2DM3A

Solution structure of the second ig domain of human palladin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
GSSGSSGFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords KIAA0992 protein
publication title Solution structure of the second ig domain of human palladin
rcsb
source organism Homo sapiens
total genus 12
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dm3A00
4F7EB 5KVDH 3NCFB 4FXLA 3ZL4H 5BV7L 2X70A 5KSUB 3RA7L 4IOFD 4O4YH 1A6AB 1FNSL 3QUXA 1K85A 1RPQA 4XNYH 4OD3L 1UJ3B 1EHNA 5J6GA 2RAMA 5DA4A 1N4XH 2NW3B 1XGPB 2B1HL 3LKSA 4F7PB 2X1QA 4WEMB 2BVOA 2BSSA 5BVPH 2P24A 3DV4B 1PSKH 3SDXA 5K59E 5KW9H 2R0ZH 4D9QE 3FQUB 1DBJH 4KJQC 1A3LH 2XPGA 3RIAK 4HFWB 2VDQH 1YEEL 3JTTA 3LQZA 4Y16C 1HDMB 2LE9A 1CBVH 3O4LB 3C60A 3G5YB 3UJJL 3MJ7A 4LCCA 3HC3L 5FYKU 1D6VH 3GSWB 3RKPA 3BMVA 3QH3B 4PIRF 3H42L 4OIIH 3WSQL 5I1LB 4ELMF 2J8UE 3TESA 3SDYH 1IAIM 3GBLA 1Z5LB 5FYJU 4XPHH 5DI8A 4GG6A 1RD6A 5D6DC 4XNZC 3U0WH 2IFFH 5DO2C 2C1PB 4G6KH 5IMOA 1YJDL 1JNLL 3HUJA 1WISA 1QSZA 4N5ED 4K7PL 5GGTL 1MWAL 5J12B 1IC4L 1UH2A 3TT3H 3QFJD 2MHAA 2UVFA 3QCTH 3S37L 5DT1H 3TO4D 1J0KA 4MYWB 1A1MA 3QEQE 1I7TB 5D2LB 1NBVL 2ZUVA 1KSRA 3IFOA 2W65A 1OARL 4ONHA 4HT1L 1SYSA 1VEMA 4X5XA 1FFNB 5DUMH 4U4BA 3GMQB 3H8NA 4ZG1A 2R29H 1D9KD 1KPUB 5K9QG 1H0DB 3GNMH 3KPQA 4KKNA 4XP4H 1AO7E 1EUTA 1BIIB 4S1SL 3PWPE 4N1HB 5SWQA 3AMLA 4WFFE 5LAXA 2HTLC 4LVNC 4PJIB 5F88B 1SJEA 4QHLA 2ATPA 4NKIH 5T5NF 3SDDD 2CSPA 3PWUA 1CE1H 3LKOB 4I48B 1JNHA 2OR8A 1TENA 4P9HH 2XACC 1IM9A 3HAEB 1BFSA 4P4RB 4DKFH 2GUOB 4H1LH 4WUUB 3SDXE 2NZ9D 2CK2A 3KVQA 5IW1A 3IDXH 1ZSDB 1CFNB 4WUKH 4RISL 1NMBH 2UYLB 4UOW1 2H8PA 3MJ9L 3UPRB 4O2EB 1RUPH 4JCMA 2EH8L 2J6EH 4G3YH 5KAQG 4NC1E 5JORA 5MEOA 2ESVA 4U1IA 4L1HA 1LO0H 5EC1B 4PRHA 2CDEB 3OJDA 1OQXA 4FQHB 5CCKH 3THMH 2APFA 2BDNH 2DQHH 1A6ZB 1NEZA 1QOKA 5DJ6B 4Z78A 1GGBH 3UPCA 5D7JB 1DL7H 2JIXA 1RZJH 5DS8A 5C0EB 5TH2A 4Y4KD 1EAPA 1P7QB 1XIWD 3MUZ1 1M05A 4W4OC 2AJZA 5IBTH 2LAGB 1OM3L 1XF4B 4MQXC 3X12B 1LK2B 1K4CA 1ROWA 1INDH 2H9GA 3QUML 3CDGA 1A3QA 4N90D 5GZOC 2E7HA 4KV5E 3AC0A 5CJXC 1RHHA 3CSPA 3PP4H 1T6VN 5JO5B 2OZ4H 3S4SB 4L4VB 1DQDH 3EIFA 1N8ZB 4H88L 5FK9A 3OHXA 2FL5A 5MEQA 4K7FB 2GJJA 4JQXC 3VXUD 1LO3H 4R26L 4PRIB 4Z0BL 5TGBB 1EHLH 5C1MB 3S36L 2DLHA 3ZLQC 4N0CC 2LAAA 1DQQA 1TTUA 4E9LA 5E94B 3HZYA 2O26U 5TF1H 3REVB 4NO5A 1HH9B 5F7YC 4MA7L 5KSAB 3DI2B 5EU3A 2BNRE 4FFZH 4Y88A 2YS4A 3DTXA 5IK3B 1Z2KA 2XG4A 5IROC 4I3GA 2BXYA 2WBJC 4I5BB 1KLFA 4Y5VC 1K2DB 3CNKA 1INEL 2DBLH 4G9DB 3AREC 4IMLB 3NTCH 1WWCA 3UO1H 4PJDB 4CGTA 4LCYB 1HKLH 2D31A 1MVFA 4OT1H 1I8LA 4RAUA 5I1EL 3QHZL 1GJIA 3GMNA 1XF5A 4XAWH 1CXFA 1OB1A 4G42A 2A74B 1B9ZA 5IOPA 4F15B 4KXZI 1FYTB 4GLRI 4L8BA 4WWKD 4PRHE 5J9PA 2WSKA 4XP1H 1GIGH 4BZ1H 4ENED 5IEHA 1J0HA 4G80B 5I9QB 3SJVA 4CVZA 1U2CA 4U49A 5KANI 3U7YH 4X4YB 4R6UA 4IHOA 2VDOL 3NH7H 4RSVA 2XA8H 4J1UA 5E8PB 3KYOA 4QRRE 4FRWA 3RUGB 1R0AL 5HHOE 1GGCL 1RI8A 3NFSH 1IL1A 4PJAE 3GSNH 2HLAB 3AY4A 1U2HA 3IDYC 5MP6H 1CU4L 3DRQA 4JDTL 5IHUH 3VDCA 4J23A 3DUUA 3W2DH 1W0WB 2MPAH 2JB6B 5C0GA 4Z0XB 3WFBH 1YEHH 4N0FB 1YA5A 1F00I 2HN7A 4FQ1L 3C6SA 4XXCA 4Z7UF 5D9SB 1OP5K 4NQCB 5F1OB 1UM5L 2WIMA 4PB9L 1UVQB 4XCFL 5C0FA 1KNOA 3G6JB 3WV0A 1L6ZA 1AXSB 5A43C 2OXHA 3PHQB 1J8HB 4XPAL 2F53D 1LDPL 3IKKA 3FN0H 1E6JL 2ZSWB 2QADD 1JGDB 1JI1A 1IGYA 4IRSD 5DFTA 3REWB 1BVLA 5BV7H 1DQTA 4XPGL 3QG7L 5MEND 2HVKA 1ZHLA 2YA1A 5LGHL 4AENA 1MRCL 2VO5A 4HIXL 4YDLB 2WM0A 4RZCB 1FL5A 4MB3A 3BP6B 5HGBA 5KG9B 2B1HH 3RGVC 4ZYKA 3HZMA 4KH2A 3HAEH 4MNGA 1YEKL 4XVSH 2P4AB 3IJSA 5IW6A 2HT4D 3LEYH 1YN7B 5K9OA 3E2HC 3QUZC 1P69B 5IVXE 4Y19B 1QRNB 6CGTA 3VD4A 2ZOKA 1YEEH 1AKJA 1QFUL 5AD0B 4ZAKA 1E4XI 3D85B 1BGXH 3VGAB 3ULUH 1M71A 1NPUA 3N0PB 1WFNA 1O0VA 3BVNA 3UJJH 1F3JB 2DQTL 4LFHG 3T8XA 1G9EA 5BQ7A 3VXOB 4HUUA 3RZCB 3TO4A 3SJVE 4OQTA 3V5DB 1DDHB 1G84A 1M7DA 1N3NB 3H42H 4PP1C 2YXFA 1MCHA 3ZKMD 3B6SA 1WWBX 1QEWA 5MHSD 3K4AA 2X6MA 2GHWB 3VJ6A 2DD8L 1KG0A 4XP9L 3VRJB 5EZJA 4PJGE 3FRUA 2VQ1A 3NCYS 5IMKA 1FVDB 4K7PH 5LXGL 5DJ8A 3IB4A 5GGTH 3HC4L 4IS6B 4LKCA 1IC4H 3VFMA 3V4VL 3OKNA 1U8IB 3VCLB 3MLVL 3NAAL 2AXFA 5EUOA 3MNZB 3V7AG 3V5HB 3S37H 1OF2A 4DEPC 2NR6C 2Q86A 1RUAH 1IAOB 4YLQT 5IVNA 1TITA 1OARH 3MV9E 3QWRD 3VDBA 2OL3L 1SVCP 4FS0A 4D3CL 4OCSH 5BS0D 5LWYH 3LN4A 5I8KH 4PJ9C 1JV5B 4KVCL 5IVOA 1UWXH 4KI1A 4P23C 1JMXA 2EEDA 1JZ4A 3QCVL 1WAAA 1J1PL 5GHWL 3MBXL 3KPTA 4G43B 1A6WL 4YXLL 5LGJB 1LNUB 4LOUC 3VGGA 3JWDH 1JJUA 4XBPB 4I18A 2PYED 4FG6D 2R56L 1QTYT 4HBQA 3C9NB 3L6FB 5MEPA 3QI9C 5T1MA 2CO7B 2FH8A 5HHNA 3RI5F 2F5AL 4HAFA 4ZQKB 3E3QC 1Q94B 1EHXA 1XIWA 1OT1A 2H6PB 2R1XB 4DGVH 1A6TB 3TN0D 4RISH 3K74B 1KB9J 1RSFA 2PW1A 2X4QB 1QR1B 4XNUL 2EH8H 1NL0L 2R9HD 1KJ3H 4HIHA 3TF7C 1IGTA 4G8FB 3VXNB 3ZSTA 2HJFB 4M48H 1OT2A 2DM3A 1VB9A 4OZ4B 4R9HA 4OV5B 5HHPA 2Q8AH 2OMNA 1J1OH 4OB5L 4I0CC 1G7IB 3U4EB 4AG4L 4EKXA 5FIEA 1VCAA 3WL9A 3WO4C 3NACH 5F7DB 3TEUA 1NSNH 3BN9D 4PRAA 4JDVA 2BY0A 3NGBC 4MDIA 1OM3H 4F2MB 4J2XA 4ONOA 2Z93B 1EFXD 4F7CB 4RNRA 1TDQA 3MA7B 2ZNWA 5GIRA 1WT5A 3P30H 1T1YB 4X0KA 1FZMA 4UV7L 2BY2A 3GM0A 1OAUL 1T1ZB 1OGAA 1Q9LB 3T1FB 1M7XA 1HHHA 3L1OL 3MACL 5SWZB 4BSWB 2DLIA 5HJ3A 2BSRB 4H88H 4KHXH 3FHAA 2FHCA 4HWEL 3MUGA 4RAVB 1NGQL 3AAZA 3LSOB 3GMPA 3C5SB 1ZA3B 3MCG1 4OZHB 3V4PL 2R69L 2OK0L 5E00A 3S36H 4WEBL 1IBGL 2W0FB 1YPZF 4IRJB 4C58B 43CAB 43C9A 4K2UH 4HQQH 3MLXH 1R3KB 4TPRL 5C0DA 2NY6D 4WJ5A 3I85A 4MS8D 4MA7H 3DMMC 5EUKA 3WHE0 3TZVC 1PVHA 4WNQB 2DWEB 2ITCB 4WWKA 3Q6FA 5TE6H 5LG1A 3QNZB 4Z5RB 3D39B 5GZND 2CXGA 3T2PA 2VAAB 5J13C 1EDQA 1HSAA 4C54A 1V7MH 4Q9RH 1CDHA 4UDUB 5ADPL 3JWOH 1KELL 1VACA 1INEH 4RWYL 5F1NA 5J1TC 1A7QL 5IEKB 1SJHB 3OB0K 2IH1A 4ZFFB 2KDGA 1Q1JL 3TM6A 4WO4D 4Q6IC 2LTQC 5I1EH 2R23A 4K94L 3SKNB 5FXCH 3T0AA 3ECBB 2AJVL 1EEUA 2YPVL 4E5XA 5HYSB 3DRTB 4PJ5B 4MA1C 3ZDYF 4G7YH 5ESAA 3WS6A 3L9RB 1C8PA 3BKML 1BD2D 2VDOH 5KTEL 1FYHB 1IAKA 2EIZB 3KS0J 1ERNA 3ETBF 4ZUVA 5DURD 4XP6H 1KLGA 5EPMB 1OWWA 2IWGA 4JG1L 3SE3C 4PJXB 3DETC 4DN4L 2FZ3A 5GS0D 5T3XD 4PJ8B 4XBEL 1MCFA 1II4E 3VRLE 1CU4H 2EE3A 4JDTH 1YYLL 1L7IH 1TVHA 3VXMD 1OGAE 4WHCA 4KUZL 4ELMA 5MENA 2NCMA 3FRPG 1T5WA 1FV1B 2OQJB 4YHKL 5IB1B 4RX4A 5KSBB 1XR8A 4PGBA 4FQ1H 3MYJB 1TVDA 4R4FL 4YWGL 4PB0L 4JVUA 2QSVA 3SBWA 4PB9H 4XCFH 4TTDC 1TZIB 3KPOA 1SMAA 4Y4FC 4M6NL 4L9LC 5HVHC 1E6JH 1QSEA 3H9SD 5EBLA 4DZ8A 3GMLA 3QQ3A 1I9EA 1IT9L 1I7UA 4JFED 2QL1A 1GOHA 5CINL 4KKAD 4PLNC 2FO4B 3DX9A 4KKLD 4R0LB 2YEZB 2Q7NA 5FHAL 5DYOB 2R2CA 3FCTA 3HNTH 3PDOA 3QG7H 3F6IA 5IHBA 2GSIB 3X11B 1KIQA 3OR7B 1EEQA 3OJ2C 3FZUD 3MNWB 5JOPD 1F90L 2BOCB 4H8WL 3KPNB 1I7RB 3FQNB 2H45A 3B2VL 1HOCB 5BXFB 2HT2C 2A6IA 4OIAA 3LQMA 5GSRA 3PWJB 3F12B 1ED3B 2H32H 2FEEI 4TULH 4OLVH 5H35B 2AK4D 2DICA 2EDEA 2FECI 4R97B 5IQ9A 1KPRB 2UWEB 3IXTB 1EK3A 3A0OA 4ODVH 5HGHA 2E7BA 3EYUL 1OP3K 2ADJA 2JLLA 5CJQH 2OR9H 3LKNA 3MROB 1JPFA 4O5LL 1NFKA 3WXWL 1KEML 2CUMA 3V0VB 4IRZH 1H8SA 3I50L 1QO3A 1OTSD 1YMMB 4H26B 4HKZB 3O2DL 1CLYL 2KKQA 1QQDB 4EN3B 5BS0A 3PDDA 3KJ4C 3S5LA 4QXGL 1YQVL 2XKNB 3WYRA 2DD8H 1T2QL 1RZIB 5AYQA 4XP9H 3BH8A 3E6HA 5D5MB 4F8QA 4UUJA 3RPIB 3B9VA 5DJAB 3EHBD 4ELME 2EC8A 4NFCA 4YIQB 1S7TB 3MO1B 4NKOA 4HUXB 2P47B 4TSAL 3CFDA 4AEEA 1MFEL 2PYEA 4N0UE 2YD3A 4L3AA 3RKDC 2WQ8A 4MLSA 2OL3H 4D3CH 2CRZA 4APQD 3TH2T 2HJKA 5L8LB 4JO3L 4KK8C 5M95B 1XH3B 4KVCH 2VABA 4QXTA 5HPMA 2VISA 2X7LB 1QSEE 1ZHNA 4XC3L 5HDLA 5GHWH 3MBXH 4FQQB 1E4KC 4S2SB 4EOWL 3O11B 4OZFB 2RFXB 3CGTA 1I4FA 1PZ5A 1OGTB 5DEFA 5IUSA 4RIRB 4YXLH 2NTFB 2PF6A 2YRZA 1N0XL 4OF6A 3RBSA 1NCTA 4RGMB 2M26A 1VGEL 5B39A 1RIVH 1S7RB 4LKXB 1HNGA 4G6ML 3H9HB 4XGZA 2NY7L 1J11A 4NSKA 1A4KA 1LEGA 1VGKA 1PKOA 2GT9B 5FYLE 3GSQA 5HI4D 1DBAL 5JHDE 4NC2B 1ZLWH 3P4LA 3QUXC 2F5AH 2UZIL 1IGFL 3O8XB 4QGYA 4PGJA 4HKBB 4Y2OA 1LE9A 3HCVA 4ZS6C 1UKQA 1QLFB 2XZCL 4Z18A 4YJZL 4LU5L 3ARBC 5I73C 3VFPA 4XNUH 3ARVA 2VDNL 1NL0H 5IMLA 3L5XL 1JZ3A 5E5MA 4PJEA 4Z77A 1K4DA 4U1KB 3WDHA 4PTTA 4J8RA 4NC0B 4F58H 1NAMA 2L4OA 3VXRB 3EYQC 4ODTH 3HNVH 1CQKA 1YDPA 4HIJA 4PRNA 4LCCC 3IJYB 4R2GC 1A9BA 4FQPA 2BRRH 4GS7C 1NUFA 2BX5A 5IT2L 3SDCD 4L5FL 3L3KA 5DA0B 4KGJA 2BP3A 3LKQB 5C70A 5I17B 3LRHA 3FTGA 2CKBA 4JVPA 5JDSA 1AR1D 2X4UA 3WUWB 4UV7H 2RB8A 4M6AA 2IBBA 4KJWC 4FQXB 3NIGF 5F89A 4NT6B 5KZCD 3MLTB 4M93B 3BW9A 3SGJA 5DJXA 4ZMAT 1NGQH 2QTEA 1FPTL 3O6LL 4HKXB 5CEYB 3UTSD 5T1LB 3HB3D 2X4TA 3PWLB 1K8DB 2R69H 2NYYC 2OK0H 2VSCA 4BQ6A 5FV1L 3W5NA 3LDBB 4WEBH 4JFFD 2VXVH 5C0CE 1T2XA 3QR2A 3DVGA 2P5EE 3PHOA 1WBZA 3O0RH 2YK1L 2BVTA 1FL3A 1YEIL 3CUPA 5TDPB 4NQSA 1A64A 1GPOH 4Z7UA 4M8QB 1MFAL 3U6RA 1NFDB 1RZ8B 1DVFD 5B8CB 4I0PD 5JMOC 4FTVA 1H5BB 3GKWL 3WKNA 1N6QL 2VE6A 3VFWB 3D25B 3T0EB 5ADPH 4XVUD 1DUYA 1BD2A 4RWYH 1T4KA 1EHAA 4Z7NF 2M1KA 5C09E 4CN4A 1ES0B 3HNSL 5IV2B 5FGCE 5TFSL 4XAKD 3D9AL 2WZPD 1T20B 3GBNL 1HEZB 4M3KB 3EYSL 3I3BA 4K07A 2WNGA 2AJVH 2J5LB 3CXHJ 4AEIL 1EXUB 1G7HA 1MOEA 1FG2B 1FO0B 5C0AB 3C5ZC 2G5RA 3QRGL 5T3ZD 1BWMA 2Z8VC 4P3CL 1G7QA 5D2NB 1Y0LA 1Q0YH 3BKMH 2PETA 3BRGC 2BNQD 5KTEH 1MCEA 3KYNB 4JFYA 1Z9MA 4QO1A 1EAJA 5HYEA 5IG7A 1UYWL 2ZUQB 3HS0A 4JG1H 4JZNA 4ODHL 2EXWC 4NZTL 4DN4H 1ZVYA 2R4SH 4JZJB 3H9SA 5L0QC 4NNXB 4XBEH 2G5BA 5DJCB 2A6DA 3QXWA 2CR3A 5LQBH 5HVWA 1JZ7A 3D3VA 1OAQL 2FB4L 4KUZH 3QEUB 4U1HA 1XEDA 3V2AR 2AEPL 5KSVA 4ISVA 1FZKB 5SX4I 1FNEB 2BHZA 5F1IB 2B5IB 3K7UA 4NNYB 2HLFC 4U0RB 4U1NA 4KWUA 15C8H 4AK1A 3IDNB 2ZCHL 2NY2D 4OCMC 3VA2C 3T4YA 1T0MA 5FKPB 1KJVB 4GRWB 2BY3A 1XGYL 1HQ4A 1EJ6A 4M6NH 1EX0A 3JXAA 4W68A 5EO9B 3B9EA 4UBDC 4Y5XB 4M5ZL 2Z9TA 4I8DA 3VFTB 5TF0A 1IT9H 3Q5TA 2AK4A 5CINH 3CD4A 2BVQB 4Z7UE 4X6CF 1WBYA 1P1ZB 5IR1A 4OZFH 2H2SC 2P5WB 3QDGE 5CKAA 4FTVE 5GJSL 1KCLA 1OSZA 3GGWA 1CI5A 4M7LT 3SQOL 3N50A 1T80A 4QTHA 3DLQR 1HHJB 1CFVH 5I1KL 1UWGH 4H8WH 5ACMA 5IFHL 5JA9A 3ES6A 2EDOA 3FO1B 2DJ4A 4NRYA 4RFOL 1WK0A 3QIBD 4N0RA 5TDOB 3P2TA 3B2VH 4LVHC 2R0LL 1X5HA 2BMKB 1TCMA 4RGNC 4JPIA 4P2YA 1H3PL 4YHNA 5FHBL 1NBZB 3E8UH 4HCRA 4OGAD 2OJEB 1UJTA 1I8LC 3BZFA 1JCKA 3L5WA 3NFNA 4WCYL 1JZ6A 3EYUH 3UJTH 1T5XA 1T3FA 1ZWIA 4CVXB 4O5LH 3WXWH 1KEMH 2Q7YB 4BUGA 4X7TB 1I9JL 4WV1B 4APQA 5C3LD 1X5GA 2PR4L 1FH5L 4JY6B 1G7PA 1T2QH 1JGVH 3BX7C 3FB7B 5GS1B 2ICEA 1YY8A 3RL2B 1NCNA 3CPLA 3CH1A 2PTTB 3C8KA 4OLEA 4JB9L 1MFDL 2FYYA 5BZDA 3D3VE 3EOBB 1KIRB 3AY4C 1C5CL 4WHDA 4TSAH 4ZODA 5A2IH 2PCPB 2VZVA 3G08A 3NIFF 5CGYD 1EZVX 1UQSB 2XT1B 4KAQL 1MFEH 5EOTA 4PLJD 5FDWA 5C0ND 1T21A 5I8EA 4NNPH 5FB8A 1WZ1L 1IQDB 5TDNA 3OGCA 3MTRA 5GGVL 1F45A 4CMMA 4IOFC 4B53A 1JP5A 3BD4A 4JO3H 2XWTA 5E2WL 3OJVC 2AGJL 4XXCC 1YC7A 4NJ9L 1QLRB 2HFGL 2FLRT 1I7ZA 1Q8MA 1EEZA 3GO1L 3U9PL 3MBED 1X4YA 2AK4E 2WIIA 4EOWH 3OR6A 5C86A 1CXHA 2SEBA 2YHGA 3V6FA 1N0XH 2EDBA 2BY1A 5F3BB 1VGEH 2GEEA 1GZQB 4G6MH 5EZIH 5F1KC 1YPZA 4LEOA 1Q72L 3HPJB 5A2FA 4IEFB 2UZIH 4MAYB 2E6QA 3ILPB 3IETB 4PPTA 5IBLD 4U6HB 5ELIA 1CD1A 5INDB 5MERA 2GJ6B 2XZCH 4LLMA 4C83B 2XQBL 4GW5B 5E2VL 5J56B 1VA9A 2ADIB 5HHMD 3OPZL 3ROOA 4XWOC 3MRGB 1FSKB 1XGRA 2YBRB 3GJEB 2VDNH 3KPSE 4Q9QL 3GI9L 5DQJB 2MKLC 1HXYB 3ZKXB 4KK6D 2B8OT 5HDBF 4X6FB 1F42A 5F9AC 3IDIB 1AHWA 4N5EC 4ZAKC 1RK0B 3GIVA 1FO0H 2DI8A 1PAMA 4FFVC 3QZWA 4NUJA 4XXDA 5D93C 2E6JA 5J0BA 3BZ4B 3UTSA 4OZGB 2E3VA 3D1MC 3ME0A 3TO4C 5IT2H 5LVEA 4QRPE 1A5FL 4JFFA 4YO0B 3RNKA 4XRCA 4L5FH 1L9NA 2XKSA 3EOAA 1WEJH 2KH2B 3PL6B 2A1WL 4Z7OF 1D9KC 3IGAB 4N5UA 3L3OB 5DMYA 5D6CA 4ZFZB 3VWKA 3D69A 4I0PA 4HUNB 3L3DA 1BLNB 4Z95L 1GZPA 2QSTA 5CSZB 4POUB 4K3DH 3T3PF 4D8PB 3ALWA 1TQBB 5DRWA 3R1GH 8CGTA 3MRDA 1S9WB 3SDDC 1FPTH 5AAMA 3CFEA 4H5SB 2L0DA 3X14A 2A9NH 2BFVL 4PFEA 4RFNC 4YQXL 1IILE 2VAJA 4DTGL 4NJAL 1Q38A 4UV4H 3PJSB 1JWMB 1U8PB 4OUOA 3P3YA 3SPVB 3G5XA 5CJ8A 4RMVA 2NZ9C 1XCQB 1DEDA 4OCWH 1A3RL 5C71A 3RZWA 2W9DL 5HSFA 5F96H 2VLKA 4NKMB 4JN1L 4ZUWB 3GKWH 2DWDA 1N6QH 3HRZB 1NGZB 1YPZE 1RMFH 3FO2A 2JB5H 2BNQA 4OD2A 5DJYA 4I77L 2D3VA 3C5JB 3MRNA 4I18C 3HNSH 5TFSH 3HMXA 2NY1B 2FATL 3D9AH 1CCZA 1ORSB 4L8SB 1KIUA 2MCPH 3HPLA 4LEXL 3B5HA 3SGDH 3GBNH 3FO9B 1ZGLB 4KTEL 3CLFL 3V6ZA 1CGXA 3GKZA 3QUYB 3TGXA 4L3EA 3GJFK 3I3EA 1XIWC 3BAEL 2CDGA 2UUDH 5JW4R 2C26A 1AXIB 5FA3A 3QRGH 1GGTA 1KCVL 3ZKNC 5KVFH 4XZUA 4P3CH 1EFQA 3G6AB 3GEWB 5IGXH 3DO7B 2VJXA 2X1PA 3QA3A 1UXWB 1IC5L 5H94B 1WICA 2AJ3B 2DIBA 3BP7B 4PJIF 4P4KB 2DN7A 1UYWH 3MXVH 4ODHH 4NZTH 5FCUH 2LVEA 2B1AL 1GL4B 5DJ2A 4O58L 4EI5D 4Z7VB 1ZLSH 2H41A 1WFTA 1U8QA 4P5MA 1AGFA 3LZFL 1OAQH 2FB4H 3IAPA 3EO1A 5C0BD 1KV3A 2ZUXA 4P5TB 3RVUD 1X5XA 5CUSL 1WT5C 2EYRA 5SV3A 4CNIA 5IFJA 1CG9B 3WE6A 1JVKA 2ZCHH 4LP5A 3DBXA 3FMGL 4YHZH 4PRPB 1XGYH 2FO1A 2XIDA 2VZTA 3VMPA 4MJ5A 3IDGB 3H0TA 4RBPH 3GBML 4RQQB 1J87A 3HHRB 3IT8D 3HZVB 4JANA 3GUTB 3N85L 3OAYH 1LP9F 5I66A 1G6VK 2AABH 3O6FD 1G6RA 3SCMD 5ADOL 3JUZA 5IF0B 5BRZD 2VLKE 4QXWA 4LLUA 3SQOH 1X9QA 3CLEL 3WNPA 3O4OC 3RWEB 1IEAA 2BNQE 4WWKC 4XT1C 5I1KH 1U8JA 4HC1H 5IFHH 1CFTB 1PJ9A 4ENEC 5IVZA 1D3CA 2VWEE 5I1AB 4NQED 1KTLA 5B38A 2R0LH 3BP5A 3PGDB 5DD5H 4PG9A 4KROB 4V1DE 4ZFOA 3ZE1F 4ZOEA 1H3PH 4L3EE 3VMNA 3IFNL 3MC0A 3VFSB 1MI5E 2BVPB 1AD9B 4ONFL 1L6XA 1XF2A 1KJ2A 5T1KB 1MH5A 5HGAA 5F9OL 4WI5A 5C8JB 1FNAA 1I9IL 3FAWA 4Y1AD 4EDWL 5GGQH 1I9JH 1AGBB 1B2WL 3MRMB 4CW1A 3WHXB 5FF6B 1FH5H 4WI9A 5FO9A 4ZXBD 5HI3C 2ZJSL 5CSBA 4YHPB 3MBEA 2EIBA 1QG3A 1MFDH 2IAMA 3IJHB 4Y16B 4GBXD 3L3HB 3QQ4A 2J8OA 4FQCL 2DKSA 4BH7B 2JK5B 2QADC 3C2AL 1BJ8A 4PJDF 4YGVA 4PR5B 5BMFH 4IRSC 4X9GA 3PGCA 5ICZB 5CBAB 4PJCB 1IE5A 1WZ1H 2DS4A 5E2TH 2V17L 5E9DD 3KLAB 2GIYA 2QSCL 4XTRD 1AP2A 2CLZA 2QR0B 5E2WH 2Q6WA 4JRYE 4NJ9H 2VLJD 2CXKA 5DD3L 3SBWC 3GO1H 5FV2A 3HR5A 1ZTXL 4HJJL 4E41B 4HJGA 3IU3A 1D5XB 2HT4C 1S7QB 1KUMA 2GTZA 4Z7WA 5EA0L 3BPCA 2Q20A 1CXEA 3ZDXF 3CSYA 4UT6L 3RUGF 1VENA 5I1CL 4HH8A 4P2OB 2QHRH 3GI8H 1Q72H 4NFDA 3P0GB 1F6AA 4NO0D 2E9BA 5HDOA 3O3AA 3OKLA 5ECJE 4EIGB 5ISZD 5H2BA 1I3RA 2IANB 1NFIB 4HFUL 4QRSA 3PV6B 4ZUSB 4OV6F 5GRXG 1X7QA 1BFOA 2XQBH 4Y5YA 5E2VH 1IGJA 3ZKMC 1N5AB 2BNUB 3OPZH 3BGFC 4LVNB 5CBEA 1Q9WA 3GI9H 3TIDB 4JFDD 5FUCE 3R06B 4QEGA 3PNWB 3MRPB 2BERA 2W91A 1DLFH 4BQBA 4JRXB 2QV2A 3C8HA 3G6JF 1QBMH 1U91B 4HGWA 1KJMA 4I4WA 3WN5A 3BQUA 1MLBB 1N5YL 4U1SB 1OWRM 1S78C 5EU6A 1JN6B 4HBCL 1LMKA 2I60L 5JR1H 2O61A 3MGTB 2APVA 3D2UB 3IFLH 2WWKT 1U6AL 4L4TD 3ZMRA 4KKBD 5KOMC 3V0AC 1FVCA 1MJUH 3O3UN 4A2MA 3PHSA 1MRFH 2IPKA 4HIIA 4YXKH 2E6PA 2G75B 4D0CA 3NCJL 4HJ0D 1BJ1H 2GCYA 4GO6B 1GGIH 3CK0H 4FG6C 2BFVH 1BF8A 1R3LA 2NNAA 3NIGE 2FIRT 1BVZA 4DTGH 4PP2A 4HZLA 4NJAH 2AKRA 4FXKA 5T1DH 1HN1A 2FJHB 1LEIA 4OUUA 4X99B 1ND0A 2GSGA 3IU4L 5C2BL 5C08D 4GRMB 1OCWL 1LDSA 3D0VB 2IPTL 2W9DH 3PQYB 1EV2E 4L8CA 1A21A 4GAYA 4JN1H 5JXED 2NX5E 5F7WC 4XNMA 1SJVA 3FN9A 4LARL 1S7SB 3HFML 5JZ7D 4G9FE 4QLRA 1BQHB 4I77H 1TCRB 1U3YA 2KQMA 3QXAA 5FDYA 1XGUB 3TCXA 2FATH 3EGSB 3FT4B 4UU9A 4C55A 4LEXH 3S5LG 4LGSB 1FCGA 4EI5A 2EDHA 1PQZA 4W4NA 3BN9C 4FZ8L 3RWFA 1ZANL 4GXUN 4QRUB 4DVBA 1QFWL 3ARFB 4HZAA 5C0BA 2EE2A 1ZA6A 3SKMB 3VFVB 5EH1A 5I6XB 5FAAA 3MXWL 1KCVH 5D7KE 2WBJB 3QYCA 4HX1B 4G6JL 4AIZA 2PXYD 4Y5VB 4WHTA 1OPGL 5ITFA 2C4FT 1X3DA 1RU9L 2X4NA 3DNKA 4HS3B 5EU6E 1IC5H 2NLJB 3STLB 4LPVA 1P2CB 1MJJB 1ZHBA 2IH3B 3NABL 4JR9H 4O58H 3BKJH 2ICWI 5EU7E 3X13B 1YUHA 4R3SA 3WXVL 3O6FA 3GSVB 4GXUM 4LLDB 4PBWD 4U1MA 1LD9B 3LZFH 3SCMA 5C6PB 4A6YB 5FYLL 2NY6C 3OKKB 5BRZA 5EBWA 1A1NA 3QQ9D 4HGMA 1H3VA 1FDLL 4MS8C 3ALXA 1JWSA 5CUSH 3WKMH 3HRPA 3SY0A 5B39G 4N9GB 3BEVA 3TBVB 1C5DB 2VOTA 3DXAB 1NGWB 5L8JB 4ODUB 5GZNC 4N8VA 2F54B 5E4IA 1CGTA 3SGJC 3DX7B 3VXSB 5A16A 5DMJB 3AB0B 2NY5C 4H1LA 3IDYB 2MNUA 2XN9B 3RX7A 5ACLA 4XCCL 5C0JA 3QWQB 3UZEA 2JE8A 4AMKH 1QLEL 5HY9B 5I16B 4WO4C 3VE0A 2V2WB 3EFDL 4OKVB 4GAGH 2J6EA 4M61A 5IW3A 4X8JB 3CLEH 4DGIL 5D1QD 3QFDA 5C92A 5EU4A 5SX5H 2J88H 4TUJA 2YD2A 4UIMA 4PJ7F 3I75A 5ICXB 2V9QA 5ICYA 2ZCKL 3CCHA 3K81A 5E5UB 5GRJH 3HKFA 3A6BH 3IFNH 1RURL 1IM3A 4KUCF 3K4DA 4EUPH 3OX8B 5GS0C 5C0BE 3U36B 5FFLA 4YE4H 4OZHF 3LKPA 2B2XL 1IZKA 1MCQA 3FT3B 5F9OH 2OZ4A 3W0WE 1WTLA 1CLCA 2R4RH 3MV8E 4QOKD 1MCDA 5E9DA 2K3TA 4LHUD 4MJID 3MV01 4EI6B 4XMLL 3RWGB 2C7UA 2VLJA 4EXKA 5JNYA 5GGRY 3FJTA 4HKJA 3CMOL 3E2HB 2ZJSH 3QUZB 2DIAA 4NCC2 4YAQB 1F97A 3BPLC 1RJLB 3KPRD 4GKSB 3O6KL 5DRXB 5F93C 5TE4L 1EJOL 4FQCH 2L7JA 4LPUA 3TBTA 1LO2L 2DQIL 2XFXA 2D7NA 3RWIB 4KKLC 1OTUD 2VDML 4LLYB 4LLVA 2YKLL 3F65A 4NO0A 1JZ8A 4OJFH 1G7JB 3CX2A 5KSUA 2OBGA 2D9CA 4OCLC 1T0NB 5ISZA 2DQCL 2QSCH 3FZUC 4RFEB 3F62A 1MEXH 4UINH 2ZUTA 3B3IA 5I18L 2DQEL 3NPSC 2NW3A 3NIFE 2C4FU 1ZTXH 4HJJH 3DV4A 4FP8L 1H3UA 3HG1B 1P5UA 4JFDA 5EA0H 3F5WB 1OL0A 4MD0B 1HDMA 4DEPB 4P2QD 2GK2A 4KDVA 3G5YA 4PJXF 5JW3L 4ZTOL 2CGRL 3GSWA 1MIEL 2CKBL 1WF5A 2Q87A 1T04B 2O5ZH 4PJ9B 3QH3A 1KLUB 1CXKA 4JN2B 2VLLB 1OTSC 2B20A 4P23B 2XTJD 5I1LA 3G9AB 1BZ7A 3ZDZF 1X6NA 3MLWL 1B0RB 1A7BA 4L4TA 4MDJB 1U8KB 1LK3L 1X5ZA 1Z5LA 3CFBB 3GSNA 5KSBF 1FZJB 1H3XA 5DHYA 4OZIB 3BUYB 2AV7B 2I27N 3IYLW 3S36X 5LBSL 3EHBC 4JJHA 4PGCB 1OLLA 1IGCL 3C87A 3QI9B 2XZQL 4X9HA 4QYOB 4GSDL 1UA6L 3GSOB 3RZCD 3ZTNH 4PJBB 3WCYA 1URLA 1I7TA 3KGRA 5D2LA 1J9CT 3RL1B 5DK3A 5HDBE 3QHTC 4O9HL 1DP0A 4TUKH 3TVMD 2EDNA 4APQC 1U6AH 1UENA 3MRQA 1NC2B 3OKOB 1IAIL 1OAYL 1RJCA 2Y5TB 1S7UA 5E0QA 2VKWA 4LMQI 5ESVB 4PJFB 4G8IA 2PYFA 4Q6YA 3QEGH 3GSXA 5JIKA 1ADQL 1FVEB 2E9IA 3NCJH 4I9WD 2WMPA 5H37H 2IBGA 3DV6B 4YC2C 4K23L 4Y0GA 1HK6A 2D4FA 4IIQA 1KTRL 1G9ML 2Z4QB 4YR6B 5DJ0A 3S35L 3LKOA 1C7TA 1ETZB 3WO4B 4Z7OE 2D0HA 3SKJH 1K8IA 3MMEB 3QO0B 3SKUD 4P2RB 3MRFB 1D7FA 2UWEF 3WJJA 3NGBB 3V0WL 1G1YA 3HAEA 3FL7A 5HI4C 1FFOA 4CJ0A 1ZHKA 2VLRB 3MRHB 5IHLB 4ZNEE 3T3PE 4WUUA 3IU4H 4EDXB 4WI6A 4MD4A 1MRDL 1FIEA 5C2BH 1KN4L 1CFNA 3N1QC 1OCWH 4HULB 5EN2A 2CDFB 2IPTH 3UPAA 3UPRA 1JL8A 3QPXH 3RX5A 3O4LE 4LARH 4LVOC 1MAMH 5EIIA 3A6CL 2PXYA 5EC1A 4JQVA 3GZKA 5D5MF 1CIDA 4JHWH 3N9GH 1A6ZA 1CZ8H 5DJ6A 5J1SC 1HILA 2YZ1A 5D7JA 2AJUH 3SE4A 5E8OB 1F5WA 1EZVY 2P7TA 3WIHL 5C0EA 1P7QA 1U95B 1NKRA 4FZ8H 3TYGL 3BN3B 3PP3K 5CFHA 3DMMB 1ZANH 1XF4A 3TZVB 1T7WA 1QFWH 5AUMB 2R0KL 1Q9KA 5GGTA 4KJPD 2RBLA 4N0CD 2GITA 3KXFD 3MXWH 1AR1C 4WY7L 4YNYB 5TJWK 3FONA 4JFOB 4QCIB 1TETL 4BZ2H 3MRRA 5ETUB 3I6LE 3S4SA 4JEGB 4IOIA 2R8SH 1AHWC 5D2LE 4OCRL 5KANG 3PABB 3CVHB 5L8KB 3NABH 5I0ZA 2ZOLB 1K5NB 3B9KD 4Q6IB 2LTQB 5F6IC 3HB3C 1BF2A 4PRIA 5TGBA 1N7MH 4LQFL 3WXVH 1Z9LA 3LPWA 5SWSB 5AG9A 5JPMB 2CIKB 4Q58C 1KTDB 3RU8L 4P59H 1FDLH 1AQDA 4PJIE 2PO6D 4MA1B 5D7LD 1N6UA 2A6JA 4KZDL 4LCUA 4F33B 4OSUL 5D1QA 4ZPVB 5IK3A 4I0PC 1RIHL 4Q2ZB 3CC5B 3O3BB 4I5BA 4OFIA 4OGYL 5EC2A 5ABDE 1K2DA 4X4XA 5DMGD 4XVUC 5DHVH 3WO3B 3PGFL 4QRQB 3SN6N 3OQ3B 3RGHA 4OLUH 4ELKB 5AG8A 4WUUE 3L7FA 3BDXA 1QLEH 4JY4A 3T3ME 3EFDH 4P57A 3WIFB 3ULUE 5DTFA 2OP4L 2LV4A 1WJ3A 4DGIH 4Z7QF 2NW2B 4Z8FL 2H1PL 4NQDB 4Q0XL 4BZYA 1KCUH 3QZWG 4LHUA 4LVEA 2ZG3A 3B4NA 3UP1A 1G7LB 1EMTL 3O2WL 2E7LA 4O2FB 1MCNA 4NPYB 3FQWB 1RURH 3O3DB 1DBMH 1MCBA 2C3HA 4MNQB 1FNLA 3KPRA 1H9VA 4U1JA 1CE6B 2HLAA 1VFAA 3MRLB 5JW5B 1NCBL 2B2XH 3KWWB 3C2SA 1E28B 1PZUB 4OAWB 5CILL 3BYTA 4F7TA 4RCAA 1R5IB 1KFAL 2JCCB 4LBEB 4L4VE 4XHJD 3QISA 2C3XA 1V7NL 2VITB 1W0WA 2JB6A 4Y4HB 4N0FA 4NN6C 4GKZA 1CDUA 5HHQA 5CD3A 3EBAA 3NCCB 4G8GB 5DD6A 3CMOH 1NFDF 3GHBH 2NY2C 1MF2L 4MX7A 1FGNL 4PRIE 3TIEA 3TO2B 1INQB 1TVBB 1MJ8L 3INUH 5F6HI 3RGVD 1FL6B 1F02I 2Y7QB 3GB7B 4OCYH 3JVGA 2A6KB 3BE1L 4OQ1A 1FORH 3IKCA 2VDMH 1JGDA 4P2QA 4NCC1 4TOYH 2YKLH 2EE6A 5HDQH 2HWZH 1S7WA 5IHZB 4KTYA 3DYPA 4OIBA 1NBYB 4KMTL 4S1RH 5I18H 2DQEH 1VKXA 3OKYA 3KYMB 3AVEA 1FC1A 3PIQB 4PJDE 2HTKC 2UV3A 4F37F 2YD8A 3L3GB 1TJHH 4GG8B 4YPGB 4HXAH 1YN7A 4L8DA 2FCBA 2MTPA 5CJOH 3ZZ1A 2IGFL 3DO3A 5KN5B 3QDMD 4PS4L 5DUPL 4R4BA 1NQBA 1HWGB 3D85A 1FYTE 4KTDL 1NCUA 1F3JA 3DUHA 5JW3H 4ZTOH 4ZSOB 1S9VB 4YBHA 5ERWB 3X3FL 2HRPH 3RZCA 3MA9L 1RFDH 1YC8A 5D1ZB 2X41A 3P4OB 3S3PA 1DDHA 1E4XL 1ZK9A 5IB2A 3TH4T 4HV8A 3TVMA 3MLWH 3RUGE 5ITBL 5CS7A 1AE6H 3P73A 4GAJL 1ZAGA 5GGSY 1PYWB 2H3NB 3CFCL 1JF6A 1HHKA 1S3KH 3IF1B 4WHYG 4OF3A 4GRWF 3D87B 2AJYH 2BCKA 1FVDA 2FX8L 3FFCB 5BOPA 4IS6A 5LBSH 3MV7D 1RY7B 2IQAB 5FUCC 3UC0H 1IGCH 2X70B 4MXQD 1Y18A 2XZQH 3MNZA 5CGYC 3UXFA 1JGLL 4M7ZC 3QUXB 1ZGLP 2Z31D 5DGRA 5C0NC 1IAOA 3RJQB 5J6GB 4NQCE 3O2VH 3VD9A 2MQCA 5F3HA 3GSRA 4O9HH 5J1AA 3LKSB 3VMOA 4P3DB 4NWTL 3UDWA 4JHAL 3G6JE 3GIZL 2BVOB 2BSSB 3ARBB 5I73B 1OAYH 1J8HE 4C56B 5IM7B 2C3WA 3MBEC 2XPGB 5GGRB 1BAFL 3HMXL 1V3KA 1JHLL 1ADQH 2Q76A 3OKDA 3GJFH 5LGJA 2X5PA 3RPKA 1U8LB 1LNUA 4TSCL 3MJ7B 4LCCB 4R2GB 4XBPA 3S35H 3LS5H 3JUYA 3E6FB 5ALCL 1XGQA 2WLZA 3L6FA 3QEHA 3JTSA 5JW4Q 5B38G 1MLCA 4TNWF 1Y6NR 1Q94A 5IBLC 2R1XA 1DTUA 2H32A 5DI8B 3EO0B 1MRDH 3MRKB 4GG6B 5CP3H 4Y19E 2VXTL 4NOFA 1QRNE 1HKFA 2DLTA 1NC4D 3HUJB 2FLBT 2DQJL 4NYLA 4WFEE 4KK6C 3KJ6L 2MHAB 4OZ4A 2VDPL 1W8OA 4TVPH 4XB8A 3DURB 4OV5A 1FGVH 4UDTA 1A1MB 4M1GH 1GGYA 1G7IA 1C16B 2HFFA 3B9AA 4HK3J 1AI1L 3U4EA 3GRWL 3IFOB 1KCSL 1PGRB 2AW2A 3MFFB 4ONHB 2LFGA 4NM4L 3WIHH 1QFOA 4GMTH 1J0ZA 1KGCD 4OBSA 3TYGH 3F7RA 2C3VB 3KPQB 4RDQF 1RUML 1Q9OA 1LO4L 4Y5YC 2R0KH 2X42A 4F7CA 5LAXB 5DQDL 2PO6A 1NAKH 4WY7H 2MFNA 3PXJA 3CFIC 5D7LA 1T1YA 1SJEB 4QHLB 1LQSR 3MRIA 4KC3B 1U36A 1LGVA 1Q9LA 4URTB 3T1FA 3PWUB 4EZMA 4WFHD 3I2CL 4UQ3B 4U6XA 2BSRA 3VXRD 1JNHB 1A9EB 1CICD 2OL3A 1G6RL 3L5IA 4RAVA 1YNLL 5DFVD 3WN5C 2HJLA 3BQUC 3C5SA 4EEEA 1ZA3A 1IM9B 3MNVA 3V52L 4JPVL 1PY9A 4X8XA 5FUZH 4TNVF 1AGDB 2W0FA 1WC7A 4JZOA 1XZ0A 2IC2A 2EDDA 3FFDA 5IW1B 2P8PA 1RZKC 1UWXK 3MLUH 2KBGA 5JHLL 2VZOA 3QIUB 2CRYA 2H8PB 1U92A 5B3NA 1EVUA 3C5ZB 2DYPB 4KZDH 1DR9A 2ESVB 1I3VA 4U1IB 1QR4A 2GFBA 2R2EA 1I75A 5DXWA 4LCWB 4Z5RA 1U8MB 3D39A 4BKLB 1H15A 1F3RB 1MPAH 1NMAL 5K93A 1IMHC 4OGYH 5C07D 2C4XA 1DUZA 2MSPA 4POYA 1KJ2L 4Z78B 2C1OA 3TBYA 2NY0D 2W60B 4G8EA 1WBXB 3UZQA 4YXHL 1SJHA 3SGEH 5TH2B 3HE6D 1EAPB 2D03L 3M17B 3LMJL 3F8UB 4DCQA 4X7FC 2NY4C 4BFGA 2OLDA 5I74B 3IDUA 2H9GB 2OP4H 5HYIA 3SKNA 4OZGF 2YPLD 4CADA 1NLDL 5J8OA 2Q8BL 1CK0L 3Q5YA 3KLSA 5F7KC 4UTBH 2D0GA 1JPTH 4Z8FH 5HYSA 3VFNA 4M02A 4CJ1A 5LCVL 4PJ5A 5ANMA 4XWGL 1X5IA 3L9RA 1U93A 1G1CA 2FL5B 5MEQB 4QT5A 1MCCA 1EMTH 5GRWA 5AZEL 5EPMA 4JLRA 1R5VA 1OTTD 2MWCA 1TLKA 1OW0A 4QY8A 4KI5F 4WGWB 1OAXH 2ARWA 1CGVA 1PEZA 2DQDH 2FGZA 4EI5C 4Y4FD 1NCBH 1FFRA 2ED7A 4YBLC 2Y23A 3B9DA 5E4EC 4NO5B 5CILH 2X1XR 4LLWB 3RWHB 3QNYA 5EU3B 4FQ2L 1F4AA 4XVJH 1QSFD 3DTXB 3RVUC 5C0AD 4XC1H 5SWZE 2P49B 4OFYD 2OQJA 4UAOC 3AU1A 1VEPA 5D96C 4HPOL 3NPZB 1J1XL 3MYJA 4LVHB 3NIDE 4OZHE 1J5OL 4RGNB 1MF2H 1PFCA 5AAWA 2YZ8A 1N64L 4MQSB 4MA3B 4G6AD 1K6QL 2D31B 5ENWA 4RAUB 2D7TL 3C08H 3QDMA 4NUGH 3BE1H 2HT2D 1XF5B 1A8JH 1OB1B 4G42B 5DRZA 2RQ8A 5IOPB 3O6FC 4GAFB 5FO7A 3SCMC 2YEZA 4G5ZH 2LU4A 4OM0L 5DYOA 2A73A 3VDAA 5J9PB 4XNXH 2GSIA 3D39E 3TT1L 3VW3H 5IEHB 4D9QD 2IMNA 4CVZB 3A67L 5CP7B 4LF3B 3EDDA 1A4JA 2GY7B 4IHOB 4QKXB 4ZPTB 3KPNA 4P9HC 1OAZL 1I7RA 1UT9A 1MCSA 3LIZL 4J1UB 1RUKL 3KYOB 2F74A 3FQNA 5D1XD 2HVJA 2ICWA 1HQRA 3LHPH 3F12A 4FMFA 5FGSA 1ED3A 2XA3A 4JREC 4PS4H 5DUPH 1KN2L 4LPWA 3DRQB 1FN4A 3MV7A 2XWJA 3IXTA 4JM2D 7CGTA 3CVIH 4YX2L 2XXMB 3CZFB 3DUUB 4PJ5E 4A2LA 2R2HA 5I8OH 3X3FH 1M6OA 3NBNA 4Z7VF 5C0GB 3MA9H 2AQ1A 2HN7B 3V0VA 4XPBL 1FIGL 4H26A 5JQ6L 4JFPA 4EN3A 2PUQT 2OTWA 3MFGB 4HK3N 1KT2A 1RZJC 1KNOB 1Y6MR 4PJXE 3BT2L 4X9FA 1SMOA 4BSJA 4KK8D 1EGJH 3QEQD 1N4XL 3RPIA 5D7IA 5DJAA 1IGYB 3IRPX 1DZBA 1R3IL 1R5WA 3CZJA 1BVLB 5BVPL 3ZDZE 4TVSa 4HUXA 2HVKB 1YY9D 1JGLH 1AO7D 1DBJL 5KSBE 3PWPD 1FL5B 3UCRA 4N8VG 4WFFD 1CBVL 4GMSH 4NWTH 4ZYKB 3PUCA 3EJYD 3HZMB 3P11H 4KVNL 4XTRC 1ZLVH 4MNGB 4H1LG 2X7LA 2I9LB 3IJSB 2Z35A 4TQEL 5K9OB 4YDVB 1CVRA 1QUNA 3MLRL 1NC4A 4PBXA 1BAFH 2ZOKB 3BKCH 4FQQA 4OIIL 3AUVA 4LSVL 4OZFA 1GHFL 3I6KA 4RGOL 3RVTD 1OGTA 2AVGA 2BC4A 4U7MA 4TSCH 4E42A 4XPHL 5D93B 3QFJB 2MQ0A 1JYVA 4LKXA 3ULVF 4HUUB 3TO4B 5ALCH 5DK2A 2GT9A 2JJTA 3RTQD 3EYQD 5I1JL 3C60D 1I3UA 4R90L 3ILQD 3B6SB 2GK0A 3TT3L 2JJWA 1D9KB 3VJ6B 3M1BA 3QCTL 1KG0B 5DT1L 4NKDB 5GGUB 5I15H 2EC9T 3FRUB 2VQ1B 2DM4A 3F7YA 2DQJH 4OD1H 5IMKB 2UWEE 5D71H 3MYZA 4DZBB 1T6WA 4LKCB 1AY1H 5CEXA 3VFMB 4U1KA 3EZ8A 2R29L 3SDDB 3EJJX 3GNML 4MA8H 4XP4L 3KJ6H 2VDPH 2ZWLT 5EUOB 3VXRA 2Z8SA 4GW4B 2Q86B 4RFNB 1YMME 3IJYA 2FIKA 3GRWH 4FFWD 3DUSB 4UNVA 4NKIL 1OAKL 1BOGB 4U6TA 1SEQH 1W72B 4HDIA 4RMTA 5DZNA 4PJCF 1LO4H 4P9HL 5D5ME 1TJGL 4KKBC 4X4MA 1OOAA 1A7OL 3R0MA 3WUWA 2FX7L 4O2CA 1YN6A 4HLJA 3IDXL 3I2CH 3MLTA 4RA0C 1QFWM 4CUCA 4WUKL 1C5BL 4YHOH 2VR4A 5C07A 9CGTA 4HJ0C 1YNLH 1RUPL 3O81A 4KRNA 2J6EL 2W0KA 2N1KA 5MEPB 5T1MB 5T1LA 5FOBA 1UZ8A 4JPVH 5D4QA 3PWLA 2BNRD 3ISWA 5KAQF 1K8DA 4D0BA 3HE6A 1LO0L 4Y4KB 1XIWB 1WZMA 1I8KB 4IDJH 2NXYD 2BDNL 5JHLH 4LPXA 4KPHL 4X6CB 2PW1B 3PL6D 2BHYA 1GGBL 1QFWI 2K1MA 2YPLA 5AYUL 1DL7L 1BP3B 2ZUSA 4JKWA 5TDPA 5DJDB 2IG2L 4NQTA 4HIHB 1NDMB 2YUVA 4M8QA 3DROA 1CDYA 1QBLH 1NFDA 5B8CA 5A2KH 1N26A 5JXEC 5BV7C 5L2JB 3D25A 2CIIA 1CFBA 3UEZA 3HI5L 4BELD 5JZ7C 4WW2A 4IIQC 4XMPH 3WL9B 4M8VA 3VXUB 2QBWA 2OZ4L 1ES0A 4YXHH 4PRHD 4PRAB 3LMJH 2DMKA 1U8HB 3WJJC 5FO8B 3H7BB 4MDIB 1JYNA 2MKWA 1T20A 2DQFA 4BH8A 4ODXB 1P7HL 1QBBA 4KQ3L 4RNRB 5GIRB 2Q8BH 1CK0H 2JIXD 1LO3L 4X0KB 3EW3B 1FZMB 2H26A 1EHLL 4QRRD 3ULUC 1FO0A 5C0AA 5HHOD 5IQ7H 4OFYA 5JA8B 1HHHB 4X6EA 3VXRE 5JXAH 4XWGH 5TF1L 3SHSA 2PXYC 1CQYA 5J89A 4X6BB 4JQVC 4K71C 3KYNA 2WV3A 2VL5A 4ZFGH 4F8TA 3BHBB 5KVEL 5E00B 2EDWA 4Z7QE 1HYRC 1NANH 5D7JC 2YWYA 3SE4C 43C9B 4JZJA 1KYOK 1WCBB 5C0DB 4X4ME 4NNXA 2F15A 5DJCA 4WJ5B 3TLRA 2IBZY 1KEGL 4I1NB 3O4OB 3NTCL 5AWNH 1F3DJ 4U6VL 4WWKB 3S8WA 3QEUA 3Q6FB 1F6LL 3OXRA 4OT1L 4X5LA 3AMKA 1FNEA 2Y25A 5F1IA 2EC9U 4XAWL 3P77A 1DN0A 2FDBP 5F1NB 4CAGA 2BRQA 1CDCA 2AEQL 5IJVB 5E8DH 5D1XA 4RRPG 1IC7H 4XP1L 1GIGL 3JV0A 1OLZA 2CD0A 1UCBH 3KYKH 1U58B 2D7TH 4LAQH 4PLOB 4WFGE 4AEHL 1T89A 4Y5XA 2R23B 4NBYB 3VFTA 4RMSA 4LSDA 1HHGA 4PY8I 2XRAL 4WTXA 4ZDHB 2BVQA 2XA8L 3RY6A 2OSLA 3T0WA 4JM2A 2J8UA 1NFDE 2FBOJ 2R0WL 3HC0A 4XPTH 3RQ3A 3L3IA 4K3HA 2CR6A 3NFSL 2Q1EA 4MCYA 3K2UL 3T0EE 1ACZA 1V5JA 3A67H 3U0PA 4JFXA 1HHJA 3V4UH 5D1QC 1D6EA 3AM8A 1OAZH 5DSCA 2IALB 1IAKB 3W2DL 1KLGB 5L88L 3NFPA 1G0XA 4LNRA 1D5BB 3WFBL 1YEHL 2F53B 3SJVD 2FZ3B 3QEQA 2EEBA 4PLKD 4IDLA 2QADB 1NBZA 1Z9SA 3ZHDA 3ESUF 3ZHLA 1TVHB 4IRSB 3WNKA 4M7KH 1J8KA 2ZCLL 5C0AE 5MENB 2WINA 3F7PC 1T5WB 2YUXA 5D2NE 3PWPA 4X9BA 2ARJB 1XR8B 4PGBB 4X7TA 4XPBH 4TRPH 4WV1A 5JQ6H 4H25A 4ODSH 1FQ9C 3LN9A 3QJHB 4GRLD 1MAJA 1I8MB 1RJYA 3BXNA 3BT2H 5F7LB 4YZFE 4X83A 4BFIB 2FR4B 2E7LC 1YZZA 1W72H 4HIEA 1YNTB 5EBLB 5GS1A 4DZ8B 1I7UB 3DX9B 4OFPA 3AXLB 3MV9D 3EOBA 3D5OF 2XNAB 3LAFA 1R3IH 5DFWH 4XVSL 5M94B 3PDOB 3FCTB 2PCPA 3LEYL 2B7DT 1KENL 4BFBD 1OTUC 5DMIH 3OZ9L 2EXYD 3ZSSA 4NO2A 2GJZB 5FEBA 3RTQA 5L2KB 3QWOA 2DQUH 3GMOB 1BGXL 2R1YB 3ULUL 2XY1A 4GRWE 2ATKA 2VTFA 5I75C 2HH0H 1UACL 2AXJA 4KVNH 3BGFB 4QHUA 4K8RL 1FFPA 4PJHF 1QLRA 4TQEH 35C8L 2ADFL 2R1WB 3ARGD 1HCFX 3MLRH 1ACYL 3KR3H 3KNBA 4JPKL 4LSVH 5IQ9B 1GHFH 4RGOH 1AFVL 3PP3H 4XWOD 2P5WE 3JVGC 2MOVA 4NRZA 3UJIL 5HGHB 1FRGH 4HWBH 5KOVC 4X98A 5F3BA 5EBMB 2ADJB 1GZQA 3V5KA 2DLGA 4HC1A 3Q2CA 1AKJD 3HPJA 4LHUG 1JPGB 4ZAKD 4GKNA 5DVLA 3EDKA 4AYFA 4JJ5A 3JWOC 1K3ZA 4X4ZA 3RWJA 5I1JH 3ILPA 4R90H 5BS0B 4FFVD 1BBDH 3S5LB 1CGSH 1IAII 5INDA 2CLRA 2XTJC 3W5MA 1RUAL 4GW5A 1R3HB 3E6HB 3MRGA 4UUJB 1NCAL 4HHAB 5I2IA 4BYHA 1E4WL 4OCSL 4C4KO 5LWYL 5I8KL 4GQ9L 1F58H 4NKOB 5DZOA 3CFDB 1B6DA 3PF2A 3VGAC 1RK0A 1RQ5A 2PYEB 2FSEA 4JCLA 1U9KA 3LQAL 4LPYA 4OZGA 1OAKH 4LSUH 2BNRA 3RZCC 3GMMB 3JWDL 2VABB 1IKNA 4QXTB 4YO0A 2VISB 1G9NL 3TN0B 4M1CD 2PW2A 3TVMC 3VWJD 1ZHNB 1TJGH 3PL6A 3OWEA 5FYKE 1A7OH 2BZDA 1I4FB 2FX7H 3L3OA 4FXGA 4MJ6B 4TYUA 4MWFA 3UBXI 4DGVL 5B39B 3CU1A 1KOAA 4FQIH 5CSZA 1C5BH 4YPJA 3QBTB 3W9EA 4AM0B 4XGZB 3QPQD 4NSKB 1LEGB 5FYJE 2P43B 3U1SH 1KJ3L 4H5SA 1RHFA 3GSQB 2FD6L 5GS2H 4M48L 3WJLC 1LE9B 1FJ1A 5CHNA 3HCVB 4Z9KB 4HWZB 1U3HD 2Q8AL 1LP9B 4EBQL 1IKFL 1J1OL 1JWMA 1H3GA 3V95A 4KPHH 1RZGB 3EOTL 1EFXB 5F8QC 3FT2A 5AYUH 3VFPB 2IG2H 3F6LA 1XCQA 3NACL 5IMLB 5D70L 1NSNL 4GUPB 4GH7B 2ZKHH 5E5MB 1MAKA 4PJEB 4QRRA 4Z77B 4PTTB 5HHOA 2AAVA 4J8RB 4NKMA 2X4RB 3DI3B 5EZOH 5DDHB 4ZUWA 3HRZA 4PJAA 1NGZA 1NAMB 1JHTA 3HI5H 1ZT4B 3FHQA 3P30L 3ZKND 1YEDB 1A9BB 3K8LA 4HWNA 4OZIF 4F9PA 5GQBA 5C0IB 2GJ6E 3SE9L 1ORSA 3L3KB 4FOMA 3LKRB 4KHXL 3KS0H 1FZOB 1U41A 1YEGH 2NY6B 4I3SH 1NLBH 4KQ3H 4PJBF 4IMKC 1P9MA 1BIHA 2X4UB 1TZHB 2NZIA 2I25N 3KPMB 5F89B 4KJPC 4K2UL 4HQQL 3MLXL 3BW9B 3RIAF 4YHLL 3TNMA 3SO3C 3DO7A 3IS0X 1I9RH 5DR5L 4OZGE 1ZLUH 4PJFF 4F37K 4OF0A 4ZS7H 1KXTB 5CKGA 4ALAL 5TE6L 4MB5A 5KVEH 1OGAD 2YD5A 5JMRA 2VIRA 1PKQB 5J6HA 4WO4B 1PLGL 3B9KC 1MHEA 2YN5A 1V7ML 2V7NA 3J8F7 5CZVH 4Q9RL 3JWOL 5TQ0H 3FO0H 3CJJA 5DC9B 4ONGL 3BISA 1FL3B 4LSRL 1KEGH 3CUPB 4IJ3C 1U8OA 4NQSB 1P84J 4XX1E 4U6VH 1DBBL 3U6RB 2D9QB 1VSCA 3ARFD 3EUUA 2X05A 2PO6C 2X9WA 3S88H 3IDJB 5GISL 2VL4A 4JO1H 5JLZB 1JBJA 3O9WD 5IVXA 4PRBA 1KB5B 4KI5E 3RY5A 1L7TH 5EG6C 1CD0A 1DUYB 1BD2B 4HPYL 1ULVA 1T4KB 2X1OA 3WIIL 2AEQH 4XCNB 3TFKC 2IPUK 3QO1B 5DMGC 5DURB 5I1IL 5D72H 3RNQB 3IDGA 4G7YL 4AEHH 1D5ZA 3HZVA 3WDJA 2XRAH 2FHFA 5ID0A 2R0WH 5DRNB 3VXMB 1G7HB 4XP6L 3ZKSD 3BWUC 5IF0A 1TJIL 1B4RA 3K2UH 4ORGA 1G7QB 1Y0LB 4PJGA 2VKXA 3BP4B 1L7IL 4HSQA 4JFYB 4JO4L 2ICES 5DMKA 4GRLA 1HINH 5L88H 1BM3H 3V79C 1NJ9A 4HS6A 3BPLB 4LL9A 3ZE0F 3Q3GA 3H9SB 2ADGB 4LP4A 4JFEB 2G5BB 3VA6A 5HI3D 3TNNA 1AH1A 2A6DB 1X5AA 3T77A 3MV9A 1IJ9A 3BDBA 2UUDK 5T1KA 2ZCLH 5KSVB 1LE5A 4ISVB 3K1KC 2FWOB 3VFGL 3QCUH 3MJ8B 3DVFA 4QGTA 1MY5A 4XHJC 4TNWK 1AGBA 1RZ7H 4DGYL 4BJLA 2GQHA 3IVKB 1IGIH 4JFQB 3T4YB 3WHXA 2FGWL 5FF6A 3HNTL 3EOYG 1HQ4B 3ARGA 1UM6L 4YHPA 4PG2A 4RX4D 5F9JB 2A77L 4Z7VE 3IS1X 5C3TA 2BVUA 3L3JA 1WBYB 1OW0C 2X40A 5IR1B 4OF8A 5A1AA 1KXVC 4BH7A 4MXWH 1E6OL 2GY5A 4L4JA 1OSZB 1KENH 3OZ9H 1QSED 3MZTA 4QTHB 4Q9BA 4TULL 1X5LA 4OLVL 2D4DA 5D8JL 3QAZC 3KLAA 3ES6B 4KK9D 1T22A 4NRYB 4ODVL 1ONQA 5F9WC 4PRPE 4MZ2A 1UACH 2AJXH 4K8RH 5CJQL 2OR9L 5T5FL 3TBSA 1JZ5A 35C8H 2ADFH 5IB4A 5C2UB 2X89D 4RBPK 1ACYH 1GOGA 4IRZL 1MY7A 4JPKH 3Q6GL 4YHNB 2VC2H 3FB8B 5FYLD 4KHTH 3OAYK 1S7QA 5JHDD 1AFVH 2JKXA 3RWDA 3BZFB 1H3TA 3UJIH 3L5WB 3NFNB 3BIAX 3F58H 3KHQA 2DM2A 1T3FB 3C8DA 1ZWIB 4P2OA 4HMCA 3P9LA 1AR2A 3GK8H 4JKKA 2IJ0C 1JGUH 4AL8H 4APQB 1T7XA 1NFIA 4G6FD 4ZUSA 2JCCF 1G7PB 2YOCA 1S78D 5FUOL 2FX9H 3MRJB 3VWJA 3ULVE 2IADA 3BSZL 1N5AA 1DFBH 5E7BA 5TQ2H 1SY6H 4EUPA 1NCAH 3EKCA 3CH1B 1E4WH 3LRGA 3TIDA 4K94C 2FYYB 4LSSL 3PDGA 4BUHA 3QUKA 3R06A 4GQ9H 5CMAB 3PNWA 4HK0A 4YC2B 3MRPA 4ETYA 4LSPL 2XQYG 4BM7A 4LLQA 5EOTB 3EFFB 4M9PA 5FDWB 1T21B 5FB8B 1U91A 3H9YA 3LQAH 4MAUL 1J88A 4MXQC 5TDNB 3OGCB 4CMMB 2Z31C 5CGMA 1BBJA 1AD0B 1I8IB 1N2RA 1VPOL 2MCG1 1RIVL 3MGTA 1G9NH 3D2UA 1U3HA 5GSVB 2PNDA 1I7ZB 1EEZB 2QKIA 3PWVB 1SBSH 3RVXD 3OR6B 1F13A 4LGRB 4LVOB 1EEYB 3MOAH 1UFUA 2SEBB 3AFLA 3V6FB 1PDKA 5L6YL 1L9MA 3VH8A 3NA4A 2DI7A 5C0CD 1LEKA 3HA0A 4PJCE 1MHHB 2P5ED 3I6GB 1UB5B 4BSVB 1KB5H 4BQ9A 1IFHL 2FD6H 3MCKA 3SDCB 1YMHB 4F58L 1CD1B 1V3JA 4J12A 3BGAA 4EBQH 1QZ1A 4ODTL 1IKFH 3HNVL 4E41E 4XCYB 4GW1A 3EOTH 2BRRL 4R7DB 5D70H 4GRMA 5C09D 3SGKC 5IESH 5KVGH 3PQYA 5KZCB 3EAKA 1AHWB 3GIVB 5K9KA 2M2DA 4TN9A 3QZWB 4PJ7B 2WANA 1BQHA 2HG5B 3UTSB 4NP4H 2IANE 5F6IB 4H8WC 3PWNA 4DFHA 4P2RD 1GRWA 2JJTC 4JFFB 3OKMA 3SE9H 1P7KA 4XRCB 2EIEA 3O41B 1JYWA 5DJZA 3QDAA 3MRCB 3T2QA 1HHIB 3LB6D 4QRUA 5CZXD 2ZUWA 1DVFB 3ARFA 5D6CB 3SKMA 2CQVA 4UTAL 2VXVL 3G04A 4I0PB 4JRXE 3L3DB 1GZPB 2F58L 3O9WA 1OD9A 1WITA 3O0RL 2GTWB 4YHLH 5DRWB 1DQLH 3DIFA 3MRDB 5DR5H 3X3GH 4HS3A 3TYFA 1GPOL 2ILLA 2WBWB 4ALAH 2NLJA 3STLA 5DF0A 1MJJA 1CICC 2KUTA 2VDKL 5DFVC 3DSNA 2W07A 1PLGH 32C2B 4MQ7B 4JKPH 4ONGH 3G5XB 4M00A 4WWID 4LSRH 4L3CB 1LWRA 2YSSA 1OSPL 3QSKB 1DBBH 4OZFG 1KBGL 1Z9OA 1JHKH 2VUOA 4AEFA 5F7UA 5GRUH 1H8NA 4S1DD 5F7EH 5GISH 3K1DA 1NGXA 1ZS8B 3KPPB 2DWDB 5I76A 4N9GA 4GG6F 1L0XA 1MCJA 2NY3D 3FO2B 1C5DA 3DXAA 4OD2B 3W9DA 4HPYH 5DJYB 3WIIH 3HUJF 3MRNB 5F9DC 5I1IH 3QDGD 4FTVD 4IBLT 2NY0C 1NANI 3HPLB 1Q0YL 3T04D 5KJRH 3V6ZB 3HE6C 2N7AA 3U30B 1F4WH 2CDGB 1C12A 3MR9A 3PQYE 1GC1L 2OI9B 1TJIH 2Z91A 2J7LA 3ZT6A 3BZEA 5FA3B 2R4SL 3PV7A 1BEYH 1U0QA 3DX8A 4NN6B 3ZYZA 5B8CC 4LIQE 5LQBL 2AI0L 4KY1L 4YUEH 2NY2B 1WFOA 3ARRA 4JO4H 2VDLH 2W9EH 4WW2C 3WFEH 2YA0A 4N0UA 1JUFB 2E9WA 15C8L 5DJ2B 4YHMH 2J8HA 3LOWA 1OTTC 1U8QB 2X4OB 4P5MB 1AGFB 3BGMB 3U36A 4JGMA 3WUWG 1ITCA 3EO1B 1ODAA 3FT3A 3S98A 1DE4B 1I3GH 3KLHD 2EYRB 5DUBA 2H2PD 3VFGH 3ARTA 4CNIB 5IFJB 4DGYH 3WE6B 4JRWA 3DYOA 2D7OA 2V9RA 1DANT 2FGWH 3D3VD 4U3XA 3QIBB 1AGEA 3V6BR 3QUZA 2X89A 1UM6H 4MJ5B 3H0TB 2A77H 3BWAA 3S35X 4YAQA 4DOHB 2EYTA 2I26N 1CFVL 1HIML 12E8L 1UWGL 4JANB 4DN3L 2ZUQC 4G6AC 3SDAD 4S1QH 1XT5A 2WWMD 5I66B 5JHDA 4GKSA 5DRXA 1S7VA 4JZJC 4PV9A 3HLAB 5DVOA 5D7SL 1E6OH 2E27L 4RMQA 3DXAE 1IEAB 5D8JH 4R7NB 1RK1A 3E8UL 3QQNA 1U8JB 1CL7L 2F54E 5DHVA 3H7LA 3U9UA 3WHE1 3VXSE 5IVZB 3I84A 3UTZB 3UJTL 4E0RB 5EO0B 4LNVA 1KTLB 2XWBA 5T5FH 5B38B 4PRDA 2EECA 2ED8A 2XN9E 1FE8H 3SEPA 4ZFOB 5D1XC 5EULV 1QP1A 5I0DA 3Q6GH 3HG1A 3VD7A 3NVQA 3D0LA 2EDLA 1P4IL 3P9MA 2Z0BA 4U2ZA 3UYRL 1T89C 3GSUA 1XF2B 4LK4A 2B39A 3CSBA 1JGVL 5HGAB 5HHXH 4M7ZB 3RY6C 2YPKA 4JM2C 1XF3B 3RRQA 3ALPA 1TNNA 4NIKB 1FCCA 3KPSD 3TWCH 3GMRA 5SX5K 4CW1B 1T04A 1AC0A 2FJFB 5FO9B 4JN2A 3BIKA 4MVBD 3AM8C 5FUOH 4NNPL 3UYOD 3BSZH 1MUJB 2DM7A 1EERB 4MDJA 4UQ2A 3CFBA 3B8SA 4LSSH 3ZKQD 4DUWA 4Q97A 1CF8L 3QQ4B 3QJFB 3W11D 4OLYL 4OFKA 4OZIA 1Z3GL 2AV7A 4QRPD 4LSPH 3ARZA 1IAMA 2P42B 5CEZE 2FNBA 1XFPA 5C0CA 1JTTA 1BQLL 4YGVB 4PGCA 1BZ9B 2IFGA 3PGCB 3V7AE 2P5EA 1ZT1A 5K33A 3S3SA 1O7SA 4MAUH 4M7JH 5BO1H 4PYGA 1YY9C 4QYOA 3VRIA 1CR9L 2R15A 1AP2B 1VPOH 4CDHA 2F8VA 5E99H 5LGKA 5EZIL 4JAMA 5BW7A 3OKEA 1E27A 3OSKA 2YD6A 3HR5B 3WLBB 3R8QA 3EJYC 1NC2A 3N06B 5HHMB 1L0QA 4HJGB 4PGEA 3IU3B 3W39A 3QULA 3I02B 3UTPE 5EU5A 1KIPB 2Y5TA 1S9YA 5C09A 3MUJA 2GTZB 4Z7WB 5ESVA 4PJFA 4XI5D 5L6YH 5GS1C 3BPCB 4WW1B 4MMZC 3DYMA 3RVTC 1M1SA 3NCMA 3P4NB 4KJYA 1F6AB 3OV6A 4YR6A 1S5HA 2D7MA 3O3AB 3OKLB 3R8BB 1IFHH 4NO3B 3VXPB 3Q1SL 1CS6A 1I3RB 5H2BB 5IB3A 4P2RA 1YEJH 3RTQC 1FO0L 1X7QB 2DMBA 1BFOB 3C60C 4Y5YB 1MFNA 3MRHA 3ILQC 1IGJB 4NC1C 3U0TA 4P2CG 5IKCA 3HG1E 1NKOA 5CBEB 1DANU 4MSWA 1Q9WB 4HLZH 3FKUS 1Q0XL 3FB6A 4J3VA 2ITDB 3CFKB 1WEJL 4J3WA 5HD8D 2G60H 4YHIB 5F7FA 1XCTB 1BHGA 5FA4A 3P0VL 1KJMB 4I4WB 2F5BH 4OI9A 2O61B 4FFWC 1PG7H 5BVJB 1YNKL 5E8OA 4K3DL 4OFVA 1I1AB 4FQLL 4Q7DA 3R1GL 5TE7L 4M1DH 4JGJA 5I30H 1QRKA 2DTML 1HI6B 3N1GC 3KAAA 4GT7A 1T1XB 2A9NL 1FVCB 3L95A 4OZIE 5L9DL 4OGXL 4UTAH 4KZEH 4UV4L 3M8OH 5HYJB 4QCIA 1UWEH 2F58H 4D0CB 1JGEA 2YA2A 4EXPX 3TBWB 4OCWL 4PJBE 1N59A 3E3QE 3VWKD 2VDKH 3PABA 1R3LB 5F96L 3QDGA 2NNAB 2ZOLA 2FJGA 3DVNA 4HZLB 4NQVA 2AKRB 4Q6IA 4ZO6A 2E9JA 4LPCA 1RMFL 5E8EB 4FXKB 1LEIB 2DMCA 3T65B 2JB5L 3MRBA 5EOCJ 3TP4A 3TA3B 2NXYC 4PJFE 1OSPH 1QNZL 1KBGH 4YDKL 3PL6C 3LH2H 1ADQA 3B5TA 3GJFA 2MCPL 4GAYB 4ACPA 4F33A 4ZPVA 3OTTA 4XCEB 4L29A 4NHUB 2EDJA 4P2RE 5T33L 1TFHA 3C6LD 4HXBL 5E95B 2VLKD 4WU7A 3SE3A 2BSTA 5KVFL 4N0YL 4NFBA 1JPSL 2CJUH 2VLRE 5IGXL 5EUOF 1PQZB 5CP3A 3ZTJG 4YBLB 5E4EB 2GAZB 2DB8A 3UMTA 4HS8H 5JW4N 3RAJL 4DVBB 1AQKH 3QIUD 3QNXA 3VXQB 1VFUA 1GC1H 3MXVL 1ZA6B 5FCUL 3UBXA 3IFPA 2QEJA 4AIZB 3WNOA 4V1DD 4NGHH 5D96B 3BPOC 4P46D 4L3ED 2NW2A 4X7SL 5ITFB 1ZLSL 4X5WA 1RJZB 2X4NB 2AI0H 4KY1H 1WAAF 1MI5D 4DKDC 4OI8A 4MHHI 5FYKL 3BDYH 1ZHBB 5INCA 4NQUA 3WIHA 1NH6A 4F9PC 4O2FA 3BYYA 3K46A 3SDAA 5DVMA 2OX5A 3TH3T 4MNQA 1KACB 1YUHB 5FYJL 3ULSB 5JW4M 3O6FB 3WMSA 3SCMB 4YHZL 5EB9A 3LPFA 5JPNA 1I1CA 4NQXA 1F11A 3MRLA 5BRZB 5EBWB 1WV7T 4I2XB 1E28A 1SYVA 4OAWA 1JWSB 1P9MC 1A0QL 3G5VB 3ZE0E 3BEVB 5E6ID 3O45B 2VSDA 2AABL 4N8VB 4Y4HA 3X17A 4NQEB 4HUMB 1ZEAL 5IIEB 3HE7D 3CX5J 3JWNC 4H1LB 4GXVH 4JREB 4NRXA 1CDGA 5C0JB 1HIMH 1INQA 12E8H 4HC1L 4K3EH 1EO8H 3UTQB 4DN3H 2DQGH 1NEZG 5SWSE 1YECL 4PV8A 3S96B 2HTKD 3VE0B 2Y7QA 3GB7A 1XGTA 5F44A 2A6KA 1CTOA 2X4PA 4S11A 1HZHL 3L7EB 4M61B 5DD5L 4JRYD 5D7SH 2E27H 4LGPB 3V7MA 3ROLA 2O93L 4QHNA 4Y1AB 1HH6B 1CL7H 3KPSA 5EU4B 3H9ZA 3AS1A 3G9VA 1F6FB 4JG0H 5JOEA 1ZVSA 4TTGA 3I75B 4CU7A 3ZE2F 1NBYA 4ZXBB 1AGCA 2Y36L 1MVUA 4AZ8A 1CGUA 2NXZD 4TSBH 3DWTA 5GGQL 4WGVB 5B21A 3ZHKA 3L3GA 4XNQB 1JWUB 4QHKI 4RA3A 5DC4B 1ZT7A 5KVMC 4GBXB 1P4IH 3UYRH 4NZJA 2BVEA 4PLKC 4QRPA 4ESKA 3DGGA 3LKPB 4X80H 2W92A 4MD5A 3ARWA 4TVPE 2HFEA 4NQDE 4HUVA 3WFZA 3F7VA 1F2QA 1A7RH 5E9DB 1S9VA 1CXLA 4XH2A 4EIZC 5D1ZA 2C7UB 2VLJB 4LLAA 5A2LH 5BMFL 3TPUA 1MFCH 5CAYB 3QIWD 4GRLC 1RZKH 1LO5B 5E2TL 3MCLL 1E4KA 4WI2A 4MNQE 4FABL 4UILL 4MCZA 2J4WL 4YBQD 5CGTA 4UOW0 1CF8H 5CWSB 2NMSA 4OLYH 1U8NB 1Z3GH 3FFCA 3QXDA 3J7HA 4PTUB 1BQLH 2JCCE 2VLME 4LLVB 3ARDD 2IQAA 2B4CH 4NO0B 4KRLB 4U0QB 2IAMD 5ISZB 1G7MA 1CR9H 3CMGA 2EXYC 3DOSA 4JKMA 4G7VL 4G8GE 1MFBH 3B3IB 3VFRA 4BK4A 4M5YH 2QHRL 3GI8L 4P3DA 3DX6B 1J05A 3ARBA 3HI1A 2G9HA 4JDZB 3RDTD 4C56A 4ZUUA 5C9JB 3ARGC 5KS9B 5IM7A 5IB5A 4JFDB 1JFQL 3JV4A 4PG2C 4M9OA 1I1RA 5GGRA 1QHPA 1CLOH 3W82A 2VH5H 2NPLX 1MQKH 1CLZH 1TNMA 1U8LA 1B0GA 2XY2A 3NZ8A 5JUEH 4DK6A 3E6FA 1V05A 3Q1SH 1QKZL 3BZDA 5EFIB 4HWUA 1DLFL 4P99A 2KZWA 2NX5D 3TV3L 3B2UD 1BZ7B 1QBML 1PW3A 5F72S 4L4TB 2QQLL 4G9FD 4YDJA 3WDIA 3GSNB 3EO0A 3MRKA 5M7QA 5HPOA 4GFTB 1Q0XH 3NN8A 1T0PB 5JR1L 5DHYB 4F7MA 3IFLL 2C5DC 2J2ZA 2CMRL 1SM3H 4X7CC 3WFCL 3RVVD 3P0VH 4ZSOE 1A7PH 1CGWA 4MNHA 3DURA 2Y07L 1MJUL 3RFZC 2JELL 4P2OC 1MRFL 4D9RE 1X5YA 4YXKL 2WWKO 1C16A 1PG7W 5J3HD 3EO9L 1YNKH 3MFFA 4FHBD 1WVZA 5D7KD 4UNTA 4JFHE 1C08B 4FQLH 4F3FA 5TE7H 3BH9A 3MRQB 2DTMH 2RGSA 3BQUD 5DC0A 1GGIL 1EGJA 2C3VA 3CK0L 5C08B 3BIBX 3HN3A 5EU6D 1KC5L 1S7UB 3MJ6A 4M1CC 5DZLA 2R2BA 3VFOA 5HGGS 3VWJC 4GRWH 2XICA 3VGHA 4G8IB 3FFCE 5L9DH 4OGXH 2PYFB 3GSXB 5BV7B 1NUGA 5T1DL 3TJHD 3ZYJA 2Y4SA 4IIQB 5DJ0B 4UQ3A 5IP4A 1WZLA 1A9EA 1K8IB 3C6LA 3QPQC 3Q48A 4K9EL 4KRPD 1FFOB 4XBGA 3T08A 3P4MB 1ZHKB 5F7MC 2F8XC 1AGDA 3EYVA 4DAGL 4B0MM 4C56E 2EYSA 2BHUA 4MD4B 4S10A 1U3HC 2F19H 1QNZH 3QIUA 5EN2B 3U2SA 4YDKH 3QG6A 2NY4D 5FOJA 3C5ZA 2DYPA 3BRDA 4V1DA 5EIIB 2PXYB 1S8DB 4P46A 1T1WB 4CN1A 1CT8A 5EZLB 4NN5C 4BKLA 1CFSB 4K71B 4LCWA 5I1HL 1U8MA 3ULVL 5HVFB 1MI5A 4U7KA 5J7CC 5T33H 1U3JA 1DEEA 1JNNL 1JF5A 1MJ7L 4HXBH 4PGDA 3VFUA 1HILB 4YFLF 4N0YH 1JPSH 2W60A 5J11C 5I1GH 1WBXA 4YDIH 5EO1B 2P7TB 3WS3A 3EYOA 3M17A 4GG6E 1ORQA 1J0IA 3FQXA 3RAJH 5FGBA 4EUPG 3HUJE 5FM5M 4QF1A 1R6VA 2DLFL 1Q9KB 4JR9L 1MWAB 1X5JA 2GITB 4JGUA 2MJWA 3FONB 3U46B 3ZDYE 3BKJL 1BWWA 3MRRB 5E6IA 5I8CA 4X7SH 4IOIB 5B4MD 3GRWA 5FYKH 3S6CA 1YYML 2R39A 3WKML 5ID1B 1HWHB 3SKOB 3HE7A 2F8OA 4HH9A 3W0WD 4X6DB 1J0YA 3MV8D 3D6GA 5FYJH 3FQTB 2X09A 1VADB 1Z0NA 2AP2A 2I07A 3UTTB 3MREB 4JRYA 1AQDB 2DJUA 4LLWA 4JHBA 3RWHA 3VH8G 4WI4A 1A0QH 2P48B 4ETQA 3FOMB 2A6JB 4LCUB 4CVUA 4AMKL 3ARFC 5D1QB 5I6XC 8FABA 4GAGL 3O9WC 5EC2B 1QHOA 3FQRA 2D7QA 1SEBA 4X4XB 1ZEAH 4PJEF 3VG9C 3MLPA 3L7FB 4AY0A 4MA3A 2WUBH 2J88L 4JY4B 1YECH 4P57B 4EVNB 2V9TA 5DTFB 1HZHH 4J3OC 5GRJL 5L7XH 3BKYH 1CFQA 1FBIL 3A6BL 2ESVE 4OGZA 2PTUA 4LCWE 4QOKB 5JOFB 4S0SD 5SX4H 2VRAA 4LHUB 4MJIB 1BQHG 4YE4L 5CP7A 4LF3A 5GS2D 5LJYH 2Y36H 4ZPTA 4XVTL 2V2XB 2R4RL 3RI5K 3QIWA 4HMEA 1T7VA 3ZO0A 3V8CA 3AB0C 3QUMB 1YEFL 3KPRB 4U1JB 3WS6C 1P4BL 1VFAB 1A6VH 4F7TB 3UAJD 1HYSD 4ODWB 2DL9A 3ARDA 1BVKB 3O3EA 4N8CH 4POZD 3CZFA 3MJGX 1DLHA 5I75B 2HT3D 4GKZB 5HHQB 5CD3B 2YD7A 4Y2DD 1T66D 4W6YB 5DD6B 2N56A 3DJ9A 4MX7B 3U83A 3QRFM 5I19L 3NA9H 4OJFL 2OMBA 3TIEB 3MCLH 4FABH 4UILH 2FHBA 3RDTA 2J4WH 4QHMA 4MLIA 2KPNA 2XI9A 3S9DB 1J18A 1MCPH 1MEXL 1VFBA 4UINL 2VZ3A 3CXDH 3SOBH 4M62H 2BSED 4XNZB 5IBUG 3IKCB 1UZ6F 1MCLA 4P2QB 5H37G 4JVWA 1UH3A 4P0DA 1IEBA 5BJTA 3FB5B 3LRSA 3RA7H 1FNSH 5E70A 1S7WB 2ZSVA 4OD3H 4G7VH 1DCLA 1IZJA 1JMZA 1JZ2A 3G5ZB 4RGNE 2NX5A 2XTJB 4KK9C 1VKXB 3CDYA 3LS4L 2ENSA 4G9FA 2I9LA 1Z6JT 5E8NB 4L8DB 4YDVA 1JFQH 2O5ZL 4LIQL 5E2UL 4R4BB 4D0DA 3M07A 4K3GA 3STZB 3QFJA 3K80A 3HC3H 4D2NA 2APXA 4U1LB 4WU5A 4HUWB 1QKZH 4UT7L 2RHEA 1CDJA 5L2KD 3WSQH 5IB2B 4R96A 3TV3H 4KFZC 3O4LD 4HV8B 3TVMB 3RHWF 3KPLB 2YC1A 2QQLH 1D9KA 3P73B 4C59B 4AIXA 3BO8A 4LPTA 4NKDA 3ZTNL 4PUBL 5JQHC 3QDJB 5GGUA 5IJKA 1HHKB 1YJDH 5A3ID 1JNLH 5HGDA 1SJXA 4FFYL 3K2MC 2BCKB 4TUKL 2O5YL 4DZBA 1MWAH 2CMRH 5J4MA 3QP3A 3JV6B 3WFCH 3SDDA 2B0SL 4P5KA 4C4KT 1Y18B 2Y07H 2E8ZA 4GW4A 2I5YL 2JELH 3U7WL 5ACZA 1NBVH 3QEGL 4A6YL 1NUDA 3EO9H 2G2RB 3DUSA 3GDBA 4PYHA 4HT1H 5F3HB 3GSRB 5J1AB 1FLTX 1BOGA 2A9ML 3I6LD 1WWAX 1W72A 3SKJL 1L0YA 3LEXA 4S1SH 1KC5H 1NGYA 2P45B 5EDXA 1WUNT 2EDFA 3RVXC 3VI4F 1TPXC 1UB6A 2Q76B 3OKDB 3BEWA 5I1DA 5T5NG 4X7EC 5GGSA 4NDMB 2X10A 2W38A 3U4AA 1XGQB 2ENYA 3QPXL 1KCRL 1MHCA 3QEHB 4K9EH 3JTSB 4BQ8A 1MAML 4JO2L 4MNGE 1MLCB 4Y4KA 1X44A 2OTUA 3IXAA 4DAGH 3EYFA 3LEVL 1ZLVK 1I8KA 2H32B 5BW7C 4JHWL 3N9GL 5H8DA 1CZ8L 3SO5A 4X6CA 1WCQA 5DEGB 2CKNA 1A1OA 4NM8L 4CU6A 3MJ9H 2AJUL 2AK1L 3KXFB 5DJDA 1R3JB 4HWBA 1NDMA 4NYLB 5DK0A 3ARPA 4WUUD 3QFJE 3SO3B 5GJTL 3ULVH 5I1HH