1WA2X

Crystal structure of h313q mutant of alcaligenes xylosoxidans nitrite reductase with nitrite bound
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
334
structure length
334
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGQIKVEGKWNDDLMKQIKAPAPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE,
publication title Insights Into Redox Partner Interactions and Substrate Binding in Nitrite Reductase from Alcaligenes Xylosoxidans: Crystal Structures of the Trp138His and His313Gln Mutants
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Reductase
total genus 88
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa2X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa2X02
1NPJA 3ERXA 7PCYA 1KGYE 2N0MA 1DZ0A 1OCRB 4HHGA 1OE3A 2FQEA 2H47C 5B1AB 2Q9OA 2ZWNA 1ET7A 1FA4A 4A2DA 3GDCA 4GY4A 2IDFA 4M4RB 1KV7A 1JXGA 2DYRB 2FT8A 4RH4A 2FQDA 2J56A 5E9NA 3SBPA 4ENZA 3H4HA 2BHFA 4JHUA 2VN3A 1AZUA 3GXUB 1BXUA 4UF7C 1J5CA 2HLEB 2QT6A 1B3IA 1J9TA 4DP6X 1PLBA 1JVLA 1NPNA 2B3IA 2IDUA 2IAAC 2PP8A 2IWFA 1XB3A 4E9RA 5I5MA 2XV3A 1WA2X 1AG0A 1RZQA 1SNRA 2BZ7A 5I6OA 2BW5A 4YSEA 3IEAA 3FSVA 2PPCA 3NP4A 2VW6A 4NB7A 2XVBA 4YSPA 1F56A 5B7FA 3ABKB 4DP5X 3QJVB 3TA4D 4E9YA 4Q8BA 2OCCB 1SDDA 5I6NA 4KOBA 7PAZA 4YL4A 1BXVA 1AZBA 4A2HA 1AZCA 2BP8A 3OD3A 2GI0A 3S8FB 3FYIB 2HX9A 3MX0B 3UAEA 4JHVA 2GHZA 2YAMA 3NSDA 2XWZA 4G7RB 4A2FA 4YVNA 3FT0A 3WG7B 6PCYA 1IBZA 3D12B 3NJLA 3NJGA 3TBBA 1HFUA 4BDVB 2FWLB 1TKWA 2CJ3A 3KW8A 1EZLA 4HCFA 3N55A 5I6PA 1JERA 4E9QA 6PAZA 3RYMA 4G70B 2XV0A 2I85A 3SQRA 9PCYA 2GSMB 2TSAA 4GP5B 4E9WA 2PP7A 1SF5A 2QDWA 2I7SA 5LDUA 1JXFA 1AIZA 3ASNB 3CVBA 3NJHA 4TXVB 4AKQA 4MFHA 1AS7A 2UXGA 2YAFA 2VM3A 2IH8A 3ASOB 3T6ZA 3IN0A 1NINA 1ADWA 2DYSB 1BYOA 3FPXA 4DP4X 4WKXA 1BAWA 2VMJA 1ET5A 3WNJA 2J55A 4FAAB 2BP0B 5B7EA 2FQFA 1NIEA 2FTAA 1RCYA 3PCYA 8PAZA 5B7MA 3N2JA 2X87A 3PAZA 3ZIYA 2EIKB 5B1JA 1KBWA 1JZFA 1A65A 4Q89A 3ZBMA 2EINB 5EHFA 4DP8X 3HEIB 2J57A 5A7EA 1XB6A 1ZDQA 1GS6X 3JTBA 1VLXA 3AG1B 1IBYA 4EF3A 1ZIAA 5ANHA 1AACA 1MG3C 2XLLA 4G7QB 3WKPA 1QHQA 2RACA 4BXVA 1SFDA 2DWTA 3FU7B 2YQBA 3NP3A 4HCGA 3OM3B 4JKNA 2VW4A 5D4HA 3C75A 1GR7A 3X1NA 1JOIA 3FYEB 1RZPA 2EIMB 3FPYA 1L9TA 1NWPA 1TEFA 3FQ1A 3NYKA 3CDZA 1BYPA 3NJJA 2GC7C 1L9QA 4E9XA 1J9RA 3NJIA 1ILSA 3SBRA 1URIA 1WAEA 3WKQA 3ABGA 1E67A 3G5WA 3DIVA 5FC9A 4E9VA 1IUZA 1PLCA 4DP0X 3TASA 1JZEA 1GS8A 1I53A 2IDQA 4AZUA 1TEGA 2YXVA 2PP9A 2XXFA 3AW5A 3T6WA 3UADA 2BO0A 3L45A 4BWUA 4HHWA 3FQYA 3U25A 1ASQA 3NJKA 2GB2A 1A4BA 3H4FA 3T9WA 3X1EA 1AQ8A 4BDVA 1A4CA 1E5YA 3QJQB 2MRYA 1UATA 3BQVA 2MTAA 2JFCA 2PPEA 4KO6A 2YAPA 4E9TA 2HX8A 3TBCA 2PPFA 1AANA 1L9PA 2XXGA 3S3DB 4DP2X 4NERA 4E9SA 1CC3A 5AFAA 5I5JA 1OCCB 1KDIA 3IN2A 3FU9A 1A8ZA 1ZIBA 2R7EB 5PCYA 1L9RA 2YAHA 3CG8A 1BXAA 3EF4A 1GY2A 1PAZA 5AZUA 1BQ5A 2UX6A 3QPKA 1BEXA 2A3TA 2WSDA 2QDVA 2VW7A 2OJ1A 3AZUA 3EH3B 4G71B 2BZCA 1X9RA 4G7SB 4X4KA 4GXFA 2P80A 2W88A 1R1CA 1PF3A 2AVFA 2DWSA 4BWWA 3AG2B 4HALA 3HB3B 1MZZA 2BP0A 3H56A 2PPAA 3ABLB 1NTDA 1WS8A 4WTQA 2IH9A 2B08A 2PCYA 4DP7X 1CURA 4A2EA 4YSUA 1KCBA 1MG2C 3BVDB 4A67A 1SHXA 1ASOA 1AS6A 1JZGA 2X88A 1NZRA 1ZDSA 1NICA 4A68A 1KCWA 2JXMA 1PZCA 2YARA 2BW4A 3PXLA 1SFHA 2HRGA 2VSMB 1ETJA 1TU2A 3FQ2A 3QJRB 3WI9A 2PPDA 1IC0A 3UGEA 3FU7A 4HZ1A 3V9EA 2FT6A 2HZHA 2YXWA 2XX1A 4K9JA 3T6XA 1AZRA 3S8GB 1AG6A 1V10A 1W6WA 2NRDA 2FNWA 1JZJA 4G72B 1CUOA 2JKWA 3QJTB 1L9OA 5I5IA 2H5UA 4M3HA 2H3XC 2P80D 3DKHA 3NSFA 3KW7A 1OV8A 3QQXA 4NAJA 4UAHA 5I6LA 1M9WA 2XU9A 3FU8A 3CVDA 1W8EA 1GW0A 1QNIA 3FSAA 1PMYA 4DPCX 2UX7A 3NSYA 5AKRA 1SHWA 2ZONA 1SF3A 2ZXWB 2WO2B 4YVUA 5F7BA 4BK5C 1GSKA 2GIMA 2OV0A 4HIPA 4AKOA 3GYRA 1ET8A 1OF0A 4HAKA 5PAZA 1AS8A 3X1GA 3QJSB 5B1BB 4PCYA 1L9SA 2HRHA 2QPDB 1YLBB 3EH5B 2YAEA 1CYXA 4YSOA 1AZNA 4W1TA 2GBAA 2AANA 1PLAA 1E5ZA 5B3SB 1QLEB 3UAAA 4KO9A 1NDTA 1SJMA 2CCWA 2VSKB 1E65A 1WA1X 3NJNA 3JT2A 2WO3B 3OMIB 1PNCA 4W9ZA 1PCSA 1RKRA 2HXAA 3AG3B 2XV2A 1OCZB 2TSBA 2BWIA 1X9UA 3NJMA 3AG4B 1EHKB 1PZBA 2EIJB 2R7EA 2CUAA 3PPSA 2FQGA 2CBPA 5F7AA 4QLWA 1FFTB 2CALA 5I6KA 1J5DA 2UXFA 1HAWA 3AY2A 5TK2A 1NIDA 4F2FA 2EILB 3NSCA 2PLTA 2UXTA 3S3BB 3TU6A 3OMAB 4UANA 4YSSA 4AKPA 1GS7A 5B1JC 1J9SA 4YSQA 3WIAA 1A4AA 1NWOA 3NJFA 3WNIA 3FSWA 4GYBA 1KYAA 3X1BA 1AOZA 4KOCA 2DY2A 1GY1A 4A2GA 2XYBA 1PZAA 2J5WA 2VM4A 2QPEB 2YAQA 4YSDA 3CDZB 4HCIA 5D4IA 1CYWA 2Y69B 5D4JA 2FJSA 5B1KA 4CSZA 2IDSA 2IWKA 3EH4B 1NIAA 4KNTA 1JXDA 1OOWA 3ABMB 5I26A 1NIBA 4YSTA 1DYZA 5I6MA 4GP8B 2YAOA 4F7KA 1JVOA 1AAJA 1BQKA 3X2QB 3IBOA 2IDTA 5IY5B 3OMNB 2I7OA 4L0PB 3PAVA 1GYCA 1ASPA 3PLYA 4KO5A 1ZV2A 4KNUA 4GP4B 2BWDA 3FSZA 1W6LA 2Q5BA 2HX7A 4A66A 1FWXA 4P5SA 2GC4C 3PAUA 4F2EA 1OCOB 3ZDWA 2ZOOA 4KO7A 2E86A 1KDJA 1JZHA 4AX3A 4QKTA 1WS7A 2IWEA 4AI7A 1M57B 2FT7A 4BWTA 4KNSA 1HAUA 1SDDB 2UXVA 2CAKA 3IE9A 1OE2A 2BP8B 5TK4A 2AZAA 2Y1AA 3T71A 4FA7B 3ZX1A 1ID2A 1A3ZA 2DV6A 1OE1A 1N70A 1WA0X 1M56B 3MBWB 1PY0A 3OQRA 4PAZA 4DPAX 1MZYA 3S3CB 3X1FA 1KBVA 2LLNA 3DTUB 1E30A 1XB8A 2XX0A 4YSRA 3T6VA 5I28A 3SBQA 3EHBB 1IKOP 1NIFA 3CZUB 4N8UA 4ZK8A 4DP1X 1PNDA 2AZUA 4DP9X 1MDAA 2XUWA 1V54B 4N4YB 1N68A 4DPBX 1AR1B 1BQRA 1ZPUA 2PCFA 1ILUA 4CSPA 1XMEB 1JZIA 3UABA 3UACA 4BXSV 2W8CA 3FS9A 4YSCA 3NT0A 3CVCA 3QJUB 1J9QA 3V9CA 1T5KA 1V55B 4YSAA 2AFNA 4P5RA
chains in the Genus database with same CATH superfamily
3SDYL 1VFAB 3M8OH 1AY1L 3MXVL 4NQDA 3WELA 2HTKD 1GMEA 4XC3H 5DLLA 3ZSTA 1ZHKB 1NOFA 1D6EA 5TDNB 5AVQB 3P9LA 3KLQA 5DVPA 4Y5XC 3MRFA 4PYHA 1KTDA 3G5YB 3VXPB 4G6FD 1MCPH 1ZLSL 1N7ML 3L3IA 5C0RH 5IBTH 4UM9D 2HJLA 1G7LA 3VFPA 5I1HL 4PGBB 3OPZH 3EG9A 2GEQA 1ZPLA 2ADFH 2ZKWA 5TDOB 3F84A 4GSQA 3VXOA 1MJUH 1HCYA 4CMHC 3DV4A 3BAIA 4F7PA 4PB9H 3QW9A 3P9MB 1BXUA 2KDYA 1N0XL 3HVDA 4UQ3B 5IF0B 5F7KC 5FPIA 2ZOLB 4P46D 4GRWE 2CDFB 1OTUC 1R75A 2OMYA 2W9DH 3BH8A 2AK4A 1WT5C 2QQNL 4C58B 3QRGL 2B3IA 5L2KE 1CGSL 3S37X 2BJML 1XR9A 3I6GA 5IK3B 3ZGHA 1MCWM 1XB3A 4PG2A 4E9RA 2PKDA 2R8SL 5JTWA 2V3EA 5DVNA 2RFXB 3L1OH 3ML8A 4Y4FC 3SDCB 4FQLH 1EJ6A 3CSBA 5FOBB 2DWDB 3V5DB 1EK3A 4OAWB 2X28A 1ZVNA 3EYVA 3STZB 2GJJA 1L7IH 3VI3E 1RJLA 4PJEB 1KN2H 3KPSA 3SEPA 3VFOB 3V4VH 4L0ZA 7FABH 3T1FA 3TA4D 3V4PH 2BDNH 2W80C 1HL8A 2XICA 1KWKA 4WNQB 5DMGC 4ZUWB 3GNML 1MHEA 3HKFA 1A6PA 1AXTH 3VJ6B 2PYEA 5CU5A 2PTVA 4MD0A 2IADB 3U4AA 1YPZB 3B7TA 2GBVA 2HUEA 4Y9CA 3VFVB 3WG7B 4C8XA 3QS2A 4A6YL 1D9KD 2DM7A 5I8EB 1UH4A 3BEWB 1R24B 1IB5A 2MPAL 3EFOA 4JM4H 3HHSB 3O9WC 4E9QA 2WP3O 4Z76B 3NG5A 1AXIB 5FUZH 5BVJA 4JDVB 1I8LC 5AOZA 4NKIH 2WBKA 4L2LA 4E9WA 4IRSD 4HXBH 3VRIB 1KCVH 4HIQA 1E28B 2ZUQC 4K71C 2C1OB 4A37A 4YK4C 1C8QA 2I7SA 2R1WA 1HX0A 3EYSH 3K1KC 3OKDA 1KJ3H 5I76B 2WXNA 4TN9A 4Y5XA 3V6ZB 4M5ZH 4MFHA 4U1KB 3QK0A 5DVLA 1HTYA 2IH8A 4BM7A 3QCTL 4NUJB 5D2LF 1LYQA 4JGMA 2QADC 3P77A 3FQXB 3PYCA 5C7ZA 3CE1A 4MWFB 4V1DB 2IMNA 1ET5A 3DX6B 4OCWL 2NTSP 4FA8A 5AW7B 2DLEA 2VSDA 1IFHL 2IAND 2F8VA 5I15H 1R5WB 3PCYA 2EDNA 3EDKA 4PJIF 1D5XA 2IQAB 4XGZA 5ANMB 2WWMC 3VXTA 1WT5A 2HN7A 4X7SL 4YBQD 4G8FA 4DCQA 2J57A 4FXKA 4E5XA 4HKJA 5F1OB 5B21A 1DFXA 3C6SA 1OF2B 1ZIAA 3VXNA 5GSVB 4JZNA 3LNHA 3EH2A 1CMOA 4WHYG 4KRPB 4M7LT 4Y4FA 5CN1A 5JNYA 4YOKA 2BOCA 4KTDL 4KHXH 2Y6TE 2QVMA 3Q1EA 3IETA 2I26N 3OM3B 1CWVA 1NAMA 1QATA 5C6WH 5JDJA 5F89A 2DMCA 1GR7A 3MGOB 1YG9A 5D7JC 3WAJA 1N9PA 4E42B 3X3GH 4BZYA 4PMEA 5BMFH 1I7UA 1N3NB 2BVEA 1U3ZA 1FIEA 4JJ5B 3W39B 1FL3B 3JYBA 4PHXA 4FP8L 4XO5A 4TSCH 3ML9A 3IDNB 2EUXA 1G7QB 3V6FA 1MF2H 1URIA 5EA0H 3CLFL 4HJEA 4NSKB 3CTTA 4Q9CA 2G3NA 2UY7B 4QTIH 4GRWF 3OWEA 2CIIA 1S7WB 4NUGL 5BRZD 5C0BD 4DP0X 1KIQB 2ENQA 4KK9C 4G2AA 2Y6SD 1F86A 1ICTA 4NHCH 3O9WA 1PIFA 3PIQB 3MRCA 4TM9A 4OFPA 4FFVD 2R0ZL 3CHQA 4MDIB 1MAJA 1XIWB 4UYPA 3TWCL 3ZT7A 4MA1B 4XN1A 4BWUA 3RVXD 1ASQA 3QEHB 3LX9A 3NFNA 4H8UA 3WJLA 4WV1C 4YHYB 3G6DL 4K8RL 3T04D 2IFFH 1WIPA 4X6DE 2HLAA 3VD1A 1VAHA 4XXDA 1EEUA 2ADIA 1MEXH 1VEPA 2WLYA 4FLOA 4JY5H 2CGRL 3FT2A 4Y2DC 4N8VA 5IQ7L 2XY2A 1N8ZB 1Z0MA 1AANA 1YDPA 3DHJA 2N1KA 3G04B 2QJDA 4NERA 5D9SA 3TEUA 3X11B 4Q9RH 3P54A 3RX8A 3UZEC 4KZDL 1LMKA 2CGYA 4JG1L 5EFIB 4NPYA 1YO4A 4JANB 4NZTL 2YAHA 5GRZA 4S11A 4F33A 1I9JH 1ITBB 5AZUA 5E6ZA 4P4RB 5EIIA 3E8VA 2VRQA 3DIFA 4I2XA 4O2CB 4F37F 5HYJB 1YRKA 3QIWB 4JY6A 3FQNB 4S0TD 3PHAA 5I74C 2BVUA 3BT2L 2CKBL 2QKSA 4A7GF 4I3GA 1JV5A 1MZZA 2BP0A 1W72B 1NTDA 5C0DA 2IH9A 2QVTA 2NUTA 1CU4H 2XKNA 4P4KA 3TGXA 3VI4F 4Y19E 3NGBC 4CBZA 3BSGA 4X4ME 4RZCB 4IBQA 1USQA 4XOAA 3S96A 4PRNB 4IU3B 2IBZX 3DROB 4K5PA 4N25A 3EDJA 2NY5C 4RNRA 1A6ZB 1HXKA 1PCXA 5I16A 4JQIH 4C83A 1JN6A 4AZ8A 3DC0A 3KPMA 3NDZE 5T33H 4UAOC 2VDMB 3F00A 4ZW3A 3RL2B 4JO8A 1ACYH 4WWOA 3GUTB 2YD5A 4K23H 3LZFL 2JKSA 4K2UH 3TFBA 3JV0A 3S0PA 1AZRA 4DGYH 4LP5A 1BLNA 2W0FA 4CMMA 3VE0A 3O6FD 3NH7H 2HJKB 4YEEA 3ZKSD 2YEVB 4N2DA 4IDJH 4K5OA 1E40A 2V9UA 1AC0A 1CUOA 1UOVA 2L7QA 1XCTA 1L9OA 4D7PA 4YXKH 2WBXA 4WENB 1VCAA 2PW2B 5EWIL 4OLZH 4EMZA 4U6VL 5IJCC 3PP3K 4IBUA 1CICC 4AV0A 2LTQC 4UQ2A 5IMMA 4CU7A 2HRPH 1AQHA 3ILPB 2KKQA 4YHOH 5AKVA 4NO0B 4CGUB 3MBEC 4RGOH 5DZLA 2AJVL 4B0MM 1E5CA 1BQHB 3FCTB 1NUNB 5DXWA 4LHUG 1AP2B 1N4XH 5JXEA 1HS6A 3D0VB 1Q9KB 4HAKA 4G8GE 5TQ0L 4QWWC 1GZHA 2J3SA 3W9DA 4UIMA 4EI5B 3I3BA 5DRXA 1I3UA 5AKTA 3UZEA 2YAEA 5CCKL 1ZV5A 1NKRA 2D03L 2HKHL 2WYHA 5B3SB 2VITB 2Q86B 3BWUC 3MJ7A 4FZ8H 4XPHH 3DPBA 3DOIA 3HRPA 5CIPA 3LRHA 4PY7B 3WXWL 2VLJB 3RDTB 1CD9B 1A7PL 5L2KD 15C8H 1NSNH 4MA7L 5AB1A 4Z18A 2RD0A 1I7TB 1JPSL 3IGAB 3U1SH 3O4LA 2VAAB 3CVHL 4MJIE 5JR1H 3MA7A 1VSCA 4LLVB 4TTGA 3NUKA 4N1HB 4LCCC 2X10A 2YA0A 1T66D 2AMUA 1ZVYA 3SZ6A 2C26A 5C08B 1KGIA 3ZVVA 2EXTA 1F6AA 1HAWA 1SJEB 1L9MA 2WYIA 3ALPA 4NUPA 5HI3D 4ELMA 4F3FB 4KROC 1GZPA 2ZOUA 1CLCA 1U4FA 5KAQF 2DLTA 2DJ4A 2W81C 3WIHL 4B3VA 5E2UL 1YQ2A 1JK8B 4XHJD 4CC4A 2E6QA 5EO9B 2WD0A 1U8IB 4MNQA 4BHUA 2YSSB 1F8TH 4FNPA 5MP6H 4UDUB 2WZPA 1NLBH 3GS4A 1IEAA 3G5ZA 4MYPA 5K1VA 1O6SA 1CFSA 2NDFA 3K4DA 2GEEA 1U92B 1DANT 2D7MA 4M03A 3K6SA 1OP9A 4UZUA 4PUBL 2NQCA 3HNTL 2DWXA 4OF7A 2V9QA 1Q90A 4AITA 4UTAA 1QYGL 4FQPA 4WIQA 3R18A 1RJCA 4NWTL 2XQBL 4ELDA 2Z8VC 3PAVA 2SEBA 4YHPB 4AQOA 3PLYA 1HILA 5J89A 3VXQA 1Z5YD 4ES8A 2DEXX 4FQIH 4UT9A 4LGPB 4OD3L 1O9VA 4MKTA 2VCOA 4FLQA 4APQC 2Z4QA 1ZE3H 3D85A 3IBEA 1IFGA 2ZOOA 3AWEA 1JP5A 3PL6A 4FD0A 5DK3A 2E86A 3TXAA 3VG9B 6FABH 3A24A 1XGRA 2WTOA 1R3JB 1QTPA 2EVHA 2F1AA 1DQLL 1KPRB 4O02A 4WUKH 3WOVA 4FZEL 4QHPA 4W6XB 3A4DA 4CN6A 4MJ5B 2BP8B 1FVCB 4GINA 3BYYA 4NGHH 2VQ1B 1VHPA 3QA3B 4YR6A 4R83A 4F1ZA 3PGCB 4YFLI 4P9ML 2V5TA 3OAYH 1PY0A 2NCMA 5EBWB 3FFCB 5AVYB 4JBSA 3G5VA 3H3BC 1BEYH 3TF7C 1IU1A 4XN7A 1K2DA 1B0WA 3JTTB 1DQQB 2R29L 3KPQA 3PJLA 4LCCA 5DHDA 4I0PD 3Q6GL 4WW2F 3T77B 3SB3A 2BNUA 5GGTL 3V7MA 3CZUB 1ACZA 2R83A 1UFUA 4QJ5B 1S2EA 3LXAA 2YPLA 4WW1A 4BZ2H 4GIOA 3VWJC 3DO7A 1MVUB 1XGTB 4KPHH 2A0LD 4CNIB 2WN3A 3P3SA 5JXAH 5E4AA 4HWZA 2YOAA 1OSYA 1J8HE 1OK0A 1QRNE 3HMWL 2DQCH 4I9XA 3ZDXE 2FBJL 1YEGL 2VO8A 4NCC1 3DGCR 1A6AA 1NPJA 4LL4A 5HDLA 5TQ2L 3VXUE 1Z1WA 2QHLA 2OTWA 4LCWB 5HVHC 5I75B 4QF1B 4C56B 2VDRB 3ULVL 3GZQA 5IB2A 4A7VA 1KN4H 1EFXB 5B1AB 1X5LA 5C9JB 2QLYA 4TUJA 2ODHA 4IU2A 1OY3B 1RUPL 1OP3K 2Y1VA 3IYLW 1KF9B 5E9NA 4M7JH 4TSAH 1U93B 3BXNA 3L4ZA 4NRZA 3IM1A 1NBQA 5DFTA 3T09A 3BDYL 3QIUC 3QDJB 5I8KL 4HJIA 5J1TC 3NN8A 1JGEB 2HLEB 2Z7ZA 3IFPB 5C6TL 4APQA 4OUUB 1P5UB 1BZ8A 3W11C 2PR9A 3WUZA 2DMHA 1D5ZB 4M5YL 2DYPD 3BVNA 3MCLH 5IIEB 5DVKA 2FUQA 2MNJB 3MV8E 5ABAA 3QSKB 2ICCA 4MMXC 3T0WA 2YSTA 3BE1L 2VRAA 1H8OA 4P59H 5DJ2A 3EO9H 5EO1B 5DWUL 8CGTA 1VA9A 4AGNA 2P5EB 2FX7L 2ZJSL 4L3EB 2OYMA 4O2EA 3E1ZA 4R3SA 5B7FA 1P7QB 3RDJA 3SE4C 3CPLB 2OCCB 4OZFB 2BRRH 1HIML 4KBPA 1LO5A 1QFWL 4PJDE 5AW3B 4PLJD 2C1PA 4ACTA 1SMAA 1LNUB 3OD3A 5CMAA 2YBRB 4S1RL 3K2UH 2MQ3A 1OGSA 4Y19D 2EE3A 2WLLA 4L4VE 3APCA 5FB8A 3LN4B 4RMSA 4I18C 9CGTA 4HX1A 3ILDA 4QT5B 1RUMH 4YWGL 3UZQB 3QXDA 5F97E 4ZMOA 1MCOH 2IOOA 5D71L 4NQEA 3MFFA 2BSSB 3H8NA 1V3KA 4HOWA 5IEHA 1EJFA 4YQXL 4M61B 3B9DA 3DX0A 2F61A 3MNZA 4HZAA 4ODUA 4KKLC 2L0DA 3NCYS 1II4E 2OA9A 2H7WA 2TSAA 3K72A 4L5FL 4J1UB 4NJ9H 5D1ZB 1JGVL 5F9OL 4Z23A 5J0BA 1BIIA 3AY4C 4Z8FL 5EUOB 2X9WA 3NMEA 5EUKB 3ASNB 2HTLD 3ARUA 3CVBA 5AD0A 2FIRT 4FI7A 3TA3D 1RL1A 4Z77B 5E95B 4BQ9A 1BG9A 1RXLA 1THAA 3MTXA 1MRFL 3RWFB 3L3KB 4HMDA 4KMQA 4PJFB 5CJQH 2DYSB 4R7NB 1PJWA 3NVQA 4V2CB 4CRPA 5D72L 5HYIA 1W91A 5IMOB 4P2RA 4FAAB 1UCBH 1OAQH 2LAAA 5CGBA 3F62A 3QIUA 4OJFL 3MRBA 4G8GD 3U2JA 5GGSA 2Z31A 3R8QA 1E4WH 4KAQH 5EHFA 2EH7H 4FLRA 2WGXA 1E8WA 1BZ9A 1OEZW 2X2UA 5EU4A 1WUNT 2EUVA 3WHE1 5L2JB 4KK5C 5EBMA 3REVB 5KZCB 2NNAA 1BPVA 5GS0C 3MGTB 4MMXA 3ZDXF 1ZLDA 2PCPB 2YKLH 3B4NA 1UJ3B 1G7HA 1BD2B 2BP5M 2O4EA 4HGWA 3S5LB 1DVYA 4NBYB 3CN2A 4U1GC 5A2AA 1FAIL 3IXAB 2WLJA 3KNBB 2E7CA 1UA3A 12E8L 3QUMH 3THMH 3F05A 4MJID 2DQEH 5E8DH 4JO2H 1AGBB 1OK8A 1TO5A 2YA2A 3MLUL 3TNNA 1MSPA 1JOIA 1MCHA 1I4FA 6TAAA 2ICEB 4Z7QB 5I1JL 2EIZA 4X99A 2ESVB 5IW1B 4IRJC 3ZQXA 3CDZA 4TLKA 2EXWC 5K9OA 2X6BA 3HI6L 1SYSA 4PWGA 1J9RA 1E2WA 4ZFFB 2FSEA 2MOGA 3UBHA 1J11A 2VN7A 1DL7L 2UWEE 4BH7A 3CFJA 2MNUA 2MOVA 5FUCE 2MTPA 3WEXB 2MSPA 4PV8B 3VD7A 1D5IH 1PDKB 4PGEA 1E6JL 3RWCB 1JZEA 3CH1B 4JHWL 4WJ5B 5L6YH 2ICWJ 4DTGL 4HF5L 4PRPE 1BM7A 5F9JB 3QEQA 4QRPB 4NXKA 1G9ML 2FHFA 3FQYA 2H4EA 3RU8L 3IFLL 5CEYB 3H2QA 1QACA 3ZR5A 3EYFA 3X1EA 2WJ7A 3OHXA 2DQJH 3BIKA 3ALXA 5GGVY 3HN3A 2YAPA 4XP4L 1NFIB 4M8VA 1HDMB 3SDXE 4MZ3A 2DQHL 2J1XA 4PJDF 3P9LB 3MRFB 3BP7A 1KTDB 3UMTA 4NC0B 2ZCHH 1TDQA 3QS3A 3ZKND 4MDRA 5D7LE 5BRQA 3FMGL 3IAGC 1G7LB 1KB5L 1WISA 1T1XA 5FYKH 4QRFA 3W9EA 3EG9B 3A4AA 1FL6A 3F85A 2WINB 3VXOB 2UX6A 1QSVA 2F7OA 2ZQKA 1VERA 1VZHA 4PJGE 2H1PH 3TT3L 1ZY9A 3DV4B 3KYNA 1EVTC 1X7SA 2OJ1A 4M1CD 4EXPX 3IKCA 1X5IA 1C08A 4PEEA 4FI6A 5KYWB 5TGBA 2OMYB 4YMPA 3BH8B 2AK4B 2OMXB 3L5XH 3KVQA 4KJWC 4HCRA 4QMEA 3RBSA 4Q6KA 3BVXA 3CXDL 4J3TA 1F3JA 1KCBA 4GKLA 2BP3A 2VXUL 4PJ9D 1W0YT 1DBMH 3DVIA 2XT1B 3SDYH 4RGMB 2IH1B 2QLVB 3VD0A 3MXVH 3AREC 3GM8A 2NY5H 1AGDA 1TU2A 3CPUA 3S3PA 3ZOAA 1UD2A 1IC0A 4PJXA 4IRJA 2R39A 3B5GA 3QJZA 1N0LA 3PWUA 1N7MH 3U2SA 3WS6A 2P7TA 1AQDA 3N1GC 3T2PA 5KSAA 2EDQA 4JRLA 2UVEA 2OPCA 2CE6A 1J8HD 4P3CH 2YFOA 3O41B 1QRND 4N0UB 5F7DA 3QC5X 3BFQG 4JFZL 1A9EA 2BIMA 2H3XC 2NXZD 2VIRB 3I6LE 3IVKA 1SMDA 3EFOB 3VXUD 2QQNH 1Y18A 3U6RA 3QRGH 5DJCB 1CGSH 1QABA 3O8XD 1JWMB 4C4BA 4O5LL 1SXAA 4XXWC 4YDIL 3VD9A 3FAWA 2V7NB 5BVJB 1FSKB 1S5HA 1EEYB 1WH0A 1RHHA 4LMQE 5A3IC 2R8SH 3LSOA 1KZYA 3MRMA 3O11A 1NEZA 3P30L 4IIZA 1U3HB 3LRLA 4LBEA 5E4OA 1A14H 4YBQC 5KG9B 1G87A 2P24B 1EGJA 4JO5A 1Q9LA 2CUIA 4ICWA 4PCYA 5KBNC 3QWQB 4Y5XB 2F9BT 1J88A 1AKJB 3ABZA 1MQKL 1I9IL 3GHEL 3P77B 4O4YL 5E94A 4CN4A 2X05A 3ZJAA 3NJNA 3BUYB 1TQCC 3GNMH 2WXLA 2XG4A 1NLDL 3LKSA 2D9CA 2EYTA 3BP4A 3MMEA 2I24N 3QEUA 4XNDA 3MV8D 1SYVA 2R7EA 3VXTB 4A6YH 2HN7B 4Y4HB 4G8FB 4DCQB 4GAGL 4FXKB 4HKJB 2RJMA 2WKOA 2MPAH 4XX5A 2MQCA 5LBSH 3GLZA 5EEZA 2NY0D 3RTQD 4AXWA 4D8PA 3SPCA 2UXFA 4EI6B 4KKPA 1BZOA 1UB5A 3H9HB 5AEAA 3S7GA 1JF1B 1VDGA 5FM4A 3TU6A 4YSSA 3KMDA 1VKXA 1BMZA 3Q8CA 4OUOA 4D0DA 3CK0H 5F93C 1YMME 4EUPG 2BOCB 5CD3A 5JNYB 1DJWA 3POCA 4M6OH 2ED8A 3EBIA 4U3XA 3EOAA 3AREA 3BKJL 3HJ0A 3IAPA 3DURB 3UTSE 4DZ8A 1ADQH 4L4VD 5E6IC 1RZ8A 1XGZA 4HGKC 3TBWB 4TRPL 5BUGA 2VM4A 2QPEB 2WBJB 3BQUA 1XAKA 3RY6C 2HT4D 2X38A 3ROLB 5D7HA 2OQJA 4ZX6A 2VL4A 3HE7D 4ZT1A 3BJLA 2Y69B 5IW6B 4GKNA 3L54A 1WYJA 5I26A 3CZFA 3L7FB 3V6FB 5HPMA 4OCWH 1NIBA 2YXMA 3QRLA 3G08A 1OSPL 5I30H 1IFHH 2FWOA 5TE4L 1KFAL 4KKCC 2YD1A 1P4LB 2CIIB 1BQKA 3V9FA 1XZWA 1DR9A 2H32H 4P3WA 3BSZA 1U30A 1SBSH 3MRCB 4X7SH 1S7TB 4PJBA 2E59A 4XXWA 3TBYA 4XP1H 2WWOA 5CZVH 1G1YA 2HX7A 2H9GB 5DTFB 4A66A 3AXHA 2X89D 2DWYA 3V2AR 1T4WA 3RLSA 1QLEL 2HLAB 4R4BB 5TF1L 1GA2A 4XXDB 1ZANH 4Z7WA 5FOJA 2ADIB 1BVNP 2UY6A 3FT2B 4GG8B 2FO1A 1J86A 2WXFA 5D7EA 1Q1JH 4WO4A 1EHXA 2VLRB 3P4MA 2XBDA 5D9SB 5BZWA 1U8PA 3VFUA 1CK0L 3MV9E 2CAKA 5E7BA 3VD3A 4HS3A 4OZHE 2H1LM 5T3XL 5LUMA 4EZJA 3IFNL 5JIHA 3U6XS 4XAWL 4LK4A 2BC4A 4ZQTA 4KX7A 2B4CL 3MROA 4F33B 1LE5B 1XL6A 4FP8H 3OSVA 3Q01A 1E8YA 4PAZA 4GSRA 1P9MA 4C4UA 5EIIB 2X6MA 1KXQA 1XT5A 1GJUA 4I2XB 1H5BA 1INQA 2R59A 4W4NA 3ARQA 3CXFA 3DHUA 3WUWG 3DX7A 1O9WA 3VM7A 1EAJA 4XC1L 3M17A 3ETBF 5C0EA 1PNDA 1WD9A 2GAZA 5KTEH 1P84J 3TWCH 4NRXB 3DYMA 4P4KB 4B9KC 4IDLA 1G7MB 3ZYIA 3VQLA 5LGHL 3G6DH 4I13B 3S96B 1W8NA 3UABA 3BD4A 4YPGB 4YHZL 3NAAL 4X0KA 5I16B 5IVOA 1G0XA 1LDPL 3QQ9D 3V0DA 4C83B 5IQ7H 1ZGLA 5E6IA 1JN6B 4AZ8B 3CFDB 3DA0A 1F4XL 1FNHA 1VEMA 2N59A 5F88A 4JRWA 1BBDL 4KJYA 4LDEB 3L4WA 5KEZA 5KUKA 4KZDH 2B14A 4JG1H 2GCYA 1OCRB 4YC2B 1G4MA 5LB1A 1XEDA 1PD0A 2O61A 4I9WE 4QJ3B 4NZTH 3NABL 3ECQA 1BLNB 1KJVB 2W0FB 5DZVA 4CMMB 3UG3A 3VNYA 2F5BH 5IP4A 4PRPD 4GY4A 3K4AA 4IW4C 1I1YA 1MCCA 1M05A 1XCTB 2VDPL 4NHUB 5CSGA 2FQDA 2FGZA 2VDOL 3TIEA 4RCAA 2P43B 4FABL 4ECNA 1W0VA 5L7XL 3B2UC 3PFQA 4WSJA 2X7LB 1X5FA 4JHUA 3BT2H 2CKBH 2VN3A 1YQVL 5IMMB 4L4TB 1U8LB 1PZ3A 2C7UA 4Y4KD 2JELL 3DBSA 4LPWA 1BZDA 2LVCA 3QG7L 3HMXA 5D7LD 4QKXB 1T66C 1OQOA 1H3TA 3I74A 4UIMB 3WENA 5DRXB 4QTHA 4JGNA 3UTOA 4PI2A 2E47A 2BZ7A 5I6OA 1KJ2L 2APFA 4LOUC 1QR1A 3IEAA 3F7LA 2ITEA 2CO4A 3MJ7B 4A55A 4POYA 3NIGB 1JAEA 3SGEI 3EYQC 4E36A 3ABKB 4CAGA 2LAGB 3GJEA 3MRRA 3ENEA 4RAVB 3UP1A 5SWQB 1G1CA 4XHJC 4BUGA 4XCFH 5T1DL 4PWJA 4ATTA 2BOBA 4K3EL 1DJSA 1H19A 4JM0A 3MA7B 2R1YA 1NEUA 3LHAA 1KLFA 3NIDB 4JS7A 1HU8A 2GHZA 5EWIH 3EGXB 4JRXA 2WJ5A 4U6VH 4YVNA 4GUQA 1UACH 1ZS8B 3SYPA 2VERA 3CCHA 1F6AB 1NJ9A 3NJLA 2IAMD 2X6AA 1HFUA 1KYOJ 2O5NA 4PY8I 5A2JH 3GXPA 2VT0A 1IM9B 2PWDA 3NGBB 5DC2A 2G3XA 5ITBL 4IIQC 5C09E 1YEHL 5TTRA 2AXJA 1MRDH 5I0WA 1YEIL 5TH2A 5DUBA 3L3DB 2DQMA 2GSMB 2BHYA 4OZHF 1SOKA 1QFWI 1D5MA 4MNQB 4RDQG 3EDDA 3DMMA 5MEPA 2OBGA 5I1DA 3U4EB 4JFEB 4GQPH 3BP6B 3SGDH 1BOGB 2D03H 4UOJA 1O6SB 3MLRL 5F6HI 3GJFH 2UXGA 3I6LD 3K6SB 3ZYJA 2YGPA 4MASA 3FH8A 1OHZA 5FK9A 1DQKA 2RALA 1S9YB 2FLMA 2MOQA 4HIJB 1FLTX 1U8MB 3T0VA 1OO2A 2BVQA 1D7FA 3CVHH 2DF3A 4GQRA 5J11C 4RSYA 1XSKA 1A1NB 1FNEB 2Z92B 3GO1L 3P1VA 1HILB 1V3MA 2R69L 4GUOA 5HHVL 3ZIYA 5IHWA 1TO4A 3KPOA 4M6NL 1XB6A 3FAXA 4NNYA 3D85B 5DJ6A 3PJSB 3PL6B 4TQ8A 4I0PC 1IBYA 1SXCA 1WFUA 3C8DA 3QJOA 4WAFA 5DD3L 5KS9A 2XTJC 3WIHH 5DJZB 3GSQB 4O02B 5E2UH 4GSUA 2OAAA 5FHAH 1AR1D 2CO2A 2K8MA 3DI2B 3JUZA 2Y7OA 3EAKA 4LRNL 2AC0A 2A0LC 2Y23A 1ID5I 1YY9D 4LF3A 3L1FA 1QFUH 5HY9A 3PXHA 1TYEB 3T4AB 5BVPL 2O26U 2VLKB 3US0A 1BMGA 1KCRH 2UZXA 3G5VB 3HNTH 1RSFA 4X0NA 1SDYA 2R1XA 5HHOA 4F15C 4FC3E 1K2DB 1P7HL 3KPQB 4LCCB 5HJ3A 4GO8A 1OARH 3Q2LA 3FCSA 1QYGH 5D7SL 1UASA 3K46A 1YMMD 4HC1A 5IVXE 2BNUB 4NWTH 2XQBH 4HMEA 2ZX6A 4FFWC 5F6IB 2EDHA 2JJTA 3QQNA 4HFUL 3EJRA 3UTSD 4WW1B 1FDLL 3TASA 2NYYC 4LFHG 3DO7B 3D3VE 1CG9A 3RVTD 4XNZC 1JZ4A 3NSJA 4PJCB 3T6WA 4AQ8A 2CBQA 2BO0A 5EEWA 3O6ML 3NCMA 4RWYH 4NDMB 5CGTA 2XTLA 4I5BA 1A7RH 4W4OA 1A6AB 1EV2E 1GKOA 3MJ8B 1N5YH 4H7VA 4FYTA 4NN6C 5HVGB 3WEBA 5JPMC 1YSOA 2WUBH 4ADIA 1J1PL 3H0TA 5IB2B 4WDIA 4LQFL 1IVLA 2WIMA 3O3AB 4P9MH 2NY6B 3IDXL 3AB0C 1MFEL 5LHDA 4IU2B 4H25A 1B4TA 1KIPB 3F6IA 4MB1A 1CLVA 1BXAA 2K7QA 4PJHE 4ZRGA 3VCLA 4JUTA 2R29H 3BXNB 2ZYIA 5D2NC 5FCUL 4NRZB 4JKLA 4HUXB 3TONA 2YWYA 2WKLA 5GGTH 3NN8B 3ZUNC 3UTQA 3LXUX 3BZFA 2F15A 4HEMA 2N0KA 2J7LA 5K9QI 3MV9D 4XZUA 1GYWA 2BMKA 2BY3A 1H15A 2WGNB 3LDBC 3NFPA 2V6HA 1QSEE 3A21A 3C5ZD 4Z7NB 3LB6D 3HMWH 4GFTB 2BIOA 4RMTA 5JHLA 3MLTA 4OIIL 4MHHG 1NBYA 2FBJH 1YEGH 3BP5A 5DJ2B 5IOPA 4XRCA 3SBWA 1NICA 4WI7A 5TQ2H 3T3ME 1UYWL 3RFRA 4JFTA 2XBZA 3LXCA 4JE0A 4R4FL 4R5VA 3G9VA 4O2EB 4PV9B 5E24E 2ATPA 2CU9A 3FT9A 3ARRA 1N2RA 4GW4B 4HUVA 4FMVA 4JFUA 4JFWA 5FW8A 1YEFH 1HT6A 2FT6A 1CDGA 2HZHA 4GG6E 3VA6A 4PJ6A 4GI9A 2ZWKA 2HTLC 1AG6A 1XH3B 2LR4A 1ETZA 4H88H 2WLLB 5CWSA 3WTYA 3FCGA 1NUFA 2V7HA 5FB8B 3BRDA 1JZ8A 3BZ4B 4HX1B 1YECH 1XGYH 4MKMA 2Q3AA 2IG2L 3MFFB 5I8KH 1ROWA 2QFRA 3CU7A 3HCVB 3MPCA 2VZOA 1BVZA 2WXQA 2XIIA 3VGGA 4O9HL 3S88L 1OV8A 4UAHA 5I6LA 5D4QA 5JMRA 1VB9A 4N2BA 4O00A 1JWUB 3GXTA 4M5YH 2N4IA 3QFDA 3VAEA 3F7YB 2I32A 4I9WD 4BK5C 3K72B 4P5TD 1QOKA 1BIIB 1LO2L 1ODUA 3BE1H 3R0NA 1MNNA 1WCBA 5JPMA 1L9SA 5DWUH 1BFVH 2FX7H 2K7PA 4WFEE 3KGTA 4PRHB 5HGBB 3B7RL 5HI5D 1U42A 3LN5A 4CADA 1W0WB 5BV7C 4XO9A 3VGDA 1BPLB 2GJ6E 1UJTA 5IQLA 3EJCA 1HIMH 2RQEA 4FYRA 3DXAA 3QBTB 3MV7A 4KQ4L 5CSZA 4F57L 5AZ2H 2G30A 1KXTA 3JT2A 2WO3B 4L37B 5D2NA 1R33A 1CDHA 5BQDA 2OSWA 3OKKA 4P2RB 4S1RH 3U36A 4XB7A 4B5EA 2AEQL 2FUTA 4U3SB 2LGNA 4RISL 3VMPA 2BWIA 1JL8A 3ECWA 3MRBB 2CJTA 2NSXA 1ZJAA 2P28B 4YWGH 1S7UA 3P73A 2Z31B 3QORA 3VFMA 5D71H 2CUAA 3PPSA 2L8AA 2VXVL 5EU4B 1H8NA 5DHMC 1G9NL 3BKCL 2NNAB 1B0GA 4YQXH 1G5AA 5J9PA 3CN0A 1I31A 1V5JA 4PB0H 2Z91A 1G7HB 3UL4A 5MENA 1BQHG 1CGXA 2EVGA 3KYAA 4IGBB 4L5FH 2WPGA 1JGVH 3WIAA 4NFDA 1P1VA 4H8WL 3IPEA 3MJGX 4IBLT 4Z8FH 2D7QA 4ZNEE 3WCYA 4HFWB 2WO4A 4W9FC 5F9WC 5DZOA 3TNNB 2EXSA 2VMCA 1GYAA 1KGJA 4A2GA 1I4FB 1I8KA 1NEPA 2DKUA 2WTPA 4GSXA 5T1LD 5GPRA 3POHA 5AW9B 5H37H 4UZGA 2JLLA 3CDZB 4PJHF 1OT4A 3HAEH 4G5AA 4ZYKB 5JQ6L 1XTLA 3KR3L 5BPPA 3GRBA 1SYSB 1U8KB 2FSEB 4JE4B 2IDSA 1NCWL 3ASWA 2APBA 1MW0A 4XCCL 5C09D 4ZODA 4Y9EA 4BH7B 3CFJB 3QEGH 3L9RB 4K07A 3KXFB 3S5ZA 4M3JA 4F7KA 4OJFH 4PGEB 3D4YA 2I7OA 2NY2D 4C4KO 1QWNA 1RIVL 4KDTC 1JHLL 1QBLL 1TTBA 2G9HA 4UZSA 5E2VL 1KGUA 2GJZB 3NZSA 4BK5A 2CCLA 2X6VA 1QA9A 5D7IB 3EYFB 4ODXB 1ROCA 4ZMPA 1M7UA 3OHXB 4ILDA 4TF4A 2I9LB 3T3MF 1J0ZA 3CMOL 5T1MB 1WWCA 4BA0A 2X9YA 5EOTB 2K45A 5LO7A 12E8H 1WS7A 4AI7A 4ZW7A 3R7RA 3O45A 1HAUA 2UXVA 3DX8A 2DTML 2E27L 1SN2A 4U3CA 4KKNA 4EZMA 4QY8A 4GG6F 1EX0A 5I1JH 1T20B 3LNFA 4FLHA 3B2PA 2Q10A 1T1XB 3GXMA 1WLHA 1RPQA 3L7EA 3CZEA 5CLYA 5DFVD 1DL7H 5KBPA 1SLXA 3IKCB 2XX0A 3PJNA 1HH6B 1C08B 2BFVL 5A2FA 3S4SA 3GSWA 4LGSB 4W70A 1BX2A 1C7SA 1UWEL 3CZGA 1GC1L 4JHWH 1RULL 4PJ7A 1EDHA 2ZICA 5KYXA 3SOTA 4UI2A 5CCGE 4DTGH 4HF5H 4LLDA 4ABWA 5IG7B 1AVAA 1N10A 1G9MH 1RFDL 3JXAA 3RU8H 2DQ6A 5H4ZA 5DMYA 1HJBC 1FF5A 3Q9PA 2EE6A 2JCCA 4G9FB 4BXSV 3SDDC 2YEQA 3FO9B 3LKNA 3N41B 1G1OA 4XP4H 3WO4C 1GOFA 1NAKH 4KK6C 1EPFA 2DQHH 3LZRA 4R5XA 7PCYA 3C6EA 4IHOB 1N0LB 3PWUB 3U2SB 1IGJA 2GJPA 1AQDB 2DS4A 2PXYD 3FMGH 4N0YL 3H1ZA 4QOKA 1J1XL 4EXKA 5KSAB 1KB5H 2COVD 2Q9OA 4KXDA 3D3VD 4Z3JA 1HHKA 1JNNH 3GIZL 4NZJA 4L9DA 3TO2A 4FQXA 1P7BA 4ELKB 4NQCB 3TT3H 4V2BA 2Y7SA 1NGYB 3TP4A 1EXGA 4GIAA 1A9EB 4KDTA 3DBXA 5KVMC 3IVKB 4FOMA 4FQJL 4DGVL 4HBCL 4EIUA 1Y18B 4Y1AE 3KLKA 4XPFL 1J5CA 2QT6A 3CXDH 3JWOL 4GRWH 1X44A 1S5HB 1RHHB 2J20A 2WLKA 3II3A 3SE9L 3LSOB 2ERJB 3O4OC 5KSUB 1SVBA 1WFIA 4LBEB 2VXUH 2A9NL 3HA0A 5BS0E 1OPGL 1AO7E 3FN0H 5EF1A 3RTQC 4K9EC 4QRTA 1TJMA 4G80A 3QUXC 4WEUD 5GRVL 1JTPA 1NFKA 2DH3A 4HSQA 1SXNA 5E2TL 4HKXA 5E94B 5IQOA 4MAYD 3L1EA 2LFEA 4HT1L 3AU0A 2Z35B 1WBYA 5CP7A 4I0CC 3NCBB 5EO0A 1QSED 3GMMA 4A2HA 1AZCA 2A5UA 3MMEB 3QEUB 4L9LC 4ONGH 3PPEA 2AEWA 3FYIB 4DEUA 2DIBA 4OD2B 4JFZH 1IAOB 5E2JA 4ZFZA 3G6JA 4NUQA 3NIFF 4PJ8D 4HPHA 3CH8A 3ZE0B 2MEJB 3HE7C 4K94C 1CQKA 1L5GA 1MRCL 3J07A 4BDVB 1I8MA 2W0LA 3U0WH 2LU3A 4O5LH 1VKXB 3MI6A 4H20L 1JERA 1E9QA 5CD3B 1NCHA 5KVFE 6PAZA 4DFIA 3SDDA 1OP4A 3P30H 3MRDA 2GTWB 3PHOB 2QGCA 4Z7VA 1F3DH 3FUJA 4GT0A 1ZVHA 3VXRA 3FCUB 4ANKA 4OCXL 4G1MA 3CJJA 5JHAA 5EOCL 1G6RB 1KWGA 4WTXA 3BQUB 3LHPH 3ZKXC 3ZHKA 4FHBD 1MQKH 1I9IH 3GHEH 1NANI 5E1AB 4O4YH 4XI5C 3ZKMD 4KKZA 5DRZA 4RRPA 3CSTA 4OZFG 4X4YA 5HPMB 1NLDH 3G08B 2FWOB 5IESL 4QR7A 4HU2A 2A9DA 5JZ7D 2G4GA 3TEWA 1B90A 4U3HA 2HCZX 3HC3H 3GI9L 1ZD6A 3B8SA 5C07A 2OW7A 4GAGH 1YVLA 2VDKL 3H53A 1WITA 4PW4A 3KYMA 3TZVD 2E7DA 5B7MA 3PAZA 4GBXC 2F1EA 3K2IA 1E2ZA 1FO0L 2PABA 2EH8H 5LVEA 3I84A 5IQMA 2EIEA 3ESVF 4WFED 4YE4L 1GS6X 3JTBA 3LPFA 3G9AB 1HWWA 2GJ6D 2X9ZA 2OZNA 4Z7WB 4PRBA 3UTPE 2XLLA 2OW6A 4WO4B 3QUXA 1FNAA 3RAJL 4TOYL 3TO4B 3BKJH 3V6BR 3MCG1 4ZDHB 5HHME 4BXVA 5IR1A 3F7VB 1ZA6A 3N44F 1D6VH 1I3VA 5MEQA 1ZK9A 4X8XA 4TRPH 4AV4A 4PLKC 1PG7L 4L3AA 5AW4B 2UYLB 5CJXC 2APTA 4CVZA 1MI5E 1OKEA 3MROB 3GZOA 5K5YA 4HLZG 1UT1A 3H7LA 1KT2A 4PSPA 1WFOA 2WXOA 4ZO9A 3P40A 5F9DC 3RWEB 2E9GA 1LO4L 2H3NA 1QFOA 1BYPA 4L9LA 2E76C 1H5BB 1INQB 3ARTA 1OSPH 2BCKA 3W0WD 5TE4H 4MHHI 3WJJC 4GAJH 3IMBA 1KEML 1SLUA 4OV6F 4AMWA 3G5WA 1QR4A 5C0EB 4MJ4A 4NRYA 2GAZB 3V7AE 4G43A 3N9GL 3V4VB 2YD8A 5CD5D 4JLRB 1X4ZA 4MD4A 4OH2A 4TNWK 2ZNXA 5CZKA 1QKZL 2LU7A 2ZCZA 1FRGL 3MX0A 4YE0A 3BW9B 4PW9A 2YXVA 3NDYE 3P4LA 2JIXD 2HVKB 2UUDH 3OWRA 5FGCE 5TF1H 4X0KB 3DHMA 5EBLB 1ZGLB 4ESKA 5DT1L 3S5LG 1LEGA 1E5YA 1X3DA 3KLAA 2YMOA 4JFSA 2YLHA 2PW1B 1CK0H 2QR0A 4BKLA 4OZGA 2G2RA 2GCYB 1OOAA 1L9PA 3S3DB 1T89C 3IFNH 4DP2X 3RPIA 2FO8A 1RIHL 3AFLA 2B4CH 3FT4B 2ZX9A 4LU5H 1R17A 1JSYA 1K9TA 1U2CA 5PCYA 2BNQE 1I1YB 2BY2A 4U6TA 1M05B 1BIHA 2WLNA 1CF1A 5FYJU 2FEDC 3E38A 4K7FA 2Z8WC 2ZXBA 4XC1H 1KJMA 3II2A 4GBXA 3AT0A 3F7PC 1O7DE 3HG1D 4QXTA 1IFRA 2ZD0A 2IPKA 2W94A 3QPQD 1HEJC 1J48A 2R0LL 5AUMB 2P80A 4MQXD 1R1CA 4XCYA 3OXSB 2DDQH 3HB3B 1KXVA 1H8SA 4LSUL 5LGJA 5G5DA 2ZXEB 3EJZC 3PHSA 1OQXA 4NKOA 4YHZH 4XNXL 4AIZA 3NAAH 4QTHB 1YPZF 3C09C 2X41A 1SHMA 2IAMC 3E0GA 4PLNC 1PY4A 1BBDH 2CBMA 5CJXA 2CUMA 4Z1PA 3D34A 5CGYD 2DI7A 4A6YA 1AHMA 1XF1A 5DF0A 5EZPA 2FWSA 3MUJA 3K0WA 4NO2A 3D87B 2IDCA 1ESOA 3BUIA 1R5VA 1KIUA 3SKNB 3LD8C 2KHAA 2HWZL 5DUPH 2ARJQ 1X5HA 3GRWL 2D31A 5HGDB 5JW4R 4AYGA 2WLHA 3F12A 1NCOA 2K8QA 2R9HD 2P5WE 4ZW5A 3T0BA 3EDEA 5DA4A 2R1YB 3WJJA 4FYSA 1ZLWK 5LQBL 1KLFB 2VDPH 2VDOH 3EUUA 3UH8A 4DZBA 4U1IA 4JRXB 2FBOJ 5J6HA 5L7XH 3KPRB 4LDOB 4N3UA 3ZYZA 5I6XB 1VGKA 3CCHB 3QHFL 1YQVH 3VFWA 1NJ9B 3HUJB 1OAKL 1E4HA 1KG0B 1ZVSB 4M3HA 2JELH 4E41B 2YD7A 3QQXA 4GRMA 2A2QT 1B3JA 1M9WA 1A1MB 3KCPA 4U1LA 3QG7H 5TH2B 1IGIH 1PMYA 1CS6A 1JS4A 1VJSA 4FULA 4JMNA 3S2CA 4ZFOL 1EHLL 1MW2A 3F7QA 2BFGA 4AKOA 4HOMA 1NFDA 2PO6B 3DMMB 3DTDA 4N0FA 5I1DB 3ZKQD 3EXLA 2NY7L 3T3PE 1KJ2H 2VXTH 1T89A 4BCZA 4HWBA 1ZSHA 3E7JA 5EU7C 1AZNA 5H2BB 5E8NA 4GAYB 5T3ZL 4QDGA 3Q2NA 3ZT5A 2XIBA 4Y1AD 1NDTA 2VSKB 3F3HA 1WA1X 5BV7H 3CFNA 5AVXB 5CEZE 2E7MA 3MV11 4JREB 2BVQB 4W9ZA 4OJCA 3PWVB 2I9TA 4NAQA 4MXQD 4XNMA 4PRDA 1RZGA 5HJDA 1Z66A 1NANH 5TE7L 5BUPA 4QJ4B 3LH2L 1GJIA 1ACCA 4HMCA 3KM2A 5BS0D 4ZSOA 1AO7D 1YEDA 3KPOB 3KPTA 2E4TA 2DBJA 3VRJB 3UCRA 4JUSA 4OI8A 4HSAC 5JIMA 3AY2A 4FDWA 2A38A 1YEHH 3DPDA 4Y1SA 2CA4A 2CG9X 3T8VA 5I8OL 1PKOA 1RMFL 5EZIH 3QVAA 4JPQA 1NWOA 3CUPA 1I9EA 5FYJE 4JO1L 3QUYC 1W8OA 4PGCB 3MRGA 4CILA 4LF3B 5A43C 1I1FA 3FH5A 3BN9D 3MLRH 2NR6A 3BDXA 2ZKXA 5SV3A 3ARBC 4DESA 5C0AB 1EUTA 2UZXB 4LIQE 1PVHA 2R1XB 4XNQB 5HHOB 2EQDA 2CLZA 4JG9A 1WBXA 1C1EL 5HJ3B 3VH8B 5I71B 1Z5HA 4R97B 4J12A 4W9HC 1I1AB 2R51A 4JQXC 4GMSL 1DYZA 1C5DA 3WU1A 3GSVA 3GO1H 2YPKA 3SO3C 3ZTCC 4PJAE 2R69H 4N2AA 5HHVH 4MYWB 3IE4A 3RL1A 3WNMA 5KANI 1MWAL 3TNMA 4W6YB 3BGFB 1DUZA 1CG9B 1F5WA 3Q0HA 3UTTA 4S2SA 5J12C 3WLWC 4G83A 1DO6A 4P23C 3FZUD 1W6LA 2R4RL 2DOCA 3OLIA 1J05A 2IGFL 2CRYA 4S1QL 5DD3H 3MKGA 1BECA 4I5BB 4M29A 4MNGA 2FEJA 4FJ6A 4NZDA 2EE9A 4CUCA 1G94A 4QKTA 1MFCL 2G9KA 4AM0Q 4LRNH 3H0TB 3QQDB 4EOWL 1QVOA 1UZ6F 4GKOA 4WDIB 1URLA 5INCB 3ZY7A 4OQTL 5FHBL 4BEIA 1OE2A 3LB6C 3T2OA 1NM9A 4AUUA 2E46A 4PIBA 5BVPH 3LQZB 1U8QA 4LLYA 3SKMA 4EE2A 3QZPA 2WZ0A 4KJQC 3HZVB 3L17A 4MJ6A 3C12A 2R0WL 4X6CA 3QO1A 3CC1A 3BGAA 1UXSA 5D7SH 3X1FA 2W07A 1YJDC 4PRAA 4K3DL 3UTPD 3F65A 1AQKL 1KYUA 4XE0A 1QSFE 5FDWA 3UTQB 2HT3D 3BZFB 1JK9B 1DCLA 4YBLB 3WS3B 5HHMD 4HFUH 3GMOA 3L9EA 3MNWA 4XZUB 3MRKA 4PREA 1CXHA 1FZOB 3BWZA 5C0CB 5ACLA 3FT1A 3ARDC 4DAGL 4CU6A 4LFHD 3HC4L 5EG6C 3O6MH 1JPEA 3FFCE 4L1BA 3OMZA 3WEAA 1CXIA 5E9DE 4D0BA 4HLEA 2EABA 2R15A 2NW3A 2FD6L 3FRPB 3T3PF 1JZIA 5A6IA 5ISZE 1KTJA 3BP5B 4XRCB 3QUYA 1KB9K 2K4AA 3C5SB 3CVCA 1ZT7A 3H6JA 1T5KA 4MX7B 4R90L 1FUNA 1J1PH 3MJ6A 5IBUB 3UBXB 3SY6A 2CIKA 5J4MA 1N2RB 3F6LA 3IDXH 4AT6A 1MFEH 1LQBC 2B0SL 5J56B 2H47C 1NBCA 2JK5B 3IS1X 4I4WA 5GRUH 1ZJBA 2G5BA 5FCUH 2IGTA 5EIIG 5AWNL 5GZNA 3SJVE 5BXFA 4TQPA 3C6LA 5JDSB 3IMTA 4RH4A 1WP6A 3QI9C 3PDOA 2CR0A 2IV8A 3OX8A 4OF5A 3TTYA 3WAKA 2K1MA 2WWNA 3CDFA 4RQQA 3VFRA 4HKZA 2IC2A 1NDGA 1EXUA 2WCSA 4C56E 1ORQA 4LVNC 2WZ5A 4GW5B 2QQQA 3TV3H 3QFDB 4R5TA 32C2A 3FQUA 5ESQB 4OLWL 3VFTB 3DO4A 1F4HA 4OVVA 3DDFA 3H9ZA 3ARFC 3LYRA 1WCBB 2BNQD 2Y7QA 5G4NA 1J12A 2YPVL 1SNRA 1U41A 1OB1A 2VH5L 4B9PA 1UYWH 5C7XL 3P4OB 5HBBA 4R4FH 3WMPA 3WEMA 4FRWA 2AAAA 2WXMA 3HI1A 2EXYD 1BF2A 1CZ8L 1D7DA 1U3YA 3MV7B 4YSPA 2ED9A 3RI5K 4UM8A 2P44B 3GF8A 5D1XB 3U36B 2J6EL 1CBVL 4NCDA 4PJAF 3QDGB 5FEBA 2WWKO 4A7QA 4PWHA 2HX9A 1TSRA 3QORB 3UCQA 3JWDC 2IG2H 3KBFA 4A2FA 2B59A 2E9IA 4LSPH 4NI6A 3FT0A 4M1DL 3S88H 3U9UA 3ZZSA 1MFAL 5DHYA 3LN9A 1UEMA 4XBPA 2CO7A 2FWLB 1T0OA 2GSGA 3LKOA 4UOW0 4WQOA 1CD0A 4JFPA 1KYDA 1U2YA 1LO2H 3L3GA 3BD5A 2H0EA 2I85A 2P5WD 2VZ3A 3WIIL 1HHJB 1CT8A 1T1WB 3GMLA 1JV2B 5AZEL 3PXJA 4J4PC 4QRQA 2ZIDA 1NH6A 2P8MA 1NC4D 1QLRA 5DD0L 3GSOA 5IW3A 1U3JA 4KQ4H 4F57H 3AACA 2E4FA 3QFJB 1ADWA 4LCUB 4LP8A 4L8BA 1JIBA 2AEQH 3QI9A 4RISH 4R9HA 4WEBL 3TEZA 4OCRL 4FQCL 3AGWA 3I50L 4P2OA 1JVKA 1QHPA 1T22A 3OAUL 2FL5A 1DVSA 4Z7IA 2EIBA 2EP6A 1RCYA 2G9HB 2VXVH 2Q0ZX 1Z9LA 4BSVA 3GBDA 4Z7UE 3UAFA 2ZOWA 1G9NH 3BKCH 1QNZL 5DFVC 4U0RB 1QA9B 3P3TA 4P5KA 3LV3A 1K4CA 2PYFA 4WUUE 2JNZA 1DVZA 4PVLA 3SDAD 2GT9B 4NLHA 5I1LB 5CEZD 4H8WH 2R29A 2HH0L 1F41A 4PTUA 5IVZA 1JCVA 2HLFC 5FO2A 3UBFA 3FU7B 2YQBA 4QY8B 1K6QL 4XP6L 2A1WH 2VR4A 3X1NA 4J28A 1TJGL 3QC6X 1ZKAA 2QKIC 4K5LA 3ZTNL 1INDL 1UVQB 5JQ6H 2J73A 3LRMA 3KR3H 4L1TA 5KYNA 3L7EB 4ZPTB 1NCWH 1DVFA 1FYTB 1ZHNA 4GRLC 2VZ1A 1T7XA 3QJHB 1JG9A 4OGYL 1EHAA 3FDWA 3QDAA 1BD2E 4O2FA 3FN3A 4ZMTA 4M8QA 3S4SB 1ILSA 1CFNA 1BX2B 1CGTA 3DI3B 1FHGA 3MHZA 4OB5L 4R7DB 3WKQA 1INEH 3SD2A 1MCQA 2VLME 4IMKA 3LQAL 1RIVH 5KYXB 1JHLH 1QBLH 3O2DH 4P2QA 5FYJD 3IGUA 2ATKA 5E2VH 3PHQB 4LLDB 5D5ME 1MHHA 5EU6B 3ARZA 5AOKA 5DURD 1TEGA 2N7BA 3C60B 3GB7A 5AOJA 1RHFA 3OQ3B 4ENEC 3LKNB 3F83A 5L8LB 4IJ3C 4F7TA 3WJMA 1LHZA 2EDTA 4FTVE 3Q5OA 3FULA 4XWOD 1UATA 3EFFA 2DTMH 4J4PA 2VQUA 3MDJA 2XXGA 2NZ1A 1EANA 1NFAA 1NGWA 5CUSL 4Y7MA 4DO6A 1L6XA 3TO2B 4FQXB 1ZIBA 3B9KC 1L9RA 1Y7VA 1KELL 2X4QA 3BCFA 1XD0A 3FUEA 3UGXA 3EF4A 5CGMA 4XBGA 1EIBA 1ZLUH 3DBXB 4MAYC 3T0DA 4NQDE 1UWEH 1X5KA 2J8UA 1GC1H 3CFBA 1I85C 1RULH 4KK8D 1U3NA 1U58A 2VSCA 5JW4M 4NNPL 4L0YA 5AW8B 1X5XA 1PF3A 1PEZA 2V2XA 4IMLA 3ZE1E 1H3UA 1JGUL 4HALA 1NCAL 4UYQA 5FDYA 3T2NL 1FNSL 5E7FA 1VRSA 2VR8A 4DP7X 1UT2A 1IC5L 4N0CC 3I2CL 4RFNC 4YSUA 1KFGA 4LLMA 1G1KA 1HKLL 3INUL 5BNXD 4G80B 1AS6A 5ECJE 2P46B 1L0QA 3B43A 4N5EC 4IRZL 1Y6NR 3N06B 3HHRB 1NCDL 1QSFD 4HKXB 5F3BA 2JF1A 3L4UA 2J1WA 1YEJL 2J5LC 3IJHA 4KGLA 3MODL 1DSFL 2YRPA 1J1XH 3MRIA 3VFSA 3PAYA 4GRLA 5EO0B 1DQDL 3GIZH 3GMMB 1PZ5A 2I5YL 4ZAKD 2E74C 1OPOA 3IDYB 3FFCD 1T04B 5E9DD 4X9GA 2BWQA 4KY2A 2FDBP 3QUMB 5DC0A 5F7YC 4Z7UF 3V79C 3ZKMC 2ILLA 4HBCH 4NN5C 2JI3A 3KPSE 4KDVA 4JFDB 4X6FB 2EZ0C 1I8MB 4PJFF 4WHCA 3JWOH 3KW7A 5H37A 3FT3A 4YDVB 5KVGL 2J6WA 1E9QB 3EJUA 3SE9H 5E03A 2E3VA 2XG5A 3LEVL 5L4JA 5JORA 3R06A 4Y8DC 2AXFB 3O81A 4NWUL 4ZXBC 2M1KA 4Z3TA 5KVFL 2PYEE 3VXRB 1OPGH 4YNYA 1ET8A 4G1MB 1XF2B 1A1OA 3ZMNA 1B0RA 3SJVD 2JKLA 3ARGB 4YIQA 4RGNE 1BQLL 4QO1B 3HLKA 3NCWA 1ETA1 2NQ3A 3MUGA 4IBVA 5E2TH 1CFQA 2IQ9L 1KBGL 3EBHA 4YSOA 1QMUA 4HT1H 5AG8A 4DVRL 2DEWX 3KWXA 1CDYA 3UAAA 3GSNH 2QSQA 4G42A 5HJGA 4C56D 3ILQD 3SODB 5B3JF 2BVPA 1HEZA 3BAJA 3NEOA 1S7XA 5C07B 4YHKL 2HJFB 1I85A 3HZYB 3KYMB 2H2SD 2ZZUT 2NSQA 5D5MF 3X14B 1WIOA 4Z7QF 1XZ0B 3IMVA 4EO5A 5ENWA 3UAJC 1QG3A 2JKJA 3RVWC 2X4UA 35C8L 5F7AA 1B2YA 1PZDA 4PP1C 1J5DA 1LP9B 4WWKD 4ONHA 1PSKL 3MNVB 3QNFA 4H20H 5GGUA 4K15A 4MMZA 1BGXL 3D07A 5CU9A 4XVSL 4AKPA 3GUFA 3A47A 3O2WL 5E6RB 4ZS6D 1YY8B 5DMIL 3TN0D 1M4KA 4LVOC 3RX7A 4OCXH 4GYBA 4LCVA 2F2HA 4B96A 1XGUB 3QNXB 5IB5A 4Q52A 2DY2A 5B4MD 5EOCH 2Y7MA 1M7XA 4CVZB 5KVDE 3WHXA 1JBJA 2B9AA 1S5IL 3HC0B 3NOIA 4CVXA 4HUMB 4L3ED 2H3NB 3BESR 3EFDH 5AKSA 1P7QD 3QWOA 1SY6A 3L6FA 1ZOXA 2FJSA 4ADJA 4CSZA 3EH4B 5IESH 1T21A 4M4PA 4QUOA 5F0PB 3SE6A 1FCCA 3WNNA 4PJ5A 3GDBA 4HKBB 2NUPB 1HOCB 2YAOA 3GI9H 3H2WA 4G43B 2VDKH 1P69B 3R19A 2IDTA 1GGYA 4KNUA 4KI1A 4P57A 4LSVL 3CQFA 3FSZA 3SHSA 1UXLA 5MI0B 4H26B 4F1SA 4ZXBA 4I1PA 3GHBL 4HJSA 2OTUA 1L4IA 5CILH 1LEGB 1JD7A 2DLFL 4S0SD 1HSBA 3RAJH 3KLAB 4TOYH 1FFPB 3KCWA 2QR0B 3MC0A 4OF0A 2EICA 4GJTB 4JO3L 5FYKU 1BBJA 3K8KA 3RPIB 2R2BA 1TENA 5FO7A 4CSSA 3RWHA 1I3GL 4Y16C 4P49A 1SVZA 4R96B 1OHQA 2WQ8A 1ID2A 2DQIH 2VLLA 1LO4H 4LSQH 2ED7A 3QZNA 5CGYC 3ILEA 1Z9NA 2JJWA 3NJVA 4WUUD 1ES0A 4XOBA 2F7RA 4P2YA 1KJMB 2LLNA 3GMPA 1E30A 2OULB 2VC2L 5IMKA 4WFHE 1ND0A 3T0EB 1Z3RA 3UAJA 3U0PA 2VN5A 4OZIA 2V33A 3N9GH 4PS3A 4XTRD 5DK0B 1KC5H 5LKNA 1MJJA 4TQIA 1QKZH 3VXMB 1FRGH 5LGJB 2AGJH 1WQVT 5G5DB 1FH5L 4PWKA 2Q6WA 3Q48A 4TV3A 1R0AL 1B4JH 3NCCB 1ILUA 3P2DA 3FXIC 5IJVA 4YHIA 4OV5A 4I2XE 1BVLB 5DT1H 5E5MA 5J7CC 5HHPA 4FYQA 1CF8H 1WK0A 2D0HA 2J1KA 1BD2D 4NQXB 3VWKD 4A6YB 1SQ2N 4JRYA 2AQRA 4XNYL 4NO2B 5E6YA 5LWYL 4ZMYA 2OTPA 3M7FB 1KIUB 4PGDB 1RIHH 4AE1A 1KGYE 2VLMD 5CBEB 2D31B 5F7EL 3REWA 5LDSA 3F12B 1PFCA 1RZIA 4UTBL 2JWYA 3TVMC 1Q72H 3RGVC 2AXGA 4U1IB 4PMFA 3VFGL 2BIPA 4MSWA 4XR8C 1AGEA 4MLSA 4ENZA 5M7QA 4FTVD 3RNQA 3SGKA 5ALBL 2R0LH 2XWTA 4K7PL 5DZNA 3KCPB 3WXVL 4U1LB 2OSYA 3FU3A 5E6UB 1GCFA 2O6PA 4LSUH 4HUWA 3WUWA 1V7ML 2IDUA 4XNXH 1NFDB 1FVDA 1BAGA 3KYKL 3WY3A 4XCNB 2H32B 3CFMA 3QUZD 4MDJB 3GPEA 4NBZB 2JB6A 5FGBC 5B38A 4KXBA 5E8NB 1SEQH 4JKKA 4Y16A 4NQDD 1WCQA 5KW9L 2DIJA 1HI6B 5I9QB 3V4UL 1U33A 5DFAA 4LOFA 2A9ML 1I82A 3MBXL 1PJ9A 2EEFA 2NY4D 3FB6B 3FBKA 2NTFB 4NYLA 4DP5X 4XNMB 3QUHA 1ZTXE 4H0GA 4PRDB 4PRIB 5LQBH 1RZGB 4QHUB 5CEZL 3SDCC 4BKTC 1D5BA 4XC3L 2OXGA 3UX9B 1NCGA 1WBZA 4ZSOB 5CKAA 1VGEL 4LB8A 2F54E 2DAVA 1OAYH 4PBVC 2FX8L 3SY0A 1OAKH 4OY9A 4KV5E 5JUEL 3AMLA 5JHBA 3GBNL 4YZWA 3NIGE 3UP6A 3OPZL 1HN1A 3ZLQC 5HYSA 4X42A 1K8DA 1EHLH 1W80A 2OR7A 2HB0A 3CXHJ 3D8MA 3O4LE 2G2PA 1G4RA 4NNXA 3H9SB 3SQRA 3FL7A 2LW3A 3NIDE 5EB9A 2F8IA 2W9DL 4YGVA 4ZTOL 2O1AA 2FZ3A 5ACMA 1I1FB 4MS8D 5FYJL 1RLBA 3HE6B 4MCMA 5IJDC 1AFVH 4ELME 1VFOA 2ICWA 5E0FA 3R4DA 3IXTA 3KPSD 5D8JH 3L1OL 4UB0L 3TVMA 4BFRA 5CJOH 4LIQL 1O6TA 4BQCA 2NZ9C 1WDAA 2YJQA 3L8QA 5C2UB 1C5DB 3GSVB 4X6DA 3LH2H 2AF2A 4MNQE 2XN1A 1ZHKA 2PYED 2OZ4H 3V4PL 5TDNA 2CNZA 2BDNL 3QJXA 3TFKD 5CSBA 1EEQA 1XSJA 3FHQA 3UTTB 1NIEA 4S2SB 4MZRA 2CLVA 4RGND 3WN5B 1HYRC 1AXTL 4HWEL 1TVHB 3V0VA 2YQGA 1ZDQA 5I8OH 1RMFH 5TDOA 1JYXA 3AQXA 5DHVA 4Z0BL 4U6YB 3V5HA 4MB4A 1C16B 3U83A 5FGBA 2OK0L 2P52A 4JO1H 1UQSB 3VDCA 4BFBD 2CDFA 2EVJA 4JM4L 2CKBB 4ZMNA 2YWZA 2KL6A 3N50A 3ZE2B 1IILE 1CLZL 3OKYA 4JKNA 6CGTA 5GGQH 4LLYB 3SKMB 2VN6A 1PTZA 1U8OA 4KH2A 1HVXA 2D8KA 2GTZA 7TAAA 1C1EH 1IJNA 4KRPC 3QO1B 4X6CB 3SDCA 2NOYA 3ZDYB 3ZQ9A 5INDB 5FOBA 3CU1A 4I8DA 3V5DA 5FGRA 5BO1L 1OZUA 3STZA 4GMSH 1E5UI 1OGAB 2YRBA 3MJ9A 5DJ8B 2JI2A 5DQJA 5FDWB 4M5ZL 5IHZA 4X4MA 1SN5A 3ARYA 3QCVL 4PJEA 3VFOA 1HQRB 1ZSDA 1WAEA 3MRKB 4OGAD 4PREB 4KGJA 4N2HA 3RVVC 1ITCA 5HYFA 3CSYA 2QV2A 4WNQA 3RFZA 1CJYA 2R4RH 4UV4L 1I53A 2J4WL 2IGFH 4N9OB 3CQQA 4S1QH 4D0BB 2NW3B 1NL0L 2HVJA 4M7LH 5T1KA 3VFVA 5SWSB 1N6QL 5I8EA 4Y4FD 1A4BA 3B37A 3KS0J 4RBPK 1ZRUA 1MFCH 2X4RA 1BWWA 2DL9A 5ICXB 2EEAA 1E27B 3BQVA 4F7MB 2CIKB 2MTAA 2XNAA 3HHSA 3TA3A 2J43A 3WL9A 4OQTH 5FHBH 4E9TA 2Y2WA 2YPLE 1XIWC 1TT6A 2C9SA 3HW7A 2NW2A 2YLKA 4MA1C 5F1IA 3PWPB 1OCCB 5FM8A 3VRIA 4YHYC 1E28A 3FU9A 1A8ZA 5DMGD 1IKNC 2G5BB 2R0WH 3WFBH 1SDAB 5DI8A 5HTSA 5BXFB 1D5RA 3KYOA 3N1PC 3C6LB 4I1RA 3OX8B 5I76A 3VGAB 4X8CA 4KV5F 3V6ZA 1AQKH 3CNKA 2CJUL 4G8GA 4RQQB 3VFRB 2EEXA 3NIGF 1BEXA 3QULA 4HKZB 4Q4IA 3EH3B 1EXUB 1ORQB 2IJ0C 3EJSA 4G7SB 4V1DA 32C2B 3FQUB 3O9WD 4TSCL 3WLBA 3L3HB 4DAGH 2M26A 3HC4H 1MF2L 2QSVA 2PPAA 4JKMA 1RZ7L 3C2AL 4FN0A 1R5WA 3AMKA 2FD6H 3NIDF 4X7DC 1T6BX 2IQAA 3CVHB 5ANMA 4NHCL 1OB1B 3QIWC 3HVNA 4ELMF 1PX3A 3HI1B 3ARWA 4R90H 3OKMB 1KNOA 3NCFB 4GSDL 4WFFE 3K4ZA 1OF2A 4IKIA 5GSVA 4PGJA 3PXLA 1BVOA 1KYFA 3QJRB 5L88L 4UM8B 3SGJC 3OGOE 2QADD 3WMQA 3ALWA 2H6PB 4KRLB 1LM8V 5AWNH 3EKCA 3MGOA 1KLUB 4HUNB 3B2XA 4N2IA 2ZNWA 3EJJX 3ECBA 3AAZA 2YGVA 4HETA 3MYJA 4LT7A 4G72B 5EDXA 2WWMD 2ZYHA 3U9UB 1AJ7H 3TL5A 4OLEA 3W39A 1FL3A 3MU3A 2B15A 4XBPB 4GNKB 3LXBA 5EZLB 3BHBB 3HS0A 3IDNA 2XU9A 1G7QA 4OLWH 5EEUA 1W8EA 4TYUA 1DEEB 3L3GB 4B53A 5HYQB 1GGCL 5B22A 4NSKA 1A7OL 4P4KD 1P4IL 1KEGL 1I3RA 1GSKA 4NQSA 4U6HB 5DDHA 2A73B 1J10A 4NIYE 7CGTA 1CT8B 5C7XH 2F74A 3PIQA 1U8JB 1CDJA 5D93B 1KY7A 1XIWA 2ENPA 1CGVA 4NQEE 4KKAC 2BHUA 1CZ8H 2P8MB 3KH3A 1TEYA 1J5IA 3MCKB 4G6FB 1QLRB 5DRNA 3IK2A 4N2EA 3TJEL 5F7HA 2AANA 3S48A 1I8IA 3FQTA 3GT6A 3SIKA 3MOBH 3G7TA 3O3EB 4L8BB 3QI9B 1O6VA 4ONOA 4RAUA 1EO5A 4P2OB 4JVWA 4EUPH 5T33L 4EI5C 1T22B 3G04A 3BWUF 3AG3B 5CJ8A 3X11A 4QRSA 4LPUA 1KBBA 2PETA 1R3KA 3A6CL 3A6BH 4H44C 1UWYA 2KLTA 5EFIA 4P46B 4BSVB 4JANA 4QYOB 4KK9D 4M1DH 4LDLB 4XNUL 4DGYL 1MFAH 3W82A 2ITDA 2QPSA 2CBPA 3L2MA 4LP4A 1WZAA 5AENA 4IDJL 3RDTC 2VDLH 3L48A 4MA8L 5F71A 1FNGA 3TIDB 5E9AA 4DGWC 2X4TA 2EILB 4O2CA 4EDXA 1MY5A 1YUHA 4UANA 5HYJA 1RUAL 1NKOA 1H3PL 3KAAA 2YC1A 3Q5YA 5B1JC 5JXED 3WIIH 5C70A 2NNCA 2RIKA 1AOZA 1B88A 5HHXH 3BKMH 1WJ3A 2RCSH 2F54D 3CZSA 4OM1H 3SGJA 3VXSA 3P0YL 1PZAA 4AYDC 4P2CG 2B8OT 3VB9A 5DD0H 5IREA 1UH3A 4RZCA 4AK2A 4PRNA 1DVFB 1T1ZB 4NN7B 4XWOC 3LTVA 4Y89A 4Z3EA 4O2FB 5JQHC 1SMOA 1HQ4A 2DQDH 4ODWB 4M8QB 2X4SB 4PBDA 3CFEA 4WEBH 1PKQB 4FQCH 3I50H 1CFNB 1J8HA 3SCMA 3ABMB 2H41A 1E5AA 3OAUH 1D9KB 1M7IB 4HK3N 3O4LD 4MAUL 4Q56A 3GUTA 3B7UX 4QHNA 1Y6MR 5E2WL 4EBQL 4ORZC 3IBOA 1MHHB 3VXUA 2KPWA 4F2ME 1RIUL 1MVYA 2XETA 1GYCA 1QNZH 4DFHA 3FO1B 2HJKA 2F6AA 2IBZY 2JTDA 4DIXA 4LNVA 4NJAH 3GBMH 4IRSB 5C9KA 4HVBA 2FLBT 2X44D 1MFNA 4MJHA 3WJMB 4HJGA 2LFGA 2D4FA 1UOWA 2HH0H 4KK8C 2JCWA 3BZDA 5G55A 2FJGB 3EFFB 3L2NA 5KSBE 3ILPA 1F02I 1U36A 3I85A 3IGFA 1K6QH 3FUKA 4XP6H 4MNQD 4KNSA 4HDIB 5I0DA 1NGWB 1TJGH 4MQTB 2WZPD 4HS6A 4X9YA 3FCTA 1OGTB 2JQZA 3ZTNH 1INDH 5TK4A 3QEQE 5KBKA 4GS7B 3CN1A 2RA1A 3D09A 3VG9C 1Q9KA 3M86A 3LRKA 3K7UA 3WDIA 4UWQB 4Y2NA 4FNUA 3FKUS 1XF4A 4M93B 2X1QA 3SPHA 3RUGA 3VH8G 2IANB 5D96B 2L7UA 5MP6L 3M1BA 4JFXB 4DQOL 3STLB 4AW4A 2J8UB 3QJFA 3G6AB 3CFBB 3LQAH 1CICD 1RSYA 2F8XC 4PY7A 3TJHC 3RNKB 2VLJA 2P26A 1A9VA 3I02A 3RDTA 4IMLB 2V2XB 3QFGA 5HDBB 4ZK8A 3CFIC 2ID5A 5K9KA 4DP9X 4U1HB 2YHGA 3GSUA 4XP5L 1GPOL 3IGAA 3DVGB 2VAAA 4AQEB 4AL8C 4LLMB 3U46B 2KYIA 4QWWD 1GGTA 4WEEA 3ET9F 1T0NB 4UIKL 5IBLC 5C08A 4G1EA 3NT0A 4L4VA 4GLRI 2XKUA 4F3FA 3E6HA 5F3BB 3RWJB 5DO2C 3IJHB 5C1MB 4IK6A 4HOZA 3A22A 2OR8A 3UEZA 2AEOA 5CUSH 4P06A 1DZ0A 4I48A 2ALAA 1PZ5B 2B3RA 1A4KA 1F42A 1UKSA 4ODTL 2FQEA 2XYCA 1JK8A 1KELH 3KZ8A 1X7QA 3K81A 2JJSA 5EO9A 1U8IA 5CCHE 2YSSA 5SX5H 3TEXA 5I24A 4M4RB 4GKSB 5BRZB 5C0BB 4HG4J 4N1EA 1CI5A 3VX1A 2V9RA 2XN0A 5I75C 1U92A 3ILQC 1F4YL 4PJXE 4NNPH 3J8F7 4Q74A 4A38A 1JGUH 1UWXK 4XVOA 2YPLD 5LXGL 4KROD 3UTZB 1NCAH 3T2NH 2AQQA 4N20A 1AOHA 1FNSH 1TCRB 2DRUA 3I6KA 4DP6X 3FNKA 1IC5H 3I2CH 4YDLB 2CK0L 4LPYA 1HKLH 4MNHA 4YNYB 3FRPG 1A1OB 5D1QA 3OAZK 4ETYA 4HUUA 1U2HA 4FG4A 1N18A 3VMNA 1NCDH 1CDCA 3CN3A 2CO6A 3AUWB 1YEJH 5IBUG 3KE0A 1P5UC 3MODH 1DSFH 3K8LA 1N64L 4DK5A 1DQDH 2NT0A 2P47B 1K85A 3UEQA 4HK0B 2N7AA 1HEZB 1KPRA 2B5IB 2I5YH 4DW2L 2NY6D 3DRQA 4HUKB 5DQDH 2OYPA 1S7XB 4WNSA 1BXVA 3E80A 4MJ5A 4MRBA 2BP8A 4XO4A 1FVCA 1QLFB 2BS9A 4X50A 2C9QA 1FORL 5ENWB 3PGCA 5JW3H 2X4UB 2XWZA 3NSDA 4DOHE 5I5RA 3H55A 5EBWA 3HG2A 4ONHB 3D12B 4WI0A 4MMZB 4B95C 5IUCA 4APQD 3JTTA 4M7JL 4R0LB 4UNTA 2AJZA 4XH2A 4EKXA 2Q8BL 2AJYL 5KVFH 2EDLA 5D2LB 3T77A 1UUSA 4XPAL 3W2DH 5JO5A 2EC9T 2RR3A 2VKXA 4KTGA 5IB5B 9PCYA 1TYJA 3QZMA 1JI2A 2PP7A 2UWEA 1PIGA 4XCEB 1UENA 4JKWA 3WHXB 1SF5A 4ABQA 3QO0B 2LOEA 4P3DB 1RZJC 1JXFA 2IQ9H 1KBGH 4CNIA 4HPOH 3QXWA 5KVDL 4CVXB 4DVRH 2HA1A 3V0AC 1NDMA 3L95A 1CBJA 3O6FB 5ABDE 4AM0A 2VZSA 4HH8A 3QAQA 1T21B 5D1ZC 1NINA 1DQJB 1HESA 1BYOA 4DP4X 3U82B 4PJ5B 2QV4A 3T08A 2GYSA 1BZ7A 1UA6L 4KHTL 3O3BB 3EJYD 4DWHA 3QWNA 3QH3B 4KQ0A 1NAML 1EFXA 1M53A 2BRRL 4F9LC 4ORGA 4MJ2A 4Y4KA 3Q8AA 3SDXA 35C8H 5EH1A 1J0KA 3NA9L 3QUKA 4NQED 1PSKH 2VR9A 4DP8X 1KB5B 2EINB 5DMKA 1A47A 2GJRA 1BGXH 4QIRA 3APMA 3UYRL 2DTSA 1VLXA 1U93A 4XVSH 4FQQB 1ZLVH 3O2WH 2DH2A 3AG1B 2I07B 5DMIH 5T5FL 3DYPA 4QYAA 3QDJA 4X5PA 1BBJB 1ZGLM 2QZQA 2XXMB 2R2BB 3NBNA 1P5UA 2I27N 2EDJA 4PJBE 3ZXAC 4X6BA 4LPXA 5FW7A 1D5ZA 1S5IH 3RWHB 3S98A 1IAIL 4GRWB 5IIEA 2XSKA 1MXDA 4NJ9L 2VLLB 5L2KB 4UNUA 1L9TA 1UJ3C 4Y8AA 3N41F 4BZ1L 4HS8L 1FZJA 1TLMA 1FFNB 4L29A 4J3VA 5EO1A 3TEYA 2ZP8A 5IMKB 2P5EA 1B2WL 1UG9A 4PJXF 4P2RD 3U0PB 1IC7L 4ODSL 1NCBL 1E6OL 4UQIM 3VI3B 5DSCB 3QIUD 4OZFA 2XTSA 2ICEC 3S36X 3WKYA 3DIVA 4B7IA 4LSVH 4M8UA 2NY1B 2Q6WB 2DQGL 2VERN 3W11D 2E9WA 1ZXQA 1OAQL 1ZXKA 2WQXA 5IJVB 5F7FA 1KXQE 1F4WL 3LN4A 1FQ9C 5E5MB 3NEEA 4QT5A 4HHWA 3UZQA 5AVWB 3T8XB 4NS0A 4KAQL 4JO3H 1JF6A 2BSSA 2Z8SA 4QHKI 5AL8A 1J0HA 3K6DA 1BAFL 5BW7A 1MXGA 1Y07A 2P8PB 4WNJA 3M1CA 1I3GH 4QRAA 2W60B 4E9SA 5HI4D 2GI7A 2FYVA 4LCIL 3NJXA 4J1UA 4HD9A 2QTEA 3BAKA 4GLRH 3LPWA 1RURL 5EUOA 2DQEL 3GM0A 5EUKA 4JO2L 3CZKA 3HPLA 3QNZA 2WXHA 4MGXA 3L9YA 1AGEB 1JPST 3BPOB 2VC2H 3S4SG 1PAZA 4F9LA 1VEOA 1JZ7A 3RNQB 3RWFA 2XWTB 1J8KA 4M43L 4BSWB 2UZYA 1S9WB 2NT1A 1FH5H 3KWWA 1DLFL 4HUWB 1R0AH 4Y5YB 3EBGA 5A2IH