1WA2X

Crystal structure of h313q mutant of alcaligenes xylosoxidans nitrite reductase with nitrite bound
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGQIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE,
publication title Insights Into Redox Partner Interactions and Substrate Binding in Nitrite Reductase from Alcaligenes Xylosoxidans: Crystal Structures of the Trp138His and His313Gln Mutants
pubmed doi rcsb
source organism Alcaligenes xylosoxidans
molecule tags Reductase
total genus 88
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00394 Cu-oxidase Multicopper oxidase
X PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa2X01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1wa2X02
1N68A 1PLBA 2YQBA 5I5IA 1OCCB 5D4HA 1IUZA 3ABKB 3ZIYA 2WO2B 1XB3A 1MDAA 4CSPA 1AG6A 3ZDWA 2DV6A 3EH5B 4AKPA 3CDZB 2IDSA 1PZAA 1J9QA 3FU7A 4NERA 4A67A 4DPCX 5B3SB 4BK5C 4KOBA 4AI7A 2EINB 3CG8A 4HIPA 4BWWA 4E9SA 1GW0A 1AZBA 3JTBA 4JHVA 4DP5X 2IDTA 2HZHA 2OV0A 3V9CA 3ABMB 3AW5A 3QJTB 1GS8A 2IAAC 2Q5BA 3X1EA 3S3BB 3AG2B 1BQRA 1WAEA 1PZBA 1NTDA 1NIFA 2YAMA 3FU8A 2VW6A 1NIAA 3QQXA 3OMIB 2BP8B 5B1AB 1L9SA 2PPFA 4G72B 3UADA 3NJHA 1PZCA 4UF7C 2CAKA 3NSCA 2JXMA 1E30A 4A2HA 3G5WA 4GP5B 1X9RA 2H47C 3SBPA 2CCWA 2FQGA 2IWKA 2HX9A 3GYRA 4GY4A 3QJUB 4F7KA 2FNWA 3TU6A 4E9WA 2IDQA 3NSFA 2WSDA 4N4YB 6PCYA 1NWPA 4BDVB 1BXVA 3T6ZA 2YAOA 2UX6A 4YSRA 2J57A 1L9PA 2QDVA 3H4FA 5AFAA 1RCYA 2PPAA 2R7EB 1N70A 2GHZA 2PCYA 1XMEB 2X88A 4YSEA 3FQ1A 4PCYA 3C75A 2BP8A 3QJSB 2UXVA 3FSVA 2FQEA 4PAZA 4FAAB 1CURA 2BP0A 1PMYA 2PPEA 1F56A 3UACA 4YSUA 3SBRA 2B3IA 4KNTA 4ENZA 4E9VA 1JZIA 2OCCB 3GXUB 1TKWA 2AZAA 1V55B 2DYSB 1J9SA 2DWTA 3FPYA 1L9TA 2IWEA 3PAVA 1JZHA 3FT0A 4GP4B 1ASPA 1BYOA 4RH4A 3S3CB 3UAAA 2GC7C 1ET8A 3QJVB 1AOZA 2R7EA 5F7AA 2IDFA 3ASOB 4KO6A 4YSOA 1SDDB 3NJMA 2GI0A 5LDUA 2ZONA 3ABLB 3IE9A 4DP2X 3NJGA 4N8UA 1M56B 1AZCA 1IC0A 3BQVA 5I5MA 1NIDA 2HXAA 3PXLA 2N0MA 4Q89A 3T6VA 4DP0X 3PLYA 2YXVA 1OE3A 2GSMB 3T71A 2TSBA 3MBWB 1MZYA 2VMJA 4KO9A 1RZPA 3S3DB 5B7EA 1OF0A 5F7BA 1AZNA 1ID2A 3JT2A 1NIEA 3NT0A 1ZPUA 1JZJA 2B08A 2FT8A 4EF3A 5AZUA 1JZGA 2VW4A 2VM3A 3NJLA 3KW8A 3NJKA 2PP8A 1AQ8A 1BQKA 1WS8A 2GBAA 1A3ZA 1RZQA 4CSZA 2UX7A 1TEGA 2IDUA 2ZWNA 1NPJA 1SDDA 3SBQA 4NAJA 2UXFA 4E9RA 2YARA 2W8CA 4G71B 4JKNA 4YSTA 1FA4A 1BXUA 3PAZA 1AACA 2TSAA 3OMNB 2BW4A 3X2QB 2A3TA 3NJNA 1JOIA 3S8GB 3WIAA 2XV0A 1E67A 2QPDB 2VM4A 4BWTA 4KOCA 1YLBB 1J5CA 3QJRB 2X87A 4A68A 4YL4A 1FFTB 1PNDA 2I7SA 3X1GA 3S8FB 2RACA 2BO0A 3WKPA 4GYBA 2PPCA 4M4RB 3FSZA 1X9UA 3N2JA 2EIMB 3ABGA 3X1FA 3TASA 3FQYA 4P5SA 1M9WA 4DP8X 1JZEA 4F2EA 5B1KA 5I6NA 3KW7A 5EHFA 2Q9OA 1WA2X 3ASNB 1W6LA 2QDWA 1CYWA 2UXTA 2BP0B 4QLWA 3TA4D 2DY2A 1EZLA 1OCZB 3FYIB 2UXGA 5AKRA 4BXSV 2YAPA 4A66A 6PAZA 1GSKA 1HAWA 2XXGA 1QLEB 4ZK8A 1KDIA 3IN0A 4AKQA 5FC9A 5B7FA 3SQRA 2PP7A 1BXAA 2I85A 2PPDA 3NJIA 3PCYA 1PF3A 2PCFA 1IKOP 1ASOA 1ET7A 4FA7B 3NSDA 2EILB 2WO3B 2BWIA 1WA1X 1JXFA 3NP4A 1SFDA 3FSWA 1TEFA 1NIBA 2JKWA 3T9WA 4WTQA 1AR1B 3NP3A 1QNIA 1ZDQA 5TK2A 3CVDA 1KBWA 1XB8A 2VSKB 2XLLA 1NPNA 2FJSA 4E9XA 1ZV2A 1J9RA 2BZCA 2CALA 2PLTA 1ETJA 4E9YA 2CJ3A 2I7OA 3FU9A 1WA0X 1E5YA 3UABA 2IWFA 2FTAA 3HB3B 3HEIB 4HCIA 3NYKA 3EHBB 4M3HA 3OMAB 5I6OA 1J5DA 1KDJA 1NZRA 2BWDA 2AVFA 1ADWA 2NRDA 1ZIBA 2XVBA 1J9TA 5PAZA 3TBCA 4NB7A 1W6WA 1R1CA 1KCWA 4W1TA 4G70B 3AG3B 3X1NA 3CVCA 1AS6A 5D4JA 1NDTA 2ZOOA 2VN3A 2YAFA 1MG2C 3UAEA 2XUWA 1JXDA 4P5RA 4YSSA 2Y1AA 2J56A 2XWZA 3V9EA 4DP4X 4TXVB 1AANA 1ZDSA 2FQDA 2VW7A 4X4KA 1GR7A 3OD3A 1WS7A 2FWLB 1AIZA 4Q8BA 5B1JC 4G7SB 4HHWA 4A2GA 4YVNA 3DKHA 3D12B 4HALA 1DZ0A 3CZUB 3FS9A 4W9ZA 4HCFA 2P80D 3ERXA 1PLAA 4E9TA 2XU9A 3WNIA 2CUAA 3H56A 1KV7A 2XYBA 5TK4A 2EIJB 4A2DA 2E86A 3IN2A 2H3XC 3T6XA 5E9NA 1GY1A 1SNRA 3FYEB 4AKOA 4F2FA 3BVDB 4AX3A 1AZUA 2LLNA 2DWSA 4DP1X 3PAUA 2QPEB 2FQFA 3EH4B 2H5UA 5I6LA 1MG3C 1PAZA 1SF3A 2CBPA 5I5JA 3NJFA 3WNJA 3ZBMA 2HRHA 5I26A 1BAWA 4BXVA 1BEXA 2DYRB 4A2EA 4HCGA 1KGYE 1I53A 1GS6X 2J5WA 1CUOA 5ANHA 2AFNA 4QKTA 1TU2A 1GY2A 2YXWA 2MTAA 4YVUA 2IH9A 1GS7A 2IH8A 1SF5A 1M57B 2GIMA 2AANA 4KO7A 9PCYA 1BQ5A 3RYMA 1UATA 3MX0B 1SJMA 5I6KA 1OCRB 4HAKA 4KO5A 1AS7A 2PP9A 2P80A 2FT7A 1OOWA 3L45A 2HX7A 4YSQA 1OCOB 3TBBA 1CYXA 1JVOA 5B1BB 1W8EA 3FQ2A 2XX1A 3FPXA 1QHQA 2FT6A 3CVBA 5B1JA 1AAJA 3FSAA 3EH3B 5I28A 2XX0A 1NICA 4A2FA 1T5KA 1DYZA 2QT6A 3OM3B 4YSAA 1A4BA 2MRYA 1A4AA 4DPAX 3CDZA 3NSYA 3QJQB 8PAZA 2BZ7A 4JHUA 3WI9A 4HHGA 4HZ1A 1AS8A 4KNUA 2YAHA 4K9JA 4DP9X 3NJJA 3EF4A 2EIKB 1SHWA 4G7RB 1KBVA 4DP6X 1BYPA 4G7QB 1ILSA 1L9QA 3PPSA 1AG0A 3IEAA 3AZUA 3H4HA 2VSMB 2W88A 1IBZA 1A4CA 3AG4B 1ASQA 1EHKB 3IBOA 3ZX1A 3T6WA 2GB2A 2BHFA 4YSCA 3AG1B 3QPKA 3UGEA 1CC3A 1AZRA 2OJ1A 4KNSA 4YSDA 7PCYA 1IBYA 5IY5B 1NINA 1VLXA 3OQRA 1L9RA 1PLCA 3AY2A 1B3IA 2YAEA 4AZUA 5D4IA 1NWOA 4UANA 1E5ZA 7PAZA 2Y69B 3WKQA 1JERA 4DPBX 2HX8A 3U25A 1A8ZA 2YAQA 5B7MA 1MZZA 4L0PB 3DTUB 4BDVA 1XB6A 2GC4C 3GDCA 1ZIAA 1SHXA 3WG7B 1FWXA 1PCSA 1V10A 4E9QA 1KYAA 4GP8B 1HFUA 1V54B 4DP7X 3FU7B 3DIVA 1JZFA 2XXFA 5A7EA 5I6MA 2XV2A 2XV3A 1PY0A 4BWUA 1HAUA 1GYCA 1PNCA 1OE1A 1RKRA 2ZXWB 1A65A 1KCBA 2AZUA 4WKXA 2JFCA 2HLEB 3X1BA 4YSPA 2BW5A 3N55A 5I6PA 1URIA 1ILUA 1L9OA 2HRGA 1ET5A 1JXGA 1OE2A 1JVLA 1SFHA 4GXFA 5PCYA 1OV8A 4MFHA 1E65A 2J55A 4UAHA
chains in the Genus database with same CATH superfamily
1AD0A 5TDPB 4D9QE 1DLHA 2VN6A 2PKDA 4OGXH 4OLVL 1G0DA 4JPQA 3ARBD 3QT2A 2AQQA 2KQNA 2ED6A 4HH8A 5F89A 4HS8H 1IL1B 3D39A 4EOWL 3MNZA 4PD4K 4DEWA 3G5ZB 1RIHH 5A40E 4HMDA 2ADFL 3QFJA 3TJEH 4ZMLA 2OMXA 1OP9A 3BKCH 1XGPB 2XBZA 1C1EL 5ISZD 1JF5A 2R0WH 4U1MA 2H1XA 5AYQA 4E9SA 3RTQA 2VERA 2EIBA 4U1JA 3ZU8A 3NCMA 1G9MC 1T7VA 5KOVC 3NG5A 2VERN 2OV0A 2BNRE 2IAMD 2CPCA 3TWYA 2Z31A 1OARL 4P2RE 5GGQH 5I8CB 3EUDA 4CBPA 3LKRA 2WLLB 1B88A 2CDFA 5F7DA 2YBRB 4LHQB 3ARFC 4QHUA 4HS6B 3BUDA 3HI5L 2ITCA 3AXLA 3R18A 3ULVD 2CKBA 3SDXE 1AHWC 4YHNA 5E4OA 4GJTB 5EEXA 1NIAA 4R7NB 5IHWA 3FL7A 3EBIA 1ZVYA 3ZDZB 3PL6D 3QI9B 4GQQA 4JFFB 1OZUA 1D5XB 1T2QL 5EZLA 1XTMA 4JE4B 5FLUA 2VNCA 1YEKL 3BVXA 3FZUD 4YDKL 4R2GC 5JW5B 1S7VB 3CSPA 1F2QA 1TQSA 5F1NA 3GYRA 5KVMC 5IVXE 4OB5H 3KDMA 2FNWA 2CO6B 1GZQB 3CMOL 4R7XA 4IU3A 4MD0A 3NSXA 3ATAA 4PD4J 4GUCA 1X6NA 2QDVA 3A0OA 1P69B 4Q56A 1OSYA 3GTNA 2V4LA 2XVGA 4KHXL 5E1HB 3LVEA 3OKDA 1A4JB 1FORL 3MBED 3SO3C 3TA3D 4MVBD 4C55A 4LZKA 3IDYC 4IBUA 1JYNA 3MYJB 3UROR 1G43A 2HJKB 3M7FB 4MAUL 4PCYA 4Z7NF 2ROYA 5BV7L 5F1IB 2Q8BH 4X5WB 1K6QL 4PAZA 2EDYA 4ELKA 4Y1AE 5IEHB 3BGAA 1DQTA 4X7SH 3M1CA 3MQIA 1FL3A 2EO7A 4TUJA 1UFUA 3O0LA 3ISYA 5INCB 3VXNB 2QQQA 2BVOB 2Y5TB 2V9UA 3IGAB 1UXMA 2OCCB 3QULB 4EAEA 1HVXA 1DBML 2G3MA 2NY6B 4L1HA 4ZX6A 2PCXA 2XFXB 2MIZA 3UBFA 2FB4H 4P9ML 1T03H 5IEKB 2VO8A 1AQHA 4GG6A 1BJ1J 2PWDA 2OMUA 2R0LH 4APXB 1ITCA 2ZYIA 4PG2C 3TVMA 4JFXA 2NX5B 5CBEB 1IAOB 4W81A 4KRPC 4DVBA 1ET8A 2BXZA 1PQZB 1AD9B 1EXUB 3Q2CA 2G30A 2YPVH 2J12B 4FXKC 2D7QA 4M8UA 2AXWA 5GRZA 4F27A 2EE3A 3DHMA 5I8OL 4E41B 5LG6A 1JV2A 5IFHL 3QPQC 1WLHA 4Q89A 4PJFB 5FYLH 3FUNA 1OE3A 4GRWF 5JORB 3T71A 3GHPA 4CU6A 3ZYJA 3FDWA 1UWXH 5FGBC 4ZMQA 5EBLA 5D5MF 1PW3A 5B7EA 3AVEA 1X9QA 2N56A 1FFQA 1GC1C 3GDBA 3GSNA 1NIEA 4NQSB 4WZ9A 2VLRE 3OC5A 4XNYL 4Z7VA 5A2JH 1F4XH 3NZ8B 2B16A 1P7KB 2IQ9L 3CD4A 4QR7A 4N90D 1CXIA 4ZMNA 1WS8A 2GTWA 1RPUA 5IB4A 1EO5A 1KIRB 1MVUB 4CSZA 2LR4A 4KROB 4HEMA 4OCSH 3UPAA 1PYWB 2DN7A 2XSKA 3BXNB 3W2DL 5HSFA 3Q8BA 1FC1A 3WIFB 4ICWA 4LT7A 3C60D 2UZYB 3TBVB 4WY7L 3T65A 5D6DA 4UT7H 3V52L 5IK3A 1QW8A 1WZAA 5D1XE 4YDZA 5JDSB 4PI2A 1PG7X 3MJWA 4A68A 2BVYA 3MHZA 1EEUA 4MRCA 3HZVA 2C9RA 4JNXA 2I7SA 4PRPB 3L3JA 3DTXA 2DDQL 4HUUB 2IQAB 1UD5A 4J4PC 1CICB 4GO8A 3LS4H 3EO1B 3LS5L 4IRZA 1U92B 3FSZA 3ABGA 4AYEC 4KV5F 4UQIM 4P5SA 4DP8X 4IBSA 2X0WA 4PJ6A 1J48A 3CN2A 3QUGA 1Z2KA 1WA2X 1MCCA 1AZVA 4LGPB 3VSVA 4JFHE 4LSRL 3GB7B 5TF0A 4BZ2L 3MLTB 3HC0B 3U0WL 5FM5O 4XH2B 2AERT 3BP5A 1MLCA 2AJVH 4CC1A 5EFIA 3VXOB 4OUUB 3R0NA 2DQJH 1QSED 2ILLA 2B8OT 5E5MB 1J0IA 1WV7T 5D5ME 4AQZA 4WF7A 4OZGA 5B7FA 1RJYA 1YYCA 3GMRB 4WKZB 4X7SL 3L48A 1BZDA 3DROA 2Y7OA 2J8UB 3U4BH 1ET7A 5CJXA 2OCFD 1WFNA 2WQSA 2X6MA 3EJTA 3SDDD 4WWID 2YGQA 4IIQC 4JPVL 2R0LL 4I89A 1HSAB 3E9UA 4PP2A 3RLSA 1MIEL 2A6JA 4WJG3 1YEDA 3D3VA 1J8SA 2BSRA 3MX0A 1RZ8B 1BLNB 5FYJU 2ADIB 3BZFA 1WA0X 4PTUA 3UABA 4F5CE 3VDBA 4YK4C 2W0FA 4P5TC 5G5DB 3ILQC 4AJYV 1Q1JH 4QRBA 1XH1A 1VENA 1UOVA 4Y4FA 1S78D 3RIFK 4BBWA 1QOKA 3BVNB 1J9TA 4KQ0A 3L3HA 4YBQD 5TPWH 3D51A 2H2SC 4XO5A 1CTNA 1K3IA 1R1CA 5DCCA 1J5IA 2B1AH 1F3JA 3X1NA 3PQYB 4Y89A 5FW7A 2XY2A 1QMUA 4JFTA 5D7JA 2J6WA 4IBZA 2WXFA 5IGXH 1FFNA 3MUHL 1XF3B 4JY6A 2AHIA 1G4MA 4N6RA 1NBZA 3T4AA 3PFUA 4NQEE 2FLMA 2GJ6B 3PDDA 3LKOB 2F7QA 2ZOWA 4PVMA 4CC4A 1CLOL 4EN3D 1T5XA 4QRSB 4YIQA 5GS0C 4X6BA 4EIBA 3RZCD 5DZ9A 3V7AE 3MXVH 3ZGIA 3C6SB 1R5WA 3ES6B 4A2GA 2VLLB 4M6MH 3VQMA 3KYOB 1IC5H 4OLYH 5BZXA 2Y6SC 1MCHA 1M05A 1ED3A 3FFCD 3KPNB 5SX5K 4NQVA 4CL7A 3P4OA 1KGUA 3CFUA 3Q0HA 4HUCA 5CMAB 4QCIA 2EADA 4Y4HB 1SBBA 1YAZA 2X2YA 2K9FB 4PG9A 5ESQA 4B9IA 2ESVE 5I1LA 2NR6C 3N44F 2UY6A 1G7PB 2LLNA 3WN5B 4TOYL 5JXAH 1AXSA 4OZHB 3MRDA 4JFYB 5KSUA 2VMDA 4ZXBC 4DK5A 1YYLH 4ZZKA 5DDHB 3VFRA 3A4FA 1NFDF 4ONOA 4AJWA 3M17A 1EUUA 5DHVA 2HCZX 5I0DA 3FN9A 4XN1A 4OLZH 3NABL 3I6GA 3DURA 4HD5A 3UPRA 1C5DB 1PKOA 2WV3A 4J28A 5ICYA 2ADGA 1X5MA 4YQXL 5L0QC 1S9XA 9PCYA 2Z7UA 4IRSB 3DX8B 3GBLA 5LBSL 4MJJA 3C5SA 2AEPH 4EKJA 1OCRB 1EBAA 2O6DA 4QAMB 1JS4A 4QOKB 1P4LA 3U1QA 2ARJB 1ID5I 4M1GH 3ZTNH 5C0JB 1KEGL 1P5VB 2E9WA 3ZPDA 2Z93B 5IHUL 2EQDA 4PV1C 3O6LH 3ZE0E 1HZHL 3QIWA 2FT6A 4PRHB 2FO4A 3V7MA 2IANB 2A74C 2VDNL 4GW4B 3TO4D 4JM2A 4H8WL 1XAUA 2CBMA 3MNMA 3QXWA 2R2CA 3UFIA 3VI4A 5K59F 3OAUH 1NCBH 5DC2A 2W07B 1HZLA 3IDGA 2J43A 3D2UD 1I3UA 2PNDA 4MNHB 3HE6A 4OBSA 4FLSA 3ZYOA 3QORB 4NKMB 1P6WA 4AMKL 5KZCB 5J7CC 1JZ4A 4MAYD 3ZKMC 2OR9L 2XQYK 3WE1A 3FT2A 4JN2B 5L9DH 2YD7A 5TPWL 4S1DC 5F3HA 4NXKA 2H4EA 2BHFA 5BQ7A 3TT1H 3DPBA 3BKJL 1YMHA 1QA9B 1UCTA 3WTUA 3GSOB 3L9EA 3QWQB 3AG1B 5D2NB 1SEQL 4PHZA 4Y7OC 4KNSA 4TUKL 1W0WB 2YR3A 4L3ED 4PJCA 3EJZC 2X3BA 4HHAB 3RTQC 2F53E 3NEOA 2YAEA 4TL4A 1KV3A 5F70A 2XPYA 2OL3H 1A1NB 4P3DB 2ZSVA 3DK2A 2Z31C 5A3ID 3QG7L 4F7TB 3NFNA 5EDXA 3MR9A 1E5ZA 3C6EA 3GFUA 4M1CD 4G82A 5FDWB 3KPSD 3TN0C 3V6ZA 3P54A 1F6AB 1G6VK 2APWA 4KTEL 3VU1A 4L9LA 2R1WB 4Y19E 2GC4C 3QIUA 4N8PA 3KLHD 2H1LM 1M71B 4G8EB 4HIEA 1SHXA 1I8IA 2CRYA 1JPSL 1RI8A 2PO6D 2GEQA 4J1UB 4L4TE 1LO0L 3K7UA 3JV4B 2YEZA 3KPPB 6TAAA 1FLTX 2V7NB 4ZS6D 3X3GL 2RHEA 3F7VA 4NO3B 4AQOA 1AKJB 5K59E 2XV2A 5JXAL 1A7QH 1NC4A 4UIMB 2X6BA 5DHXB 4RGND 3MUUA 4JDEB 1WK0A 4EQ2A 2I69A 4W9FC 2W9DH 1RZGA 3SY0A 1IB5A 1G1OA 2H6PB 1P1ZA 3HUJF 3OJDB 4MCYB 1OAQL 3WFCH 1MJJB 2BCMA 3CZNA 3KCPB 4D3CH 5LAPA 1YEIH 4OLZL 3OAWA 2WGNB 4WIQA 5CLZA 2ICCA 4UOZA 5ECGA 5FO9A 1WIOA 3VXSA 1UQSA 3QWNA 5LBVA 4FNPA 3WS3A 1RU9L 2Q2EB 3EYFA 4BFEA 2A6KB 3LEVL 3FT4B 1IBHA 4PV8A 1IIIA 3NIFF 5CN2A 4UV7L 3CBJB 1CFTB 4NZTL 4LSPH 4TQHA 5IVNA 3IMVA 4WEBH 3UG3A 3QDGB 4I3GA 1SXZA 1XF4A 2OS7A 2Z8SA 4PJ7E 3WGVB 3WFBL 2J4WL 3D9AL 2ZYSA 1LP9F 2FGZA 4GQZA 3X3FH 3O6LL 3UTTB 2KZBA 1A6ZB 3DDFA 3L3KB 2E75C 1GOHA 3D33A 1XD0A 4NP9A 4GT0A 3S3BB 3ZW3A 3LVTA 1OWWA 3TVMC 3U9PH 1BAFL 2R1XA 2R69H 3VWKA 2YUVA 2HFFB 3VCLA 2P5WA 2YAMA 1JF1A 3GLEA 3RNQA 2WD0A 1NCBL 2NY4D 3J8F7 5GIRA 2QQKH 2BNRA 5K69A 3C6LA 2VMFA 4JHBA 4YXKL 4YXHH 4ZAKB 4NQXA 5CLXA 3V2AR 5T5FA 2DBJA 1NQBA 4U1GC 4XPGH 4UF7C 5DMYA 5DA4A 3SDXA 1CTMA 1IFRA 3LKPA 5A6LA 2FH8A 1WD8A 3BSGA 5EC1B 5G4NA 5L4MA 2W9EH 4D0BA 3KLAA 1CFQB 2H26B 3H6JA 4QRPD 4OLUL 5DZNA 3A6CL 1D6EA 4ZUTA 3HUJE 1BQLL 1CTOA 5IUSA 4XCFL 2Y5EA 5FKAB 4ZPTA 5D7IA 4JVPA 3VFOA 1E6JL 5EU6E 1BXVA 1IGTA 2HMIC 3JTSB 1SY6L 5EF3A 1T4WA 3U7AA 2ZUYA 3P9MA 1OB1A 1RHHB 2WVVA 2NSXA 5DRNA 5JPMA 2F7OA 1BD2B 1GKOA 4X80L 2W81C 5AVUB 3L4CA 5J8OA 4PJ5B 2RAMA 2WXMA 3KWTA 2Z8WC 2Z92B 1KLUA 2CJUL 3F7RA 2FQEA 4HJGB 1XFPA 2F7PA 3H53A 4NX0A 5AW2B 3VXUB 4HULB 3HB3D 1G6RL 3F01A 3VXTB 4F1ZA 2BP0A 1PMYA 1O5PA 4J3UA 4PGDB 1ESOA 4R2GB 1MFDH 4B9GA 5DO2D 1R3JB 1S7RB 4GKZB 2F7RA 2D03L 4IK7A 4O02L 4PEEA 4U3XA 4UT6A 4X5QA 3U4EB 2BX5A 1R3KA 2CGYA 4HU8A 5E6IA 5E03A 2XETA 2MQCA 4B5ZA 3EJQA 2YD0A 4F2ME 2YPLE 2K78A 2VH5H 4OQTA 3BN9D 3FT0A 4Y4KB 5C71A 1MNNA 4HJJH 4QXUL 1D5BA 1UC6A 4JQVA 2SEBA 3SO3B 3ZRSA 4A39A 4Z3JA 3GXIA 4MMYA 1YMMB 3D0LB 4UM8B 5FIEA 4CVXB 3ARPA 4I5BA 4N0FA 2W9DL 3V0GA 3Q5OA 3E3QE 4M8VA 1HJBC 1HKFA 3OLDA 4AGLA 3NCFB 5LJYH 1FYTB 5J57B 5BRQA 3SBWA 1MWAH 4B9ZA 1UGNA 1CB4A 2WBJA 3IXTB 1WT5A 5DGQA 2IH1A 4C83B 3O3AB 1RK0A 3GXFA 4QRTB 3N43F 2OFQA 3VYPA 1YNTA 4H0IA 2N0MA 4KJYA 4JZOA 1AGFA 1FBIH 1QRNA 2WAQA 3FB6A 3CIAA 3HCVA 2BIIA 3JYCA 4OKVA 5T1MB 4LSSL 2DOCA 3F7PC 4G6KL 2IGFL 3GO1L 1BV8A 5EUOA 1L5GA 2R1YA 1J8HB 3R7QA 4NWUH 4L1LA 1Z9SB 2I25N 2WQ8A 4Z7OB 3CFBB 3MV8B 4DNLA 3QJFA 4PYHA 2K0RA 1AQDB 1FV1A 5CJXC 3GMNA 4F9PA 4PS3A 4WEBL 4ZX3A 4NNYA 1T3FB 1IAIL 3LRLA 3NJKA 4Y16A 1LEGB 1AQ8A 4DKEL 4KK8C 2IMNA 4N22A 3W57A 2Y7QA 4FXKB 2ZP0T 4X6DA 5EA0L 3KYMA 2VXQL 2R69L 4M5TA 3HG1D 4EVNA 4CSSA 4AYBA 2L3BA 3VFPB 1J18A 4FQJH 5FM8A 1ODAA 3OKLA 4KXCA 5J3HD 3R19A 2D73A 4FLOA 3W0WB 3H9SB 4BUQA 1JOIA 4L8CB 3TM6A 1DVXA 3ESUF 1MFNA 5DA0B 4XPGL 4YL4A 4Y4FC 4EUPA 4GUPA 5FYKE 4B96A 3GS7A 2JKNA 4PMFA 5CUSH 4KJWC 1TQBB 5K9KB 2G2RB 4WU5A 1A5FH 3K2IA 4ALAH 1C9SA 3D4CA 1OPGL 1UD3A 1A22B 3ZLQC 2P46B 4HKJA 1KTLB 4HCRH 2YD4A 5ICXB 2NCEA 1CYWA 2J44A 3D30A 1TVBB 3NUKA 5DU7A 3VFNB 5INDA 3VQLA 4QLWA 5EEYA 5ABAA 5DZPA 5ISZE 2I9LA 1WCBB 1VGKA 3QUML 1G0YR 4RAHA 2VR9A 5EZJB 3BDXA 3S48A 4CC4C 4NAQA 4D8PB 3BKYH 1WZ1L 2YZ8A 3MCLL 4ZK8A 5ANMA 3BEVA 4N2MA 3B7TA 3FUKA 3T4YB 4U6VH 3ULVE 3WSQH 1ASOA 5D8JH 3UMNA 1JGDB 1UM4H 3FCTA 3J7HA 4ZO6A 4XMUA 5KAQG 3FCUB 3CSTA 3OB0K 2XWJB 4AL8L 4IGBB 1ZHLB 1TEFA 1B0GB 4LU5H 2NYZA 3I6SA 1FSKC 3EYUH 3WEOA 4OF3A 3BAWA 3VVWA 5CINL 5CP7B 2AQSA 3CQFA 2YGVA 2CHZA 4X8GA 2FSDA 2GCYA 2GK0A 1T5WA 1PKQE 1X5ZA 5HHNB 3RWHA 2AEIT 4GUQA 1A3QA 3S4SA 4LVHC 3VAEA 1KTBA 4XNDA 1BJ1H 1XSOA 4NWTL 4KNQA 4YZWA 4PJ8A 4ZFOA 3V5DA 1ZIBA 3MRCB 3N06B 4JPWL 1BDYA 5FF6A 5PAZA 3BP4B 5CWSB 1RIUL 2ATKA 1KBBA 4MXWH 3NBNA 3ETSA 3GXPA 1VSCA 3N50A 2MQ3A 3HPJA 1KF9B 4R90H 4BJLA 4Z78A 5C7ZA 1OSPH 1JWSB 4WGWB 2HWZL 2XUWA 1BIIB 4IIQB 4JDZB 1ZANL 3SY6A 1W72L 4NM8L 3TWCL 1E40A 2CO7B 3HS0A 1FNHA 3U2SA 1PDKA 4P48A 1Y18A 4FNUA 5TQ2H 3FB8A 3G04A 4NOBA 4TQ8A 5JIDA 4P5TB 4JM2C 4HHWA 5C07A 5B39A 4FG0A 4U1LB 4ZZFA 4POZD 4LKXA 1O9VA 4S11A 5MEOB 2XZQL 4FQJL 1D7BA 4K15A 5BS0A 2MFNA 1AGCB 5F1SA 3LRHA 5HYJB 1E5BA 1G7LB 5G2NA 3HE6C 3HC2A 4EZLA 2EVGA 1T1XB 2Q7AA 2XYBA 3CH8A 3LRGA 4ECNA 4JB9L 3K6SA 2FIKB 4BZ1A 2BS9A 1GY1A 1SNRA 3FYEB 1D5IL 1A5FL 3V4PH 5KVEE 15C8H 2P5PA 5F71A 4DAGL 3OSVA 5E23A 4LCWB 5DF0A 2ICEC 4AM0A 4XB3A 3I3EA 4EXKA 2QJDA 4NO0A 1GJWA 1NA8A 1IRAY 2EE6A 1HWGB 1MH5B 5L4FA 5JHDB 1A1MB 4NO2A 4FKKA 4F7CA 2P1YA 1S5IH 1YPZE 1XIWB 2MJWA 2W60A 3O11A 3F65A 4PWFA 4DGYH 1UT1A 1IKFL 2EXYC 4PW3A 4OI8A 4FQ1L 3F85A 2AFNA 3PREA 4N90E 1KCRH 4QKTA 5A16A 1LNUB 2X9ZA 4ONHB 1XMWA 2D9QB 5I1EL 3RB5A 1XDTT 1FVEA 3PP4L 1K4DB 4WDIB 3RPKA 1ZAGA 4Z7VF 5D8JL 1W8OA 4YHML 4L9LC 4GRLA 3RJDA 5DD6B 3QIUC 1GKEA 3MREA 1IAKB 3RVTC 5E9DD 5J6GB 2HRLA 4IOFD 4YHKL 5DI8B 1CDYA 2XX1A 5B38B 2V2XA 2VZTA 2ZX8A 4NENB 1NICA 1BWWA 3ZIMA 4WJKB 2B4CH 1TZGL 5CGYC 4YSAA 3GXDA 2VDLL 3QDMA 1QTYT 5KW9H 1BGXH 4WEMB 2KBGA 3FQRB 2HTKD 5LB1A 4HH9A 5GZOD 5KVGL 1EA9C 3MLZH 1TETH 2BSED 1T0NA 3HZ3A 2XTLA 3DVNB 3PHSA 2D3VA 3QEUA 2DMGA 1CFSB 1GIGH 3L3GB 4TV3A 1LDPL 2KZWA 1ZT4B 2OMTA 1CLZH 1JPTH 1QSEE 5EO0A 1H3TA 4N2EA 1HIML 1OP3K 1AFVL 4W4OC 4MXWL 4G8AC 1S9WB 3SSGA 2XNAB 4XCCH 2W95A 4N28A 5JW3L 4O2EB 4MA1C 4R90L 5HI4C 2DTMH 1BFVH 4OIBA 4PRNA 4ZUUA 2B7DT 3ZVVA 2GSGB 1MW0A 3MRKA 3VXRA 3GHEL 3LQZA 2YD2A 1U8QA 3ZN6A 2A1WH 2BNQB 3G9VA 1I3VA 2ED7A 1B3IA 3S35X 2X1PA 3BZEA 3JWNH 5AVYB 2HG0A 3EOTL 3D0VA 2CUIA 4OZGF 2WLNA 4F24A 1U6AH 3BZ5A 4JJOA 1VADB 5B7MA 3C9NA 4NZ8A 2XRAH 1AD0B 4ZW6A 1XR8B 1DLHB 2WWKO 5IJVA 1VEMA 2ENSA 4X9YA 4CNIB 1RUKL 3C6LC 3GSQA 3NSJA 5HHME 5F89B 3V4UH 3D39B 2FHCA 2G5BB 1I7RA 2FBJL 4NKIH 4RMSA 1V7NH 5AAMA 1FI8C 3QFJB 5AZEH 1CO1A 2OMXB 2BY1A 5DJAB 3ESOA 4U1MB 4WHCA 9CGTA 5I6MA 2P26A 1B90A 3PE9A 3QZMA 3V4PL 3KS0J 3UEQA 4UQEA 4LL9A 3VDCA 1NCIA 3WXVL 4JY5L 4JO2H 2Z31B 1UACH 1RULL 1ZPLA 4FA6A 3ZSTA 3TN0B 4S0TD 4HUNB 4XBEH 1OGTA 2WN3A 2JI3A 1IC4L 2WLIA 1DVQA 1NMBL 5JPMC 1KB5A 4UAHA 3B9DA 3UTSA 2CGRL 4IOSA 1PLBA 1KT2A 3QUYA 5DUJA 2D4FA 4TQEL 3FMGL 3SB3A 3U46B 5D1ZA 3UTPD 5T3XL 2WO2B 1KXQE 1G6RB 3A22A 5T5NF 4HMCA 2GT9A 4BK4A 3I2CL 3BZ4A 3GMLA 1WIPA 1OTSC 1HEZB 1U8MA 3GLDA 4OLXH 1J05A 3CSYA 3FFCE 1GPOH 2OSXA 2EINB 4XGZB 5F1NB 3KDMB 5E6IC 4WFED 4S1QL 1DVFD 3NAAL 3WDIA 2MSPA 2Q6WB 4JRYD 3D25B 4YHZL 4PP1D 4YHIA 1N2RB 3MRQA 1WZMA 5DWUL 1JK8A 4JQVC 4MLIA 2J8OA 4WFGD 5FWRA 5SX5H 3D5OF 2Y24A 4TLSA 1N6QL 1MI5D 1N8ZA 5ELIA 5DHYB 3HRPA 3MLZL 4NKOA 1E8ZA 1IBFA 1TETL 4LIQE 3PDGA 4ELKB 2WBJC 1WT5C 1SRDA 2H32A 5IMLA 4XPAH 1P7BA 3WY2A 3ZQXA 1ZEAL 1CLZL 1JPTL 1T1ZA 4OM0L 1HYSD 4DZ8A 1F0LA 1XGRA 1F90L 1V3LA 2PCPA 4IHBA 4N86A 4OGAC 2CCWA 4XCCL 3V0AC 1T7XA 3MFFA 1QRKA 4LPVA 1KBGL 3SYAA 1S3KH 4GG6B 1U0QA 3QDJD 2YJQA 4I85A 2YAOA 4F9PC 1GJUA 3W82A 1AZZC 5HYEA 1FAIH 1CXLA 1L7IH 4L3CA 5DZVA 3US9A 4DVBB 3SKOA 4YFLF 4Y16C 1RCYA 3ARZA 2HLAA 5ITBH 2WIMA 3O6FD 2J1WA 4YDJB 3WL9A 1EJOL 5LNGA 4PJIB 4LBAA 4QTFA 5EORL 4ANUA 3FSVA 4F9LA 4U1GB 3VI3B 1L0QA 1SMAA 3KGTA 4NQQA 4ZO8A 5KVDH 2XIDA 3LY6A 4H7VA 4KNTA 3VW3H 1CXKA 1PZDA 3MRNB 3SZKC 5C3LD 4JHWH 4KMTH 5EEZA 2PR9A 4OAWA 4PBWD 4NKIL 3R4DA 1M6OA 3CN4A 5AZEL 1PZ3A 3BYTA 5LWYL 1FG2A 1KN2L 1L6ZA 3T0XA 1A3RH 3A6OA 4JR9H 4LEXL 1FZJB 1U95A 4JM2F 1CFNA 5KVEL 3B2MA 5BMFL 5LHDA 1BYOA 3VI4F 3S3CB 3HG2A 1A7OH 5IB4B 5D55A 4KXAA 4PJAA 3WFHA 2J88H 3OC8A 3RWFB 1H8NA 4XBMA 3MOBH 2A9NH 3KWXA 2A77L 4EKXA 4Q6KA 2P28B 2MCPL 1B4JH 5LDUA 1MQKL 1G5GA 3FW6A 2HA1A 1KC5H 3DO4A 3LX9A 1A25A 2X6VA 5EN3A 1A6WL 4G9DA 2EYTB 3RAJH 25C8H 2DWEA 1SM3L 1U8KA 1YQVH 2OMZA 4D7BA 5BZWB 2R51A 4KK6D 2VOTA 3P77B 1I7TA 3FK3A 1FF5A 4HGMA 4HW6A 3LH2H 3K91A 1HH6A 3HZVB 4BCZA 1P4IH 3S6CA 2JWYA 3DTXB 4MXQD 3S0PA 1XF5A 1JI1A 4KVCL 4EF3A 1ZLWH 2YRBA 3QUHA 2WAHA 2VW4A 4XNQA 4AZ8A 4ODVL 1IBDA 3R06B 4ZSOE 2QADD 3HPLA 5HDQL 3SODB 5AEAA 4QWWD 5E7BA 1ZHKA 5AOIA 1BMWA 3TZVC 4H1LA 4OF8A 3IVKB 4AK2A 4EJ1C 2BH0A 2ZWNA 2YKLH 4MDJA 3BP5B 1MLCB 1MHEA 3GM0A 4IRJA 3EBGA 4RGNE 5BOPA 3RKPA 4HWEH 3IKCB 4AYFA 1SEBA 1GAFH 4L8BB 4ZTPH 5DMIL 1F42A 4KOCA 1WZLA 2ATPA 3MLVH 1AMYA 4AEHH 1A47A 2WXQA 4JFPA 4PJ8C 4QT5A 3DROB 5L6YL 1AO7B 1N0LA 2EYSB 5K93A 5FW6A 3CBKB 2BO0A 4JO3L 4M4RB 1HE7A 3UCRA 5DRWA 4XTRC 3FOMA 2PW2A 3GM8A 1HL8A 3E80A 4OCXH 3WUWA 4EBQL 3FF7A 1FFRA 4CGUB 3VFTA 2JTYA 2IFGA 1HS6A 2YQ2A 4CADA 5B3JF 2V2TA 2EC9T 2DLGA 2DY2A 12E8L 2A6JB 1YEDB 1L7IL 3D3VB 3HS0C 4AVHA 2BSRB 4L4VD 5AKRA 4TF4A 3SDCB 4V2BA 4X6FA 3TPUA 3AT8A 4KKQA 1CGUA 3BE1L 5IT2L 5LGKA 5ITBL 1HAWA 3FH5A 2XV6B 2W0FB 3SDYL 2VL4A 2C8NA 2GUYA 5TDNB 4P23A 5JIIA 4XN7A 1YN6A 4M43H 2I85A 1SJHB 4KRLB 3QEQA 2CBTA 3CDCA 2FBRA 3W11D 2EDRA 2JLLA 4LHUD 5TE4L 3L3HB 5JHLA 2YLHA 4UQBA 3BWAA 5E2WL 4UI2A 1SLVA 3VW3L 2QQNL 3PWUA 4MA8H 2EC8A 1KCLA 1WYJA 2M26A 1DJGA 1SDAB 3IDNA 4FJZA 3O4LB 1ML0A 1NGYB 4R96B 2XZZA 4JY6B 2VQ1B 4N6RB 1A3RL 1NFIA 1QNIA 5TK2A 3WAJA 1NSNL 3NCBB 2VWEC 1R3LA 2W92A 3FO2A 1T5XB 5IF0B 4YIQB 2CALA 4X6BB 4QRPE 3GSUA 1B3JA 1E5YA 3MOBL 4Z5RA 4GKLA 1WWAX 1E5UI 3PF2A 4LSQH 3WEBA 1CI5A 2UVEA 2ZOKA 3KVPA 2OSWA 3OMAB 4HC1L 1VGEH 2P8PA 3CSFA 1LVEA 2LV4A 3DMMA 4NRYB 3W5NA 1I7ZA 1HEHC 2AJZB 3MCG1 3LZPA 2CG9X 5D93C 1CIUA 3CX5K 1EGJL 3BQUD 1W6WA 2V5RA 5GJTH 4HUWB 3U36A 2HUHA 3JV6B 4UM9A 4FTVD 4QCIB 2ICWA 1H0DB 2VZVA 1QABA 5EO1A 5ESQB 4RLDA 2K6YA 1FSKB 4Y9CA 2Q8AH 2VXSH 5I1LB 5D7IF 3S88H 3AU1A 2DQFA 3BUYA 1YG9A 4AVIA 1AXSB 3MRDB 1PBYA 4TNVF 3FC8A 3ZZ1A 1IJ9A 5KSUB 4MD5B 4M93C 2G5UA 1GR7A 4IKKA 4OFPA 5HGAB 4LVHB 3VFRB 4K73A 3M17B 3DV4A 4Z3HA 2XOTA 2VDLB 5DHVB 4BQCA 4C47A 1U36A 4N1CA 2ZKHL 3GSXA 1EFQA 4XCYA 1KNOB 2HN7A 3BVTA 1QPPA 4JKLA 3CZUB 2XTJE 5EEWA 3DHUA 2ADGB 5KS9B 4FN0A 3VFGH 3W38A 1S9XB 1G9MH 4G5ZH 4RMQA 1I82A 4IDLA 2DMCA 3C5SB 4G83A 2BSTA 4NUGH 2Z7ZA 2K6ZA 1RZJC 2C9UA 3NCJL 3CX5J 1GGCL 1A4KB 5D7LD 1FGNL 1MG3C 3P1VA 2M2DA 3QUXA 4OCXL 3L2MA 5I5JA 1TO5A 3AB0C 2FO4B 5I0YA 1RZ7L 2V2WB 1TYJA 2R8SH 1W2KT 3II3A 4JPKL 5JOPD 2OMYB 1F4YL 3KBEA 1TJHL 2D7OA 3ARYA 2FUTA 2DYPA 1IFHL 5C08B 3MRHB 1KULA 1YNTF 1UZ8A 3FUEA 4W70A 3HMXL 5GS2D 5SWSB 3STLB 1HHGA 3WD5L 1IILE 5EUOF 1KIQB 2UZIH 4PLKC 3HG1E 4M8RA 2AP2A 3MRFA 3JWOL 5F3HB 1AS7A 3GZQA 1JWMA 1RD6A 1TG8A 2UY7B 5BQ7B 1SN0A 2ICEB 3DPBB 1CLVA 3F84A 1N9PA 3BJ91 4PVLA 5AAMC 1XGYH 2CBQA 1ZWIA 4LBEA 1KLFA 4XMKL 3ZTJH 4X6DF 4PJCB 4Z7WE 3WLBA 1EERB 2Q20A 2PR4H 5I76A 1X7TA 4FQHA 3BZDA 2QT6A 5ADPL 1UD6A 3T0WA 5IP4A 3PRZA 1A4AA 3CDZA 3C2SA 1GA2A 3B6SA 5AKVA 2GFBB 3MR9B 2F15A 4Z18A 1HWWA 4K9JA 4RQQA 3MO1B 3V6ZB 2I60H 3PHOA 1IBGL 2EXWC 1YYMH 3M86A 4K71C 1ES0B 1T4KA 3BWZA 4M61B 4NBZB 5AVZB 4K8RD 1XSJA 3RPIB 4A7SA 4L9LB 3AWFA 1TYEB 3NIGE 3QXVA 2NW3A 2AC0A 3QUYC 2X9WA 3BP6B 2XQYG 5D1ZC 1QLFA 2YC1A 1FGVL 2FSEA 3TNNA 1CD9B 3QNZA 3U9UA 4CAGA 4UQ2A 1MFBH 3GRWA 2VXSL 3CZFA 4J2QA 4F33A 1T0PB 3L1OL 4MZ2A 1FIEA 3ALPA 4M62H 2ZPKL 1JGIA 2OMVA 3WEAA 3CFCH 2DQCH 3RKDC 1LE5A 3HNSL 1XCWA 5E0FA 5C0AA 3QS2A 4HAGA 2OA9A 3SZ6A 1ACCA 1BREA 1UVQA 2W65A 4K0OA 2N4IA 2QLYA 2LFGA 3C8HA 2I07B 3TFKD 1A8ZA 4GI6A 4RX4D 1K5WA 3BLPX 3UG5A 4HETA 1I9JH 2P5ED 2CIIA 3MRPA 1GC1H 1U3HD 1MHCB 1TZIA 2AQRA 1UQSB 4KDWA 4GW5B 5BW7C 3WS3B 2OK0L 2PYED 4I3SL 1MCEA 3B2DC 1N64L 2IPKA 4BFRA 4MA1B 4P2QA 1G9ML 1GGYA 1VESA 3L2NA 2CIKA 4EQ3A 5CLWA 4LB8A 3R8BB 3BYYA 4OFYA 2DLIA 2VC2L 4PJGA 5FDYA 1SXAA 1T83A 1GVIA 4L48A 3INUH 2HT4C 1XF4B 4BH8A 5IW1B 1QSFA 4B95C 3N0PB 5IQ9B 3A24A 1GXEA 4YSPA 3N55A 4RAVA 1CT8B 2R1XB 1T89A 2Z64C 1SQMA 2Y1ZA 3K2KA 2P5WB 1LQBC 1EFXD 2VYRE 4NM4H 1MQ8A 4TVPD 3RNQB 3GI8H 3FSOA 3KPMB 3QNXA 4D0DA 4F3FA 4XCEA 5GIRB 4FLQA 1IGFH 1USQA 2BNRB 2X4UA 2X05A 5KBMA 2XTSA 1KOAA 1OCCB 1QD0A 4FQPA 1BCIA 4F9LC 1MDAA 2X4NA 1AG6A 1B0WA 1IVTA 2R56L 5GSVA 3SDXB 5F3BA 3HTLX 4I9WD 4PRDB 4PTTB 2JLPA 3FFOA 4JX0A 1LWHA 4J3OC 4Z0BL 4RGOL 3MGOB 5DD1L 3HN8A 4JHVA 1QWHA 3BVWA 3PHAA 1NKRA 3KL5A 4FQXA 4ZD3L 1H9DA 2H7WA 1KXQA 1UB6B 5C0ND 3SKNA 3CGTA 4ZPTB 1FZOA 4DFHA 3QHFL 4OJAA 5CJOH 2DQTL 2ZG3A 3AFLA 1IGTB 2DQEL 2DW5A 3QDAA 1IQDB 1QHPA 2CLVB 2ZIDA 3SKJH 3F83A 2Y5QA 5ITFB 4AYSA 4JPIA 1OB1B 3AXIA 3HHSA 5DRNB 2FJFB 1VHPA 1BM3H 1F4WH 4CKQA 4TNGA 5BXFA 5IVXB 3UGUA 3V0WL 1UKTA 3FQ4A 2ERJB 3HNTL 4ZJ9A 2VKXA 4TPRH 3WYRA 1OTUC 2C9VA 1TTAA 2GAZA 3N5AA 2HAZA 4FFYH 1LL1A 1JAEA 2ZWSA 4HOWA 2VDRB 3ASWA 4CU8A 3PGCB 2KMWA 4LASH 4PLOB 3CCHB 4I88A 4K2UL 2OULB 4GP5B 1R3KB 2H47C 4MYPA 3E3QC 2FQGA 2ADJB 1W15A 2YWZA 4OFQA 5E6IB 2BJML 1F1AA 1FNEA 4F7KA 3Q2WA 2W9LA 3NK4A 4Y1AB 4ORGB 3K6FA 2ENPA 5EZIH 4NJAL 4TLTA 5BO0D 4OLEA 4N0UE 3QYNA 4K3DH 2X7LB 5D6CA 2SEBB 1O6TA 4FP8L 4N0FB 5E9DE 2EE0A 2PCYA 3RBGA 1C8PA 43C9B 3LZQA 1GGIL 2EEFA 1U4EA 3B1TA 1J0HA 3FQ1A 3QBTB 4ZPVA 2WBJB 4IRJC 3MACH 1RK1A 4PY8J 1D9KA 5D71H 1KJMA 4YSUA 1AGFB 1QRNB 1FO0L 1O5DT 4WUUA 4ZMAT 1CG9B 2A6IA 3P4MA 5HHXH 2FBOJ 2VR4A 3BP7A 5GS0H 3A5VA 5HVGB 1E6OH 3K4ZA 2DQHH 3QJFB 1ACYH 2WXHA 5C0BA 3AAZA 2F0CA 5K39B 4HUVA 3K5SA 4NNYB 4R4BB 3CC1A 3L3OA 3MLRH 1AXTL 4FTDA 3K2UH 1DE4B 3ARED 1AOZA 3BOVA 2XY1A 1DJHA 3SOBL 3H85A 4CN4A 1P0SE 1ECYA 4YZFE 3KS0H 3DX1A 3OKLB 2X4OA 4HDIA 4G6FD 2IALB 4FFTA 2GBTA 5F0LB 3KWVA 1BF5A 1B4LA 1ZT7A 1XCTA 3FOLB 4QGYA 4MJ2A 4ZFGH 1N10A 5D1QD 3RA7L 2AJXL 4P23C 3I9PA 2FGWL 2MWCA 3BAJA 3MODH 4NZRL 4WWKA 3SQOL 4EUPB 4GUPB 3HR6A 3UYPA 1QI5A 2X3CA 3G6AB 5DJXB 5L2JA 2ZZUT 2B08A 4WU5B 3SDAD 3S34L 1DUYA 4PS4L 3U1SL 4JM0A 4XPFH 5D1XB 4HKJB 3IJHB 2JSFA 3KPTA 4GBXA 2Z8RA 4KBPA 3VUAA 1BQKA 7CGTA 4FG6C 5EU3A 3SE4A 3TH3T 1F2XK 4JHAH 5INDB 1JFQL 4PIBA 1D7CA 2R0ZH 3LXBA 5IB1A 2YARA 3I6KA 3EKCA 4WGVB 3U83A 1RZFL 2DIEA 4YDLC 4JG9A 2YD9A 2A3TA 4NJ9H 1K2DA 3AQYA 1FRGH 1N26A 3BEVB 2X42A 4BFFA 3C8KA 5SWZD 1KCUL 2G75B 3FZUC 4NPKA 2EKSA 3DMMC 1HX0A 3MJ9L 2RALA 5KVFL 3VJ6A 1KBPA 5C92A 4GYBA 4UUJA 3G6DH 4NDMA 1NGQH 5CU5A 3UTPE 2VRKA 2DD8L 4MHHG 5E99L 3TZVB 1BVZA 3FRPG 3B9EA 4GRMA 5E5UB 1KCSH 3WDJA 3O2DH 4OZFB 3TA4D 4HWZB 1L9MA 1G7IA 1KYDA 3NH7L 2GK0B 1CGSL 1T5WB 5LAXB 4WFEE 1GSKA 1LDSA 1NEZA 3RWHB 2XXGA 3GIVA 3MXWH 5I1GH 2M83A 5ALBL 3ZOAA 2R4SL 3MKGA 4JRYE 4RSYA 2DAVA 4Q9QH 4PJ8B 2NW2B 4K94L 4ZFOB 3LZRA 4FEIA 3V5DB 4TRPH 3MLSL 4WFGE 3IU4H 1PIFA 5FF6B 2YBGA 1GGBL 5D71L 1S3RA 2PXYA 2ATKB 3SE8L 2Z4QA 4DVRH 3EFDH 4Z95L 3GGWA 1MI5E 2R39A 1TITA 5BVPL 4BKLB 2RH0A 3B83A 5F0JB 3D18B 1JXFA 1JDAA 3EBHA 1CFBA 5M94B 3FSWA 1E6OL 4YPJA 1NIBA 3PWPD 2J1KA 3QPXL 1ADQL 1IT9L 1U4FA 3CN0A 4J3VA 5DJCA 3VXMD 1E28A 3EDDA 2X9XA 1PEZA 1NGZA 5CHNA 1QFOA 5C0IA 1NPNA 1Y18B 1TZAA 3QUXC 1SUHA 3V0IA 1LO2L 4MWFA 4GO9A 5C0EA 3QDJE 5E08H 2EIZA 3V6FA 1LXMA 4M3HA 4Y5YA 1Q9KA 3L4TA 4X4YB 5B39B 4LKXB 3DI2B 1YY9D 3VWJA 5BS0B 5ENWA 5HJGA 5DHDA 5DLLA 4QRPA 3US1A 4MX7B 4ZFGL 1GJIA 3FKUS 1IAII 2N59A 1CF1A 4JM4L 3GSVA 2VRAA 4HXBL 2X28A 1MAKA 4K5MA 1HQRB 1G4RA 4QRQA 5FUOH 3ZE1E 3MVSA 3ULVL 1FDLL 5DEFA 2FJHB 3P0VL 5H37A 3N91A 1AIFA 5KANG 1RUAH 1F13A 3GD1C 5CSBA 4ZNEE 1V7ML 2FQDA 3EFFB 3MZTA 1BP3B 4P8QA 1KN4L 1S7WA 4NNPL 4Q8BA 2ESVB 4ISVB 3C60C 4NO2B 3VMOA 2UV3A 3L17A 3RGVA 2W60B 3LHPH 3MNVA 3IPFA 4PRID 2X1QA 3KJ6H 2ZOTA 4NN6C 5E95B 1RUMH 2FO8A 3OX8A 3O8XA 3AXHA 2KDGA 4J3OF 4BELD 1FVEB 3APMA 3EGXB 3N42F 3T2NL 5DMJB 4OM1H 3PWNB 4JQIH 3TYFA 2ZSWB 2H3XC 2DKSA 3V6BR 3FN0H 5E9NA 3N85H 1IGCH 4PBDA 4JCLA 5JMRA 4WCYH 4DP1X 1FNAA 2H5UA 4KX8A 2C5DC 5E8OA 5F6IC 3DX2A 2JB5L 4EI5B 3WKNA 1KBKA 4GEJA 3VYOA 2V2XB 1DSFH 1EMTL 4TYUA 2DYRB 3IMBA 4NS0A 5T1LB 5JTWA 5J9PA 3BGFC 3HFMH 1QI4A 1MNUH 3IJYA 1PLGH 3TEZA 1SXNA 4MNQD 4PUBL 3HS9A 1I4FA 3QDMB 5FM4A 1CUOA 4KZEL 2PMZA 3QWRD 4GMSH 1U41A 5L2KD 1WBZA 4M3JA 3KR3H 4B9PA 1MRFH 3HLAA 4HH9B 3ZE0B 4ONFH 1JUFA 2CRZA 1M57B 2GIMA 2YN3A 3QCVL 4X6CA 4HJEA 1FJ1A 2X2JA 3LZNA 3ETBF 4Q9QL 4NHCH 5IKCA 4QEGA 3A67L 4ZBJA 1KZQA 3IU4L 1RUPH 3GSNH 4HXAL 3O45A 4Y9GA 3FJTA 3GMOB 1T80A 4LOFA 2P80A 3FHQA 2I5YL 2WZ5A 1OF2B 3BDYH 3SDDC 5GSRB 3C5ZA 1I85A 4K07A 4HF5H 4PRNB 4XRCA 3TBTA 1WICA 1LEKB 3AB0B 2Z3FA 3RWGA 3G08A 3MRKB 4PJXE 3VXRB 2NY1C 4HFUH 1M2VA 1CD1A 1MY5A 4Z0XA 2CKBL 1YJDC 2CQVA 2Y6TE 5DZAA 2IPTL 1AQMA 3NSYA 5EWIH 1BOYA 2NY2D 3WI9A 2BFGA 2OBGA 1GRWA 2WKOF 3OR7A 2FX8L 3V4LA 1T89C 2FAUA 1KPUA 3WIIL 4DKTA 3EGSA 2EIKB 3RL1B 3FRUA 1ECZA 2F53B 4LGRB 4ILDA 1WAAE 2WYTA 4L4VE 1ILSA 1WAPA 5J06A 5BCAA 4XP5L 3GSQB 1X6LA 4IRZH 4HV8B 5FGCE 5I0ZA 1MHPL 3P73A 2AS5M 1A2YB 2YGOA 2JCCF 2VDOB 3QPKA 5DUMH 1XHHA 5EMYA 3ARQA 5C0BD 1EXGA 1WBYA 4PFEA 4BFOA 3MCKA 5FUCC 3G5XA 1IGML 4Y19B 3S5LG 3S36L 4BE6A 1BEYH 1FAKT 2CXKA 5LN4A 5ECJE 1IEBA 4FQXC 5BNXD 5TFSH 1AP2A 1JK9B 4FQCH 4L4TB 3CJJA 1NWOA 5CFHA 3RG1C 1UD4A 1TTUA 3PV6B 1ZA3B 4LPUA 3LHPL 4K71B 2EC9U 3RHWF 5A2AA 3A4DA 2WLIB 1SN2A 4YHPB 3WTXA 1SJXA 5I74C 1RUML 4TNFA 4BDVA 1WH0A 3QUYB 4UT9A 1U8OA 3UJIH 3BWUC 5L8JB 3BO8A 3RIAF 5H35B 5A2FA 3RVUD 1K72A 1WQVT 1ZIAA 4ATTA 2CLRA 2CPUA 1QYGH 2BY0A 3C12A 2GT9B 1MPAH 1QLEL 3B8YA 4JRXA 3ZDYB 4XO4A 3UBGA 1J0KA 3BZ4B 1DL7H 2K7PA 1PZ5B 2XXFA 4L1TA 1IGCL 3CSYB 3O2WH 3VFVB 2B1HH 4BUGA 2E7LA 3TYGL 2HT3D 1RKRA 1JMXA 4FTVE 5EF2A 5CD3A 2VL5A 1D5ZA 2JFCA 4PREB 5DTFB 2UWEA 2YO3A 1KXVA 3CFDA 3N3EA 3MRQB 3N0AA 2XQBH 2Y7MA 3F8UB 4NQDD 2Y07H 4I0CC 3GJEA 2O5NA 1JK8B 4N9GB 3L7FB 3D7PA 4GMSL 4PJ7B 2DJSA 3MRGB 5FHAL 5HHOD 3E7JA 4RA0C 1ERNA 3IJSA 2NY0D 1WJ3A 4N2GA 5DK2A 5EV7A 4NKOB 5AVSB 5DMKB 2J6EA 4TSAL 2JCCE 2EDBA 2H32B 1U58A 4NHCL 2A9ML 4I77L 4L5FH 2GIYA 3CN1A 1FO0B 5CO1A 4JFWA 5DJ2A 4DPCX 4TQPA 4KJQD 3ZE2F 1GTFA 1NJ9B 3CXHK 2DMHA 1QKZH 3OAZH 3LQAC 4BK8A 2EH8L 1MFEL 2IDTA 5EOQL 3NACL 2EUXA 2X9YA 4HGWA 1JGVH 1ZJBA 4I48A 2XWBB 4MQ7B 4F37F 2IOIA 2G4GA 3SKOB 3L3OC 5MERA 4LOUD 3SPVB 5D7LE 3ZR6A 3W1ZA 4LGSB 2ED8A 1XH0A 2F6AA 3A4EA 3WL9B 4H20H 4BD4A 3WY4A 3OAYK 2ZKYA 5I18H 3RVWD 1EEZA 2X38A 3VNZA 5JOPE 4ANKA 1OK8A 1Z3RA 3IS0X 1M4KA 2APFA 1KGJA 5EIIG 1FVDB 1E30A 4NFBA 1FH5H 4A2HA 4PGZA 3G5WA 4P2AA 1EZVY 4XNMA 1UOKA 3T0ED 2APSA 4KVNH 4OAWB 4WW2C 3S37H 4M9OA 3VH8G 1JZ6A 3GWJA 1M6OB 4OIFA 1UG9A 3UO1H 4E9WA 1N12A 3X12B 2K9UA 3NIDE 2YIHA 3T6ZA 4YSRA 3AQZA 1DDTA 3CXHJ 5DHVH 4LSVL 5ETUA 2BSSA 2Q10A 4X0KA 4LVNC 4GBXC 3HOGA 4PJAB 3WFHB 2ALWA 1PSKL 2R29L 4JN1L 3FN3A 4N9OB 4ODHH 3SE4C 2JH2A 1YN7B 3ISRA 4IOIB 3P3SA 4FYSA 2FDBP 3DETC 2L7QA 3OMZA 2B9AA 2DWEB 4LAQL 1T22A 2CH8A 1U8KB 4JFVA 1U33A 2H6OA 4GKSB 2G0KA 4KTGA 1U8LA 4GG8B 4YFEA 3OB8A 1MCOL 1MUJB 3QAZC 3RWIA 4ZS6C 2PF6A 4HK0A 4PRAB 4KMQA 1TQTA 4GAYA 1V55B 4J23A 3FCSA 4LIQL 4RGNC 1SXSA 2LHAA 3I3BA 3UOAB 3CVIH 2EEBA 3EG9A 3HPLB 2QELA 2YMXH 1VPOH 1UOLA 1ZHKB 4OQ1A 4UYQA 3TTSA 4LVOC 1XF1A 3DIFA 2F54D 1A7PL 2ZXDA 4U0RC 4H1LB 4XO3A 5T33H 2DLEA 5A6MA 4G7VH 3SJVD 5C0FB 3ULUC 1QZ1A 4ODUB 1MHEB 2KYIA 1VACB 3B9KD 4AGQA 4C56A 4I0PD 3RX8A 35C8L 3CBRA 3OKNB 4E5XA 5IW6B 1PD0A 2YD6A 4EO5A 1SEBB 1ETZA 2EDNA 4NCDA 3IAQA 3WCYA 2ATPB 5E8EB 4WSGA 3VVVA 3B3IA 4K9EC 1N0LB 5IROA 4HKXB 1E7UA 3BEWB 2P5EE 3G5VA 4JG5A 1N5YL 2XN2A 4XPTL 4YWGL 3EYVB 5IB2A 1QKZL 4P59H 3UYOD 2PW2B 2NSQA 3WUWB 5AKSA 1M1XA 3VFTB 3X11A 5FEBA 3ESVF 4IEFB 1JGVL 4M5YH 3QHZL 1NOAA 4YAQA 2V2TB 4F58H 3BUBA 1AGBA 1EDHA 3GUFA 1TZOA 3BCFA 4JKNA 3TNMA 4HWUA 2NLJA 3ARBB 3TPUB 5C0DB 3LN5A 4LQFL 3IM1A 7TAAA 3IFPA 3L5XH 1LJMA 4H20L 3QCUL 4LPCA 4DKFH 5HPMA 2A0LD 4HWBA 3I9AA 3CVHA 4P23B 4KPHL 5IBLD 1YN6B 4LCIL 4Y5YC 5KBPA 1X5XA 5DK0B 1VAHA 1JRHH 4G9FD 3EXJA 3VWJC 7FABH 4TVPE 4PJGF 4XVTH 2OMBA 5GZNA 3T3PB 5C3IA 2DQGL 4XI5D 4PCTA 3IGLA 4KGJA 4FQ2L 3VG0L 3X1FA 4OSUL 3R1GL 2EECA 2H8PB 8FABB 2FR4A 2D2CC 4MDRA 5EHFA 1H3PL 4NKDB 3LNHA 1NFIB 4I9WE 2NYYD 1AR1C 5T1DL 3IFOA 3O4OC 3U9WA 1R3LB 1OCZB 3FO2B 1PX3A 4FNSA 2BIOA 4ZT1A 3RUGA 3L95A 5CM1A 3QQDA 3GSUB 2WXGA 3DRTB 3REWB 2ZCLH 4K7FA 5CSZA 4Z5RB 1SOKA 3F64A 5F0MB 2ZOKB 2BMKA 2H1PH 5HDBF 1XF2B 4U6TA 3RGVC 2CK0H 5HHVL 2APVA 4Z7AA 3DMMB 4TTDC 2PPDA 4G7YL 3BW9A 3WLWD 2EVHA 5I1HL 1KTJA 1P7QD 3O8XC 3O6ML 1PKQB 4FQIH 4S1SH 2N7AA 5ILTH 4UM9B 5IMKA 1HYRC 1CE6A 1UWGH 2ICWB 3WEXA 2P8MB 4HBCH 1BVKA 4HSCX 3VE0A 1L0XA 3M6DA 3AU1B 3RVXC 3FTXA 5KSAD 3TV3H 2V3DA 3MBEB 1R4XA 2XJLA 2XLLA 3LPFA 4BHUA 3QUKA 2XTJC 3V6OE 1X5JA 4JZNA 4JFUA 2OTUB 4CDGC 1DR9A 1JGUH 1OT2A 3MV7A 4E9YA 4MJIE 3CH1A 1M3IA 2E27L 2IWFA 3DV4B 2Q86B 2FTAA 4M6NL 4UIKL 3RFZA 1SOQA 3GKWH 1VFMA 5FO7B 4R4ND 1N59A 1H15A 5T5FH 1HILA 3ECVA 1EAOA 5DRZB 4XCYB 2HN7B 4U1HB 3ROOA 1OLLA 1CFVH 5FFOA 2JJSC 4DT2A 4ZX5A 1D7FA 4ES8A 1DVTA 5EIQA 4ZTEA 4OGYH 1XZWA 2EDLA 2WWMD 3CVCA 1BF2A 3LMJH 4YE0A 5H4YA 1J1OL 2VXUH 4OZIE 5LVEA 2ZOOA 1BVNT 2O5YH 3MAWA 2CR6A 3ECWA 5CCKL 2F74B 2O5ZH 4J12A 1JXDA 4BFNA 5G4MA 2A7BA 4C59B 2XN9D 3J27A 2FJGA 4P5RA 1BQSA 1HHKA 4Q6IC 2J2ZB 4P59L 4W9HC 5D2LF 3O6FA 2XWZA 4J8QA 5CJBA 3C5ZC 2IPUK 3TURA 3B2PA 4CDHA 1I85C 2DQDL 2RGSA 2WUCL 2ZUQC 5FOBA 5C0CA 5HYQA 1KPVB 1NMCB 4FKHA 5DZJA 3NRPA 1CGVA 1OAZL 2JJUA 3ZGHA 3PDOA 1OAYL 4HX1A 2VDRH 4WO0A 4MZ3A 5ICZA 4DKFL 1GMIA 4FXTA 2VO5A 2WQRA 4MS8D 1M42A 4UT6H 4AW4A 4ZNEA 5AVTB 1NLDH 2F19H 2WNWA 5E2TL 6CGTA 1DO5A 1YPZB 4UV4L 1WG3A 1QLRA 4NBYB 3MRFB 4AH2A 1QQDA 1OSEA 4OQTH 4XVTL 5CCHE 2X5PA 3JWDL 3GPSA 4OTXH 5FA4A 5IHZB 3SD2A 3PAUA 1I7UB 5H94A 3L08A 4HFWA 1CGTA 4XODA 3DUSB 4XP4L 1E9QA 3WNJA 1ZWIB 5I26A 4LBEB 1KLFB 2PCFB 1FLRH 1LO4H 3C60B 3QC5X 2ICWJ 2Z1KA 1ZVHA 4FQHB 4BIKA 1XZ0A 4JVWA 3LRSA 2Z65C 2VT0A 2WQAA 4TUUA 4NN6B 2VZ1A 2PN5A 1X5LA 5DK0A 4G43A 1CLYH 2GJZA 2XBDA 4CMMA 1HESA 4A6YA 5DLMH 2CCLA 2H1PL 3TPKA 1C12A 4PB0L 5IMMA 4JFDA 2ZUXA 4Z3FA 3OZ9L 4TS6A 1BQ5A 2EDQA 4PB9H 3LPGA 4UU9A 3RYMA 5D2LE 3I85A 1SJMA 4NN7C 4CJ0A 4B9JA 4EDWH 4FQIL 3RNKA 1TLMA 5DMGD 3QZOA 1QLFB 2W91A 5F6IB 3S36X 2HH0H 4N2AA 2FSEB 1MW1A 4YSQA 3TNNB 3U9UB 4P2OD 5DFTA 1DN0B 2AI0H 5TDPA 1IAMA 3CZFB 2ENYA 5HD8C 5FKPA 3BGFB 3SO5A 5C7XL 4HPYL 1MCPL 1QHOA 2DL9A 3HJ0A 2DWYA 4IMKA 3KJ4C 1IL1A 2E3VA 1DYZA 4DO4A 2YFOA 5IM7A 3G5YB 2OYPA 1A4BA 5F7YC 4F57L 1DQKA 4XBPB 3JBG7 1XGPA 2NUTB 2QFRA 3Q06A 3I50H 3GSWA 4HHGA 1KXVC 3VD3A 1EEYA 1OQOA 1AS8A 2OR7A 2YAHA 4UOW0 5FK9B 4NC1E 1FL5B 4NRZA 2CIIB 3DV6B 5HGGS 4KRNA 4EUPH 4A2MA 4Y2DA 1CFVL 4WU7A 2E6JA 2YBRA 2YRLA 2YA2A 3I84A 3H9HB 3SDDB 3TIEB 1YUHB 4XP1H 2NY5L 4P0DA 5GS3A 1GGUA 1WSST 4N0YH 1M7UA 1SYVB 2O5YL 4AVKA 2NY1B 3MBXH 4PJGB 2O1AA 4GINA 4R7NA 3TV8A 3GLZA 1RLWA 4AYGA 1SLWA 3ULUF 4PW4A 4YSDA 4X8JB 2MCAA 3QI9A 5IY5B 5AZ2L 1IM3D 2EUWA 4AUJA 2WZPD 4QRRD 5HHMB 1VLXA 4JFFA 4BA0A 5TDOB 2P49B 4H88H 4JRWA 4ENEC 1LO5B 2WM0A 5JW5A 4RAVB 3PWPE 3VXME 4J3WA 2Y69B 3E6HA 5K1VA 4U1IA 5HGBA 4F93B 3EGDB 2CO6A 1DBJH 2FD6H 3NEXA 1UM6L 1NCHA 3II2A 3QNXB 4D0DB 4N2FA 4X7TB 1RQ5A 4XCEB 3EO0B 1WC7B 5AALA 2CHNA 5DO8A 3TJPA 1RURH 1U3YA 1N0XL 4JGNA 3U30C 1A4JA 2X4NB 4DGIL 1ZY9A 2WSKA 3EH1A 2WKGA 5GSVB 5F3BB 3MYJA 3FQUB 4OQTL 2HJKA 1SJEA 3D8MA 3GJFK 5EOTA 4EN3B 5JIQA 4XAWH 3EJUA 4MJ4A 4OZFH 3RZCB 1RZIA 4U3HA 1HNFA 1OD7A 2ZICA 4R4FL 4X5WA 3ZY7A 5IEHA 3S9DB 1DO6A 1FFOB 5T1KD 3KM1A 4LSDA 3SCMD 3ARGD 3QGVA 5JR1H 4LRNL 5INCA 2FYVA 4RMRA 1NBQA 2BVOA 2Y5TA 2F58L 1URIA 3QULA 3VTAA 3KPRD 5EZOH 2J20A 3HHSB 1H3XA 3F7YB 3ZHNA 5C9KA 2XFXA 1BXXA 5I74B 4NO5B 3KGSA 3MCYA 5IEKA 1T6WA 3ERXA 2MH4A 4IDJL 4JREC 3WFEL 4APXA 4PWIA 1MLBB 2D4DA 2GAZB 5FXCH 4X50A 2XQ0A 5JXED 3HW7A 5IV2A 1DFBH 5I19H 4M5SA 3EW3B 2HFTA 4GQPH 5FV2A 1OAUL 4PRIE 4I9XA 1PQZA 1AD9A 1EXUA 4FC3E 4PB9L 2XCMC 4XWOC 2IF7A 4AG4L 4IOFC 5J13C 1LYQA 2AEWA 4HIPA 5I9QC 1FNEB 2HH0L 1RVFL 2AJYH 2DQMA 4OKDA 4E41A 2J21A 2HZHA 3MNDA 2MKWA 4PJFA 4QTIL 3AW5A 5JORA 3X1EA 3OQ3B 2IWGA 2EIEA 5D6CB 4N26A 2J1YA 3G6JE 4KXDA 4XXCC 1NIFA 5C0RL 2X1OA 1EEQA 3U7WL 3UEZA 4TSBL 1OAKH 3BPLC 1AMXA 5B1AB 3IB4A 1P7KA 4WHDA 4KZDL 1U8PB 5AW9B 3BT2H 4APQD 2DLHA 5C6TH 4MNQE 4BZ1H 1RIVL 1RK1B 1MVUA 3KLQA 3JWNG 1KJMB 5E9AA 1PYWA 5C1MB 3BXNA 5L2KE 4GSRA 5GS1C 3QRFM 3ORJA 1HJCA 1X9RA 5E4EC 3TBVA 5IWLA 3KH3A 5CZKA 4HJIA 2V37A 5C0BB 3KDPB 2CHWA 3K4AA 5I16B 3D2UB 2WUBL 3IWUA 5C09D 5CIPA 4PRPA 4OJYA 1JGLH 1BZ9B 4HUUA 3Q44A 2IQAA 1CR9H 3FQTB 4W6XB 1R34A 2NNAB 2X88A 1BZ7A 3IGFA 4U1KA 3U6XA 3LPOA 4X6CF 5HGDB 1AC0A 3QJSB 1DBJL 1CN4A 2C1PA 5CSGA 4ODSL 1ZT7B 2QR0B 3MLTA 1F56A 3HC0A 3UACA 4RGMB 4XH2A 2B3IA 3Q3GB 4WW2B 2NX5D 1JZ2A 2DICA 3V0EA 2EH7H 5BVJA 3WAKA 5KYWB 5FYJH 5MI0C 2OJZH 3O3EA 1Z9NA 2WCSA 5GZNC 3FPYA 1UEMA 3U2IA 2LTQB 2XXMB 3X14B 3GMRA 3B7YA 1G9HA 1HWHB 1NCCH 4GBXB 5FECA 1F45A 3H2PA 4G8GD 2J8UA 3VA2C 4R7LA 1I1FB 5MP6L 1YEGL 5I1AA 1G87A 1NGXA 5DT1H 4PQXA 2ZONA 3I6KB 2IOMA 4ZSOB 2B9BA 5JIKA 3EZJB 3UTQA 1K2DB 1YZZA 1NIDA 2PO6B 1CDJA 1HSAA 1RFDH 1RZJH 3C8KB 4D7PA 3QAZB 2QFPA 2YUZA 5I19L 3ML9A 1BLNA 1CDIA 1SGKA 4FFVC 3OXRB 1KG0B 2QVKA 2RA1A 2VGLM 4RGNB 5FCSH 1P2CA 2VQTA 4AEIL 5G5DA 5AZUA 3MRJA 2C3WA 2R2EB 3IETA 2VDQL 1E4KA 2Z1PA 4KDTA 1DQDL 4LVOB 2VLKA 2WQUA 3BVNA 4H0HB 4GRMB 2MOGA 2PWGA 1EHNA 2EDKA 2FATL 4XP6H 1J1XH 3QXAA 2WWKT 4M7JH 2BVEA 2JXMB 5KBKA 5JHAA 1KWKA 1F00I 1MF2H 1QUPA 1SDDA 1G7IB 3BWSA 1S7XA 5CF3A 3RDJA 1IEHA 1XCXA 4G71B 1IZKA 1JMZA 1VJSA 3ZDXF 2TSAA 2VITB 1QSVA 4MXVE 5I17B 1KEML 3RB7A 2CLZA 4FOMA 4NQDE 2GJ6A 3TJHC 3LKOA 5DS1A 3WIAA 3RFZC 3O0RL 4QRSA 2VR6A 1HYSC 2Z6FA 4BZ1L 4HPHA 1PZ2A 3DXAD 4WEUD 1H6UA 4XNXH 1MY7A 1NBCA 2HFGL 2Z4QB 3C6SA 2VDOH 5HHOE 1S46A 1YNLL 2AEOA 5I8EA 3K71B 1MREH 2ZCKL 3KYOA 3CFIC 2AXHA 5JQ6H 4H2AA 5I6NA 4RMTA 3RE0A 1HDMB 1N3NB 2UWEF 3KPNA 4PGEB 4X99B 4XPHH 5DJCB 1E4JA 1NGZB 5CHNB 4FFZH 2WW8A 4X7DC 5CMAA 3O6FC 4RFNC 5LG1A 4BXSV 4MTMA 5JA8B 3L81A 1H3WM 4PJBF 2E46A 1G7PA 3FTUA 3FT9A 4OZHA 1DEEB 3AS2A 3L9YA 3ECBA 3VWJB 4NGHL 5ENWB 3BSZA 4Z3TA 2Y06L 3HI6H 3O3UN 5DDHA 3ZMNA 2ZG1A 4QRPB 4JUSA 5LQBL 5EO9A 4KK9C 4IJ3C 1KPRA 4U2YA 4YDVB 2JIXA 2EILB 4Q0XL 2ZX5A 5CD5D 3GSVB 3QDHA 3UBXI 2WZ6A 1ZLSH 4YGVB 4WENB 5FYJL 4ETQA 4L4JA 4QRQB 3CK0H 4HT1H 5DEZA 2XQYA 1CI3M 1AR1B 3DO7A 3COOA 3O4OB 1Z9OA 4N5EC 1P4UA 3W37A 3QUZD 4BE5A 4IRSA 1NCCL 3DX8A 3T0EE 4H4NA 2BS8A 1FNLA 1N4XL 1S7WB 3TBSA 5ID0B 2N7BA 4NXSA 4KKAD 3HB3B 1CQKA 2O6FA 2OW6A 4N20A 1F58L 5C0JA 1P5VA 3MNVB 5DT1L 2Z93A 3F2LA 1DBBL 1MCRA 3PQYD 2H32H 1OTTD 1ADWA 2WXPA 2IANA 2WXLA 2QGBA 3O8XB 4XX5A 2YRPA 4GW4A 3TIDB 1RFDL 1RZJL 4NB7A 5B1CA 4MJIA 5GISL 3EZ8A 4KTDL 3P3UA 4DQOL 3EO9L 3ZT5A 3HZYA 5KYUB 5HVFB 3TYFB 2W07A 4RCAA 4WV1C 1YC7A 5KAQF 2L04A 4MNHA 1HH9B 2Z34A 3TCLB 3Q1SL 3QORA 1DQLL 3LB6D 4K3JH 2XTJB 3THML 4BKSC 4PJBE 2ID5A 2B2XH 4JN2A 4Z7QF 1KCVL 4X4KA 4XO8A 1A7NH 3P2DA 3GTVA 4RSVA 5CGTA 2FWLB 1T21B 5IOKA 2JELH 4HLZG 4FNLH 5BOZG 4NLHA 5J9PB 5MHSD 3O9WD 5HVWA 4G7SB 3L4XA 1TJMA 4IMKC 4YVNA 2YK1L 3D12B 2VDMH 1QA9A 2WANA 1WBZB 1NBVL 5D2NA 4Y4HD 2F54E 5BRPA 3CE1A 4QI3A 5BO1L 4J3OH 3V4VB 4HHAA 1MOEA 3SJVE 3TL5A 5IKCB 3P02A 4Q9BA 2DMKA 1B4TA 3EH2A 4Y2DC 4ZMXA 1HINH 4Q6IB 5FDWA 4N2BA 4ZUVB 4LCUB 1BAGA 2XZAL 3E8UL 3TBTB 1Z5LA 2ZUQB 4XXDB 1A14L 3GMQB 2R1WA 3HG1B 1Z6JT 1BAWA 1QACA 5HI3D 2BNUA 1M71A 1M2VB 1CD1B 1E8YA 1TIUA 3QI9C 2BIMA 3B9AA 1MCSA 4LAJH 1I53A 1CXEA 3ATDA 4J1UA 3KPPA 3JV4A 1CZ8L 1MJ7H 4KITB 3TGXA 1NC2D 4OFKA 5ANHA 1KB5L 2H9GA 2BIHA 1Q1PA 1AKJA 1PZSA 1G1KA 2D3JA 3QRGL 2CRMA 4WWNA 4RAUB 5I1CH 4XMPL 4P99A 3EYQD 2WYHA 3EGSB 4P2YA 2NT1A 1K5NA 4QOKD 4Z7WB 5KBDA 2A4EA 3FRUB 4HIHB 4ZX4A 3TLRA 2ENJA 3AS0A 3T04D 1EVTC 1I1AD 1KB9J 5H2BB 2H6PA 2WSPA 5D9SA 2VZUA 4PRHD 5TE7H 4Z7QE 1UXWB 1MJJA 2NPLX 4MASA 5F7HA 3KCPA 1B6DA 5IIEB 2FT7A 1OOWA 1S9VA 4BQ9A 3P73B 1JVOA 3KBFA 4NQTA 3OL2A 4G9FE 1I31A 4H1LH 2G60H 3GI9H 4E2OA 4QXTA 5ABDE 4K23L 2XC8A 5JIMA 1FCGA 4PJEE 3FSAA 3NIGB 3NFPB 2A6KA 1H3VA 3FT4A 5EU5B 1N8OE 5BQDA 5KZCD 1CFTA 1NAKH 4MDIB 1ZA6A 4LARH 3PIQA 4TNVK 1QR1B 1OSZA 5JIHA 2JNZA 4ZMYA 4PJHE 5ESVB 5DD0H 3B3BA 3H3PL 1UCBH 2A9AA 2NY6C 4GAJL 2MCG1 2QKIA 5DD5L 3EF4A 3P40A 1KB3A 3UTTA 1A6ZA 3BQUC 5AB0A 3L3KA 3SYCA 2AKRB 4L9DA 4NN7B 2ZF9A 1UWEL 2BRRH 3Q5YA 1A4CA 1EHKB 2HFFA 4XHQA 2XZCL 4AC2A 4N8VG 4WK0B 1MCWM 3VD0A 4H8VA 1H19A 1FZMA 4LPXA 2NYKA 3PWVB 1I8UA 5KN5B 2YGPA 1NEPA 5FYKH 3ZRFC 5KG9B 1AZRA 2ICES 1PPIA 3KJ4B 4ZAKA 4PPTA 2CMRH 4JZJC 1CE1L 3NDZE 3RUGF 1LQSR 3VTMA 3ALXA 1OL0A 1TTCA 5FWQA 1GW6A 3VRIB 2VL5B 1D5ZB 3QEGH 4WI6A 5CD3B 4QLRA 5EC1A 5E94B 3ZL4L 5D4IA 1HCZA 1I1RA 3MU3A 3GJEB 1CFQA 4UMSA 1UEYA 2Y36H 3MJGX 3W5MA 2DH2A 1NCWL 2HLFC 4KKZA 1OP5H 1R0AH 2YAQA 3L6FA 4V33A 1IM9A 5FKAA 2BSDA 4FGMA 2ADYA 5JHLH 3T5WA 4K7PY 3GK8H 1PU0A 4KHTL 2GBVA 3SD5A 1RHHA 3OKOB 1SBSH 4ORZC 3WG7B 3VD7A 3Q48A 1JL8A 4GP8B 3DOHA 5DJ2B 4KROC 2Z92A 3MROB 2Y1YA 3ZKNC 4HJGA 5TJWK 3MC0A 4YBLB 4ZS7L 5AW1B 1J9CT 4G5AA 3VXUA 3VXTA 3IJEB 4PGDA 5IWLC 2YSSA 4HGWB 4M48H 1R3JA 1S7RA 4GKZA 4I48B 4KXBA 3UIZA 2X53A 3QQ9C 3U4EA 2EE9A 3VRLE 1J86A 4Z76B 1GMEA 1O9ZA 1TTFA 1YEHH 5LGYA 4XXWA 2XN9E 5PCYA 3GIZH 3SHSA 4UMGA 4DFIA 1M1SA 5HDOA 4Y4KA 3ZTJG 1KSRA 2FLBT 1PIGA 3BFQG 3L5WB 1UT2A 2DRUA 3QDGD 5I8KH 1XB3A 5GQBA 1YMMA 4CVXA 4BZ2A 2F08A 2YHGA 4P4RB 1YECL 4HISA 1PY4A 2DL2A 3WKMH 4CRPA 2RB8A 3LIZL 4XNMB 1OT1A 5MEPB 3RDTD 1KJ3H 3IXTA 3O3AA 3F62A 4QRTA 5KSBE 1GZPB 2VZ3A 4TNWF 3D4ZA 4X9GA 1GS8A 1N19A 2IC2A 2DZEA 3CLFH 4KJPC 1OLZA 3FRPA 2BSSB 2CJTA 3BH8B 5AOMA 3S5YA 2IOOA 4JREB 1HI6A 4G6MH 1C7TA 3N1MC 2YD8A 1AQDA 2X4PB 2GK2A 3MLYL 2EDJA 1NUGA 3FQXB 3CDFA 3V0VB 3CZEA 1T3FA 3IFNH 4K8RC 4NNXB 1LEGA 2DM7A 4ONGH 5FM5M 1U3ZA 1WWWX 3LZFH 2MNWA 4UZSA 2BRRL 4FXKA 5E9DB 5J13B 4P57A 3RIKA 5FAAA 3ARFD 5SV4A 2WQWA 1R24A 3LNGA 2F5AL 5GRYA 3DSFH 3VFPA 4GAYB 2W0LA 1NCDH 1BD2D 3W0WA 2UUDH 3H9SA 4L8CA 6PCYA 4EZJA 4PJ5D 1T2JA 3EG9B 1XSIA 2J57A 1R75A 1T66C 1IIKA 2C3HA 1M7IB 1N7MH 3DIFB 4KDTC 4BZYA 5LNEA 3QEGL 3BPLB 5K9KA 3OF6A 4MNGE 4R2GD 3TFKC 3N40P 4A7UA 3UH8A 1NCAH 4YNYA 5CFAA 1OAXL 4JG1L 4TQIA 1KTLA 5ICXA 2R4RH 4X2UA 3MV9D 4OJEH 3UBXG 1NFAA 2RTTA 4OCNC 1TVBA 3VFNA 4K7PH 1UYWH 5GRVL 5GS1B 3GK8L 1I3RB 3DX7B 5EZJA 1ZSHA 5E4EB 1JZIA 1FCCA 3B3IB 5CJQL 1COBA 4D8PA 2MOQA 2JE8A 1ZOXA 1X4ZA 1MIML 3H0TA 3QIBA 5EOCL 4WI0B 1ZVSB 2IWEA 5IB2B 4GFXA 1FYTD 3N41B 2DQIH 3WS6A 1H9VA 2E0PA 1M1XB 4YOKA 2Z0BA 2ZYHA 4J4PA 5IW3A 5ADOH 1JGDA 3AWGA 3U7YH 1MRDH 3OJVC 1HZKA 3SKMA 2XWJA 1ZGLB 3D50A 2OMNA 3GXMA 4IGBA 1ZHLA 2K4AA 2NLJB 4JG0H 3NJGA 4QRRE 3LN5B 3UXFA 1J8HD 4I1RA 1AZCA 3BQVA 3MV8D 4JGUA 1G7HB 4AY0A 3BJLA 2CHDA 2QQLH 4W9CC 3CVHB 5K9JH 5CP7A 1RUQL 4K3HA 1I3GH 3K5RA 3OTTA 1XSKA 5F9OH 4IMLA 3VD4A 4KRPD 4DUXA 1UM5H 4UQ9A 5IBTH 1A0QL 3BN3B 2QPFA 4AYDC 5JIPA 1IQWH 1P4BL 3JT2A 1QFHA 5CEZL 5BRZA 1ZPUA 5KBLA 2ATAA 5KJ7E 4KGLA 3I9GH 3TESA 2FR4B 4XAKD 4YDIL 3MRCA 1INEL 2NXYC 3SGKC 3BP4A 3QPQD 3WNOA 4FZ8H 3CC5B 1MW2A 3IFOB 2K70A 2UX7A 4M6AA 2IDUA 2VN5A 5LBSA 2VR7A 3DSNB 3HAEG 3KHQA 3SBQA 4IRSC 3ZHFA 4BQBA 1JWSA 4AQ8A 4IIQA 4K7FB 4UNIA 4RWYL 3OMNB 4JDZA 2BW4A 2GBUA 5AW0B 1Z9PA 4KI5C 3K4DA 3OPZH 4F7PA 2F8XC 4AT6A 2R0KL 2WCGA 3IFNL 4YDNA 5KVGE 2HKHH 3KPRE 1VDGA 3BW9B 1KELL 3O2VH 1CLCA 3V6OC 1T6VN 4DGVL 1X5HA 4AXWB 1DVFB 4GUOA 1RERA 3O41B 4GFTB 4U1LA 4U0QB 1BHGA 2PYFB 3DGDA 4JRYB 4JO4L 3DSFL 5MEOA 1YJDH 2EIMB 2GYSA 1BVKB 3VE0B 1AGCA 3RQ3A 1QX1A 4N0CD 1CGWA 1YEFH 3KW7A 4I1PA 3BVUA 1E2ZA 1W6LA 4OJFH 5HYJA