1WA2X

Crystal structure of h313q mutant of alcaligenes xylosoxidans nitrite reductase with nitrite bound
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGQIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Reductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE,
publication title Insights Into Redox Partner Interactions and Substrate Binding in Nitrite Reductase from Alcaligenes Xylosoxidans: Crystal Structures of the Trp138His and His313Gln Mutants
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
total genus 88
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa2X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa2X02
2YXVA 4E9RA 5ANHA 2VW6A 1FWXA 2QPDB 1GY2A 2PPFA 5F7BA 2DYSB 4M4RB 1QLEB 2IDQA 2GI0A 1AS8A 3NJFA 2YXWA 2LLNA 4YSOA 3WKPA 3FU7B 1NPNA 2J55A 1ILSA 1SFDA 1RCYA 1W6LA 2VSKB 1OCOB 4QKTA 4W9ZA 2GBAA 2IDFA 1BYPA 1TKWA 2DWTA 4DPAX 3WNJA 3MX0B 2XVBA 3V9EA 2BWIA 2HX9A 1HAWA 2EIMB 2XV2A 3AY2A 4WTQA 1CYXA 3V9CA 2H47C 3ABKB 3NJMA 4P5RA 2XYBA 4NB7A 2R7EB 3PLYA 2JKWA 1AZBA 2BP8B 4HCIA 3X1GA 1SJMA 2AZUA 2WO3B 4KOBA 4YSSA 4DP6X 2VN3A 4DP7X 1CURA 3FSWA 2CUAA 4YSUA 5B7EA 2OJ1A 1MDAA 2Y1AA 1JZHA 1AZRA 1NIAA 2J57A 1WA0X 2FT6A 2DV6A 1WA1X 3T6XA 4A68A 5I6LA 1AIZA 3NSYA 1KCWA 2QPEB 1EHKB 1W6WA 2FQEA 1SDDA 1BXAA 3TA4D 2J5WA 3QJRB 5D4IA 3CZUB 2CAKA 2GSMB 3IE9A 4N8UA 4KOCA 3T6WA 1BYOA 1NIFA 2FQGA 4KO7A 3FQ1A 3IN2A 1BEXA 3FU8A 1JZIA 1KGYE 2GHZA 2A3TA 3ZDWA 1SFHA 4QLWA 1L9SA 1PLCA 1J9TA 4DP1X 5I6KA 1WAEA 2IWKA 1JXGA 1OCZB 3FS9A 4AKPA 2UX7A 1NZRA 3SBQA 3S8GB 1ZDQA 8PAZA 3CVBA 2X88A 2PP8A 3X1FA 3MBWB 3QJUB 4A67A 3DIVA 1ZIBA 3WKQA 1JVOA 1KV7A 1OE3A 1M57B 4BWTA 5IY5B 3ASOB 3WG7B 5I6PA 1KBWA 2UXVA 1PF3A 3ABLB 3QJSB 3ZIYA 3OQRA 4W1TA 5F7AA 5I6NA 3CG8A 4X4KA 1V54B 2PP9A 1OCCB 4DP0X 1GS6X 2IH8A 2FNWA 4E9QA 5B3SB 4DPBX 1YLBB 3NJKA 1CC3A 1KDJA 3X1EA 4A2DA 4F2FA 1AANA 3TBCA 3UGEA 3FSVA 1ETJA 4AKOA 4DP4X 1SHXA 1PCSA 2EIJB 3IN0A 1I53A 1L9PA 1B3IA 1SF3A 1ZPUA 4UANA 1CUOA 1OCRB 3NSCA 1J9SA 3FSZA 1XMEB 3PAVA 2AFNA 1NWOA 3HEIB 3FU7A 4BWUA 5D4HA 2CBPA 4JKNA 2YAPA 2I85A 5AZUA 3T9WA 1DZ0A 2YARA 2DY2A 3PCYA 3ABMB 2B3IA 4JHVA 1GSKA 4DPCX 3NP4A 5B1BB 3GYRA 4E9VA 4HAKA 1KDIA 1IBYA 3FT0A 1PAZA 2FTAA 2H5UA 4DP5X 3HB3B 4NERA 1M56B 3FYIB 2P80A 1X9RA 2R7EA 4E9XA 1GYCA 1SHWA 3OD3A 4PCYA 3NJJA 2HRGA 1A4AA 2EILB 4WKXA 4YSCA 1NINA 5AFAA 1JZJA 2HLEB 2HXAA 4E9TA 1SF5A 2QDWA 1RKRA 1X9UA 3SBRA 3UAEA 3H4FA 3NJGA 2IDSA 1FA4A 1JZEA 3NYKA 2BW5A 3S8FB 4YL4A 6PAZA 4DP8X 4EF3A 4BXSV 4P5SA 4YSTA 1ILUA 3AG2B 6PCYA 1NIDA 1JOIA 1PZAA 1JXFA 1A65A 1IBZA 1NDTA 5AKRA 2W8CA 3ERXA 4BDVB 1M9WA 4CSZA 1W8EA 2GC7C 1NICA 1ZIAA 2YAEA 1A4CA 1XB8A 3DTUB 3AG1B 3NJHA 3JTBA 4HZ1A 4Q8BA 3U25A 1N68A 1UATA 2I7SA 2NRDA 2IDUA 3C75A 4AZUA 2Y69B 4Q89A 4CSPA 2DWSA 1BXUA 2MTAA 1GW0A 1GS8A 4G70B 3ASNB 3KW8A 2YAHA 1ID2A 1NTDA 2VM3A 1NIEA 2EINB 3AG4B 4KO9A 3X1BA 4BXVA 4GP4B 1ASPA 3H56A 1JXDA 3ZBMA 4F2EA 2CALA 2IWFA 3AG3B 3S3DB 3QPKA 5B7MA 2VW4A 1L9OA 1PNCA 4E9WA 1MZZA 3FPYA 4KNSA 2IDTA 1ASOA 2PPCA 1PY0A 3JT2A 3IEAA 1AACA 2PPDA 1AS7A 1AZNA 1AZUA 2XUWA 1J5DA 1KBVA 2BP0A 2CJ3A 3EH5B 3SQRA 1SNRA 2BWDA 5E9NA 1MG2C 1KCBA 2XXFA 2XV0A 1URIA 4N4YB 1BQKA 2FT7A 1L9TA 2XLLA 1V10A 4A2GA 2PCFA 4KNUA 2PP7A 3X1NA 4HHWA 3EF4A 3OMIB 4A66A 5D4JA 1ET5A 4NAJA 3G5WA 7PCYA 4RH4A 5B1KA 2IWEA 3ZX1A 3PAZA 2VW7A 5B7FA 2VM4A 4UAHA 3TASA 3IBOA 2OV0A 2AANA 1BXVA 2QDVA 2EIKB 2ZWNA 1PZBA 2N0MA 2AZAA 2Q5BA 2BHFA 3S3BB 3T71A 2I7OA 4HCFA 1KYAA 2TSBA 4GP8B 4TXVB 1NIBA 4G7RB 4YVUA 2ZXWB 1HFUA 4F7KA 5I6MA 1ET7A 1JZFA 3QJTB 2FQFA 1AG6A 1JZGA 2BZ7A 5I5MA 3SBPA 1ADWA 4KNTA 5EHFA 4GP5B 1QHQA 1PLBA 2ZOOA 3TU6A 1AS6A 1TEGA 1T5KA 2BW4A 4L0PB 3UADA 3CVDA 3TBBA 2VMJA 2BP8A 2QT6A 3WI9A 4KO6A 1VLXA 4M3HA 4GYBA 3AW5A 1BAWA 5B1JA 1AG0A 1AQ8A 1N70A 2DYRB 1A8ZA 2YAOA 1ZV2A 3DKHA 5PAZA 3UACA 4BDVA 3D12B 4E9SA 4ENZA 2FQDA 2XX1A 1PNDA 1F56A 3N55A 3NT0A 1IUZA 4ZK8A 3FSAA 4DP2X 2Q9OA 3QQXA 1FFTB 2MRYA 2H3XC 2ZONA 3CDZB 4G7SB 2UXTA 3NSDA 1HAUA 4YSRA 3EHBB 3OM3B 1AAJA 2PLTA 2UXGA 1E5ZA 4K9JA 5LDUA 5I28A 5B1AB 4YSQA 2IH9A 3NJNA 1CYWA 3PPSA 1TU2A 1GS7A 2XXGA 5I5IA 1E30A 1OOWA 5TK2A 4A2HA 4YSDA 2E86A 2BZCA 4FA7B 3KW7A 1AZCA 1IKOP 2HRHA 1OV8A 5FC9A 2FWLB 2J56A 1WA2X 7PAZA 4AX3A 3FQYA 2FT8A 2HZHA 2JFCA 3S3CB 5TK4A 3H4HA 1AOZA 1J5CA 4GY4A 1PLAA 1DYZA 3OMNB 2YAQA 1E67A 4G72B 4BK5C 1MZYA 3CVCA 1EZLA 1PZCA 1RZPA 3NJLA 1MG3C 4G71B 3PAUA 3FYEB 2GIMA 3OMAB 1TEFA 1J9RA 3QJQB 4FAAB 4HHGA 3UAAA 1A4BA 3FU9A 4MFHA 3QJVB 4BWWA 3WNIA 2P80D 3PXLA 2HX7A 3FPXA 2PPAA 1ZDSA 1QNIA 3AZUA 2XWZA 1E5YA 2YAMA 2AVFA 3EH4B 3FQ2A 2PPEA 4YSAA 2GC4C 2TSAA 2WSDA 3WIAA 1ASQA 3NSFA 3GXUB 1SDDB 4AI7A 1RZQA 4YVNA 3X2QB 1XB6A 4YSEA 2CCWA 1JVLA 2PCYA 2HX8A 2WO2B 2UX6A 3T6VA 3ABGA 1BQRA 2BO0A 4AKQA 9PCYA 3NJIA 5A7EA 2XV3A 1BQ5A 4JHUA 2IAAC 4YSPA 4PAZA 1IC0A 4GXFA 2UXFA 1WS7A 2OCCB 3T6ZA 3UABA 1A3ZA 2YAFA 2RACA 1NPJA 1PMYA 1GR7A 3N2JA 1NWPA 4UF7C 3EH3B 1L9QA 1L9RA 2FJSA 3RYMA 2GB2A 1AR1B 4DP9X 4HIPA 5B1JC 4A2EA 3GDCA 4E9YA 2JXMA 4G7QB 5I26A 2XX0A 2BP0B 1WS8A 3NP3A 4HCGA 1OF0A 2YQBA 2B08A 3BVDB 1J9QA 1XB3A 2VSMB 5PCYA 1R1CA 4A2FA 2W88A 1OE1A 5I6OA 1JERA 1GY1A 3BQVA 3CDZA 4HALA 1E65A 1ET8A 5I5JA 2XU9A 3L45A 4KO5A 1OE2A 1V55B 2X87A
chains in the Genus database with same CATH superfamily
2BOBA 4XCYA 2FUQA 5CN1A 5JDJA 3NN8B 2YEZA 2AEQL 1KXVC 2BIPA 3G5VA 1YEEH 4OF0A 3SYOA 4O00A 4U6XA 1K3ZA 2B0SH 2VAAB 5T33L 4I1NB 1XD1A 4G11A 5I74B 3Q2CA 1S7XA 4OCYL 2WXKA 1JRHI 2JCCE 3E2HB 4MGXA 4QKTA 4W9ZA 1UXLA 3WCYA 4DPAX 2H45A 4BD4A 2D9CA 4MHHG 1KEGH 1QVOA 4ZMOA 3R18A 1WUNT 2HX9A 4JQXC 4X5PA 2XV2A 3HRZC 2FZ3B 4HG4J 2DKMA 5DUML 3VGBA 3A4EA 1P7KB 3N9GL 1HSAA 4U0RB 4UILH 3MLWH 3TC9A 4AE1A 2Q3XA 3BN9D 3IF1A 3MKKA 5HHPA 4PRHB 4AUYA 3IVKB 1Q9LB 1E27B 5CJ8A 2UUDK 1KELH 3LH2H 3GHEL 3QR0A 4J3OH 4XPAL 5BXFB 3MUUA 3I50H 3WDHA 3K4DA 4UQ3A 2Y7LA 3O2VL 4UZUA 1BZOA 3CFCH 2VOTA 2GY7B 5F0JB 4DEPB 3QUZD 3P3SA 5JXEA 2X12A 4CDHA 3ME0B 4BK4A 3JTSA 2WINB 4OD2B 3HI5L 2M26A 4FQHA 3RGVD 1WA1X 1X5YA 5JYMA 4MYPA 1BPLB 3CQQA 5IESL 2NX5E 1VCBC 2FQEA 3L3OB 4XHJD 4ODUA 4GB9A 3C5XA 2DBLH 3MCKA 1BBJA 1OTSD 3TFKD 3H3KA 3E7JA 4DN3H 4XT1C 3D52A 1I7UA 5MEPB 2QVKA 3FU8A 5IB5A 3D30A 3RWHB 4LSRL 1AQKH 3ZDWA 3O9WC 1M3IA 1PLCA 4KTGA 4ELDA 2KZBA 4P3WA 5TFSH 1AGCA 4ZUSA 4U6VH 1ZLSH 2H8PB 5CINL 2Y07H 3KL5A 5BV7H 4XN7A 5LAXA 1KCVL 1S9XB 5EO0A 2L3BA 2APFA 2NY2D 3NDYE 1G7MB 1RUKH 4E41B 1OP9A 1V7NL 4LF3A 5MEOA 4XH2A 1M57B 3QZPA 3VCLA 5IBLD 5K39A 4DJMA 1VACB 5KTEL 5C8JA 1KBWA 2GPZA 2V8LA 4W1TA 1X5IA 2JTYA 2Y5QA 4MDRA 4NJAL 3CG8A 4D3CL 2A6IA 3POHA 1N6QH 1V54B 2ERJB 2PP9A 1MNUL 1S8DB 2B7DT 2D4DA 5F3HB 1S46A 3LKNB 3RUGB 2K1MA 3IMSA 3WIIH 1FO0B 2R27A 4A39A 2G2NA 2A9DA 2VN4A 2YA2A 5E8EA 2CHXA 3C60C 3E3QE 3Q3GA 5EZJB 1UKTA 1JGIA 3UGEA 3CH1A 1JGDB 1Z3GL 1GCYA 1ETJA 4MJ6A 5LO7A 4NP4H 3RE0A 2C3HA 3B9VA 2R0LL 1UD4A 3LSOA 3QRBA 4MXVE 3FB7B 3QDAA 3QUMH 1R5WA 2D3JA 2NY0B 2WXRA 3W9EB 1CWVA 5DC2A 5HHMD 3WTWA 1OGTB 4JJHA 5B8CB 1I1RA 5H37A 1MFDL 1MW0A 3NBNA 5FEBA 1J9SA 4NQDB 1HL8A 2EH8H 2X6UA 3MXVL 4NNPH 4YDJB 1NMAH 5I66B 2I85A 3DTXA 5DQJA 5C09E 2NYZA 2WUBL 3AMLA 4PWFA 1NGPL 1YN6A 3S4SB 4BJLA 2GBVA 3P2DA 3Q9PA 4RFEB 5I16B 3UERA 4DEUA 3FT0A 1D6EA 4X8JB 1PAZA 4XPGL 1QHOA 2H0FA 1DCEA 1RZIB 3VM5A 3LHAA 5DURD 3OD3A 4PCTA 1BWMA 2H2PC 1MFUA 5IVXB 3N04A 3BZEA 3LS5H 1NINA 3BC9A 3MO1B 2LAGB 2ORBL 1HKFA 3LAFA 3QG7L 1TETH 5C6TH 3O0LA 2BCMA 4XVSL 2VC2L 1Q9OB 2R23B 5JHDE 1CDGA 2IDSA 2Z31B 4F3FB 4Z3GA 3V0WH 4EMZA 4TPRL 2ZICA 5H94B 2OKMA 1UZ6E 3BMVA 3LIZA 3MYZA 5ISZD 2KLRA 3FU0A 2BMKB 4GAYB 4P5SA 2GABA 1KB9J 5TGBA 5IOPA 4PSPA 5E1QA 1AXTL 1T0MB 4J3OF 1F4YL 1PZAA 2VDKB 3BH9B 5D5ME 3BVXA 3GLZA 2EDTA 1M1SA 4X7TA 2A83B 5KN5A 3IRZA 3GSVB 3GBNL 4XWGL 3UAJA 5I0WA 4PJDE 5DYOA 2X6CA 3HZ3A 2WVUA 4KVCH 3FHQA 2UVEA 2I9TB 2K4WA 1IT9L 4I5BB 4PJEA 1KIRB 3V79C 4XCEB 3V4VA 4YE4H 3RWCA 4RAUB 3B9EA 1MREH 2J8HA 4Q8BA 5C7XL 5FGBA 1TZGL 1YJDH 1P7BA 2ITEA 2IDUA 3C75A 1U95A 1L7TH 4NUPA 5A16A 1TCMA 4FHJA 1FDLH 5LGHH 3SPVA 3VU2A 3OJDA 3THMH 2GEEA 4EUPA 1XF1A 2GJRA 4JM2B 1A2YA 3TNNA 1J8HA 3L13A 5JIIA 2HKFL 4NHUB 4RSVA 4UQIM 1CICB 2ZUVA 1CE1L 4GUPB 3WFEL 2UZXA 1TOXA 1JXDA 2A4CA 4KQ0A 5SWZB 4AJVA 3ETSA 4HKBA 3P69A 4P4KD 1S4IA 5IREA 2B1OA 4XB7A 1H3VA 1AMXA 5FGCB 3U83A 4IRSD 1CFTA 1OOAA 4BV1A 3RPKA 1DUYA 2CZNA 3LEVH 1CU4H 1XR8A 4HUWA 4WK4B 4CGUB 4TVSa 3HCVB 2JSFA 3HC3H 2JV6A 1OSZB 3RBSA 3V4PA 1SNRA 3RTQD 4X6CF 3RVXC 1WZAA 2ICEA 3VXQA 4BFIA 1CI5A 2FJHB 2G2RB 5DJZB 1LP9B 1SEQH 4MJJA 3ARGC 3NA9H 3MTXA 4P0DA 1L5GA 5ACZB 1F45A 3V5HA 4P46B 1BP3B 2KZKA 5IIEB 4HJ1A 1AE6H 2E7LC 3Q44A 3F04A 4I48A 1E4XH 2CR6A 3QIUA 2N7AA 4HPYH 3JWDL 1SJEA 4NQVB 1QEXA 3PAYA 3MREA 4NPYA 1AI1L 4OJCA 5DR5H 3A3YB 1T22B 3WY1A 2WLYA 1S7QA 3KJ6L 1C5DA 2AZAA 3X11A 4XN2A 1D7BA 4BH7A 1N67A 4HCFA 4DKFL 4N5UA 3F7YB 2XN9D 3U30C 4GP8B 4PV9B 2PXYA 4QTHA 1T6VN 3SPHA 2J21A 3G08B 3BEWA 1AR2A 3SEPA 5EB9A 1F6LL 3P2BA 4ZUVA 4MB4A 4Z3HA 3QFJE 3CFMA 5JW4R 2UYLB 2ADGA 2VZUA 3QQDA 5DJYB 1JIBA 2CJUH 4KNTA 4QO1B 1OTUD 1HOCB 1K4CA 3DHMA 1QHQA 4Z3EA 3PP4L 4YDVB 5K59F 4HOWA 4FLOA 1T5KA 4BH8B 4U3SA 3V5DB 1UUNA 4LMQI 3T4AB 1AKPA 1IGFL 4KRPB 3UAJC 4HKJA 3V0AC 3CFUA 1D5XA 1BD2A 3AW5A 3LPWA 1CFQB 4LPTA 5DK0A 5C0GB 4TVPE 4HKZB 4OF3A 1AR1D 4GO6B 4D7PA 1PNDA 2AKRB 5EOTB 1IUZA 1LEKA 4XP5H 3H42L 4Z7OF 4IGBD 4QCIA 4JN1H 4LSSL 2Y3NA 1S5HB 4P2OD 1HILA 2J8UB 5FO8B 3MGTA 1AC6A 4MA1B 4O58H 2Z7WA 2EDWA 4X6BA 5I28A 3GKWH 1X3DA 3KXFE 5HY9B 5I18L 1ZHBA 4G1EB 5EU4B 1V3JA 2R1WA 2VDNH 3FQUA 5TK2A 3WE6A 4JRYB 1T7VA 5CEYB 7CGTA 1CFSA 2YBRA 3WO4C 5CD3A 3CC5B 2QLYA 3WSQH 5GS0D 3O3AA 4MCZA 2BFVL 1KB5L 5F44A 4HT1H 3O9WD 2WJ5A 4ZNCD 3ARDA 4IOSD 4NO3A 4AIZA 3KLSA 4K4KA 2L04A 4PP2B 3B56A 1Q9KB 4HSAC 2FECI 1VADA 3GIZL 1J5OL 1EVUA 3F12B 3OAWA 5ALCL 5CLTA 2ICEC 5E2JA 1TTFA 3N06B 3A67H 2QSVA 3CVHH 1KLGB 1YYLL 1MG3C 2QTVA 2VXVL 4OVUA 3VSVA 2WNXA 5ICXB 1KTCA 3OMAB 4GSQA 2HJFA 4XO5A 3D2UB 2X4RA 2NQDA 2AJXH 3TF4A 2MFNA 2HFGH 2NSQA 1OWRM 5T3ZD 2HUHA 3QJZA 2HX7A 3BVNB 3T77B 3ESOA 5C3LD 3CPLB 2IV8A 4PRHD 4WW1B 2EDLA 2BHZA 2AQPA 4D9LH 1JV2B 1JWUA 1RP8A 3DBXB 1TQCC 4XO3A 5CSGA 1FVEA 5J13C 3TV8A 5IGXL 4NPJA 4W68A 1QABA 3ECVA 1UCBH 4YVNA 3KGUA 3UOAB 4O51A 4FQCL 3TGXA 3WEXB 3RP1A 1IU1A 4AKQA 1THCA 4WWKA 2PXYC 3AM8A 2KPNA 5DRWB 4JFTA 5A6IA 1WP6A 3JWDC 3VD4A 4NKDA 3OAZK 5K9KA 2BY0A 1FL3A 1IC1A 2DJSA 2IH3B 3PQYA 4JANB 1F4WH 4XNYL 4F58H 2WKGA 1M05B 3UABA 2P5EA 2Q87A 1CBVH 5DK2A 3H9SD 3CD4A 3V9FA 4XP1L 4L9LB 4UINL 5CBAB 4X5QA 3QNYA 3INUL 1NWPA 3MJ9H 2WJ7A 4BQBA 2VQUA 1A9EA 4K5OA 5LBSA 3HKFA 3GMNB 4POUB 1B0RB 1FNSH 2BVTA 2IFFL 4NO0B 3DXAB 4C47A 3MRNA 1KC5H 3X13A 1VEOA 1OTTD 2WXLA 2BP0B 3G6AB 2HG5B 4WU5A 3ARBB 3W39A 1VGKB 2C9UA 1ID5I 1J9QA 4AGQA 1ZS8B 2ZD0A 1EDQA 5DQ9A 5TH2A 2BSSA 3DX3A 2PYFB 2ENQA 2W88A 3ULVE 2R0ZL 3NK4A 2VISB 4LCWE 3ZKND 2WNGA 1I3UA 4Z78B 4TUUA 1KIPA 1AKJD 2DZEA 5KSBB 1RL1A 5IWLA 4JKPH 2X41A 1IC7H 1HCYA 1BEYH 5DMKA 5KAQF 4R97B 3IDMA 4WHTB 1LDPL 2BH0A 3GSQB 3PY9A 3MGAA 3OKDB 3X17A 1HU8A 1FGNL 3QI9B 4AQEB 4IKNA 1XF3B 1FHGA 1RIUL 3SDYH 1Q8MA 1OHZA 4GJTB 1AD0A 1RUAL 4M7LL 2J55A 3VFOA 1A7RH 2CO3A 2NY0D 5FOJA 3L5XL 2DWTA 1S9VA 2W65A 3EO1B 3EYFA 5D8JL 2WNKA 1NEPA 3ZHNA 5IF0B 3U4EB 4KKAC 1QBLH 4LSVL 2BWIA 2ATKA 3BQUA 4JREB 4BBWA 2E9IA 2CGRL 4PJXE 2DM3A 2D3VA 4LCUA 2XACC 1OF2B 1Q1PA 3Q8EA 4TUKH 1MCPH 1UJ3A 3O2VH 4N2NA 1IAIL 1UZ8B 2NZ9C 1GMEA 1UWXH 4ANVA 2VLJA 2XG5B 2E4TA 4G6JH 4WO4A 2ED7A 5EBMB 3FQWA 3BT2H 3MBXH 5TD4A 1J48A 1SGKA 1WT5A 1KEMH 2ZXAA 3TXAA 1WBXA 5FYJD 3ZR6A 5D2NA 1FG2B 4N2IA 3R4RA 4PJ9A 4NT6A 4ES8A 4WSJA 2O5XL 4BGDA 4NN5B 3K4AA 3FCBA 3K6SA 4JFHD 3I3BA 3SQOL 2HMIC 4OM0H 1T1WB 5IQNA 1EAOA 4PUBH 2H6PB 3C6EA 4Q6IB 3BWZA 2X6VA 1E9QA 2HH0H 3CXHK 1WCBA 5JIMA 3NSYA 2WKOF 4HWBH 2AJYH 5AD0A 3MNDA 3WGUB 1EDHA 4JPKL 3CZUB 3DK0A 1ZE3H 4DKDC 2G3MA 2XZAL 3RX9A 5C0FB 1SEBA 5KS9B 5DC4B 5K9JH 1J1PH 1JF1B 1YMHB 2FRGP 5CINH 5D72L 3MMEA 2Q86A 1FFPA 4EBQH 3D3VA 1KCVH 1W0YT 5FECA 2R69A 5SWSB 1Z32X 3VI3F 2OLDA 1N59A 4RA0C 3KPNA 3L4TA 3QB7C 4MZ2A 2UX7A 5DDHA 5DMGC 3FH5A 4EQ3A 1U91A 4EDWH 3TNMB 3V8CA 3X14B 3N41F 5LAPA 2WWMD 5FO7B 5C0AA 4YLCA 4E68A 3WKQA 5IJVA 1E6OL 3O6KL 4GRLA 1JUFB 3SDCA 5H37H 3KVDD 5E8NB 1ODAA 2PWHA 2QR0B 4P2RA 2DWDB 1LO0H 1D5ZB 1I8LC 4JM2D 1OCCB 4DOHE 4PMFA 4Y88A 2YGQA 5IWLC 2Y5TA 4M1DL 2J71A 3UCQA 5B3SB 2BZDA 4XO4A 1ZLDA 1YLBB 5DZAA 2LHAA 2Z9TA 5SWZD 3M17B 4AT6A 4G42A 2LVEA 4G6AC 5E00B 4PGEA 4FJ6A 2C1OA 1PCSA 3FFDB 4KK5D 4MDIB 4BE5A 1TXKA 1NPUA 4D0CB 4RGNB 4UANA 1PBYA 5GSRB 4F2MB 3VQ1C 1YY8B 1UT1A 2CKBH 4WGWB 1EJ8A 3GT6A 3X12B 1NL0L 3MR9B 2QADC 4BFEA 3NK3A 5AVRB 3V4UH 4LEXL 1TZIA 1UD5A 3SOBL 1MQ8A 3DV4B 3LIZH 3PUUA 3PCYA 1AO7A 2B3IA 5CCKL 1OALA 1D7DA 1Z66A 3WHXB 4AY0A 4AYBA 4BELD 3GYRA 4X99A 1UT9A 5F7FA 5F93C 4P46D 2HJKB 2DQIH 5DVOA 4WO4C 2HT3C 3F7PC 4JMXA 2VZSA 5D1QA 4DCQB 1MCRA 4RNRA 5BVJA 2HRGA 2YUWA 3TVMB 1P69B 5D2NC 4PJ9C 1GTFA 5JZ7C 2F19H 2EO9A 2HXAA 2HKHL 1JSYA 3PJLA 4PBDA 2KQMA 3V4VH 1R3LA 1JZ6A 1O75A 1Q90A 3LD8B 3O0RH 2DD8H 3ARZA 4UDUB 2IAMC 4NO5A 5JHLL 1D6VH 2P5WA 3CK0L 1AGEB 2WYTA 4UQAA 4PRIE 4WFHD 1Q9WB 4FXKB 2OX5A 2YOAA 3SBWA 4MMYA 2PYEA 1OANA 2IPUG 4BKTC 1KJMB 1U0QA 3IBEA 4K94L 1FVCA 2Z65C 4P2QA 4QOKD 3IMWA 3D87B 4NZUH 4UU9B 4YGVA 3RU8L 4MS8C 1KFGA 3WN5B 2BNQA 3MZTA 2BM3A 3UBGA 3BUTA 2W81C 4BM7A 5IROD 1P4LB 3L3GA 3MLZH 1LGVA 3OWEA 4KRPD 3Q6GH 4QYOA 1BZ9A 1GPOL 2Z7YA 1NUFA 1TLMA 1EWHA 1KYDA 2L8AA 2ZPKH 4PJ7B 3FRUB 1HE8A 2PUQT 4MJ5B 5EEYA 4E0RA 2NRDA 4DETA 3W9DA 1MXGA 5D1XE 3BRGC 1A64A 4C54A 1NGXB 3VD0A 2NW3B 4K3HA 3V4PH 1CD1B 4GRLC 4ACTA 3SDCC 2BCKB 5IR1B 4LEBA 3BT0A 4G8GA 5J12B 5E6IB 3ZUNC 4K8RL 4IKLA 1NDMA 1SOKA 2CALA 1F6AB 2IWFA 4QWWD 2P8LA 2NY3B 5KJRL 1XGYL 2OBGA 3CX5J 3QWOA 5D6CB 1PNCA 4YHZH 2BC4A 3SCMB 4DUWA 5KBKA 1XF4B 3FPYA 4WNQB 1IC5H 1EEYA 5TQ2L 1SXZA 2SODB 1UQSB 1FHNA 4X5XB 4XXDB 5B39A 5HPOA 1TCRA 3TH2T 3DUUA 3GI9H 3VXPB 3R06B 4P06A 1VZHA 5K1JA 1AZUA 1HSBB 2CLVB 4NWTH 1OAQL 5EFIB 4KK8C 2EAEA 2OR9H 4N0UA 4U7SA 1ZGLB 4LVHC 3R8QA 5LBVA 1DQKA 3QHZH 3HE6B 1O7DC 3QXUA 1G0YR 1JPGB 4PHXA 4WTZA 3CFEB 4RRPM 1QSFE 3NA4A 3JWNG 2KBGA 2XLLA 4WUUE 4Y4HC 4GKOA 5GJTL 1QA9A 1P84K 4RBPK 2Q7AA 1YEFL 3D2UD 4UB0L 2BFGA 1OP3H 1MCLA 1ZVNA 4P5TC 1ZS2A 1R24B 3LPGA 2CJSA 4RH4A 2FBOJ 4AM0A 4PWEA 2FO4B 3ARFC 2SEBA 2D8KA 4K73A 1MCWW 2EIKB 4HIEA 1Y0LB 3QFGA 3TIEA 2AJ3A 2Q5BA 3P30L 4ZFFA 2P8PB 5FYJU 1PG7W 1ZT4B 1FZOA 4WV1B 1HFUA 4F7KA 1RULL 1O9VA 4M6MH 1ZVYA 2X1OA 4PI0A 1OQOA 4PRBB 3SBWC 2BZ7A 1DVFB 5E24E 1KCKA 4A6YA 2BW4A 1XWVA 2KKQA 4L0PB 5G55A 3WY3A 1IAMA 1I3GL 2BRRH 3B2MA 4OZHA 3DVIA 3WIHA 5CBEA 5LNGA 1TYEB 1INEL 4PJEF 5CNHA 1PYWB 4EKJA 5HD8C 4EVNB 3O4OB 1PX3A 1HQ4B 1HYRC 3N55A 5ECJE 3DXAD 3F5WA 4GAAA 4DP2X 1WDAA 1A6VL 4Y9EA 5EO1A 5EBWA 4ZD3H 3CDZB 3FO1A 3MFFA 3QULB 1MRCH 3ZRSA 3ARBD 4IBSA 4EPSA 5IJBC 2Y4SA 3EHBB 4LSQL 2RMNA 5E1GA 4JFEB 2X4NA 1N6UA 1UWYA 3VDBA 5C0IA 3F7RA 4XMTA 4WEBH 3ESNA 4TNEA 1MDTA 1KG0B 3JXAA 3UC0L 4MD0A 4OQ1A 4CUCA 4M8VA 4UIKH 1E2VA 4GMTH 3VXUB 4MAYA 5KVDE 4IOIA 1RJZB 1PX8A 2R9HC 1JFQH 1FPTL 2J44A 4JFPA 3ARXA 1RUML 2QSQA 1LMIA 3Q8CA 3ZTEA 3NDZE 4AX3A 3AU0A 4DO6A 2R2EA 5IMOB 3SGDI 1IGCL 3QI9D 4K8RC 4NDMA 1CLZL 2BP3A 3OGOE 3PFUA 4XAWH 3VFPA 4MQTB 3IDNB 5DMGD 4OLEA 5HJDA 4X80L 4M3JA 3OMNB 3GRWH 4U3XA 3C6SA 5F21B 2NLJA 3GI8H 2F5BH 4CSTA 4NN6B 4W81A 1ULVA 2FB4H 4XI5C 3NJLA 5FFLA 4AJ0A 4KY1H 3HZVA 4CKQA 1TIUA 3HNVL 1MHCA 2ZOTA 3UTQA 2QSCL 5KYXB 4ZMYA 2O72A 2ZXEB 4M8UA 5GGQL 3REWB 3SGEH 4D7BA 2YGOA 4BWWA 3CXDL 4DKEH 2F8IA 3PXLA 2VLKE 3HUJA 1HH9B 5CJ5A 1Z9SB 1G7JA 1U92A 3EH4B 4XX5A 4B3EA 4F9PC 4AJWA 2DMKA 3F65A 1KULA 4PP1C 4Y2OB 5LBSH 1Q0XL 2CHNA 2W38A 4EXKA 4G6AD 4YHLL 1UOVA 5I19H 3PV7A 2EYSA 2NTFB 2VR9A 3PYCA 1T20A 3F84A 3DC0A 3K1KC 4KAQL 4YHPA 5FYKL 4PIRF 3ZO9A 4BFJA 3LPFA 4DTGH 1E50A 3HFMH 2DQJH 4JO1H 5FPIA 2FNBA 4JFQB 4JJOA 3REVB 4APXB 3CFNA 4GG8A 1JZ7A 5J56B 1EMTH 1RJYA 3FCSB 5C07E 5MENE 4CVZB 4LOUC 3IDGB 5EOCL 3O3UN 2XFXB 4URTB 1E3FA 4WCYL 5AVTB 2AV7A 2DLEA 5FA3B 5SWSD 3V55A 2CR3A 2EXWD 4IKKA 5JW4N 3U82B 5MERB 4CMMB 1K2DA 1SPDA 1X7QB 1QFHA 4HKXA 4KKLD 3VQ2C 4ODVL 4LLUA 3FO2A 5DMIH 4KXZH 1O6VA 2NCEA 1U8HA 1YEKL 2BNRB 4ZAKC 4JFDE 5JZ7D 1UWFA 1P4BL 3BKYL 2WLLA 1KFAH 2D3NA 4N2GA 2ITDA 4I9WE 1OAKH 1E4HA 1I7ZB 4ZFZB 3T65A 1F6FB 2IAMD 5KVEL 5BV7B 3KPLA 4YBHA 2J5LB 3RJQB 5F7UA 1E65A 4AK1A 2XU9A 4PRPA 2RB8A 3VFMB 5IB3A 5HGAB 2YQGA 5AYUL 2FYYA 3LXUX 4LDEB 4Q0XH 1UB5B 5EDSA 5I1IH 3GUFA 4FA8A 2ESVB 3UBFA 2ICWJ 3L3HA 3LDBC 5D7LB 4WI0A 1IQDB 4M8QA 2A9BA 2AI0L 2QQLH 4X6CB 2DLGA 5DZOA 3FU7B 2APWA 1RCYA 4PGCA 5FYLE 1MJ7L 3PV6B 4UYQA 2JIXB 4M4PA 5DHEA 2YLKA 5KJ4A 1XVSA 4HZAA 2D31A 1RIVL 3B8YA 4RZCB 3V0VA 4L18A 4PG9A 1M7DA 1G7IA 4RGND 3PP3K 3F6JA 4JW3A 1PZSA 1MF2H 3L2LA 3BGMB 3RDTA 1L7IH 4NB7A 5CHNB 5LXVA 4OGYL 3QUMB 4PGBA 3PLYA 2JKWA 5HGHA 4YHKH 3EBGA 5LQBH 1V5JA 2MKLC 2HAZA 4Z7UE 1GGBL 3IDYC 4HCIA 3RA7L 3X1GA 1JNLH 1MRDL 2AZUA 1ZK5A 3ZQXA 1U58A 4KXBA 3RX8A 4CILA 4CVUA 3NPSB 4GKNA 4YJZL 2Z91A 4C4BA 2R69H 4TSBL 1B4LA 1OB1A 4OD3H 4QRRE 3TH4T 3NFSL 3W1ZA 3K71A 3RWEA 2EKSA 4P2CG 3SKJH 1D9KA 4NSKB 3TVMD 5EU6B 4MZRA 1IARB 3D7PA 4UT7H 2DV6A 4PN6A 4WFED 3ZRCC 4PJGA 4A68A 4DHLA 1MJJB 2DEXX 3HLAA 4XBEH 4GO9A 3JUYA 1BXAA 5TDNA 1NGZB 3PWPA 2FBJL 3CLFL 3O45A 4LLQB 2EYTB 4GPVA 3HG1B 5HJ3A 3AXIA 1KMGA 3IJSA 1JNHB 3O6LH 3F2LA 1BF5A 5F6IB 1I1FB 3KYOA 1WIPA 1NIFA 5CZRA 2MHAB 2Y6SD 4ATTA 2WKLA 4PBVC 2VDLH 4YPJA 4YNYA 4C83A 2JMRA 2H6UA 3OKMB 5I6KA 2HT2C 4Y5VA 3RFZA 1R5VB 2IWKA 2LV4A 3GF8A 3JUZA 1E9OA 4NUJB 3C5JA 4L1HA 4Z7OB 3KJ4C 5IBUB 1H6TA 4P5TD 5AW1B 3SBQA 1DBMH 5IK3B 1ZDQA 1XBDA 1MCJA 1YEDA 3TPKA 2F8VA 1SMDA 5E99H 2FEJA 4OTXL 5EC2B 4TTGA 2X1WL 1I8KA 3WEBA 1BZ8A 3U0TA 3U9UA 3V0GA 2WYIA 5GXBB 2I60H 2C4FT 4JHAH 4MJIB 4LCCC 4ZODA 4UV7H 1B9KA 3D39A 3DI3B 3HJ0A 3RPIB 5DJ6A 3GHPA 2Z93A 2AK4B 2Y0SA 1N64L 2D7TH 2DIAA 1OGAE 3EOAA 4Z3IA 1KBGH 4FHBD 3CSYA 3UO8B 5E6ID 3KPOB 3MV8B 3AACA 4PJHA 5D7HA 2FBRA 4KFZC 1MSPA 1RHHA 5FA4B 1A3LL 4PJ5B 3WFBH 2NY3D 4RDQF 4F2FA 2OFQA 5FDWA 5F2FA 2IGLA 4OAWB 3RZCC 1QKZL 1VCAA 2VDQH 3SCMD 2VJXA 1QEWA 2B8OT 1J88A 5A2CA 1BM7A 3GXIA 2EVIA 5C0EA 3BPNB 2ZCHL 3QCTH 4U6YB 5TDOA 1ZPUA 1FZJB 1QUNA 1XH0A 3ECUA 3U2JA 1KV3A 1OCRB 2Q7NA 3SO3C 2C3XA 2YD3A 3PE9A 4QJ5B 1BF2A 2AFNA 2WUCL 3CZSA 2XRAL 3T1FB 4P2AA 4AEIH 3HE6D 2H32A 5AB1A 2V7NB 2ZXQA 4G7YL 4OJFL 2JVUA 2Z1PA 2WMPB 3RB5A 2NSMA 2XV6B 3MRGA 2OJEB 3HN8A 3PDGA 2COQA 3S37H 4PWJA 1KDIA 5IQMA 4QYAA 2HFEA 3UZEA 4BCYA 3HC0A 5C9JA 3QEQD 4JY6B 3VYNA 4AYMC 5A7BA 4QI3A 1IKFL 1EXUA 4YAQB 1M56B 3F64A 2IBZY 2R7EA 4ZSOA 5T1KB 1GYCA 1YNKH 4DW2H 4ZDHB 5HDWA 2Z4TA 4GQRA 4MCNA 3F58H 1JZJA 1S2EA 1AH1A 1F0LA 4R0LB 4E9TA 3V6ZB 4XPFL 1D9KC 4MNQB 4UM9A 5HYQA 1YQVH 4GBXA 5L2KA 3H4FA 5DHYB 5JORA 2H41A 3QQ4A 5I1HH 3WNNA 5CSZB 4KZDH 4FLHA 1CVSC 1S78C 4OCXL 4YL4A 3DSFH 4Z77B 2Z7UA 4XO8A 4R4BB 4NM8H 3BIKB 1XCXA 3T3PF 3VB8A 4J1UB 1WFMA 1H6UA 1DVFD 3KWWB 1Y07A 5I6XC 2ZP9A 1BOGB 3W56A 3IU4H 2A6DA 4FYSA 3OXRA 1B2WH 5KZCD 1W8EA 4Y16B 4Z95L 4I18A 3DO7B 2WBJA 1QHPA 4Q2ZB 5ABDE 2PW1A 3LXBA 4JG5A 2ZWZA 4Y5VC 3LPOA 4LKCB 4RCAA 4AYSA 4UTAL 2JCCB 2AQNA 3IFOA 3WXVL 4K71C 3FB5A 1MFBH 1CK0L 3MRCB 4LEOB 1TKWB 3EGDA 2W95A 3E6HB 1FYHB 1RK0B 3SKMB 4B27A 2Y1YA 2MTAA 2OMNA 3U0WL 2E8YA 1GS8A 2ZUUA 5DD6A 4MDJA 3WLWC 3UBXB 3GSNA 1FYTA 4UTAA 4TNWK 3B6SA 4ICWA 3O11B 1TITA 3EHBD 3EBHA 3EYVB 4MA8L 1B4JH 4JFED 4K23L 1IEAA 5HP5A 5IV2A 1IBFA 1XH3A 3ZDZF 2NDGA 1AC0A 3SJVA 4D2NA 4XNXH 2GJZA 2VW4A 5JPNC 2J1ZA 1OAQH 1J11A 2OMXB 3C8HA 3NGBB 4TUJA 4M5ZH 4KMTH 3O41A 5I8KH 4LK4A 1PY0A 2X9XA 1IJNA 2QMKA 3WTUA 2H0PA 4UWQB 1AS7A 2I5YL 1OB0A 3KPPB 4KJQC 3VXME 1WG3A 4QTIH 2G75A 1R3HA 4FQXB 2VDNB 4NGHH 5GGSA 1U8MB 5E1IA 1X5XA 4ZNEA 2ZP0T 4AYID 3SOTA 1C12B 1QBMH 4DVRH 5GGVH 4PGJA 2CLZA 5IMMB 1VPOH 5AVWB 1ERNA 2XWTB 1BW8A 3F05A 3U6XA 4GKSB 2H2SC 4FNLL 2DLTA 4X9YA 3WNLA 3BFOA 4V1DE 3STZA 5ICZA 3GIVA 5A2AA 1AIFB 5IEKB 3GK8H 3AQXA 4FDWA 4IDJH 3ZZSA 1CL7I 4KDTC 4A6YH 1TR7A 1XV8A 3HVDA 2XWBB 3FQ4A 1JN6B 1WC7B 2IWEA 5CUSL 3A0OA 3TBSA 2X2IA 2XPGA 3CVHB 3H6AA 5DS8B 1C8QA 3WIHH 2NT0A 5E6ZA 3GBMH 4KROB 5I15H 5I1JL 4XCFH 1UH3A 2BXYA 4ODBD 4Z8FH 1BF8A 3T2LA 2BVYA 4HUVB 4GBXC 3OLEA 5ERWB 5EUOA 1E5BA 3MX0A 4H26A 3J2PA 1QFWM 4HUUA 5FYLH 3U1QA 1T1XB 3HG3A 4Z7NF 2YGNA 4J3OD 5ESAB 1ED3B 4MMXA 5BZWB 43C9B 4A1RA 4OF8A 4RFNC 4PS4H 3VI3B 2ICWI 4HJUA 1GKOA 2G4EA 2A9ML 1FL6A 5TF0A 2YK1H 3KLAB 1D5IH 2BP8A 3P3UA 3WI9A 2XXMB 2YFOA 3NRFA 4ZBJA 1BVNP 5T1DH 3VSUA 1XT5A 4I18C 1SM3L 1XGQB 2WBJC 1CLOL 4TKWA 3QWRD 4F27A 1U3ZA 5E7BA 2Q20A 5PAZA 3H2PA 3BUPA 1T0NB 2F68X 1VSCA 4KKNA 4QRQA 2VXUL 2DQCH 1I75A 3L4UA 2G9HB 3DARA 5D9SB 2UXTA 2X7LB 3NIGF 4FG2A 2W59A 3S3JA 2BNRD 1G7LA 2MNUA 1E5ZA 4ICXA 5I75B 3VDAA 4FFVD 5ETUA 1E0OB 1CYWA 3NJNA 1GTNA 1C5BH 2DOCA 3MLYL 1TU2A 3PPSA 5CJQL 3G5VB 4Z7QE 4JVWA 3U4BL 4M1CD 4KKBC 4U6XB 2QV4A 1J1OH 3BUYB 4MAUH 1GOHA 1GYWA 1B9ZA 3CQFA 2XNAB 1SY6L 3KW7A 1CDUA 1KJVB 2MKWA 4FZEH 4DGIH 1R3JA 3OZKA 1FCGA 2HLAB 1JGEA 4PW3A 3QDMA 2ESVD 4F8OA 1QVOB 1RFDH 1VFUA 3D85D 5D7LD 3EGXB 1B0GA 3HG4A 3TZVB 3S3CB 3SN6N 4B5EA 5A6LA 5TK4A 4R90L 4FADA 2DMGA 1ANUA 3LX9A 4GY4A 2MWCA 1NEZG 1JCKA 15C8L 1HSAB 3QGVA 1E67A 1SY6A 5HHPB 1GSMA 1A1OA 3IF1B 3LOWA 4MMZB 5D5MB 3ZMNA 1B4RA 2JIXD 4W9EC 2DLHA 3VGEA 3WUZA 3O3DB 4N24A 1DE4A 3E3QC 4ADIA 2XKSA 1NFDE 4L23A 3U7YL 5HPMA 1YSOA 1K8IA 1N19A 3MRRB 4L29A 4UQ3B 4UTBL 3ZT7A 4RMUA 3WELA 4LBAA 4Y19A 3QA3A 3UTTE 3EGSA 3AZUA 3BX7C 4HJ0C 4OI8A 4XR8C 1NCUA 4HBCL 1R0AH 4M56A 3WS3B 2AVFA 3DA0A 4FQHB 3VD3A 3B2UC 3QO1B 3DBSA 4KMLB 4PRDA 3S34H 4YSAA 4V33A 2ZKXA 3HHRB 1E43A 4HMDA 4HFUL 1MLBA 1RV6X 4NCC1 4JFOA 5EZOL 3MUY1 4K7FB 3OKNA 4KPHL 2NCMA 4G9FE 4NN7C 1YNTB 2PTUA 4H13C 2HX8A 4ODUB 1PKQA 5D1ZA 1YCSA 1BBJB 3MCKB 3DRQA 4LCVA 5EU6D 4JJ5A 1MXDA 2O5YH 4OH2A 1I7UB 4IBLT 2APTA 5HHXH 2X4SA 1IFHH 4GRMA 4S1RH 5IB5B 1YYCA 4EO5A 3OAUL 1W72A 4MMXC 2VWEE 4XBPA 4O02L 5J3HD 5F70A 1YPZE 5BQDA 4OZHF 4M6NH 4N2HA 2VDPH 4KTYA 1NPJA 1PMYA 3AT0A 5LAXB 1JHLL 5EO0B 4UF7C 1LE5B 1CO1A 3QJXA 4N2BA 1CQKA 3QDJE 1TZ8A 1LK2A 1A6WH 4FI8A 4DZBB 1YQ2A 5KJ7E 4KNQA 4A2EA 1HHGA 1EV2E 3X3FH 1KNOA 4IRZA 3CHSA 4LDOB 2XA8L 4PGDB 4JK0D 1BAFL 1BFVL 1NM4A 1QRNE 2DJ4A 2Q10A 4TVPL 4IU2B 4XPTH 4C55A 3QPXL 3FT4B 1WH0A 1QD0A 3H8NA 1MY7A 4L8CA 1JNNH 2Y2TA 4P2YA 1ZOXA 3NH7H 3SE8L 1P2CA 3Q2NA 3ZKSD 3SYQA 1BG1A 4KVPA 5E8EB 4NP9A 3BQVA 3Q3GB 4R5XA 4FKEA 3VD7A 1MY5A 1DHKA 4MJID 1YEHH 4RFOL 4UZGA 1S78D 1CFMA 4LBEA 3WLBA 4NLAA 3BJ91 3KH4A 2AK4D 3L45A 4MJ6B 4R5TA 3LSOB 1G43A 3U0PB 2DYPA 1R5WB 1FH5H 3FU5A 5KUKA 2EH7H 3MV8D 4Y4FC 3WD5H 1AXSB 3HKZA 1E8YA 3GBEA 2WYZA 4O5LL 3RI5K 4PJ5D 3SYCA 5F7DA 2LLNA 1YMME 4KK9D 1YEIH 2VQ1A 3EYQD 4OB5H 1T1YB 3QFJB 3JWNE 2X9ZA 4HUKB 3KXFA 1BIIA 4U4IA 1BYPA 5DQJB 1TJGH 4P9ML 4JO4H 1SHSA 4N8PA 4PJIE 3RG1C 1GYUA 1KT2A 5FFGA 3QUYC 1JYNA 3I84A 3EO0A 5LG1A 3A4DA 3OV6A 1NBCA 2A73A 1NLBH 1AZBA 4H0IA 5K93A 3HUJF 3QIWB 4U1IB 3B9KC 3UYPB 1W8NA 4FYRA 1QFOA 3MLUL 4KOBA 2CKBB 1IO4C 3DX9B 3KZ8A 1XZ0A 5FCUH 2NXYC 4QXGH 2GEQA 2YOCA 5T1KD 1OKEA 4QRUA 3NIFE 2BWQA 5IOPB 1FORH 4IW4C 2NY4C 1WHPA 4Y5XA 5D1ZC 1IM9A 4X7TB 4KJQD 1LO5B 1W6WA 3P0GB 4MNQD 1I82A 3ZYOA 5LKNA 5CJXC 5JIPA 5DYOB 4CRPA 3FL7A 5DWUH 3WFCH 2IANA 5FOBB 2WZ5A 3TTSA 1ZANH 2CMRH 3QO0B 2ZOLB 3IN2A 5CLZA 5T1LA 3V4VB 2YBGA 3K81A 3RWCB 3WBDA 1XGUA 1TQTA 1P5VA 5AEAA 1FRGH 5AL8A 1CLVA 1Z6JT 3FOMA 5E9DE 3LRSA 1U95B 2NNFA 4Y16D 5A16B 4DESA 3QSKB 4YE0A 4BIKA 3K6NA 5DUPH 1DP0A 3TNNB 1J8HB 1FL5A 3T3ME 4A67A 1FSKC 4IJ3C 1KV7A 1OE3A 2E27H 2UZXB 3DX0A 1MWAL 1RUQH 1K5NB 1L9MA 5J06A 1GIGH 2RCSH 5I1GL 2XWJA 3BWUC 1G7PB 1ZA6A 4RX4A 3VI4A 4NENB 2NUPA 1MW1A 4JAMA 5HYSG 3ULVL 1NC4A 2H32H 3QUHA 2WBWB 1MPAL 1CYGA 5L4FA 2PO6B 4AUJA 1DUYB 4ZMAT 1SJXA 3E8VA 1MWAA 1CC3A 1XR8B 3AADB 1KDJA 2F6AA 1P4IH 4Y2LA 3BKJL 4IBZA 1AANA 4NZRH 3V4PB 2YGPA 3CLEH 2X2JA 3FSVA 1ZT7B 4DP4X 4X7SL 4X7DC 4BFIB 5D2LA 2A6KA 1I9IH 2E7DA 3SE9L 1LK3H 3VWKB 2NZIA 1ZGLM 1L5GB 4NBXB 5C2UB 1ACYH 4PLNC 3TO2A 2J43A 3V5HB 5JA9A 4FQXD 1CDHA 1ZAGA 5IB1B 4FFYH 2IH1A 5FYKU 4I48B 2YLHA 5AWNL 5J8OA 5AZUA 2EZ0D 4PJAE 1X44A 3QIUB 4ZX4A 1R4XA 4IBYA 4FRWA 1SJEB 2V5MA 3UGUA 4RWHA 2GTWA 3MREB 3EXJA 1OWWA 5EBGA 1IEBA 3VXRE 1S7QB 2JK5B 3S3PA 1D7CA 2Y7MA 3ARPA 3KVPA 5EA0L 4H2CA 2V6HA 3S37X 4G43B 3QCVH 3OKOA 4BH7B 1Z2KA 5KVMC 4XVOA 2PXYB 1YECL 2ZWLT 3BEWB 3ZQ9A 2AV1A 5CXPA 3JVFC 4GMSL 2ADGB 4OCSH 4Z7VE 2MCPL 5B38B 5JW3L 3QQDB 4KROD 4PJGF 4N9GA 5IJDC 4FLQA 4Y5XC 3GEWB 4AH2A 4G83A 2DM4A 1GGYA 4U3SB 4F7CA 1PL3A 2WOBA 1UEMA 1OSEA 1T4WA 1UKSA 2A0LC 3QK0A 4HF5L 3AXLA 4HKJB 1T03L 5K9QI 1BD2B 3C09C 3GSNH 3JBG7 2I26N 3C9NA 5DK0B 1FAIL 5AKRA 1XDTT 1MCNA 4HUNB 2Y24A 2KZ1B 3LCYA 2GC7C 5AOKA 1OP5K 1FAKT 4ONOA 3SQBA 1TJXA 1GZQA 4QCIB 1JDCA 2B4CH 1H8OA 2NNXA 4NQEE 5IVZA 4R84A 4CN4A 2F74A 3MGTB 4OCRH 4X6BB 1VENA 4ZI8A 1VEPA 5FM5M 5KVGE 1BAGA 3DOIA 3CHRA 5HVFB 5DZLA 3BAXA 3SGKA 2R1WB 2CM5A 3WE6B 5A2JH 4MNGE 2AGJL 2VM3A 3HHSB 4G6KL 4JY5L 5C09D 3QUKA 1PFCA 1CFSB 4N1CA 2FWSA 2YBRB 4WDIB 5CGTA 3UDWA 3ZBMA 1RI8A 1PPIA 2QQKH 3O3AB 2G0LA 2WQAA 1L9OA 1X5JA 3QVAA 3ARDB 4NO3B 1CGTA 3GMOB 4AIZB 3U2IA 5IMLA 3KPRE 1JD7A 2H26A 1S3KH 3QZBA 4HX1B 4LRNL 3CFDA 2XZCH 2EEXA 1F58H 3IEAA 4JB9L 4LPXA 5JDSA 4OLWH 3TT3L 2NY1C 4FQJL 3S88L 4J6RH 3VWJB 3GXNA 4JPWH 3MLXH 4GLRH 4JVPA 5C92A 2BSEA 3TZVD 1NBZA 1U2YA 2HVKA 2X4RB 3TJEH 2Q3ZA 4Q56A 5AAMA 3OL2A 3QHFH 3VFGH 4Y5YA 4MXQC 1D3CA 3NESA 2VDOH 3U7WH 1M7UA 1T1ZA 2GJPA 1GGCL 3G7TA 1GRWA 1IKNC 4HHWA 1JWUB 3K8LA 1HQRA 1QZ1A 1NCCH 2YXFA 1FVEB 3EF4A 1IZJA 4J3TA 4XC3H 5D4JA 3APCA 1PTZA 3FJTA 3CN0A 4CW1B 4U1GB 2XOTA 4G8EA 5TE6H 4NUGH 2UY7A 3OHXA 3FUHA 1E5CA 1QTPA 1UACH 4WWKB 3GJFK 4RISL 5JO5B 4IKIA 2Z64C 1V7MH 3QEUB 5D7EA 4NX0A 4RWYH 1UXWA 5F71A 1J5HA 2VDRH 2GUYA 3NCWA 5K9KB 1FL3B 2FIKA 2WC7A 3PQYB 4H88L 2ICCA 4KI1A 3EFFA 4LSUL 2C9QA 4F80A 4NWUH 2UUDH 1P5UB 2DM2A 2Y36L 2R0WH 2GT9B 2K9UA 3L3JA 4YHIB 5DK2B 3QNYB 3N44B 1AG6A 3MV7E 2K6WA 1BQLH 2TRYA 2ZCKL 3AT9A 4Z18A 4Y4KA 3OZ9L 1AS6A 3QUYD 1G94A 3ARYA 3IPBA 2HN7A 5J1TC 3F7LA 2VMJA 3X13B 3DDGA 4AL8H 4WU5B 2VR7A 1VIWA 3VFVA 1E7VA 3W39B 2ZF9A 3TBYA 4Q9QL 5TDPA 4BQ9A 3N3EA 3T5WA 1OARH 1P9MC 1UM6L 3MHZA 5TH2B 3WTXA 3KNBA 2XBDA 1F56A 4PY7A 4W9GC 2P45B 2QKIC 3HRPA 5F7MC 1E4KA 43CAA 1KIPB 1NC2A 4HU8A 1U8OA 3RIAK 4YQXH 3GSXA 1IE5A 5IB4B 3OG6B 4K9JA 4ZS7L 3FT3A 4TSCH 4ODTH 5CILH 3IDMB 3GDBA 1ZHLA 1P0SE 5AOLA 2OZNA 2EACA 4Z0BH 4GT7A 3BGFC 1ML0A 1CFNB 1F11A 4YSDA 1T80A 1U4FA 4B9PA 3VJ6A 1AD0B 4CL7A 3VFOB 4BSWA 4ZZFA 3FCGA 4OZGF 5JXAH 2RIKA 5KEZA 4OD1H 5GGTH 1HXKA 1S9VB 2W65B 3EYFB 1ZTXE 3QZOA 4W9KC 1Q1JH 3H7LA 4EOWL 2MPAH 3PUCA 5EG6C 3JZ7A 4FL4C 3V7AE 4NKOB 1TPXB 3BQUB 2ATKB 1KGIA 4XP4H 5CZXD 2JELL 4EI6A 4A2MA 1IAOB 3FO9A 2BVPB 1PLAA 3QFJD 3IWUA 1S7VA 4ZTOH 1UJ3B 1L0PA 4GW1A 4W9IC 1N0LA 5AAMC 4PCKA 2CHWA 2VTFA 5E6UB 3K72A 5GS1B 1J9RA 4FAAB 1VAHA 1JPTH 4W9LC 5FO9A 3BPOC 1W15A 3L4WA 1WBXB 3AWFA 4OLYL 4MFHA 1W72H 2B1HH 4NT6B 2JJTA 5IP4A 1KIUA 1CTOA 4FFZA 3A22A 3L9EA 2PWDA 4X4ME 3QIWD 3UTSE 3ILQC 5CLXA 1QR1A 2XQYG 1M6OA 5T5NF 4WI8A 2QVTA 1DUZA 3BAJA 1WCBB 4LHUA 3LH8A 5D1XB 1AFVL 3QORC 3IDUA 4BYHA 4DGYH 3VTMA 4EDXB 4XTRD 4XOCA 4NS0A 5IFAH 3DK2A 4J12A 5EUOF 1SEBB 1BQRA 1HHKA 4IRZH 4KJYA 2QFRA 1WGVA 4LASL 4ZMLA 3T3PB 2BRQA 3UXFA 4FG6C 3MMEB 4PAZA 1FFPB 2Q86B 1HK6A 3IDIA 4QT5A 1B88A 2FJUB 1WS7A 3WEMA 4N2FA 4NC1E 2IADA 1GC1L 2IG2H 3T6ZA 3I75B 3KPNB 3UH8A 4NNXA 1RZ8A 4FNPA 4F15C 1N4XH 5DDHB 1KXTA 3H9ZA 5ISZE 2X5PA 5T1MA 1GR7A 4X5RA 4R2GB 3VFRB 1MAKA 1RIHH 2WYHA 5CR1A 3UAFA 3MRMA 4JQIL 5ICYB 3UPCA 2DQMA 3SZKC 3V95A 2NW2A 1NSNH 4RFOH 4WUUB 1KUMA 2Q2LA 2O4EA 2VDLB 3FC8A 3WKYA 2GYSA 3WKMH 2Y5TB 3ZDZB 5D7IE 2OR7A 1L3WA 1CF8L 2FWUA 1HZHL 4J4PA 4AT6B 4YBQD 1LXMA 5AVZB 4G42B 3MBEC 4ELKA 3CIAA 5I5JA 5L88L 4KRNA 4PGEB 4G8IB 2F53B 2OMYA 2C1OB 4HJJL 5F7BA 12E8H 2WLKA 3GC3A 3ES6A 2PO6D 1AYRA 4FFWC 5KVDL 2DMBA 2YMTA 1BZEA 1MUJA 1KBPA 1U8QA 1TJMA 4KKRA 1ODUA 1E9PA 1E3XA 2YC1B 5F9OH 4J8RA 3WS6A 3ZE2F 3RQ3A 3PNWB 5LVEA 3BESR 4NQCA 3QYMA 1T0PB 4HUXA 3PGCA 3SYPA 3VWKD 5D7SH 1RH8A 3OPZL 1UENA 3OHMB 2IJ0C 1HAWA 5AYTA 3O4LA 1IM3A 3NCJL 4ES9A 1TJIL 1MEXL 2VDQB 3US9A 1I1AC 2E7HA 4I9XA 2V4LA 2EDFA 5D1QB 5K1VA 4EKXA 1ORQA 4HMCA 1DJHA 1SN5A 4K9EL 4OGAD 3TA3A 3QIUD 5BVJB 1QFUH 1U8KB 1WZ1H 3HR5A 1SBSL 4PVBA 3DX1A 5EV7A 3BRDA 3K91A 1R3LB 1CCZA 2BHYA 1OPGL 1MDAA 2YXMA 3QISA 2P5WB 1AZRA 3V8OA 2MOVA 4OFKA 2C9AA 4MMYB 4FP8H 4IJTA 4Z7NB 6CGTA 3ULVD 4P2QB 1CPUA 4L1SA 2IOMA 1UD3A 3OB0H 5SX4I 1VEMA 3BVUA 3OC8A 2WGNB 3L3GB 4GW4B 2XKNB 1A1NA 5TF1H 1EHLH 4NYLA 4XXCA 2MTPA 4KOCA 1K4DA 2Z7ZA 5DVPA 3H0TA 5HJGA 2JJSA 3CZGA 3D8MA 4HWEL 3O6FC 4QYOB 2H1LM 1BD2D 1NCTA 3IE4A 4BGLA 5INDB 3FAXA 3IXTA 2FHFA 1LNUB 3VFNA 1OM9A 3HI6L 2HB0A 3ABZA 4G3YL 5E6YA 3BRFA 5IM7A 4E0RB 4OUUA 3L6FA 1JXGA 2G60L 3ZT6A 3CU1A 1YG9A 1CLCA 5LG6A 1N3NA 4AGLA 4YDKL 1CQYA 1GC1C 5JIHA 3ROOB 2OMUB 3DRTA 3RIKA 3MBWB 5K9OB 3BVVA 2EICA 2OZ4L 4S1SL 3UYOD 5AAWC 1ZCRA 3B5GA 4ZUUA 1BJ1J 5C07A 2J1WA 3ZKXB 1NDMB 3ASOB 1A9BB 2GITB 3EG9B 3IPFA 4I7ZC 5FW8A 3BWUF 3BPCB 3VH8A 1DSFL 2P8LB 4M48L 4PYGA 3TO4C 1X6NA 3QWOB 2VLKB 1DLFL 1KCUH 3FUJA 1T89A 1RVFH 4QIRA 1ROWA 4N87A 1UM4L 5DHVA 5B39B 1TCRB 2G2PA 1DANT 3LJ3A 4DPBX 3WJJA 4ODXA 1R19A 3FQRB 4N0UB 1NAML 3KL3A 4JRXE 3GM0A 1MAMH 2F54A 2YZ1A 3ARDD 1S7WA 5JMOC 1WICA 3F8UB 3DDFA 4DN4L 3CDYA 2F5AL 1GAFL 4CBPA 5T3XH 1AOHA 3U6XS 5E8DL 1NBVL 3SDDA 4A63A 4GQ9L 3VWJD 3NSCA 5HDQH 4BSVA 3L3DA 1GJWA 2NOYA 4N6QA 5E94B 2GJ6E 3EUUA 4GQPH 4RIRB 2CR0A 1I8UA 5J6HA 2XHNA 1ZHNB 1U36A 1MFCH 5DI8B 5HHOB 2QVFB 4IIQA 4KJPC 3DMMA 1H3GA 4AM0B 4XBGA 5IT2H 5L4MA 1R3IH 4RGOL 4BZ1A 1PJ9A 2SEBB 4AXWA 1JK8A 3MNMA 5L6YL 4P99A 1DZBA 3EO9H 5FHBH 4GMSH 5AW2B 4HIEB 3TIEB 3CCHB 3MNWA 4ZFFB 3P4OA 2MMXA 5FKAA 2AP2A 2OJZL 2CRMA 4FQ2H 4XNUH 4PCYA 1S7TA 3I02A 2W5PA 4TVUA 1IL1A 3MLSH 3S97C 1DSWA 4L5FE 3GSWA 4J3WA 4WWKD 1T03H 3HAEG 5JIQA 3VA6A 5AUMA 3D51A 4TM9A 1X9UA 3ARRA 1KCLA 4UMSA 1HHHA 3PQYD 5HYSA 3S8FB 1E5AA 4DKAA 1BFSA 5HI5D 4PLJC 1J5IA 2OSXA 4CVWA 3KEHA 4OZHB 1NAMB 5J7CC 5CBEB 4W6WB 4LGRB 5DLML 1DJIA 4GSDL 4P9HL 3U6RA 4KTEL 1CXFA 3QEHA 1ONQA 1THAA 5CZVH 3CBJB 2OMWA 3UBHA 1KOAA 3OXSA 1UD6A 5EWIH 4DAGH 3FUIA 1G6RL 3QZNA 4JPVL 2WAQA 4D0DA 3F5WB 4K15A 4DO4A 1XB8A 5EBWB 4F93B 1IMHC 2B59B 2D7OA 1TTRA 3FO1B 3MFFB 3GO1H 4M1GL 5B1CA 3FRPG 1DVXA 2O93L 3DTDA 2Q8BH 3OAZH 2XWEA 5E1AB 3NZHL 2ZKYA 4X9IA 1HWGB 3P3RA 4CSPA 4X6EA 3N42B 3V6BR 5F0PB 2DB8A 5F1IB 5DJ0A 5EOCJ 5F88B 5CSBA 3EJCA 3SY6A 4YFDB 4HH8A 3BGAA 4R7NA 1R34A 4MAYB 3VI4F 1C08A 4IOIB 4P57B 4BXVA 2R0KH 4HEMA 1BQHG 3EFOA 1A47A 3H56A 4AV4A 4F20A 1VKXA 4FZ8H 4F2EA 1T89C 2DH2A 4E41E 3QPKA 2R2EB 1Q72L 2DAVA 1NCAL 5CEXA 1JRHH 2B1AH 4Y2DA 4NDMB 4G9DA 3WJJC 4K7PH 4HOXA 3VFPB 2E7CA 2HRPH 4E5XG 3B2XA 3KYKL 5LGJA 3MTRA 3QXVA 3WTVA 2N1KA 4QRPA 2NLJB 5D2LF 1BBDH 2K7QA 1FIGH 5ADPL 1OGSA 4H8UA 2RFXA 4YHNB 3E8UH 4JR9H 3RUGE 1INDH 2DW5A 4O9HL 4EI5A 3HZVB 4U1KA 4EN3A 4P8QA 4IU3B 4JLRB 3SDDC 1MHCB 3H2WA 1KCBA 2QVMA 2F08A 2VCOA 5FR3A 5EC1A 1XHHA 4I0PA 3WHE1 1L9TA 4LVEA 2OW7A 1PCXA 5JHMA 4HS8H 2B20A 1FGVL 4QHKJ 1DEEA 4YXLL 4CC4A 3DMMC 3DOSA 5G5DB 3O2WH 2HT4C 2CE6A 3BAIA 4NQDE 5EU5B 2ATAA 3VD1A 3BSGA 3FONB 4RMRA 4O2EB 3QNZB 3BZFA 3CFJB 4GAGH 3IBOA 5C71A 2AXWA 1A1MB 2OV0A 1WV7T 4WY7L 1T20B 4MKTA 5IHBA 3VYPA 3CZLA 4YHPB 3S36L 5D1XD 4GUCA 4B3VA 1BECA 5FYJE 3MOAH 3CZKA 4GG8B 1R5IA 4OIIH 4S1QL 5I6MA 3BISA 3GRBA 3O8XA 4OSUL 3N0AA 3RY5A 3RKDC 3QJTB 2VRAA 5IG7B 1AXIB 2GI7A 4S1DD 1JZGA 5IVXE 4NRZA 3MUGA 4X4ZA 1NKOA 3ZYZA 2HWZL 3EJZC 4XNMA 3LEXB 3TT1H 3UJIL 3EYOA 4R9HA 3TU6A 3MJ8A 2LTQC 1I1AD 4LHJB 2E3VA 1IGYB 2WB7A 2WLHA 3L5IA 4LLUB 3FO2B 1N18A 3ECBA 2FLMA 2W9EH 2O26U 1LDSA 1Z7JA 2KHAA 1U8HB 1PW3A 4R2GD 1AJ7H 2YAOA 3TYFB 4MD5A 2EC9U 4P9HC 4ENZA 2AK1H 1NGQL 2O5ZL 3NT0A 3T65B 2DQUH 3G6DL 3ATBA 2VDPB 4KHTL 3HNTH 1QSFD 2F61A 2X4TB 3KPLB 2DTMH 2N56A 2ADFL 3LY6A 4IKJA 4WUUD 1MOEA 1P1ZA 5IB3B 2R1YA 1A3RH 4K3DH 3QJHA 1ZEAH 1F90L 4JL2A 4FQQA 2YPVA 4M5YH 3L3HB 4GAJH 4JG9A 4EOWH 1CFVH 4AQAA 2EXTA 3DVFA 4M8QB 5C0DB 3BZDA 4FKKA 2IBBA 3GNML 1OV8A 2F53D 3CMOH 4HUCA 4I3RH 4PGCB 4FFZH 1RUPH 2D31B 1OQXA 3QJOA 4NKIL 1EAJA 3V0VB 3UZVA 4TQEH 4UAOC 1QFPA 2E74C 1L6PA 5SWZE 1GZPB 3L95B 2N1TE 4EI5C 3RDTB 1AY1H 1FZMA 4G72B 4EN3C 3CUPB 5HGDA 4PJ8A 5ILTL 1A6TA 2PCPA 3CVCA 5FGCE 4LSPL 1JPSL 3LZFL 1ND0A 5EN3A 4PW4A 3K2IA 3V6OA 3EYSL 2X4UA 3ZZ1A 1KLUA 2P49B 4MYWB 4I77H 2ZNXA 4GKNB 2NY5H 3MJGX 2Z91B 5DA0B 4CC4C 4OFIA 3EDKA 1Q0YH 1BGXL 1OB1B 5FO2A 5D1QD 3MV9E 2R4RL 3JWOC 3RWEB 1KTDB 3VXMA 2PPAA 4LQFL 1D9KB 1PG7H 4M9PA 4GOSA 1E5YA 1PDKB 5DRXA 4P07A 2TSAA 5IKCA 2R8SH 1Z9PA 3HLAB 1B90A 3W11C 3NSFA 4YDLB 1GJIA 3H3PH 3BAWA 4BUHA 5IUSA 1EUTA 2AJZA 3W38A 5BUAA 3PWPB 5JPMA 3FO0L 3O45B 3SODB 2JLLA 3US1A 3IJSB 4V1DA 2WXOA 4OGZA 3KYOB 3MRQA 4QRTA 3EFDH 5AB9A 1HEZA 1BREA 3VGAC 2J1XA 4GXFA 3MA7A 2EIDA 4P2QD 2UV3A 1S5IL 4YNYB 1N2RA 1MI5A 2C26A 1A6ZA 1HVXA 3RVTD 3RFZB 2NUTA 4QXVA 3ZKQD 3FH8A 3AB0B 1E9OB 1MWOA 4WHCA 3C2SA 3TCTA 1SXBA 3C5JB 2F9BT 4WFHE 5TE4L 4BRJA 3IXAB 4KJPD 4LKXA 5HHVL 5E08H 1YEDB 1FN4B 4JKWA 1T4KA 2R2CA 4F37K 1XMWA 4R26H 5AW6B 1KF9B 4WJ5B 1AQHA 3QUXA 3B5HA 1I8KB 4K5NA 3U9UB 1E6JH 4CMHB 4NFCA 4ZW8A 1CGSL 2D03H 3A6CH 2DWXA 5DJ6B 2NXZB 4I2XA 3R1GH 4B53A 3QS2A 3MJ7B 4U49A 4B9IA 4HC1A 2QQNH 4WU7A 3QDGA 4AEHL 2QQQA 4X83A 3CSYB 5JR1L 2WZ6A 3FH7A 4LARH 4HJJH 1F13A 1FZKA 2EKJA 2YR3A 3L7EB 1RHHB 1CBJA 4TSAH 3KLQA 3SYAA 2A74C 2DL9A 1KIQB 4QDGA 2VLKD 1UKQA 5AG9A 4ALAH 1QEWB 3HFFA 2YXVA 5IBUG 1TQVA 3BSZA 2CKNA 4E9RA 2BVEA 5C0EB 1XD0A 4XN4A 4KDWA 1CJYA 2J8UE 3SSGA 3MXWL 1X7SA 3K2UL 3LKSB 1MIML 1U8LA 2ROXA 2ZSVA 4JRYE 3ZDXF 3NCEB 4DKTA 4JFYA 3G04A 3C6LA 4AYGA 4PJ8C 4FFTA 4ABWA 1ZA3A 3HC0B 4F9LA 2H47C 1EXUB 2DQTL 4PJCA 2R7EB 4ZSOB 2G3ZA 1SQMA 5HHOD 3BLPX 4C56A 5JW5A 1O6SA 1SJMA 1PSKL 4P48A 4ORZC 5GZND 1QWHA 6FABH 2DQEH 1A21A 4OLZH 4NRXA 2NDFA 4DP6X 4FF9A 5L2KB 5JORB 4GXVL 5DUBB 2CUAA 4YSUA 1YO4A 2VERN 2G9KA 3IKCA 4G5ZL 4OIBA 5DVNA 5I30L 2ZJSH 5L7XL 4TNGA 1G9MH 1K8DA 1TYJA 3SDXE 5JPMC 3F00A 5DD5H 4P4RA 2FT6A 4WKZA 3R0MA 2OM5A 3FF7A 5I6LA 2X89D 3QXWA 3ZOAA 1U2CA 3HS0C 1SDDA 4FKHA 1G1KA 2CBOA 1SYVB 4B9GA 5DJXA 4UIMB 4N8UA 2WBJB 2WHVA 4MD4A 4XZUA 3OR6B 5IFHL 4U33A 1DN0B 2LFGA 3RL2A 3UTPD 3V6FA 3BO8A 4OZIA 1CGUA 3PDOA 2N0KA 3FB5B 5HGGS 3BH8A 5DHVH 3EGDB 4ZOBA 2QZ5A 1BDYA 5C0NC 4QKXB 3RVVD 3S5LA 1NZRA 4JZJA 2NSXA 4MDJB 4RESB 5FYLD 3GSNB 1FYTB 3CVBA 4FXLA 4IIZA 1FBIL 3E6FA 3TYGH 2X4OA 4LP8A 1EIBA 1N5YL 3ZHFA 3EH2A 1OAUH 3VFWA 3PWUA 4E36A 1IEAB 5IV2B 2F58H 1YPZA 3O2DA 1MJ8L 5CFAA 3G5YA 4ORGB 1VZGA 4XMPL 3WTTA 1PF3A 3ABLB 1QYGL 3SJVB 5AOMA 3DXAE 1IAKB 5HYJE 4F7PB 5D7JC 4MAYD 2DEWX 3O41B 4XWOC 5GRWA 4HWZA 4OZGB 4NO2A 3TV3H 1ZLWK 1SLWA 2GAZA 4WRLA 3CZFA 4TNVK 5J9PA 3VMPA 4BZ1H 2G75B 4G9FB 3E38A 4QRRD 1RJLA 3BVTA 4Q6YA 4PHZA 5DFVC 2AQRA 1CE6A 3CN1A 3E0GA 3I6KA 4JFZH 4M7ZC 4JY4A 4ODHL 5IQ7H 1XXDC 5KSBE 2CLZB 2BIOA 1MN4A 2M2DA 2MSPA 2X1PA 5EMYA 3LPPA 1QSEA 1G7QA 2AHIA 4NFBA 3OKLA 7FABH 2EEDA 1RZFL 4KHXH 5KAQG 1FNLA 3QR1A 3P11H 3C6LC 3GIVB 1BVZA 3OKEA 2JNZA 1KENL 1MJUH 2YAPA 3VFRA 1MFVA 5ENWA 4WGKA 4NBYB 3HE7C 4F9LC 4ZO9A 2FSEA 2XPGB 3NEEA 3QDJB 5DVKA 1GSKA 3TEZA 2EUXA 1EERB 1E8XA 3FQTA 3MN8A 1GCFA 1I8IA 4N0CD 2FX8H 1H6FA 1OCWH 2P8MB 3DPBB 1BVKA 1YAIA 1HXMA 1L9NA 4W9DC 5LDSA 5F9DC 2P80A 2ID5A 1MW2A 2VDOB 5HVHB 5EUOB 3FFCA 3FUEA 3UROR 4MQXD 3TM6A 3RVWC 5T5FL 4OLUL 4H26B 5C86A 1XQ4A 4QJ3B 4HUUB 2R39A 4WO0A 3F85A 1GW6A 2ZYIA 2AJVL 5BS0A 2WWKT 5LCVA 3SBRA 3UAEA 4ODSL 1B0WA 1FL6B 3BH4A 1YNLL 2OTWA 3POCA 1D2PA 4KZEL 1JGVH 1OGAD 3AG2B 4LGSB 5LNEA 4C59B 1JXFA 4JKLA 2Z4QA 1OSYA 2VDRB 2YZ8A 3ERXA 3ECQA 3TX4A 3P4LA 1SJHA 3PL6D 2X40A 3GWJA 1KTLA 2ADIA 3LQMA 1HKLH 4QRQB 1RXLA 5CJOH 3U36B 4D8PA 4WJG3 1ORSA 4XN5A 2WB1A 5KS9E 4CNIA 4JZJC 3K7UA 4HS3A 1DSYA 3STLA 3U25A 5D4QA 5KYNA 3HZYA 1JMXA 2YJQA 2WLZA 4PV8A 1AHWA 4X4YA 3BAEH 5ETUB 1KCSL 1MVFA 5SWSE 3NACL 2A77H 1ZLUK 3H7BB 2OXGA 1LO4L 1DQJA 3TWCL 2ZNWA 3STBA 3NAAL 3VDCA 4G2AA 1IC4L 4Q74A 3ZR5A 4WW2F 4OM1H 1JK9A 3L3KA 4OY9A 4W93A 5DZVA 4LXFA 1R3JB 4YDIL 3QDMB 3PWLA 4IRJC 1I1YB 4ONGH 1UHVA 4G80A 3VGHA 5LWYL 2V5SA 5B7MA 1Q0EA 4E9WA 1AHKA 2QSTA 4P5KB 4N2EA 3JWOH 5DO8A 3ZE2B 1ASOA 1SJVA 2OL3L 3HAEA 4M43L 2C8NA 2X0UA 4QXUL 4K7PX 1A1OB 3W0WA 3WYRA 3UBXI 2H1XA 4EEEA 4EZMA 5IQ9A 3NQKA 1DE4B 1NJ9B 2P9RA 4MVBD 1DVYA 3O6MH 1URLA 2IXQA 4HZLA 5CEZE 1URIA 1YUHB 4L29B 4IM8A 4J7RA 4WK0B 1TYRA 3RDTD 4ZMWA 1JHKH 4GQZA 1NBQA 1V10A 3QA3B 4G1MB 2P24A 3RWDA 3EGSB 5E8OA 5GZOD 3B2DC 4F7TA 4DGVL 1E8WA 1OAXL 2PP7A 4ONFL 3VD5A 4H8WL 5C0BE 4XPHH 4PRDB 2QPUA 4RGNE 4HIIB 5FHAH 4LIQH 3O3BA 2P47B 1UM5L 1U3HC 4FTVE 3SIKA 4F2ME 4JFOB 4P23A 5I9QC 3KM1A 3OKNB 4RAVB 1PKQB 2ZOKA 3T3MB 2JB5L 3DRQB 5C08A 3P0VL 2YMXL 4WWID 3FK3A 4JJ5B 5IHUL 4L3EA 3ZIMA 2QGBA 2CBQA 2CK0H 3BP7A 3PWPD 2AJSL 4YVUA 2AJUH 1QSZA 2XWXA 3HW7A 5LUMA 1DL7H 1BQHA 5E5RB 3TESA 2CRIA 2DQHH 1HNYA 3BLBA 2VLRA 4F5CE 2OK0L 1SOXA 5DUJA 3KWUA 2TAAA 4WFEE 1FNEB 4GP5B 3IGUA 3L1OL 4S11A 3TN0A 2IOOA 5I2IA 1XSIA 4X5WA 1I8MA 3CVDA 1KPVB 3EADA 1KNOB 3FQNB 3FTZA 1NAKL 4FABH 2YPVH 3NEOA 3P4MA 1LO2H 1VLXA 2B39A 1CR9H 5CU9A 3ZDYF 1HHJA 5GRXG 1ADQL 4FEIA 4HJSA 1EEZB 4L8CB 4H8QA 3D12B 5GHWH 3MLRL 4P3CL 1P2CB 3HPJA 3WNKA 3QFDB 4PS3A 1X9QA 4XAKD 4GIOA 1BLNA 2W0FA 2WPGA 1FI8C 1AHWC 2MRYA 2H3XC 5EORH 3IJ9A 4G7SB 4LBEB 2PABA 3KDMA 3IFLH 1HAUA 2NXZD 2BS8A 3MLTA 1U30A 1PZDA 2EXYC 5I1CL 1ADQA 5KVGL 2DYPB 2IDCA 4NIYE 3L4XA 5AKSA 2KH2B 2BY2A 5INCA 2DQFA 5BO1L 3ARVA 5DFWH 1N9PA 2P5PA 1DBJL 2XTSA 1W80A 4F8QA 1WRFA 5F7DB 4A2HA 4AGPA 2HUEA 1IGJB 1MHHA 4GAFB 5TJWK 2FWLB 2EABA 1T3FA 2ISDA 4JHWH 1DVQA 1NM9A 1P7QB 2V2WA 4KU1A 4MNGA 3GSOA 2H3NA 4WVRA 4Y7MA 4L37B 3KYAA 2IC2A 5CM1A 1R3KA 3D48R 4Z23A 2A73B 2DQDL 4F57H 3QG6A 4HULB 3P0YL 2PMZA 4PREB 5FUZL 5KVFH 1T5XA 2X28A 1E4JA 3PAUA 3VE0B 2V2TA 3OGCA 1XGTA 3DLQR 4LB8A 2NNAA 1BJ8A 2D0HA 3QW9A 1TENA 3F01A 2ZX6A 1XZ0B 3BXNA 3ULSA 5IHLB 5HI3D 1J8KA 3WXWL 3CFBA 4Y1AA 4PD4K 1CGVA 2FATL 4WEUD 5CIPA 5D7JD 3Q13A 3FSOA 4LLYA 1MCCA 3QZMA 4MXWL 2I9LA 1DJXA 1F42A 1IM9B 5F7YC 1I7TA 4PMEA 1PG7X 4P3DB 1DQDL 3BCFA 2HTKC 3GXUB 3H3BC 4G8FA 4HP5A 5ITBL 5L2KD 5DK3A 4O4YL 1EXHA 3FU3A 4PG2C 3Q1SH 2IANB 3NJIA 1KXQE 4APQB 2EE3A 2ED9A 4PWHA 4M8RA 4FQIL 1U8PA 5DEFA 5T1LB 3D25A 2WP3T 1XFPA 3ZY7A 1FG9C 4HC1H 5EEXA 1P5VB 3FOMB 1Y18A 1A3ZA 2VH5H 1TQBC 3A6BH 3KPRB 3P9MA 1PZUB 4UT9L 3T4YA 3I2CH 5JUEL 2MCG1 3D6GA 1QAWA 4KI5F 5F9WB 3BPLB 3S35H 1M6UA 2DM7A 3BSZH 2CDGA 1I3VA 3MRLB 3QUZA 2JXMA 4JBSA 3COOA 1TDQA 5D71L 2WZ0A 2W9DH 1JGUL 2VIRB 2CU9A 4FG4A 4UT9A 2RR3A 3VI4B 1FYTD 3ZGHA 2NUPB 1L6ZA 1IB5A 1F4XH 4JAMB 4YR6A 3DX2A 1UA3A 5ADOH 3MKGA 4XOBA 4UNTA 5KYWB 4YIQA 4I3SH 4F8LA 4Y0GA 3SJVD 3ZYIA 1RURH 1CN4A 4PW9A 4AC4A 2B5IC 1OE2A 3UX9B 1KJ3L 2HTLC 4EUPG 2R56H 2EVHA 3CSFA 1KGCE 1NLDL 2R2BB 3TJHD 4IOFC 5FK9A 1WFTA 3PWJB 4Q9RL 3FN0H 2EDYA 2YXWA 2XQ0A 3TO2B 4G9FD 3GLAA 4PYHA 5D1ZI 1TQUA 5TE7L 4KQ3H 1UZGA 4JG0L 4OBRA 1NGWA 1ZTXL 3VXUE 1FFOA 2J4WH 3MV7B 1H5BA 2VDMH 5LXGL 2FD6H 4TULL 3OLDA 1L6XA 2X4PA 4YMPA 2GTWB 5H4ZA 3J27A 4ILDA 1HDMA 3B7UX 3CX2A 1IEBB 2O1AA 5I17B 3NJMA 2IPKB 5BVPH 2XYBA 3LKRB 4HJGA 3OKOB 3IAPA 5CD5C 3EW3B 4IS6A 2FX9H 1H3WM 3QDJD 4KTDH 2AV1B 4GI8A 1UWEH 3KLKA 1A7QH 1QPXA 4DVBA 3GZPA 4XMKH 4N9GB 2BY1A 4YX2L 3LEYL 1NCBL 2ZCLL 5JYLA 5KOMC 2OJ1A 3IJEA 2Y7SA 4F7CB 4X4XA 2ZSWA 5LHDA 3AXLB 5C0RH 2FH8A 3C9NB 4OCWH 4ZFGH 1CLYH 2Y1VA 4G6ML 1U6AL 2WN3A 2J5WA 3FMGH 1P7HL 3G6JA 3O2DH 3ZQWA 1WLHA 2BOCA 5E4AA 3K8MA 3D69A 5I23A 1DQLL 4PTUB 3Q1EA 4ZPVA 2FQGA 3BN9C 5DO2D 5EEUA 2AXFB 3Q2LA 3C5ZA 1HTYA 4JO2L 4NPKA 1GZQB 1JZDC 5CF3A 4HYTB 4ZS6D 4U1LA 1X5GA 2BHUA 4YC2B 5IVZB 3PG2A 3AVEA 1N0XL 1J9TA 3W2DL 2XICA 2CIIB 3TEWA 2IGTA 2CXGA 32C2B 3FB6B 5EEVA 1JPST 4OLXH 4K3EL 5BMFL 1U2HA 2FIRT 3QYCA 3GSUA 3KWVA 1MH5A 3D33A 4U1SA 1YDPA 2NTSP 1A7NL 2QEJA 1X5KA 4N2AA 3B3IB 3ZN6A 1QQDA 3RGVC 2EEAA 3QUKB 4AYFA 4PM1A 2AERT 4TL4A 4GXUM 3QJSB 1E8ZA 3MCLL 2FJFA 2G5RA 4AQ1A 4JG1H 4TF4A 2Q8AH 1MQKH 4XHJC 1WWAX 1OTSC 1Z9NA 1IQWL 3VB9A 4AGOA 3SGDH 1GS6X 4BFFA 2BNRE 4LCYA 4D0BB 3BLKA 3NABL 5FF6A 3U7AA 2UVFA 4KY2A 1P4UA 2BDNL 2WLIA 3AREA 3KAAA 4RA3A 3RWFA 5F7WC 1DQMH 3AUWB 4A2DA 3NZUA 1NBZB 3PABA 2HVKB 3ZTNL 3NIDF 1G5AA 5D96C 5GGVY 4UV4H 5TQ0H 2EIJB 3DURA 4HAFA 4Y5YB 3BE1H 4OFQA 9CGTA 3G3LA 4ZFOL 2NY2C 3UCRA 4JPSA 4FNSA 3IFNL 5IB2B 2ZKMX 1T1ZB 1UXMA 5EOQH 1EO8H 2DICA 1H5BC 2ESVE 1H3TA 1USZA 2AMUA 3DUHA 1HQRB 3CFTA 4L05A 4NQXA 4OIFA 4OKDA 5HDLA 4HOMA 5C9KA 1MCDA 1DFXA 1F41A 4QRFA 5D7LE 4K07A 2CIKB 5LCVH 5KBPA 1LE9B 2FR4A 3T0EE 3RWIB 3ZLQC 3QWQB 4PJCF 1MIEH 4X6CE 1EVTC 4G8EB 1GYAA 2HFTA 4L4TE 2IBZX 2UY7B 3OHXB 2DBJA 3KH3A 2F7IA 4RMTA 4U3CA 1X7TA 3BP6B 4UOW0 4YBLB 3VG9B 5E2TH 4XX1G 3TPUA 5B1BB 4MA7H 3MRKA 3QNXB 1KJ2A 5DD1L 1A7PH 2FTAA 5EU3A 2MQCA 3RILA 4H20L 1TNNA 3CH8A 3ENEA 2HFFA 4TRPH 1SVCP 4IRSA 2FIKB 3EFFB 4JZOA 3ZPDA 2D7NA 4AV5A 2CA3A 3FT9A 1GHFL 3LIUA 2WWNA 5I0VA 1KBBA 3L3JB 1JGLL 5DJAB 4LLDA 3L2NA 3B7SA 5FWRA 4IHOB 3RTQA 1DO6A 4LLAA 4KRMB 1OSPL 1YN7A 5GIRA