1MAJA

Solution structure of an isolated antibody vl domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
b'DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 26-10 FV (LIGHT CHAIN)
publication title Solution structure of an isolated antibody VL domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 13
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1993-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1majA00
2DKUA 3LMJL 1JL8A 5D7JB 5D1ZC 2XKUA 5ALBH 5I8OH 3BOVA 5KSBA 2EDRA 3O2VL 1GL4B 1RUAH 3WFCH 1NGYB 4E41A 3CVIL 2IFGA 1E4KC 1DANT 4ZFOB 2J8UE 5JHLL 2VQ1A 4OTXL 1P4BL 4KKBD 5FYKE 4BFEA 3Q3GA 1NANI 4ZS7L 4M5YL 2FBOJ 3NTCL 3QIUC 1DBJH 3RHWK 3TJHC 2OTPA 1QBLH 4NQDA 4XBGB 4Z7WE 1PZUB 1DL7L 4WENB 4U1NA 3T1FB 2XIDA 3UC0L 4XNZB 3IU3A 4QRRD 5ABDE 4N0UB 4WNQA 4E41B 2BJML 3DX9A 3HZYA 1UWXH 3OJMB 5C0BA 1BQSA 4NCC2 5M95B 3LB6D 2YUVA 4YR6A 1ZSDB 3VFNA 1S7UA 1A7OH 4BZ2L 3U82B 4LCWD 3MNVB 3MO1A 1FYTE 3V5DB 1T03L 4MQXC 1A0QH 3CFDB 4XVJL 1YEIH 2AJXL 1A02N 1J1PH 3SHSA 2IADA 1DBBH 4M7LH 2VR4A 4PJ8C 5IJKA 1NGPL 3BPNB 3QCVL 3ZE0F 2BOBB 1T3FB 4HC1A 1LO2H 3O6ML 4OFYD 1DBAH 3N85L 4WNQB 1MCPH 5CMAA 3HZYB 5C0BB 4RAVB 3VI4E 4PRNA 1B0RA 3PWUA 3WJLA 1IGFH 3SBWA 2OLDA 1JGVL 1CZ8L 1FNGA 4GW4A 4MD0A 1R0AL 3BWAA 1UYWL 2GCYA 4G6JL 3RU8L 2ILLA 4OLXL 4MDIB 4PGZA 2IADB 3GI9L 5GGTL 2OP4L 3IF1A 4MJ6A 4JG1H 2VAAA 3PDOA 4U3XA 3BPOB 3MLRH 3MA7A 1KCRH 4RBPH 3ZYJA 4ZSOA 1QR1B 1DQMH 3DUUA 3LCYA 2X9WA 4KJPD 1R24A 2PYFB 5CMAB 5DEGB 3ARGB 4OCRH 1W0WB 1B0RB 2F5BL 3PWUB 1FNGB 2QSTA 2AGJL 4MD0B 1RZKL 1J8HD 4QY8B 5IVXE 4RGMB 4XRCB 2EDLA 2GSIB 2ZCLL 1V7NL 2WP3T 2A6DB 4WTZG 5E2VH 3MA7B 1H9VA 3BP5B 4AG4H 3EYUL 3UTSE 1AQDA 3Q1SL 4XCNA 1F00I 5IQ9A 1H8SA 2ATPA 3S37X 3D9AH 4OZGF 4A2MA 2ENSA 1HH9B 4XPAH 1PZ5A 4POYA 3BJLA 5KS9A 1WCQA 3BHBB 3M1BA 1JZ3A 2OL3A 4G5ZL 1S9VA 4LNVA 3RI5K 8CGTA 2DQDL 2DQHH 4Z0XA 2YN5A 2DQGL 3QQ9D 4NNXB 2Q8AL 1G7QB 1J0HA 1TVDA 2OR9H 5DZNA 4ZG1A 2BCKA 5JORA 4MJ5A 1PQZB 3NCFB 3MLXH 4M6NL 4GMTH 5TPWL 3TT1L 4XCNB 1AKJD 2ATPB 4IM8A 2F74A 3QEGH 4Q58C 5F44A 1TNMA 2DQTH 2ENYA 4YDVB 5DD1H 3S3JA 4DEPB 5KS9B 3FZUD 3LHPH 3M1BB 2OL3B 1NH6A 1EBAA 1I7RA 1KT2A 1S9VB 3O9WA 4ZFOL 2F19H 1H5BA 3O11A 4R2GD 2H2SD 3B5HA 3JWNC 3MZTA 4M48L 3MGAA 5JORB 3VXNA 2CRYA 4MJ5B 3THMH 3PL6C 3TT3H 2OCFD 5SX4H 1FG2B 2BVTA 2F74B 1XCTB 2WUBL 2LVCA 5JMRA 3T0WA 3C9NB 5CP3A 4HWZA 3MV7B 3R0NA 4OD1L 4XNQA 5K9JL 3TWCL 3E0GA 4U33A 1WWAX 1H5BB 3EGSB 4IDJL 1WT5A 4MA7H 1OARL 3GMPA 4UDTA 4DOHE 3TCLB 5GGUA 4Y4HD 4H8WL 3VXNB 3EYQD 1JNHA 3LOWA 1QP1A 3AMKA 1W72H 4KRMB 3F12A 3MJ9A 1PAMA 3JXAA 2BFVH 2P5EA 3SDXA 3EO9L 2DI8A 4PUBH 4WO4B 1MUJB 3LQAC 1TJIH 3L95B 5GS0H 2LAGB 5MEQB 4RIRA 4HWZB 1F8TH 5FYJE 4UOW0 3QHZH 2ITDA 4HK3J 5KSUB 1YEHH 1V3JA 5BRZD 1T20B 2K7QA 2Y25A 1OP3K 4BQ6A 1OD7A 4HS3B 4U1SA 3K2MC 3MXWL 3LQZB 2ZCHL 1JNHB 1HI6B 4PIRF 3NCJH 5IG7A 4K71B 1YMHB 4DUXA 2X2YA 1IAKB 1V5JA 1MRDH 1RULH 2Q3ZA 4AIXA 2Q7NA 1J5OL 4RIRB 3OAZH 4HC1L 4OIBA 5FDYA 3DO7A 5E5UB 2F58L 4PJEE 1AC6A 2IGFH 4UV7H 5IFHL 5CKAA 4L3EA 1OQXA 2YD4A 4X6EA 1AO7D 2J4WH 5D7LE 5IG7B 1KCVL 1C1EH 1P4IH 4RQQB 3U0TB 4OBRA 5DD5H 2EECA 4LLMA 4M1GL 5DJ8A 4OAWB 1Z5LA 5CJ8A 5JQ6L 3K8MA 3O0RH 4Y2DB 1BLNA 4HD9A 4LPWA 4WI5A 1WFUA 1A7NL 4U6YA 2ADIA 2EDOA 1I7TA 5EU7C 2C3GA 4C59B 2FB4L 4X6EB 3IXAA 4WHCA 4PJDE 3W39A 2EIDA 3BT2H 2WWKO 4LLMB 2WSKA 3OWEA 5E0QA 2J8HA 2HJKA 4ZS6D 3KXFD 4JPWH 1XR9A 3BDBA 3VJ6B 4QTIL 1SJVA 1BLNB 5J11B 3INUH 3T08A 3BQUC 4C4KO 5A40E 3DROB 4Z77B 3CVHH 2Z9TA 3K8LA 4R90H 1CDGA 1N26A 1JRHL 5C08D 2V5RA 1TITA 3W39B 3LN5B 3CXHJ 1ZE3C 2HAZA 2OL3L 4X9HA 5C0FA 5E5RB 5EIQA 1KPRB 4EI6A 3H3KA 2BNQA 2VXSL 1XR9B 4DZ8A 5C6TL 4PJ7E 4YGVA 5DJ6B 1FVEB 4UOJA 1MLCA 1EIBA 1HEZB 4YHZL 3TJEL 3U7YH 4Z7VA 3SDAD 1P7QB 5FIEA 4NQDD 1PKQE 2YA2A 2XTJC 4G9FA 1U8LB 4JKPH 5CZKA 3DX6B 2R8SH 3JVGC 4M6MH 3FOLB 1R5IA 3ELAT 3FB8A 5D5MF 1YYLL 5C0GA 2KQMA 5C0FB 5D7IA 1G0YR 2R1WA 4OZFH 3SE4A 5GSRA 5TDOA 15C8L 1MLCB 4K3GA 1QFWI 3CFIC 5HHPA 2W1NA 4G8FB 1WGOA 3V52L 4MQTB 3OJ2C 2IANA 2CUHA 5DFVD 4JO1H 3GMOA 4OQTH 5TQ2L 1R5IB 3KYKL 2OJZL 4LLYB 5C0GB 4B50A 1TZGH 1A6VH 3SDDC 1W0VB 3NPSB 4TVPD 5GSRB 5TDOB 1S5HA 1SBSH 4G43A 5E6IC 4DKEL 3WJJC 3ULUF 3OKKB 2ZG3A 3IDXH 5F72S 4RWHA 1UACL 2WMPA 3MJ9L 4QYOA 2D31A 5IJVB 4ZUUA 1BOGB 5SWSE 1DLHA 5TH2A 3MX0A 3EJYC 4HIJA 5T5NG 3W2DH 1E0OB 3FO9B 3ULVC 2LTQB 1A1MB 5HJ3A 2ZKHH 4JPVL 2R1XB 1OAUL 1FFPB 3B9VA 2P42B 2Q1EA 4TYUA 1TVBA 4RZCA 1OPGH 2EDJA 3BKMH 4TNVF 3UTPE 5GGRA 2VNCA 2YUWA 4NKDB 3KNBA 4YNYA 1LEKB 5F9OH 3BZFA 3RKDD 2YA0A 4CMMA 2D31B 2DJUA 1INQA 2QQLL 3HE6D 4BFGA 3FFDA 4U0QB 4NHUA 1CXKA 1NAMA 1DLHB 1QSEE 3GHEL 1AY1H 4BQBA 1I1FA 3QIWB 5CEZD 2AEQH 2EH8L 2DM4A 1WIPA 1RIUH 3SKJL 4HUUB 4TRPL 3BH9A 4QXWA 4RZCB 1U6AH 2AK1L 2G75B 2OTWB 5GGRB 1OP3H 4HV8A 4KK8C 4PG9A 3BZFB 1CK0L 3BPLB 5ANME 1W2KT 4NQCE 1S8DA 1SY6A 3MBXL 4NHUB 5LWYL 5C86A 5EOCL 2NY5L 1CFBA 5JZ7D 1KOAA 4NDMB 2Y07L 4GFTB 4GBXA 4MLSA 5C0CA 1EMTH 3VXSD 5T1KA 3VFRA 4P5TA 5FUCE 2JJSC 4JQVC 3WUWG 2EE2A 3KPPA 4FQXC 2VR5A 2X1XR 1BD2E 2IQAB 4PG9B 4Y5YC 4YHIB 4PJBA 2VDQH 4Y16A 3I2CL 1K4CA 2ZUQB 4LLDA 5EN2B 3IVKA 4N9GA 5EPMB 3EIFA 4A2LA 3PXHA 1J1OH 5DD3H 3HNVH 5CJQH 5EC1B 1JBJA 5C0CB 3ZO0A 3VFRB 4YO0B 3WIIH 2FECL 1SEQL 5AYQA 5DS8A 4JFEB 2EC8A 4ORZC 2YD7A 5CJOH 4ZPTA 4UINL 1EAJA 2KKQA 3R1GH 5IBTL 4OD3H 3RWIA 4KDTC 1II4E 4Y16B 1IFHH 3NACH 3TO4C 3EAKA 5GS1A 1G9NC 3QUZC 1U8PB 2EXWC 5BOZG 4NZRH 3RDTA 1FAIL 3BD4A 5IB2A 1WZLA 2BSRA 4YK4C 5DA4A 3ARZA 4G80A 2FBJH 3BAEH 1RIHL 3WFHA 1BWMA 2E27H 5CBAA 3O3DA 4XMKH 2CGRL 3F65A 3TLRA 3O4LB 3JV4B 4JFZH 3P4OA 1ONQB 1FFRA 4NQEA 3RWIB 4Z5RA 2OJEA 1NBYA 3OZ9L 4EN3D 3BP6B 3UJJL 1HHJA 4QTHA 5J7CC 3BP4B 3DMMA 3L6FA 2VDRL 2DMBA 1BZ7B 3RDTB 4FTVD 1MIEL 3V0WH 3MMEB 5IB2B 1EVUA 4WEUD 2CIKB 1J7VR 1NQBA 3DYMA 2MOVA 5I1LA 2B5IC 5DEFB 4U31A 1ITBB 5KJRL 1G7IA 4G8IA 4FG6C 3Q5OA 4Z5RB 5LQBL 1RVFL 5T1LA 4OCMC 2BVUA 3GMNB 3N9GH 5DUBB 4JY6A 4QTHB 4A6YA 1JPSL 1CLZH 3VA2C 2D7TL 4BQCA 2H2PC 5FGCB 5HDBF 4S1SL 4M7ZB 2H41A 4JM2C 3PWJA 2DS4A 3OX8B 2NW3B 1U58A 1K6QH 1NCAH 1FL3A 1OAKH 4JFFE 2CJUL 4G8GB 2PTVA 5IOPA 5L88L 4IRJC 5JUEL 4PJ9A 3TP4A 1G0DA 3MRHB 2VXQH 1SQ2N 2O61A 3KYNB 4BKLA 2HYMA 3RY5A 1GVIA 4YXLL 1XF4A 4MD4B 4FQLH 1DQLH 1Q1JL 4C54A 5E6ZA 5IGXH 1EGJA 4OCYH 5CJ5A 2Z8SA 4HIIB 4M9OA 4FQIL 4MA1C 2GFBB 2X1WL 1TQBB 2E9JA 1CIDA 1P7KB 2R15A 3LKNB 4M02A 1YJDL 4X8JB 3MLZL 4F58L 5IOPB 3HMXH 4PJ9B 1XT5A 5I8EA 4OLWL 1Y0LA 1NEUA 1TZIA 4JRYB 2FIKB 4U7SA 4GQPH 2IPKB 1VESA 2E8YA 3IJSA 5J6GB 5T33H 4LGPB 4HPOL 4X80H 3TO2A 2V9QA 3K8KA 1UH2A 4S1DD 4Q97A 5E5MB 2EDNA 3WFEL 2P5WE 1TQCC 1KN2L 4LCCB 3HKFA 2C3XA 5HPOA 1MSPA 3VMOA 4LPTA 4L8CA 5ENWA 5CKGA 3I50L 4DW2L 4KJWD 3QDGE 1L0XA 2DQCL 4X4ME 2BNQD 1S7VA 1Y0LB 5IB5A 2O5YH 3UTTB 5JDSB 5C0RH 3NIFF 5DHYA 5EUOF 1HSAB 2WBJA 5ACZA 2VDLH 4I0PC 1E4WH 1C5BL 4TOYL 4R4FL 2HWZH 1QR4A 3MRMA 5L2KD 1MI5B 3OGOE 1INEH 1VFMA 4PY8J 1ES0B 1X5HA 3L3GA 3KYOB 4L8CB 5ENWB 5GISH 3P77A 1OAQH 3PQYE 4XVTH 3U9PH 4Z76A 3F7VB 3MLYH 2PCPB 1S7VB 1WVZA 3TFKD 2OSLA 1BJ1J 2NY4C 3AB0B 4IOFD 1LILA 1KFAL 2VC2H 3DV4A 4ZAKA 5KSVA 5ACZB 3OKDA 3RVTD 5C0AB 1GOGA 3LB6C 3MJ7A 3WIFA 3MRMB 1F4YH 1R3LB 3ES6B 4IOSD 4OZHA 1I4FA 3SCMD 1T83C 4Z7OF 3BZ4B 3U1SH 5LXGL 3E6FB 5MENE 5JIHA 3MR9A 4APQC 1BIHA 4JCLA 2OSLB 3QIBC 1NGWA 3D39E 3ISWA 3C6LD 4ZAKB 1BVKA 2AXGA 1YNTA 1TJGH 4F7TA 2MQ0A 3OKLA 2GIYA 4MWFB 1F3DJ 3NN8A 4WCYH 1A1OA 1FL6A 4OZHB 4U2YA 1DBML 3VXMD 1I4FB 3WFDH 2BNRE 5BW7A 2KZ1B 3D0LA 1UCBH 4K07A 3LDBC 4CNIA 3MLPA 2FX8L 4U6VL 3HNSL 2XN9A 1KG0A 2AXGB 4D9RE 4YXHH 3VXOA 3GSRA 4KJPC 4KPHL 1D7FA 4Y19E 4F7TB 5D71H 3ECBA 1KELH 1J1XH 4L3CA 3L3KB 1NEZG 1VGEL 4UV4L 4HFUL 3U2SB 3CZJA 4PGBB 1A1OB 1FL6B 4JY4A 1BEYH 1HQ4A 3AMLA 4QXTB 4RMWA 2D3VA 4NSKB 1JV5B 4NKIL 4ODSH 2MKLC 5ACMA 5AYUH 1EO7A 4QXUL 2B0SL 3BW9A 1HCVA 3PHOB 5IROA 4JRXE 1B4JH 1S7XB 4OT1L 5FOBB 1WWBX 5BCAA 3VXOB 5CSZA 3MSPA 5D1QA 5CD3A 5D93C 4ODXB 1CFSA 1MY5A 2AK4E 1LK3L 5J06A 4L3CB 5D7KD 4GG8A 4EI5C 5CGMA 1S9YB 2OR8A 4DVBA 1EHNA 4Z0BL 2JK5A 1DUZA 2OXGA 3ZKSD 3CFKA 2PYEB 5HHVL 3LN9A 3QUKA 4M6AA 1DBKL 5DSCB 5IHLB 5L0QC 1N3NB 3HUJE 3P11H 3PIQB 1D6EA 1C8PA 4OFPA 2AJ3A 4JDVA 4GXVH 5CD3B 4M43L 2DQFA 1RPQA 2F8VA 4I13B 2WZPD 3PWNB 4JFHD 3FQWB 4EUPA 1MNUL 1OB1B 4WI6A 1A6PA 4DVBB 1J86A 4YEEA 2DIAA 2JK5B 1DUZB 4AEHH 1QSFE 2VZOA 5FO7B 3CFKB 5GRUH 2QR0A 4BELD 1QA9B 3QUKB 4OKDA 5D7SH 1S3KL 2W07A 1D5BB 4R2GC 3Q0HA 2H2SC 4OIIL 1HE7A 3TV3H 1TENA 4QHNA 1D6EB 1NDGA 2FGWL 1I8IB 2ZUSA 1EVTC 4JDVB 3TIEA 2M1KA 4YDKL 5HHQA 2DQFB 2OBGA 3NPZB 3QDJA 1GSMA 1YPZE 1QRNE 2VRAA 3HNTH 4LSTL 2VAJA 4L8BA 1RUKH 3T0ED 1A5FH 2CKBB 4WUUA 4GMSL 3HE7A 4GOSA 2R29H 5I19H 4GG6A 4NO2B 1NC4A 1FVDA 3ZMRA 3V5HA 3EYQC 1A7PL 4KI1A 1QFUL 1D9KA 3RX5A 2VITB 4PBVC 1ZAGA 1WSST 2R4SH 5EIIA 4LEXH 5HHQB 1Q94A 2M26A 1LO4L 3QDJB 4NNYB 2W9EL 2D9QB 2ZCKL 3MRJB 4WUUB 4UT6L 4JZNB 2FR4A 5C7XL 5KAQG 1P1ZA 2B20A 2VO5A 4PJHA 3ULVF 1G6VK 1KJ3L 4I3SH 2MCG1 3RWJA 3KPSB 4HG4K 3RA7H 4JFYA 3R0MA 3JV5A 5FYLH 5HHMD 3V5HB 1A3QA 2YR3A 5EIIB 3QG7L 1B6DA 1JYWA 5DMIL 5BV7C 2E9WA 2IALA 1OTUC 2VDPH 2ZUXA 3BVNA 1HHIA 2FR4B 1FE8L 3GSWB 4HJ0C 4KY1L 4QHLB 5E1AA 2AV7B 4PJHB 2F53D 5E00A 2FJFB 1W0YT 2IAMC 3LV3A 1M05A 8FABA 2DB8A 3DIFA 1LO0H 4HWEH 3RQ3A 3V9FA 3PWPB 1KLUA 3QEHB 4E0RA 4UIMA 2IPTL 4K94H 3W11C 2YRLA 3HC4H 1TPXB 2IALB 4LPCA 2NNAA 5I2IB 4R4ND 3MLVL 1HHIB 4DGIH 4HCRA 2DLIA 3EFFA 1H8OA 4LSVH 3BKYH 1YMMB 5DVNA 2J88L 2Y5EA 4OZ4A 3T4AB 3EYSH 4TSBH 1K4DB 4WU7B 1G7MA 3NIFE 3MYJA 1XF3A 8FABB 2DMKA 4PV8A 3V4VL 1A4KA 5ETUB 2MNUA 4NC2B 4Z7WA 5TE4L 1OAZH 2BSSA 5T5FH 3QQ4A 1M7DB 5DRZB 2YA1A 2NNAB 5F9DC 1I7ZB 1YN7A 2GJ6B 4KXZH 3U46B 3LMJH 3GB7B 4O2CB 1WICA 2J8UB 5FDWB 3O2VH 2UY6A 1UKSA 4KKNA 4WI2A 1XF3B 4UAOC 3MLUL 1F6FB 4OTXH 1P4BH 4J3XA 1A4KB 3B9KA 4P2OD 5LGHH 4NKOA 4Z7WB 3CGTA 4JHWL 4M5YH 1WBXA 2BSSB 4PRHE 4ELKB 4Y4FD 1Y6KR 5HGBA 1RJZB 2WBJD 3QQ4B 2ICWI 1T7XA 3LY6A 5K9OA 4LKCA 2LQRA 5KVGL 5IHBA 1FV1A 4QO1A 5FGSA 1I8MB 4MNQD 1F6LL 5GRVK 3UC0H 1GGTA 1N5YL 2Z31D 4YWGH 2BJMH 2XWTA 1JN6A 4UTAL 1FYTB 5FUZL 1EHAA 3S97C 3HPLA 3B9KB 3EZJB 2F54D 2NLJA 1NCCL 2CKBL 2JJWA 2MQ3A 4M7KH 5F8RC 3BUTA 2R9HD 1WBXB 1FZMB 4BZ2H 1N0XL 2DWDA 2XYCA 1U36A 1LNUB 1Z9MA 5HGBB 1I7UA 3QAZC 3FMGL 4XVJH 1KCLA 2AJXH 3MRKA 3WD5L 3WKML 5B39A 1FV1B 2YMXL 1IKNA 2Q8BH 5T3ZD 3QCVH 1SJXA 2OQJA 1VB9A 1L0YA 3CFJB 4WFFE 3MV8A 4XZUA 3SKUD 3O6MH 3O3UN 3N85H 5B8CA 4HDIB 3WLBB 2XWTB 3MBEA 2PXYA 5IVXA 1O5DT 1NCBL 2NLJB 1J0YA 4OF6A 1CZ8H 4PJ5E 5D2LF 3G04A 1AP2A 2I27N 2LV4A 2H32H 4U7MA 1UYWH 4G6JH 2UUDH 1GZPA 5ITFA 2Y7QA 4Y4KA 4EDWL 4NQTA 4OLXH 5GGTH 3GI9H 2OP4H 5FK9A 4XI5D 1PX3A 3UTSA 5ID0B 3BO8B 2OQJB 1IAOB 5J13C 2XQBL 4OCWL 2Q7YA 4XZUB 4HH8A 4MJ4A 5CSBA 4JM2F 5CZVL 1MQ8A 5ESQA 3LSOB 2PXYB 4HUKB 1IE5A 2ZSVA 1U3HC 3G04B 2AGJH 4WVRA 1RZKH 2WUCL 1HYSD 4GRLA 4PP1C 4QWWD 3IDYC 3KJ6L 4AH2B 4Y4KB 5DJZA 1V7NH 3P3YA 4FQQA 2FZ3B 5EU6E 2VDKL 3UTSB 2VLMD 3C60C 2MSPA 5C09D 3G5XB 2X89A 1C08B 2HA1A 2EDYA 5C8JA 3EYUH 3RZCC 3RL2A 3UZEA 1AXSB 4YFEA 5GRWA 3PHSA 4TUKL 1BMGA 4F7EB 2ZSVB 1QNZL 4PS4L 3OHXB 4GRLB 5GS0C 3LD8C 2C4FT 4Q0XH 1T7YA 1MJ7L 4AL8H 3ARSA 5D1QD 2A6IA 4NWTL 2PO6B 4YHPA 4ZXBD 2DQDH 3MCLL 3OBAA 4XBPA 1KACB 3W81A 4CVZA 2VDOL 2Q8AH 3DTXA 3DARA 1T7WA 2XICA 1MHHA 1TVHB 2QSVA 5TPWH 1JPGA 3VGBA 3RVUD 3E8UL 5F1SA 3FQXA 4HCRL 3ZE1F 4OZIB 3DJ9A 4LDOB 4ZYKA 5FYKL 4CRPA 1S7QA 3ARED 4YBLB 4N8CL 3H7BA 3ARTA 3UPRA 4YHPB 3AROA 4XBPB 3G08A 4N0FA 4KV5F 1JGEA 1NGQL 4V1DD 3S96A 1X9QA 2YK1L 2WLZA 3EOAB 4FQXB 2XFXA 5J1SC 5KOMC 1I3UA 2NY7L 3FQXB 3QWQB 4RMQA 3BIKA 4V2BA 4KRPC 3I6KB 3OB0K 1YNLH 1LWRA 5I8CA 4ZYKB 1S7QB 1N6UA 4OD1H 1KCKA 1N5AA 4DOHB 5K9JH 3TWCH 1D6VH 4IDJH 5F7WC 5MHSD 1A3RH 1YEKH 2DTML 3S96B 1T21A 4KKCD 1TETH 3L3HA 3BN3B 4H8WH 3RWGB 1F4WL 1RZGA 4L1DA 5L9DH 1XIWC 2AJVL 1P5VA 4HX1A 1J0ZA 1A7BA 2VZUA 3IKCA 2BRQA 5DJ2A 4TNWK 3EO9H 2QLVB 1KEGL 4PJEA 3BIKB 5KOVC 3TO4B 1ZT7B 1J05B 2AXHA 3MV9D 3FN3A 3UYOD 4HWNA 5E2JA 4R96A 4ZUSA 1DQQA 4HGKC 4NRYA 4X7FC 5HGHA 4YK4B 1UG9A 3TA3A 3FFCD 4KHTH 4Z9KB 2WWMD 1KLGA 3TZVD 4TTDD 1IEHA 5J1TC 1J12A 3WNMA 4EN3C 2CLVA 4HX1B 2BXYA 3IKCB 2I9TB 5DJ2B 1IKFL 1QSVA 2KZWA 3NH7H 4P5MA 2YD6A 1I85C 4PJEB 4L4VE 5CHNA 4GW5A 4I2XE 4WGVB 1J5OH 4HC1H 3QUXC 4ZUSB 1N6QH 1DQQB 2F58H 3PNWA 2RHEA 1FIGL 4XAWH 4JR9L 3O8XD 2E6PA 4LF3A 4X5XA 5D2NC 5F88A 5D7LB 3TA3B 1MY7A 4EXKA 2V5MA 1KLGB 3ARFB 5FHBL 3QCUL 1ZANL 5T3XH 3RWCB 2VLKA 3UJIL 1KCVH 3ROOA 5GS2D 1VDGA 3S35L 3BGMA 4JDZB 4KTEL 4P5MB 5HDLA 5M94B 1E4JA 1NMAL 4M1GH 3GIZH 4Z7UE 4HPYL 4GW5B 5DZLA 3O6LL 2DD8L 4MQ7B 4PTTB 1A6AA 2P8MB 4P2QD 2BY2A 3PNWB 2QQKL 1A7NH 2JELL 2CMRL 4GAGH 4R97C 4LF3B 4PJDB 3FAWA 3M8OH 4LBEA 2FB4H 3UO1L 1MQKH 4R8WL 3C08L 1WAAE 1BQHA 4HQQL 4PJFE 3MREA 4RGOL 1EAPB 4P99A 2OI9B 4MAYA 5I18L 3QULB 4LHUA 3OF6D 4W4OC 1CDHA 3O45B 4K3JL 1PKQA 4QHKJ 3BGFC 4OZFG 4GQ9L 4YZFF 2Q76A 1ZWIA 2FX9L 2XXMB 1QVOA 3GK8L 3LEYL 1JRHH 1LP9F 3SO5A 4KZEL 1ZHBB 4Q9RL 2CQVA 4OLYL 5SX4I 1BQHB 2R2EA 2WBKA 1F6AB 3MREB 2OL3H 4PJ7B 3QUYC 2E7MA 1IQDA 4XNXH 2VXSH 4G42A 5C6TH 2IWGA 4N0CD 3KHOA 5IBLD 3UYPA 3ZDXF 1PKQB 3VD7A 1NSNL 3SJVD 3ARYA 2Z91A 3QHTC 4U7KA 3X12A 2F9BT 2BY0A 2EDWA 4X6FA 4BH8B 3CSGA 3G5VA 4J8RB 1IL1B 4Q6IC 3QYCA 3TVMA 1EDQA 3CFCL 1YYLH 2IJ0C 2APXA 4X4XB 5ITBH 3PWVA 3X14A 1MJJA 15C8H 4G6KL 5B38G 1ZMYA 4XXCA 5HHOA 1RK0B 5SWSA 2Z91B 1QKZL 1AXTH 3H9SE 5JW4N 4PRDB 3I85A 4LHJB 5FYJL 1X7QA 2JJTA 3MRDB 4XAKE 3TFKC 4OLUL 1Q9LA 4YPJA 3QI9D 1X5GA 5CP3H 3TVMB 3KYKH 2OJZH 1UJ3C 5D7JD 1BWWA 2X44D 5IEKB 2BMKB 1Y6NR 3FO2A 1JNJA 4L1HA 3PWVB 4JKWA 5C0IB 5DJYB 3U4AA 3X14B 4CU7A 4DKEH 1P53A 2YWYA 1L7IH 3T77A 5DZOA 1QSEA 1UACH 4XVSL 3MJ9H 4HJJL 1CGUA 4XPTL 5CLTA 2KH2B 1R3IH 1QG3A 5AD0A 2EH7L 5F3HB 2KQNA 3MRBA 3CZFA 4D8PB 5GGVL 5E8OB 4I3GA 4HK3N 1HILA 3ALXA 3MRPA 3FO2B 4WV1C 4JPVH 3LEXA 1NEZB 3OB0H 4TQEL 4F7PA 1L0QA 3FRPG 4LRNH 2GQHA 2ARWA 1HQRA 5IM7A 3K74B 4NQCA 1S9WA 3G6JF 3W0WE 1YQVH 1FGNL 1CFNA 1QSEB 2CRIA 1M71B 3GGWA 4WWID 3UAJC 4ALAH 1KBGL 4LSDA 2QQLH 4KDVA 4OM0L 4X6CE 2NXZB 3CZFB 3GHEH 5J6HA 1J0JA 4Z7QE 1KJ2B 2D9CA 2DLFL 4PJXF 4OJFL 3GNML 3LEXB 4PYHA 3SKJH 3ZE1E 4F7PB 4JG0L 5JOPE 5IR1A 3O6FD 4TRPH 5ANMB 2A0LC 5GXBB 3EYOA 1HQRB 5IM7B 1EERB 2AK1H 3WN5B 4Q74A 1FSKC 2IEPA 3Q6FA 4WFED 1SBBA 3GGWB 3U36B 4YDIL 1XGPA 4DVRL 4N8VG 5EOCH 1V3KA 2NY5H 4PREA 2H26A 3WDHA 4JVWA 1S9XA 2VDNH 3CLFL 2Y07H 4KMQA 1OD9A 1UC6A 4P5KB 4W6WB 3QEUB 1BD2B 5FKPA 2A1WL 5FF6A 4CADB 4WTWA 3QWRD 2EE6A 1DSFL 5KVMC 4HKBB 4ZUVA 4F9PC 3LZFH 3RFZC 2Y36L 4CVUA 3I75A 4QRRE 4JJ5A 4PRID 3I2CH 4EI5B 2BVOA 3GM8A 5I1GL 4AZ8A 3BUYA 2H26B 4X4YA 1I1CA 2ZNXA 4LCWE 4MA3B 4Y5VA 1FPTL 1VFAB 3VRJA 1SEQH 3H9HA 3U6RB 3MNWA 3TNNB 4LSQL 5IBTH 2DQUH 2MPAL 4Y1AE 5IWLC 5CCKL 2X4QA 4L29B 5D6DA 1UEYA 1VGKA 3TYFA 2FATL 4P59L 1ZLVK 3TYGL 4HKJB 2QADD 1FAIH 2FYYB 4IS6A 5BZWA 5AG8A 2H9GB 4Y5VB 4AENA 4RGNC 4P23D 4OUOA 1H0DA 1J8KA 3EOBB 1REIA 3ARBC 5BS0A 2CGRH 1AGFA 5JA8B 4XPHH 1BAFH 3IU4H 5GZND 1BHGA 2BDNL 1IM3B 3OZ9H 3CXHK 3UJJH 3CCHB 1S9KC 1VGKB 3TYFB 4AMKH 3IAGC 1M7XA 3ARDD 2VDRH 4L4TD 3EDEA 3UZQA 1BBJA 1J8HE 4OV5A 5KSAA 4UT9H 2NY3B 3RTQA 1F45A 3GI8H 2H6PB 2HTLD 4QGTA 3OAUL 3OSKA 5F7HA 5LQBH 3ZKND 5L8KB 1F4XL 1N4XH 3UTZB 1ZVHA 3CLEL 3MV7D 4M7JH 1CGXA 1CR9H 1JPSH 2Q3AA 3I6LD 1M6OA 1W8OA 2OTUA 4LASL 4HUVA 3AM8C 3I3BA 4R3SA 3RGHA 4R0LA 4S1SH 3V4UL 2DJ4A 4LDLB 4JFFB 4R26L 3SGJA 1I3GL 1WWWX 1MH5A 2UY7A 1UM6L 2CJUH 2X4NA 5L88H 2A74A 1IGML 4WO4D 3AS3A 1G9ML 1OGAE 4U1IA 3FO0L 4EDXB 5D1XD 1KTRL 2EIZB 2AABL 3CDCA 1M6OB 3LEVL 1LP9E 2OTUB 4K8RL 5TJWK 2P5WA 1I1AA 1X4YA 3P0VL 4ODUA 4R3SB 3O4OB 4L9LC 3GM0A 1Q1JH 5JO5B 3TNMA 1WUNT 3IXTA 2X9YA 4JAMB 1YQ2A 1WZMA 1MH5B 4DN4L 35C8L 1NKRA 3QDGA 2ZJSH 2R56L 4X4MA 4R4BB 3DX8B 3IB4A 5IB4B 1NAMH 1YJDH 4F58H 3ZDXE 4LQFH 2ED8A 3BKJL 1XF2B 5FFLA 4U1IB 3SDCA 3VD5A 2UYLA 1KF9B 1HXYA 5LGJB 2P5WB 4ODUB 1UZ6E 4DUVA 3NAAL 4HPOH 1LO3H 3IXTB 3PQYA 1NKOA 3FHAA 1SY6H 3ETBF 3I50H 1CS6A 4AIOA 4NJAL 4DW2H 1ORQA 3J7HA 4WI7A 4EBQH 2P8PA 2P1YA 4DFHA 5GRZA 3FQUA 2UYLB 5IMKA 4Y2DD 4Y5XC 1QBML 1NFDF 4H20H 4NN6B 3V6OE 4Y8DC 4MXQC 5E4EC 2DBJA 4QOKA 3GIVB 1YYML 3MZGB 4TOYH 4R4FH 4RWYH 5INDA 1DR9A 4P2OC 5L6YL 4I3RL 1RZ7L 5MENA 5J9PA 3TN0B 2A9ML 5ERWB 2V2WB 5E4IA 3OJDA 5ID1A 1R3JA 2FO4B 1VFUA 3D39A 4LEOA 2P8PB 3HHRB 5DT1L 3ZDZF 2V2XA 2XWBA 4BQ9A 1KFAH 1RUML 4HULB 3P9LB 3REVA 3WUZA 1T1ZA 2BNRA 5GRXG 5INDB 2FCBA 1Q9WA 3MLSL 3F7YA 3E6HA 5GJTL 1MAMH 2BVPB 2W9DL 5LXGH 3BDYL 4NUJA 2COQA 4Y19A 2ATKB 5J89A 3D3VA 4JKMA 1QLFB 2D0FA 1MCQA 2CDEB 3REVB 2AS5M 5GS3A 2BNRB 1P7QD 4JO2H 5DJ0A 2KL6A 2N56A 3HAEA 2NY6C 2XY2A 1P4LA 4FFYL 1Q9WB 1DVFC 3F7YB 5F3BA 3E6HB 2WINA 3TBTB 1RHFA 5I75C 5T1MB 1SM3L 3NGBB 1KB9J 3VDCA 3BP7B 5BJTA 1R6VA 4JRXA 3QJFA 1D5IL 5TDNA 2FH8A 2C1PB 4U6VH 4Y19B 3HNSH 2HFGL 1ZLVH 2AK4A 1ITCA 3NFNB 2HVKA 3TIDB 4KPHH 4L8SA 5J13B 2EXYD 4CN4A 4N9OB 4UV4H 3KXFE 2Y9RT 4HFUH 4R7NA 1DBJL 3CSYA 4HZAA 2VLRE 5DEZA 4QHUA 1RK1A 3FT2B 2WINB 1HYSC 5F97E 1ETZA 4YPGB 4A6YH 4HKXA 5BJTB 1CDUA 3HUJA 4NKIH 1U3HB 3AU1A 2NPLX 2UZIH 4JRXB 4HUMB 3CXDL 3QJFB 5TDNB 4QXUH 2AKRB 2DIJA 2ZUUA 5LGKA 5C08E 2D0GA 2AK4B 1ORSA 1VHPA 1P5UA 4L3AA 4HH9B 4OT1H 4GRMA 5KSBE 2HVJA 1QPPA 5KVDH 4TSAH 4L8SB 4XXDA 1T1WB 3LH2L 1A7OL 4MDJA 4R7NB 5C3TA 1QSFA 1B0WA 4OKVB 3RUGE 4ONHB 4QHUB 1RK1B 1OVZA 5DRNB 4O00A 5C9KA 1J1PL 2VJXA 4Y89A 3I9GL 3HUJB 1KIRA 4M7LL 1G1YA 4U6HB 1DEEA 4NQDE 1U93B 1A9EA 5DK0A 1ZHLB 1DBKH 2O5ZL 4HKZA 3VRIA 5ICYA 1EGJH 3B3IB 3WL9A 3MRNB 1NBQA 5CILH 1DBAL 1MCPL 1YPZA 3QNYB 1FFOA 1FNAA 2F15A 2BC4A 4DN3H 1U8HA 1K9TA 1IGFL 4I0CC 2FGZA 3X3FL 1QSFB 1PW3A 3NABL 4X7TA 3IDMB 4JQXC 3WS3A 1MEXL 3QIWD 5EZJA 4AM0A 3S37L 1I8KB 2W0LA 4OB5L 4FXKA 3MLRL 5DK0B 2A73B 3V6ZB 2L0DA 2L4OA 1AFVL 3RGVC 5B4MC 1S3KH 1EZVX 4HKZB 1CICB 1YY8B 3HG1A 3OPZL 2YC1B 4OIIH 2VWEE 3WL9B 4MCYA 5E8PA 3LRSA 1YPZB 1QRNB 2FGWH 2Z92A 4MAUL 4ODTL 5HBBA 4TVSa 3H3BC 5TDPB 4YDKH 4OCRL 5EU5A 4TVPE 4K94C 3JWOL 4LSTH 2FJGA 2WK2A 3EDJA 3B8YA 2UVFA 1F5WA 3GMQA 3PGDB 5EZJB 4P48A 4GMSH 1KXTB 1XGQA 1P2CB 4ZDHA 5E2VL 2UWEE 4I0KA 1RZFH 4B0MM 4BZYA 4D94A 4WW1A 4MCYB 1NJ9A 5E8PB 3U48A 1A7PH 1QFUH 2I26N 2VZTA 1PBYA 4ZSOE 4MXWL 4PGCA 5F7YC 4NC1E 5IMMB 1LO4H 3T3MF 2XZQH 4WJ5A 4MMXC 3CK0H 1A8JH 1WZKA 1XIWB 3V8OA 2ZCKH 4LLVA 3GMQB 4UT6H 2AJUH 4XC3L 3STLA 5C7XH 1ZT4B 1XGQB 5GRJH 5KSAD 2IFFL 1AI1H 2XTLA 2RGSA 1JI1A 2B8OT 5FA4A 5DC4B 4NQXA 2ARJA 4JFED 4WHTA 1NJ9B 3MLXL 4J3OC 3TZVC 3DO3A 1LEIA 4ONFL 2HTKC 5CEZE 1WCBA 1DQJB 3QH3B 3QG7H 3CVHB 3RJQB 5DQDH 4X83A 5DMIH 3D2UB 4GH7B 1WBYA 2G60L 4G9DA 3PL6A 4IRSA 3VFPA 1T5XB 4NZJA 1KIQA 4J3TA 3MFFA 1SJEA 3EO1A 4LRIC 2ADGA 1Z9SA 5C92A 4JPIA 4CDHA 1QO3B 2RB8A 4KY1H 5DURD 4RX4D 3AGVA 3D5OF 1C12B 3S36H 2AEIT 4LLWA 4U1MB 3A6CH 3MV01 2FHCA 1QYGL 3DI3B 4CW1A 2ARJB 4HUWA 4WHTB 4QT5B 3TT3L 3O4LD 3KAAA 3GMMA 1A6ZB 1EEZB 3DVGB 2XXCB 3TCXA 1C16B 4F57L 1C5CL 3VWJB 4XVUC 3RIAK 1MIML 4DK6A 2NY2D 4G9DB 4IRSB 1WJ3A 1HH6B 1WC7A 2EO9A 3MLVH 4X99A 3MFFB 5HVHC 1A9BA 5CJXC 2DWEA 3ZE2E 4MSWA 2EC9T 4LLWB 4MA7L 2B4CL 1K8IA 1I3RB 3MRRA 5JXEC 3S9DB 5GJSL 4PRHA 4M4RA 3LS5L 3GMMB 2PKDA 1GCFA 1JGDA 2NXYB 5TE4H 3NBNA 3SDCD 5DJCA 1JYNA 1TJIL 1WTGT 3S36X 1ZA6A 2YPLB 3HFML 4ZODA 1AR2A 3VFWB 3K81A 3QHZL 2X70B 1FZOB 1RHHA 5C0DA 2DWEB 4XHJC 5DMGD 4P46C 1KCSH 3ULUD 1X5AA 4NOBA 2GT9B 5HDQL 3ZDZE 3MRRB 3VA6A 4PRHB 3MLUH 2VLLA 4G8GD 3T0BA 2W9LA 3BEVA 3DX7B 2P7TA 5TF1L 1NLDH 1JGDB 5HI4D 4I4WA 4JHWH 5D96B 3STBA 2LVEA 1RZKC 1MRDL 1U8MB 3Q5YA 1ZA6B 2P5EE 3SDXE 4X6DB 5B38B 4QOKD 5KVGH 1YEGL 4I77L 4Z95L 1A2YB 2EZ0D 1I8LC 3HI6L 2DL9A 1CL7L 4F3FB 1XH3A 3KJ4B 2R4RL 3SKOA 5ADOH 3AS2A 3T3PE 1N5YH 3IDGB 1MFEL 4P4KB 4FTVE 4ZFGL 2J4WL 2P4AB 4RFEB 4WWKA 3DXAA 2P7TB 1GGYA 3MRLA 1BQLL 1EO8L 2I9LA 1UA6L 5DMKA 4EUPH 1FN4A 2H8PA 1C1EL 4I4WB 1ZHNA 3X17A 1XR8A 4NHCL 4J4PC 1BFOB 1N0XH 5EO1B 4JRYD 1KENL 5I71C 2ICEB 3QA3A 3ZYZA 4F7CB 3WKMH 5F6IB 5FCSH 1KPVB 4JZJC 2Y6SD 5LJYH 1E28B 2ZOLA 4X5WB 5AZ2L 3QXUA 4BSWA 3EUUA 5DUMH 3BKCL 3MXVL 4IJ3B 2YSSA 4PJ5B 4F37K 5IW6A 1OM3L 4KKAC 1RV6X 5EOTB 3GO1H 1OL0A 4P0DA 5KW9L 3MRLB 1NCBH 3BQUA 3QI9C 1K3ZA 1FN4B 2H8PB 1R3HA 5D7JC 3UTTD 1XR8B 5EU6A 3L1OH 4JPWL 1JF1A 5IFAH 3QA3B 4EDWH 3JBG7 5D1ZD 5EU3A 1IC7L 4G3YL 1NLBL 4KGJA 4QNPF 3QXDA 5C2UB 2ZOLB 1NAKL 4OCWH 2YD3A 1AHWA 1MI5D 3CVHL 3KYAA 4BUHA 2YSSB 3UJTH 3QQ3B 1HXMB 5CZVH 1KNOA 4MYWB 4FMFA 3QIUD 2NX5D 3TJHD 1DQTA 3QDMD 2WUCH 5EU6B 2W65B 1T6VN 3KJ6H 2NTSP 4K3EL 4HIHA 2CDFB 2PETA 2VDKH 3U7YL 1XGUB 3I02B 5CINH 3BESR 5K33A 2J12B 1AHWB 4H8WC 2J8OA 3F6LA 4N8VB 4PJCB 4XWGL 2P49B 2Z93A 4TUKH 2MKWA 43CAA 5JW5A 4MQXD 3HC0B 4PS4H 3BPNC 2AERT 2EDBA 4ZO9A 5E8DL 4PJ8D 3VFVB 3B2VH 4KXZI 2ESVB 3MCLH 2BNQE 2D7MA 5AWNH 5HHNA 3SDDA 4KTDH 5H35A 3WHXA 2VDOH 2EDXA 4DFIA 4O4YH 2E7BA 4F33A 4JO1L 1ZHKA 4WIQA 2YXMA 1RZJL 4OQTL 4IIQA 5FM4A 2I60L 3J8F7 3DETC 3H6JA 4HCRH 4G9FE 1ZLSH 3BPOC 5IJKC 2BK8A 5FYKH 3G9AB 4GAFB 4N8CH 3EHBC 1TCRA 1BJ1H 5D7IE 1HKLH 3LIZL 4G6AD 3FO1A 3ARGC 1ZKAA 5HHNB 1JZ5A 3R4DA 2FDBP 3WJLC 1CT8A 4F9LC 2YK1H 5C6PB 2Y1VA 1CXEA 3BZDA 5I73B 1T1XA 1NGXA 1OTTC 2DN7A 4FQHB 4RGMC 3VE0B 3ARRA 2IANE 2MFNA 1NC2A 2NY7H 3O3EA 2C3WA 2JB5L 3FN9A 3HI5H 3HG1D 5IKCA 5DK2B 3MGTB 1MRCL 2GY7B 4D0BB 3BRGC 5SV4A 1OPGL 2ED7A 3JV0A 3FO1B 4HWUA 2NY0B 1U8IA 1FAKT 3U7WL 2DTMH 1CT8B 2BNUB 4X0KA 4OLVH 1QACA 4W4NA 4BM7A 3MQIA 1AGBA 3CC5A 2PYED 4YDJA 2YD1A 1H3GA 3IFNL 4KI5C 1RIUL 4P49A 5EBLB 2X4UA 3VXME 4ENEC 3D85A 4WDIA 5IKCB 4V2CB 3C8DA 2HT2D 1U6AL 3QPXH 2P48B 4WFHD 3EOYG 5EUKB 4JQVA 5IB1A 3CFBB 1M1SA 2ZG2A 4BFIB 4L4VB 4DEPC 4Z7UA 5D6CB 4I2XB 5GSVA 1AGBB 3KR3L 3H42L 2FJHB 1SHMA 3SDYH 5A16A 2DI9A 1OF2A 4EIGB 3D85B 4OCLC 3CPLA 3D1MC 3RIFF 2G5RA 3MUY1 4ODBD 1FIGH 5GGQL 1BVLA 3NIGF 4U6XA 5IESH 4FMKA 4MS8C 2ICWJ 3PL6D 5I30L 3QCUH 5E70A 2VR9A 3I3EA 2H1PL 4PBWD 4Z7UB 3ALWA 4Q2ZB 3PV6A 1VFBA 3S35H 1J1OL 4NP4L 3HNVL 3O9WC 5CJQL 4KTEH 3X13A 5KBNC 3C87A 1H5BC 1OF2B 4E5XA 1RZ8A 4GRWH 5HGGS 1F2XK 4K7FB 4M9PA 3QUZA 3WIIL 3MC0A 5SWZD 4YAQA 2QQKH 3L7FB 2JELH 3V5KA 2CMRH 4DK3A 5CJOL 1BVLB 4B41A 5A2KH 1JYXA 4YFLI 1N64L 2DQIL 4HFWA 4PJFB 1DLFL 4WO4C 4NZTL 4BZ1L 3UO1H 3C08H 4P9HH 5IEHB 4NZRL 5AG9A 4RGOH 4JFHE 3X13B 5I18H 1OSPL 1U8QA 2EYRB 3TPUA 2FBJL 4E5XB 5EBMA 4PGEB 4K3JH 3WEXA 5C07D 5AAWA 4K71C 3S35X 4GQ9H 4KJYA 4OM1L 4XCFH 1SMAA 3GK8H 5FV2A 3LEYH 1YEEL 4XTRD 2CO7B 3JTSA 4Q9RH 3VXPA 3HPJA 4OLYH 1HHHB 3ALPA 1MAJA 5D2LA 3EJZC 2VZ1A 4EQ3A 5BZDB 1U8QB 3TPUB 3H9SA 3T0EE 5FCUL 3GMRA 5EBMB 2YPVH 2AQ2A 4BH7A 1PSKL 3WEXB 2W38A 3TBSA 3PWPD 3DURB 1JHKL 4HIXH 1KB5A 1GC1L 5MP6L 3R8BB 3QISA 3REWA 3DSNA 3JTSB 3VXPB 3HPJB 4NQEE 2XT1B 4Y2DC 1YMMD 3LPFA 3CFCH 2GTWB 4P2RA 2X42A 3MCKA 4KROC 3JZ7A 4XCCL 2J5LB 3H9SB 4Y5XB 4X9GA 4NM4L 4HS8L 1BVZA 5E4EB 5H94A 1R3KA 4QRPD 3DXAD 3AAZB 3TBSB 1QKZH 1JF5A 2CLRA 3VMPA 4NRXA 1CTNA 4LP5A 1JZ7A 5HXMA 1LD9A 4QNPE 3VWKB 3I6GA 5FYJH 3LKSB 3ULSB 2IH1B 2NY5C 5HHME 5TFSL 2Z4QA 3WO3B 2G9HA 1OGTA 1A7QL 2GJ6D 3IDUA 3R06B 4PRAB 5H2BA 5J11C 5IF0A 4OCYL 3MCKB 2VH5H 2AJZB 5H94B 1R3KB 3SGEH 3BQUD 3MRQA 5BQ7B 4XVSH 5DFTA 4NRXB 3HMXL 4HJJH 2F53E 4XPTH 2V2TB 3CFEB 1EFXB 4O58H 1K5NA 3I6GB 4AQ1B 1U8OB 2Q87A 4N90D 5GGVH 1OGTB 4GS7B 4ESKA 1IM9D 4LMQI 3TGXA 5EO0B 3W0WB 4LAQH 3PP3K 3RWFA 3D25B 3MLTB 1FYTD 4X6CB 2OZ4A 1NUFA 5F7DB 3MODH 3KLAB 3G6AA 3OKOB 5BXFA 2W60B 2ZSWA 4HGMA 1KBGH 4OM0H 3VGGA 2W91A 5C0RL 4QHMB 4YH6A 2VDLL 3STZA 3PJSB 2DLFH 4I9WD 3IDNB 1JMXA 3RVVC 4OJFH 3GNMH 1T04A 3L5HA 1U91A 2HWZL 1A1NA 2EDKA 2JCCF 3L5IA 4QRRA 4JGJA 4PY7A 3WO4C 3G6AB 5BXFB 3U9PL 1AGEB 3MLYL 4PTUA 4YDIH 1PLGL 3SE4C 1S5IL 3NPSC 1JRHI 1KTDA 4LCWA 4PJAB 3STZB 3SDDD 4APQA 5KVFL 3MOQA 5EBWA 4OI9A 5E6ID 3A0OA 5F7FA 5F7UA 4FQPA 1DSFH 3W9EA 4OFYA 4E42A 2N1KA 4MNQE 4F2MA 5EZIL 1PEZA 3U1SL 3B9EA 3OXRB 5DRWA 3MRGA 2Y36H 3P4LA 5HTSA 4PTUB 2DL2A 1KUMA 3EJYD 5I1GH 4KJQD 2N4IA 4NN7B 3ULVD 3WV0A 4MNGE 2F54E 2ORBL 4FFWC 4BFBD 4JFQA 1TJGL 3QQNA 3WFBH 3B8SA 4LKXB 1ZGLB 2V7NB 3KVQA 3MRFA 3FT4A 4M03A 1TFHA 4J3VA 3ZKMD 5IB3B 3QJHA 1WTLA 4WCYL 4Y1AB 4JB9H 1BX2A 3SGKC 4LSQH 1NC2D 4F2MB 5T3ZE 2OR7A 2MPAH 3MRGB 3QIWC 2XA3A 3OKMB 1Z6JT 5CCKH 1D5ZB 5E7BA 1ZA3B 1CDIA 3UYRL 2FATH 4P59H 1J8HA 1MELA 3TYGH 3HCVA 1UEMA 5KANG 2JE8A 3E3QC 4YXHL 5DA0B 1CGTA 1JP5A 1KELL 3FT4B 4JFDD 1UWGH 3GJFA 3OAYK 4NO0D 4QXGL 3SN6N 2X4SA 1GOHA 3NFSH 4LU5H 3U4EA 4KK8D 5F89A 1YJDC 4UBDC 5BVJA 2BSED 3T0DA 4H26B 4ODSL 4XH2B 1IZKA 4PJGF 5HYJD 2VISA 3BIBX 1J8HB 3BH8A 1FCGA 2X4TB 1B4JL 2XKNA 3C5ZB 4HS6B 5ESAA 2BERA 3PHQB 1UM5L 3RY6A 4DTGL 5DLMH 2XZAL 2P24A 4FQXD 2PF6A 1G9EA 2VDML 4J1UA 1PX4A 2CUIA 2X4SB 2ZOKA 2ZUQC 3U4EB 5IMOA 2HT3D 5F89B 3DRTB 5I15L 1HSBA 2VLME 4KUZL 3U30B 3OAUH 4UU9B 3L3IB 4U1JA 1LP9A 4GBXC 1AKJA 1R5VA 3CLEH 3BH8B 2QKIA 4LASH 1AD9A 4LFHG 4LSSL 4UIKL 3V4UH 3IJHA 2CDGA 3ARVA 5AUMB 4R26H 4F8TA 1I3GH 2P24B 4Y16C 4QRUB 4J1UB 1HDMB 2ZOKB 1OGAB 1JGLL 1HSBB 3FB5B 3VH8A 2X40A 3VG9B 4AEHL 1RURL 3TO4D 1FZKA 1G9MH 2EE9A 4KK5C 5GRUL 5D7SL 4CAGA 2MMXA 3KPRD 4ZOCA 2EXWD 4XCEB 3TV3L 2AABH 1NCDH 4K8RH 1FNFA 2QEJA 1L9MA 4ZFZA 4RDQG 5CGTA 1F3JA 3P0VH 3A6OA 2PW2B 3QO1B 3QSKB 5CS7A 1ED3A 3IJHB 4O2FA 4X7CC 2V5SA 4DN4H 3HNTL 5CAYB 2R56H 1P9MC 4Y4HA 3T0VA 3EYFB 5L2JA 1A5FL 1OP9A 3RDTC 4V1DE 3V6OA 5ISZD 2D7QA 1QZ1A 3F5WB 3FT3A 5KZCB 3PXJA 1OT2A 1T1YA 2HRPH 2YPKB 3VW3H 4K7PY 3WNKA 1IGJB 3HI1A 4N68A 4G8EB 4TNVK 5K9KA 1FDLH 1QQDA 3PP3H 3F58H 4PG2C 4LEXL 5BRZA 3ARFD 1T7ZA 2YS4A 2FECI 5FHAH 1Q9OA 4MX7B 4Y4HB 5FO9A 4UILL 3DMMC 4FG6D 1ZOXA 3DNKA 3BYYA 1KEML 3ARXA 3FQTA 3QFDA 3GJEB 2N7AA 4M7ZC 3RWHB 1J9CT 5C0NC 4ZMAT 5I17B 3WMSA 3IAQA 4KMTL 1QBMH 4CN1A 3RA7L 3VXQB 5FYLL 5K9KB 1YYMH 5I74B 4GG6E 4F7MA 1MLBA 4JM2D 4ZQKB 4DAGL 3G6JA 3MV9E 4C56B 3OKNB 3F8UB 4I3RH 4PFEA 2ADJB 2A9MH 3DGGB 4EZMA 1AGCB 1Q9OB 1B0GB 2VDPL 4IRJD 5EZOH 3VI3F 1AO7A 2ZNWA 3VXRD 3FFCE 3MGOA 2I5YL 3GRWA 4BK4A 4L8DB 2VL4A 1BFVL 1CVRA 1N0LA 3BWUC 4LSPL 4N5UA 2EYSB 3HR5A 5I0ZA 3MUGA 4PJIE 1GXEA 4POUB 4PJXA 2X4PB 1EEYA 1NUDA 1LO0L 4HWEL 4QRQB 5F7KC 5FGBA 3CDGA 5CEXA 3HS0A 3QPQC 4PJ9C 1D5MB 2DAVA 2EDFA 2L7UA 5EU4A 1HIMH 1UB6A 3CDFA 5GJTH 3IETA 2W9DH 5DD0H 1S7WA 3MGOB 2C3HA 1PY9A 3BDYH 5KANI 3MUHL 3WXWL 5KS9F 1DUYB 1NDMB 3F7QA 1G7PA 1RFDL 2NZ9C 3HZVB 3O3AA 5IMLB 1IC1A 1YEJL 2LE9A 4LCCC 4YE4H 1CXIA 5DXWA 2A6JB 5C6WH 3CDGB 3DUSB 1UCTA 5KG9A 3BISA 1I3VA 1OAZL 1YECH 2FL5B 3SO3C 4HLJA 1PY4A 4P2QE 4FFYH 5ICZA 1XMWA 2CLZB 2NW2A 2V9TA 1SM3H 4M93B 1GJIA 4KWUA 2X4RA 2C26A 5C08A 1GAFH 2LU3A 2E9BA 1FLRH 1JHTA 5TGBA 1D5IH 1JFQH 4MGXA 3VDAA 4U1GB 4E9LA 1JNNH 2HFGH 3FCTB 4I0PD 2GJZA 2X1QA 3KXFB 2F5AL 4TUOB 2VLRB 3RUGA 4Z78A 5LGHL 2D7NA 3MNZA 4DCQA 4HUXA 3SDAA 1WBZA 3C2AL 3LKOA 3AB0C 2NW2B 1OTSD 3RVXC 5IV2B 5C08B 4NQVA 3ZLQC 5IT2H 5TGBB 2NY4D 1EEUA 3CXDH 5KSBB 2N7BA 3CIQA 5BVPH 1YUHA 2GJZB 4YWGL 1CE1L 2LU7A 1HNGA 2D2OA 4BSJA 2VQ1B 5BOPA 3MUJA 3RUGB 5K59F 2R2BA 4Z78B 3Q3GB 4M7KL 1A21A 4HUXB 3LH2H 4RFNB 1WBZB 4D9LL 3LKOB 3O3BA 1ZXQA 2AJSL 4NQDB 1BF2A 4MQSB 3SJVE 4ZAKC 3I9GH 4APQD 4NQVB 2Q8BL 1RSFA 1XF1A 3QIBD 4U1NB 2O5ZH 3DV6A 2G2RA 1MHEA 3FB7A 2WP3O 5JNYA 3IU3B 5J3HC 2A77H 2X1PA 3DX9B 3ZT5A 2X7LA 4UI2A 2R0LL 5IVZA 4XWOD 3UX9B 1A6TA 2W0KA 4YR6B 4FQ1H 3VFNB 5I1KH 1IGIH 3X3FH 1S7UB 2FEDC 3MO1B 3NABH 4UT7L 3DBXA 3P2TA 3L3OA 1RJLA 1MEXH 2UWEA 4XGZA 3S37H 2FD6H 3L3JA 4OB5H 1KPUA 2MHAA 4G6AC 4I1NB 3VRLE 1AFVH 3DV6B 1MHEB 4PB9L 3OPZH 3K2UH 4PJGE 2RBLA 1OWRM 4MAUH 3O2DA 4ODTH 3ARQA 1OHQA 5HI5C 3C60A 3MV8E 4PRNB 4JM4H 3JWOH 2Y5TA 4AIZA 4GW4B 4NBZB 4DUWA 5JW4R 3BWAB 3HE6A 2GCYB 3IFOA 3QEQD 3L3OB 1ZLWH 5CIPA 3FKUS 1AGDA 2UWEB 1Q0YL 3S3SA 1KGCD 3L3JB 2WNGA 3U4BL 3IF1B 4MJ6B 5MERA 2VAAB 3PDOB 3VD9A 3OTTA 2MHAB 1PJ9A 1Z2KA 3DHJA 4ZSOB 5JPMA 1CE6A 3DUUB 1R24B 4PLJC 5D9SA 4IDLA 4GRWE 3FRUA 4MXWH 1IEBA 3WKNA 4AEIL 5IW3A 4RRPA 2HKFH 4EI5D 4AIZB 4XPGL 5ICXA 3GRWL 2JKXA 3QHFL 3DWTA 5CIPB 4Q0XL 4AL8L 4XC3H 3OG4B 2HT2C 5FECA 2IFFH 3KWWA 3VXSA 5TF0A 4HWBA 3S34L 1RQ5A 4ONFH 4K9EH 3GBNH 12E8H 1AQDB 1MHPH 1FL5A 5IQ9B 1IEBB 1BIIA 1CFVL 2JLLA 5ICXB 2G60H 1ADQA 1PZ5B 4GUPA 2OYPA 4WFEE 4ZO8A 5EFIA 2J6EL 2BHUA 1KJMA 4Z0XB 2CR6A 3KWWB 5IK3A 3S7GA 5C70A 2BCKB 3KDMA 1QYGH 2W59A 4AT6A 3HAEH 1LK2A 4N0YH 1FL5B 5JHDA 1LGVA 2HT4C 1MCWW 3GEWB 1BIIB 4NOFA 4F57H 1C5CH 1MIMH 5E94A 1GZQA 1YNLL 2CRMA 3IRPX 1VKXA 4LIQE 1I7RB 1KT2B 3O9WB 4PGDA 1D6VL 4TPRH 4MHHG 2GYSA 4PRIE 3O11B 2B4CH 5EOQH 1A3RL 1YEKL 4RA3A 1TETL 5I1HH 1KULA 5GJSH 1MFNA 4DKFL 3QUMA 3LS5H 5L9DL 4N5EC 5JMOC 2XG5A 3VFOA 2HJFA 1KB9K 4ZUTA 3H9YA 2HMIC 4LLQA 4EN3A 2O26U 3HFMH 3RRQA 1VKXB 4EUPG 4XNQB 1ZGLP 3VFMA 1D9KC 1G6RA 4JFFD 4FTVA 4HSQA 1KJVA 1SJHA 4KHTL 3GMPB 4UDTB 5HDQH 4P57A 5GGUB 4D0CA 3P9MA 1IRAY 3F12B 4XTRC 5TF1H 2P5EB 3SDXB 1FZJA 5D2NA 3V7AE 3EDDA 1V8HA 2GTZA 1OTUD 3NH7L 1C7SA 5DQ9A 3T4YA 1F3RB 5FEBA 1PKOA 3ZDYF 1QUNA 4BSVA 4ELME 1JZ8A 2DBLL 1A14L 1YZZA 1YEGH 4I77H 4HJ0D 5H8DA 1N6QL 1TNNA 2ITDB 1UJTA 2DICA 4XAWL 4KDWA 3DGCR 4Z95H 3OXSA 5DTFA 3VFMB 5IIEA 3HI6H 5GRVL 3NFPA 3LS4H 1CL7H 2R4RH 1X5LA 2IAMD 4U1SB 2V5YA 4P57B 4D0CB 1MCJA 1TPXC 1MFEH 5T3XL 4L4TE 4ZFGH 2CO6B 3PP4H 3FL7A 4GAYA 1T66C 3HRZA 1BQLH 1EO8H 1UA6H 3W11D 3S88L 5DO2C 3RWDA 5B3JF 2SEBA 4S1RL 2GTZB 4NHCH 4KGLA 2IBBA 5DQ9B 3T4YB 3GIZL 1KENH 4J6RL 4CUCA 5DDHA 2ERJB 3DO7B 2XZCL 2I07A 2VKWA 1U41A 4GAGL 5IIEB 1I75A 3NFPB 5AZ2H 1AQKL 1F02I 1WF5A 4KROB 4L3EB 3I6LE 3M8OL 3BKCH 3MXVH 1OM3H 1MQKL 2IPUK 1UB5A 5KW9H 3HRZB 1B9ZA 3MOAL 4MCZA 1G7HA 1JI2A 2SEBB 1CU4H 2VLKE 5DJ8B 3C2SA 1Z5LB 3D18A 3VU2A 1T0NA 5FKAA 1RJYA 1IC7H 4G3YH 1MOEA 1NLBH 2I07B 3P4NA 2APFA 4U6YB 2ADIB 1NAKH 3D0VA 4PRBA 4S1QH 1I7TB 4OF8A 3IXAB 3MLWH 1UB5B 1MAKA 5I8KH 4LVOB 4X8XA 4XNXL 4HIEA 2HJKB 2NY1B 1JYVA 4K3EH 4HWBL 5FXCH 2V7HA 5BMFH 1OOAA 3U79A 5E24E 1KCUH 3B9KC 5F6HJ 1N59A 3D0VB 4PRBB 3ZE0E 3T2QA 1U3YA 3V6FA 3KG5A 4ZTOL 5L2KA 4XWGH 3MROA 5E9DD 2NZIA 5IUSA 2O5XH 1H15A 5ITBL 3HB3D 4EI6B 3CSPA 4HIEB 3VMNA 2BNQB 1RU9H 3LKRA 4FXGA 4DZ8B 5HYEA 4YGVB 5E8DH 2J7LA 1UJ3A 2V7HB 3V6BR 1EHLH 1CD1A 5JOFA 1AXTL 4Z7VB 1RMFL 2CUMA 3T2OA 1GGIL 1EA9C 4G9FB 4EVNA 1RZJH 5FYKU 3WO4B 3SCMA 2V17H 3MROB 3NA9L 4FQ2L 1ZT1A 2I60H 1U3ZA 3FB8B 4KKLC 5D7IB 2R1WB 4MHHI 4HXBL 4LAJH 3LQAH 4U2ZA 4FXGB 1CG9A 3WIHA 4XP1H 3LIZH 3C6LA 1L7IL 2RFXA 3ARPA 5HHPB 4WV1A 1CD1B 2PXYC 4YBHA 4UUJA 1R3IL 2IANB 5HHOE 4NGHL 2DRUA 1DCLA 3GMOB 1XCQA 2BVYA 3VXMA 1TDQA 5F7EH 3SCMB 4Y4KC 1U3HD 3SY0A 5E2WL 4KJQC 2NMSA 2JB5H 4PP1D 1IARB 1URLA 5LG1A 4KK6C 4OZGE 3SKMA 4LRNL 4YQXH 1S5HB 1CG9B 1MRCH 2A9NL 3ZKMC 4G43B 3H8NA 3C6LB 1YQVL 3C60D 3VGFA 3PDGA 5B39G 1SYSA 2RFXB 3C5SA 3P9WB 1RY7B 5I1CH 3EYVA 1A3LL 2JB6A 3NZ8A 3U7WH 4ALAL 4UUJB 4QYOB 4RFOH 3RZCD 4ZUUB 3U0WH 3MRIA 4Z7NF 4GRLC 3D69A 5TH2B 3VXMB 2WM0A 1ERNA 3C09B 4HIJB 2PO6C 5HJ3B 5GS0D 3IFNH 5EH1A 2C4XA 4C57C 3VFSA 1JHLL 1MCCA 1TVBB 4YHMH 2R0KL 4JVUA 4W6XB 2HFEA 4JANA 3C5SB 3KNBB 4YNYB 3RBGA 1JGUL 4CMMB 3EYVB 1INQB 3FFDB 2GSGA 4O02L 1AH1A 1NAMB 1ND0A 1I9JH 2AP2A 4XPFH 4YBLC 1I1FB 3KR3H 1UWEH 1MFCH 2VDNL 3H42H 4K3DL 4XNYH 1U8KA 1U42A 1CICD 4YDLB 3BH9B 3K1KC 1TZHA 4TSCH 4YXKH 1QRND 4PLKC 2VL5A 2HFEB 5GGQH 3HC3H 4HV8B 2HT3C 3LZFL 3QP3A 1S8DB 4QF1A 5I30H 2VN7A 2H1PH 1UKQA 3WS6C 4NP4H 1TTUA 1HOCA 4GBXB 3P4MA 4KRPD 1DQDL 1U8KB 5T1KB 1DDHA 4P5TB 2L7JA 3OJVC 3G6DL 1A4JA 3IGAA 3KPPB 3MCG1 2ADFL 4B7IA 5JHDD 1Q9KA 1N64H 2HFFA 1S7SA 2DQIH 4PJBB 5IBUG 2DQUL 4XBEL 1DLFH 5D72L 4QF1B 4MJID 4NZTH 1JWUA 4BZ1H 1K4CB 1XIWD 3JUZA 4LLDB 3IVKB 4N9GB 2ICCA 3GSVA 3T0EA 4PY8I 1FNEA 4HLZH 4RMRA 1LHZA 3P4MB 1UVQA 1OSPH 3BMWA 1IC4L 1YDPA 4O51A 3MUZ1 2VXUL 5DS8B 4XPHL 4H1LA 3NIDF 1EX0A 4OZHF 3H0TA 4ZPTB 4X7SH 5JIKA 1BAFL 1MCDA 1S7SB 2I25N 3IU4L 4OM1H 5IFJA 4O9HH 5CGYC 3D2UD 1YEEH 1ZGLM 3P73A 5GS1B 4AMKL 1CXFA 1OT1A 3T0EB 3HMWL 4OGAC 1FNEB 1Y18A 2BSRB 5B3JE 4G80B 3TA3C 1PVHA 3QUXD 4UT9L 3WFHB 5FCUH 4QLRA 2EKSA 5CBAB 3O3DB 3ARFC 1CXHA 1PSKH 2HH0H 3AM8A 3GI8L 5AEAA 4H1LB 1J0KA 3P4OB 2VXTH 1JHKH 32C2A 4NQEB 3VWJD 3OGCA 5BS0E 1GC1H 2OJEB 1NBYB 5IHUH 5MP6H 5IFJB 1HN1A 1N4XL 1HHJB 3P73B 1VPOH 3KPOA 4FS0A 4M7JL 1CR9L 3DMMB 2UV3A 4GJTB 3L6FB 3WIHL 3ORJA 5F1OB 3BZEA 4LSRL 4M1CC 2VYRE 1ACZA 3V4PH 4XCCH 1JZ2A 4NM4H 4HS8H 2F53A 5FYJU 2EKSB 5I1LB 3IJYA 3VGEA 1NGZA 4L9LA 1G7IB 3QFJD 5HHMB 2VQTA 4G8IB 3P0GB 5T1LB 2EYTA 2OI9C 2XA8L 2YPLD 4JFEE 1E6JL 3JUYA 3LN4A 5TFSH 4JY6B 3KPOB 4A6YB 1BREA 3S98A 2DI7A 1A7QH 4Q9BA 3G5YA 4I18A 5MEPA 1KTLA 4JFXA 4IOIA 3T65A 3PWJB 4ODWA 1L7TL 2ZJSL 3AXLA 1U58B 2Q20A 1FL3B 1NGZB 1NAML 3U0PA 4P4RA 4LQFL 3QO0A 1VFOA 2X4OA 2O61B 3WLWC 4BKLB 3T0XA 3BXNA 1XF4B 2DYPA 3QUYD 5DJDA 4I18B 5MEPB 1KTLB 1LO3L 3KLDA 5D5ME 1F11A 2GEEA 1OAXL 4NO5A 1SY6L 4KK9C 1I1YA 3BSZH 3RL1A 3RP1A 4JGMA 4LLUA 4W68A 4P4RB 5I16A 4BJLA 3SO3B 4P2OA 5I8EB 4EBQL 3N1MC 2EDEA 4Y4FA 1TZIB 4WY7H 1FIEA 4H20L 3AY4A 1OLLA 5HVFB 1BQHG 3LAFA 2GK2A 3IJSB 1NL0L 4HJGA 3TO2B 5DJDB 2GHWB 1I9RL 4MNQA 4RWYL 1F11B 1EFQA 4OBSA 2BZDA 4LHUG 5FGCE 1I1YB 2Z31A 4NKMA 1M7IA 4LLUB 1OTSC 3TVMC 3ULUE 3EKCA 3HZKA 1TLKA 4MNGA 2F54A 5J1AA 1PLGH 5IB5B 3IT8D 5DYOA 1S5IH 2XPGA 5DHYB 4G8GE 4Y4FB 2WBJB 3UBXA 3QG6A 1JMZA 2A38A 4XXCC 4FFZL 3S5LA 5KVFH 3R8QA 4MNQB 1J88A 2OXHA 4MB4A 4QOKE 2R2CA 4HF5L 2Z31B 3L3GB 4MD5A 1IILE 1M7IB 5ILTL 3OMZA 5EZIH 1MAML 3P77B 4AK1A 4D9QD 4Z76B 1ZEAH 4MNGB 2F54B 1JNLL 4WFGD 5DYOB 1J10A 1TXKA 1G7LA 3DV4B 3KPMA 5KSVB 3S8WA 1MCEA 2ORBH 4PJHF 1WZ1L 3HA0A 3OKDB 3GJFK 3NCBB 5HYSA 3EFDH 5EC2A 4JO2L 2XQYK 3B2UC 1NUNB 4KVNL 4XWOC 3MJ7B 3WIFB 3B5GA 2A6KA 2NXZC 5SWQA 1EK3A 1HWHB 3UAJD 1RUQL 2BHZA 2B7DT 4PP2A 1G9MC 3MR9B 3ME0A 2BOCA 5CUSL 4ODHH 3UYRH 1F58L 5JQHC 5GGSA 1NGWB 3IYLW 4K8RC 1P84J 4FA8A 1BVKB 1YNTB 2ESVD 4LARH 3WN5C 5DVLA 1T5WA 3G5ZA 3D3VE 5EC2B 5C1MB 3SE3C 2A0LD 3OKLB 3JWDL 5C09A 1KB5H 1MJUL 2A6KB 2KPNA 3NN8B 4QXGH 4RMVA 3RAJL 5SWQB 3SGEI 5E8NA 3TH3T 4AEFA 3D0LB 4A6YL 4NT6A 5FUCC 4PP2B 2UZIL 3IAPA 4CNIB 2D7PA 2ZZUT 1JZ6A 2XN9B 2J8UF 1KG0B 4GKOA 3KYMA 2NX5E 1UM5H 3GSRB 5KVDL 4OLEA 4DTGH 3G5ZB 3QDME 4TSAL 1DEDA 3ECBB 4ZXBA 1VACA 2XZAH 3BE1L 3ZHDA 2VDMH 1WIOA 4JY4B 1HQ4B 4Z7WF 3UEZA 1K85A 5I15H 5E8NB 1A7RH 1J11A 3MJ8A 4KUZH 2VE6A 4NT6B 2EDTA 2KDGA 3K0WA 3LKPA 1XZ0A 1WQVT 4K23L 4MB5A 5I6XB 3BW9B 1NBVH 4GW1A 2JIXA 2Z8RA 4JQXA 1EGJL 1T4KA 1XF5A 5CILL 4LSSH 4UIKH 3AREA 3KYMB 5CSZB 5D1QB 2HRLA 4DN3L 1CFSB 1VACB 3DRQA 4GG8B 3W82A 4V1DA 4LOUC 3IDJA 4X6BA 1JGLH 3MJ8B 2VLJD 1BM3L 1RURH 2BY1A 1XZ0B 1HINL 4Y5VC 1GOFA 2BP3A 4OSUL 4OCSL 3FHQA 4PGJA 3VFGL 3EO0A 3ZHKA 5A3ID 4OUUA 2HJLA 3AREB 3VI4F 2AJ3B 4Q7DA 4RGND 2OZ4H 3ARBD 5DJAA 5T5NF 1FRGH 5D70L 1LEGA 3IDJB 4L4VD 5D6DC 4EUPB 5L7XH 1QSZA 2PNDA 2QR0B 3QNXA 1RZFL 2NY3C 2J1KA 4ONOA 3MV9A 3EO0B 4ONGL 5E6YA 4QHNB 1NDGB 3K7UA 3TIEB 4QGYA 5DVKA 3HG1E 1DP0A 5HDBE 3FFCA 2APTA 5DQJA 2XZQL 3CK0L 4L8BB 1LEGB 3TZVA 3KPQA 4UILH 4DGYL 4PPTA 3OQ3B 2AJUL 1KEMH 2W0FA 1P69B 4PJIA 3LQMA 5HYQA 4NN5B 5GRJL 3WE6A 1K2DA 3HE7B 1QEWA 4GG6B 1AI1L 3QNXB 4J12A 1NC4B 1FVDB 4KMTH 5T3ZL 3RTQC 3MV9B 1F90L 3ESVF 2XACC 4TN9A 1D9KB 4P9ML 5EG6C 4DAGH 3DSFL 3O8XA 1Q94B 2HLAA 5DQDL 4WHYH 4K3HA 3FFCB 3IFPA 1UADC 1MHCA 3KPQB 4FFVC 2E7HA 5HSFA 1KYOJ 5TQ0L 1X44A 4WFHE 2W0FB 2P8LA 1A6UL 4PJIB 5HYQB 2I5YH 3O4OC 4HAFA 1P1ZB 4R0LC 1QEWB 3S36L 2G5BA 1BFVH 4LSPH 4HK0A 4LK4A 3RWJB 3A6CL 3GFUA 1FNSL 4FZEH 3SQOH 2EEBA 3B6SA 5A2LH 3S4SA 4JFYB 4Y0GA 4P2QA 1JZ4A 1AE6H 5CJXA 3EZ8A 3O8XB 2JCCA 4B53A 2RIKA 4GKSA 3C8KA 4NRZA 4LVHC 2R2HA 3IS1X 1INDL 4OZIF 3FTGA 2BSTA 3BVNB 4ISVA 1MFDL 3WXWH 4PRPA 4GSDL 3C5JA 5E1AB 2G5BB 1RFDH 4HK0B 4I48A 5E00B 3LV3B 5EUOE 1YEJH 3S4SB 1M05B 1JK8A 5GGTA 1JJUA 5ACLA 3GJFH 4UQ2A 3OF6A 3DIFB 4P2QB 1XGYL 1KLUB 5F8QC 4E0RB 4UIMB 1Z3GL 2C1OA 4GKSB 4EOWL 3C8KB 4J3WA 4HZLA 3HZMA 2H3NA 5SWZE 2P44B 3FTGB 2DYPD 3GSQA 3ZL4H 2E8ZA 4NN6C 3EFFB 2IH3A 4OZ4B 1FO0A 1KCSL 4I48B 3OG6B 4MXQD 1G7MB 3MYJB 3TN0C 4UQ2B 2F5AH 4PV8B 4FNLL 4Q9QH 1IT9L 1NLDL 3SJVA 2PW1A 3JWOC 3VWKD 3C2AH 2HKHL 3MFGB 4I5BA 4H88H 4YX2H 4TUJA 4OI7A 4HZLB 1J18A 1V7ML 2UVEA 3HZMB 3L3DA 5C07E 4D2NA 2AJYH 1YN7B 4OCNC 2X05A 1U92A 4Z7OE 3NCYS 4QRTA 4J4PA 1FO0B 4MA8L 5ADOL 2UZYB 1U95A 1DN0A 1QOKA 1CE1H 2FRGP 4JZJA 1CGSL 3W9DA 1EFXD 3SJVB 2PW1B 4NKOB 3V0VA 1KXQE 4M6OL 4D9LH 3QWOA 2AJSH 4TUJB 2E7LC 2PR4L 1B2WL 2QSCL 3HB3C 3FQRA 3WNNA 5K9OB 4LKCB 4M61A 4PJEF 4RNRA 4NM8H 4YUEL 3QI9A 4PJGA 4YHOL 1VEOA 5D7JA 4RA0C 4EJ1C 4JRWA 1EO5A 4U0RC 5DUML 2NR6D 4FQJL 5F9WC 5C0JA 4ZFOA 1JN6B 1KLFA 2AAVA 3GO1L 5EIVA 3NGBC 2R0LH 5IQ7L 3HPLB 1IAIH 1VADA 2NY6D 3V0VB 5F96L 1DVFD 2DWDB 3QWOB 4QRPE 4UT7H 3DXAE 1I7UB 3L1OL 5JOPD 3MRKB 3FQRB 5IFAL 4M61B 4RNRB 2GI7A 4M5ZL 5B39B 5EU7E 3MACL 4WI8A 1T22A 3T1FA 4PB9H 5B22A 3MV8B 2GJ6E 4KHXL 4KMLB 4PJDF 4N0UA 5B8CB 3UJTL 5C0JB 3MBEB 2AXJA 5IVXB 4YBQC 4K55A 1VADB 2Q6WA 1ZSDA 5EOCJ 1AP2B 3MNVA 3MPCA 4HBQA 3V5DA 5BV7H 3CFDA 1GZPB 5ITFB 2Y7QB 1Q0YH 3OAZK 1BZQK 3U4BH 5FK9B 2DQJL 4JFOA 1T22B 2B4CC 4L8SC 4OGXH 4GRWB 5CINL 2BOBA 4DJMA 1T3FA 4N90E 2Q7YB 1FCCA 4WTXA 5F21B 4GXUM 3O6FA 1VSCA 3N1FC 3UROR 5ESQB 1P7HL 4RAVA 4AEIH 1FC2D 3HLAA 2Q6WB 3DYOA 4XPGH 3GRWH 3TEUA 3HAEG 4PJ7F 4X5LA 3WNOA 3QHFH 5DJZB 3KPNA 4FQQB 4MDIA 3B2VL 2XTJE 4ODVH 5AWNL 4JFOB 4KTDL 5K93A 3OB8A 1QR1A 4O4YL 4Y1AD 5FYLD 3S34H 5C8JB 3GZKA 2PYFA 3O6FB 3RL2B 4I9WE 5DEGA 5AZEL 2E7CA 3ARGA 5E08H 3QWRA 4QRSA 4J3SA 1W0WA 2P45B 1CFVH 3HLAB 2X6MA 4QHKI 1KTKE 1ZLSL 4F9LA 2JIXD 2PUQT 4PRIA 4QY8A 4XRCA 1CICC 2GSIA 7CGTA 4PD4K 2A6IB 1HKLL 3KPNB 3UDWC 5B4MD 1MCWM 5IBUB 3RGVD 2A6DA 2J6EH 1JE6A 4CVZB 1BBDL 3BP5A 3DTXB 2ID5A 1IGCH 1MHHB 3GHBL 1JPGB 4KUCF 3PF2A 4QRSB 5HD8C 1H3PH 4J2XA 3HI5L 1HH9A 1DANU 3VDBA 1IBGL 4PRIB 1FO0L 3C5ZD 3RBSA 3BHBA 3H7BB 3UPRB 3IDIA 4GXUN 3QZWA 4JE4B 3VXUD 3G08B 4N0FB 1JGEB 4HUNB 4NNXA 4B5EA 1G7QA 2CKNA 4P23A 3ULVE 1H3TA 1PQZA 4DKFH 4H0GA 2XFXB 4OLVL 5KN5A 3ZTJH 4ELMA 3FN0H 3BGAA 3WHE1 1WFNA 4YDVA 5I8CB 1OWWA 1TCMA 2YUZA 1N5AB 2QQQA 2CIIA 3IDIB 2OMNA 3ARDA 3QPXL 2QADB 2AQ3A 3QZWB 4L4TA 4ZTPL 1T21B 3L3HB 4P23B 2HTKD 1OGAD 4U4BA 7FABL 5F70A 1RZGB 5DVMA 1MPAH 4XB8A 1ODAA 4GAJH 5KN5B 4ELMB 1FG2A 3SDYL 4KRNA 5J4MA 4JFDE 4WW2A 3X3GL 1XCTA 4XC1L 3C9NA 2DBLH 1A14H 4N1HB 5DK3A 3MV7A 4R96B 5HPMA 4TVPH 4OZIE 4NRYB 2CIIB 3ARDB 2VSDA 5HGHB 2E3VA 1IZJA 1L6ZA 5EA0L 4L4TB 1U2CA 4DKDC 5IESL 3EGSA 3NCYP 5HHXL 5HYJE 4HGWA 3NOIA 2QHRH 3VWJC 3TCLA 4ZNEE 1MCOH 2Z8WC 4IRSC 4IEFB 2CLVB 2DDQL 1F4HA 1FBIL 1YY9C 3ZYOA 3S88H 4XVUD 4S1RH 5KZCD 4WW2B 5EWIL 4WO4A 2O93L 1MUJA 3KPLA 5CHNB 4J6RH 3L95A 5MEQA 4WUKL 5HPMB 2XZCH 4O5LL 5D1XA 4K2UL 5KSUA 3O2DH 1T20A 2YUXA 1AQKH 4X5XB 5F88B 1HCFX 1JTOA 2NXYC 4HS3A 4HGWB 5JXED 1V3LA 1RZJC 3LQZA 4XP4L 1HI6A 5CD5C 5JW4M 1CD8A 2VLKB 4P9HL 3EJJX 3ROOB 4KRLB 4PRPD 1I9IH 1YMHA 3MOAH 5CIPH 3BGMB 1IAKA 3V2AR 4EKXA 2FEEL 3KPLB 5CEZH 3ZT7A 1A6AB 4MVBC 1E4XH 5D1XB 5JR1H 4XHJD 2R0WL 4P46D 5L8JB 4C56D 4XP6L 3KPRE 4XCFL 5D96C 4LBEB 2R0ZH 5DGQA 1CGWA 5E03A 3JV6A 2NQCA 3T09A 1V3MA 3T0AA 4RQQA 3U0TA 2IG2L 3C8HA 4MAYB 1QFHA 4BYHA 4OAWA 3KJ4C 4LHUB 2YPVL 4IRZL 4HWBH 4Y2DA 4P4KC 5ISZE 1XGRA 1HHGA 1BFTA 4HIXL 2Q76B 1ZWIB 3T04D 1QVOB 4LIQL 4ZTOH 5KAQF 3JV6B 1ADQH 2R2EB 3L7EA 4J7RA 5DJXA 5F6IC 4J4PD 1JPFA 4JN1L 4KVCH 1IQDB 1OAYH 3WYRA 5D2LE 4G42B 4IMKC 4JDTL 4XPBL 1YEFL 3VJ6A 4IJ3C 1PD6A 1XGRB 2DM2A 4I8DA 1HHGB 4WWKC 2BY3A 3X12B 2XRAL 1RMFH 3DUHA 3DROA 4Z77A 4X6FB 1GGIH 4KKAD 3G5VB 3NA9H 4FQ2H 3N1PC 4OZGA 3LN5A 3L7EB 2CXGA 2YD5A 5DJXB 2CK0H 1JPFB 4JLRA 1LQSR 5J0BA 2VZSA 4HXBH 1KPRA 2K7PA 2VH5L 2APWA 4GKNA 1MJJB 4UNTA 5DJ6A 4F15B 1FVEA 3VXRE 2VLRD 1L6XA 4P2RE 5DMJB 5HHOB 3VGAC 1HEZA 3QUMH 5SWSB 1CWVA 4CJ0A 2A83A 1CL7I 1P7QA 3NMEA 4OV6F 4O58L 4NGHH 5C9JA 1X7QB 2OM5A 1LDPH 1Q9LB 1U8LA 3DX6A 4OZGB 3OR6A 4HXAL 2D4DA 3FOLA 5E2WH 4D3CL 4JKKA 4JLRB 1S7RA 4LAQL 1CQKA 1G6RH 2M2DA 1BZ9A 3O81A 4JCMA 1EV2E 1AHWC 4E41D 2A9NH 4GKNB 3BFOA 3PE9A 4ZO7A 1EUUA 3N0PB 3O2WL 3T77B 3MODL 4JHAH 1MFAL 1A3LH 3O6KH 2A83B 4G8FA 3FJTA 5AD0B 5C9JB 4HEPG 3MRBB 2OK0H 4X9FA 1S78C 2LAAA 4LLAA 2WWKT 4MZ3A 3OR6B 3WBDA 4DQOL 1HILB 3MRPB 4LLYA 1GHFL 1S7RB 2ZG1A 3P0YH 1W0VA 1JHLH 4X7EC 1BZ9B 3BN9C 1GGUA 4NQCB 1S9WB 2R0KH 1RIVH 5C0BD 4C4KT 1MREH 2QTEA 3OKKA 1CFNB 4CN6A 1JGUH 4Q9CA 3B43A 4POZD 3IRZA 4NFDA 5IJVA 1LMKA 4KV5E 5I9QB 2VMFA 4O02H 1BOGA 4MLIA 5J6HB 3DETD 4K3DH 4LCUA 3FO9A 3TESA 1A1MA 5LBSH 2R1XA 4MXVF 4OLZL 3EHBD 1FFPA 2IPUG 5IR1B 4JO3H 5EDXA 3EYOB 3CMOH 1GGBL 5I73C 3ARGD 4HLZG 3Q6FB 5D4QA 4IIQC 4NKDA 1LEKA 1GC1C 1IGTA 3CNKA 4LSUL 5T3XD 4CMHC 1OTTD 2JTDA 4HAGA 4ZOEA 1XGPB 4PREB 3SGKA 1S9XB 3ILQD 4LCUB 3QIWA 4LGRB 1DQDH 3N50A 3WFBL 3WNLA 3BYTA 2NY0C 1LE9A 3EOTL 3G6DH 4FHBD 4HUUA 4ACPA 5FKPB 4OI8A 5FF6B 2ED9A 2ADFH 4JB9L 4HMEA 2G75A 2OTWA 4ZUVB 3VG0H 5DFWH 1IGTB 4XBEH 5D72H 3I75B 4KTYA 4JJ5B 3PGFL 1GPOH 2BVOB 2GKIA 3BUYB 4NDMA 2NYYD 1MF2L 4X4YB 1A22B 4KI5D 5DGRA 5GHWH 4KFZC 5F71A 5A3IC 4JREB 4ENED 1IC4H 3WDIA 1LE9B 1UWGL 2VZ3A 3VRJB 1FFQA 2VXUH 3H9HB 1HYRC 3NFSL 4LU5L 3MNWB 4UMGA 2IQAA 5EULV 4YHIA 5E8EA 2ZPKH