1MAJA

Solution structure of an isolated antibody vl domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 26-10 FV (LIGHT CHAIN)
publication title Solution structure of an isolated antibody VL domain.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1993-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1majA00
5F96H 3WDIA 3BX7C 1HZHL 1A7OH 3HAEH 4KMTH 3GSVB 2DN7A 4XGZA 4NDMA 4R8WL 5BW7A 5ID0B 1OAQL 2ZUTA 1A02N 1XT5A 3ARSA 1H3UA 2RR3A 4Z7VA 2AXFA 2Q76A 2MNUA 2NXYB 5E94A 1PG7W 2HWZL 3RVUC 2IPUK 3LQZB 1J7VR 5JLZA 2ORBL 4L4JA 4P3DB 5I1AB 2XXMB 1AC6A 1NCDH 3O81A 1S7UB 5INDA 1NC2B 1X44A 4XVUC 3AUVA 2I60H 3MLWH 4EDWH 1Q1JH 4HK0A 4HUXB 2YRLA 5FECB 4PGZA 4PV8B 2P44B 5D93C 4X99A 2IPUG 3OBAA 2IG2H 4KZDL 2A6KA 3K81A 5IVXE 3MLSH 2VZ1A 3WLWC 1DQDH 3SDAD 1TNMA 1E6JH 1X5KA 4TTDC 4P57A 5C0CA 4I0CC 5GGVY 2WUCL 1BX2B 3RY6C 4ZUTA 1MFBH 3QJFA 2Z93B 5JNYB 2YS4A 1FVDB 3MOAL 4NZJA 4LFHG 4HEME 3FFDB 4ODTL 5B22A 5IEHA 4J4PA 3MTRA 4DOHB 3D0LA 3ALPA 4OT1L 2VXTH 1DANU 1FFOA 1XF4B 2VNCA 4U2ZA 2AKRA 2APXA 4GW1A 4WHYH 3MLXL 1JRHH 1CXFA 3Q6GH 1MFAL 1ZLUH 1GH7A 2BNQB 1N3NB 4I0PC 1LD9A 5IQ7L 4ODHH 5IFJA 4ZS7H 4DWHA 3FT3A 4Z7OE 3DYMA 2A38A 4CKVX 4YHYB 3NCBB 3EYVA 4HIEB 3R06A 4XNQA 5DR5H 4YEFA 3PE9A 4QYOB 3NCYP 1IGFL 1YUHA 3JV5A 4FQXC 3RGVA 3UTZB 3RUGF 2I26N 4K71B 4NC0B 3ZT7A 1NCWL 4R7NB 3G6AA 1JN6A 1X7QA 4M8QB 1TJIH 5ALBL 4Z77B 3E0GA 1NSNL 2AAVA 3SE4C 4EUPG 4H25B 4R90L 3QFJB 4F7CB 1T0NB 1OSZA 3ARTA 3UBXI 4PP2B 3HNTL 1Q9LA 3FTGA 1BECA 1NAML 4CMMA 5EU3B 1UYWH 3O6ML 4J6RH 4YUEH 1F58H 5BZDB 2OJEB 2DM3A 3O11A 4M6ML 5CINH 2X4NB 1JPST 4V2BA 4XXCC 4XNMB 5DT1L 1JYWA 3OF6D 5ID1A 3QJHA 4FG6D 3EGSA 4R2GB 4XNYL 3QUXD 2P5WA 3QUKB 5SWSA 5JXEC 1ETZB 2BRRL 4LK4A 4KUZH 2BMKB 1Y18A 1UWEH 4NO5B 2PXYA 5BQ7B 4P48A 1RURH 2X70B 2FL5A 3GK8H 3RZCC 2ENSA 4EBQL 2A83B 2ICCA 1ITBB 1HZHH 3MCKA 1C5CL 5E08H 5EUOA 3BIKB 5BS0D 4R8WH 1XF2A 4P2OA 2XPGB 4ETYA 1OAQH 4BQCA 3VXPA 2YD1A 3CFDB 4OZFA 3U48A 4GO6B 5LKNA 1I1AD 1N6UA 3KHOA 5HYFA 3UX9B 2HWZH 5C0RL 1QSFD 5CLTA 5C0JB 4NWTL 1A22B 4OBRA 5F89A 2DIJA 5DMKB 5CP7A 5IFHL 2QV2A 2EZ0C 3VFWB 2PUQT 4JAMA 4LLUA 4DCQB 1RHHA 3QDGD 5DGRA 4A2LA 5IMMB 3BW9B 3QUMB 5JR1L 2YN3A 4LKCA 4MA3A 3SDAA 2VXUL 2W0FA 3WN5B 4KZDH 1QSED 4P4KD 5DK0B 3PF2A 3U46B 1P84J 5JOFA 1JF6A 1NBVH 3V5DB 4HS8L 1SMOA 3VGGA 1LEKA 4U6HA 4OKDA 4LF3B 4EI5C 1R24A 1QFHA 4F7MA 3DROB 3V6BR 3IDNB 2VQ1A 4ZD3L 4MJIE 4CJ0A 3MOAH 3GMOA 3PDDA 4PY8I 4ODTH 4JFFE 1YEFH 1BREA 1A1MA 3BXNA 4KTDL 1EIBA 5SWZE 4OT1H 5E6IB 1F3JA 2WBJA 2LU4A 3NIGE 1NGWB 3V52L 2VISA 2YPVL 5JO5A 3MLXH 2JJSC 1TJGL 5DC0A 1MFAH 4QT5B 2EDBA 5KSBB 1YPZB 5L2KB 4N1HB 2Y5TA 5IQ7H 4OFPA 4N8VG 5GXBB 1YEEL 3STLA 1GIGL 1NUGA 1X5AA 3PL6B 3MRMB 2APVA 1RUPL 4JCLA 2WZPD 4X8XA 2D7PA 1RIVL 4M7KL 5M95B 1FLRL 1NBYA 3C5JA 3S35L 1IGFH 1KGCD 2FX8L 4PJIA 5IEKB 1UZ6E 4I8DA 4X7EC 1TMCB 3HCVA 1NCWH 1MY5A 3ARGD 5IIEA 3DVFA 3D85B 3VFPA 5FUOL 1WT5A 3LKOB 4KY1L 2QADB 1ZT7B 4MQTB 2Q87A 3RL1A 3SQBA 4JHWL 3TN0B 4KKAC 4QXTB 5DJ2B 3L95A 1NUDA 1RFDH 4JFQA 4KKBD 4L3AA 1NSNH 5FYJE 1CIUA 1LE9A 4R90H 3MRGB 5IBLC 1KIRA 3QISA 4BFGA 3HNTH 1NAMH 3WIHL 1FZMB 3O6MH 3OF6A 3KDMA 2WWMD 3VFNA 5J1AB 1D5XA 5DT1H 1GC1L 4N9OB 4UBDD 4HIJA 4XNYH 5CEZD 2VL5B 5I1JL 1I9EA 4TVPD 3VD9A 5DD6A 2HRLA 2P8PB 3HR6A 1M1SA 1CT8B 5E8PB 5J4MA 5FOJA 2BRRH 5F6HI 5C0BA 5HSFA 5HDLA 5L88L 4EJ1C 4AIZB 4MGXA 3P4OA 1OQOA 5EOCL 3DTXA 2XNAA 3DO7A 1W72B 4ZFOA 1FCGA 2DQIL 3LRSA 4PRBA 3HE7D 4Z7NE 2IBZY 4EBQH 4JFED 4KWUA 2WIIA 1AJ7H 4JZNA 4J8RA 2E27L 1C5CH 2BSTB 1NEZB 4D9RE 4G9DA 1VGKA 2CUHA 4IRSB 4HC1A 5JMOC 1CFQB 4P5TC 3N06B 5C0RH 5BRZB 2BSSA 3QDJD 3OTTA 4NWTH 3UJJL 5HXMA 4MNHB 3GMQA 1A2YB 3QDGA 2BXZA 1OTUC 4N68A 1A6UL 5IFHH 3UTSB 1MCFA 1A1NB 5E99L 3EOAA 2GK0B 5B39G 1HDMB 2CDGA 1AD9B 1QSEA 5JR1H 1FVEB 3MO1A 4P4KA 3MFFA 2R2BA 3TA3C 4I48B 1EBPA 2VXUH 1XGRA 3KPMA 1J8HA 2HVKA 3BWAA 3E1F1 3QIUC 2GCYB 5DRXA 3KNBA 1C12A 4HS8H 4GT7A 5DJ8B 1FL3A 4OCSL 5BV7B 3S4SB 4PYGA 5JOEA 4A6YB 2AJ3A 3EDJA 3UROR 4OLEA 4P23A 3G04A 4KZEL 3QEQD 4ZD3H 1ZHNA 3C9NA 1ED3B 1FNAA 1IC5L 2ADGA 4KTDH 1A1OA 4YFLI 1TVDA 4GRLD 4HGWA 1CFSA 5E1HB 5J56B 1FP5A 2YPVH 3ZT6A 1TJGH 5D96C 1UJ3A 3KLAA 1IARB 2MOVA 3P3YA 4FQPA 2AXGA 1OGAB 1YEEH 3RTQB 1L6XA 1GIGH 3WS6C 4CVZA 3MUZ1 3CXDL 1RUPH 4XP4L 3DV4B 3DWTA 1AHWC 4U7MA 1S78C 3CX5J 3GIVB 1RIVH 3QCUL 4M7KH 1FLRH 3S35H 3WE6B 4EQ2A 4Y19D 1ADQL 1KXVC 2FX8H 2EYSB 1PKQE 5IMLB 1MRCL 2VMFA 4LQFL 5DJCA 2FO4A 4J7RA 3ULVC 5FB8A 1P4LB 2EDEA 4CU6A 1ORSA 5EBLB 2A74A 4JHWH 5IW3A 2L7UA 4QO1A 4B50A 5CEZL 3VI4F 2VYRE 5HVFB 3QR2A 4GS7B 2GSIB 3MJ6A 3ZYJA 2BC4A 4CL7A 4Y2DB 4JFHD 4R4ND 1MH5B 5F1IB 3WIHH 4LVOC 1JGLL 2Z92A 3MLUL 2YA2A 1HQRB 3EHBC 4HFWB 3MREB 4ZPTA 1IGJB 1OTTD 5I19L 1EXUA 2MHAB 4IRJD 1SHMA 5FCSH 2L7JA 4M93C 4KRPD 4LSRL 1EEYB 3REVA 3CMGA 2AI0H 1GOFA 3QIWB 5C09A 3EDEA 3ZKXB 3JVGA 5C9JA 5L88H 1SMAA 5HPMA 2EDWA 5D7LE 2YPLD 4PUBL 5BXFB 3IDIA 2AJVL 1BD2A 3QPXL 5EOCH 4JFEA 5DO2D 3MRRB 4FQHA 2DQIH 4X6CA 3PQYD 4OSUL 1X5HA 1HK6A 4ERSH 4JRYD 4BQ9A 3GMLB 3PJSA 5CSZA 1PDKA 3CSPA 3T77B 2E27H 5DJDB 1QACA 3PWPE 1N5AA 4RGND 1VFAA 2R8SL 1KYOK 4OCYL 5CJBA 5KSBF 1YPZF 2I27N 2XN9B 5F93C 3MRLB 4LSSL 2BVQA 3NPSC 2DIAA 3MRFA 5JUEL 4CN1A 4JFDE 3UJJH 3ZHKA 5IG7A 1GGIL 4DKEL 1C7TA 2LVEA 3FRUA 3IAPA 5C08D 1A6UH 5FDWA 1S7WA 5F88A 1MLCA 3H9SB 4ODWA 1U8QA 1AQDA 4L8DA 1HXYA 2F5AL 5E99H 2G60L 3I3EA 4Q2ZA 5EU4A 4RGOL 2VLLA 4DEPB 2P8LA 2HLFD 1KJMB 2NXYC 5EU6D 4M43L 4DGIL 4HUUA 3LHPL 3SE9L 1GL4B 3VFGL 4OCSH 3FFCA 1N6QL 3QEQA 2PO6B 5EORH 5F7MC 1OAYL 1OAKL 3OKNB 4KZEH 2EXYC 5IMKA 1T21A 2BOCA 1UXWB 4JZJB 3TH3T 4LCWA 1WWAX 3EFFA 1IC5H 4YE4L 5IJKA 3RA7L 1BJ1H 2O5YL 1EDQA 1S7SB 4YXLL 2QEJA 3NOIA 1OGTB 3V5HB 3QB7C 3UTPE 3O45A 1ZA3A 2NYYD 3LKQB 3KWWB 1KN4L 3MC0A 1TZIA 4JKLA 4JGJA 4FQQA 4Y19A 3P4LA 2PTTB 3CXDH 2MJWA 4XP4H 3ARZA 3HZMB 2Z8RA 1LP9E 2E7HA 2O5ZL 3PIQA 3UPAA 1ADQH 1LVEA 5EBGA 4LQFH 4X4YA 5DZNA 5JPNA 4P2RB 3L3HA 4EOWH 4BQBA 1A6AA 1GZPA 1KB5B 4F7PB 1OF2B 5CEZH 3UYRL 4PRHE 5GGTL 3KPSE 1D7FA 2X2YA 2ESVE 3CVHB 4DZBA 4YHYC 3B2VL 2JIXA 4MMZC 1T6VN 4POZC 3FJTA 3BEWB 1JGLH 5IROA 3DVIA 3MLUH 3NMEA 4K71C 3LPGA 1A7BA 4WJ5A 3ZE2F 1Z9OA 1WJ3A 3FQWB 2Z35B 4IRJA 2P24A 2QQNL 4NFDA 4XB7A 5FM5O 5I19H 2X4UA 4PJAA 3HE6B 4LDEB 2ZSVB 4GRMB 4RRPG 4GRWE 2OTWB 4LSRH 4X9FA 1XZ0A 2JJTA 4XX1G 4Z7VE 1U8IA 3PQYA 1UXSB 4JRXB 4PUBH 3CGTA 3SBWA 3QPXH 4IHOA 3GUTB 3DBXB 2GAZA 1CVRA 1M7DB 2JJVA 4PJBA 4R2GC 2J8HA 2FJGA 2DLFL 1A9BB 1LQSR 3Q6FB 3VXSB 5TQ0L 2Q3ZA 2IPKB 4JKKA 2ZOLB 1FGVL 2GY7B 3T3PF 1MCLA 5MEPB 4HKJB 4U1MB 1PBYA 3HPJB 3RWDB 3Q5YA 5C08A 5C2BL 3PWUA 1PG7X 5JUEH 3RBGA 3NCFB 3LCYA 3SKOB 4OFDA 1GGIH 2ENYA 3I75B 3QG6B 1TZHB 4DKEH 2AQ3A 3LD8B 2V9RA 1KPRA 3D9AL 1U8KA 4MXQD 2OL3A 5C0CE 3UPCA 4TTGA 4AY0A 5IB4A 3BP6B 5E1AA 2R1XB 5I76B 1QFWI 4XBGA 2F5AH 2HH0L 4WDIB 3RDTB 1OP9A 1FNGA 2G60H 3LKPA 4RGOH 4L3ED 4TUJA 4WTZA 2OX5A 2HT4C 1F4WH 3PWNA 3VGBA 4EI6A 5HPOA 4QRUA 1EV2E 3DUHA 3W0WA 4WW1B 5D7IB 4DGIH 5BVPL 1KEML 4TSAL 3WJJA 1T1ZB 5I1CL 5KVGH 1U8HA 3LHPH 3SE9H 3VFGH 5KS9A 4MA1B 4RAUB 1N6QH 1LO0L 1DQLL 5HYJA 5DD0L 1RI8A 2WINB 1OAYH 3TZVD 1OAKH 4POYA 3WLBA 5D72H 4YDVA 5J7CC 5GRXG 2C1OA 3FZUD 1A4JB 4K7FA 1N59A 1DN2A 4F7EB 3ZYZA 4YE4H 4U1KA 3RA7H 3TIDA 1HILB 1YNKL 2O5YH 4Z76A 5I1DA 1HEZB 5EC2A 3WNOA 4ONOA 4YXLH 4QCIA 2H45A 5EO1B 4M6OL 1MUJB 5DYOA 5JORA 4KFZC 3MCG1 1BQHA 4PD4J 2O93L 3VGFA 3QZWG 4KDVA 4LKXB 1T6WA 2UZXB 1KN4H 3ET9F 4OKVB 4FQJL 3HKFA 5FKPB 3E8UL 5I74B 2HFEB 2ZUQB 1ZS8B 3BI9X 2RHEA 3RVVD 1FG9C 5KSUB 2O5ZH 5E6IC 1WFOA 3T09A 2G75A 1VACA 4X5XB 4U1JA 4F37F 5CMAA 3BP4B 1B6DA 3SJVB 3JWOL 4YXHL 4X83A 4LHQB 4F8TA 3ZHLA 1Z9LA 1K5NB 1RJCA 2DLGA 2HJKB 4G5ZL 4HLZG 2NY6B 3AREC 3PL6C 3UTQA 4F9LA 5EFIB 2ICEA 1DP0A 5EZOL 2FECI 1ES0B 5SWSE 1U3HB 5C7XL 4Z7WA 1FG2A 3FB8A 2NY0B 4NQED 3MUGA 2DI9A 4JFPB 4MAYB 1XCTA 5ENWB 4XTRC 3P40A 3HI1A 1J05B 5KSVB 2DWEA 1CL7L 1UADC 3MNZA 1YMMB 2QADC 5D2NA 3GI8L 4TVSa 3RX5A 3V5KB 1FL5B 2QQNH 3TN0C 5SX4H 3QI9C 5B38B 5FKAA 3V6FB 2OK0L 3V2AR 5D7JB 1BIHA 5KAQG 5EUOE 5IB1A 3D39B 4BELD 1D5ZB 1J12A 3NBNA 1IMHC 2H8PB 5KG9A 4O9HL 2I24N 1GGCL 3OR6A 4HWUA 4WHDA 1FO0B 1AGCB 4GLRI 4ZUVA 2NX5B 3L5HA 2X4RA 2AQ1A 1QR1A 3T3ME 4HIHB 2DKSA 4LOUD 2DLFH 4NO0A 4GXVL 5ISZB 3EOTL 5TQ0H 2VN4A 5JIPA 1FGVH 3PG2A 2OL3H 1K3IA 4L3CA 4ZXBC 5FOBB 3MROA 4XBPA 5I0DA 1BVKA 2V9QA 4PRPB 4I3RL 4PJ9D 5C2BH 4ALAL 2DMBA 5HGDA 5GS0C 4QHKI 1RK0A 4IEFB 3BHBA 4WW2A 3D9AH 1FV1B 3O4LA 2DAVA 5GIRA 3LKRB 3ARFA 5D1XA 4JRWA 1LWRA 4BK5A 2HH0H 3DMMB 4S0TD 1IAIL 3K4AA 4BQ8A 3LV3B 2CQVA 3GBNL 3GSWB 2H1PL 1UKSA 4U1IB 5J3HD 4P2QD 4G9FB 3ROLA 5KVEL 2HJLB 3S3JA 2DM2A 2HFTA 5BVPH 1KEMH 4TSAH 5FV1L 5EIIA 4L9LA 2VO5A 3PABA 3TZVA 5I1CH 4HH9B 1JF1A 5DTFB 1LO0H 1DQLH 4YHKL 4PJEA 4NQSA 5DD0H 4PGCB 2X6MA 1NFDB 2KKQA 1P4BL 3VH8G 3NFPB 2XQYK 4KC3B 3IGAA 1G7HA 5IVZB 1YNKH 2DQJL 4HX1A 3BESR 4XWGL 4PJIE 3ES6A 4M6OH 4MVBD 5SX5K 1U8PB 4W4OA 4JO2L 1H8NA 1JPGA 1XAUA 4Y4FD 1T04A 2Q86B 4CRPA 5DI8B 1S7RB 3B5TA 2IF7A 4JVWA 3W9DB 1J11A 2EC9U 2V9TA 5B3JF 2XTJD 2CKBA 3L3DB 3E8UH 1AR1C 4RMRA 4DVBB 4RSVA 1KIUA 1IM3B 1N7ML 4PJCA 1BAFL 1NH6A 1UJTA 3SDCB 4F9PC 1BWWA 3K46A 2C5DC 2NZ9C 2VN7A 3DOSA 1FDLL 2NY1B 3SDDA 1A47A 4MWFB 4R26L 5LGHH 2JCCF 3WNNA 3JWOH 4CW1A 2IADA 5I1HL 3UPRB 2NW2B 1MWAL 4G5ZH 3RTQC 3X14A 1FCCA 1L9MA 32C2B 4KI5F 5IW6A 1H15B 5EZOH 5DK3A 5C7XH 5C6TL 5EG6C 3B2UC 5F7DB 4HPOL 5C0BE 5J6HA 4IOIA 4LSTL 1IRAY 2WQ8A 3D69B 3QWOB 1CL7H 2E7CA 2R39A 1KTKE 3QNZA 3PGCA 1FFPA 3GI8H 3C5SA 2W9LA 4FFWC 3H3PL 3RWCA 1DVFC 3TVMB 1X9QA 3FO0L 2OK0H 4NQUA 5HYQA 4Z78B 3LSOA 5D7IF 1H5BA 4GS7C 1CD1B 1R5IA 3QH3A 4CVXA 1T03H 3EOBA 2Y25A 4MJ5A 4O9HH 5BZWA 3X11A 3FO9A 3TF7C 3L5IA 2X4PB 1GGCH 3MJ9A 3S9DB 1IBGL 4RIRB 3REWA 1HH6B 1PVHA 2XI9A 3HR5A 3CPLA 3SHSA 3QDGE 4M5YL 2C26A 4MLIA 2ADFL 4XNZB 1ZVHA 4GXVH 1MCWW 3EKCA 3EOTH 1NCNA 1BMGA 4ODUB 5F70A 5DHVH 1QSEE 3QIWC 3MNWA 4NKOA 1H3WM 4LIQL 4HWZB 4HSQA 4I3RH 1I1YB 1RJYA 3V95A 5JDSB 1J8HE 3QUZD 5C8JB 4ALAH 5IR1A 1G7MB 3BGFB 2GSGB 1IQDA 3G9VA 2XFXB 4PLJC 3VI3E 1HKFA 1MVUA 4P2QA 1AGEA 1T5WA 5GJTL 3WL9B 3RVTD 1T2XA 1IAIH 1Z3GL 1ZHLA 4PGEA 2P7TA 3WDHA 1AO7D 3GBNH 5HI3D 2D7TL 2DQCL 2HAZA 1H3TA 5DDHA 3MBEA 3VXRD 5HDQL 3WJLA 5KVEH 2R23B 3WO3B 4M03A 5ESVA 3MLPA 5E56A 1AKJB 3JWDC 3VFSB 4LGPB 1M7IA 3FOLA 3BZEB 4HQQL 4RA3A 4GG6E 2ZCKL 3MV8D 4YHKH 2NY4D 2JB6A 3QHZL 2BOBA 2GKIA 3OKOB 1P4BH 4QXUL 1CLOL 1KGCE 1IM9D 5ADOL 2J2ZA 5ILTL 2AJSL 2E9IA 5E6ZA 4LLVA 2DQJH 5GSRA 3TYFB 4L8SA 5F1NB 4XWGH 1BVLA 4JO2H 5IB5B 1QBML 3HC0B 3L3GA 3E2HB 1UCTA 3L6FA 2PO6C 4EN3C 1H3XA 1I7TA 3VGEA 1ULVA 4OUUB 4E41B 3DV6A 3PWVB 3U6RB 3U36B 3RPKA 4EKXA 1JZ3A 3V4UL 4LFHD 1P1ZA 2CRMA 4JZJC 4QHUA 2HG5B 3AU1B 4IOFD 3L3OA 3ZO0A 1WAAA 1N7MH 1XIWD 3DNKA 1BAFH 2NY2D 2FWOB 4OF7A 1HYSD 1T7YA 1IZKA 5AD0B 4WI4A 1N2RA 4YZFE 1DEDA 1FDLH 3CLEL 5IMOB 1DDHA 2EDJA 2CK2A 2EDRA 1IGTB 4TVPE 4U6XB 4P46C 5DS8B 1I85C 1JZ4A 4DVRL 2R4RL 3O6FC 1BFVL 5I1HH 1MWAH 4G3YH 4X6DA 5J12B 4XCEB 2OMNA 4I18B 3U1SL 4O58L 5C6TH 4F80A 3B3IB 4HPOH 3WIIL 4LSTH 5EN2B 1I9IL 3LEXA 3BKML 1YN6A 1RUQL 4JFEE 4QOKD 2GY5A 4X6CE 5CP3A 1AGDB 3SGKC 3I6LD 2E6QA 3FO0H 1M6OB 1Q9WB 5T1MA 2RCSH 2AJXL 1A7QL 2F5BL 4G80A 4JFYA 1NEUA 2N7BA 4HS6A 2ARWA 1GGUA 3K8MA 4W6XB 5I8EA 2HVJB 1D5MB 2XXCB 3QDJE 1A7PL 1IBGH 6CGTA 3P9MB 5M94B 3OAYH 1DEEB 1NLDL 3O2DA 3V4PL 3DETD 4JM4L 4P4RA 4M7LL 3ELAT 2IMMA 3IFOA 1I8KA 5GGSY 3WFHB 1ZT4B 5DJYB 1V7NL 2ADFH 3NFNB 2EYRB 4JQVC 4ETQA 5D1ZB 3GJFA 1HKLL 5GPRA 1QEWA 4DKAA 4MDIB 4PG2C 4JPVL 3G6JA 3E3QE 4U0RB 3QUZA 4K8RD 1ZT1A 4D0CA 4NKIH 2XYCA 3NZ8B 2VITA 3RIFK 5IB3A 4HWBL 4LIQH 3BJ91 2X1OA 2I9TB 4P9HL 3QYCA 2EEBA 1EHLH 1K2DB 2HA1A 2LV4A 3BDXA 5DEZA 1NUNB 2PR4L 3FFCE 3QEQE 1IEAB 3ZHDA 3VWKD 1AO7A 1HI6A 1C5DB 1ZVSA 5GJTH 1AXSA 1FFNB 1WWWX 4HMCA 5GRVK 3VXRA 5DFWH 1ZGLA 5KBNC 1Z3GH 4WU7B 2IWGA 1FAKT 3I6KB 3VXNA 1CICD 5BV7L 2D7TH 2DQCH 4PJ8B 4LCWE 5EZLB 4A6YL 4M1CC 2EE9A 3ARDA 5HDQH 4KVNL 1KT2B 1RY7B 1LO5A 4GW5A 2D2OA 4HQQH 4JFXB 3CK0L 4AH2B 3LD8C 3RVUD 2ZCKH 4UINH 3IF1B 2BERA 4NHCL 1MAJA 2YD9A 2ATKB 1MCCA 1KFAL 2R0LL 4Y1AD 3RDTC 1CLOH 4X7CC 1T89C 4V2CB 4Q6IC 4XVUD 4Y19E 3TO4C 2MCG1 3HG1D 3L9RA 2AJSH 3QAZC 5ILTH 2QL1A 5HHOD 5T1KA 3MNVB 5LGKA 1JV5A 2IALB 4GSDL 5A2IH 2YPKA 5K59F 2Y7QB 2IGFL 4HUVA 5TE7L 2YC1B 4XPHL 4ZFZA 1TENA 1QBMH 2V2WB 2FEEI 4OGYH 1XF5A 4NPYB 1LE5A 3WLWD 2F54A 4J12A 4TTDD 5F3HB 3KPNB 3CCHA 3V4UH 3OL2A 1XIWA 4JFHE 5JA9A 3P9LB 3GSUA 5I8KL 3F7QA 1D9KB 1LEGB 3G6DH 5D5MF 4PLNC 3IB4A 2Z4QB 5E03A 1J18A 2GJ6D 3LIZL 4NBYB 1OP3H 1C5BL 5EOQL 4B7IA 5FYLD 3ULSA 3RNQB 1PQZA 43C9A 3HB3C 4PJ5B 2R4RH 5EA0L 3U0PA 1BFVH 1TXKA 4HCRL 1OAUL 3P77B 4I0PD 5I74C 2P8MB 4L4VD 5T3ZE 2ICWJ 2YPLE 2CMRL 2ZUQC 3WNPA 1NGZA 4RDQG 4O58H 4MCYA 2ZOKB 3WIIH 3PNWA 4QOKA 3RNKB 1F6FB 2G5BB 1OHQA 3PQYE 2CIKA 3BP7B 1I9IH 3CXHK 4HK3J 3BKMH 1RUQH 4FQXD 4U4BA 4BZ2L 2VDOL 2LTQB 2YUZA 3GSNA 1ZKAA 2IPTL 4PJBE 3G5YA 3BO8B 4RGNE 2A2QT 4XMLL 3W39B 5F97E 4JLRB 5T5NG 2NY6C 2CSPA 4YHML 4UIMB 1G7IA 2AJXH 1A7QH 3VRLE 1UEMA 1U3HC 3WUWG 4Z9KB 2NY0C 1VCAA 1GPOL 1VERA 1A7PH 2ICWA 4XZUA 3ULUF 4MAYC 4YHPA 2MSPA 5AUMB 3D48R 5A2FA 4YR6B 5I16A 1NLDH 5C08E 3OGOE 5IKCB 3V4PH 2F9BT 1GOHA 4JM4H 4M7LH 1EAJA 1SJVA 3RVWC 3X12A 4K3HA 2F58L 2A6IB 1F4AA 1HKLH 3JTSA 1BZQK 5D7JC 1VFBB 1M71A 3UMTA 4RGMC 1UACL 2YR3A 2Y72A 2QSVA 4HWBH 2PTUA 5D9SA 5TFSL 5JXED 4GBXC 1EX0A 3QDMD 4P9HH 3O2WL 2Z8VC 2YOCA 3MUJA 3ZKSD 3VWKA 1B4JL 4X6BB 5KS9E 1MNUL 2PR4H 1CD8A 4PBXA 4JFZL 3RZCD 2COQA 3DGGB 5CILL 1G0DA 2AJUL 2W9EL 3WYRA 2CD0A 1NFIA 5F7FA 4BH7A 4K7PL 4OGZA 5K9JL 3O9WB 4KVNH 1S7QB 1ZMYA 5ERWB 4KUCF 4QRPB 4RFOL 3FONB 2R2CA 3CK0H 1AGFA 2C3HA 2WMPA 4R97B 4NHCH 4LGSB 3QXAA 4F3FB 1OAXL 5C0IA 3BE1L 4MS8C 3T4AA 1KFAH 2R0LH 5K33A 5HHOA 1MLBA 2EZ0D 3QEUB 4JJHA 3Q1SL 3MMEB 1BFTA 2NNAB 2DMCA 3SGEH 4GSDH 5GRUL 5LAXB 4A2MA 3LRGA 2IGFH 4MB4A 4XPHH 3EDFA 1HHGA 2ADIB 1T1WA 1U8LB 1RZ8B 2X44D 3RGVC 4WI8A 2BY3A 1OLZA 2E9JA 2M1KA 3FL7A 3V9FA 4FXKB 2YK1L 4OQ1A 2VQUA 4OZGF 4YDJA 3EJYC 4EQ3A 4KDTC 3TBVA 1BZ7A 1IGYB 1RZGB 4S2SB 4RFNB 4EI5D 4TOYL 5DZOA 5I8KH 4EZMA 4MNGB 4Y8DC 5F72S 4Z7WE 5LCVL 5GGRB 5CBAB 3JV0A 1N5YL 1HSBA 5K9KA 3LIZH 2VLRB 1C5BH 5EOQH 2VTFA 3AS0A 4RWHA 5SWZB 4C55A 1QRKA 4Q9BA 4ZAKB 4MJ2A 5D2NE 4I0PA 1C7SA 3V6ZB 1HHJA 2D4DA 5CIPA 5EA0H 4HCRH 1OAUH 1A4KB 4OLUL 3HZVB 2AV1B 4EUPH 4L4TB 3CDGB 1T7VA 3C09C 1FRGL 5MEOB 2VWEE 1EHXA 1EJ6A 3J7HA 1IEBB 4GUPA 4FQXA 3SDCC 3JZ7A 5DA0B 3RJQB 1B0GA 5ICXB 1QVOB 3MV7B 3BUYB 5I1KL 1JMXA 3QNXB 1QA9B 5F21B 2NY1C 8FABA 2UV3A 4BZ2H 1YN7A 2QQLL 1NDMB 2Q1EA 1B3JA 3KYNA 4HS3A 2IPTH 3BH8A 4JHBA 1MCIA 4LPCA 3G9AB 4XMLH 1X4YA 5DUBB 1OL0A 3BIBX 4OCLC 5ELIA 1Q0YL 1ONQB 2VRAA 1AIFB 3G5ZB 3TBTA 2GJZA 3HRZB 3U7WL 1JHLH 3P0VL 4G43B 3G5XB 5IBLD 1GPOH 4K8RH 3C6LB 1A64A 1BJMA 2EXWD 5C86A 4FXGB 5LG1A 5F7HA 1FZJA 1NBQA 3S7GA 4UT6L 4I9WD 4XP6L 3U2SB 3SY0B 4NM4L 3TVMC 2F58H 3O4LE 3K4DA 1TVBA 4L3EE 4OFIA 1J8KA 2Q6WB 3B9VA 5E5MA 4F15B 4M7LT 4QGYA 2VLJD 5JXEA 1UACH 1DQQB 2AEIT 4NQXA 3U7AA 2J8UE 3KXFD 2DJSA 2E7MA 5IVXF 3IDJA 2B4CL 2MKLC 5TFSH 1KCVL 1MJUL 2PCPA 3O2WH 2QR0A 3N1GC 1YDPA 1FC1A 2LVCA 1B4JH 3RZCA 2AV7B 1G6RL 4AEFA 4KMLB 4G7YH 1MNUH 5DRWA 1SJHA 1CLCA 2DL2A 2X1PA 3QCTL 3CFEB 4YO0A 1M05A 4H26A 3KPPA 4PJEE 1BBJA 4JFZH 4S10A 1A6WL 2EDXA 4XC3L 4XNZC 1HYRC 2YD8A 4MD0A 1EA9C 3QBTB 5CILH 4PTTB 3RAJL 2ZUYA 1AQKL 4K3JL 2AJUH 2W9EH 3TT3L 1FYTB 4FFYL 1XF3B 5FGCE 4K7PH 5K9JH 5CAYB 3I02A 3UTOA 3QFDA 4RFOH 5ADPL 1MCNA 4PRDA 3VFRB 5IK3A 3RRQA 4N0RA 5HTSA 2BVYA 3WHE1 3DXAD 2IAND 4Z7OF 1RJZB 4C4KT 2YRPA 1OAXH 4ORGA 3BE1H 1OTUD 2CXKA 2VQTA 3WHXB 1G7JB 2Y07L 3Q1SH 3FT2A 2GT9A 1NGPL 3E6HA 4PJCE 2EKSA 4N0FB 4JVUA 3TA3D 1RK1A 2GHWB 4P5MA 1S9KC 4MD4B 3FB5B 3K4ZA 1FIGL 2CRIA 3CFJA 4XCNB 4CADA 2X5PA 2YK1H 4ONGL 4EI5A 3VW3H 2LE9A 3LRHA 3UO1L 5DUPH 1WZMA 1G7QA 3ME0A 5DJZB 2VUYA 2HJFA 1XGYL 3QXWA 4TOYH 1QRND 4G6MH 4Q9RL 5FGSA 1UB5A 2XKNB 5LCVH 1N5YH 4F2MB 5KW9H 2VC2L 3IAGC 2BVOB 3KVQA 3S5LB 4K9EL 2WK2A 2OSLA 4AG4L 2VZ3A 1GRWA 5ETUB 3MRNB 3S6CA 3E2HC 1YJDL 3BGMA 1L7IL 3GI9L 5FA4A 3MA7B 4M62L 2V5SA 1R5WA 4OB5L 4NRXB 2EDYA 2PYEB 3ZKNC 3GMNA 2D0GA 3R0MA 4OLUH 2OTUB 1EH9A 1AGBA 3K8LA 1I8IA 4PV9A 3MV9B 3RWGB 5AZ2H 5ICZA 3CU1A 4LLYA 5I1KH 4E9LA 1PKQB 7FABL 3ZE0E 4MQXC 2BDNL 1TJHL 3ULVD 1AR2A 1B90A 3SCMB 3QUYB 2DD8L 3KLHC 2ITCA 4BSWA 1Q0YH 3JWNC 4HKBA 2CIIA 3ESVF 4WO4B 4YC2B 1OPGL 3U7WH 4B0MM 4L8CA 1CWVA 3OMZA 5C0DA 3LN4B 2H26A 2JF1A 5JZ7C 3P4MB 4UTAH 4UT6H 4XP6H 4NM4H 4XP1L 1CS6A 3EHBD 4OZFG 4BQ6A 2Z9TA 1FPTL 1QKZL 5JHDD 4FFVC 4P2QE 1P7QD 4IIQB 5CHNB 1UH2A 4L8BA 2B4CH 3VG9B 1EHNA 1F8TL 1CE6A 5DQJA 5DMIL 1KCVH 1MJUH 4LMQI 4DTGH 1NGYB 4QY8B 3OJMB 2VSCA 4Z7UA 3H7LA 5GSVB 1G6RH 3TP4A 5C0EA 4HJ0C 1T22A 3HAEB 5DUML 1V8HA 1YEIL 4E42A 4QEGA 4XC3H 1A6WH 5D1ZC 5HDOA 3RAJH 1MCKA 1AQKH 3TT3H 2AERT 3BKCH 4FFYH 4U0RC 2AK4B 2H9GB 4P23C 5B8CB 3R8QA 5GGUA 2HFFB 5DGQA 4P5TA 5FO9B 3DXAA 1P84K 1Z0MA 5M7QA 5ADPH 1MHEB 1B9ZA 4F58H 2AQ2A 3W5NA 2YMXL 1ORQB 1CU4L 5I30L 2XZZA 3HPLA 1UQSA 2XTJE 4TUKH 1EFXB 1ZLWK 3SO3B 3RWEB 1SEQL 1TCRA 1MSPA 3UTTD 4XH2B 5EBMB 2Y07H 3ILPB 4PJ8C 2BCKA 4H1LA 1UZ6F 1ZA6B 2IBGA 2EDTA 4MSWA 4PG9B 3QIUA 3DI2B 2A6DB 4ZUWB 3VWJB 4NHUA 1KJ3L 5FO8A 5GGSA 4UQ2B 4JM2B 5MEND 1MAKA 2NXYD 3GSXA 4Z0XA 5DJ0B 3KG5A 1F3DH 3ZSTA 3H9YA 5SWQA 3P11L 4M8VA 4ONGH 1O7VA 1QRNA 3UO1H 4CMHB 4MX7B 2C1PB 3C8KB 1S7TA 1FNFA 3T65B 2VLKB 1CR9L 1NC2D 1XGYH 4GAYB 4X6DE 1XGTB 1WBZB 4YBLB 5IHZB 3LKSB 4XPTL 2EXYD 4Q9RH 3U9UB 3VRIA 3FQNB 5EC1A 4X7DC 3OX8A 3STZA 5HGAA 1DLHA 4YHIA 4AG4H 4MHHI 3EO0B 3BWUC 4M7ZC 4RFEB 1QFWM 5ACZA 1YJDH 1L7IH 4J3UA 2I07A 5C71A 2FEDC 3GI9H 1EHAA 4FQCL 1JZ5A 5H37G 4M62H 4BKLB 3B9DA 4OB5H 3RWIB 5TF0A 3KPLA 2A6JA 1AHWA 2AEQL 1HHHA 5JTWA 2BNUA 1I3GL 4ZSOB 1IE5A 2C7UB 3VD4A 3F65A 4WFGD 3ARUA 4Z7NF 2F19L 1W0VB 3DX8A 2K1MA 2IQAA 7FABH 4U1NA 4LBEB 1T66C 1UCBL 5HD8C 1FZKA 1TJHH 1IAOA 3ZDZF 1F6AB 3OJVC 3VFVB 4P5KB 4F7TB 2EEAA 5T1LB 2BNQD 3P30L 2EDLA 2R9HC 1OPGH 2V2XA 3BAEL 1X5GA 4UQ3B 1JNHA 4HUNB 1YEDB 2GFBB 3ILQC 2DQHH 3T8XA 4LDOB 1R5VA 1VPOL 3B6SB 4N0CC 4POZD 5EO9A 5A3IC 4G8GD 3DX6B 5TGBA 4PTUB 1F90L 4AMKH 3MJ7A 1BZ9A 4RNRB 2FJFA 2VB5A 3MZGB 3L3KA 1MCOL 3DYPA 1P7QA 4HKZA 4XP1H 3PGFL 1U6AL 1U3JA 3D2UB 1I75A 1VFMA 1AO7E 5AWNL 1FPTH 1QKZH 4LEXL 4DGYL 1C16A 5F71A 3VXRE 5BJTA 3F7YA 1V5JA 5GS1B 4PJGA 1YEGL 3QFJD 1HCFX 2RGSA 1F8TH 1I4FA 1JE6A 1F00I 3OHXB 5DMIH 3WKNA 3IDGA 2F53B 4Q6YA 2B2XH 4J3SA 3IU3A 4U0QB 25C8L 5DUMH 1YEIH 1PFCA 2WWKT 2J4WL 3C60B 3GKZA 3SKMB 3TBYB 5HGHB 4XCYA 4S1RL 3EYQD 3K80A 1TLKA 3UBXA 1JNJA 4R2GD 5KN5A 1MFCL 4WGWB 4N1CA 4OJFL 5A2KH 2OR9L 3UJIL 3BFOA 4PB0L 1P6AB 2P1YA 4HGMA 1HHIA 3RKPA 1V3MA 2YXMA 5F9WB 1FE8L 1YMHB 1LK2A 2YMXH 4M4PA 1YY8B 4X6EA 1CU4H 5I30H 5FGBC 3AXLB 4FXLA 1G9ML 3TNMA 3UTTA 3BPOB 3O6KL 2F54E 3BMVA 3D18B 1SEQH 3GSVA 3FB6B 5MERB 5F9DC 5ID0A 3VD7A 2V5YA 4FA8A 4CJ1A 4WHTB 4GXUM 3UXFA 3O9WC 1A3LL 4HDIB 4PJXB 1EZVX 3TLRA 2IAMD 3LQZA 2HT4D 1J0JA 1OW0A 1VADB 4RDQF 2QQKL 4NKDB 1JZ8A 5I1AA 1JPTL 3TC9A 1S7UA 1CZ8L 1MHPL 3P11H 4X5WB 1NC2A 3FOMB 3F7RA 1P7KB 1CR9H 1ROWA 5FECA 4PV8A 5KJRH 1BJ8A 1LD9B 3RI5K 4XPTH 1XMWA 5I1IL 2R1WB 1HINL 5DD5L 4QOKE 4B5EA 2XQBL 1V3LA 4S1QL 4J3VA 1GGYA 5IROC 1BX2A 4HIXL 3T2NL 4FQCH 2RFXB 2VZOA 2Z93A 3CFKB 2X42A 5JNYA 1FVDA 3JV4B 5L8KB 4RFNC 5DJXB 3FFDA 5F9OL 4QHLB 2AXHA 1HN1A 2FYYB 4KK5C 4QRRB 4M3JA 4HZAA 1I3GH 1XF4A 2F19H 1BPVA 4CVWA 2IMNA 1K9TA 1A6ZB 1UCBH 4ZAKC 2BNQA 1N3NA 3SBWC 4ZUSB 1HCVA 3C2AL 1HQ4B 2G9HB 3FO2B 5L2KD 3P30H 4MZ3A 1ZHBB 1IKNC 1NAMB 2NTFB 4HIEA 1SQ2N 5A40E 5DK2B 3BAEH 4QYOA 5IJVB 3ARED 1KJVA 3NTCL 3PL6D 1TNNA 3UTZA 1VPOH 4NC1E 4NKQB 4R7NA 4LVNB 4WUKL 3QULA 2YUWA 3RWHB 3KPQB 4ZUUB 4M8QA 3G08B 4XTRD 1FJ1B 1CLZL 1MCOH 4LLWB 4PLKC 1WZ1L 4Z77A 3PGFH 1U6AH 5BOPA 4H25A 5AWNH 3QDHA 4KU1A 4LEXH 3QFJA 3TN0D 4DGYH 4F7CA 1T0NA 3QI9D 4Y8AA 4PP2A 2EKJA 3E6FB 2J6EL 3L7EB 2LQRA 3EJZC 4K55A 5EU3A 1YEGH 3MRCB 4R4FL 5FO7B 5BZDA 4U33A 2OJEA 3C6LC 4YDLB 2X4NA 1CDUA 4XNMA 4CN4A 4PFEA 2CUMA 4PJ7B 2VDKL 1E28B 4X4MA 25C8H 4BSVB 3WJJC 2J4WH 3MRQB 4S1RH 4F15C 3QUKA 2Y6SC 1RMFL 3CDFA 1MFCH 1ETZA 5EDXA 3H0TB 5HHOE 4OJFH 2BMKA 3D3VD 2DKUA 2OR9H 4NO5A 1NGXB 3UJIH 4LVEA 1P2CB 3KYMB 3OXRB 4PB0H 3T1WA 5BQ7A 1EGJA 4ZXBD 3VFTB 4MXVE 2X70A 3MLTB 5D2LB 1KXTB 1FE8H 3DVNB 1RU9L 1ZVYA 1WBXB 4H20L 2NCMA 2A83A 1G9MH 5J06A 1REIA 3U82B 1LP9F 3LMJL 3BIKA 3CFCL 5FYJU 5TDPB 2XPGA 1E4KA 5GS3A 2V5MA 1VEPA 3CFDA 4JDZB 1A3LH 5FYLE 5IQ9B 2QQKH 4KHTL 5C0JA 3JSSA 4YAQB 1CZ8H 1MHPH 4GKSB 5DMKA 5C9KA 4Y88A 5BRZD 3VFWA 4UOW1 3WO4B 4N5EC 4AT6B 4DCQA 1A8JH 2P42B 5IMMA 1F4XH 1FORL 4KKCC 3BW9A 1IFHL 4LU5L 3QUMA 4U1GB 3UTSD 2QQQA 3VXQB 1S7XB 5C07B 5LJYH 5I1IH 3WN5A 1HINH 3DYOA 5DK0A 3U46A 3V5DA 3V6OA 2XQBH 1NCCL 3WHE0 4S1QH 1W8NA 3ZE1E 4LF3A 3T2NH 4EXKA 4GRWF 3DROA 4F8QA 4RAHA 1NGQL 3IDNA 3WXWL 4OI8A 4LPWA 4PYHA 3O3UN 5F9OH 4HLZH 3S37L 5D6CB 1KELL 4Z7VF 2YBRB 3IKCB 1GOGA 1LE9B 5E6IA 4B41A 4AEHL 4L29B 5FYKD 2FX7L 4OF6A 2A1WL 1NGWA 2FLBT 5ITBL 1XF1A 1CIDA 4QT5A 5KSBA 1MQ8A 1YPZA 3ROOB 5L2KA 3WIFB 2NZ9D 1R6VA 2Y1VA 3C2AH 3QUXB 3CLFL 3PL6A 3TGXA 3MRMA 2C3VB 3X13B 2KZWA 1OGAD 4XPFL 2Y9RT 2D7OA 1ZK9A 3NABL 2F74B 3SDYL 5IEKA 1Z5LB 3NPZB 3QG7L 2X1QA 1MCSA 3B2UD 4WUKH 3D85A 3L5WB 1JIBA 3KS0H 4N8CL 3LKOA 1ZT7A 3TN0A 4QXTA 3QI9A 1CLZH 5DJ2A 3SCMC 1WZ1H 1MI5D 5KTEL 1NBZB 4FFWD 5BS0B 1DVFD 1BBDL 4WO4C 1X5LA 1YEKL 2J6EH 4EDXB 2G2RB 5CBEB 1FZMA 4TNWK 4R4FH 2X4OB 1I1AB 3W5MA 3ARFC 2HFGL 1DLFL 3B5GA 5J1AA 3VXMB 1QSFB 2VKXA 1OY3B 1X4ZA 1WF5A 1U58B 2B7DT 3MLZL 3QHTC 3BDBA 2VDKH 4CBPA 1CFTB 3HFMH 3I6GB 4JR9L 4NCDA 1U8JB 3GSRB 2VL5A 3N85H 4WTZG 3VFOB 3KYOB 1FYHB 1KTLB 4NFCA 5H94A 3JUYA 1JI1A 3AAZB 2P8PA 1RMFH 1CT8A 5E8PA 4BH8B 4H0HB 1I7UB 3AFLA 4IIQC 4XVTL 2AK1L 2VAJA 1YNTB 4WIQA 3MLRL 3TIEB 1V05A 3VG9C 4U1SB 1T20B 4AIZA 3QIWD 3HUJB 2DOCA 2R2BB 1QPPA 3BQUB 1W72A 4OF3A 4QHNB 3IRPX 1RU9H 3KPMB 4JB9H 2HN7B 4FTVB 4MD5B 2BSTA 1NEZA 3LMJH 5FFLA 3CFCH 3WFBL 2VOTA 5EU5B 4M9PA 4P0DA 5B8CC 1MVFA 2W60B 5KOMC 4IRSA 1BQHG 1ZHNB 3FHAA 3C9NB 4NUGL 1S9XB 1CFQA 2WLZA 5IM7B 5BRZA 4YQXL 1SJXA 5HI4D 4KHTH 3VXUB 3CC5B 4MNHA 4MYWB 5F8RC 1A2YA 4HG4K 3UTSA 3BP5B 2ICWI 3JV6B 2AS5M 1A1NA 4LHUB 3SO3C 4GG6B 2ZP0T 4GQ9H 1UJ3B 1I8LC 2GK0A 1FORH 1HDMA 4TUOB 1IFHH 1AD9A 1FVEA 3NGBC 3DUSB 2OS7A 4ELMB 2V7HB 3O3BB 3QXTA 4JJ5B 4ODVL 5SX5H 1IAMA 2GCYA 1YEHL 3VWJC 4LVHB 5FYKL 2ZCHL 3ARGB 4JM2C 2DQDL 5CJOL 4KTYA 3S4SA 2LFGA 4A6YA 2FB4L 4U3XA 2F8VA 1DUZB 5HYSB 1IEHA 5EUOF 1NGQH 1XGUB 4RMUA 1QFUL 1OD9A 3WXWH 5EU7C 2PO6D 3QQ4B 1DBAL 4EN3D 1PY4A 3S37H 1ED3A 4Z0BH 1KELH 1ZLVK 4FOMA 4EVNB 4YBLC 4PJ7F 2WANA 1QLEL 4JFOB 2F8XC 1Q72L 4RQQB 4AEHH 2LU3A 2IH3B 4DN3L 2Q8BL 2FX7H 4KKNA 2A1WH 4I9WE 5ITBH 4I3SL 1TQBB 5DFTA 1TTGA 4YPGB 5HHMB 3I3DA 4LAQL 5A43C 4JN1L 1OGAA 1U92B 2VLJE 4TULH 3QO1B 3FQUA 5TH2B 5ACLA 3RTQA 3CLFH 3TPKA 4P46D 1MIEL 3DV4A 3O6FD 4Q74A 4D0DB 1CG9B 4UDUB 3GIVA 1PGRB 5JA8B 3NABH 3SDYH 2EYSA 5IMLA 5D71L 3QG7H 1UVQB 1P4LA 2BRQA 4N8CH 3QXUA 4Z7UE 3MSPA 4GMSL 1FH5H 4MHHG 5EBLA 3HE7B 2ATPB 2R0WL 2DICA 3MRKB 2I9LB 4P2RD 5KTEH 3L3JA 3ZLQC 1WQVT 4YNYB 1BBDH 1WIPA 2GSIA 1YEKH 1YC8A 4Y2DA 1TQCB 2DDQL 1MH5A 5F1IA 4JEGB 4BZ1L 1N5AB 5KVDL 3AS1A 2HFGH 3VXOB 1DLFH 4JO1L 3MLZH 1HQRA 3DXAE 2DB8A 3QDJB 4OD2B 4BA8A 1WIOA 2ERJB 1KV3A 3MREA 1L0QA 3MBEC 3OWEA 3WJLC 1IGJA 4ZFFB 2GTWB 4JR9H 2MHAA 2WAHA 3IETB 2GITA 5CGYC 1S7WB 3FAXA 4Y0GA 1EEYA 3QIWA 4XVTH 2JK5B 2DBJA 4KK6C 2AK1H 2VXQL 2DLTA 3QRGL 4N0UB 1AQDB 4PJIF 1RZKL 3QXVA 3MLRH 5EUKB 4O5LL 4G8IB 5BXFA 2PN5A 5F7YC 2QBWA 2M2DA 1MCBA 2GTZB 2VLLB 3MRRA 3PWPD 1W0WB 3VGAB 1YY9C 3GMLA 3FB7B 4L8SC 5C2UB 4RX4D 4XNUL 5GRVL 3HRPA 3EO9L 1QRNE 3QNYB 5DJDA 3C60C 3T77A 4WWID 3O3EB 1UWXH 2A73B 4JFDD 3WCYA 4PJHB 1QBLL 4J3WA 5HJ3B 2XN9A 4GRLB 1N8ZB 3MRLA 3I84A 4NUGH 1EERB 4M1CD 5T33L 4YQXH 5MI0B 2ITDB 3N1PC 5DLML 5F9WC 2UZIL 4GMTL 1WZKA 2KPNA 3BPOC 3H9SA 3CFBB 4MB3A 3QXDB 3PXJA 3O45B 2NW3B 2BHZA 1TIUA 5ALCL 2DM4A 2XIDA 5IHLB 4NNXB 4BFBD 3RHWF 2V7NB 3RDTD 1KJMA 4ODVH 1IQWL 2AABL 3TO4D 3FQTB 3MGAA 3W2DL 1YEHH 5FYKH 3ULVE 2DQDH 4XP5L 5CJOH 4JY4B 2PO6A 3VMNA 2FB4H 3MX0A 4YHNB 3OKNA 1IAKB 1QFUH 3O41B 4HMDA 4JREB 4X7TB 3T0EB 2UWEB 1UXWA 4JZJA 3JBG7 3RWFB 3WKML 1QLEH 1JVKA 1Q72H 3FCTB 4NO2B 4QXGL 1S7SA 4PGJA 1OGTA 2WIMA 2Q8BH 3V5HA 3ORJA 5HI5C 1E6OH 1JPSL 3EUUA 4FQLL 4I3SH 5DRNB 1FNEB 5IB2B 1JZ2A 3BEVA 4WHYG 3LKQA 5JHDE 4LAQH 4Y5XB 3KWWA 4NN5B 4JN1H 1FSKB 5K9QI 2R56L 4R96B 4IRJB 4WRLA 1MIEH 4XX1E 2PTTA 3FMGL 3HB3D 4AQOA 3HZMA 3GSQB 4G6AC 4CUCA 5E8OB 4PJGE 5F7EL 5D71H 5C0ND 2YPLB 3L1OH 4UIKL 4PRHD 3KPSD 4P2RA 3VI3F 4MAUL 4GMSH 2EH8L 4JRYB 3SGKA 1KG0B 1KB5A 1EPFA 4F7PA 1OF2A 2H2PD 4G8EA 3CAFA 3CVHA 4RGNB 4LPVA 3BZFB 3RUGB 4NOFA 5I1LB 2MWCA 4BZ1H 2DDQH 2NY6D 5E9DB 1GXEA 5IGXL 1WTGT 3BEWA 4QRQB 4IRZL 3ZDXE 5KVDH 3IRZA 4JPIB 4YGVB 2FECL 4C58B 4JO1H 4GG6F 1RZJL 2NY0D 4LVNC 3FQWA 5D1QB 3IVKB 2Z35A 1PLGL 3ARDC 4MAYD 1TCMA 4LCUB 3WFEL 4ELMF 1MREL 3HE6A 2ZSVA 5FF6B 3UTTE 4GRMA 4PRIB 2R1YB 5IBUB 2AVGA 5DJAB 4X7SH 5JIIA 4PG2A 2OTWA 2OL3B 1CDGA 3D6GA 3H3BC 4PRAB 3QRGH 5D7JD 1RZKH 1R3HB 4DUWA 4O5LH 5E5UB 3IJHB 1UXSA 4JRXA 5EU6B 1I7ZB 1MQKL 2WW8A 5MENE 4OQTA 4UMGA 4YDLC 4X6FB 5FUCC 4ZS6C 3GUTA 3DBXA 4EI6B 1M7DA 4GBXD 1F11B 3CSYB 2M26A 4OBSA 3T1FB 5BMFL 3IDXL 4XNUH 1A9BA 3Q6FA 3VXSA 4KHXL 2IPKA 2ZOLA 4D0BB 5ISZD 1MFBL 5MEPA 4OV5B 2FDBP 5LXGL 1QBLH 4HKJA 4U1MA 4YZFF 3RWDA 5DMGC 3TBSB 3EYUL 5A2LH 1DN0A 5T33H 4AENB 3SKOA 3WNKA 3I75A 4GMTH 4Z76B 3QG6A 4I1NB 1TZHA 4H0IA 4QRSB 1K4CB 4QCIB 3PGDB 3W81A 4Z8FH 1KJ2L 4MNQB 3BP6A 5DVKA 5CKAA 4J2XA 5MEQB 2R1XA 3M1BB 5CEYB 5B3NA 5I76A 1OSPL 2W59A 1D5IH 4Y2OA 4WDIA 4MQ7B 3RDTA 4PR5B 5ALCH 4DN4L 3HS0B 1T89A 4Q6IA 2HTKC 4MS8D 1UWGL 3T04D 4DOHE 2R2EB 4WFGE 1QFWH 1EJOL 1IQWH 1JF5A 2AABH 4WW1A 3H9ZA 1T1ZA 4X6CF 5DR5L 2P5EB 2VZSA 4HUMB 5AG8A 4XP5H 1U8OB 4I5BB 4RAUA 4ODXB 1JGDB 4LLMB 3GMPA 2WINA 2BP3A 4QRTB 2BNQE 4NQDB 4LCIL 3WO4C 3RGVD 5L6YL 4G8FB 1A4JA 1F3DJ 4I77L 5DC4B 5TJWK 4U1GC 3EJYD 4F7EA 3WKMH 4TNVF 1NC4B 3PV6B 4L5FL 1HILA 4OF8A 4QXGH 1GHFL 1HEZA 3B5HA 5EO1A 1MUJA 4XCFL 4E0RB 1JPSH 4NCC2 5IBTL 4FQLH 4UOW0 1UA6L 1F58L 1E27B 2VLMD 4LKXA 3GJFK 4D9QD 1ZHKB 4OKVA 3IDUA 3MNZB 2R56H 1ZAGA 5FKPA 1GYAA 3K8KA 3EOYG 1EUUA 3BT2H 1YEJL 3FMGH 3QFJE 5L9DL 2FRGP 2HFEA 4KAQH 1ZS8A 1J1PH 5KSUA 4LHJB 5F7EH 2AGJL 2HKHL 4LSUL 2P5WD 4X5XA 1URLA 4UIKH 3BP4A 3SDCD 4N1EA 1KLGB 3LS4L 2VR9A 1T83C 4AYFA 2EH8H 5I71B 4PJHF 4X4ME 1K5NA 2NY1D 3BOVA 3WD5L 1NMCC 1VSCA 1ZOXA 3IFLL 3QUXC 2HJKA 3DLQR 3BZ4B 1T80A 4XHJD 5LBSL 4NQTA 3NCEB 5EFIA 1ES0A 1NMAL 2X4TB 1U3HA 5IGXH 1JNLL 5E08L 4IRZH 1U93B 1U41A 4MAYA 3C6SB 1GC1C 1F4YL 1RZJH 2B8OT 3MROB 5KSVA 3C8HA 2NZIA 1G9EA 1RUAL 2X09A 1YMMA 1PLGH 3HMXA 2E9BA 3M45A 4P2OD 3V5KA 1FL5A 3WFEH 3MCLL 1WFUA 1MREH 5B38A 3V6FA 2P4AB 1W0YT 1GZQB 5D7SL 5D7JA 5DHVB 3TVMD 1HH9B 4RZCB 2H8PA 4L3EB 4OLVL 2NY3C 4GBXA 1MQKH 3V4VL 4Z95H 2J8UB 3MGTB 1FO0A 4G7VL 1AGCA 2HYMA 5E00B 1ZEAL 2NX5A 2UWEF 1XR8B 4JZOB 2HT2C 2VERN 2W38A 4N8PA 5BMFH 4QF1B 4HIHA 3IDXH 4GLRH 5F7WC 1FNHA 1NBVL 5HHPB 5ISZA 4WI6A 5DVLA 1VA9A 4KHXH 2H32H 5FOBA 1FN4B 5LXGH 4GQPH 4PGBB 4GAFB 2VJXA 2VABB 4GW4B 4ZYKB 4PRPA 1KF9B 2KBGA 1YEFL 3EYUH 5GGRY 2CLZB 3BQUC 2BXYA 1AP2B 3LN5B 1FV1A 4HF5L 1KJ2H 4R3SB 3LKRA 4UV4L 1OSPH 3DRTA 3DMMA 1A6VL 4DN4H 5EIQA 2XWTB 3LV3A 2WBJD 3GSWA 1QQDB 4U1IA 3P2TA 1UWGH 4G9FA 4NQCB 3VDCA 4HUWB 1EJOH 2HJLA 2KZ1B 4HZLB 2UY6A 3RU8L 4HH9A 5DTFA 3IFNL 1RVFL 4OZHB 1JNNL 5KSBE 1YPZE 5L2KE 4PGCA 1NFDA 2JJWA 4R7DB 4LCIH 4KDTA 3VRLF 4NYLB 5L6YH 1CGYA 4I77H 3NFPA 1LGVA 2YZ1A 2ZUXA 4KJWD 4HXBH 1RFDL 4L5FH 4NZDA 4NQEB 2ID5A 5IVZA 1GHFH 4XCFH 1U8PA 5IBTH 4LVHC 5GS2D 4JY6B 1A9EB 3BPCB 3ARGC 2Q86A 1UA6H 4ONFL 5DI8A 1S7RA 4CN6A 1YYML 3TH4T 3W9DA 1MWAB 1Y6MR 5FEBA 3RPIB 5I8OL 3WFCL 3L3DA 2V2TB 2BJML 4DVBA 1YEJH 5L9DH 3MQIA 1IM3A 4LCCB 3ZKND 5IWLA 1IC7L 2HT3D 2BVUA 5B4MC 3SDCA 4PY7B 4NP4L 2AGJH 4HV8B 2HKHH 4WWKB 1K4DB 2OZ4A 4I2XB 4LSUH 2I25N 1VGEL 4MWFA 1LO3L 4KROB 3LS4H 4GRWH 1Q94B 1U3YA 1IZJA 2BY1A 1S9VB 2IBZX 3WD5H 3IFLH 5C0BD 3UPRA 2NW2A 4MQXD 3D3VE 32C2A 5LBSH 1C08B 1H15A 5JW4Q 1NMAH 2DI8A 3GZKA 4MDJB 3KLHD 1KENL 1AJ7L 3OAUL 3ETBF 2GJJA 1QBBA 1JNLH 5F7DA 2B5IB 2APTA 2OTPA 3S96A 4PJ9B 4X9IA 35C8H 1F4YH 2W65B 3D69A 3DIFB 5KANI 4WU5B 4LNRB 1S8DB 3QWOA 1VFUA 1RUAH 4NT6B 4UI2A 3HE7C 3MCLH 4DAGL 5JZ7D 3JTTB 4ENEC 1IJ9A 3TVMA 1KEGL 1F6LL 1QHOA 2J7LA 5D7SH 4Z78A 1MIML 1IAII 1CD1A 2VIRB 4C56B 1TQCC 4FFVD 4OLVH 5H2BB 1WICA 2WLYA 2X4PA 3O3DB 4LLAA 4RIRA 3V4VH 4I3GA 2ZUSA 1P4IH 4G7VH 1JK8B 1HH6A 5I9QB 1ZEAH 5BRZE 2ERJC 3KAAA 1A6PA 3R0NA 1KOAA 3UTSE 3AB0B 2BX5A 2R0ZL 3F7VB 4N9GA 4HJ0D 1J8HD 3LH2L 4ODUA 2DL9A 1HE7A 2VXSL 5D1ZD 2W1NA 2BOBB 4P99A 1TITA 3EZ8A 3ZKMC 1IGCL 4HWZA 1I1YA 5JDSA 3OAZH 4OAWB 5C8JA 4P23D 3VRJB 3MXVL 4OCNC 2VAAB 3AMLA 1G7MA 3SKNB 3MBXL 3NA9L 1OAZL 3VGAC 4Y4FB 2GSGA 1JPFB 1CGUA 2XFXA 4HF5H 5IT2H 4G6FD 1NL0L 1U91A 2HTLC 4UV4H 3WL9A 1A6VH 4HAGA 4OZIE 5DQ9B 1I7TB 4LPXA 3DV6B 5FYKE 4HJGB 5F44A 5IHBA 2XRAL 15C8L 2R23A 1SYSB 2JKXA 3LPFA 2X40A 1AKJA 4PJ8D 3VFSA 1B6UA 4O00A 1J1XL 5C0AB 5DQDL 3RU8H 3WMSA 3D87B 1P5UA 4ZTPL 4MQSB 3IFNH 5IFAL 3FAWA 3T3PE 3O8XB 1RVFH 3NN8B 1JNNH 1HOCB 1GCFA 5FM4A 3VJ6B 5SV3A 2N4IA 4JN2B 1OGAE 4NNPL 4C4KO 3DJ9A 3OKOA 4JPWL 1CDHA 5HDBE 3EYFA 1PEWA 4GXUN 1AE6L 2R2HB 1D6EB 3TNNB 4NQVB 4LHUG 4HIIB 3NFSH 3TYFA 2QJDA 3AM8C 1RZ7L 3WEXB 5IB5A 3HC0A 2W07A 1MI5E 5D7KE 4ONFH 1YYMH 4OUUA 4E41A 5CJXC 3PWVA 3U6RA 5I8OH 3U36A 3WFCH 1JZ6A 4HKXB 2FEEL 4JREC 4HGKC 3HNSL 2FEDD 2J8UF 4Y5VB 1H0DB 2BJMH 3PXHA 3T0EC 2HG5A 3AU1A 2XZCL 5DFVC 1IC7H 1X4XA 4N0YL 2FWOA 4ZFOL 4NP4H 2IFFL 1VKXB 2AI0L 1VGEH 5IMOA 1LO3H 4PJEF 1UB6B 2BFVL 1IGTA 5IP4A 3N9GH 2Q7YB 1BM3L 4U6XA 5DS8A 4Y5XC 4XCCL 4NN5C 5GRWA 1FSKC 5C09D 2X9YA 3GRWA 5GZOC 3L3IB 4OZFH 1SYVA 1XH3B 2D3VA 5HD8D 1D5BB 4XCEA 3RX8A 4I18A 3VMPA 4ERSL 1H3PL 2DQEH 4PREB 1BD2D 4DZ8B 3CH1B 4HC1L 1I7RB 1ZWIB 5C0FB 1KENH 3OAUH 3P4NB 4GKNB 2HMID 4KK8D 3B3IA 2R9HD 2GIYA 3EYSL 1X3DA 5EN2A 4GFTB 2DRUA 1I8MB 2MQCA 1OB1B 1AGDA 1NCUA 4N0CD 1BQUA 5ITFB 4DAGH 5CZXC 2PTVA 5A3ID 4LDLB 1KEGH 1M6OA 3KS0J 1Q9WA 3RWJB 1MIMH 5K9QG 4UNUA 1I1RA 1TTUA 2HVJA 1D5MA 4OZHF 2VDPL 1DBJL 4KRNA 3UZVB 2XN9E 3P9MA 1DEEA 2EDNA 1NAKL 5C1MB 3T2QA 5D1QC 4QTHB 5J11B 4XPAL 1O0VA 2EICA 4DW2L 1SEBB 3MV8B 1MELA 3WFHA 1ZT4A 5DJYA 2EYRA 3GSOB 5D1ZA 3NCMA 3IU4L 3PV7A 3H9SE 1EO8H 4S1DD 2R0ZH 4MDIA 3LH2H 3M17B 1EAPB 5EORL 1AXTL 1H9VA 1IM9B 2VXSH 1EBAA 3NZ8A 4U1LB 1FAIL 4DKFL 2ADJB 3FFCD 1IGCH 1U3ZA 5EULV 2I9TA 1VHPA 4NRYB 2DBLL 3MXVH 1K2DA 5E2UL 3B8YA 3MBXH 3NA9H 1OAZH 4JDVB 4KJYB 3TT1L 2C4XA 3HLAB 1X5JA 1IEAA 2E8YA 4LCWD 1U42A 1BIIB 2CGRL 1NL0H 1C5DA 1FFNA 2EDQA 4WU7A 3I6KA 2YZ8A 1RZIB 1CGSL 1T0MB 4PJ8A 3KJ4B 5EZLA 2XRAH 4BYHA 5DZLA 15C8H 1KT2A 1G7LB 3OKKB 3UYOD 3ZE0F 1J1XH 4M6NL 5DQDH 4ZOBA 3O9WD 2KL6A 1HSAB 4ZTPH 4JFXA 4XT1C 5BVJB 5IFAH 4AH2A 2NYYC 3MLVL 3CZJA 3IF1A 1ZSDB 1B4RA 2DTSA 3IXAB 4ZQKB 3DRQB 3ZTNL 4NNPH 4JPWH 4EEEA 1X6LA 3ARXA 4EOWL 1AE6H 3V7AE 1PW3A 4K94L 1PY9A 1I1FB 3MNVA 2IALA 1XCQB 4TVPL 4JKMA 1FLTX 2Y7QA 1RZ7H 43CAB 2YC1A 4MCYB 1EZVY 2V2WA 3MLYL 1A5FL 4P2RE 4NPYA 4KQ3L 3U0TA 4PP1D 2D03L 2JIXD 5F3HA 1QLRB 4EUPB 3KPNA 3RIAF 3HNSH 4PGDB 3MRHB 3P9LA 3FN3A 2FATL 2XZCH 3HTLX 3KR3H 5HY9B 1LEGA 4KGLA 1T1XA 1NCBL 2Z4QA 1G1YA 1QO3B 4N0YH 3IJSB 5CZVL 2IFFH 1TDQA 4KK5D 1RHFA 5T3ZD 2BFVH 4IMLB 1BM3H 3CIQA 3RNQA 4XCCH 4PJ5A 2P46B 3C2SA 4L9DA 1S7VB 3P77A 4ZAKD 3F12B 1RUKL 2MQ3A 2VKWA 3BJLA 1H3PH 2P8MA 1CGXA 2PW2B 3SDXE 4HC1H 2WUBL 2DYPB 2ZOKA 4L4TD 3RNKA 4TQEL 2G5BA 3EYSH 4JRXE 5B3JE 3BP7A 4OFVA 1NPUA 4K2UL 5JIHA 2EH7L 3KLDA 1F45A 1RSFA 1PX4A 1ODAA 3MV7D 5C0GB 4YBHA 2R29L 3BO8A 1P53A 1S3KL 2AJZB 4JLRA 4U6YB 2CJUL 3DHMA 4UIMA 4PLKD 1ZGLM 1CICB 4MJ4A 4RA0C 1U2HA 4UZGA 2VDPH 1ERNA 1DBJH 3VE0B 3EJZD 3OQ3B 5AUMA 1BEYH 1NFIB 4YR6A 3OKEB 3CX2A 1NAKH 3OKYA 3OGCB 5IKCA 1F4WL 5EOTB 2FJHB 1SVCP 3C6LD 4XPAH 4GH7B 4DW2H 4LLQB 1WUNT 1UENA 1OW0C 2A6IA 1WSST 3IU4H 4H1LG 4WV1B 5KVGL 3VGHA 4OD3H 1VFBA 3W0WD 4Y1AB 1EEZB 1AXTH 3HG1B 4U05A 3MRIB 1FAIH 5D72L 3X3GL 2Y6SD 4DKFH 3T0BA 5HYJD 5D93B 1SY6A 2DBLH 2BY0A 4W6WB 5E2UH 5JPMA 4X6BA 3TT1H 5FGBA 4D2NA 2CGRH 4YHZL 2WWKO 3DGGA 3FZUC 1BQSA 3RKDC 2DJ4A 1CGSH 5E6YA 5AZEH 3O9WA 4OM1H 2C3XA 3QWRA 1CDYA 2GJ6B 1S7QA 5ERWA 4QRPA 4M6NH 3FONA 3Q3GB 1A14L 3MLVH 4F3FA 3ZTNH 4N8VB 3OJDB 1J5OL 2CRZA 2XKUA 5DA4A 3QEUA 1UGNA 3F7PC 4N5ED 4L4VB 2C3WA 1HWGB 3QEHB 1RQ5A 3MMEA 2NNAA 4K94H 5GGVL 3MRBB 5IW1B 4TVPH 4HHAB 3S36X 5LAXA 4Q0XL 1S9YB 3FRPA 1QFOA 2ADIA 4GUPB 1U8LA 1RZ8A 4PJDB 3MLYH 1A5FH 4FXKA 4YFDB 4KQ3H 5T3ZL 3SQOL 2D03H 3HI6L 1OP5H 1IGYA 1RZGA 2ARJB 4NSKB 4S2SA 3FHQA 1MFDH 5DC9B 4FZ8L 1F42A 4MNGA 2FATH 4K7PX 3AMKA 3IS1X 5GGRA 5CBAA 1NCBH 5CZVH 4WUUB 2VLRA 2R69L 5HHVH 1L4IA 5HYIA 5SWZA 2H3NB 4OF5A 5JW5B 4H5SB 3KLSA 5GJSL 3I9GH 1YMME 4ZAKA 1NLBL 3V6ZA 4QKXB 3O0RL 2OM5A 4LAJH 1A4KA 3DUUB 3SEPA 4IMKC 1RUKH 2AV1A 3HZVA 4L4TA 1IKNA 3CDGA 3D25B 5MEOA 4WFFD 2PYED 2WUBH 1IEBA 4Q97A 5H35B 2IEPA 4KXZI 5DVNA 2BY2A 4TQEH 3A6OA 3QDMB 4RBPH 2JCCB 1QVOA 3MV7A 5ICXA 3MV9D 3BUYA 1PYWB 4NO0D 4WWKC 4K2UH 3QNXA 1QA9A 5L2JB 2OL3L 2W0PA 4KROC 2EH7H 3UBXG 1NDMA 2NX5E 3PDOB 1BOGB 4HWEL 2R29H 4QGTA 5KSAB 4LRIC 1S3KH 1IKFL 5DUBA 3MA9L 5ISZE 2CJUH 2C3GA 3UAJC 1ONQA 1K8DB 4H26B 3G5ZA 3HRZA 4XXDB 4AZ8A 4G43A 6FABL 2CDEB 3G5XA 4NZUL 1HHKB 3C6LA 5E0QA 5DSCB 4PRPE 3O4LD 1E4KC 1G6RB 2VH5H 2CLRB 4FXGA 3ARFD 5D1XD 1PEZA 2EDKA 3U2SA 3SY0A 1YA5A 2FSEB 5CD3B 1SJEB 4XBEL 1Q9KB 2JE8A 2Q6WA 5B39B 5D6DC 1DQQA 3BPLB 1AFVL 3BPNB 2H2SC 2VZUA 1NJ9B 5J3HC 3X3GH 3WBDA 4G9FE 1S9WB 4UOJA 4IS6B 4XRCA 1NDGB 5E2TL 1PZ5B 2VDRL 5FHAH 1UC6A 4O2EB 2AV7A 2B1AL 1TETL 4NJ9L 3WN5C 5KANG 3CFEA 4XB8A 4YHZH 4UUJB 2K3TA 3V6OC 1NFDE 3AB0C 4DK3A 5HHXL 4LNVA 4PTTA 2R4SL 1KPUB 3GO1L 4HG4J 1FYTA 2D9CA 3HI5L 5E8NB 3IXTB 1FGNH 1XF3A 4TPRL 2VDLL 5ESQB 1UM6L 2AK4D 4MVBC 2VLME 1QP1A 4D9QE 3VFRA 4L1HA 3TCLB 4BFEA 1A14H 3GHEH 3SPVB 1RJZA 5F9JB 1BLNB 1A6TB 2OR7A 3BN9C 4OI7A 1CFVL 1J5OH 4ZOAA 5LGHL 3WHXA 3BKJL 1G7JA 1EFXD 4XI5C 1R5WB 3SDDD 3QEGL 1MHHB 5GZNC 1INQB 2P5WE 5GGVH 3IDMB 4N0FA 1K85A 1JYVA 4PJFB 4JY5L 4MD4A 4Q0XH 3FB5A 4I4WB 5INCB 2VDML 3LN9A 3O8XC 4P2CG 4XCNA 3VWJD 3IJYB 4LLYB 1U95B 5T3ZH 3TWCL 5L8JB 3SQOH 4JM2D 1L9NA 3HI6H 5DJZA 4Y4KB 4OI9A 3H9HB 1JCKA 4G6KL 2UZYB 1HNFA 4FZ8H 3WUZA 2VLKD 2XKNA 2ITCB 3F58L 4F2MA 2APFA 3ARBB 2BVOA 2R69H 3S5LA 3Q5OA 4XC1L 1T03L 5ETUA 3O3AB 3MRNA 1T0PB 5GJSH 5CKGA 2D31B 1NLBH 4W6YB 4S11A 3MA7A 3P73B 3O0RH 4NRXA 2PYEA 3ECBB 5K59E 2OTUA 4Z5RB 4HULB 2JTDA 2Q20A 5TQ2L 2VLJB 4MJ6B 2ZG1A 4NN6B 3MV9A 3RWGA 4D94A 3KXFB 1KIQB 4AM0B 1KLUB 4LQ1A 4ISVB 1BFOB 1PKQA 5JOPD 4HWEH 1KN2L 3MGOB 3SCMA 5CUSH 2EEDA 3QUYA 2SEBB 5GRYA 2DQGH 1IKFH 3MA9H 4UILL 4WO4A 2WBWB 5I75B 4JGUA 1JWSB 4JDTL 2ZPKL 6FABH 5CS7A 4NZUH 4U7SA 4X80L 3R8BB 2XV6B 3LN4A 3P4MA 2J1KA 3PP4L 1O5DT 5GGUB 3V0AC 4IRSC 1AD0B 1W8OA 4X9GA 2XZAL 2IANB 2R15A 2UUDK 3MBED 4XBEH 1WFTA 1K8IB 2DWDB 4IIQA 2C4FT 5CHNA 1AFVH 3WS3B 3FT4B 4PJDF 5CGYD 4P9HC 1MCRA 3SE3A 5E2TH 2VDRH 4KK6D 1KC5L 5DXWA 4LARH 4RCAA 3TA3B 3ZE1F 1NGYA 4QY8A 2B1AH 3CUPB 4G42B 5GSVA 5J11C 1TETH 3C5ZB 4NJ9H 3HAEA 2CKBL 2F53D 5E4EB 2Y23A 3FQXB 3BD4A 1QOKA 1N0LA 5F7KC 5HHXH 1YY9D 2R4SH 2AP2A 5BV7C 3LKNB 3GO1H 2ZUWA 5TE6L 1T4KB 3C60D 1KCRL 3HI5H 3T0DA 2AK4A 2H9GA 3OKDB 5B8CA 1F2QA 1WIUA 3PHSA 2Z91B 4TPRH 2XQYG 2VDLH 2HFFA 3F62A 5K93A 4GKZB 4XMKL 5FO9A 1UM6H 5FK9B 1MHEA 4S1SL 3QDAA 1OWRM 2QSCH 1ORQA 3CMOL 1RJLB 4YHIB 3VXTB 4ELKB 1A21A 1J0ZA 1EFXA 4E41E 1RZFL 4UU9B 3KPOB 3RWEA 5ACZB 1CFVH 1I8LA 4DKDC 4XH2A 5EBMA 3BKJH 1K3ZA 3LPWA 5ESAB 3ILPA 5I1GL 3KJ4C 3QEGH 1ZA6A 1SBBA 4I0KA 5ANMB 1XR9B 4G3YL 4PG9A 1BVZA 2A6DA 4ZUWA 3VWJA 5IF0B 1I3RB 4JY5H 4UQ2A 4JM2A 4NIKB 2APBA 1CFNB 5DJ0A 2VDMH 5J13B 1CFBA 4K3GA 3TWCH 4MX7A 2C1PA 1WC7B 2ZG3A 3C8KA 3DSFH 4OM0L 5E5RB 3T65A 2VLKA 4FHBD 4GAYA 3QQ3B 5IVOA 4NGHH 1XGTA 4G6KH 1MEXL 1WBZA 4APQB 3LKSA 3MJ9L 2VE6B 2M8XA 3U9UA 3BKYL 3F58H 3FQNA 3CSGA 2RCSL 3K0WA 3SGDH 3EO0A 4O2FB 4RFEA 4XC1H 2OYPA 4Y2DC 3U79A 3BMWA 5HI5D 5JHLL 4S0SD 1OT2A 4PB9H 1PZUB 4BKLA 4YEEA 4YDIL 4U1HB 3NIDF 3RWIA 4JQIH 5JHDB 2Y06L 5D5MB 3D5OF 5TQ2H 5IOPB 4OIBA 3P0GB 4MCZB 4ZO7A 4M93B 1MHCB 4ZSOA 5BJTB 2C7UA 3ALXA 5J0BA 3ZMRA 2NXZB 1PAMA 4G6AD 1E0OB 4UDTB 1W0VA 4NKIL 1DQJB 4QRRD 3ZKXC 2GYSA 3QPQC 5IV2B 4LBEA 3VMOA 1KN2H 5AYUL 4Y16B 4X9HA 3LQMA 1EHLL 1F6AA 3B4NA 3VFVA 4P5KA 3U9PL 4F7TA 2RAMA 5T1LA 4NOBA 4UILH 2YHGA 1RD6A 3NZHL 3TJHC 4JDTH 4UQ3A 2ZPKH 1MCDA 1YEDA 2GFBA 3HZKB 4X80H 2EE6A 2EIZB 3B6SA 4FRWA 4QWWD 3IDYB 3DX6A 4PTUA 3PP4H 2F15A 4RNRA 3VCLB 1NEZG 5I18L 2OCFD 5BO1L 3NPSB 4V1DB 2XZAH 2NY5L 1MCJA 1YECL 3D2UA 3ARDD 1CBVL 4X6EB 4PJFF 4UINL 2B20A 1CXHA 1MJ7L 1CICC 5GS1A 1NQBA 1VENA 5T3XD 2ZSWB 4NZTL 4U3HA 1U8MB 3OHXA 1KC5H 4ZNEA 5J9PB 2F53A 1FNLA 4D8PB 4DEPC 5MENB 1R3LB 3KPRB 4TN9A 4ZS6D 2L0DA 2CKBH 1S5HB 2EDFA 4UAOB 5E8DL 2ZCLL 3SKMA 3C60A 3TBYA 5HGHA 1DE4B 4WV1C 1MJJA 4M3KB 4ZOEA 5T1KD 5KOVC 4OGYL 3GGWB 3VGDA 4NRZA 5TE6H 4WEUD 1KCRH 3HC4L 4MLSA 3U7YL 4C83B 3MYJB 1CGWA 3S4SG 4XMKH 2F54D 3OXSA 4LP5A 4AIXA 4HUKB 3T4YB 3G6DL 4S1SH 1YMHA 5DMGD 1YY8A 3CMOH 3QZWB 3AXLA 3C08H 3DX7B 4P49A 3BH9B 2CXGA 3D18A 1RZFH 3BVNA 2GUOB 3VFMB 4ZNCD 3FB6A 5MERA 4O2CB 5DMYA 3BZDA 4M1GL 5B21A 4WHTA 5I1GH 1CGVA 1DBBL 2BNRB 4HDIA 4PJXA 1WVZA 2J12B 4O4YL 2HTKD 1VADA 4Z7UF 3DX9B 1G9NL 4NKDA 2QLVB 1WCBB 5I2IB 3LOWA 5C09E 4YK4B 4X5WA 3FOMA 4XWOD 4X8JB 4OM0H 4PJ5E 5I1EL 1BD2E 2KQMA 1P7KA 2HLAB 2CLVB 1MEXH 5HYEA 3MJ9H 3BKYH 4M61B 2CRYA 3O2DL 2R1WA 1CQYA 4MA8L 1BQLL 4FQ2H 5F6IB 5C07D 1KJVB 4G8GB 4OZGB 3NIFF 4YIQB 5HGBB 3KGRA 2CK0L 5JHLH 3BYTA 3WFDL 3RQ3A 2RFXA 3CFKA 3QULB 4JGMA 4YDIH 3JV4A 3QA3B 2Y06H 5DJXA 2YSSB 4QHLA 12E8L 3HE6C 1LHZA 2FYYA 3RGHA 1CN4A 4QRRA 2JELL 3RP1A 1AC0A 2ZG2A 3HZYB 2DQFB 3BUTA 2DKMA 3BD3A 1U2CA 1A6ZA 5AYUH 3QSKB 4X98B 1M4KA 4ZUSA 4LEOB 3QCVL 1HQ4A 4F37K 3J8F7 2G9HA 3FO2A 5TE4L 3U9PH 2EYTB 4OD1L 4LLDB 3NZHH 1INDH 1ZHBA 1NAMA 1WEJL 2NTFA 3TFKC 5DK2A 5DRZB 2B0SH 4FZEL 5EO0B 5IJVA 3EO1A 1R3JB 3MUHL 1QG3A 4NBXB 4JQXC 4HFUL 5T3XL 3RWHA 1OARH 3KPQA 4Y4HB 1VESA 4ZUUA 5LWYL 5I18H 2YUVA 3G08A 5BO1H 2PYFB 3V0VB 5JQHC 1FJ1A 2NY5H 4LLWA 4KI5C 1YECH 5KSAC 3L7FB 4P3WA 1CBVH 2XOTA 5IESL 1RV6X 4PS4L 4OUOA 3QQNA 1MJ7H 3E6FA 3L7EA 5EH1A 2B4CC 2FZ3B 2O26U 3JXAA 3QQ9C 3MRCA 1OWWA 5FO7A 4RAVB 4NZTH 3S88L 4NKMB 3ULVF 4Z18A 3QIBB 2IAMB 1JWUB 2BVPB 2NY3D 4QRPE 4PJ7A 1E28A 1R3KB 5CWSB 3VXMD 3TO2B 5E8DH 2ORBH 4BSVA 1NANH 2ZCLH 3MRQA 2HT2D 5HHQB 4MA1C 5IVXB 3VH8B 2OLDA 4YLQT 4DFIA 3H0TA 3OB0K 3BPLC 3BPNC 3HC4H 2NLJB 3U7YH 1NGXA 5F1SA 1P2CA 3KYMA 3OXRA 1RULL 3TV3L 3FKUS 2YD5A 3U4EB 3VFTA 3MLTA 2FHFA 5D2LA 1FVCB 1EMTL 3DVNA 1IAIM 1KXQE 5I8CB 2C9AA 2XZQL 5HHNB 1WBXA 3QO0B 1E4XI 3BYYA 3Q5TA 3BQUD 2CDFB 4FS0A 2XT1B 5EPMB 5TDPA 3OR7B 4FTVD 2WUCH 1QTYT 4PJGF 4M1GH 4JDZA 1DBBH 4MNGE 4PJAE 1Q38A 4AEEA 1MRDL 1I3UA 4FQIL 4O4YH 3H7BB 1QNZL 2VLRE 3DVGB 5IQ9A 5CP3H 1G9NH 1UZ8B 1IC4L 3GSNL 3CZFB 4CNIB 3MOQA 4YAQA 1A3QA 4GKSA 3V7AG 1FZOB 3HHRB 4AQ1B 3VXUD 2VZVA 5I1EH 4AT6A 1DBKL 2EECA 1M7XA 5C70A 5FA3B 1N6VA 4L4TE 3VXQA 3ZDXF 2UVFA 4LHUD 3EAKA 1S7XA 5C07A 3O2DH 3AREB 4K9EC 4MA8H 4U2YA 5EZJB 1U9KA 1BQLH 3MV7E 5ICYB 1JHLL 1YJDC 5FV2A 1OT1A 4K8RL 3GJFH 1G7PB 2CK0H 3FN0L 3ZTJG 1G84A 3WFDH 3GMMB 1D3CA 3CH8A 3MJ8B 2W0LA 4Y4KC 4J1UB 4J3XA 1Q8MA 4Z7QE 1BP3B 5D6CA 3QI9B 2YBRA 5DD3L 9CGTA 5ALBH 3IKCA 12E8H 4LASL 4GG8B 2JELH 3ARBC 4L29A 3MRPB 2KDGA 1WBYB 2EXWC 5B4MD 1JUFB 1T83A 3ROOA 3WIFA 4W81A 4M6MH 3W0WE 3QCVH 3QUXA 3S36L 5TE4H 3GJEB 5HHMD 2C3VA 4G7YL 1T3FB 4OD1H 1ZTXL 3X13A 1DL7L 4FP8L 1WEJH 4NN6C 3WIHA 5HYJE 5EOCJ 3D3VB 4FZEH 2PNDA 2F74A 5H94B 5HVGB 1Z5LA 4HFUH 4ZXBB 5T3XH 1DUYB 3L5WA 5LWYH 1J87A 1FL6B 2X4SB 2OXHA 4ZO6A 5I17B 3D0VB 3GMRB 1NBZA 3S37X 5IESH 5DHYB 5BS0A 4ENED 4PS4H 1FYTE 5I75C 3PHOB 4M6AA 4EDXA 2G2RA 5CBEA 5DEFB 1UEYA 1Z2KA 1I1AA 2X4OA 3MRDB 3ZDZE 4GAGL 4ZPVB 3S88H 3DMMC 1JL8A 4LMQE 5L0QB 2Z8SA 3VXMA 1QSFA 4NO3B 3BD5A 1U58A 4XVSL 5CEXB 4BSJA 4U6VL 1CFTA 4OZ4B 4Y5YB 3I6GA 4M4RA 1U8JA 1F02I 2YUXA 3GSRA 3N1MC 1TPXB 3VFUB 3VFOA 3KYOA 1KTLA 3K3QA 5E2VL 1VEMA 3AAZA 4BH8A 5FYLL 1I7UA 4PRNB 3VW3L 3EBAA 5DUPL 5AEAA 1YNTA 3M07A 3TIEA 2YEZB 4DJMA 1RULH 3PWJA 1T20A 4U1SA 3HUJA 3TV3H 5I73B 1ZANL 4AK1A 3ZKMD 3BQUA 5KAQF 4MJIB 4G6ML 1EMTH 4QHNA 2XZQH 4JFFB 3C5ZC 5KW9L 2HN7A 4FTVA 4MD5A 1SBSL 3I2CL 5E4EC 5FDYA 1BJ1J 3ARYA 5J57B 3RFZC 4BUHA 2HTLD 1FC2D 5EU5A 2FIKB 2W60A 4OF0A 1CTOA 5GGQL 4OZIB 1MRDH 4FQIH 1S9XA 1QNZH 5IM7A 2O61B 4OLWL 3CC5A 1WTLA 3VXUA 1IC4H 3GSNH 3OKLB 5IWLC 1T1YA 4M1DL 5AZ2L 2YD6A 3BP5A 3V52H 1DQML 3JV6A 4LHUA 1DBKH 4GG6A 2X1XR 1UG9A 2H41A 4WFFE 2PYEE 3GDBA 4X4XB