1MAJA

Solution structure of an isolated antibody vl domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an isolated antibody VL domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 26-10 FV (LIGHT CHAIN)
total genus 13
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1993-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1majA00
3O3UN 3VGAC 5I71C 3G6JE 1U3HB 3QCUL 4K8RL 3EOBA 2HJLA 1A64A 3MXVL 5TDOB 3ZKXB 1TQCC 4MA7H 1KFAL 1FORL 5D7LA 3OKOB 3BYYA 3NN8B 4YZFF 1DEDA 2GJ6B 2XA8H 1CFTA 3ZHKA 4N8PA 1SYVB 2XFXA 3GSNL 1KBGH 4I0PC 3I75A 4LKXA 5CIPH 4HZLA 2NXYB 4L3EA 2NNAB 5IV2B 5I0ZA 2G9HB 5AWNL 5TQ0L 3W9EA 1TCMA 4ORGB 4FRWA 1NC4A 3MREB 1PYWA 3TPKA 2D4DA 1EFXA 3CSYB 3M17B 4PBVC 2GUOA 1TXKA 2GK2A 2BX5A 3V0VB 3QO0A 5GGRY 2EKSA 3Q6FB 5C08B 4W4OA 1N4XL 3C2SA 3OGCA 1TFHA 1A6AB 3TBTB 4O2CB 3U83A 3DUSA 1PSKL 1G9EA 1U8KB 4LASH 5DVKA 3ZHLA 4GH7B 2CDFA 2DS4A 4RWYH 1C1EH 5ALCH 3VFVB 4WUUE 1IGTB 4PRDB 3OAZK 3IB4A 3EYSH 4Z9KB 1K9TA 4EUPB 1HH6A 1RUQH 4YBLB 1S7TA 3HE7C 4WO4C 4UOW1 4P9HC 5ERWA 2BCKA 5J12C 2F15A 1AXSB 1V7ML 3JTTB 5BZWA 2E27H 4I3GA 4NZUL 3MO1B 1YN7B 2Z92A 4QRTA 3NH7H 4H88H 3RWEB 1BFOB 2UY7A 3NCYS 3TPUA 5EPMB 3QG7L 2PUQT 3V52L 4LQFH 4X0KA 1U3HC 2LABA 4QHMB 5I1JH 2F5BL 4DWHA 4WFEE 1NUFA 2DQGH 3T77B 3HE6B 4M1GH 3X3GL 1MRCL 4OV5B 1JFQL 3RI5F 1KN4L 3U9PH 2FLRT 2VUOA 4AQOA 3VXSD 4YX2L 2E3VA 4O4YL 5F7LB 3RY6C 5DQJB 5CILH 1LWRA 3O3AA 4Z7QF 4FQ1L 3WSQL 2CQVA 4OZIF 2VE6A 2O5ZH 5C0AE 4YXKH 2KBGA 1NLDH 3Q3GA 2VNCA 3IXTA 2WINA 5AEAA 4WHYG 1QOKA 4OCSH 4RIRA 2A6IB 3RWFB 4ZFGH 2FEDC 4GBXB 4MVBC 4G8GA 4WI9A 4YNYA 3FO0L 3KR3L 2DMKA 1YEKL 2Q1EA 3MROB 1HH9B 5CP7B 3NPSC 4X6CE 2E9IA 4N0YH 3KYKH 3QT2A 5IMOB 1U8OA 2X10A 4XWGH 4BFIB 4U05A 4CN6A 1J10A 1NGZB 2DYPD 3HZKB 4UINH 1SEQL 2DTML 4ZO6A 5EZJA 2R0WH 4ENED 2PYFB 1RUMH 5C71A 5I76B 2VZ3A 2VITA 5BV7L 1E4WL 2FR4B 3T0WA 4MX7B 4P49A 4HKBB 1YEJH 2CRYA 4FTVA 2R8SH 3LKPA 4GBXC 4BH7B 4Z7VB 3PUCA 1OLZA 4TUKH 3MV7D 3KLHC 4MNQD 3CJJA 3PIQA 5F96H 3QUZA 2VQ1A 5FHAH 4QF1A 1QBMH 4P2RE 1Y18A 5E6IB 4NZTH 1TPXC 4Z8FH 5BRZB 3L3IA 3EDDA 1WF5A 4HS3A 3P11H 5I1EH 1A4KA 2RFXB 3WV0A 3QULA 4OQTL 3OB0K 1R3IH 2AEPH 5GGVH 3BWAA 5I30L 1WWAX 2OJZL 4K7PL 2HLFD 3LEXB 1KXTB 4QRSA 4FABL 1QR1B 1OT1A 2WBJB 5GGUB 5DT1L 3FQUB 5IJKC 1U8LB 4HKXA 1F3RB 3NCCB 1U8PB 4M4PA 4PJDE 3TYGL 2BFVL 5E8EA 2R4RL 3WEXB 1XF4B 4FG6D 5B39G 3Q6GL 4MB4A 3EFDL 5FECB 3QIUB 4XPGH 5DHVA 3PGFH 5HDOA 5MEPB 2XZCH 4NQUA 2HN7B 3VXUE 1X6NA 4TQEH 5ISZA 1P6FA 2ZUTA 1RJZB 1C12A 3MCLH 3RZCD 3DROA 5C07D 4WGVB 5A43C 3SJVB 2P5ED 5F7WC 2F5AL 2IGFH 1N64H 4ETYA 4UTBL 5C1MB 3V0WH 3TBYB 3KPRE 3PDGA 1LP9B 4ODHH 4UIMA 2GSGB 1A7PH 1HOCB 4HEME 3AU1A 2NW3B 5FIEA 2NY7L 1IAMA 4Q2ZA 4EI5A 5BRZD 4L3CB 3TYFB 3C6SB 4JKPL 5H37G 1AGDB 1I7RA 4NYLB 1FE8L 1JZ8A 1FGNL 1FC2D 5EOQL 4ZUVA 3HRPA 1Q9WB 2P8MA 3Q0HA 5FUZH 3T2OA 3RWIA 1ZT1A 3PNWA 3O2VH 1IGJA 3TT1L 2C1OA 1ZVSA 3ORJA 5T5NF 2UZIL 3VWJA 5IFJA 1QRNA 3IDIA 3MRFB 4L8BA 2EYTA 4OCNC 2P42B 1S7RB 4X80H 1FG9C 2A2QT 4GJTB 4KKAD 4ZFZB 3SBWA 3QBTB 4HJGA 1IARB 5CP3H 1JP5A 5E00B 4NN5C 1HH9A 1M71B 3LQAH 4OM0H 5HYEA 2XYCA 5DJ2A 1HYRC 4WEMB 2XQBL 3FZUD 5HYFA 5ICXA 5CEZL 1F58L 2H2PD 2XWTB 2ARJA 4HXBH 4YHIA 5I15H 5D2NB 3QQ9D 5E6ZA 3EOAB 5EOCL 1CFVL 3MLWL 3T0DA 4P23B 1Z2KA 5GHWL 3PDOA 3VFNB 5AG9A 4BKLA 4ELKA 5EFIA 3PHQB 4N9OB 4P4KC 5DC0A 4HK3J 4PP2B 4WTZG 3VD4A 4E0RA 3QO1B 1NMCB 4BQ6A 5F7UA 3O3AB 4LVEA 1EHLH 3ULVL 1B3JA 2BVQA 1RIUL 2EEAA 4P2OD 1AXIB 1J1PL 4O5LL 3D25B 1LK3L 4O58L 3HE6D 3RY4A 2EXYC 3CK0L 4JJHA 4OV5A 4F2MA 3BT2L 1HHIA 1KUMA 1K8DA 2DQUL 1GSMA 4P23C 1Z6JT 4Y2OA 3QIWA 4YIQB 3WJLC 1F11A 4Y19D 2OMNA 4YC2C 3MRDB 1PZ5B 5GJSH 3RI5K 4HK0A 4BFGA 1T5WB 1FFPB 4MJ4A 1WSST 3INUL 3V95A 2DQCL 5EOCJ 1D5IL 2IH1B 2BSSB 1YPZF 3O2WL 2UVFA 1HCVA 2D3VA 2X4UA 1YY8B 5MERB 4Y1AB 3LKOA 4DTGL 1T03L 2CKBA 1KENL 2A1WL 3VFTB 2HJKA 3RWGA 1FN4B 4XBEL 1INEL 2IPTL 5HHME 5TF0A 5FDWB 3LKOB 4LCWA 3O4LE 5K9KA 4LPWA 2JJSC 2PW2B 4NQDD 4N0UA 4CMMB 3BX7C 1PQZA 1OAKH 4OTXH 4GAYA 5DJAB 2H2SD 4AENB 1EMTL 4LEXL 4PD4K 3NZHL 4LPXA 5C08A 3NIGF 4LGSB 3ECBA 1NANH 4MXWH 4LIQH 3VMPA 5HGHB 1ZHLB 5F9AC 5ICYA 5HGAB 3AU1B 3MV7E 4ZTPH 4XCNB 3PWUA 2V5SA 4KRPB 5EU5B 5HHPA 4G5ZL 5I2IB 1EK3A 1IC1A 4HUXB 4JR9L 5IOPA 3OKDA 4XPHL 5BO1L 4NGHL 4Y2DC 4KMLB 1H8SA 3EYOA 5DXWA 3G6JF 1RZJH 5F21B 4M6NL 3EFFB 2HVKA 2IPTH 5ISZB 5B38G 2MCPH 1KIQB 1KENH 2A1WH 3TIDA 3ZDZF 1JGLH 3ZDXE 2WBWB 4UDTB 3B6SA 1ZLWH 5GGQH 3ARBB 1NSNH 3F58L 5EZIH 3BUTA 3IJYB 4JQVC 3QCTH 5ICXB 1DEEB 1IZJA 4PV8B 4TNVK 2ITDA 1U8LA 4HKXB 5EOTB 5E8NB 5IIEA 2A6DB 3MBEC 1A6WL 1PAMA 1I3GL 4X6FB 3DSFL 4D0BA 4OD2A 1TJGH 4I5BB 3HPJB 4ZTOH 1FO0A 3T08A 5JW4R 5LQBH 4O51B 1NBQA 5INDB 4APQC 3L5XH 3P9MA 5IROA 2QADD 4KMQA 1MEXL 1R0AH 1SY6H 1IGJB 3B9KC 4MMXC 3VXUB 3QEQA 1I9JH 5EU5A 3REWA 5C6TH 4JDVA 2AJUL 1Q9KA 4ELMA 4IMLB 3ULSA 1MCWW 4ELMB 5B3NA 5IQ7H 4Z7VA 1SJVA 2ESVE 2W07A 1X5XA 5HGHA 3PWPA 3QEQB 1ORQB 4D3CL 3CXDH 4RGMB 2J7LA 3G5VB 2VABA 1MCPH 5E2WL 3UZEA 4M8VA 5D7JA 3PIQB 5CEYA 4PRHA 5FV2A 3RVXC 3TBYA 3DO3A 1M7DA 2G5RA 2XTJB 1UWEL 2AXGB 1KT2B 5JW5A 5I1AB 3L1OH 1U8JB 1I8KB 4YO0A 1KJ2B 4MX7A 3P73A 4TNVF 3HC0A 3BQUD 1JCKA 2VLJB 4HUVA 4NQED 4KHTH 2NZ9C 1U8OB 3DMMD 2E27L 4JRXA 1FDLL 1MEXH 4PGBA 2FCBA 1MCHA 3L5XL 3VD9A 1YYML 2G2RA 5HVWA 1KCVH 1P7QA 3CFBB 5D7JC 4RAVA 3AS0A 4LOUD 3LDBB 4NOBA 4FQPA 2HH0L 1T0PB 1TVHA 5EU7C 1ZXQA 1B4JH 4Y0GA 4G6AC 3RL1A 4X6EA 3ILPA 3V5DB 1J7VR 2GCYA 1KJ3H 3D3VD 2ZCLL 3BZ4B 4MNGA 1DLHA 1DBJL 1V3MA 1RZIA 3S36H 1UA6L 1U92B 8CGTA 3VFSB 3HMXL 2CJUH 3T8XB 5JW4M 2HKHH 4NHCL 5I2IA 3HMXH 3ARYA 2XI9A 2QQKH 4HXAH 3QUZB 4XCNA 1KCUH 5KANI 3BKCH 3WBDA 3FQRB 1CLCA 2HRPL 4L3EE 3KXFA 4KPHH 4BZ2H 4K23L 3IDGB 2Z91A 5HHQB 4EI5D 4S1RL 3EZJB 4F37K 1FLTX 5KJRL 5T1LB 1J8HD 2PO6B 2EE6A 5D6DA 5C07E 4EUPA 4PYHA 2BRRH 1AGEA 3ZYZA 4WFGD 4GG8B 2DBLL 5KVFL 4L8SB 2CKBB 4N0UB 4CMMA 5ERWB 5E56A 1YY8A 5MERA 4LPVA 1XF3A 3HC4H 1BJ1J 1VERA 2NQCA 4ZUTB 4YFLF 3T0EC 4HJGB 4E5XB 4PGCA 4JDTH 4GBXA 1G0YR 5I8CA 4WI4A 3G5YA 1DBKL 2HT3D 3TO4C 1CLYL 3KVQA 3MLXH 1BFVH 2P47B 3KYOB 1O0VA 2Y36L 3OPZL 4PUBL 2EECA 3ARGA 4PJAA 4JKWA 5IMKB 3QRFM 1KB9J 5HHVH 4I0PD 4UIKL 4KVCL 4NO3A 1GGCL 4FXLA 1KELL 2BSRB 3QXVA 4N1HB 5HI5D 5HGBB 1MFEL 5BVJA 5HYSA 4JFFE 1WT5A 1P4BL 1UM5L 1KCKA 5GS1A 3BHBB 4Y5VA 3ES6B 2OZ4L 5ADPL 3G5ZB 5B4MD 3X3FH 3S3JA 4ZMAT 3PL6A 5F7EL 5DJCB 2OCFD 1EZVX 4PG9A 1QSEA 1ODAA 2DIJA 1FSKC 2I27N 3MRCA 4WEUD 1I9IH 3BP4B 4NRYB 3PHQA 4Z7WA 3MO1A 3UBXI 1OL0A 3CCHA 4MB3A 4WRLA 3L3HA 3QDMD 4M61A 5JO5B 4X6BA 4ZFFA 3AB0C 3EHBD 4M48L 1QRND 2A0LC 1A5FH 3HFMH 3MJ7A 1A6ZA 5HDBE 5HHXL 2K7QA 1MPAL 4ZUUA 4OZFG 6FABH 4QXTB 3V7AE 2AV7B 2FX8L 4ORZC 3SGDH 5B39A 1MREL 3IXAA 3CFEA 5DS8B 4HIEA 4JHAL 5I15L 1V8HA 4X6CA 5HHVL 4B41A 3D85A 3QQ3B 4P4RA 1EH9A 2RFXA 3B2VL 3IGAA 3OKEB 4M5YH 1UH3A 4PP1C 4MAYD 2APXA 2YRLA 1BVLA 1AGDA 1I7RB 2PO6D 3PWJA 2UZYB 3ZKSD 2A73A 1IC4L 1P9MC 4PRPE 1NC4B 4TVPH 5C0CE 3ARQA 4EDXA 1ZMYA 4ZUVB 3KPSB 4YGVB 1WWWX 2XN9B 3OJVC 1PVHA 5FA3A 2JJSA 3T2NH 2CRZA 5AUMA 5DD1H 4L4TD 4EZMA 2BHZA 3BEWB 1QZ1A 3SDAB 4LDLB 5GGSY 2NXZB 1FYTD 2B5IB 3VGHA 3BRFA 5IBUB 3SQOL 3ZLQC 1HIMH 3HB3D 2OL3H 2DI7A 1DE4B 1EGJH 3DMMA 2D31B 4YNYB 3CH1B 5DD0L 3QP3A 4G8GB 1F8TH 4X98B 4L29B 3VDCA 2B20A 3VGDA 3K2MC 5F7NC 4JGUA 4A6YB 2SEBB 4XX1G 3QIBB 2WBKA 3VXSA 2D03H 4OSUH 1QQDA 3QIUA 3MLTB 5C09A 2KQNA 1FNSH 5IW6B 1FV1A 1KPRA 3FMGH 3UTZB 3CX2A 2COQA 2RQ8A 1GXEA 2PW1B 4ZFOL 1S7WB 1DUYA 1J1OH 1D3CA 4M03A 5I1GL 1KN2L 3RTQD 1MFNA 1JHLL 2X4RB 4JHWL 1WLHA 3O9WD 4GSDH 5E2VH 4HIIA 3PXHA 2NZIA 1OAXL 1IGFH 4KROD 4TTDC 4XRCB 1MELA 3KPMA 5E6IA 5D1QA 3AS2A 1EEYB 4U1HA 4J6RH 1X5ZA 4CVZA 2R4SL 5SWSE 4DN3L 1O7SA 4O5LH 4HGWA 5EU6E 4C59B 4JFEA 1XCTA 2XQYK 1AKJD 1CD1A 1IM9D 3HCVB 5C70A 4JGJA 4ODTL 3SGEI 5FUCE 1FCGA 1OCWH 5JHLL 3C5ZA 5I9QB 3MRKB 5KN5B 2Q76A 5E2UH 4K7FA 4QCIB 5FDYA 3ZDXF 1NANI 1MWAB 2FGZA 2L4OA 4S10A 1PLGL 3TLRA 5FKPA 3MLPA 3SBWC 5TE4H 2NTSP 1NCTA 2F19L 2NY3B 1BVKB 3HZKA 3MGTA 1F4WL 5IMOA 4ZS7L 5CLWA 1G7JA 3SO3C 5GRZA 1S3KH 1UM4L 4HUMB 1S9YA 1UADC 3WFBH 5F9WB 1DBBH 4KROC 4XMLL 5CJQH 4JFEE 4KDTA 2ZNWA 4M6AA 4OGZA 4GXVL 3BPLC 1I7TB 5ILTL 1SVZA 5LCVL 4IS6B 2X09A 4OB5H 5KVGH 3WFHA 3U0WH 1Z5LB 1CLZL 2VAAB 5C3LD 5EC1B 4S0TD 4PRPB 1WVZA 5IB3B 2G9HA 1RJCA 4BFBD 3QNZA 1TJGL 4NN6C 2PW1A 1FQ9C 1ZTXH 32C2B 3MFGB 3C8HA 1R5VA 43C9B 2VN4A 3LPFA 4ACPA 5J13C 3L3KB 3MLUL 1WWBX 3CFJA 4MA1C 1EHAA 1GGUA 2WANA 3U7YL 3IDYB 4BZ1L 1GGBH 2VDRL 2ZKHL 4U1MA 3VXMD 4RWHA 4CADA 1K4DB 2W0LA 1QEWB 1A0QL 3N1PC 1F90H 4Q74A 3FJTA 2KPNA 5E9DD 4Q0XH 1DANT 3QEHB 3PWPD 4NIKB 1S7TB 2BOBA 4I18C 1AI1H 2FJHB 1NCBL 2F19H 3FONA 2PN5A 4F9PA 3DIFB 1OP5H 1UGNA 4DOHB 3X3GH 2ICWA 5E8PA 4P4KA 4X99B 1IGTA 4PRDA 1YN7A 3VFWA 4F57L 2VLLB 1CIUA 3D39A 4MGXA 4I2XE 5BS0E 1TMCB 3C2AH 3MUJA 1UCBH 4CGTA 2R0KL 3VFOA 3KDMB 4X8JB 4GXUN 3DX7B 3F5WA 4ETQB 3WKNA 5GRYA 3CIQA 2A74A 1OD7A 5J9PB 3P77A 3WLBB 4ODTH 2ERJC 1FVCB 3T2QA 4FQQB 1OTUD 1MQKL 1MCIA 3TZVC 4OLYH 1RUQL 3DRTB 4N1EA 3ZMRA 3OGCB 2L0DA 5HHMD 3W9EB 2YD6A 2HLAA 4HF5H 5IEHB 3MCKB 4N8VB 5DS8A 4QNPF 2E7MA 4PJIA 1CXEA 1EFXB 3CSYA 3M17A 3O3EB 4MZ2A 5T3ZH 3V4VH 3C8KB 1DDHB 1WFNA 2XFXB 4PJ5B 4CW1B 4HW6A 4ONFH 4XBEH 4F7CA 5LVEA 2AI0L 1NCCL 4F9PC 4XCEB 4PJFF 5EU3A 1B6DA 5BVPL 3IAPA 1AQKH 3TV3L 4XXCA 5AAMA 5GGTL 4I13B 4NHCH 3RWCB 1IAIM 1C16B 4JZJA 1P7KA 3ILQC 2C3VB 1FAIL 4J3XA 4WWID 4YDJB 4PTTA 4XP1L 3BH8A 3MRCB 3SGEH 1X5AA 2OXHA 5IFHH 1U8MB 3R06A 2VC2L 4RQQA 1R5WB 4OCRH 2HVJA 1TJIL 3KXFD 2XRAL 4XCCH 5IVXA 1F45A 2MWCA 1NLBH 1QEWA 4QTIL 3A6CL 3WFCL 4N90E 3R06B 1AGFA 4Y88A 4ZFGL 3L9RB 5IVXF 3BGMA 1R3HA 3UC0H 4ZSOB 2G75B 2W0FB 1U95B 3C5ZC 1D5BB 1FZKB 1R3LA 4NO0B 5IMLB 1UXWA 3LRGA 5JORA 4KJWD 5FHBH 4KZEL 1DBAH 2OL3A 4F7MB 4NO3B 3I9GH 2XTLA 3HMXA 5F9OL 4MWFA 1I7ZA 1HKLH 1JUFB 1UM6L 4NCC1 1JNHB 1DDHA 1RURH 4WO4A 2NLJB 5GHWH 7CGTA 4LFHG 4HKJA 3U9PL 4Z78B 4NQEB 1C5DB 2JB6A 3BSZL 4Z0XB 1FVCA 3DETC 5E2VL 1ZT7A 2BNQA 3TGXA 3EBAA 4XT1C 2FHFA 3WUWA 4A2MA 1MRCH 1N6VA 1RJLB 3TO4D 4XVSL 3VFPB 1JPTH 2D4FA 4M7KL 3WJJC 1BF2A 1WBZA 5DO2C 3ZT7A 5GS0H 3LQMA 3U4EA 3H7BB 3U30B 1MRDH 3AMKA 2NX5E 3O2DA 2ZUSA 1R5IB 4MD4B 1CG9B 1J18A 3P30H 4K3DH 4LSVL 5CHNB 4XPBL 3QXAA 4PJCF 1G6RH 4I3RL 1FNEB 2AGJH 4Z7OE 5TH2B 1U93B 3IS1X 3VXTB 5L8JB 4OLUL 3T0XA 3DV6B 3H3PH 2Z91B 5HHQA 3HG1A 5I1LA 2VLLA 1QHOA 3FO0H 3HS0B 2FBOJ 4R2GB 3MRKA 1DQLL 3RKDD 5L88H 4YBQC 4GAGL 3BO8B 1T89C 1RU9L 5AYQA 3FB5B 2ADJA 1ZSDA 1X5FA 4J3TA 3QA3A 4HS8H 4RRPA 35C8H 3VWKB 5BW7A 4GG6A 3GBMH 3M1BB 3BP5B 2EYRB 4JRYD 3I6LD 3VH8B 1HDMB 1N3NB 1BGXH 4X7TB 1KSRA 2I60H 3UXFA 3KPMB 4PRPA 2IBGA 5ADOL 2VLKA 4YR6B 5L6YL 3QUXC 3BJLA 1UEYA 1ZE3C 4M1CC 3W81A 5L2KE 1BQHG 2IPUK 5EUKA 3RVUC 5HXMA 1JPTL 1LEGB 3CLFH 1RFDL 2JB5H 2ED7A 1E6JH 4P2QA 3BJ91 2FJGA 1F3JA 1HHJA 3BW9B 4X4ME 5CEZH 1RFDH 1ITBB 5L2KA 4Q6IA 1BOGA 1FFOA 3BIBX 2W65A 4DKFL 4G8GE 3HG1B 4OF8A 4QHUB 1S9VA 4GAJL 3RNKA 2LE9A 5DZNA 3BXNB 1QD0A 2VLJA 2F8OA 2VKWA 5SWZA 1K85A 1NDGB 3JWOC 4R2GD 4LIQE 5DRWB 1DE4A 1KJ2A 5EBGA 4OZIA 1MWAA 1FP5A 3H7BA 4HWBL 4YBHA 2ILLA 4QWWC 3V2AR 4C4KO 1I9IL 5DQDL 4Z7WF 3UTPE 3BKYL 4C83B 3K8KA 4Y4HC 2R1YA 3TT3H 1A6VL 4UT9L 2JJVA 3MXWH 1QFWH 5D7JD 1A4JB 5IW3A 5KVMC 4O2FA 1JGVH 4LPUA 3FFDB 3PWLB 2AP2A 3MX0A 2QQKL 4EDWH 3QJFB 5JLZA 1S7SA 1FG2A 1F4YL 2Z93B 3OBAA 1UXWB 5I73C 3P9MB 2JIXB 3DVGA 1T7YA 3DARA 3STLA 1JZ2A 4H8WC 3LOWA 3L7EB 1DLFL 1PG7L 1HILA 3RVVD 1N0XL 5JR1H 4YBLC 1I1AD 1LNUA 4B5EA 2Y07H 1DL7H 3O9WA 4NN5B 3KR3H 2J6EL 5ID1A 4MXQD 3GHEH 5T1KD 1H3PH 2X4TA 3RWHB 4OGYL 4K9EC 4FS0A 4LLWB 3I9GL 3UJJL 3SDXB 2RBLA 1OCWL 3OKMB 3L3HB 4CVUA 2GFBA 2VDKL 1JGDA 3N1GC 4LIQL 3JBG7 5C0EB 3N1FC 4RQQB 2SEBA 2AEWA 4NZDA 4KK5D 3FAWA 3EGSA 3A67L 3OB0H 1G1CA 3HMWL 2QLVB 2D31A 2E9BA 1W0WB 3QCVL 3U4AA 1HEZA 2H9GB 3FKUS 2XTJE 4IHOA 1CGVA 2WV3A 4ISVA 5EO0A 2JB5L 1MCPL 1RUAH 3ETBF 1MUJA 1CICC 3V5KB 3WN5B 1J8HA 3R1GL 5FM4A 3PJSB 3QWRD 4IJ3B 4NP4L 3JWNC 3ULVF 2HLAB 5IEHA 4KZDL 3MBED 3QJHB 4LVHC 5J6GB 2YBRB 4HCRL 4LDEB 2CGRL 4GT7A 3O8XA 5ENWB 5IT2L 4LU5H 2HMIC 4MA1B 1WWCA 1MLBB 1G7IB 3VRJA 3CFEB 5DLMH 2APFA 3BWUC 3MA9H 2GJ6E 3OGOE 3T4YA 2R1WA 1OAQL 3MNVB 3T4AB 5GRUL 1AY1H 4Z7UA 3D39B 5DRZB 4IMKC 4P2RB 3ZSTA 4JFFB 5B4MC 3NZ8B 4OBSA 4WW1B 3X12B 2H26B 4WUUD 4NN7B 1NGYA 3ARFD 4GW1B 4WJ5A 2R23A 3QEHA 3SKJL 2FRGP 2YD3A 4XPAL 1RK0A 3MFFB 1F4XL 4M43H 1F42A 4X99A 1A1MB 1Z3GH 3L3OB 4LVOB 2AXFA 3ARTA 4EUPH 5F7MC 2FIRT 3T3PF 2YD5A 5LAXA 5GIRA 5GQBA 1KIPA 4PJ7E 1N5AB 1P4LB 4FXGB 5GSVA 4JN2A 1IRAY 1QYGH 4FQHA 4F57H 4QXGL 5ISZE 3VXOA 3UTTA 4YDKL 3G9VA 1NCBH 2P7TA 4JRYA 4KY1L 4GUPB 4B50A 3NFSH 3L6FA 1QYGL 3D25A 5EC1A 2CO6B 5C07B 2GKIA 2FEEI 5IW1B 1S7QB 3WFHB 1C5CH 3ZE0E 4Z0BL 4MA8H 2E6PA 3QNZB 3RUGA 1LD9B 1PG7X 4NC1C 3DXAA 3BIKB 5IB1A 5IFAH 4ZFOA 4YHNB 1ROWA 5ID0B 1C7SA 1LE5A 2VZTA 3SKNA 5C0BE 5BVJB 4HT1H 5HYSB 1SY6L 1MCBA 3DHJA 4AEFA 4IJ3C 1P2CA 1LVEA 1NGPH 3T1FA 1H5BA 1QBBA 3KPNB 1B0RB 2BC4B 4PLKD 1MHHB 4B53A 5KAQG 1EXUA 5E4IA 5AZEH 4OCYL 3MJGX 3VA2C 1V7NH 2J12B 2AK1H 5E1HB 4PY7B 5D71L 3GMLB 4MD0A 3AS3A 4M5ZH 2H1PH 4JJ5B 2WK2A 2B0SL 3QPQD 4ZXBB 5I1CL 3NVQA 4D9LH 4GKSA 5H94A 2ZSWA 4ODHL 2CPCA 5IMMA 1IAIL 2EIEA 1MFAH 4N1CA 5D7IF 1H9VA 1YEDA 2C4FU 2PO6A 5IFJB 1CDJA 1WICA 3ZKQD 2X9XA 2HKHL 5IJKA 3SDDB 4ZS7H 1CCZA 2N1KA 2Q20A 3CDFA 3GB7A 2UUDK 1U3YA 4RGOL 3BH9A 3QUZD 3JUYA 4K3EH 1BP3B 4FFZH 1YEGH 1HNGA 1KC5H 3MNZA 3OXRB 3BDYH 5E99L 3ARRA 5DD6B 4ZS6D 2Q6WB 4LDOB 5I0DA 3C6SA 1MLCB 2YSSA 1J0ZA 3CC5A 2B5IC 4QYOB 3U48A 4XP4H 1WAAF 1NGPL 4XBGA 2YZ1A 1MJ7H 3QNYA 3LEYL 1REIA 3RP1A 1DBAL 3F7VA 2EZ0D 4KWUA 3BPLB 3BP7A 5KG9B 3UTOA 3ZE1E 3S34L 1N59A 4PRAB 4RMSA 3LD8B 5I16A 4KK8C 4MAUH 4LCYB 4XAWH 4DZBA 1DLHB 3PDDA 3S4SG 3VCLB 2P43B 5I18L 3CH1A 3DURB 4L4VE 3AROA 4V1DD 5DJ8A 1YEHL 4KHXL 3RAJH 5IEKB 3O6FC 4Y4FB 1BZ7A 3QIBA 3CFKB 3IDXH 3BQUB 5F1SA 5IFHL 2XWJB 3GMPA 4S11A 4JO1L 4L29A 4AT6A 1TQBB 2Y7QA 3L3JB 4WU7B 2R8SL 1MREH 2OTWB 3LIZH 2UV3A 2OI9C 4Y16D 5A3ID 1MFDH 1A7OH 1XFPA 1KIQA 3VU2A 1FFRA 2AXGA 4NDMB 4MJ5A 1A3RH 2P4AB 3C5JB 3SDAA 1BJ1H 5FCSH 4JFED 3P73B 4CBPA 2BNRD 4G8FA 4NUGH 1IJ9A 3SGKC 3MRHB 5JHDD 2OL3L 5DDHB 1U6AL 3RGHA 4WFHE 5ALBH 5L88L 4A6YL 1DVFC 3OKEA 3KYAA 1UCTA 1U36A 1JMXA 1OQXA 2WWMC 1LK3H 4HIEB 4JCMA 3ECBB 3CGTA 4UMGA 1NGWB 2AV7A 4AL8L 3GGWA 3GUTB 4RA3A 4B7LA 3V6ZB 4M1DL 3TJHC 1JHTA 2AJXH 4BQ8A 4AYFA 1N4XH 1L7TL 4X6CB 3D2UB 1NSNL 1N7ML 3VW3L 4L8DA 3JWOH 3N1MC 3G6JB 2V5MA 3GJFA 2EDFA 2EE3A 4YX2H 1IGML 2F53A 1K6QL 4PRIE 3CCHB 1IAKA 4NPYB 3K4ZA 1A6ZB 4JO1H 3BD4A 2F58L 1KLGB 2HJKB 1GGIH 1KJVB 1Z9OA 2O61A 5C0GA 5T1DH 1CBVH 2GEEA 5DEZA 3SCMB 1RUPL 2ITDB 3ARWA 4KKLD 5ANME 3U6RB 2ARWA 2RHEA 1ZA6A 4X6DB 1FNGA 5EUOF 2JKXA 4H26A 5E2UL 1B6UA 4ZTPL 2C7UB 3X11A 4YHKH 5HI4D 4C56E 3B6SB 4PJCB 4HS8L 5I6XC 3RX5A 2Y23A 4NSKA 5DK2B 1NFIA 2E5EA 3ES6A 3WXWL 2XZZA 4GW4A 5EU4B 4NQTA 2X4QB 1TCRA 5LG1A 2Q86B 1ZHLA 4GW5A 3K2UL 1MWAH 4PJHF 1YNLL 2CO7B 2QSCH 2ZUWA 4KV5E 4KQ3L 2ADFL 1QBML 1QLEL 5KSAC 1XGQB 3UO1H 1S7VB 3F7RA 2ZCKH 4H1LB 4PJHA 4W6XB 4PJAF 1ETZA 5HGAA 4MA3A 3S8WA 1CFNA 1FNFA 3ARGB 3LY6A 1FNAA 4POZC 5C0NC 4LMQI 2DWDB 4OSUL 3G9AB 1DQMH 5MI0B 1QACA 4MLSA 3WIHL 3DUUA 3DBXA 1OGAA 5GPRA 1OGAB 4Y1AD 4PJ9D 4APQB 3RRQA 2FX9H 3U0PA 4NQDA 4M7LH 1SM3L 1KXQE 4XNUL 5KVEL 3P2TA 4L3AA 2HFFA 2ZOLA 3WO4B 3QUKA 4XAKD 4GG8A 5HI4C 1KBGL 2IANB 4ERSH 4DK6A 1C08B 1V05A 4CMHC 3C6LD 2NY4D 3O11B 4LRIA 4P5TC 5IVXE 2EYSB 1JWMB 2VLRE 4NM4H 2FEEL 3ZTNL 4MQ7A 5ESVB 3PL6C 8FABA 3T8XA 2CRIA 3DUHA 1ZLVH 4KJPC 4X7SH 3RWIB 1IEHA 1S7UA 3GI9H 2KQMA 2H45A 15C8H 2UWEB 3PXJA 3LKSA 2O93L 1U58A 4PJXE 3B9KD 2JCCE 5JIPA 1H3TA 5JDJA 3IJHB 4I77L 4KRMB 4Y19A 4DGYL 3GMOA 1JHKL 3TYFA 1HKFA 1KN4H 3LRSB 1AE6H 3RL1B 4ZAKC 5IF0B 4CAGA 2ENSA 4PJ8A 4POZD 5IM7A 2E7LA 4MNGE 3H9SD 2IAMC 2GJ6A 1L9NA 1HQ4A 1RZIB 2HRPH 3EOYG 4KJYA 5F96L 2XQBH 3JZ7A 2DI8A 1L6XA 1QSEE 4JHAH 4LAQH 5IJVB 2ED8A 3CZFA 4HFWB 1KIUA 3FMGL 5L2JB 4XVTL 5CWSB 4IRJC 3NTCL 4P46D 5HHOA 2WIIB 4OAWA 4YFDB 3UZVB 4DUWA 4G3YL 5EUOA 5T1MA 1RPQA 4HUVB 2YUWA 3FFCB 3SY0A 3ZE2F 1MJJA 3IU4H 2BY2A 3K1KC 5E5UB 1T5XA 4P2QE 5GRJL 3BPOB 3NAAL 4JRXB 3OF6D 3O3BB 4PD4J 5JW5B 1RAMA 5E00A 1W0YT 4LARH 5E8EB 1KLGA 5BXFB 1N6UA 2NY0B 3GBNL 5MENE 5EC2A 3I6GA 3ZYIA 1ADQL 4GG6F 4D8PB 4U31A 4U33A 2LFGA 3ARFA 3WHE0 2XPGB 4KMTH 5I75C 1KJ2L 1YJDH 3KPLB 5FM8A 3U0TA 1T1XA 4XCYA 5F6IB 3QHZL 1W72L 3V0WL 3JUZA 4NC0B 1Q9KB 1Y0LB 1P4BH 1MFBL 1CTOA 2RIKA 3MV8A 4PJBE 2ADIA 4H0GA 4CN1A 3I3DA 4NFDA 2BVOB 5EWIL 3T65A 2A0LD 5EOCH 3E3QC 5DEFA 3WIHA 5DWUH 4JFDD 3ME0A 3H7LA 4HXBL 4WFGE 1P53A 1OP3H 5CGYC 5E5MA 4YDKH 3VI3F 3G5XB 5FYJH 4NYLA 1EO5A 3UTTD 1T1YB 4Z76A 2GTWB 2J5LC 5A2JH 3MRHA 3RZCB 1VKXB 2N7AA 4ODVL 5CGYD 1G7PA 4U2ZA 2DLEA 4ZQKA 4QGYA 5TF1L 4OLWH 4P2OC 2K9UA 4TULL 4M00A 5HI3D 5DSCB 2VISA 4JDTL 4KI5D 5E2JA 5AD0B 2AV1A 1CE1H 2NY2B 1S7XB 5C8JB 5T3XE 3MSPA 3SE3C 2VL5B 5DJ0A 1BZ7B 2KKQA 4V1DB 1J86A 1LDSA 4RX4D 2Z4QA 4WU7A 1G6RB 1OTSD 2BRRL 3FO1B 1CWVA 3CU7A 4XP4L 4FQXC 3WEXA 5IHZA 2B2XL 5F1OB 2J6EA 3VXRE 4YK4C 4L5FH 5FOJA 3MUGB 1CF8H 5HHOB 5I8KL 3G6AB 5DMGD 1GOGA 5ESAB 3D3VE 3MR9A 3P4OA 2FZ3A 4QRSB 2X4OB 2NY1B 4WFFE 1JYWA 3PABA 3VRIB 3T0BA 3VXNB 2CRMA 4JZNA 5ACZA 4M7JL 2NY0C 2OZ4H 2EDTA 2FWOA 2UWEA 3WIHH 1HXYB 4KZDH 5ICYB 4NNXA 1EJOL 2BMKA 5DEFB 4H20L 5C0JA 3OG4B 4TUJB 4H25B 5GGTH 4HIHB 1IC7H 1Y18B 5ECJE 4M62L 4EXPX 1ZK9A 1P4IH 2OBGA 1IEBB 4PGEA 1A4KB 3OAYK 3VMOA 4HIJB 4E42B 3DPBA 1CICA 3PQYA 4HUKB 1O5DT 5KOVC 5DD5L 5J3HC 1JRHH 3ZT6A 1MLCA 4QRQA 5HVFB 3RUGF 1CDHA 2O5YL 3BP6B 2X42A 1P1ZB 5DJZB 3KLAA 1CFSB 3MQIA 1T66D 5DTFA 3DTXB 4JG0L 1C08A 4X9FA 2VKXA 4OLYL 1HNFA 3GI9L 4EI5C 3DUUB 1UJTA 1PZUB 1P5UA 5FHBL 1MRFL 5J0BA 2HFEB 3G6DL 4DN4H 4Z7NE 5C86A 1SBSH 4NQDB 2WP3O 4QRPD 5CKAA 2DQJH 4LSQH 4DKDC 1FN4A 4G42A 3WNPA 3FFCA 5CMAB 3WKMH 5GS3A 4PJHB 2WW8A 5I74B 2ATKA 2VXTL 2WINB 2RR3A 5JXED 3H2WA 4C54A 3BI9X 1CFVH 3MLWH 3QUMH 1JFQH 4GRLA 3MYJA 2A83A 4OFYA 3BDYL 5E99H 1KN2H 1KCUL 4F2MB 1BZQK 2ITCA 4P46C 4KJYB 3VGEA 2Y5TA 2HT2D 2R2EB 5JOFA 1K6QH 4IOFC 3MCG1 3Q3GB 3O6LH 4GS7B 2J88H 4Y19B 1K8DB 4ORGA 1DZBA 3BKML 1MHPH 1RVFH 1IM3B 1R3KA 2EDYA 2NNAA 1R3JB 3HKFA 5IV2A 5F70A 4FFYH 4PP2A 3S3PA 3WMSA 2V5RA 2IBZX 4JN2B 3MC0A 2YKLH 4NSKB 4OT1H 1I7UB 4QHMA 2C3WA 2AXHA 4U0QB 3RVTC 1HIML 5IB2B 4DUXA 1CVSC 4OI8A 4JVWA 5J1AA 3O6FA 1V3LA 1HI6A 1D5XB 2PETA 4OCYH 3QFJE 3UYRL 3GSNA 2EDDA 1FNGB 3SGJC 3MMEA 1TVBA 1BD2B 5K9QI 1CGWA 2R0ZL 1BZ9A 4D9QD 3NIGE 3E2HB 4OLEA 2RCSL 1NGYB 1KJVA 5F6HJ 3WDJA 3D87B 4JPWL 4ESKA 4FZEL 1Q9LB 4P2RD 3OZ9H 2VH5H 1XGPA 5J1SC 1QUNA 3FL7A 3IS0X 4NP4H 4F9LA 3IDIB 5IUSA 1U8KA 4DFIA 5J6HA 3P9LB 2YXMA 1LEIB 1HH6B 4RGNE 5D7KE 1GGIL 4ZXBC 1E6JL 1GHFH 2X1WL 4GLRH 1JNNL 3D85D 2R2BB 5J57B 1UWXK 2XKUA 3AFLA 3BISA 1SJEA 4QHLA 3DUSB 1ZLUH 5EIIA 5EBMA 2DWEB 4LPTA 3ARED 3BAEL 1TCRB 3I6LE 4JHZA 4UT6L 4PP1D 3QJHA 1H15B 3V5HA 3MXVH 1YEIH 1A9BB 4BSWB 4KZEH 3HC4L 4HZLB 4L3EB 4JFOA 3LKNB 3VGAB 4Q2ZB 5BV7B 3RX7A 3DV4A 4JFPA 4R26L 2AJ3A 4WY7H 1JV5B 4JRWA 4KI5F 4UUJA 4L4TA 4LLUA 1KGCD 1IFHL 2R1XB 4JFXB 4LPCA 4WV1C 3KJ6H 5D96B 3W9DB 3SJVA 3QDMA 4IIQC 1L0XA 3TZVB 3CFIC 4GMTH 2HTLC 4OM1H 4NQDE 2VMFA 4TPRH 2FEDD 1IT9H 4QOKD 4OIBA 1MF2L 1SJXA 3D5OF 3KPSE 3OR7A 3IVKB 2I9TB 3G08A 4LCYA 2Q3ZA 2H32H 2ED9A 1WISA 1A7OL 2GFBB 4UAOC 1KB5H 4X8XA 2FJFB 1YQ2A 1NGXB 1XF4A 5J3HD 3KG5A 4LLWA 3TA3C 1BD2E 3O6KL 1MJ8L 4LAQL 4LVNB 4ZD3L 2NCMA 4Z7OF 1P6AB 2OX5A 5IHUL 4O9HH 2F74B 1XIWC 4IIQB 3D39E 5KSAB 3KS0H 4R7NB 4N0YL 4NKOA 4PJ9A 4JQIH 2WLZA 1FNHA 1OB1B 4YDIH 1FJ1A 2CK0L 2FHBA 1EVUA 3MLRL 4QYOA 2VQ1B 5I1DB 5F8RC 2BFVH 1MVFA 4O2FB 2DQJL 4WY7L 5DD1L 2FNBA 3T65B 3WDIA 4R4ND 2GI7A 1X4YA 4I0KA 1EHNA 1FG2B 4LVNC 2Q7NA 3DX8B 5FUCC 3EO9H 2VL4A 3ZE1F 5CBEB 4PB9L 4R4NC 4GRLC 3C5ZD 2X1XR 4PV9B 5EZJB 2CLZB 2Z35B 3FAXA 1KIRB 1ZLUK 4I9WD 5DJXA 5FFLA 5I17B 3B2VH 5FHAL 1F58H 1NKOA 1CDUA 3GJEA 3FQTA 3RVWC 3BKCL 2NYYC 2ZOKB 4QRPA 3BOVA 4UNUA 4RIRB 1T03H 3AUVA 4DGVL 4TRPL 4TSCL 1LDPH 4JN1L 1BPVA 4N8VG 4CU6A 2RAMA 5SWZB 3JVGA 4PJCE 2VDLH 4POUB 5CEZD 3E8UL 4KV5F 4URTB 4Y5XC 4GG6E 1OY3B 4AG4H 2J8UE 43CAA 1IKNA 2NX5A 2UZIH 4YEFA 4TN9A 2IPKA 4ZO9A 1S7QA 3O2VL 3MOAL 3O41A 4HHAB 4OD1L 2AXJA 4G8IB 5FEBA 1MH5B 4HPOL 1H3XA 4E41D 3W0WD 2DM2A 4ODWB 4J8RB 4OZGE 3U9UB 2NY2D 1K4CB 5GGRB 2Z8VC 3S97C 4F15C 4OD1H 5F71A 1KCLA 3LRSA 5F9JB 1QFUL 4GLRI 2VDNH 1K2DB 1FZOA 3AM8A 4GUPA 2AEIT 5HDQH 1KJMA 3IRZA 3Q48A 3IETA 3PV7A 3TPUB 1EPFA 4NWTH 4UV4L 2EYRA 3MNZB 2R29H 4F9LC 3ARXA 2X41A 4NKDB 4M8QA 2J88L 5SV3A 3TVMA 2YD9A 1FL5B 2JCCB 2F5AH 5CP3A 3R1GH 2MJWA 3CPLB 5E8OA 5H2BB 1U93A 4KKAC 3CH8A 5EPMA 5CJ8A 1G6VK 5JQ6H 1QR4A 1X3DA 3CVIH 3IU3A 4M5YL 4YDVA 3X12A 1X5JA 3OX8A 4L8CA 3NZ8A 3GI8L 3VFVA 5JHDA 4U6HA 4D9RE 5EO9A 4N5ED 4NWUL 4UT7L 5JNYB 4GO6B 4ZXBA 2ZOLB 2R23B 2P45B 2QHRH 4YWGH 4GW1A 5BS0D 3V0AC 3MJ8A 4PJDF 5T33H 1PEWA 1TJHL 2AJSL 2FO4B 4LLMB 5DJ6A 5I8OL 5DVNA 4NQCE 1TITA 5D1ZA 3AREB 1A6AA 5CHNA 4Y4KA 2AEQH 5EBLA 4FP8H 4UZGA 2YPLA 1KTLA 3PG2A 4PRBA 4X7DC 5D5MB 3MV9D 4U3CA 4KMTL 1KTRL 3HI6H 1CS6A 3TT1H 4KI1A 4JB9H 5LGJB 2BY1A 2WNGA 4C57C 1PEZA 4KUZL 2PCPB 3GBNH 2AJYL 4RDQF 1YUHB 1JI2A 3FT3B 3FB7A 1ZV5A 1ULVA 1EERB 4YHZL 4U6XA 3ULUC 2MOVA 4BZ2L 3BN3B 2G75A 1CE6A 1JHLH 1T2QL 2W0FA 4LHUD 4JFHE 4MWFB 2OLDA 5A2LH 1FZMA 3VG0H 1CFTB 5EB9A 4Y4HB 1TNNA 1A7PL 1QFOA 2OL3B 4EIGB 3DETD 2FHCA 2B4CL 3BD3A 2I07A 3I75B 1LDPL 2PYED 3CXHJ 4ODBD 1F00I 4YXLH 1KPUA 4IDJH 4X6CF 5C0IA 5L9DH 3U7AA 5J1TC 2KDGA 5JXAH 4PTTB 3KNBA 3WS3B 5LWYH 4WWKA 4LAJH 3MFFA 5ETUA 2NR6C 3TJEL 2HVJB 3SE8H 4EBQH 4XPGL 4PJBF 2I24N 1IEAA 3CK0H 1PG7W 3EYVA 2VRAA 2NY4B 4JLRB 5ID1B 4DKEL 2FD6L 2JJTA 4PJ8D 3UYOD 5T1KB 4V2BA 4XB8A 2XV6B 1AGBB 3D0VB 4ALAH 4YQXH 3ZYJA 2IH3B 2IMMA 3HB3C 3SDYL 3PP3K 3DVNB 4PJ8C 5GRVK 5DJYB 1ED3A 4XXCC 5HY9B 1PKOA 2BNQD 3KJ4B 1S7SB 1UWEH 1L9MA 3CNKA 3MLZH 4PJXA 1MUJB 1WITA 4JHWH 5BQ7B 4XP1H 5EO0B 4HXAL 2DKMA 4LCCB 2X4NA 4XXDA 3WL9B 4OCXL 1PDKA 2PTUA 3MA7B 1KB5L 4OCWL 3NFNB 4ZPTA 1CGUA 5EO9B 5DFWH 1FFQA 2YWZA 1TTGA 3CSGA 4P4KB 4XVJL 3STZB 4A2LA 3S35H 1Q9OA 3E6HA 4KKLC 2FJHA 1P84K 4WEBL 2QKIB 3JTSB 5H2BA 4OZIB 3HZMB 4WNQA 1JGDB 4JDZB 1OPGH 3SQOH 4K8RD 2P24A 1FFOB 1P69B 4C56D 3OX8B 4L8CB 5T3XL 5CEXA 2XWJA 3GMPB 3RL2B 4RZCA 4N8CH 4KUZH 3BQUA 1LO3H 2QSQA 5GS2H 4PJ7B 1FIEA 4U3XA 4QHUA 2M2DA 3IDJA 4IRSB 5C0FB 5E8DL 2ERJB 4G7VH 1CFQB 1A3LL 1SYSA 5EIQA 1INQB 1OAYH 4PRPD 5C0RH 1A7QL 2X05A 3SKMA 1WUNT 3F58H 5EZIL 4QRRA 4ZUSA 4HBCL 3QDHA 3FO9A 1MCQA 4MLIA 1J9CT 4O4YH 5D7IA 4OCXH 2WBJC 3L1OL 5K59E 4RFOH 4OF6A 4I1NB 3D3VA 1XAUA 3RJQB 3T0AA 5DFVD 3BP5A 3S96A 5HYJD 2GJJA 3CLFL 3MZTA 4DZ8B 2VAAA 1FZJA 4NNYB 2CKBH 3QIUC 2P5EA 4NHUA 1W0VA 4GOSA 1NMAL 5D6CB 4NBXB 1MHEB 4FNLL 5DD6A 3KPTA 2Q6WA 3FHAA 2IFGA 2MFNA 4JM2D 1OAUL 3LQZA 5TGBB 1D5MB 2EDBA 2V5TA 4MA7L 1X5GA 3H3BC 2P5WA 4YHLL 5D1ZB 3QXAB 2P24B 3S34H 1LK2B 1OSPL 5HGDA 1CG9A 1V7MH 5E8DH 1SEBB 5DD3L 4HPYH 1ES0A 4Z7UE 1YMHB 1BVKA 5HGDB 5JHDB 1LO3L 1IC5L 3GJEB 1J88A 5ESQA 2XZAH 3TA3B 1ZHNA 3MLSL 4LRNH 3L5HA 5D4QA 4XP6H 3SDCB 5J8OA 2P46B 2W91A 3Q1SH 3GMLA 4MD0B 1CD1B 5TE6H 1NDMB 1Q0YH 3MV01 2DQIL 4PJFA 1E4XH 3MV9A 2ICEB 4PLKC 1T04A 2HT3C 1H3UA 4NC2B 3KYNA 2L7UA 5ILTH 5KN5A 2OSLB 1S5IH 4ODUB 4LSVH 1IC7L 4C55A 4K3HA 4F7MA 2IGFL 4I3SL 4MJID 3DX6A 3IF1A 3P3YA 1I85A 1ZHKB 1ED3B 4R97B 4HS6B 2FYYA 1LE5B 2NY0D 4X9BA 1F3DH 1R3HB 1RUAL 1XGRB 4QRRB 4ZUSB 4BJLA 1VADB 1G9ML 1BX2A 5LXGH 4K55A 1RULL 2R0LH 2DOCA 5D1QB 3L9RA 1T20A 2XIDA 5LGHL 5D72L 3VWKA 2YEZB 1KPRB 2NY4C 2OR7A 3D0LA 5C3TA 5E03A 1FL6A 1AR1C 4NM8L 3X14A 1BEYH 3LSOA 2F74A 3FFCD 5J06A 1CF8L 2HH0H 2IFFH 3C9NA 5D1XC 1JK8B 3SKMB 2XT1B 4OKDA 1IC5H 4MB5A 5IB5A 5F7HA 4I48B 3MRIB 4P57A 3B3IA 3X17A 4FQCH 4NQCD 4L1DA 3L5WA 1IGYA 3EYQC 2I5YL 4JCLA 4B0MM 4WWKD 4RGNB 3ZHDA 2F8VA 2MPAL 4W70A 2AXFB 4L4TB 3EIFA 1CT8B 2CIKA 4MDJA 3VFMB 3SKOB 3NCFB 1E4KC 3BDXA 5FA3B 4AEIH 2Z35A 4NZTL 4BK5A 4RFEB 2DDQL 3H9YA 1F97A 4G9FA 4AEEA 2BNUA 3JSSA 4YAQA 3K74B 1NH6A 2G60L 5EIIB 2Q8BL 4ZXBD 1U8QB 1G7QB 3C6LB 3FN0H 3WJJA 5J9PA 3QWRA 4OZGF 5CCKL 4HC1H 5HYJE 1AHWC 2Y06L 1RIVL 3D18A 3VD7A 1T83A 5CZVL 5HI5C 2L7JA 4PJXB 3G04B 1QTYT 4TSAH 4X8JA 1G7QA 3V4VL 1FPTH 3ZKNC 3LS5H 4PJ9B 4PBXA 4ZNEE 4NKMB 5T1KA 5J89A 3P77B 1YEKH 4ZSOA 3BN9D 2EXWC 1GOFA 3F5WB 3BT2H 4PJGA 2V9QA 5CJBA 3FT2B 4E41A 1TTFA 4ZOAA 3SKOA 5SWQB 1DVFD 1JRHI 2X4SA 3IFNH 4HLZG 4KUCF 5IVXB 5L7XH 5KS9F 4YHYC 5JUEH 2GTZB 2KZ1B 3WNOA 1BD2A 5GISL 3ET9F 5DMGC 3JV0A 3VD3A 2I9TA 4PRIB 3C09C 1B2WH 2XKNB 2HTKD 4JN1H 2Q8AH 1ZGLP 5HD8D 2UYLA 1F4WH 5CLTA 3EO1B 4R0LB 1CDBA 1K4DA 4YC2B 5FB8B 1WQVT 2NW2A 1NCDL 4AH2A 4F7CB 3MRPA 4P48A 3GKWH 2Z0BA 4AEHH 4P2OA 3CVIL 3U79A 5F89B 3X13A 1FH5H 4RFOL 4Y2DB 5BRZE 1CXFA 2HMID 4UB0L 5GS0D 1K4CA 4BUGA 3FRPA 3AGVA 3QXUA 3DRTA 3MYJB 1QLRA 5F7KC 3WIFA 2FYYB 5EBMB 4PGDB 2R2EA 3SE4A 3U36A 4YGAB 1ZTXL 4K71C 2EZ0C 5I1KL 1UG9A 3IRPX 4HUNB 1AIFB 4KI5E 4M9PA 2IC2A 1E6OH 2X7LB 1HHGA 1ZLSH 4OUUB 3BPOC 1G7JB 2JF1A 4FQXA 5DEGA 1ZWIB 5IGXL 4LSTH 4Z8FL 3A6OA 2BXYA 3CU1A 4N9GB 1ONQB 5C92A 1BHGA 1IGCL 3GEWB 5DUML 4NJAH 3PGCB 5HD8C 5TDNA 1Q9LA 4XPBH 2NY3D 3IU3B 4YDVB 4YHPB 5E0QA 3MJ8B 1I1YB 3BP6A 5GGQL 5FGRA 2AS5M 3CPLA 4MQXD 5CFHA 4U6HB 1SBBA 4K7FB 1AR1D 2YWYA 2JELL 3L5IA 3MRNA 1CFSA 4OZGA 5TGBA 1FFNA 3HZYB 5I8EA 3UPRB 5JPNA 1A6TA 1UFUA 4G7YL 3FRUA 1MFCL 4D0DB 1K8IA 2XY2A 4XNMA 3EOTL 1HSAA 1WEJL 3A67H 4F8TA 3JXAA 1KEMH 3W82A 1YYMH 1CGYA 5JHLH 4PJGF 1OB1A 1YEEH 1FL3B 1KEGH 2DM3A 4BFEA 3FO2B 4TUOA 4IIQA 4DKEH 5JOFB 1FBIL 3O0RH 1WZMA 3QFJD 1UH4A 2YA0A 4KAQL 1DUYB 5GS2D 1VFAB 4ZUWA 1T7WA 4OZFA 5DURB 1KULA 1NBZA 3P11L 5I1EL 4G8EA 4S1DD 3TP4A 2OMBA 4HAFA 4OFIA 1MIMH 2DM4A 2DQEL 3M8OL 2HRLA 4F7EB 3QFJB 2WQ8A 5IHZB 3I02B 5DWUL 3SE9H 1BF8A 4RGOH 2Z4QB 1QKZL 1G7PB 4N68A 5DGRA 3P40A 4WW2A 1VKXA 3LMJL 4Y5VC 4S0SD 4OF5A 4MJIE 2ZOKA 4HWUA 3RA7L 4K2UH 2QJDA 5E94A 1BAFH 3NFPB 2QQNL 3QI9D 2R0WL 4HWNA 5HPMB 1F4XH 3QH3A 4JZOB 5DD0H 2ZCHL 1R5IA 4MD4A 4PPTA 1KG0B 2XG4A 3QUXA 4IRJA 5AUMB 5GJSL 2YXFA 4XNQA 1S8DB 5L0QB 2WUCL 5HYQA 5C2BH 5DVOA 1LO5A 4PJBB 4L5FL 3Q5TA 3EDJA 4GKZB 4EUPG 5IBLD 4QGTA 3KPLA 3E1F1 3WIIL 4HPYL 4HCRA 2EDEA 3LS5L 1AJ7H 1BVLB 2LAAA 4H25A 1WFTA 3BKJL 4HMCA 1JNHA 1T4KB 3IGAB 2X4RA 1ZVYA 3WNMA 2IH3A 4BSVB 1BLNA 5C0CA 1CZ8L 3NTCH 2A6JB 1JE6A 2HWZL 5C9JB 1S3KL 1UM4H 5FKAB 2UWEE 5JIHA 3PGDA 1RZ8A 1FVEB 3OKLB 3OHXB 1AP2B 3RWJB 1QSVA 4W4OC 2XWBA 1S9WA 4P5TB 1QG3A 3NABL 3OTTA 3UPCA 3QXDA 3ARBA 2V2WB 2FJFA 5F9DC 4AIZA 4M7ZC 3PL6B 3VXMA 1P7QD 5ETUB 3EFDH 3MGAA 3FZUC 3B43A 3VI4E 4YJZL 4RFNC 2XXMB 4JFXA 3KNBB 3G08B 5TJWK 3OR7B 3SDDC 3IVKA 15C8L 3IJYA 4LSQL 1HI6B 1J0HA 1X7QA 1QSEB 4XMPL 1M7XA 4M43L 5HDQL 3LB6D 1B4RA 5T5FH 3DI3B 4NQCA 2FD6H 3W9DA 1W72B 3TIDB 3KPRA 4J23A 3UBXA 4POYA 5D6DC 5I66B 2IAMB 4GAGH 2VR9A 5FAAA 5DHVH 3W11C 3SEPA 4YDLB 1GAFH 2PYEA 1CE6B 4K07A 5IVZB 3TBVA 3V8OA 3LS4L 2DRUA 3NA9H 4RA0C 2DJSA 1Y6KR 4NQVA 4TUKL 5IMKA 1S7UB 1MHPL 1FAIH 4EKXA 2DTSA 2NY1C 1JWUB 4OCWH 1N2RA 1XIWD 4QRUB 1UWGL 4R96B 1ZGLM 4XCFL 5F93C 2M1KA 4GAYB 5DJAA 3DX7A 4EOWL 2EKJA 1WFOA 3QUKB 2ZPKH 4Y5YC 1SJHA 2P5EE 4M93B 4Y1AA 3GK8L 1MCWM 1IAII 4LL9A 4WENB 3RBGA 3QZWG 1AGEB 3GSNH 1XGPB 2AJYH 3QQNA 2W9EH 5JIKA 3BP4A 3DBXB 4X6DF 1UXSB 5EUOB 3ZKMD 1T5WA 1MI5B 3EUUA 4J3VA 3VMNA 2AQ2A 4KXZH 1FLRL 3KYMA 2VDKH 2V9TA 2BSSA 4U7MA 1EA9C 1YN6A 4KKCC 1DTUA 2B1HH 4I0PA 1CFNB 1YQVL 1DP0A 3K0WA 2V9RA 3GHBL 2D9QB 3O4LA 4PB0L 2V2TB 3TCLA 3MZGB 3MODH 2VTFA 4G80B 2CUIA 2IBZY 4BYHA 1CXIA 1U0QA 1T80A 3DECA 5C9KA 1T6WA 2J5LB 3H9SA 1PD6A 3GMOB 12E8L 2DJ4A 2P49B 5DD5H 1U92A 5F1NB 3BD5A 4JHBA 4GW4B 5EU4A 3U9UA 1IM3A 4O9HL 2F58H 3QO1A 1A3QA 3BZ4A 1MH5A 4LSUH 1NFIB 5EWIH 1TENA 3ARSA 1D6VH 4PJAB 1ZHBA 4ELKB 2ZUXA 4NQCB 4HGMA 3F7YB 3QNXA 5D2NA 4U1KB 4NFCA 3DYOA 4OFVA 3LZFH 4RAVB 3LEVH 4IOFD 4R8WL 3RTQA 4YE4H 1KCSL 3P4LA 4NZUH 5EFIB 1RMFH 1D6EB 4H0HB 1EAPA 2F53B 2R0ZH 1RZGB 5D1QD 4LRNL 2AV1B 4QRRD 2XNAA 3FQTB 4HPOH 4LARL 3H9SE 1CR9L 1D5ZB 2VDQL 2MHAA 4Y5YB 5DVMA 2EDRA 1NGWA 4W6YB 5I1AA 3ZKXC 1ORQA 1HK6A 4TOYH 2HG5B 1IE5A 5FYJU 3QXTA 2Z8RA 3IDNB 4JG1L 5GS1C 2I9LA 3B9KA 3ROLB 4UTBH 1G0XA 3R4DA 5D7JB 2QADC 2EYTB 4CVXB 5H35B 1C5BL 3CVHL 1QSFA 4FOMA 4PJDB 2WLYA 4MSWB 1MRDL 4P9HH 1YPZA 5ITFB 3OXSB 2X6MA 3TBVB 2Q86A 4NNXB 4IMLA 3GI8H 3ULSB 1HXYA 1HOCA 4O51A 4Z95H 1CGTA 3REWB 4JZNB 5ACZB 4HIHA 4NDMA 1G7HA 5BOZG 1A21A 3GO1H 1CVRA 1R24B 4X6EB 5C0JB 1ZA3A 3IKKA 2BMKB 4LQFL 4F58H 4JAMA 5EC2B 2ESVA 2FWOB 4P3WA 2R4RH 1LP9A 3TN0C 2C7UA 1IQDB 4N0RA 4XAKE 4JPWH 1T0MA 4OF0A 4WU5B 5B3JF 5IW6A 4LCIL 5JUEL 5K9JL 3OR6A 5D1XD 3HRZA 5L2KD 4JREB 3HRZB 3RDTC 3WNLA 3ARUA 1LEKB 1T0MB 4WU5A 1KEML 4V2CB 3SY0B 3ULUD 1J8KA 2XWBB 3K3QA 4JGMA 1IBGL 2VISB 2VJXA 4BUHA 5MHSD 25C8L 3TH3T 3EYOB 2LQRA 2BRQA 1U8JA 1FAKT 1JYVA 4LEOB 1VEPA 4L8DB 3WUWG 5HVHC 1PG7H 2GQHA 4HH9B 2V2XA 5HYJA 1INEH 1SHMA 3GMNA 4KU1A 5E2TL 1RVFL 1MJ8H 2EO9A 4J1UB 4OV6F 5ISZD 1UM5H 3JV6A 4IRSD 4YXLL 1DQML 2V17L 4JFYA 1QFPA 5DC4B 3U30C 3ULUH 4HUUA 1QSFB 3PWNB 1D9KA 2HT2C 2IG2L 4CVXA 1F6FB 3HNVH 2AJVH 4TTDD 4PJGE 1SEQH 2DTMH 3CC5B 1NEZA 4HS3B 4XNZB 3U0TB 4MQXC 3HHRB 2HFGH 4XWGL 5ITFA 4CRPA 3KHQA 1X5HA 3T09A 1SJEB 4QHLB 4O2EB 2C3XA 5BRZA 2VOTA 2PTTB 1YY9D 2DQUH 5E4EB 3BKYH 1KXVC 4OGAC 2I9LB 4KKCD 3D85B 3QQ3A 4P4RB 3D69A 3ROLA 3WXWH 4AENA 4BH7A 1FORH 4PB9H 2H32A 2B4CC 4DN4L 4JJ5A 5T5FL 4NKIL 4FN0A 1I1YA 1YEEL 3H8NA 1PX3A 4YXHL 2OI9B 4FQ1H 5F44A 3F65A 1U8IA 1RV6X 2XNAB 1XT5A 4ELMF 1ONQA 5EZOL 5CBAB 4KTEH 4PJXF 1LHZA 1RZGA 5J4MA 4QTIH 1EAPB 1KLFA 2EEBA 5T1DL 1CBVL 4X5WB 5KVEH 3VFUB 4KY1H 1EVTC 1NBZB 4KKBC 1EXUB 3GSNB 5I1GH 3HR6A 4XHJD 1M4KA 3AB0B 2AERT 3T1FB 5JQ6L 3LN5B 5D8JH 1JZ5A 4P3CH 4R4BA 4LLVA 5JTWA 4OIIH 5D2LE 3RFZC 1OTTC 1MAMH 3WIFB 5BV7C 4QNPE 1FL3A 4XHJC 1IVLA 5KBNC 3S88L 1N6QH 1GC1C 4JKMA 1CICD 3LKSB 3PQYD 4KJQC 3UAJD 2LU4A 4J3SA 5F1NA 4X7CC 4JM2F 4FMFA 4FXGA 4QOKE 5GSVB 3BQUC 2B39A 4D0DA 3OWEA 4FQLH 1ZLVK 3V8CA 1DANU 3FB6B 5ICZA 3HE6A 4E0RB 1JNLL 3MBEA 4UILL 2Q7YA 2APTA 4ZSOE 2DN7A 1QFWM 1A02N 1YECL 1Q72L 2HFFB 4V1DE 2DICA 4WJ5B 4XPFL 4HX1B 5CBAA 4Y4HD 4I3RH 4APQA 1NL0H 2BOCA 3ARFC 4RISH 5CJQL 1XGYL 2XQYG 5CUSL 3PGCA 4GKOA 2E7HA 2GTZA 1M71A 1U2HA 5JXEA 1E0OB 2HFEA 4WUUA 1XR9B 3T4YB 4YUEH 1ADQA 3NFSL 4BSJA 1I3UA 3OAUL 4ZNCD 4Q6IC 3JVGC 3D69B 4HKZB 2Z31A 1B0RA 2BC4A 4DAGL 1ACYH 1BFSA 2DDQH 4AQ1B 5J6GA 2HKFL 4N0CC 1UQSB 4NQVB 1Q8MA 5DMIL 2FL5A 3GSQA 1VPOH 2C1OB 3KJ4C 2V7NA 5F7DB 1G7IA 2DQFB 1FO0H 3QCVH 1XGUA 1NEZB 3UJTL 1QLRB 3RDTB 1S9KC 3QHZH 5BS0B 4FQXD 2E8YA 4IHOB 4ISVB 1I1RA 1I9JL 4YHML 4TUJA 3TBSB 1MRFH 1R0AL 1YECH 4L3CA 2C9AA 5CS7A 2JE8A 3PHSA 4HBQA 1NJ9A 2Y6SC 2D7MA 2JJUA 2GAZB 4WWKC 1GC1H 1UZ6F 5TDOA 2DLFH 3OMZA 4FQHB 4KK5C 4QOKA 1NCAH 1QBAA 3BFOA 4NO2A 3QWOA 2BY0A 3SJVD 2XKNA 5JXAL 1J87A 5GZNC 2Z31C 3OAZH 3QCTL 5K9QG 1LEKA 3OHXA 3RWJA 1IAKB 4NPYA 3P30L 3TEUA 2QV2A 1IGYB 4KK9D 4R90L 5DJ8B 4V1DA 5GJTH 3GMMB 3VWKC 2APWA 3MUHL 3B3IB 1VB9A 3VCLA 5E2TH 2VXSH 3LVEA 4NNPL 4U6VH 5C6PB 1J0YA 4NJ9H 1KCRH 1JZ4A 5FUOL 2YMXH 1NBVH 4LSRH 3H42L 4CUCA 4LNRA 1I8KA 3MNVA 3QUZC 4I0CC 5TFSH 1HHKA 3L95A 4IOIA 4EI6B 4PRHB 4HG4J 2EEDA 1HKLL 4S2SA 5SWZD 3V6OE 5HHNB 5FYKE 5B38B 4PJBA 5DHYB 2D7QA 4HWBH 1VESA 4R26H 3UTQB 1YQVH 5DD3H 2AAVA 1SBSL 2HYMA 4QWWD 4WV1A 5K9JH 1J8HB 5JLZB 3QIWC 4WCYH 4EI5B 1AFVH 2J4WH 1IKFL 3V9FA 3K4AA 3PWLA 3QDJA 4P2CG 5T5NG 5I76A 2HT4C 1YYLL 3W2DH 1UACH 4Z0BH 3VFGL 3VXUA 1OAKL 4JANA 4BQBA 4FTVB 2OS7A 3ISWA 4HGKC 1NUNB 1NCUA 4XCCL 3HA0A 2NY3C 2LU3A 1NAMA 3QI9A 2VZVA 2P1YA 5FF6B 4MS8C 3RIFF 3CDGB 3WFEL 1YEGL 1NFDB 4OF7A 1RJYB 1JF1B 4HWEH 2OR9L 3DURA 3FHQA 1LO2L 1YNKL 4MAYC 4AT6B 4XNYH 4HIXL 1N8ZB 4DZBB 4F7EA 3NH7L 4P2QB 3B9EA 5C08E 1JGUL 4ONFL 5IEKA 5E24E 2WBJA 3O9WB 2W65B 4R97C 4YHZH 2C5DC 2NX5D 3KAAA 4NN6B 2AK1L 1EUTA 5C0CD 3OJDA 1KTDB 3QZWA 1IFHH 3U2SB 3RBSA 5DK0A 4UQ2A 5DQDH 2VLKD 4FZ8L 3WFZA 1TZIB 1A6PA 5KS9A 4HUWB 1UYWH 5I1HL 1NAKH 5FYKL 3OXSA 2UZXB 4S1QL 2Z93A 5JPNB 4KHTL 4QF1B 3UTTB 1X4XA 1J05B 1MCFA 3TVMD 3VH8A 1RSFA 2FSEA 2IWGA 3FFDA 3P0VL 3T77A 2MKWA 1CFQA 1MY7A 4H8WL 4K3DL 2YSSB 4X0KB 3FRUB 1MFEH 4DGVH 3LIZL 4J4PD 2EH7L 5J11C 3MRJA 4HKBA 2APBA 4KGLA 3O6MH 5A3IC 4JPKH 5L8KB 2FLBT 4GKSB 1ES0B 2EIZA 4JDZA 2IAND 2YPKB 5GGTA 2CDEA 1DBKH 2J8OA 4X9IA 4O2CA 1VEOA 1ZKAA 3WKML 2H26A 4JM2B 3TYGH 2ZSWB 3VFPA 3EO9L 1U9KA 4RCAA 3RWFA 3TFKC 2BSED 3QO0B 1T89A 5L7XL 1OT2A 4Z7UF 4EVNB 4FQCL 3O81A 1H8OA 3F8UB 2PF6A 5MEND 4JRXD 2EDQA 1PKQB 2VE6B 4RMVA 3ZE0F 3QPQC 2E6JA 2VIRB 2CIIB 3K7UA 1JPGB 5EORH 5DA0B 1T0NA 3V4UL 5IP4A 1AO7B 5JA8B 1P2CB 2BSTA 3QDME 4NOFA 1DBMH 3QEGL 2ICWJ 1EO8H 5HY9A 1BWWA 4GW5B 4TNWF 5IWLC 4HV8B 3AVEA 3TH2T 1TIUA 2P7TB 1I1AA 3BGMB 4KTDL 4QRRE 5D7LD 1A3RL 4R3SA 5IW1A 2DKSA 3LPWA 1HWHB 2IAMD 4NO0A 3VG9B 1N5AA 1ZSDB 4ZS6C 2B4CH 2BVQB 2W9LA 4K94C 1SYVA 5D7SL 4EN3B 2VR4A 4D2NA 5EU6B 3GMRB 5D9SA 3IKCB 4Y16C 2W92A 4Y4KC 5AWNH 5TQ0H 4QRTB 2K3TA 1CK0L 4PUBH 4WHTA 5JPMB 3KYKL 1QVOA 2C3VA 2XZCL 3C5SB 5CSBA 4AIZB 4WNQB 4L4VB 5C0AD 4YPGB 3O4LD 2V2WA 1OSZA 1LILA 2XZAL 1FNEA 3HMWH 1CDYA 1AP2A 4PG2C 5D2NE 5J7CC 3V79C 5CD5C 3PWVB 3VG9C 5EU7E 2CDFB 3ARVA 5I6XB 2EDJA 3RWCA 4MHHG 4YHMH 4HG4K 5F88A 1HINL 2ADGA 1JGEA 3QDGB 4GS7C 1MNUH 4DVBA 2HTLD 4UTAH 5MENB 1WCBB 1XCQB 4U1IB 4ZAKA 2N56A 3I6KA 4GAJH 2YUXA 5E08L 3C6LA 4XVUD 1U8QA 5F6HI 4LKCA 5HBBA 4XNUH 1J1XL 1LE9B 4Z95L 3D18B 3RY5A 1MCRA 3JV5A 3CMOH 4R6UA 4U1LA 3VJ6A 5EO1A 4Z77B 4G9FB 2AJVL 3OAUH 1P4IL 4K3EL 5LGJA 4RFEA 2BVEA 3L3DA 3O8XC 2H9GA 2BVTA 3MV8D 3GBLA 5IMLA 1KG0A 1TZGL 3ARDA 3IFLL 1U95A 3QUXB 4Z7QE 2CD0A 3O9WC 2Y1VA 1QNZL 3HNSH 4NQXB 4UIMB 1OM3H 4M1DH 2QR0B 3SO3B 4NUJB 3HC3L 3VFOB 1TZHB 4PRHE 1WFUA 2HJLB 1J0IA 1NEZG 4C56A 5MI0C 4WI3A 1QFUH 3C6LC 3C87A 4RMUA 4NQEE 3RKPA 5JPMA 5FGSA 5KSUA 5EU6D 4N8CL 3BMVA 4HF5L 5C2BL 1S9WB 4G6JH 1NBYB 4GRWE 3RWHA 3RWDB 1NMBL 3EHBC 1FVEA 5BMFL 1LNUB 3HE7A 4P23D 3SN6N 3MRIA 3VXRD 4XCEA 5EU3B 1RD6A 4HCRH 1N64L 2CH8A 1NGQL 1U8PA 3FN0L 5EBWB 1UZ8B 5BZDB 2X2YA 1I3RA 1OP9A 4Q9CA 3WE6A 3LMJH 4AY0A 4TSCH 2ESVD 4HS6A 1UCBL 4PJEB 1QKZH 4CDHA 1KNOA 3QPXL 5DA4A 5IR1A 1U8NB 3DXAD 3O8XD 2WWKT 2R69L 5IHBA 1DN2A 1BX2B 1T2JA 2VDPH 4LLDA 4GG6B 2CKNA 2A77H 5FYLH 4HHAA 4WFFD 1VGEL 1NEUA 3QPXH 4I18B 3RX8A 3MV9B 3CFDB 4M6ML 4Q6YA 4F3FA 4IS6A 3ARBC 43CAB 3BE1L 4G43B 4PYGA 3WLBA 3QFDB 1VFUA 1F13A 1CXLA 4MMZC 3KGRA 4ODXA 3NOIA 4JM2A 4MNQA 5A2FA 2R39A 3SDDA 1QO3A 4CU7A 2DIBA 1U8HA 1GZPA 1OGTA 3QUMB 4HJJH 3VD5A 1ZHNB 3S37L 1Q0XL 3VFRB 2IALB 1GL4B 1D5MA 2E7BA 4WFHD 4Q9RH 4NO5B 2A9NL 1OGTB 1OAXH 4F37F 3H0TB 3U4EB 1RHHA 5HJ3B 5DRWA 1NDGA 1DLFH 1HSBB 1J1OL 5TDPA 4PRHD 3DRQB 1ERNA 4XB7A 1AXTL 5F3BB 3BXNA 4NZJA 3KPNA 3SPVB 3E8UH 1DBBL 1VDGA 5I73B 4F7TA 1JVKA 1MHEA 3VE0B 3V6OA 1KLUA 3FTGB 3W39B 3CFDA 5TPWL 1BOGB 1WK0A 2DKUA 2J1KA 4I3SH 3T3ME 2P8LB 1JPSL 4WDIA 3QIUD 4MNQE 1YNTA 4KTDH 4RSVA 4FTVE 4UQ2B 3UCRA 1GZQB 4X4ZA 1U8NA 1DQDL 2ZUQB 1MCOL 4WDIB 4XNMB 5JORB 1DSFL 4NKOB 3L6FB 3DSNA 3ESUF 1EIBA 3MNWA 4WTWA 1I7TA 5KSBB 3QG6A 3QYCA 5F9OH 2YD7A 4KAQH 2R2CA 4D0CB 3CZJA 5JZ7C 3HS0A 1FBIH 3O0RL 5K33A 1TQCB 4XC3H 3SCMC 3H0TA 5DUPL 1U3ZA 2Q3AA 1FLRH 4H0IA 4LCIH 1AD0B 1WTLA 2AJZB 4XC3L 4OGXL 5B21A 5JW3H 2NY5H 5JZ7D 1BFOA 3THML 2QR0A 5JOPD 5D93B 3QIBC 1IC4H 4OJFL 4XMKL 4JRXE 3WDHA 1RIHH 4P59L 3H9HB 4NN7C 1RK1B 1C16A 4JZJB 3V6OC 3B2UC 4FQXB 5DEGB 4IBLT 1JF5A 1JNNH 5JMRA 4IRSC 2XG5A 1VFMA 3HTLX 4LLUB 3B9AA 4OI9A 3M45A 3BEWA 3D48R 4DOHE 4LMQE 3VGGA 4U1LB 1OVZA 3VJ6B 4ZD3H 3B4NA 4XPTH 2EH7H 4P9HL 4W81A 1YDPA 2DYPB 4R90H 1VGKB 3HNTL 4OLZL 5BW7C 3NIDF 2ZG1A 1IQWL 3EO0B 3G04A 5I19L 1TLKA 3PE9A 3VXME 4Z77A 3FB8A 1DR9A 5IQ7L 3SKUD 3U7YH 5FA4A 3MRLA 5IG7A 4IMKA 1QA9B 1KJ2H 3BEVA 4XPAH 3MLVL 3PWJB 4OGAD 5I1CH 3OAYH 4APQD 3DNKA 3WIIH 3N0PB 4Z7WE 1B4JL 3X13B 4U1IA 4JFZH 4HZAA 2VXQL 3S9DB 2OP4L 1M05A 4KJPD 3BPNB 3RNQA 1ZEAH 2VLRB 1NAML 2LTQC 1T1WA 3ARGD 1JPST 5F1KC 4KVNH 4PJ5E 4MJ2A 3PV6B 2PR4L 3WS3A 1T22A 3RWDA 2CGRH 3NN8A 1IEAB 4XMLH 4QHKJ 5EU6A 4XWOD 1E27B 3PV6A 4AIXA 1AD0A 2R0KH 1P7KB 4WHTB 4WWKB 1D6VL 5H37H 1TVBB 4OZ4B 4XPTL 2MCG1 4Q9BA 1TZHA 2X44D 3IKCA 5DGQA 3BH8B 3WFEH 5KSBE 2X5PA 2Z9TA 4NQXA 3VXRA 4CW1A 3C60B 4LSPH 5KSVB 3RU8L 4M3JA 3SDXF 1WC7A 2XA8L 2Q87A 3BEVB 1ZGLA 4CL7A 2BSTB 3FOLB 3RDTD 2G5BB 1T0NB 1I1AB 4AIOA 4C4KT 4BZ1H 3O3DA 2J4WL 4FZEH 5A40E 2B1HL 3PHOA 3FN9A 3RJDA 5DVLA 1T7VA 5HGBA 1ZHKA 3IFNL 4FQQA 5FYKU 3GSQB 2LVCA 2R2BA 5IG7B 2HJFA 1LO4L 2PCPA 4X5XB 5JMOC 1NFDE 3B8YA 3LKQA 3U4BL 3A6CH 3GSRB 4LPYA 4P9MH 4F7PA 4PFEA 3IAGC 3UTSB 5DQ9A 2VC2H 5LGHH 4WIQA 4KPHL 4KUCD 4U1NA 4OKVB 5LXGL 2PNDA 1NKRA 3HLAA 2BOCB 3LEVL 1GCFA 1J0KA 2CDEB 2DMBA 4J3UA 2BK8A 2MMXA 2NXYD 2PXYA 3NACL 3MMEB 4Z7WB 1Z0MA 5AZ2L 2Q76B 1JI1A 1RUKL 3AXLB 1D5XA 1OARH 1JK8A 3IETB 4D9LL 1E4XI 1BIIA 4X5LA 3JV4A 4M5ZL 5CSGA 1INDH 4JFEB 2MTPA 2QHLA 2CR6A 1CICB 3PQYB 4CADB 3UTTE 3FQRA 3U46A 5I18H 3LPGA 5KSBA 1Y6MR 4N0UE 3MACH 1UB6B 3OKKB 1B88A 3IJSB 4JB9L 4WW2C 2P8LA 4HV8A 3ILPB 3V5DA 3GRWL 5DUBB 5IBLC 2IPKB 4RAHA 5GGRA 1CL7L 3LN5A 2Y5TB 5IB3A 3HE7D 3PF2A 3GSUA 2FH8A 3VXNA 3VRIA 1SYSB 1GRWA 1U41A 3ARPA 4PTUB 4M7ZB 5C09B 3B9VA 2CKBL 1A6UL 4HQQL 2RJMA 1MCOH 3B5TA 3G5YB 3GKWL 1RZ7H 4KK9C 1A1NB 2P8PA 3GDBA 4Q97A 2G2RB 5DYOA 2YUVA 5AAWA 3LH2L 1YMHA 1S5HB 5SX5H 2VSCA 5GXBB 4NO5A 2FBJL 3SGKA 2IALA 5DSCA 5FF6A 1W8NA 1GIGL 2ZCKL 5I71B 35C8L 4QT5A 1P1ZA 4JQVA 3DX8A 1U8HB 5D2NC 4MCZA 3MXWL 4PJFE 3SKJH 1EUUA 4GMTL 4HLZH 1UYWL 2EDLA 1NMBH 5F7FA 4X4XB 3P4MB 5CSZA 1BBJA 2LVEA 5CBEA 2WUCH 5DZOA 1FRGH 4S2SB 5DR5L 5TE7H 1LE9A 5DMKA 2FATL 2X1QA 1P5VA 1BQUA 1QSZA 2EDNA 5GRXG 1VFOA 1BM3H 4FQJL 1PW3A 4R4FL 1YMMB 3TBWB 4LLDB 3HAEH 4JDVB 5CCKH 3WFBL 1S7WA 3QZWB 1OAUH 4I5BA 1TZGH 3IFLH 4XVTH 1VACB 1NGXA 4R7NA 5HHOD 4HIIB 4P3CL 1DQJB 4NWUH 2A77L 2H8PA 5FYJL 4AEHL 2CUHA 1FO0B 3CMOL 1JIBA 2BVYA 2DQHL 3D9AH 3EAKA 1F2XK 2FGWH 2R69H 2D7TL 2QQQA 4K94L 4R0LC 3GIVB 4NO2B 4NC1E 3C5SA 3OKYA 3Q6GH 3VXPA 2VDML 2N7BA 5MEQB 1JF1A 1MPAH 2VL5A 5DJ0B 2Y25A 1KB9K 1YYLH 3ZO0A 5M94B 2MPAH 4QHKI 5KSUB 4PG9B 3H9ZA 3QWOB 4XTRD 4ZQKB 1WAAA 1LP9F 2X4PA 3TZVA 3MLUH 4YO0B 1KEGL 4UBDD 4Z76B 2YS4A 5BMFH 5SWSD 4TSBL 3OQ3B 2VLMD 2FATH 1BJMA 4LK4A 4YGVA 3AY4C 1JNLH 2BJMH 5BS0A 1FRGL 4PJIE 1R3IL 2AEPL 5FM5M 5TE7L 4G6JL 3HR5A 2CXKA 5EN2B 2ZSVA 3RDTA 4J4PA 1XGUB 5AYUL 1YPZB 2Y07L 3T3MF 5JA9A 3A6BL 3P0YL 4JFDA 1MIEH 5D72H 4ZOBA 2IANE 4KXZI 5HDLA 3E6FB 3RZWA 1UWXH 4XBPA 5B38A 1FC1A 3S88H 5C0AA 3ULUL 2XPGA 1MAML 3O6LL 2NYYD 1EEUA 1JWMA 4JY5L 3UROR 1BQHA 1XIWA 2NMSA 2VLJE 4NQSA 5CD3A 2KZWA 1IAOA 5DF0A 1BQLL 1DCLA 2Z8WC 4PGZA 1ORSB 1D7FA 3F12A 1OSZB 3HUJB 4OM1L 3OPZH 1CL7I 1AE6L 1XR9A 4L4VA 2EIZB 4K7PY 5KANG 2J2ZA 4MCYB 5FDWA 3MBEB 5C08D 3C60D 4ZOCA 1M7IB 3SDYH 2PXYD 3OJMB 1I9EA 1G9NC 4K8RC 4Z7VE 1PZ5A 4GRLD 4XP5H 1BZ9B 2IH1A 2NY5C 5C6WH 3KXFB 4U1MB 3UJIH 3ZKMC 1U91A 1R3JA 3WHXA 5SWZE 1S7VA 4KK6D 4TULH 1HQ4B 4DFHA 1NC2D 5CZXC 3WFDH 2BNQE 1F11B 3C2AL 4UNVA 5GGVY 4EBQL 3TBSA 5FYLL 2JK5A 4LGRB 4H1LH 1AO7A 4DAGH 5CZXD 2ITCB 2YOCA 4GXUM 1U3HD 2ZG3A 1BQSA 3O6KH 4K3JL 5DK2A 1OHQA 5JHDE 1BVZA 3QI9C 4PJ5D 1MI5D 5EUOE 5TPWH 1YEFH 4PJCA 4OBRA 5DFVC 4L4JA 2ATKB 3QXWA 5ANMA 3X11B 3MRGB 4HWZB 5HHXH 2XWTA 4BELD 2CIIA 1M7IA 1OP3K 4JPIA 1ZA6B 2APVA 2EH8H 3EYUH 4UU9B 3ELAT 3FQXA 2ZUYA 4BM7A 4X9HA 1UJ3B 4L9LC 5INCB 5D71H 3LS4H 3HUJA 3MLSH 5CJOH 5IKCA 3S5LB 1YMMD 4JFQB 5D7KD 3CDGA 3O2DL 2QBWA 3NCJH 5DTFB 1Q0XH 1MCKA 1U42A 4JFZL 3HC0B 1XIWB 1BJ8A 3STBA 1FE8H 2PTTA 1T3FA 4JANB 3O4OB 2CLZA 4U1SA 9CGTA 1IEBA 4PGEB 4K2UL 3VA6A 5CKGA 5DJZA 1U3JA 3C5ZB 5A2KH 2B8OT 2V5YA 2F9BT 4OLZH 4FNLH 1FO0L 5GRWA 4WV1B 4QHNA 3QIWB 3HAEA 1VPOL 5E6YA 7FABL 4U0RC 4K3JH 4K7PX 4LSUL 2AK4D 2XA3A 3JV6B 4JY6A 5F7YC 4HUWA 2WSKA 3NABH 2ZSVB 3F6LA 4P0DA 2W60A 5FYLE 1NCDH 4FFWC 1FJ1B 1G7LB 3UTSE 4HUUB 4MNGB 1Q38A 3L95B 1JJUA 1QHPA 2FZ3B 4DGYH 4RAUA 3CDYA 3V52H 2NW3A 5ESAA 4KROB 3AC0A 3NCEB 4UTAL 4H88L 1H3GA 1OAYL 4X6FA 4D0BB 4PRNA 3W11D 3PABB 4KH2A 1L4IA 1SQ2N 3QAZB 4G7VL 4XPFH 4RNRB 4P23A 1NAMH 3SO5A 2VUYA 2V7HB 4P5TD 2VDQH 3MACL 1VCAA 4G6KL 4OIAA 4WHDA 2R56H 1S7XA 5C8JA 1EMTH 4LEXH 2VZ1A 4HSQA 1U8IB 1F4HA 1WCQA 5F8QC 1OTSC 4DUVA 1OAQH 2J8UF 1ZA3B 4QOKB 5SX4H 2JJWA 4K23H 2YKLL 1KT2A 1V5JA 5DLML 1MSPA 1NFDA 1SMAA 1KCRL 3B9DA 1WJ3A 1KC5L 2J8UA 3WS6C 5FGCB 1JHTB 4HIXH 5F9WC 5ELIA 3TA3D 1JV5A 3LZFL 1JPSH 3N1QC 1LO2H 2GHWB 4WI8A 2CLRB 3LEXA 5D2LB 3VWJB 5D93C 5IESL 2OR9H 4HUXA 3D1MC 2MNUA 2V17H 2DL9A 3L3IB 3LN4B 4DCQA 1RQ5A 4QTHB 3UTQA 5E1AB 2DBJA 5CEYB 3R8QA 4I8DA 4L3ED 5MP6L 5DHYA 5C09E 2CUMA 1ZT4B 4X4XA 1T1ZB 4L1HA 3HAEB 2D9CA 1PLGH 1T6VN 4DCQB 2V7NB 5F7DA 4PJDA 3QUML 2ADIB 5DDHA 3RAJL 2VXTH 1T1ZA 1Y0LA 3S98A 1ZT4A 2E6QA 4Q9RL 2FECI 4MAYB 3LHPL 1LO4H 1T1XB 2RB8A 4HH8A 4XCYB 3UMTA 4X7SL 3J7HA 1F02I 5D1XA 4LEOA 5B39B 1RZKL 5IIEB 4M0