1MAJA

Solution structure of an isolated antibody vl domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an isolated antibody VL domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 26-10 FV (LIGHT CHAIN)
total genus 13
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1993-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1majA00
1KJVA 4S1RL 1G9ML 3IDYC 2VLKE 4NCC1 1N3NA 4QXGH 4F7CA 4W81A 1OT1A 4OCSH 4MQTB 3RWHA 3UJTL 3N1GC 3PL6C 3OXSB 5D9SA 3VU2A 3MOQA 1FL6A 1X6NA 5E8DH 3L3JB 4LLVB 5JIKA 3HZYB 5EOQH 4OUUA 4G6ML 1Y18B 4HS3A 5DJXA 4A6YL 4KKBD 4Z7QE 3BN3B 5ICYA 4N0FB 1ZVHA 3MCLH 3A6BH 3L6FA 3ABZA 3TBYA 1RJCA 3F5WA 1RQ5A 3N06B 2JIXD 3DVIA 5F9AC 4M7JH 2XTJC 2BHZA 1HQRB 3IRPX 4APQC 1NC2D 4W6XB 1KCKA 3MV11 1Z9MA 3IKCB 4UTBL 3WJLC 1A5FL 1UXSA 2E8ZA 4MNGE 1MCOH 4OLXH 2JJUA 3MNWA 1LWRA 1TLKA 3CFEB 4PTUA 4QWWD 4KZDL 4HS8H 4RIRB 1KJMB 2UWEB 3TZVA 1GL4B 5LGHL 4UTBH 1UWEH 4XP9H 1P84K 3NIFE 3EJJX 4LEXH 1LE9A 5ESQA 3IGAB 4W4OC 4LP5A 1PDKA 1KXQE 5D6DA 2YEZA 3P30H 4M7KL 3EO1A 3QXAA 1MCJA 5E2JA 3KWWB 3MA7A 4LLUA 5F7MC 5MEND 1WBXB 15C8L 3N85H 3K7UA 2FO4A 4Z76B 1BD2D 1FORL 1MJ8H 4M6MH 2NY4B 1AGCA 2X9XA 3CFIC 4P9HH 1JPGA 4JFDD 1YMHA 5IHBA 1CGWA 4DEPB 3KDMB 1DBAL 2DICA 3TPUB 1FSKB 2JK5A 3DGCR 1RIVH 1A6AB 4WU7B 5D1XA 5IMLA 4GQPH 4IRSD 1DBAH 1LDSA 3IJYA 4Y7MA 3QBTB 4LSPH 2W60B 3RPIB 5JQ6H 2IC2A 1X5FA 1TVHB 1X44A 5CWSA 5J6GA 3HNVH 3V52L 2RHEA 5SWZD 1PBYA 1ZLWH 4D0BA 4P46A 1WV7T 5FECB 3C5SA 3HNVL 3WFHB 1SY6L 5GGVY 3QIBA 3LS5L 1JTPA 5I73B 1Q72L 4OAWB 4KUCD 2IBBA 2OI9B 5CSZB 1RZ8A 3VG0H 2HVJB 4PJ9A 4HFUL 1RZ7L 5EORL 3TCLA 1C5DA 3RGVB 5BV7H 4PLKD 1Q72H 1KCUH 5DD6A 3OGCA 4R90L 3MC0A 1RK0A 3VG0L 1YEGH 5JZ7D 3JWDC 1WZ1L 1C1EH 4U1SA 4XPGH 5ETUA 3UTTB 2ARWA 1JUFB 1S7SA 1X5LA 1R24A 3LKNA 3MJ8B 4PJGB 2OJEA 3FB7A 4PRPE 4OI7A 1J8HB 3VXSE 35C8H 2QKIB 1XF3A 4D9QE 5MERA 5I8OH 2YD1A 2KBGA 1FFOB 4R3SA 1XGPB 4WW2B 4DWHA 1NEZA 4GRWH 3OPZL 1U92A 4OJFH 4UBDC 3G5VA 2OZ4A 2H9GB 1MWAA 5DDHB 1P7QA 2VLMD 3GUTB 5C09D 5L8JB 3BP7B 4PRNA 4PRHD 3ARBC 4JFEA 3IF1B 1N4XH 1WBYA 2QQNL 3HPJA 4LVOB 2R23B 1K5NA 4HHAA 4JFEB 2NY1B 3H42L 2UUDK 1GVIA 2P8PA 4WUUB 2R23A 1NBZB 5DUPH 4WV1A 2DLFH 4I18A 3VXRB 2F74A 1V5JA 1U9KA 3WNLA 5TGBA 3TYFA 1HCVA 3IETB 3PWJB 4HZLB 4AZ8A 1HYSD 1L7TL 1UZ8B 3QHZL 5HHXL 3H7BA 5HJ3A 4M9PA 4NO2A 1LD9A 2OSLB 4JRYE 1M71A 2HJFA 1NGXA 5HDQL 3MRDB 3SJVD 5CD5C 1TCRB 3O41A 1JWUA 3QFDB 1UACL 2VABA 1HN1A 1YN6B 3ZDYE 3S96B 2NX5A 3WN5C 3R8QA 4K2UL 4J12A 1A6UL 1T5XB 4YEFA 2I26N 1IC4L 2HFFB 4K3EH 1UCBL 2XPGA 4P2RB 5L2JB 2V2XA 4OZIE 1FFPA 1M7DB 3L3JA 4LLVA 1F3RB 5GRWA 3UROR 3VWJC 1MAMH 3E8UH 3VRLE 5EIIA 4N8VA 3EYSL 3C5JA 1W72H 3SBWC 3TCLB 2VXSH 3EHBC 3FQWB 4PJXE 2VDNH 4NDMA 4LIQE 3ARFC 3NZHL 4JAMB 3D69B 1MCQA 1Y6KR 4XB7A 4E9LA 4PYGA 3ARYA 3JV4A 4F37K 5BJTB 3MRHB 1DFBH 1GSMA 3IFPB 1LK3L 3GBML 4Y16D 2GT9A 3LMJL 1RK1A 4F7TB 4BM7A 5ACZA 2P1YA 3NCFB 3DUSA 1VGKB 3PGDB 1DFBL 4ZO7A 1EFXA 3S5LB 1IC7L 1JCKA 2RCSL 3S36X 1MCWM 3KPNB 5J11C 1T2JA 5CJOH 4KKLC 5HPOA 3DI2B 2GTWA 2FRGP 1P4LB 1IC7H 4L4JA 5FYLH 2VLKD 2P42B 4ETQA 2I9LB 2YSSA 1RZJH 4QHLA 1CIDA 4CNIA 2CKBH 3FAXA 2YSSB 3EYOA 3UBXB 2VJXA 3BO8B 3V5HB 1JP5A 1WBXA 3QFJD 3QUZB 3KLHC 2FO4B 2N7BA 2KL6A 3M1BB 3BGFB 5F88B 5D7LD 1TZHB 3OV6A 1BIIB 1NFDE 1DUYB 3AUVA 4EVNA 3VFOB 1R24B 2B5IC 1DBML 5ISZD 3O9WC 4F80A 1PYWB 1NUGA 1OTUC 2P5EA 3PHOA 4JREB 4AL8L 5CJQL 1QR1B 1NGQL 3KXFA 3V0AC 5EB9A 5F9WB 5H8DA 1OW0A 5J1AA 4P99A 4F58H 1WSST 1X7QB 2E9BA 4JANB 4GO6B 3OG6B 5GSVB 4R97B 5CJQH 5CP3A 4FTVB 4OCXH 5JO5B 4MMXC 3ISWA 1A21A 1QSFA 1JYXA 4MXWL 1AO7E 4D0BB 5IHUL 1FL3B 2F8XC 5J12B 4MQ7A 2A1WL 4L9LA 5JQHC 1BQLH 4MYWB 5ICYB 4LQFL 3QH3B 4X8JB 4GKZA 2DKSA 4JZJC 5E8PB 2EDOA 4XCNA 5FM8A 4N9GA 1FZOA 4ELKA 3ARGB 4RMWA 5HY9B 2H2PD 1F4AA 3EDEA 3T3MF 5DVLA 2C1OB 2YD4A 4WNQB 1AXTH 2JELH 2YMXH 3SPVA 4XHQA 1H3GA 1VENA 3HZMB 3MCKA 3SDXB 4YQXL 1RZGB 4XTRD 2E7CA 4KJWC 2H45A 4HV8A 3QNZB 1WK0A 4KTDH 3WEXB 5I15H 4YK4B 4PTTA 1NAMA 4YXLL 5J12C 1VDGA 2X70B 5D7SL 1TDQA 2R9HC 5C0CD 3DMMC 5C0JA 5DR5H 3HS0B 5DJZB 4EN3D 2X4RB 5E7FA 1IMHC 5LXGH 1D9KC 4FQHA 4GSDH 1OCWH 4JFFB 1E6OH 1A9BB 5DR5L 3SN6N 43C9A 4OKVB 4JM4H 3UYRL 3MV9B 2NTFB 4DOHE 3F12A 1EA9C 5D5MA 1BF2A 4ZFOB 1SMOA 3ZDZF 2AK4B 1G7HA 2DYPA 4XPBL 4ENED 2CDGA 5CZKA 5F44A 4MX7A 3VH8B 3FFCA 1VFAA 3MACH 1C16A 3UTTA 3JWOH 3Q5YA 3W39B 1XIWA 4G5ZL 4YGVB 2GJ6D 4GS7C 4XNYH 4LSDA 4OZHF 1XIWB 4YGVA 4KKAD 1MIEH 2BX5A 1LP9B 2FX8L 3SE3C 4Z0BL 4X4ME 3QXDA 4RGOL 4QRUA 3G08A 1AGBA 4X9GA 4KK8D 3SDAC 1DE4A 3PWPA 1E28B 3CGTA 3OB0H 4QHUA 5F93C 1B4JH 1CXKA 1KJ3H 4LHUG 4PJCF 1I7UA 5I19H 3U1SL 4ONOA 4N0CD 2JCCB 3HI5H 1U93A 2JCCE 4BYHA 3GRWA 2WMPA 4GLRI 4M9OA 5HHVH 5DK0A 3RY6A 3RX8A 3DOSA 4Z7VB 4X6DF 1MPAH 1RFDH 5IK3B 1FVEA 5BJTA 3IS1X 4CADA 4HIHB 1CD1B 4Z7WA 3RBSA 4K3JH 5I30H 1BREA 2DI9A 2FCBA 1EX0A 4NOBA 4CNIB 4HJGA 2A9ML 1WTGT 1U95A 2C1PA 4PJHA 1S3KH 1JPST 4XVSL 2DYPD 3C8KA 4JFPB 4NZUH 1T1ZA 1JZ2A 3SO3C 2P5WA 2R69H 1G0DA 2EXYD 3OKNB 1FJ1A 2WBKA 4NFCA 2FDBP 4QXGL 4EQ2A 4M1DL 3K80A 2I07B 4OCSL 4KWUA 5DUBA 3U6RA 3DECA 5T1DL 1QLFB 5C07D 2FGWL 4NC0B 3HC0A 3ARUA 1ZHKA 4ESKA 4IRJB 2Z8SA 4JFDE 3P11L 2X1QA 4LLDA 1G7JA 1S7XA 2A77L 2DMKA 4LKXB 4J6RL 4DKFH 4ZMAT 1AQDB 4FS0A 3OXRB 2EEAA 2ZUYA 2E7LC 1Q9KA 3T1FA 1MH5B 3GMNB 3O2WL 1FL3A 4NKQB 1A7QH 1L0QA 1I1AC 1NFIB 3QPXH 5SWSE 4PJFE 5A2IH 4NKMB 2X4QB 4CMHC 2QSVA 4PGBB 3B9DA 3L3HB 1S9VA 3D3VB 3P9WB 4ODVL 1AGDA 1JNNH 3HB3C 3SHSA 1A3RL 3B4NA 4M7LT 1OGAA 4JHZA 4G8GB 3IDGA 1INQB 4GRMA 3MRHA 2EDTA 3TYGH 3WLWD 4P23C 4WW1B 1OWRM 2KQMA 1NGYB 1T1YB 3TO4C 1TZHA 3BVNB 3VGBA 2NPLX 2OP4H 2P8MB 3PL6D 1FL5B 4PJAB 5FEBA 2ICWJ 4RWYH 4TQEL 1U2CA 1X5ZA 3EZ8A 1CI5A 4ZPTB 4JY6B 4LSRL 5BZDA 4PJEE 4FFVD 4PP2B 3RU8L 4OFYA 3GI8H 3MODH 3E3QC 3HI1A 3MRGB 5J3HD 1G6VK 2YUVA 2NW3A 4XBPA 3QRGL 1V7NL 1Q9LA 2OTWA 5IROA 5CILL 4K07A 4X4ZA 5DZOA 5ESAA 5SWSD 1QBLH 1BJ1H 3NCYS 4XVUC 5D8JH 2NY0D 1IKNA 2YD8A 2E3VA 3N1MC 3QHFL 1QKZL 1WCQA 3ZYIA 1EUUA 1QBLL 4XBEL 4OV5A 1I3VA 4R0LC 4XPTH 1HHKB 1FBIH 1B90A 5HVFB 1JRHI 1QKZH 3VE0A 5EC2B 1BIHA 3RVXD 3STZB 3NCCB 1PD6A 4X4YB 2A6JA 3E6HA 3K8KA 5IG7B 1WICA 3Q6FB 4Y5XC 1XF2A 5B4MD 3QUYB 3DETC 5FKAA 3MYZA 3UZVB 4YFEA 3QR2A 2ZP0T 5HDBF 5D7JC 3PF2A 5DJ6B 2FL5A 4MB5A 4OGXL 4U7MA 4IIQC 3WFEH 1SBBA 2EDDA 4Q2ZB 5DJ2A 5MP6H 1ZA3B 1IGFH 3W9DB 3UPRB 4OJFL 5CSBA 4XX1E 3LKPB 4MD5B 5FYKH 4L4TD 1EEYA 3TVMC 3EGSB 3FO9A 1A1NA 4X6DA 5T3ZH 3IKKA 1CE6A 4GAJL 2J6EH 4XCYB 5AZ2L 1EEUA 1ZTXL 5EU3B 5GJSL 4WUKL 3VXRD 3MNWB 1T2QH 4Q6IB 2DQDL 3QI9B 4JO4L 4OZIB 1BPVA 3UYPA 3FQUB 5FA3A 4MCYB 1ZLSL 3HI6L 1SEQL 2HT2D 5IQ9B 3P4NB 3WN5A 1J11A 1PEZA 5M7QA 5FGSA 2Z93B 3NPSB 3BW9B 1UC6A 3OJDA 4MNQA 1TZGH 4R4NC 3MRQA 4WI4A 1SYSB 2AJZB 3BW9A 3OJDB 3WIIH 3KWWA 3EYFA 3MA7B 4LLUB 4CJ1A 3C5SB 1MAKA 3VXTB 4MVBD 2C3VB 3PXJA 4XNZC 3TC9A 3GFUA 4ZXBA 5IT2L 1SJXA 2LVEA 1O7VA 1OP3H 1CLCA 3HE7C 4IRJA 1LK2B 1JPFB 2H41A 2VXQL 4NZDA 4OM1H 4XGZB 3I6KB 4RBPK 5CJ8A 4PV9B 1ZKAA 4YDKL 4AJ0A 1W72B 3KAAA 3GSQB 3O9WB 2DQFA 1JGEA 2PXYA 1EV2E 4B7IA 2XY2A 4N68A 4OM1L 5I6XC 4LCCC 1JUFA 1S7SB 2B1AL 4NQTA 4NSKB 4YHNA 2I24N 4NFDA 2OL3H 3MRKB 1F8TH 5JIHA 4OD2A 4JRXA 1NC2A 3MUZ1 3WLBA 1T21B 3FQNB 5SWZA 1YY8A 2CLZA 4H1LB 3QNXA 1AHWA 1U95B 1VFUA 2FEDC 4QHMB 2Z31A 1BHGA 1F8TL 1I1FA 4Y1AA 1LEKB 1Q9KB 1I1YA 4ZPVA 1Y18A 5L9DL 2HT2C 5HGGS 1TPXB 2WQ8A 1QPPA 5F6IB 2XFXB 3B9VA 5CINL 4G8GA 2J8HA 2BK8A 4LF3A 2RCSH 3HLAB 2X42A 1NCBH 4OSUL 4YE4L 3T0AA 4NGHL 3L3GA 3NACL 4L3EE 3BKYL 4LP4A 1ZHNB 1T5WB 1BOYA 4PJBB 5GHWH 4HXAL 3P40A 1RIHH 1RVFL 5D71L 4U1JB 1OD7A 3TT3L 4HWEH 1SEBA 1KEMH 3D3VA 1UA6L 4UIKH 3CFEA 4UILL 2VDKH 3P3YA 4ZSOB 3TJHC 5C0DB 3QPQD 2JK5B 4PV8A 1A0QH 1EAPB 2FWOB 3QP3A 2BERA 4GLRH 4PGDB 3CFDB 3H7BB 5HJ3B 1XF3B 3GSOA 4HQQL 2VDKL 2FECI 4RMRA 1TJGH 3SKNB 4KRLB 5TE6L 4CUCA 2VZOA 5B38A 1ZT7A 5FO7B 1GC1L 3G04B 4R4ND 1JI2A 3GMOB 4MQSB 2W9EL 5B39G 4FG6D 1I8LC 2IAND 3OAZH 5BXFA 3H3BC 1FAIL 1FZMA 1FL6B 2A73B 4JFHD 3IFOB 3RIFF 3F7RA 4AIXA 3HAEG 3V4VH 4GW5A 4U31A 3EHBD 2VDMH 3O8XA 3VE0B 1FAIH 3ARFD 5ANMB 4Y19E 1GIGL 1I8KA 5T1KB 4D0CB 3JTSA 1NCNA 2JIXA 4U1GC 1QRND 3QXAB 4PJ9D 2GK2A 3TNMA 2WLYA 2WINA 4MXWH 1F3JB 4OM0L 1ADQL 3VXPB 4OCWH 1AKJB 4GG6E 1UXSB 3HUJB 4MXQC 3KNBA 3AB0B 4H1LH 1BWWA 1C08B 2AEIT 1OP5K 2VZVA 3CLEH 3MOBH 1XF5B 1G6RA 4OM0H 3QDME 4OZFH 3BP6B 2WWKT 4ETYA 3MUHL 2FECL 4YHML 1N5AA 4G6KL 1TMCB 4KI5F 1QLRB 4XP4H 3H0TA 4O4YL 4X5WB 5D93C 1HQ4A 4JG0H 3WO3B 4JJ5B 4YHMH 4YWGH 4N0CC 1XGTB 2ZUSA 3H6JA 1KFAL 1S7WA 3QUML 3VD5A 5FF6B 3IDJA 4S1DD 5ALBL 3DXAB 2V7HA 4M1GH 2RIKA 4RMSA 1HHKA 2X4SB 4ZNEE 3CC5B 5EOCJ 2JLLA 3JWNC 4K71C 1GH7A 4QT5A 4X6CF 1TCMA 2YC1A 2DWDB 1ZLWK 3SGKA 5LXGL 1HH6B 2HLFC 4Z95L 5IHZB 3CFCH 4M5ZL 5IM7B 3IU3A 3DO3A 3WYRA 1MCRA 2X09A 5H35A 5IV2B 2YD7A 1CT8B 4TULH 5C0AD 3BPCA 5C07A 3CFCL 4RFNC 2X9WA 4NWTH 4PLNC 4RRPA 5BO1H 2C3XA 1A1MA 1MFEH 4WI7A 3U82B 1UH3A 2Q3AA 4Q2ZA 2FNBA 5JHDB 1EJ6A 2IALB 4O51A 3C5ZD 3X11A 4Y2DC 4NKIL 5JHLL 4APQD 5F1NB 1NMBL 1CICA 3IJSA 5E2TH 3NABL 4F7PA 4HLJA 1MHEA 1CICB 1FV1A 3IJSB 4IOFD 1QEWB 2BNRD 2BMKA 5D2LB 1OM3H 2AJUH 4TSBH 5TPWL 5LKNA 3I02B 1H3VA 3GRWH 4ZOBA 1G1CA 4LSTH 3R1GL 1R5IA 1UJ3A 4NHCH 5F7HA 3QNYB 4F8TA 2IFFL 4HBCL 3VXUB 4HIEA 3U0WH 1QBML 4YXHL 3U2SB 2ICCA 2IAMA 5E8OB 2Y7QB 1IKFH 5EBWB 1DQMH 5HYFA 2LAAA 5IKCA 5CLTA 4YAQB 2P5WE 2OLDA 4PTTB 4WEMB 2V5RA 5HHNA 3CDGB 4YDVB 4X9BA 3BZEB 1I1AB 2YRPA 1JGLL 3S9DB 2X4TA 5IW6B 1G7PB 3K2UL 3MLVL 1KTKE 4GRLC 1ZHBB 2J88L 4PBWD 4NYLA 3CFJA 3CIQA 1G7PA 3PUCA 2Z9TA 1I8IA 3OKEA 3CFDA 1NUFA 4YX2L 4DFHA 4FTVE 5HYEA 4U33A 3LQZB 1U8NA 5MI0B 1T4KB 2Z8RA 1K2DA 4P4KB 1HKFA 1KTRL 4ODXB 5CBAA 3SDCB 5EIIB 1OW0C 4TUJA 1S9VB 4M61B 1HXYA 1MF2H 1I8MA 5CIPH 1F11A 3WFCL 5K9JH 3UPCA 5TDPA 4XVJH 2NCMA 3C08H 3T0EE 2CUMA 4FQPA 4HKZA 3CMOH 5ENWB 2JJTA 3REVB 1JK8B 3TEUA 5JHDE 1NFIA 3PDGA 5D72H 4NZRL 5EZIH 1K9TA 1RZFL 1JV5B 5LGJA 1KN4L 4X6EA 3MUGB 3OB0K 4P2QD 4QHKI 3TIDA 2B2XH 4FFZL 5C9JB 1NUDA 3IFLH 4MAYB 1A7QL 2EDBA 4HC1L 4XC3H 2V2WB 4LASL 4PRIA 4ZFFB 3HR6A 2WUBH 5D5MB 3GSXA 3WDHA 4GKSB 5C0FB 1FGNL 3O3DB 1MCBA 3DNKA 4NNXA 5KSBE 1PKQE 4L29A 1UQSA 4RFEB 1IAOB 1Q94B 3MGOB 3A67H 5T1LA 1NFDF 3TNNA 5JMOC 4ODVH 4U49A 5GS1C 4TUKH 2LU7A 2NXZD 5DS8A 1F6AA 1J18A 3FOLA 2OCFD 3F62A 2C4FU 4YXKH 4JO2H 3LEVL 3TP4A 1A1MB 3LY6A 4K8RD 5FYLD 4JO3H 3W0WB 3R06A 4OLZL 5JW5A 4CDGC 2Y5TB 1NC4D 3DX7B 1NCTA 2PETA 2WSKA 4GRLD 3WEXA 1MI5D 4NC1C 3MA9H 3Q5OA 1ITCA 4I8DA 4JO3L 3OJMB 2M2DA 3C6LC 5INCA 3PL6B 3D87B 3QDMB 3HMXH 3DRTB 2HKHL 1ZHBA 1Z5LB 3H9ZA 4TYUA 3MA9L 3U0TA 3QULB 2BJMH 3DMMD 1QBBA 4M62H 5SWSA 3MLUH 5DHYA 3QQNA 4ODWB 4Y4FD 3K74B 2XWBA 2Y07H 3MLXH 4U6XA 4LRIC 3V0WL 2F8VA 4JQXA 4LSUH 1SJEB 32C2A 3BP6A 4M8QA 2D3VA 2V17L 1IQWL 2ENYA 3LKPA 1NCDL 2VLRB 1L6ZA 2VL5A 4LSUL 3MLZH 1WJ3A 2VLRA 5EBWA 2NY4C 2C3GA 1IQWH 4JE4B 4HS6A 5ABDE 4FQXD 5KVDH 2D7TL 2YKLL 3LV3A 5CZXD 5BZWB 3L7EB 1A6WH 3O0RH 1TVHA 5CWSB 2CR6A 1MCPH 2X4PA 4QTIH 3EZJB 1JNHB 4ZS7L 3RNQA 3PV7A 2FATH 5KG9A 1KENH 2E7LA 4Y4KA 1A6WL 4GW1A 1HSAB 4Y8AA 5D70L 4U7SA 4ZTPH 1JNJA 4MB3A 4C55A 2HLAA 1KCUL 3CSYB 3TV3L 5KW9L 3O11B 3ZKXB 2P8PB 4ZTOL 5SX4I 1R6VA 3ARDA 3WHXA 3H2WA 2HVJA 3CZFB 4HIXL 3FN0L 3L95A 4YZFE 5IMKB 1IGFL 3E1F1 5GS2D 1BQHA 2BSSB 1HDMB 4PRPB 5C07B 2HYMA 4KVNH 1D6VL 3MREB 2QJDA 3QT2A 5JDSB 3UTZB 4Y4HB 1LO4H 2E9IA 3Q3GA 4OZGB 2VLJA 4Z77B 5T3ZL 3AS2A 5GGRA 4NOFA 4W6WB 3BEWB 4ONFH 2HRLA 2UZYB 3MLTB 4J7RA 3X3GH 2EDKA 4QRRD 3DX6A 2BVUA 3DRQA 1BFOA 2VRAA 4I0PB 2ITDA 1XZ0A 2C4XA 4FNLL 1KJ2B 1EO8L 2OQJB 4PREA 3X3GL 2VAJA 4GAGL 4F7EB 2YK1H 2QQNH 3INUL 4QY8B 1XMWA 1MHPL 3BDXA 1S5IL 5MEOB 2DQUL 2EKJA 4PRAB 2NX5D 1EO8H 3AS0A 4N1HB 4TSAL 4NO5A 4LLAA 2HA1A 5EU7C 2P5WD 1OAZL 1S78C 4S2SA 4WFGE 1BBJB 3RWEB 5L2KD 3O2VH 4KMLB 2CPCA 1RHHB 1IGJB 2AJ3A 3OF6D 4WEBH 3QHZH 1L7TH 3D69A 3GMMB 5CMAA 4RMUA 4QRPE 5ETUB 4L3ED 2NMSA 2P8LB 2QQKH 2ESVE 1CIUA 2OM5A 4AT6B 3F6LA 3WJJA 3OKKA 2YN3A 3KPMA 3KYAA 4YAQA 3FOLB 3FZUC 5DA4A 5GJTH 1C16B 3VDBA 3MR9B 2Q76A 5IVXF 5IWLC 4R8WH 4DKEL 1ACYL 5FYJH 1KCSH 2GJ6B 4XAWH 2X5PA 5DJ0B 3EDJA 4UOW0 1JWUB 1U58B 1N6VA 2LTQC 3VXQA 1U91B 2JB5L 2M26A 3C60A 2NXYD 4WI3A 3MRLA 5H94B 4AENA 2FR4B 3HC3H 4LHUD 3FOMA 4FP8H 1LO3L 3CSYA 5BVJB 1BFTA 3MLRH 4LRNL 5KZCB 2NZ9D 2X4NB 1AY1L 4PG2A 5EC1B 1U8OA 3TBTA 1H3WM 3OGCB 4OSUH 1TENA 3RTQC 1A6AA 3WS3B 1JTOA 3BKYH 4ODBD 4LRNH 1A4JB 1IRAY 2HTKC 5F7DA 4FZ8H 4OZIA 3SOBH 1WWBX 5GS0L 4RRPG 5D71H 3TT3H 1D9KA 3VI3E 4LVNB 1R3IL 1HKLL 3PQYA 2W0FA 4XVUD 1KJ2H 5DO2D 4JZOB 3TESA 2MHAA 4OBRA 3NGBB 1SQ2N 4Y19A 2HMID 4YHOL 1EFXB 3SPVB 1PJ9A 4ODHL 4JZNB 1HHGB 4Y16B 1SYVA 3T0VA 4U6VL 3SKOB 4C4KT 1N2RA 1H3UA 1KUMA 1UKSA 3KYMA 1QHPA 2IBZX 5ITFB 3VRIB 1PG7H 3HAEA 3VJ6A 4D8PB 2EC9T 3ARVA 4NRXA 1EEQA 1CGUA 3FCTA 1D5BB 3IDXL 4LKCA 5DFTA 4X9FA 3VWKA 4AEEA 4NDMB 4PLKC 1ZLVK 3AB0C 2MJWA 5HDOA 1DR9A 4CBPA 5FO9A 2ATPB 1NGQH 4HUUB 5F1SA 1IEAA 4P5MA 1BGXH 5ICZB 1CF8L 3KNBB 1MHHB 3ARBD 4BH7B 4DAGH 1X4YA 3GSRB 1I85A 3O4OC 5E9DD 3TWCH 2E9WA 3KLDA 1BBDH 1H5BA 3FT3B 4JFYB 5EPMB 3ETBF 2ADGA 3OR6B 1MFCH 3KYKL 1ZS8A 3A0OA 3TWCL 5SV3A 5L8KB 5DEFB 3C8DA 1FYTB 2WIIA 1QFWI 5E2VL 1ZWIA 2NXZB 4D0DA 2EDNA 2WIIB 1VFAB 3CDCA 3BYYA 1D5XA 4G9FA 4F2MB 4UB0H 2CLVA 2VERN 3IDNA 2QSCL 3MRBB 3HI1B 1CG9A 2QTEA 3FTGA 3GSNL 1AJ7H 2IQAB 1MQKL 4YWGL 3T77A 1OGTA 5I1HH 4JM2C 5IESH 3D9AH 5T3XL 5AYUH 2GCYA 3F5WB 3J7HA 4YQXH 3BHBA 2DD8L 1CFTB 5JXAH 2HG5B 1QRNE 1NQBA 5JOPE 1T66D 3LN9A 4UT6L 5T3XH 5JA9A 5FO7A 2G2RA 1BX2A 1MVUB 1GPOH 1DL7H 1UFUA 4HX1A 5EWIL 1MCNA 1H15A 4CJ0A 4CAGA 1FGVL 5LCVH 4X6BA 2XFXA 1FVDA 4HXBL 3TH4T 5A3IC 4KJYA 5EWIH 4ZFGH 2HN7B 5HGBA 25C8H 1MFEL 4MNQD 4Y8DC 2VXTH 3T2QA 2R0ZH 2VZTA 1KT2A 4HW6A 2FL5B 3K4ZA 4QHUB 4NO3A 1LP9F 3QAZC 3B2UD 3MYJB 3FONA 4EBQL 4FQQA 3ARGA 2AV1B 1RUKL 3QWOB 5JLZA 1DLFL 2QL1A 4UDTA 3BD5A 1RJYB 2R1YA 5GGRY 2K3TA 2IQ9L 4HKBB 4LBEB 4YR6B 5F7WC 2JCCF 4R4FL 3VXMA 3ZKMC 1C8PA 3RKPA 3GMMA 1L9NA 4RAUA 1XF5A 1RUKH 3QG6B 4BH7A 3HR5A 3ARWA 3PWUB 5CJXC 4PRID 2R0WH 3MV9D 5D6CB 4WY7H 4KH2A 2VDPH 2CLZB 4H1LA 4KK9D 1JZ5A 4NQVB 4EUPA 4KK5C 4MXVE 4PRAA 4MMZC 4FTVA 4WCYL 4YXHH 2VDPL 4POZC 1CDJA 3SCMB 3CXDH 3KYMB 4NC2B 1H3PL 4D0CA 1TJHH 3HTLX 2AI0H 2GJZB 4LF3B 4NPYA 2YUXA 5J1TC 4RCAA 4X80L 3UO1L 4WGVB 4UINH 2C3VA 1OAYL 1UYWL 5F89B 4X7EC 3TFKD 4ZAKC 2J88H 1JTTA 4X83A 2C3WA 3BZFA 4KRPD 1DBBL 2EIZB 5FHBL 2LVCA 4K3JL 4N0RA 3O81A 4JFOB 3TVMB 1PKOA 1UB6B 4O02H 2BXYA 1S9WB 5F7DB 3P4MA 4WNQA 3WBDA 2A74A 1U3ZA 2PO6A 3ILQC 5IBLD 5IFAL 3SE9H 3F7VA 3VA6A 1XR8A 3NAAH 3IGAA 4CN1A 4JCLA 1GYAA 4OTXH 4NZUL 1MF2L 4CMHB 5CEZE 3F7PC 1KYOJ 2MHAB 3MRPA 5CEZL 2H6PB 2DI8A 2J4WH 1CYGA 2X10A 1RAMA 2R2CA 4U1GB 4QRRB 3RVTD 2O5XH 4F33B 5GS3A 3GB7A 5IB4A 4G7VL 2XQBH 4M7LH 5F9OL 4YHKH 1B0WA 2CXGA 3MGAA 4P3CL 5D72L 2D7QA 3DX9A 3UJJH 3OR7A 2C7UA 2CH8A 1Q1JH 4JKPL 5DZNA 3P9MB 4PRPD 4YHKL 4BSVB 5CMAB 5JW4R 2I9TA 4GS7B 2AK1L 4R0LB 5E9DB 3NOIA 4G6MH 4LLWB 2D2OA 1ZSDA 4JKPH 4OCYH 5AG8A 5F7FA 3QO1A 1ZLUH 1EGJH 2BY1A 2VR9A 2EDFA 1LEGB 5HHQB 2XWBB 3RZCB 5HD8D 3EFFB 1QFUH 5EC1A 4P5KB 4YDJB 4ZSOE 5DQ9A 3BD3A 5EOCH 2DIJA 3OXRA 4JKWA 5EC2A 1MIML 1VGEH 3ULVL 5EO0A 5ESVB 4PJ5D 2X40A 3EO0A 4F57H 4CU6A 3ZTJH 4XBPB 1PEWA 4YXKL 3C60B 2C26A 3ES6A 2XG5A 3AM8A 5KJRL 3L3IA 1A9EB 4J4PD 5DUBB 2ATKB 4Y5VB 5GGUA 4DGVH 3D0LA 1LO0H 5SX5H 3P77B 1G9EA 4RNRB 2ATKA 5IMMA 1FO0L 1WIOA 1OT2A 4GW5B 1YEHH 5EU5A 5DEZA 5KJRH 4QRSB 3MV7B 3HMXL 4PJFA 1IAKB 2OBGA 3MCKB 15C8H 4ZO6A 2F5AL 4Y2DD 2OP4L 1YEHL 3FHQA 3V5KB 4R96A 4MDIB 4MSWB 5IQ7L 1S7QA 4MHHI 3KPRE 3GI8L 3MODL 5C09A 4HT1H 1BQHB 2BSSA 5I8EA 5ICXB 3BVNA 1RIVL 2DWEA 5L2KA 2XKUA 1JWMB 3QDGD 1BM3L 1RK1B 4EUPG 5CILH 4NQSA 5AUMB 4KQ4H 4DTGL 2X4QA 3K8LA 3BEWA 3BQUC 3G08B 3CAFA 1BM3H 1AD9A 3A6OA 3IU4L 5J9PA 3IB4A 1V7ML 3SE4C 4I48A 1X5KA 3SY0B 1KJ2A 5D7IF 1ORSB 5EU4B 2JJVA 3BEVA 1KELH 3CX2A 1N8ZB 2Q86B 1BOGB 2CXKA 3LRHA 3V95A 4UDUB 5ADPH 5CEYB 3GJEB 4HGKC 3NPSC 1KN2L 3L3KA 4X0KB 4KZEH 4FQIH 5T1LB 2C3HA 3X14A 5GGTH 3VXUE 2FSEB 4M02A 4QRPD 2NY3C 4LAQH 2VZ1A 2LAGB 1CLOL 4XHJC 3RIAK 4C54A 1YEGL 3TBWB 1D6VH 5TGBB 3L5XL 4LLMB 5MENA 2EZ0C 4X6EB 1QR1A 5EZLA 4XRCA 4EXPX 1F6LL 3V6OA 3L5XH 4X7SH 3SGEH 2AXFB 1Z5LA 4XXCC 1RUML 1ORQA 2WNGA 4L5FH 3QO0A 3OPZH 3WL9A 2GSGB 2APVA 1BF8A 1DUZA 4WEUD 5F6HI 1BQUA 1FZJA 2J6EL 1CFSA 4TOYL 4X7SL 2GJZA 2OR9H 4NPYB 4RNRA 5IMMB 4XNQB 1MVFA 3GJFB 1I8LA 3I6LD 5D7JB 4Y19D 2ADIA 4JY4A 3WFZA 4V2CB 3HI6H 4YPGA 3PWLA 3QIWC 3RJDA 2CDFB 5BOZG 2ZG2A 1R3HA 4LPYA 2ICWA 1EGJA 3RPKA 2FGZA 5L0QC 4OQ1A 5BV7B 1WUNT 4IOIA 4GBXD 4YFLI 4DUVA 4L4VD 1QA9A 1K4CB 1ZANH 3BQUA 2XZQL 5GZND 2DAVA 4MCYA 1MCLA 5KVEH 1WVZA 3H3PH 5E2WH 4KKBC 4NYLB 2C1OA 2AQ3A 3EDDA 3MBEC 1A3LL 3LHPH 3BSZH 2DQGH 3QUMB 4XAKD 4P5TB 3C5ZA 5HDQH 1J5OH 3WKML 2HP4A 3VFPB 1RZIB 1PLGH 3C60C 1CICD 5DRNA 4YLQT 3UYOD 4K8RL 5FV1L 4L8DB 1U41A 4PJ9B 2X1OA 2PW2B 5DTFB 4J8RB 3JV6B 1NLDL 2AABL 5C0FA 3JV6A 4NJAH 3VXRE 4PJBF 2C7UB 5CEYA 3HC3L 4HAFA 2CJUL 4OB5H 1MCWW 1NEUA 1U8NB 1LO3H 4WRLA 4WW2F 1D5BA 3BE1H 1W72L 2FJFA 3TJEH 3RY6C 1NLBL 4DZBB 2AXGB 4JCMA 3VRJB 5BVPL 5FYJE 4HWBH 3BH9B 5K9OA 5GS0H 1F90L 4Y19B 5E08H 3HMWH 5KG9B 5F97E 5ANME 4J3XA 5HI4D 4F3FB 4ODUB 2CKBB 2JJSA 4XZUB 4ZXBB 2A6KB 3MLPA 4CVUA 3MO1B 5CKGA 5I8KL 4WI6A 3BDBA 2ICEA 4NQEE 2VOTA 5J3HC 4FFYH 2IPKA 3K0WA 3D39D 4Z7UF 4YHPB 1DBJH 1P2CA 2BOBA 3UTTE 3C6LD 4IOFC 3HS0A 4H8WH 5I1LA 3D0LB 5IP4A 3QZWG 4GXUM 4NNPH 5ACLA 3RGHA 1ZVSA 1MNUH 2W92A 4QOKA 1DBJL 5JZ7C 5SWQA 3LKSA 1PZ5A 3D2UB 3P0VL 3KPPA 1NSNL 3WIFB 1CFNB 3K2MC 4JHBA 4WO4D 4WWID 1UQSB 3DBXA 1RZGA 5C7XL 3V6OE 3NTCL 3F8UB 2NY2D 4Z7VA 5FUZL 1T2XA 1NBYB 1U8QA 4G8EB 3RZCA 3MCLL 1YECL 4ZUUA 3NTCH 4PJ5E 3QDGA 4OCNC 3CX5J 3QCTH 4P2QB 3T4YA 2ARJQ 1OP9A 1MFCL 2XPGB 1UKQA 1P4BL 4JFFA 1PAMA 2IPUK 1FYTD 4WWKC 5IJVB 2R2BB 1X9QA 3X14B 4D9LL 4EOWL 4LCCA 4OCXL 4RWHA 4U1IB 4JHWH 1FE8H 2PF6A 5EA0H 3CLEL 5ALCH 4D9LH 3MOBL 1JBJA 5IOPA 1FAKT 3TVMD 1UWEL 2ZWLT 1AQKH 4XP9L 1MHEB 4XXDB 2QSCH 4MDJA 1BLNA 2GQHA 3GNMH 3U9UA 3QQ9D 3ZE1E 1CXLA 3CFKA 2D7NA 5IB2B 3VXME 5IV2A 5IMLB 3BWAB 1NPUA 4MX7B 3VH8A 2WAHA 1TQBB 1R5IB 5IESL 1KGCE 2QADC 4Z7QF 4R9HA 4JG0L 5B8CB 1JF5A 1A02N 3JTTA 1FZMB 1G0YR 1GGUA 4GAYA 3KLAA 2YRLA 4B53A 5I1GH 3QIWB 3QH3A 4NN5B 4QXUH 4X8JA 5HSFA 3KLAB 1VCAA 5DJZA 4FQJL 1NGWB 2M1KA 4N0UB 5FGBC 2FLBT 2R2HA 4AG4H 5FUCC 4LLQA 3CVHA 2P46B 4WUUD 5CIPA 9CGTA 4KKLD 2ED9A 1A1OA 4M5ZH 5I8CB 3T2NH 5D2LF 2L7JA 1A8JH 5CP7B 4LSPL 4Q9QL 1QTYT 2R0ZL 4F7TA 4PB9H 1EXUA 2EDXA 2GT9B 1FC2D 3I3DA 4MJ6A 5DHVA 3LD8B 1RZKC 3BPLC 5E70A 1MUJB 3HZMA 4YHYC 5J0BA 3MRIB 1VACA 1XF1A 5D7KE 4UOJA 1UWGH 4KXZH 3U48A 2QKIA 5T33L 1K6QL 3MFFB 3D25B 4WHYG 3VFSA 4P57B 2X4PB 5F1KC 2W1NA 4MJIB 3AS1A 4NKOA 1ND0B 4QF1B 5H2BA 2BP3A 3V4PH 1S9XA 2ZUUA 2YD3A 3IDJB 3V5DB 4FXGB 1NDGA 2DIAA 2BVOA 2X6MA 4YC2C 3EYOB 3UBXA 2AJUL 2EDEA 5CEZD 1GZQB 4ZD3L 3MRFA 4NM8H 3CPLA 4NHCL 3GSVA 4BUGA 2DTML 3FQRA 3QIBB 4DKAA 4ZD3H 2JB6B 1HNFA 1I3RB 2AJXL 4KQ3L 1TJHL 2CMRH 3LB6C 1IKNC 1W72A 1YNKH 3I6LE 3CVHH 4P0DA 1UJ3B 2MCG1 4KKCC 1G9MC 5J1AB 4LDLB 3GM0A 1HEZA 1OB1B 2DQCL 5DD3H 4NO2B 5I1KL 6CGTA 2W9LA 2FLRT 1WCBB 2BSED 2ZG1A 2NY7L 2AXHA 3RZCC 3IJYB 4UAOB 3VI4E 1N64L 5A2KH 3ULVC 2AV7A 3ARGC 4PGJA 1P2CB 4WI8A 5GSRA 4CU8A 3OL2A 4YDIH 3MXWL 3RWGA 2VZ3A 5C92A 2EYRB 4CKVX 4KUZL 4OIIL 1B3JA 2YPVL 3C8KB 3KPQB 1HXMA 2IBZY 1Y6NR 3G5VB 1CVRA 2FWOA 1DUZB 2AJVH 3AY4C 3UC0H 2F5BL 1A14L 3DURA 4R7DA 3PWNA 4NUGL 2O5XL 5F3HB 4NRYB 4PJBA 1AKJA 4ONHA 2YBRA 1DVFB 1D6EB 2W38A 3B6SA 4NWUL 5ISZB 2R69L 4LDEB 2FBJH 4RAVA 2X1PA 4LARH 5D2LE 3V7MA 3GJFH 1ZEAL 1LEGA 2OI9C 1NFDB 2WQRA 4PJGA 2IGFL 4HZLA 3O45A 4LGPB 3DV6A 3AU1B 2FJGB 1GAFL 3D85A 3P11H 5ESVA 2X44D 4M03A 3S88L 1S7WB 1MAML 2H3NB 4XC3L 4NRZA 4NKOB 3LVEA 4BELD 2R15A 3Q6FA 3JUZA 1GOGA 4U7KA 3ZYJA 5H37H 4TN9A 3DYMA 5IB3A 2BSTB 3P4LA 3U4BL 5TQ0H 3RFZC 3TFKC 3KVQA 5C2BL 4LMQI 5SWSB 5IJVA 2AJZA 3GBMH 1QQDA 5EO9B 1NL0H 2DB8A 3LN4A 5BS0A 4WENB 5JLZB 2B20A 2DMBA 4FXKA 2A6IA 5DMYA 3KPRA 3ZKNC 5C2BH 4MJ5B 3S6CA 1DQLL 5HGDA 3DIFA 5HHME 2V5MA 4I3GA 3G6DH 2DYPB 4KK8C 4MA8H 1FVCB 1F58L 1VACB 4P3DA 4HUMB 3G5YA 4UQ3B 2PXYB 5E9DE 2XXCB 3VXOA 2OXHA 5FFLA 3UAJC 4M6OH 3O6FB 4Y4FB 4M00A 4XMKL 4PJXB 3WIFA 3TYGL 4NZTH 1URLA 2HRPH 1F4YL 2EICA 1JHLL 5IWLA 2R0KH 3CDYA 4TNWK 1OGTB 5IBUB 1FRGH 3HMXA 3KPQA 4JVUA 4TQEH 2NTSP 4ZPVB 3NZ8B 4O5LL 4ONGL 2H9GA 2DI7A 2HFTA 2BNUA 4Y1AE 1KBGL 2PN5A 4LCUB 5JOEA 2VH5H 4F2MA 1F3DJ 1UVQA 1PY9A 1NCDH 1MJUH 3KPOB 1V7MH 4X6CA 4JM2F 3T04D 5LGKA 2VITB 4JKMA 5D1XC 1V3MA 2XQYK 1SEBB 1KJMA 2UWEA 4KMTL 4R6UA 5GRUL 3TZVB 3VGAC 3U0PB 3HR5B 1BVKA 5BMFL 2ADGB 1IL1B 5CJ5A 1GGBL 5C08D 2FBOJ 5E6IC 4QTIL 2Q20A 4I0PA 1QD0A 4EZMA 3PP4L 3OZ9L 1BQLL 1MCHA 3LV3B 5C0GB 1PQZA 3Q1SL 4DZ8A 3TH3T 4LK4A 4JGUA 2XZCH 4LVOC 1ND0A 3KPRD 3WFDH 4H88H 3DX9B 3LQZA 3FN0H 2BVOB 3LIZH 3KJ4C 1EVUA 1P7KB 5EN2B 4HKBA 4YR6A 5GRZA 5IB5A 5K59F 2X4UA 3B9EA 2FHFA 4L4VB 4U0QB 1S7XB 5HVGB 1DZBA 1FN4B 4XPAH 5D5ME 1HZHL 5E8EA 1DANT 5GS0C 1JZ3A 4TOYH 1YJDH 3BWAA 1TZIA 4L3CA 3OKLA 3C09B 4M43H 2F53D 2HWZL 2APWA 5GGRB 4LCIL 4WO4B 1DQQB 3BQUD 1ZHLB 4GSDL 1T2QL 5DK2A 3X13B 3HZKB 3ARTA 4K71B 5C0BB 4KJQC 3RWFB 5F71A 4JZOA 1SEQH 4URTB 3WSQH 1WISA 1KCVL 5GSRB 1JPGB 1YMMA 4UT7H 5FOJA 2D9QB 12E8H 1GJIA 3U7AA 3ZL4H 5IW3A 2P5ED 1A3LH 1HXMB 1IGCL 3LHPL 3WHXB 3EJYC 4YHIA 2XKNB 4PY7A 3BDYH 3IAGC 1KG0A 3I84A 3UEZA 3KLSA 2VLRD 2H26A 5IT2H 1HEZB 1CLZH 4DN3L 2AS5M 1QYGL 5GJTL 4QEGA 2R56L 3BDYL 1ROWA 4NHUB 5EU6A 3BMWA 4F15B 4G5ZH 4JRXD 3ULUE 1NLDH 4F9PC 3JV5A 3RWDA 2XA3A 2VYRE 4UOW1 4A6YA 1I3RA 3LPWA 2XTJE 1JV5A 5LGJB 4BH8A 4L8SB 1QYGH 1Q0YL 5IR1B 2CJUH 5SWQB 1IQDA 5E6YA 2PXYC 2VO5A 3ARRA 4HJJL 4JG1L 3BX7C 4NNYA 2B1AH 3S35L 3ARFA 5BXFB 5ECJE 3OKDA 3PDDA 2E6JA 3V4UL 2I60H 1CDYA 1A6VL 3OX8B 2GW5A 4XP6L 2YD6A 4QF1A 1S7TA 5H2BB 5DJ6A 2UZIH 4YNYA 4RGNE 3UDWC 4F8QA 5E1AB 3WFBL 3MLRL 1IAOA 1CFBA 4HS3B 3MRPB 4HH9B 4NJ9H 5DHYB 4LPVA 5DJXB 4TSCL 4KRNA 4U6XB 3CZJA 43CAB 3TPKA 3QIWD 1Q0XH 1IBGH 5I74B 3VFVB 2JE8A 2D7MA 3FB8B 2GAZB 2Q7YA 1OL0A 2ZOKB 1SJEA 4HCRL 1LNUA 4AY0A 1T1WA 2Y5EA 3G5XA 2CLRA 2EKSB 4Y2OA 5GHWL 1KCLA 1E27B 4Y2DB 1A2YA 1RURL 2A38A 2DL9A 4NT6B 1HIML 1BVLB 1J12A 1D6EA 2Y36H 3QDMA 3QI9C 1M6OA 1Q8MA 4DCQB 4NIKB 2BZDA 4G8FB 3HKFA 4X9IA 1M7IA 4HQQH 1PG7L 4QNPE 1CL7H 4L8BB 3MLYL 1YEDA 3AM8C 4P2QA 3WL9B 3SDXA 1C5CL 1KIRB 1RZIA 2VAAB 3C2SA 5TF1L 1I3UA 2KH2B 4PJ7F 3O11A 3NIFF 1N0LA 5DWUL 5DJDB 2N56A 1YDPB 1FNLA 3LDBB 3SO5A 5IMKA 3RL1B 1KXVC 4JFZH 5EO1A 1JGEB 1B0GA 3SGJC 1FZOB 1QSED 1O7SA 2UVEA 2VXUH 3TIEB 1OLLA 4G7YH 5E5MA 5B4MC 4ZUVB 1VPOL 1LEIB 4JHWL 1FE8L 3QISA 5C08B 1JRHL 3DXAE 5A16B 5KSBF 5DQ9B 1LHZA 1LO2L 3C6SB 4HH8A 3S3JA 1J10A 4KKNA 2OL3B 3ZE0E 4ZFOA 1ADQH 3C09C 3CMGA 3QDHA 5DD5L 1IQDB 3HZVB 3QDJA 5DK2B 3X13A 3MRQB 3QIUD 1I4FA 4WVRA 5EBLA 3VFPA 4HWUA 4QRQA 1OVZA 3HE7D 2C1PB 3DHJA 3LQMA 3P30L 2FH6A 2F54A 2YN5A 4XP1H 4P59L 1NJ9A 4JY5L 2W91A 4C59B 2AJ3B 3QUMH 5DJAB 3VFMA 1I8IB 1MFAH 4FOMA 2ZOKA 1BFVH 1MJ8L 4KU1A 4M6ML 1T83A 4I2XB 2B1HL 2NXYC 1FFQA 5C1MB 4N5ED 4QYOB 3MJ9L 4BQ8A 1MFAL 1AIFB 3WIHL 3V7AE 4ZG1A 3BZ4B 1K8IB 4RSVA 3CCHB 5C0EB 3AVEA 1HQ4B 3FKUS 4NQCD 3VWJD 1JYVA 3MJ9H 5DRXB 4MGXA 3TO2A 5F8RC 2X9YA 3VFGL 3DX6B 3QEQE 1N7MH 4MNGA 3ECBB 1JGVH 3C5ZB 4HLZH 4F9LA 2EXWC 4NWTL 5A43C 1T3FB 4PJHE 5FK9A 5BVJA 2BNRA 1N7ML 5KSVA 2YC1B 2RFXA 1E4XH 1WGOA 4OGYL 3MRCA 4ZS6D 1KPRB 1BECA 1QFWL 2IBGA 3BGAA 1WFTA 1KPRA 4X6DE 3L3DB 1B0GB 1FNGB 3IFPA 4U05A 3NABH 1UGNA 5I9QB 4PJBE 4JHAH 4OZGE 1OM3L 1I75A 4ZO9A 3GMPA 1KCRL 1MCCA 3U9PL 1HQRA 5EU6D 4KQ3H 2P48B 1JFQH 1F45A 2CMRL 4LLWA 3WNOA 2YWZA 3ZMRA 4JO1L 3PQYD 2KUTA 1YNKL 4NN6C 3UX9B 2IFFH 4PS4L 4JFFD 1M7IB 4G6AC 2NX5B 5DK3A 4OZHE 4I3SL 3CX5K 4FABL 2X4RA 4MNQE 1CZ8L 2YHGA 4HEPG 4XMLH 5A40E 3ZKND 3X12A 1ACZA 3H9SA 7FABH 4FABH 3S4SG 4WUKH 3OMZA 2NY2C 3DTXB 3PL6A 2DQDH 2R9HD 5F88A 5FHBH 5EO1B 3MRMA 4U3XA 3BT2H 1FPTL 1CK0H 3FN9A 3C8HA 4Q58C 2CDFA 1AP2B 2N7AA 5CBEB 1XF4B 4TVPL 1NDMA 1D5IL 5E8EB 2BY3A 1NBZA 4OGAD 1C12B 1G9NL 2VWEE 1FPTH 5GGTA 1DTUA 2CO7B 3PV6A 5F6HJ 2F5BH 4TNWF 1K4CA 2MSPA 1D5MA 1TPXC 4X5WA 5JPMA 3RDTD 4NWUH 3SEPA 5MHSD 4OCLC 4YNYB 1G1YA 4EDXA 2W0PA 1XGTA 4O2FB 4LARL 4Y4HA 4FQ2L 5B3NA 4Y1AB 3C2AH 1TETH 2X4OB 5BRZE 3LS4H 2WUCH 1PVHA 2VN4A 4ZDHA 4P3CH 8FABA 2Z8WC 3EOBA 1I9RL 3ES6B 4FXLA 5DMIL 1FFOA 4MA3A 5IVXA 2EC8A 4W70A 1UACH 1ZT4A 2PYFA 5TF0A 1LEIA 4OLEA 2HFEA 2BMKB 1FZKA 4PRDB 1LNUB 1A7OL 1HI6A 4ZUSB 4G8IA 1KB5A 2OTWB 5BS0D 2H26B 2H32B 5FUOH 5TQ0L 3UZQA 5KAQF 1DUYA 3MROA 4U6YB 4KI1A 1QFUL 2FH8A 2R1YB 1N6UA 1PYWA 2VXSL 3OAZK 4HHAB 1S9WA 2HLFD 5D96B 3WHE0 3RA7H 4JLRA 4PJDF 3QXTA 1L0YA 2V7NB 3DI3B 4IDJH 2J6EA 1G7QB 1J0HA 4AM0B 2P8MA 4UQ2A 3MV8A 5HYJD 3OKDB 3LRSB 4YE4H 1R5VB 3MV01 4UUJB 4KJYB 2LE9A 3PWVA 1T0NB 2HKFH 1T04B 5LAXA 2FD6H 2G5RA 1UM4H 4JN1L 5KVGL 3GBLA 3UTPD 5CJOL 3VFNB 3DMMA 4LHQB 1A0QL 1QFPA 1ZK9A 4DN4L 5A2FA 4ENEC 3EJZC 3U0TB 5FO8B 1SJHB 1XCQA 3IRZA 5F1OB 1QG3A 3OB8A 3ZE1F 5KVGH 2QQLH 3PNWB 2ZNXA 3GIVA 1FRGL 1UZ6E 1J0KA 4YK4C 3STLA 3QEUB 4GRLB 1QHOA 4PJDA 4UTAL 1NEZG 3PG2A 1IAKA 2W9EH 3HPLA 3ZZ1A 5E8OA 5I1EL 4OZHA 3ZKMD 2EDRA 4S1SH 1UXWB 4R96B 5E0QA 2AV7B 1ZV5A 1ZXQA 4KK5D 2VDML 3IXTA 3HZYA 4PJGF 1FCGA 2ORBL 1JN6B 3JV0A 3AY4A 1GIGH 4KMTH 3MYJA 4PRHE 3MLZL 3VCLB 2IEPA 1DQTA 4MLSA 2VABB 3N9GL 4PY8I 5L6YH 5C3LD 2ORBH 3FO1A 2Y23A 3MCG1 4HIJB 2D7TH 5EUOB 5DJ8B 2CRIA 4L1DA 5JOFB 5ADPL 1QSFD 3BXNA 3S35X 4K23H 4FQIL 1A1NB 1EHXA 4H25A 4MJ5A 3TYFB 3WUWA 4HJ0C 3JTSB 4JFOA 3TVMA 4BZ2L 4KGLA 4HKXB 4G6KH 2B0SL 1TJIH 1KLUA 3L5IA 1S7QB 4YHIB 1KLGB 4Z7UE 3WD5L 4BZ2H 5IQ9A 3ARPA 3DVNB 1KFAH 3EYVB 5TJWK 1HZHH 1UM6H 1S7VA 1EPFA 5HYSB 3QUKB 4HC1A 2VLJD 1YJDL 3KJ6H 1YNTB 2PUQT 3X3FH 3OJVC 4OLVL 5C0CA 1UADC 4QRRA 5A1AA 4H26A 4U1KB 4JGJA 2HT3C 2WBJB 2D0FA 2MQ3A 4FNLH 4WWKD 3L3IB 3ZTNH 2F9BT 3V79C 1YEEL 4MJIE 1A1OB 4ZNCD 4U6TA 5EU6E 2A6IB 4QHNB 1KCVH 1UVQB 3MRFB 4U1SB 4LL9A 1XEDA 5KSAD 2D4DA 1F6AB 2X4SA 1EFXD 4KV5F 3OTTA 4RIRA 1T0PB 1F5WA 1YQVH 3PQYB 5DLMH 3SKJH 1AR2A 3TBVA 1A7RL 3EO9H 4WTWA 2XXMB 4MNHA 3QNXB 2F58L 4HPYH 1CLZL 4DN3H 2VE6B 3LD8C 1I3GH 2YPLD 4XPBH 1LEKA 3SJVA 5CSZA 2H1PH 4QCIB 2F58H 4O58H 1CFQA 4J1UA 5E03A 3T4AA 5E99H 4EXKA 2Z8VC 3VW3H 3GK8L 4U6YA 1B6DA 2AABH 2BNRB 3EOBB 2HLAB 3HG1E 5ISZA 4NJAL 4LHUB 4XP6H 3U0WL 4RGOH 3KXFD 3TLRA 3M8OL 4OZGF 3OKKB 4LPCA 2DQEL 4EDWL 1DQML 2HH0L 5KVFL 5T1KA 5KBNC 3F65A 1AGEA 4Z7NF 3M8OH 4HWBL 1IBGL 2B4CC 5DEGB 1ZGLP 1LP9E 1JGLH 3D6GA 3ULSA 2IAMD 4WO4A 1VFBB 1I9JH 4RMTA 5FO9B 4K94C 1AD0A 5D7IA 1ONQA 4WV1C 1X5HA 2ERJB 1CD1A 4N8CL 4Z7WB 3SOBL 1YY9C 4ZO8A 1PZUB 1D5MB 1EZVY 1R3IH 3QDMD 4P2OA 2AXJA 2VUYA 5C0CB 2AW2A 3DPBA 5TE7H 4CGTA 3QEGH 5CZVH 3GMQB 3C6LA 4JFED 4H8WL 5J8OA 3CDGA 1JNLL 4PJ5B 3OG4B 5KANI 4GKZB 4V1DB 3T3PE 5HGDB 1JMZA 5TFSL 4ODHH 3NMEA 3KPSB 5DQDH 1GOHA 5F70A 3DX8B 1ZVYA 3T3ME 4M48H 1IAIM 5D7KD 5ITBL 4Q6IC 4ALAH 4WU7A 3MREA 2BHUA 3LN5A 4N8VG 1EJOH 4UBDD 2EE6A 1T89C 2V5SA 1CDBA 2FGWH 1XH3B 4P5MB 5GZOC 3IKCA 2FHCA 1OQOA 3FQNA 4NZRH 1KLGA 1OHQA 4OF8A 2VDRH 4WHYH 2UYLB 4TUOA 1BWMA 4HULB 3BZFB 1YECH 1I7RA 1N5AB 3GIZL 4OCMC 5GISH 5EOQL 4JLRB 2R8SL 4NO0A 3OXSA 3NFPB 4JPKL 3RHWF 1NMCB 4KHTL 1FYTA 4NO5B 3SDXF 3N1FC 4GBXC 3W81A 5I17A 2FR4A 1QRNB 4HIIA 4OZFB 3KPOA 3B2VL 1BAFH 3KPLB 3QHTC 3ZE0F 2BXZA 4XBGA 3PHSA 5EUOA 1FZKB 4PRDA 5IB1A 4I9WD 3MV9A 1A5FH 2EYSA 2L7UA 4I18C 3PHQB 4PJIE 2DM2A 1J1XH 3TA3B 5ICZA 3NPZB 3MUJA 1OF2A 4UB0L 4JO2L 4K3DH 1N6QH 1J9CT 2CD0A 2NY6B 1A4JA 3U36B 3IU3B 3BRGC 4D9RE 3ZTJG 2AKRA 3KPNA 4YO0B 1AR1C 5EPMA 5LJYH 1QOKA 2EDWA 3NCMA 3PNWA 3BIKA 1I7TA 1S7UA 3ZKQD 4TRPH 3L1OH 4PFEA 4CADB 5D1QA 4K7PX 4S1QL 3QWQB 3MLUL 4RGMB 4AG4L 2CKBA 4F7CB 5DO2C 2ZG3A 5F7YC 1KJVB 3A6CH 5E4IA 4OFVA 5DJYB 1BZ7A 2MKLC 5HYJB 2EIBA 4HF5H 3RU8H 4KJQD 3DMMB 4D8PA 3HRPA 4XCCH 3UJIL 1KB9K 3UBXG 1YEJH 3B43A 1S5HA 2AQ2A 2JB6A 1U3HB 3N1QC 2NY5L 5GZNC 4LVHB 4IRSA 3IDUA 1UWGL 5ELIA 4PJCB 4OGYH 5IW1A 4G42B 5FAAA 5BS0E 3CLFH 3Q3GB 4X9HA 1OTSD 4BFIB 4QHMA 2IAMB 3TNNB 3FFCD 1FBIL 3RWDB 4A6YB 4J4PC 2FATL 4R4BB 4WHTA 1A47A 5IGXL 1AQDA 2IQ9H 3CDFA 4JHAL 1U8PA 4N90E 2VLKB 1PQZB 5ID0A 3TV3H 5KW9H 4OLYH 5H37G 4HFUH 5EORH 3ZDYF 2NXYB 2EIDA 4FMFA 4MZ3A 3TJHD 4HIJA 4DQOL 2ITCB 3V6OC 3IVKB 1QRKA 3DJ9A 3WFEL 3RTQA 1BIIA 1MJ7L 1IGYA 5EU7E 1U2HA 4PJEA 1CZ8H 4NKDB 3GGWA 1J86A 3IDIA 3UTSD 4KVCL 1XR9A 3HC4H 4X80H 1C12A 4AT6A 4X4XB 3GZKA 5D1QD 1N64H 3HE6A 1A7BA 1DCLA 5C3TA 1NAMB 4KVCH 2VQUA 2J7LA 4XZUA 5AZ2H 4XNXH 5D6DC 2VLLA 2YXMA 2VISA 5E6ID 3EDFA 3MLSH 4MJ2A 4U4BA 1KPVA 4LOUC 3ARDC 1IM9D 4GAYB 4N0YH 5HI3C 3IYLW 4K7FB 4GXUN 1OSZB 3OF6A 1JIBA 4GXVH 1NJ9B 5GRJH 2G75A 5C6WH 3GI9H 4N0YL 4RDQG 1QLEL 5EU5B 2ZUQC 2PNDA 5MEOA 2F19L 3O4OB 4OAWA 4RZCB 1T04A 4QRPB 4WFHD 3NCJH 1Q38A 4GXVL 3MXVL 3P9LB 4RQQB 5J56B 2ZSVB 1T7YA 2AJSH 4MDJB 1XGQA 3QCUH 1P7HL 1P1ZB 1OTSC 1FLRH 3BEVB 3L95B 3UMTA 1CFSB 3LKQB 4XAWL 1FQ9C 3U7YH 1AXIB 3QUZD 1KIQA 5HYQA 2JB5H 4BZ1H 1C7TA 4OUOA 2QADD 4XNUH 5C09E 4X4YA 5F1NA 1X5JA 3WDIA 2OSLA 4LCWB 5ID0B 2ILLA 3V5KA 1YEKH 4ZYKA 5JR1H 3MRDA 1FV1B 5D2LA 4BZ1L 4NM4H 3W5MA 1N59A 1KNOA 1MLCA 1QVOB 3TT1L 4O2EB 4L1HA 3VD3A 3H9SB 3QSKB 3NZ8A 5C6PB 1CE1L 1MWAH 3V8CA 2BNUB 2KQNA 2XRAL 1T83C 4K9EC 5KOMC 4FZ8L 4AQOA 5I6XB 5JUEH 5BRZD 1DVFA 3NACH 4WUUA 1YPZF 2P43B 1E6JL 3M1BA 1WITA 1MCDA 4DN4H 1I8MB 1LO0L 5FXCH 1JGDB 1OSPH 4UILH 3E3QE 2NY0B 3G5ZB 3H7LA 3K4DA 4DVRH 1UCTA 5FYLL 1V3KA 1JHLH 4WI9A 5DRWA 1QFOA 4JPIB 1JYNA 4TPRH 1DQDL 1DLHB 3M45A 5EZLB 4F15C 3D39B 2EECA 4DW2L 4GMTL 3TIDB 3ULVE 5DJ2B 4TPRL 5JXED 4OCRL 3PDOA 1CGSL 5C0CE 4QRRE 1I4FB 2MQ0A 3D3VD 4S10A 1YA5A 5BQ7B 1BGXL 2HJKA 2R4RL 4I0KA 1WZMA 4OCRH 3I6GB 4R7NA 2V2XB 3N9GH 5L6YL 3GEWB 2AQ1A 2CIKB 4QRTB 1Y6MR 4AL8H 2Q86A 6FABL 2VL4A 1Q9WA 5DTFA 5IUSA 2JJTC 3FQWA 2GSGA 1GHFH 2FIKB 2EYSB 1F3JA 1M4KA 3U2SA 2JTDA 1G7MB 3CH1B 3FRPA 3FB6A 4FFWD 1VFMA 5F72S 5AD0A 5E2VH 1X7QA 4JPVL 4OZ4B 4UQ2B 1KN2H 3RZCD 4PBXA 3U46B 5HBBA 4I4WA 2IMNA 4JPWL 1TJIL 5C9JA 1NANI 3D39E 3CVIH 1ZT1A 1HHJA 3I50H 4Y16C 4WHTB 3EO0B 2AJYL 1J8HA 5F7NC 1KC5H 3LIZL 3ZT7A 1AGFA 3MRCB 4LAQL 2UWEE 4QXTA 3GSXB 4HWZA 5I2IB 4G80B 2ZPKH 1TNNA 1Z9LA 3QULA 4I77H 3AXLA 4XCFH 2NNAA 1RPQA 1TITA 2F54D 2ZPKL 1LILA 4KKCD 1PFCA 2WWMD 5B8CC 2VLLB 1PKQB 4XNQA 2IPKB 4PB0L 3RX5A 1HINH 3FQXB 3V5HA 4K94H 1A6PA 4BFIA 2Z35A 2FHBA 3QXVA 2QSQA 3BJ91 3CU7A 1F4WH 3CK0H 5I15L 3K81A 1FGVH 5LCVL 3TBSA 2D03H 4R2GD 5C71A 1TXKA 3BH9A 1CCZA 1RUQH 4ZFGL 1WC7B 5ILTH 3IAPA 4UT7L 2VNCA 3RKDC 3AAZA 1E6OL 2ADJB 1OTUD 2ITCA 3UPAA 5K9QG 3T65A 1CFQB 4J1UB 3T4AB 3VMOA 4RISL 3UYRH 4Z78A 2VLJE 3HLAA 4P2CG 5IB3B 1MELA 3BP4A 4MXVF 2GIYA 3MJ7A 1IE5A 1RULL 1DE4B 3GKWH 5CUSL 3E6FA 1AGBB 2P44B 4JJ5A 5DMJB 1YEDB 4HFWA 1I7ZA 3BMVA 1AC6A 1CQYA 4Y89A 1UJTA 3VFWB 3I2CH 2R0WL 3ILPB 3LKRA 3BOVA 5KN5B 2HVKB 2Y1VA 4YBHA 4YBQC 4D3CL 2BOCA 4PJCA 4OV6F 1CTOA 2EH8L 4LSQL 4ZQKA 3IFNL 4BQCA 1R0AH 4D3CH 1A6VH 2IADB 5ESQB 3QJHA 2YS4A 5KVFH 1RMFL 3GSNA 4FG6C 1TVDA 2O61A 2AK4D 3WFBH 5HPMB 2CDGB 1UYWH 5F3BA 5C86A 4Q9RL 5I19L 2WV3A 1F3DH 1H15B 4EQ3A 3ZDXE 4KROB 3TA3D 2DKMA 3HNSH 4PRHB 2EO9A 4G6FD 1F02I 1F90H 2ENSA 2NNAB 5DZLA 3QIWA 4BQBA 3DUHA 2MPAL 1J1OL 4KAQH 4L8CA 1IAMA 1X5GA 5CGMA 1FYHB 3QEGL 5CZVL 3SE9L 4Y4FA 4KY1H 1R3LB 2DBLL 4CW1B 2XWTB 3PV6B 1NC2B 3WLBB 3PABB 1XH3A 2JKXA 2ZUXA 4NQDE 5DQDL 2F53B 2A9MH 5FYKD 4MD0B 3D0VA 3S8WA 4M61A 4L3CB 5T5FH 1W0VB 4GT7A 4XB8A 3U46A 1OAKL 5BW7A 1EJOL 4Y4HD 4BKLB 3OR6A 4YGAB 4RX4A 5K9KB 4ELMA 3BP5B 2YD9A 1R3KB 3NBNA 1D5ZA 5C0IB 1GZPA 1T7ZA 3NA4A 2VDRL 3I6KA 4U1HA 3UJJL 2EH7L 4RDQF 5BW7C 3L3GB 2QSTA 1Q9WB 1IAII 2OTPA 1P7KA 1G9MH 2LABA 3RGVA 2OX5A 4JFZL 5MI0C 1BJ8A 4PG9B 4GFTB 1RZFH 2P8LA 3U30C 2BHYA 3RY5A 4M6NL 5JTWA 3TF7C 4W4NA 3NH7H 1Y0LB 1QSFB 4CU7A 4XWOC 1T21A 2D31B 5SWZB 5C2UB 5AAMA 4MQ7B 5I71B 2WUBL 1LO2H 4HUNB 1UEYA 3WHE1 3MTRA 1VGEL 5HXMA 3SDCD 3BESR 4X6CB 1A7NL 1MH5A 3BPCB 4N0UE 1A6TB 4Q7DA 2O26U 5E1HB 3OGOE 3FZUD 5ALCL 3A67L 1FIGL 2W60A 5D93B 1FFRA 3B6SB 4Z7OE 3RTQD 3VFSB 4X98B 3BPLB 4M7KH 4F7MA 3QUMA 3U0PA 3SKMA 2AERT 2XZAH 4KZDH 3EDKA 3UTSA 3H9HA 3OKOA 1M05B 4DGVL 2X89A 4FN0A 1FORH 1LK2A 4M3JA 2AEQL 3HPJB 4JY5H 4LPTA 5LQBL 1E4WL 5DD0H 4BQ9A 1QNZH 3B5TA 3QQ4A 3S37L 4Y0GA 1PGRB 4EIZC 2K9UA 3QUYC 4EI5A 3TPUA 1IGIH 3MJ9A 1B4RA 4HMDA 4NBXB 5TQ2L 5I1GL 3L9RA 3VI3F 3N85L 3QEUA 5GXBB 1AGCB 1G84A 3MRKA 3AMKA 5F21B 2VUOA 1OPGH 1XGUB 2PW1B 5JQ6L 1NGYA 1T1YA 3MBED 4DZBA 5AAWA 3T65B 4NZJA 2V9TA 2AEPH 3WO4B 1HHJB 1YUHB 3NFNA 2EEDA 4WFFD 5DEFA 1EHLH 4Z9KB 4P5KA 3CLFL 4LLMA 1UKTA 1TIUA 5IEKB 1BZ9A 3IJHA 1NGZB 2V7HB 2ZCLL 3AMLA 3LQAC 4X7TA 5HI4C 4XBEH 1T5WA 4MD4A 5I66A 4XPTL 1PG7W 3FQXA 2ATPA 3MJ7B 1F2XK 2XYCA 2J1KA 1CN4A 5KS9F 3LKOA 2DLEA 3EW3B 1Y0LA 1VADA 1G6RH 2OMNA 4LQ1A 4CN4A 4DQOH 3AXLB 1RU9L 2Y9RT 3ALPA 2MNUA 4P4KC 3RAJL 2ZCKH 5I8OL 4PRBA 2H2SD 3PP3K 4XCYA 1ZT7B 2R2EB 4IMKA 1MREL 3DSFH 2QEJA 2ARJA 2ZCKL 4D0DB 1MJJA 1NBYA 1XR8B 4I3SH 4X5LA 2QHLA 1J0IA 5MP6L 2EDQA 1R3KA 5IMOB 1JZ7A 1A7PH 1HHGA 4Y16A 1FO0A 2E27H 5D1QB 5FGRA 2D7OA 2ED8A 4XC1H 2YZ1A 4ZFZB 3WXVH 3TO4D 1S7RA 1KIRA 4XH2B 1WC7A 2OQJA 3QUXA 3EYFB 1EUTA 1MRDL 1EK3A 2Q6WB 2C4FT 2NW3B 3BIAX 3WXVL 4DVBA 4PRHA 4ISVB 1MRDH 3KHQA 5CAYB 2BRQA 2CR3A 4TSAH 3TBTB 2XZQH 3BUYA 4HCRA 3QI9A 1RHHA 2NR6C 4TVPE 3CFBA 4WEBL 1WCBA 4WU5B 4U2YA 3VXOB 3P4NA 1TZGL 2G9HA 3BUTA 3BSZL 4OD2B 2BVTA 3SQBA 4ORZC 3W9EB 1ZHKB 1K85A 1IILE 2WUCL 4Z5RA 3L3OB 3QCUL 1XGPA 4HGMA 1PLGL 3LRSA 1EIBA 4W68A 3K3QA 5J11B 2P24B 3O3EB 1D7FA 2VIRA 4PUBH 3G5ZA 4M7ZB 4HK3J 4CRPA 2CUIA 3LRGA 5I18L 4G3YH 2P47B 1JPFA 1ZGLM 3VXSD 4CL7A 5IROC 4PUBL 1Z0NA 1J8HD 3UDWA 4ODXA 4L3EA 1DEEA 4NM4L 4G3YL 4K3EL 1G7HB 3PDOB 1HHHA 3V6FB 2VXVH 1UG9A 1P7QD 3MRIA 5IHLB 1EO7A 3CZFA 3HPLB 4X6CE 3PWJA 3I6GA 1JHKH 2R0LL 4AEIH 4KRMB 5HVHC 4QTHB 3D25A 2CDEA 5FDWA 3VA2C 1P84J 4P23A 4BUHA 3BIKB 1G9NC 1DQLH 5I8KH 2XWTA 5DRWB 5K33A 3ALXA 4JFHE 3EJYD 2LTQB 1U3HD 2ESVA 3D39A 2XN9D 4ODTH 4HXAH 3LPFA 1REIA 1TQCC 4RAHA 4H20H 1X4XA 1U8LB 5ERWA 4XVTL 4YHOH 3TA3A 2B8OT 1B2WH 4FQCL 4PGEB 5CBAB 4CN6A 1EDQA 5BZDB 1PSKL 3SJVE 2HRPL 4LPUA 3QQ4B 3VD9A 4ETQB 3MPCA 4GMTH 3RWJA 3W11D 3ZKSD 5F7UA 3N0PB 1B2WL 3MGOA 4FQCH 2X05A 5D2NC 3D18B 4HWZB 3NFSL 3W5NA 4S1SL 4YDLC 3ZT5A 5I76A 3TH2T 4IRZL 5DJCA 1SBSL 3K46A 1YPZE 3QUXC 4YDJA 3JZ7A 1DDHB 5C0NC 2KZ1B 4QO1A 5HYQB 1J05B 1KTDB 3WE6B 5IBTH 1BD2E 4B5EA 4DGYH 3LPGA 4U6HB 1DVFC 4LFHD 4BA8A 1MI5E 1IFHL 2ID5A 4KI5C 5BMFH 2X4OA 4BSWA 4JPVH 3X12B 4GW4B 2DM7A 3V7AG 3OR7B 3HFML 4KRPC 8FABB 4Y5YC 5A2JH 4BSVA 1QSEB 1AQKL 1NGWA 3OZ9H 3ORJA 4P4KA 3VXNA 4MA1B 4AEHL 2Y6SC 5LWYL 1PX4A 3EAKA 1G7JB 5J6HB 2NW2A 2D0GA 3QCVH 3BPNC 3RL2A 3WXWH 1NDMB 3V8OA 3UTOA 3IDMB 3MRJB 1WZKA 1MQKH 3ROOB 3MROB 5IVZB 5HI3D 5BCAA 5I1HL 3TN0D 2XACC 2A74B 2PO6B 3D9AL 3HE6D 4PB0H 4P46C 2UY6A 5FHAH 5L2KB 4OD3H 3OSKA 1UJ3C 1U6AL 4NBZB 5D7SH 5DSCA 1F00I 2RJMA 4FZEL 1I1AA 1F4WL 4ORGB 3CK0L 2X89D 4M1GL 3T1WA 4N90D 3MNZA 4G9FE 3HRZB 5D1ZA 5IW6A 5EZOL 1GGIL 1DL7L 1KTLB 2FB4L 2C9AA 4FZEH 4LCIH 2I07A 4OT1H 4Z7UA 1Z9OA 5ILTL 1CD8A 4U3CA 5GZOD 1P4LA 1GGIH 4QT5B 1G0XA 3WUWG 2A6KA 1YEFH 4O2CB 5C8JA 1P9MC 1QEWA 4CVXA 3SDDA 1T1WB 4OF6A 5JDSA 1ZE3C 1KLFA 4POUB 1WZLA 4XT1C 3RUGA 4XWOD 1K6QH 3EYUL 1RULH 5BO1L 4E5XB 1IGCH 2IQAA 3RUGB 3MACL 43CAA 5C0AA 5DJCB 2F54E 4R4BA 3V4PL 2IANE 3M17B 2ICES 4ZUVA 4D9RD 4FA8A 1KIQB 2Z91B 4OQTL 2VDQH 5DGQA 1ULVA 4KPHH 2BNQB 5E99L 2EH8H 4LSQH 2APFA 3FMGH 3IFNH 4Z7WE 1CT8A 1YMMB 2LQRA 2W59A 1U3JA 4PGCA 4UU9A 2ZNWA 3L3HA 1MFNA 2VIRB 3JWOL 3O3EA 1DSFH 4UNUA 5IB4B 5HHPB 4UU9B 4N9OB 4LSTL 2A83A 2BC4B 3S35H 4JFXA 1U42A 2GTWB 3G6JF 3RIAF 3PIQA 4U1MA 4BK5A 4Y5VC 5C6TL 1GZQA 3STLB 2D9CA 3VFRB 4C56E 5HGBB 4C56B 3KYOA 4GQ9L 4HPOH 2GAZA 3C87A 4JN2A 2Q7YB 2BY0A 5DQJB 5TE4H 3HNSL 5T3ZD 2B7DT 5DMGD 4ELME 5EZJB 3U1SH 4DKDC 1UWXH 5DJAA 3VFMB 4LKXA 3EOYG 4ELKB 2R1XA 5IIEA 1CXIA 1QA9B 4J3TA 4Y2DA 4DK3A 3DBXB 5D2NE 2J8UA 3V9FA 4IRSC 4HCRH 3VFOA 2Q8AL 3BHBB 3B9AA 1MPAL 3UP1A 3DYOA 3NCYP 4NCDA 3CH8A 1U36A 3ULSB 2HG5A 3K1KC 4DCQA 3MLWH 5FGCE 5GS0D 2SEBB 1JK8A 3QO0B 3OAUL 1JNLH 5I30L 4LVEA 1A14H 1W0YT 5IKCB 3QNZA 4NUGH 3O8XC 1U8LA 2FBJL 3B8YA 2AK4E 2VSDA 3HE7B 1FNSH 2EH7H 3UJTH 3DVGA 3DGGB 2VKXA 4G7VH 1TTUA 2VQTA 3WS3A 4XNZB 2A77H 3O3DA 1AXSB 5DUML 5KTEL 5TF1H 3S3SA 3I85A 4P23B 4L29B 4RFEA 1OAXH 1CGVA 3V6ZA 1P69B 4DUWA 3UTSE 4KROC 3QFJE 5F9JB 4APQA 3EYQD 4JPKH 2M8XA 3RVXC 1SYSA 5D1ZC 1IGTA 1II4E 4HK0A 1IVLA 3IFLL 3ARFB 4HC1H 3RWFA 3SE8L 3VXNB 2E6QA 4KKAC 1M7DA 4PGEA 3B2VH 4HKZB 4N8VB 2MQCA 2VC2L 1AFVH 3TM6A 1FIGH 4WFFE 5CD3A 1CD9B 4E0RB 2CIKA 3RGVD 4H0GA 4LKCB 5HHPA 3DUUB 4LPWA 5E8NB 4Z7OF 1ES0A 3MGTA 5JW3L 1B9ZA 2H6PA 3QJFB 1WAAF 2ICWI 5BRZA 4M4PA 3GB7B 1FDLL 3JWOC 4MA7L 4X7CC 1P53A 2FZ3A 1MUJA 4P9HL 4P59H 4Y5XB 1G7IA 5EUOE 2EDHA 2FSEA 4K3HA 1LVEA 5JW5B 3ZSTA 1DLHA 1P6FA 1U8KB 3LEXB 1VFBA 2HKHH 2O5ZH 5FCUH 1BP3B 2GI7A 1I9IL 3DVNA 1C7SA 4PJFF 4HT1L 1KBGH 3SBWA 1RZ8B 5ADOL 4XCCL 1I9IH 1S9KC 2DQHL 3BKJL 1YQ2A 5KSAC 2X4NA 5I1IL 4NN7B 1OGAE 2V17H 2DMCA 2NY5H 3QUZC 1VEOA 3EGSA 2EDYA 4NUJB 5D2NA 1SY6H 1RZKH 2CLRB 2EKSA 5MERB 4HLZG 4L9DA 5IB2A 2GK0A 3SJVB 3BKML 5BV7L 3TA3C 1MCPL 1QFWH 1UH2A 2W65A 3LKNB 3MJ8A 1S9YB 3GBNL 2MTPA 5IW1B 2XZCL 1EAJA 3IDMA 4OLYL 1KENL 3QO1B 2XNAB 4OGXH 1HILB 4CMMA 3ZDXF 1LQSR 3HN3A 5HDLA 5HHQA 1FNFA 2D4FA 1AHWC 4YIQB 4JRYD 2R2BA 5TDOB 3DSFL 4ZTOH 1IARB 5JMRA 2VDLL 2O5YL 1S7RB 5FYKL 3O45B 3I75B 1MJ7H 5I73C 5IVXE 3KHOA 3HB3D 3KPSA 5D9SB 1L0XA 4H0IA 4XC1L 5E5RB 4KVNL 2W0KA 3VXPA 4MAYD 3DO7A 1U3HA 2ESVD 1AGDB 3GSWB 5DJ8A 4IRJC 2FEDD 2ADFH 1QQDB 5EO9A 3H42H 1FG9C 3BJLA 3DROA 5HD8C 4GAJH 4P2RE 3DRQB 3WSQL 1ZTXH 2GTZB 3CSBA 4I13B 4RGNB 2BRRH 5C70A 4TVPH 2GY5A 1HSBA 5KVMC 1HHIB 4OQTA 1DBKL 4IOIB 5FYKU 4UUJA 1ZLSH 4XMPL 3N50A 3REWB 4HMCA 1KEGH 3V5DA 1OAZH 3GMNA 3UCRA 1LMKA 1DBKH 1N59B 4EUPH 3C5JB 4J3OC 1DQJB 4GRWB 4XMPH 4FQXC 3VD7A 1MFBL 3KYNB 3KPLA 2V2TA 2QQKL 2DQGL 1CFVL 5F3BB 1R3JA 1FNEA 4PJEB 2ESVB 2JJSC 3WKMH 1I9RH 4FXKB 2AEWA 5DMIH 1KB5B 1IC4H 3DGGA 2DM4A 1YNLL 3W82A 3ZT6A 3DUSB 2AGJH 2IG2L 4JG1H 5HHOD 4NQVA 4EUPB 1B0RB 3E8UL 1XFPA 5T1LD 1A7OH 2QR0A 3NN8B 2HJFB 4IIQA 5I75B 3KGRA 1YPZA 4R2GC 5FUOL 5CGYC 1AR1D 3IXTB 1U8KA 3LEXA 1JHTA 3O3BB 3EKCA 4PJIB 2OL3L 3MV8B 3VD4A 2NX5E 4MQXD 4HAGA 4TSCH 3TT1H 1BZ9B 3IJHB 5AYQA 1CU4H 4AMKL 4YIQA 4IDJL 4MNHB 1H3XA 3QUYA 5FKAB 4EI5C 4JJHA 3EUUA 5E56A 3RWHB 1N2RB 3SKOA 2OZ4H 4PJGE 1IZKA 1ORSA 2ZUWA 4P9HC 3BP7A 4PRNB 4HZAA 4JKLA 4EN3B 5IFJA 1E6JH 1S5HB 1MRFH 3DRTA 2HJLB 4G43A 2MOVA 4JVPA 1PSKH 4GG6F 1NC4B 3BAEL 3AROA 2MCPL 4NNPL 2PW1A 4BK4A 5D6CA 1UA6H 4OLWL 2VZUA 4UIKL 3VDCA 1DQDH 4YPGB 5TH2B 4JY4B 3MLYH 3KDMA 1UT9A 2MCPH 3FRUB 1KIUA 4OLWH 5CD3B 4E0RA 2DQJH 1D9KB 3KPSE 1I1FB 3GMRA 3V4VL 1SBSH 2CK2A 3QDJE 5C7XH 1S8DB 4PJAF 1NANH 5DWUH 1H5BC 1T0MA 2AXFA 2H2SC 2Q6WA 1A64A 1P6AB 3SO3B 1M05A 1OAQL 3GUTA 2CLVB 2WINB 2BVPA 2FEEL 3VGHA 3RVVD 4J2XA 1CF8H 3FTGB 3DVGB 4LLDB 1X6LA 3MRBA 1OOAA 1U8JA 2FZ3B 3JVGC 3ARDD 5ANMA 4RFOH 4NUJA 5CP7A 5FM4A 1CGXA 1BBDL 5JOPD 5D2NB 3OHXB 4O00A 4PJ8A 4Q6YA 1VERA 4GOSA 2E7HA 2DQFB 3B83A 4PLJD 4JQIH 7CGTA 5D7LE 4JPWH 2I25N 5I1LB 2FIKA 4HWNA 2ZUTA 3WXWL 3C5ZC 4PJ7E 3V2AR 4O2FA 2CUHA 4S0SD 3T3PF 3G04A 4JQIL 4NKMA 3RZWA 4NT6A 3QDGE 2OR7A 4P57A 3G6AA 4DGIL 3TO2B 1IJ9A 4B50A 2R29L 4XCFL 4J4PA 3JTTB 5J9PB 3AFLA 4MB4A 1N3NB 1UEMA 1AO7A 4Z78B 4XNMB 1SYVB 2Q1EA 1BD2A 1QO3A 2R29H 1T4KA 5T1KD 5FECA 2WBWB 5KAQG 5C0RL 1HINL 5IEKA 4POZD 4B41A 1XIWC 4PP1C 4EN3A 5HHMB 3C6LB 3HAEB 3VJ6B 5IHZA 3RRQA 4XCNB 5DK0B 1BQSA 3RHWK 1OGAD 2IANA 4Y4HC 2EEBA 1HE7A 4UT6H 2N4IA 3N1PC 1YEIH 3DO7B 1GGYA 2IANB 5AZEH 1I85C 4NBYB 2DN7A 4MCZA 5AD0B 1RUQL 1G7LB 2NLJA 3FQTB 4NN7C 4Z0XA 5I1DA 1ERNA 5JW4M 2B4CL 1EXUB 3WNMA 5IR1A 1MHHA 4OZIF 1ONQB 3ESVF 4PJIA 3PWVB 2DQIL 2GFBB 4EIGB 5JA8B 4IS6B 3GSUA 3EYUH 3FFCB 2VXTL 1KULA 5C0GA 4JRXB 3ILQD 2EYRA 2V5YA 2PR4H 4EBQH 5GRVL 2YPKB 5CD5D 3RWIB 1VKXB 2FX9H 3L6FB 3TBYB 4UIMB 1CD0A 4YHZH 4XWGL 3ARSA 4MWFB 4RA3A 1MHCB 4M1CC 5JPNA 3I02A 2GJ6A 3FMGL 3T4YB 4P2RD 4MWFA 3RNKA 2FX9L 4NKIH 5JHLH 4KC3B 4YHZL 1RUAL 3B9KC 2CRMA 4ZFOL 5E2TL 5EFIB 1B88A 4NC1E 3RQ3A 1UM5H 4A2LA 1E4KA 3TNMB 4JB9L 2DTMH 4PTUB 4LNVA 1B4JL 3HE7A 1KXTB 2DRUA 1UXWA 3BN9C 3BIBX 5BZWA 5C6TH 4WCYH 3X17A 3FRPG 3JWDH 1CDUA 2G60L 1ZGLB 4JB9H 5FOBA 2DQEH 3GM8A 4JDVB 4EDWH 5TE4L 3CXDL 1EERB 1H3PH 1ORQB 1NMCC 3FL7A 1CQKA 4EDXB 4G9FD 4XCEA 2DJUA 5I1KH 3MNZB 4LSVL 3NA9L 5FUCE 2SEBA 5C0AE 1KTLA 4APQB 4AEFA 4FFWC 2XTJB 5F1IA 2D7PA 4YDIL 5T3XD 1ETZB 1JI1A 4WIQA 4Z8FL 1G9NH 4NQCB 5FF6A 1KT2B 2YPVH 2DBLH 1BZ7B 5J89A 3QEHA 3ZLQC 1UH4A 2JCCA 5GS1B 2UVFA 3KPRB 5HYIA 4MAUH 4XVJL 5IVNA 1F4XL 3W11C 2DS4A 3CFKB 5T5FL 2IH1A 3I9GL 4M1DH 3HHRB 1FNSL 4XI5D 4LCYB 4C83B 5T1DH 2IADA 4NKDA 3O4LD 1NKOA 5GGVH 3SDYL 1F4XH 3TB