA 3ULVH 2HFGH 4JDVB 5FGCE 5B21A 2F53B 1ZA3B 3NAAH 1B0GB 2XG5A 3OTTA 4IOFD 3SE4A 4NIKB 3KYKH 2MCPL 3IVKA 2VO5A 3DUUA 3O6MH 1T1ZB 1JTPA 4WO4A 2ADJA 2Q20A 1WTGT 3DNKA 3MV8B 5ANME 5IW6B 1FL6A 1WT5C 1JMXA 1P7HL 5HYQB 1OTUC 1MCBA 2ZUVA 3MLSL 3JWDC 5JXEA 3OB8A 4LF3A 1YYLH 4P5KB 2PNDA 3N85H 4R2GD 3I3BA 4MD0A 1NLBH 2F74B 1A6WH 2Q8BL 1HHKB 4PRHE 3M45A 1DVFD 1DDHA 1MFNA 4FFZH 2FGWL 2VDKL 4D9LH 4HUVA 1J1PL 4IRJB 3NFPA 3RY6A 1KLGB 3DVGB 5IESH 2DMCA 2I9TB 1QSEB 3C6SA 1IAIM 3BQUA 4PJBE 3TO4C 3QCVH 4OZFA 3B9VA 1U91A 2XA8L 3QIWD 3G04B 1UKTA 5DHVH 3PP3K 4KJYB 4HZLB 5ICYB 1WWCA 3D85B 4XBEL 5DZLA 3RX8A 2XZAH 3U0PA 1ETZB 3VD3A 5KVMC 4G7VH 2IFFH 2VLKE 4QT5B 1TMCB 3HE6A 1RUKL 3BDYH 4H5SA 3WMSA 4OZGA 4N8VB 4BQ8A 3IJYB 2C1OB 1U93A 2E7BA 4HJJH 4PJAB 1U3HB 5JNYB 3MRGA 5FKAA 4DZ8B 5SWSD 4EQ3A 2AK4E 4GUPB 3VWJC 4Z7NF 1DE4A 4Q6IC 5JHDB 5EZLA 5I30H 1MCOH 1YN7A 3QJHA 3LKSB 2GCYA 3ZKQD 4YX2L 1TETH 4Z7UB 1GHFL 4KAQH 2NZ9D 5JTWA 3MRPA 2B8OT 2VKXA 3CVIH 5DRZB 1HSAA 4ZTOH 3SDXB 4M3JA 5C0FA 3LD8B 4JY4A 4UB0L 5BVJA 1DQTA 1MHCA 5E70A 3GHEH 1NBZA 4OCYH 3CFBA 1Z0NA 1MCHA 5E9DE 3D25A 3KDMA 1CLYH 2APWA 4LSPL 5EIIA 1I75A 1B2WL 1RUPH 4LSDA 3VW3H 1CG9B 4NJAH 3BN3B 4FFWD 4I0PA 1DBAH 4NKDA 1RZKH 1TTGA 1K8DB 4XCEA 4TOYH 4RMRA 1FGNH 1X4ZA 4UMGA 4R8WL 5L8LB 4UT7H 3GSQA 1U8HB 1I1AA 5IK3A 4TN9A 3OKDB 1OGAB 1CS6A 4MAUL 5MI0B 1QFOA 1E6OH 3HPJA 2OTUB 3IXAB 1AFVL 2YD3A 1TZIB 1P2CA 1CCZA 4XMLL 2YD5A 4X6CA 4TPRL 5TFSH 1NEUA 5AZ2H 4XI5C 1IT9L 4M4PA 1QFUL 5C92A 4NRZB 1U8JB 3ILQD 4D9QD 5L9DL 3RGHA 5CCKH 4FQQA 1A21A 1RZGA 5E4IA 3QQ3B 2J1KA 1AC6A 5I71C 3WHE1 4PRPA 3UAJD 3O6LL 1U3HD 1S7WB 3HZYB 5J1SC 5EIVA 4XNMB 2DTSA 1I8LC 4KHXH 5GQBA 2J3SA 5DRNA 1I1YA 2H32B 1MVUB 1ZVHA 3U7YL 4AIZA 3TBVB 1FNGA 5BZDB 2DB8A 4NJ9L 1JF1A 2W0KA 3OMZA 4PJIF 4EI6B 1ZHNA 4OCXH 1YEIL 2IC2A 2DDQL 1EPFA 2X70A 3QZWG 5ID0A 5MEQB 5E99H 5I18L 2XZQL 5IKCA 2KPNA 1QPPA 5IBUG 1JGVL 3ZE1E 5FYLE 4V2CB 4OFVA 2Y07L 1HKLL 5C08B 1FZOB 4N9GA 1MFAL 5H2BB 4HJ0C 2LFGA 2R9HC 2YS4A 3GSVB 4LPYA 4UOJA 3RUGF 2EH8H 1KC5L 2DMKA 5E8OA 1GRWA 1SYVA 4MA7L 3BIKA 1VESA 1DFBL 1GIGL 1JZ5A 4NNYB 3RTQB 1GZQB 2OR7A 4LQFH 1E4XI 3JV6B 3ZHDA 4D3CH 1JZ7A 2EXYC 3MRIA 3BZEB 5JIIA 1M7IA 1CDUA 3MLWH 3ZYJA 5DSCA 1SBBA 3HR5B 3ARFD 3U0WL 1NC2D 4BQCA 2FHCA 2WV3A 3WJJC 4G9FD 4GAJH 4HIJA 4XCYA 5I1JH 1LD9A 1ZT1B 4HGKC 3TEUA 1U8MB 3C9NB 2X5PA 1UKSA 3PWLA 3QZWA 3ILPB 3OKNA 5C2UB 1LQSR 4R7DB 3M17B 3MUGB 2VXQL 4CMMB 4OAWA 4M8QB 3DMMD 4PJCF 1D5IL 3EOAA 5D2NC 4LARL 4U1GB 3ULUD 3S3SA 5J6HB 4AG4L 3RI5F 5DXWA 7FABL 4H1LB 5ESVA 1A7QH 4TUOB 2H2SC 3VGBA 1TJIL 2VQ1A 1ZK9A 2X1WL 4NWUH 4DGYH 2BY2A 2GAZA 1T0MA 1ITCA 3LB6D 1KCRH 1DBBH 5ISZB 2O61B 2NY6C 3DX8A 1WWWX 3GI9L 4HF5L 4X4ZA 2FH8A 4GG8A 4EUPG 1J0YA 5EBGA 4HIXH 4KTDL 2ARJA 3UYOD 3V5DA 3K74B 3IKCA 4OZHF 4RQQA 4X6DA 1JFQH 3TYFB 4OT1L 5FYJL 1KB5H 1N3NA 1FIGH 1ORQB 1T83C 3Q3GA 4MA3A 1HH9A 2OMNA 4EI5B 1HHHB 1G6RA 5IUSA 2A74A 1V05A 2AQ2A 1FGVH 3PGDB 4IJ3B 1MAJA 4KROD 4M1CD 5EU3B 3VGAC 2ATKB 3VE0A 2MKWA 9CGTA 4MB3A 4RZCA 3KNBB 4TVPH 2R0KH 5BOPA 3RTQD 3TYGL 4HIIA 5I1EL 5EH1A 4FZEH 4PV8A 4CKVX 4EDWL 3BQUC 5ABDE 3S35X 3FQWA 1NFDF 4ZNEA 3BP5B 3MUHL 3P4MB 3QDMA 4G6KH 3HLAA 4BSVA 3T0DA 2VOTA 1XGUA 4Z8FL 1NCNA 1KJ2L 1XR9B 4O4YH 2DMBA 5E56A 3AXLA 5ILTH 2CDGB 3RIAF 1DQDL 5C0RH 5TPWH 4LHQB 3D39E 1EEUA 1UM4L 4LPCA 1IM3A 4XTRC 3IJHB 3HE6C 3TFKD 3PWUB 2UVFA 2HKHH 4LKXB 4EN3A 5C7XL 2C26A 3GMOA 3G5ZB 2EE9A 3KHQA 1FZKB 4EUPA 3FHAA 2UZYB 5T3ZL 4WUUE 3BPOB 5FECB 2X4UA 4P4KC 4K55A 1UXWA 3SO5A 4Y5YB 4BFEA 2OZ4L 5HDBE 4ZFGL 4XP6L 4JG1L 1JZ3A 1VB9A 5D70L 1TFHA 2IGFL 4OJFL 2YSSA 4JO4H 4PY8J 5DHYA 4JQVA 1PZ5B 2AI0H 2PXYB 5D2LA 5IJKC 5FYKE 4Y1AD 4R0LB 3H7LA 4MJ5B 5HHOB 1MPAL 2BFVH 1AD9A 4K3GA 1A6AA 4LQ1A 3QDAA 5T1MB 4P23B 2E6PA 3C5ZC 4P5TB 3FKUS 1N4XL 4HPOL 5MENE 2A6JA 4UQ2A 1OW0A 2B0SH 1NDGA 3DO3A 4U7MA 1SJHA 3EYSL 3TP4A 4LEOA 3KWWB 1UCBH 4E41E 1T5WB 1FYTA 3OKMA 2AJXL 2PO6D 5GS2D 5CKAA 4OB5L 4YXKH 2Z31B 3MRQB 4EI5D 2MTPA 4NQXB 2R2HB 4Q0XH 1AXIB 1WEJH 1KGCD 4PJHA 1Q9LB 4U0QB 1I3GL 2BCKA 3I3DA 3KXFA 3L3KB 5E7FA 5KANG 1G9NC 2X4PB 4RAHA 1A6VL 1FG2B 1KIRB 3X11B 5A2IH 3PE9A 5GGSY 2EZ0D 4R26H 1GOGA 4XC1L 3EW3B 3C5JB 2OXGA 5D7SH 3QEHA 3S96A 2DYPB 5TE7H 1PAMA 5SWZE 3TBYB 3VXSE 1GCFA 1WIUA 5H37H 4RGOL 4FQPA 2BVOB 3LEYL 3QO0B 2V2XB 1AHWA 4YDIL 5IB1B 2WWKT 1BEYL 1JHKL 4XPFH 2WQ8A 4H20H 1YYMH 4D2NA 1YMHB 1E28A 1HXMB 3FOMB 3PHQB 2A6DA 3TT1L 5BV7H 5DJ8B 5TE4L 3WSQL 1C1EL 1IEAA 3ZDXF 5HHPB 2DQJL 4MQTB 5EO0A 1M6OB 1CFVH 5BS0E 1A4KA 2HJKA 2VZVA 1BWMA 4U1KA 5EC2A 1U8OA 2IQAA 4XZUB 4P3WA 3PQYB 4FG6D 3MZTA 2ID5A 4HCRH 1Z0MA 1QFWI 2PXYD 3GSUB 3AY4C 5I74B 3GM8A 1BOGA 4WUKL 3VWKD 3CFJB 5DJ6B 2YZ1A 4JFEB 4LCIH 2F58L 2JTDA 4KGJA 1LK3H 4JM2F 1AO7E 2IANE 5JOPE 1ERNA 4B0MM 3VD4A 4M93B 4NQED 3KS0H 3TH3T 2DL9A 4K8RC 1QPXA 4X7FC 1KCUL 5ADOL 4ZTPL 4P2RA 3BN9D 3DVNA 3VFGH 5E2TH 2GY5A 5EZOL 3RHWK 4WFED 4GAGL 1J8HB 3CMOL 2IG2H 1BVKA 5BRZB 1HSBA 3UROR 5J9PB 1P6AB 5FGBC 4YGAB 1CXKA 2E7MA 2DI9A 4UIKH 3SDDD 4U6YA 1UCTA 1RIHH 1RJYB 1ZAGA 1WTLA 2ICEB 5DT1L 4Y4HB 5L7XL 2RBLA 3S37X 5DJZA 3QEUA 3GIZH 1B0RB 5GJSL 3LHPL 5E94B 2BNRE 2AEWA 1NGWA 3LKNA 3GJEA 1JJUA 1VEMA 3O8XD 3GMLA 4ZFOB 4NQVB 5D1QD 2HRPL 3O3BB 5GZOD 4RMQA 5IROA 1YN6A 3RNKB 1A6UH 1FO0H 2NXYC 5ESQA 4XWOC 3FRPG 3RY5A 3OKEB 1I9IH 2NY1D 1R5VB 1DQJB 4FXGB 2GUOA 4PRNB 1C12B 1KPRB 1HKFA 3TO2B 1AC0A 5T1DH 2FZ3B 2ITCA 4R4ND 4ELKA 4ZO8A 3I2CH 2Y25A 5F21B 3IF1A 1ZLWH 5LKNA 1N5AA 4LOUC 4OTXH 1R6VA 1YNLL 1I9RH 1LE9A 4HKBB 4FP8L 1KXQE 2BRQA 4H8WL 2B4CL 5TDOB 2B7DT 1BAFL 3MJ8A 3BPLB 2DQEH 5JOFB 4I13B 3PJSB 5B3JE 1Q0YL 1FFPB 4KVCH 4FQXA 4RDQG 2DWEA 1IGJA 2VXVL 3QI9A 4JCMA 4M7ZC 4X83A 2D7TH 4KK6D 4NBZB 4YC2C 1KYOJ 5I1DB 1MAKA 2BNQE 3TBTA 2A0LD 3EJYD 2QSQA 1T4KB 2ZCLH 1CGTA 3E2HB 4MJIE 4FQJH 1MVFA 1YUHA 3WXVL 3D6GA 2RIKA 4CVXA 3H3PL 1CFQA 4KK9C 4U6HA 1CR9H 3QDJA 1VGKA 3UTQA 5F70A 3OHXB 3VXTA 4PJ9C 4O02L 4NQCA 1AI1H 2OR8A 2R0WH 5GGRB 5DRXB 2YA0A 1PX4A 5F7YC 3T4YA 2FHBA 3OJ2C 1OAYL 1QEWA 4Z7WE 3UBXA 3ZYIA 5FYLH 1OCWL 4AMKH 1OTTC 2PW2A 4QRPB 5F9JA 5KSAB 5EWIH 4YPGA 1FH5H 3S36X 4MS8C 4P4RB 5IVNA 5KVEL 5JO5A 5DUPL 3UTTB 5D6CB 5EA0L 2X4SA 4F7EA 3EKCA 3P4NA 2XFXB 3FHQA 4U1JB 4CGTA 1MCKA 1FE8H 3ETBF 2DBLL 2VL5A 3S35H 1GPOH 3SE9H 1BBJA 4NZDA 3SCMC 1OF2B 3I3EA 2CRIA 5C0BE 4PR5A 5M95B 1EXUA 4G8FA 3TNNA 4YO0B 4KXZH 1MRCH 2K7PA 4WWKD 1SMAA 4LLVB 1FNSH 1IBGH 2Y5EA 1D9KB 3FQTA 2FSEB 2Y23A 4AM0B 4ZDHB 2RCSL 1GAFH 2EXWD 4U1MB 3HG1E 5A1AA 5I8OH 2A9NH 1UM6L 3T4AA 1O5DT 4UTAH 5AUMB 2C3HA 3ULVC 3SGEH 1NCAL 5KSBE 2F54D 4NP4L 2X1QA 2YMXL 2OL3L 1ZT7A 1FLRH 1T6WA 1XF5B 4N5UA 4O5LH 4DQOL 2DQGL 1INEH 1YJDH 4KHTL 2AJZA 2BVPA 3MFFB 1BM3L 4WV1A 1EFXA 3OKLB 3HRPA 4S1RH 4JDZB 1FZJA 4HHAA 5F9OH 1JRHI 3V7AE 4ODHL 3FQUB 4MXWH 3D3VB 2WUCH 1RJLB 5CJ8A 3VD9A 5DZOA 3GMQA 1VGEH 3U9UB 2DQIH 1NAML 2YBRB 3MV8E 3U1SL 1EO8H 4X7SL 2C1PA 1J9CT 4AEFA 2VZSA 3GKZA 5E1AA 1RZJH 2CRMA 3HRZA 5IM7B 4QRPD 1Y6MR 1PEZA 3HI5L 2P43B 3T0EA 4WI7A 4OCNC 2Z91A 3DV6B 5E4EB 1MIMH 2VUOA 3L5XL 2I60H 1MCIA 4M6AA 5DC4B 1PQZB 2YPKA 2NY3B 2D31B 3JV4B 1BIIA 2H8PA 4DFIA 1DR9A 3LPGA 5A40E 4N90E 4ALAL 3SDCB 4JFFA 5T33H 4ISVA 5GGVL 5DLMH 4PP2A 5HDBF 1HWHB 2DD8L 2L4OA 2XZCL 3QUZD 1QSEE 3CD4A 1IGTA 4UTBL 4Y4KA 2C3XA 2ADIA 5FYJD 4ZPTB 1FCCA 1YMMB 1U8IA 5E03A 2VH5L 3UPRA 3P9MB 3I02B 2V6HA 1EEYB 3V6ZB 4FOMA 1E27A 5D5MA 2QSCL 5FM4A 3MYJA 4QY8A 3HE7A 3TVMA 2Z8SA 4P46D 3PWJA 2VIRA 2VDQH 4PJ8A 2LU3A 3SJVD 5DVKA 1MFCL 1QSZA 1NMBH 2B1AL 3ARGB 5IW1B 1KN2L 3K4AA 4D94A 4PJAE 1JHLL 3DI3B 2ICWA 3C60B 5ETUB 3VFNB 3MTRA 2BOCB 2ZUUA 4X9IA 4F9LA 4F7MB 1JYWA 4X6BA 1S7TB 3OJDB 4FFVC 5JHDE 1W0WA 5GRVK 3U83A 2NX5E 4LGPB 4PG9B 3FFCA 3KPRB 3DROA 5FYKD 1EEZA 4FXKA 4LLQA 3IJSA 5T3ZD 3L7EA 3QFJD 1KTLB 3BW9A 2BRRH 3EYFB 3D3VD 4HUKB 5LG1A 1T03L 3P0VH 5JW4R 3VFMB 5D7KE 4DEPC 1XGTA 3SDXE 5MEND 1UVQA 3RVXC 3MGTB 2KH2B 1Q8MA 4N8CH 3WJLA 5ICXB 3HUJA 1GL4B 2W60B 4AIXA 1TZHA 3OAYH 1BGXH 4HH8A 1A3LL 1WBYB 3GSXA 3QUYC 5C70A 4OIAA 5DS8B 3CSPA 4JFYA 3ELAT 3AB0C 4I18A 3RZCD 3RA7H 3SEPA 1S7XA 5JIKA 3SDCD 1W0YT 4Y5VA 4PIRF 1MFBH 2AXGA 4F9PA 2GK0A 2DQCL 2XWJA 4KI5C 4WW1B 3GRWH 5MERB 4GRLA 3TO4B 1NC4D 4PJXA 4QRQB 5FOJA 2EKSA 1OGAE 2EIEA 2ZKHL 5SWZD 3QEQA 1IC4L 4JN2B 5CJBA 5I1GL 3ARZA 4JFDA 4JY6A 4JRXA 4G9DB 2UVEA 1R5IB 1A1MA 3T2OA 5I6XC 1F45A 1GGIL 2YC1A 1A7RH 3RIFK 2PTVA 3QFDB 5TQ2L 1S78C 4IIQC 5M7QA 1GSMA 2EIZB 4FQCL 1EGJA 4WFGD 5IHUH 1Z9OA 4LGSB 5C8JB 4NO0A 5INCB 1QACA 5I1CL 4KRPD 4Q6IB 3ARUA 1U0QA 3FB5B 2J2ZA 3VRIA 2GY7B 4WHCA 4K9EC 5CUSH 4WGVB 4M7LT 4JE4B 4ETYA 3V52H 4PJ5B 4HG4K 2AP2A 2XN9E 3BP6A 2Q8AH 2VAJA 4YGVA 3I9GL 5D7IB 1SEBB 2P48B 1WFOA 5IMOB 1BZ9B 1QBAA 4K7PX 1ZLSH 4M00A 1IEHA 4UAOC 5CSZB 3MRHA 3MCKB 2CK0H 3CFCL 4ZSOB 1DLFH 1NH6A 1JWSB 1CD9B 4OF3A 5DJCA 1K8IB 4HKZB 2A83A 3PGCB 1L4IA 3OKYA 2DJSA 5C08E 4J1UB 4LIQL 2EIDA 5IB2A 4RMWA 4XBPA 5AYUH 5CZKA 4A6YA 4HJGA 5CIPH 4MXVE 4JFQB 1G7LB 1MJ7H 4Z76B 2DLHA 5GZNC 4G80A 1OAXH 5EOCH 3VGHA 1J12A 1OHQA 4EOWL 5D72L 2A73A 4JFOB 5M94B 4ZPVB 4PJFE 5JPNA 4QTHB 2NZIA 2CKBA 1ZEAH 1QRNA 4KY1L 5IMLB 3KR3H 1AR1D 3K2MC 2BNRD 4LCWB 3IDIB 3Q5OA 4GBXA 4JY5H 3RWHA 3S36H 5B3JF 5DO2D 4ZUTB 2X89D 3PXJA 4BFBD 3EYVA 3OGCA 1F2QA 1INQA 5F1OB 1JGUH 3KGRA 4EQ2A 2V2WA 3VJ6B 4PJGB 1HZHL 4X8JA 2DLGA 1GOFA 4ZAKA 2WBJC 1IKNA 1C16A 2YPLD 4MD4B 4WCYL 3MV01 3GBNH 1ORSA 5D7JD 1OD9A 5I71B 1TCRB 2X9XA 3F7YA 3NZ8B 1ODAA 2H2PC 1K5NA 1FVDB 2XNAB 4ACPA 1JPTH 2EDQA 2JE8A 4QNPF 5D1ZA 3LEXB 1YEEL 3SGEI 1S7RA 4YXHH 5DQDL 4XNXL 4JZJA 4GG6A 2WW8A 5HI4D 2HLFC 5J3HD 1OTSC 3VFSB 2VLJB 1PLGH 1QFPA 5FXCH 4PUBL 4KK8C 5TGBB 2B2XH 4L4JA 5EC1A 2P8MB 4TSBH 3VG9C 5IEKA 5ISZE 4K2UL 1BVLA 4Z7WF 5ITFB 2YA2A 3C2AH 4HX1A 1P69B 2V7NA 3TPKA 3MLTA 3E6HA 3D9AL 3QSKB 4YBQC 2FNBA 5C6WH 5IB5B 1ES0B 4Z95H 4PGDB 3FMGH 4OZ4A 3CK0L 2DQUH 2YK1H 1X7QB 3P30L 3MXVL 2VRAA 4MNQB 5AWNH 1OP3K 1ZLUH 5JW4N 2YWZA 5HYJD 2Y5TA 4MA8L 1KJMB 5C0GB 1T3FA 1JUFA 1CL7H 1TJHL 4FTVA 3U9PL 4GRMB 5B8CA 3VXMA 3AAZB 4U4BA 3GBML 4KVNH 3TT3H 3OKKA 4KRNA 1CLOH 5I17B 3QIUC 3S3PA 1B4JH 1UZ8A 1T1YB 3BGMB 1X5ZA 4HSQA 2EYRA 4DKFH 3FQRB 4HS8L 5F3HA 5HI3D 3CCHA 2W0FA 1G6RL 3QEGL 5DD6B 4BFIB 3GMRB 4MHHG 5IQ9B 4R90H 5AG8A 5KSBF 5D7LA 12E8L 4LFHD 1NAMB 3IT8D 1RIVH 2NW2A 1GZPB 4PBVC 3DLQR 1A6ZB 2EO1A 3VDBA 2IQ9H 1QSFE 5DMGD 32C2B 2OXHA 4NKMB 2J4WH 3KJ4C 5D2NB 3PL6A 2IH1A 3MRMA 2VLRA 3C5SB 2DM4A 4HLJA 4JLRB 4KKAD 3WS6C 5B38G 3EOTL 3QIBD 3QNZA 3HG1D 2EH7L 4DN4L 4HS3A 1AD0B 3S98A 1EV2E 1I8IB 4TSCL 3MRCB 2F5AH 4H26B 5DD5H 3SDYL 1TCMA 1MWAB 1YEHH 2NY6B 3LH2H 4JFXA 3MJ9H 4NDMB 4RWHA 2VDPL 3TPUA 3J7HA 3BYYA 5IFJA 4NQSA 2P5WB 2GJZA 4LF3B 3ARXA 1YA5A 1AXTL 4RMSA 1KBGL 1XEDA 1LEKB 1HHJA 3UEZA 1DDHB 2W1NA 4PGEA 3FZUC 3C6LD 3W9DB 3O2WL 3VGAB 4L4TD 3NFPB 3Q5TA 1U6AH 1I1CA 1RSFA 3KVQA 4GRLC 3C6SB 4PP1C 2C4FT 3BQUB 3K4DA 5C0AD 1RFDH 5DJXB 4ZO9A 4GW1A 5BV7C 1U91B 5C0DB 3BO8B 3QG7H 4QHKI 2LU7A 1X5HA 3SGKA 2IPKA 2WINB 3STBA 5B38A 1ZTXH 4KZEH 3MBXL 4YHIA 5KSVA 2R56H 1CD1A 1VFOA 4JDTH 3R06A 1UJ3A 3GSOB 1YEJL 2AK1H 2Y06L 3HE6B 4KDWA 2ZSVA 2OK0L 1SVCP 4OZGB 5IJVA 1CE1H 4N90D 1A5FH 1MRDL 2FJFB 4PJAF 1N0LA 2XQBL 1W0VA 3DETD 3ARBC 4K23L 4ZUUA 2BXZA 4LDLB 1WCBB 4P4KB 1B6UA 4IRZL 4OSUL 4NO2A 4XWGL 1ZGLA 3ORJA 5FIEA 4DZBB 3KPNB 5GXBB 1HCFX 3CUPB 1LNUA 3L6FB 3T3PE 3PQYE 1YNTA 4X9HA 4NRXA 2XPGA 3EOBA 3BT2H 4JFEE 2NLJB 4I9WD 4WFFD 2F8OA 3AS3A 1KNOB 4XP4L 1V3LA 3SDXF 1HSAB 1QLRA 5CBAB 4WO4D 3QNYA 3HC4H 3C5ZB 4MNHA 3MV9B 1R3HB 5C0FB 2QADC 5C0IB 1MHCB 3O0RH 4UV7H 1NBZB 1G7JA 2X42A 3REVA 5JXED 1HE7A 5B39A 4HPYL 4X5WB 3IGAB 3TZVC 3STZA 3FTGB 5EIIB 1FVCA 5EU7E 5EU6B 3CVHA 3UTOA 1J8HE 3UJJL 1CICC 4K3EH 4MZ2A 3DUSB 5GRJH 5BRZE 4DFHA 5MHSE 3BISA 5GGQH 4P0DA 4XMKL 4KDTC 8FABB 4WW2A 4ODVH 4UNUA 3AM8A 4RMTA 1ONQB 4LSVL 1I1AB 4M43H 2H3NA 5IK3B 4JANA 4P5MA 1IFHH 4QGTA 1NCUA 3O6KH 2P45B 3B8YA 3MREB 4WU7B 35C8L 1JK8B 1YDPA 3WFHA 1Q72H 4Y4FC 3FFDA 3EO0B 1K4CB 4FQQB 4Z0XA 2EYSB 3KG5A 4TUJA 4PRPB 2H26A 5GGUA 4G42B 2XV6B 2YOCA 3SQOH 3TIDB 3SE3A 3KPMA 1MRFL 4HGWB 2F15A 3MLVL 4X5XA 2XRAL 3ZT6A 4IOIB 1LO2H 3GKWL 1FNGB 3OAZK 4U49A 3LN4A 3WO4C 4X80L 1I9JL 2C3WA 5C71A 3L3HA 3A6CL 1ZHNB 2HFTA 3QWRA 3VGGA 3QT2A 5ADPL 3HZKA 4HH9B 1N64H 4JPWL 2X70B 1A22B 1UEYA 1SBSH 1NJ9A 1G9ML 4PRBA 5EZIH 3M1BB 5IKCB 4P9ML 3F7VB 2MNUA 4DCQB 1A1OA 4L29A 4N0YL 3B2VL 5EU5A 3NABL 1U58A 5HSFA 1J5OL 1YEDB 5E2WH 2H32H 3LQAC 5E8OB 1OLZA 2FATH 4MXVF 4DKAA 2ORBL 3C8KA 1UQSA 2OMBA 4GMSH 4I0PD 4ODTH 1VKXB 1N7ML 4JPKH 1CXLA 1JWUB 5IT2L 4DVRL 2XN9D 2BZDA 4U3CA 1FZMA 4Y8DC 4DGVH 5KVFL 1WC7B 3I84A 4BH7A 4C57C 1VPOH 2DIBA 1ZOXA 1I1AD 4KRMB 4OGXH 5E6IC 3ZO0A 2HKFH 1CL7I 5BVPH 1SJEA 4OZIB 2XTJD 3IU4H 2LU4A 3DARA 4XMPL 1N0XH 5JLZA 3LDBC 4QRTB 4XPGH 2KZ1B 3NIDE 3ZSTA 1EMTL 3GI8L 1Q94A 3UTTE 4XPBH 2ZSWA 1YEKL 5D71L 5FA3A 1NBVL 1JZ8A 3G6JA 4ZO7A 3ZL4L 4FQHB 1IGCL 4GKNA 2PTTB 4FRWA 5DMJB 4K9EL 2X4NA 2NXYB 4YAQB 4OM0L 4OAWB 4ENEC 4HUNB 5SV4A 4PLOB 1CQKA 1AP2A 4HS6B 1M05A 4N0CC 1F3JB 1L0QA 1D5XB 1IC7H 2YUZA 5IBLD 2CO6B 4OM1L 3CFKA 3RRQA 5GS0H 4GMTL 4LLUB 1R24A 2IPUK 3QB7C 1I4FA 4MCZA 3MRDA 1EUTA 2VQ1B 4QRRB 5C09B 4A2MA 1XIWA 4BZ2L 2DQHH 1DN0A 1DSFL 3BEWA 3QP3A 1JL8A 1KJ3L 3B43A 4M7ZB 4YC2B 1HIMH 3O45A 3B4NA 5GSRA 1IEBA 3G08A 4JFHD 3G6AB 43C9B 3R8BB 4H88H 4ODUB 1S7SB 3Q3GB 1R3JB 4QXUH 5GIRA 1CE6A 4XP1H 1HH9B 3MV11 1KIPA 5EOTA 1MF2H 1RIUL 2A74B 4ONFH 3MJGX 1P1ZA 5FOBA 1U8LA 3T2NH 3IDXL 4H1LH 1Y6KR 1LO4H 1OOAA 1CU4L 3JWOC 3VE0B 5C6TH 4RZCB 3RVWC 3EGSA 4HUUA 1OT2A 5H94A 5SV3A 4HW6A 3MACL 4F33B 4HT1L 4NO3A 3N1FC 2FJGA 2MHAA 2JB5L 3NFNA 4F57H 4XNQA 2GTZA 4PJ9B 3TCLA 3QDMB 1M7DA 2R4RL 4GT7A 4PS4L 4I5BA 1INDL 2FD6L 1T04B 2IPTH 1DBML 2JK5B 3F5WA 3ZTJH 4JHWH 3FB8B 5F7DA 2C7UB 5GS2H 3S3JA 1KELH 4WTWA 4R9HA 2FWOA 2ZUXA 4NSKB 3OWEA 4YXLH 1NGPL 5IF0A 4EN3B 3GMOB 4UZGA 5BO1L 1C7TA 4B7LA 3UJIH 4RFOH 3BP4B 5CKGA 2O26U 3BSZL 2IH3A 2X4UB 1IAIH 1P4BL 1XH3A 3RWCA 3RWFA 1UXWB 4J2XA 3ZSSA 2IBBA 3SCMB 1DVFA 2X4QA 5DK0A 4P2QB 3DECA 3UO1L 4KZDL 4LHUB 1YMME 3RQ3A 3G5VB 4B41A 2VWEE 1A1NB 5GRUH 4XGZA 5DHYB 5DR5L 3PDOA 3X17A 4H0GA 1LK2B 1H8NA 2H45A 1H3PL 4OLZL 4M5YL 3T0AA 3UJTL 3ZKSD 2CIIA 3ZKXC 2DJ4A 2MCPH 3QIWA 1MJ8L 5IFHH 1RURH 1YY9D 5DHVA 1ITBB 4LVHC 3S88H 2AJUH 4GAYA 1J1XH 3I6LD 4X6FA 1RAMA 5MEOB 2W92A 4I3SH 2A6JB 5IOPB 4K71C 1GC1L 1NDGB 2ICWJ 4M9OA 1SJHB 3MLSH 4F7PA 4AJ0A 4KKBD 4HBCL 2DIJA 1CGYA 5GGSB 3REWA 4XP9L 4KUZL 3OKMB 5A2KH 5JR1L 4QRSB 3QUMB 2Q8BH 5HJ3A 3BP7B 2XY1A 4PJHB 1J1PH 5F8QC 3KPRE 2MOVA 3KXFB 5DDHA 4GOSA 2HFFA 2Q76B 2VE6A 1VACA 1HN1A 4E5XA 2VZUA 3CSYB 5E8NA 4BZYA 2XA8H 3N9GH 3LEVL 3QDMD 5CEYA 1UWGL 3EYUL 4R97C 1LEGB 1A02N 1O7VA 3SKOA 3NBNA 1K4DB 4N9OB 3S96B 3H42H 1Z6JT 5CAYB 4UOW1 2MPAH 4XBEH 1ZSDA 3VXOB 1D3CA 3SKNB 4XAWH 2GITB 1P84J 4FABL 1JGEA 4QYOA 5DK2A 3H3BC 1I85A 4OCMC 4EN3D 4KRLB 3U7WH 5DYOA 3KPSA 5LCVL 1OLLA 3LVEA 4NKOB 3LPFA 4M7KL 4DUVA 2CRYA 1BBDL 1HXYA 1P7QA 1R3KA 5IHLB 1LMKA 4ZMAT 3OXRA 3H9SA 4GH7B 1N2RB 1FNHA 1NCCL 5T1KA 5DFWH 3T3PF 5E5MA 1AQKH 5IHZA 3G5YA 4S2SB 1UB5A 3RVUD 2E7LA 2RFXA 1EDQA 1SYSA 3E6FB 2DQDL 3B9DA 4TQEL 1JPGB 4Q58C 1KEGH 1XGPA 5HHQA 1FORL 1RHHB 2FEEI 2LE9A 3VXNB 1A4JA 5GRZA 3UTZA 1D6VH 5CMAA 2HA1A 2DQFA 3BKYH 5IV2B 3QHTC 4Z6AT 43CAA 4KK5D 2P1YA 2YRZA 4LRIA 4UB0H 4P2RB 3CFDA 3DVNB 2ICCA 1KEML 3W9EA 5IFAL 4F37F 4GW4A 2FYYA 4R4BA 1CTOA 1X5JA 3LAFA 2OR9H 4PJDB 4N0UA 1FYTD 3VXUA 2Y6SC 3WE6A 1QFHA 3QUXA 1BVKB 1FBIH 1MJJA 3OX8A 5E6YA 2R0ZL 4HWZA 4YNYA 1QG3A 4J3OC 3KXFD 4P9HH 4GRWB 2R0LH 3U82B 4PJ5E 4Z5RB 1Q9KB 1WZLA 4R8WH 3SO3B 1V7ML 1S8DB 4YHKH 5D7IE 1FL5A 4UU9A 1S9WB 4Z0BL 1QQDB 1P7KA 2G75B 4AL8L 3MOAH 4KKCC 3WHXA 4LEXL 4ZSOE 4QF1A 4MAUH 4LU5L 4MDIB 5D1XA 2P46B 3SDAA 3MBEA 5CD3A 1AFVH 4MZ3A 5J89A 1NGWB 1UXSB 3RFZC 2FJHA 1IM9B 1EGJL 1FG9C 1MCQA 2APTA 1UACL 3GSNA 3F65A 1IT9H 4BYHA 3RX5A 5L9DH 4NHUB 3QUYB 4JO3L 5BJTB 1RY7B 1OL0A 5IW3A 1Z3GL 3AB0B 2FBOJ 4JKMA 4R4FL 3IS0X 1CT8A 1AY1H 2W59A 4C56A 3PIQA 1FFQA 4K7PY 3U4BH 3HZMA 1U8KA 3T8XA 4MDJB 4L3EA 2NYYD 2P5EA 4RSVA 1O0VA 2ZPKL 1N5AB 4FHBD 3PGFL 2R23B 4APQC 2YA1A 2H9GB 5E8EA 4LSQL 3N06B 4PJIA 1ZA6A 4RCAA 4DK3A 1DJSA 4G7YL 5JIHA 1NMAH 1KIQB 1IGJB 3BPNC 1B90A 4QXGL 3S5LG 5F7EL 4A6YL 1NANI 4Z7QF 1XZ0A 3EDFA 2GJ6B 2EEBA 2O5YL 5I6XB 1CI5A 3WXWL 3TBTB 3K2UL 4XB7A 2XZQH 1JGVH 1NQBA 5HD8D 3FQXA 5FUZH 25C8H 3IKKA 1HKLH 3RUGA 1ZHKA 2A1WH 1FV1A 4RGMC 4B5EA 2EC8A 2HN7A 1UEMA 4IIQB 2GTWA 4CVXB 1TIUA 2CKBL 2IAMA 1DFBH 4U6HB 3GMPA 3O9WC 3S4SG 3VI3E 3U0TB 4E42A 4FZ8H 4DW2L 2MWCA 4LVEA 3B5GA 5DMIH 3H9HA 2GFBA 3VFRA 5CGYC 2P8PA 3UTQB 1QHPA 1QA9B 3O41A 2RJMA 3RP1A 1N6QL 2OJZL 4Z7VA 4I77L 4IOFC 1MHEA 4RAVB 3U0WH 3X3FH 4UAOB 2PW2B 5LGKA 1S7QA 3NIDF 3F7RA 3IETB 3LMJH 2AV1A 3CC5A 3WIFB 2OSLB 4I2XE 1NGXA 1XCTA 1Y18A 4ONOA 4KH2A 1FHGA 1J8KA 1Q38A 3OR7B 3W2DL 3P77A 4TNVF 5GGTH 4R2GC 4PJCA 4M7LH 4OQTA 5T5FL 2XG4A 2VXQH 1DVFC 3HI1B 4LASH 4PR5B 1D5IH 4S1DD 3SKJL 3V6OA 5ACZB 4B7IA 1RQ5A 1EXUB 3GBLA 3TNNB 1NBYB 2WQRA 5CGTA 2F5BL 4NRYB 1IAOA 1CYGA 7FABH 4IEFB 1T89C 4Q9RL 1UH3A 1TJIH 2A6KA 3OL2A 3B2UD 3NCYP 1T5XA 3QIWC 3BGFC 3CXHK 4MAYA 4G6ML 3T4AB 4FQXD 2X4TB 4J3TA 3TV3L 5HYIA 1T0NA 2XTLA 2V9QA 3QI9D 4PGZA 5KVDL 3WFEL 3HNVH 4OZHA 3S6CA 4KTDH 1J05A 1MCCA 1WV7T 2HJFB 2WBJB 3QA3B 1AGDA 3W0WA 1ZT7B 4OLVH 1EHLH 1IQDB 3QNXA 5FF6A 4PLNC 1H15A 1AQDA 3C08H 4PY7A 2M26A 3CAFA 5INDA 3WEXA 5D2NE 2AJZB 4PRIE 4S11A 4X4YB 2VNCA 4UDTA 3IFOB 1KV3A 2MSPA 1PKQB 2J88L 1MI5B 1QLEH 3TYGH 1NFDA 5HPMB 3QDJD 3EYQD 2X4RB 1KB5B 4NOFA 1MCRA 4YDLC 4O2EA 3NVQA 1FIEA 4NQCD 2X7LA 3VG9B 4PB0H 2NZ9C 4IBLT 5DVMA 5F96L 3S4SB 6FABH 4IM8A 3VG0H 2C1PB 5H37G 4HBQA 1F6AB 5E1AB 1DQDH 2CR6A 5T3XE 5GS1C 4LLMA 4CL7A 2P5WE 1D5ZA 3T0EB 3VXRE 5AZEL 2Z91B 1VADA 5IMKB 3QCTL 2F9BT 2DOCA 4M7JL 4GKOA 3KLHD 4ZXBA 4QHUB 4PP2B 2VXTL 4FFWC 5IGXL 4TRPH 2OZ4H 2G60L 3H2WA 3M8OH 5DQ9B 1ZHLA 1LE5A 1T1XB 2YD8A 3UPRB 3TH4T 1F3RB 1WBZA 4KMTL 4YHNB 5D5MB 3QIUB 2HT2D 3MYJB 3F12A 5EU4B 5BXFA 5FHBL 1CXEA 2HVKA 2CLVB 5ANMA 2C4XA 2WZPD 2PYEE 4LLDB 3T0WA 4PJ8B 4O2FA 1S9VB 5LGJA 1EHXA 3O11A 4HWBH 2FO1A 1N4XH 4MB5A 4OD2B 4HQQL 5EO1A 4YWGL 3ILQC 4PRHA 3EYSH 1EUUA 1EJOL 4JPVL 2N7BA 4JJ5A 3UAJC 1WWAX 4KMQA 4OB5H 3P0GB 4X6EA 1G7PA 1U3HC 4JHAH 5C0CB 2VDML 1C5BL 2VB5A 3KJ4B 5TJWK 3RDTD 4TULH 1D5BA 1EFXD 4G6JL 3ALXA 3DROB 2AXFA 3CZJA 4PJBA 2IBZX 3L7EB 3BWAB 2R8SL 1A6VH 1FFOA 4G6AD 2AEQL 3BH9A 1G9EA 2X10A 4HCRA 4PRDB 4XC1H 2Q86A 2BDNL 2EDHA 1MCFA 1XGTB 3OR6A 4N1HB 3BAEL 1UVQB 3MV9E 4FQLL 1H3XA 3T0BA 5F7WC 2VLKA 5KG9A 5GHWL 3HUJB 2HT4D 6CGTA 4YDIH 1WBXB 3T0ED 2XWBA 5HVHC 1BEYH 4CADA 5EU6E 1HEZB 1Y0LA 2ADGA 4NN7C 1ZWIB 4UNTA 2AK4A 5KVGH 4PLJD 4ZYKA 1S7XB 2V5TA 3DX7A 4WGWB 3WSQH 3VFWB 1QUNA 4JFFD 4YHMH 2DQJH 5FM5O 4RAUA 2D7QA 5EO9B 1U8QB 1XCQA 2XWTA 3NPSC 4O00A 2V7HA 2ZJSH 4Y4KD 4GRLB 4XHJD 2AEIT 4OFPA 1ZS8A 4J4PA 3E8UH 2EKSB 5J8OA 2R4SL 2QLVB 4DVBA 5I16A 3HZVA 3OJVC 1CBVL 3LRSA 2GI7A 4WHTA 5F1IA 3DX6A 5CJXC 2DLFH 2OJEB 3ZTNL 4WUKH 1DQLH 4I3GA 1A2YA 3MRKB 4TUKL 3HE7D 3ARFC 3JWDH 5C07B 3DBXB 3TVMD 4NUJA 4JY6B 5J57B 4Q9QH 1EFQA 3BI9X 1I7ZB 3CVHL 3I6KA 4ZQKA 4XT1C 4PJ8D 2HRLA 1NMCC 3U4EA 3TF7C 2QR0B 5E9DA 2ESVB 4ZG1A 5KANI 4NQDB 1ND0B 5JXAL 3BZDA 3CDGA 3ARBB 4NCC1 1R0AL 2VDNH 5LXGH 1RZFL 1NAKH 1V8HA 5CFHA 4V1DB 1NCDL 4TTDD 3Q5YA 1FO0A 4GAGH 4NO0B 1MCNA 3CMOH 5F1KC 3DMMC 4BZ1L 2P49B 3Q6FB 5EBLB 3VRIB 2GSGB 5JA9A 3MLXL 3MRBB 3FFCD 3ULUC 2A6IA 5D7IF 4HEME 1HINH 2QL1A 5FB8A 5L7XH 1KYOK 4L8BB 1L0XA 5CEZL 1BLNA 2HTKD 3LB6C 3ZKMD 5GJSH 1T20A