2DM3A

Solution structure of the second ig domain of human palladin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
GSSGSSGFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0992 protein
publication title Solution structure of the second ig domain of human palladin
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dm3A00
3V6ZB 1MF2H 1WGOA 4WWKD 4JJHA 4MD5B 1S9WA 2DWEA 4F15B 2D03L 1JNLH 3SCMD 2PO6D 4U1NB 2DD8H 5F72S 5A1AA 4FABL 1XZ0B 3FRPA 3QDGB 5DHVB 2EE9A 3QUXB 5E99L 4EI5B 5DDHA 2BOCA 4BZYA 3C2AH 1BLNA 1HHIA 3DX7A 3MROA 3W0WE 5A3IC 4NQDD 1CICC 4OZGA 1G9NL 1ZS8A 7FABH 4LIQL 1D5IL 4R4FH 2AK4E 2XKSA 3LN9A 3PWJB 2DIJA 1M71A 3NPSC 4E0RB 3BP6B 4WV1A 1JF1B 1HQ4B 2D7TH 1AI1L 5F9WC 4O2EA 4QHKI 3D18A 1LNUB 1XIWC 5HVFB 3W39A 3SQOH 4HUVB 4JQIL 1YN6B 1I9RH 5GZOD 3GI9H 4E41D 2XN9B 3NACL 4POZC 1ETZA 3WIHL 4FNLH 2F53B 2JJTA 3VXOA 4DZBA 4IRJC 4JM2D 4R3SB 3EFFA 2Y23A 3CJJA 3UJTH 1VACB 1UKTA 2GJ6A 3MRRB 1JYXA 3UTPD 3BDBA 3TNMB 4NFBA 2OCFD 2WIIA 3WNKA 4OFDA 2J4WH 4U1IA 1NBVH 4NO5B 4XBEL 5K9OB 3QDGE 1A1NB 5I6XB 5T1MB 3BE1L 3TESA 3HCVB 2GJZA 3WCYA 2OR9L 5BO1H 2QQNH 3E6HB 5FXCH 4ZOCA 5H2BA 3WL9B 5C2BL 4POUB 1JTPA 4WO4C 3MUGA 2C3WA 4Y16C 5C07D 2LFGA 3AM8A 4JHZA 2G75A 3RWIB 2P8PA 3QHTC 5F3BB 2C7UA 4OFIA 2EDDA 3FFCD 1PVHA 4X9FA 5BVJB 1FJ1A 3T1FB 2F8XC 5AG8A 4P5TD 4Y4FC 1T04B 4JCMA 1DFBL 1JRHI 2XN9E 2ERJB 2GUOA 1KNOA 2F53E 2X1OA 2Z8SA 5C0NC 3DO7B 4KROC 3AXLA 1FFOB 3MRQA 1EO5A 2HJFA 3OJDA 3DX9B 1EV2E 4GAJH 4JDTH 5JOFB 1OW0C 3T77B 4CDGC 4U6YA 1J86A 3VE0B 5HI3D 1GZPA 3FOLA 1LGVA 2GITA 1GAFH 1DBJH 5EOQL 5C0CB 3VG0L 2Z9TA 1U2HA 3HE6C 2EDOA 3MLUL 3V0WH 4Q2ZB 4NCC1 4LSUL 1XGQA 2XA3A 1VENA 3EW3B 1PKOA 1TCRB 3FRUA 3JVGA 4P5MB 4NSKA 4HIEA 2F5AL 1F00I 1INQB 2O26U 1F4AA 3U4EA 5FYJH 2ZJSH 3QHZL 2NY3D 4WU7B 5IMKA 2JF1A 1FZOA 4U0RC 5HVHC 2C1PB 4D9LL 4JO1H 3HC0B 3BWAA 2PTUA 3IXTA 3QUZC 3E1F1 4RRPG 1U8OA 1EFXA 3THML 1KC5H 3L7EB 2B2XH 2BNRD 3U46B 3HRZB 1FGVH 3I2CH 3WFCL 1KELH 1A4JA 2DMKA 3HRPA 5I74C 2R2BA 3GHBH 4OI8A 1NH6A 4IDJL 1EHNA 5FO9A 4YPGA 1MLBA 1U92B 5GS0H 4CNIB 5CD5C 4A6YH 3U83A 5DUBA 3OTTA 1XH3A 1Q0XL 3HAEG 3HZKB 1S5IL 2ZCKL 3VH8G 4F80A 5C0CE 2AEQL 1DP0A 4NWUL 4TOYL 1F45A 1W72A 3LB6D 2P1YA 1A9EB 2QSVA 1CFNA 3FHQA 1GSMA 3PWLB 3NN8A 2QSCH 1MRCH 4OCWL 1CGWA 2DOCA 1IM9B 1KN2L 1NL0L 3QUMA 2EDFA 1EAJA 1I3GH 3BIKB 3CFBB 4N0UB 5GRXG 2CLZA 4OCRL 1U3HA 2Y7QA 4WW1B 1A1MA 5IHLB 3QXVA 5A2LH 1JK8A 3FQRA 4CJ1A 5E70A 4LFHD 3TLRA 5D7LD 4LPCA 4RGND 3X13A 4ZTOL 3WUWA 2CQVA 3LMJH 3P73B 4A6YB 3MA7A 2WSKA 2VR9A 3ZYZA 1CFQA 3DARA 3HI5L 2DWDB 4OI9A 1AD9A 1RIVH 5DJ0A 4G80B 5E5MA 4BUGA 1A9BB 3U36B 5D2NA 2YUVA 5L8JB 4HMEA 3WIIH 4ODSH 4C54A 4MD0A 3ROOB 1U8QA 3HC3H 2Z35A 4ELMA 2OMNA 3QJFA 5JNYB 3U30B 1A7NH 4PJFB 2FEEI 4F57H 5FYJE 3OR7A 2EH8L 1WBXB 3DVFA 3EHBD 5DD1L 4OLEA 2QHRL 3UJJL 1NBQA 3WN5A 5JXAH 1ADQH 3GSUB 1S7VA 2IQ9H 4P46B 2A74B 4O5LH 4N0UE 3W9EB 3MODL 5E2VL 5C0DB 3OXRA 4Y2DA 1YECL 4LASL 2FH6A 4LHUG 4LQ1A 5BV7H 3O41B 2V9QA 3TVMB 1FLTX 3NCJH 2R0ZL 4F33A 1KEGH 5ID0A 1RZ8A 1SY6A 1BM3L 5DURB 3O6FB 4YHZL 2H3NA 3FFDB 3JV6B 2Y4SA 4KZDL 3FQNB 5B39B 3QJHB 1J1OH 1DE4A 1MF2L 3WNNA 2BY3A 2KPNA 4M00A 5FO7A 3NCFB 1QRNB 4HK0B 2DI9A 5GRVL 3KYKH 1JNLL 1BOYA 1G7HA 5CD3A 2DD8L 3TN0A 4F7PA 5KAQG 4HJGB 3GHEH 3W9DB 3CDGB 4PJFE 5IJVA 1LP9F 4XVTH 1A3RH 3C2AL 1FZKB 4R2GB 2ZCLH 3BN9D 3D3VE 4AEEA 2ZP0T 4WHYG 1X5KA 7FABL 2X4SA 4R4FL 4JDVA 2I60L 3EOTL 5CZXD 4NKMB 1DEEB 3SBWC 1TTUA 4PBWD 3BKJH 4D3CH 3UO1L 2VDPH 2D7TL 3STZA 3PDOB 2IADB 1RJYA 4XWOC 3IJHB 2WWKT 5BRZB 3FZUD 4FQ2H 4OFKA 2EXWD 1EX0A 3B5TA 2E9BA 1CXLA 1I9RL 3A6CL 4XCYA 3GI9L 5JHDB 4LPUA 1FNGA 3I84A 5T5FH 1DSFH 4F37F 4IOFC 4YNYA 5GJTL 4WI4A 3UTZA 1DL7H 3UJTL 5JXEC 1QRNE 3OKOA 2R4SH 3C5ZD 3B5HA 4PJBF 3CC5B 1RIHL 4HAFA 2J4WL 2AGJL 3IDGB 1NBVL 3KGRA 3PUCA 1ND0B 5CJXC 3W2DH 1T7VA 5GRWA 1FFPB 2R4RL 32C2A 3ET9F 3TYGH 5IBTH 5DJ6A 4Q97A 3KNBA 2RB8A 5FYLH 3B6SB 2QQNL 4Q9CA 2FWOB 5EBMB 5E4EC 1GIGH 3DRQA 5J13B 4MQXC 2R1YA 3LHPH 4F3FB 4N5EC 1WZMA 4GOSA 1BEYH 4GRLC 4HXAH 3O11B 3ILQC 5BRZE 2NW2B 2H2PD 4QRUA 3PP3H 4U1KB 5JHDE 5KVEH 2B5IB 3IS0X 1EJ6A 4MHHG 1A14H 3KVQA 3MRJA 5CP7A 3ZDYF 3EDDA 1AXTH 2BOBB 3U4BH 2UUDK 4GAJL 1LWRA 2OZ4H 3HB3C 4JDTL 2FECL 3DBXA 4PY7B 1UM6L 3WLWD 1K2DA 3WE6B 3E3QC 5E6YA 4FFVD 1R5IB 1YQVL 3I50H 1YYLH 1I8KA 2OP4L 4U2YA 1YMMB 1DBJL 3G5VB 1ZA6A 2CXGA 1WIPA 1NKRA 1NGXB 4Y1AD 5FAAA 1A2YB 1W0WA 4Y5YC 2WLYA 1DQDH 2OYPA 5J1TC 3IGAB 3MRIB 3NCMA 5FYJL 5J6HA 4UTAL 2IANA 2ZJSL 4F7EB 1B0GB 3MREA 3WS3B 2I25N 3HTLX 3OKNB 5CZKA 2V7HB 3FQUB 4JO1L 4ZUWA 5T1LD 4DWHA 3I02A 3KHOA 1VGKB 3VXNB 2O5XH 4PP2A 3C60B 5ITBH 5FGBA 4IOIA 2H45A 4CADA 1KC5L 1FGVL 1FPTH 3I2CL 1KELL 3QIBC 5D70L 4ZXBD 1YN7B 3MC0A 5SWQA 5JZ7C 4UBDD 5GS0L 3L3KA 3B3IA 5FYLE 2X09A 3KPLA 5C08D 2MPAH 2XXCB 2B4CH 3HE7B 4NO0B 1YMME 3EUUA 5HHOA 3AREA 3S5LG 1Z9SA 5DTFA 2MCPH 3VRLF 3AVEA 5D6DA 3QIUB 5SX5K 3I6GB 4DOHB 4KZEL 2NY0C 1AQKH 1EA9C 4YFDB 2QSCL 2MKWA 1DBMH 4QXTB 1OGTB 4G5ZH 4U49A 2M1KA 5KVMC 4WUKL 5AEAA 3TEUA 4APQD 1JNHB 4GT7A 4M5YL 4YHIB 1F5WA 1I1AA 3O8XB 2VXSL 5EOTB 4K7PH 3IETB 1G1CA 1DQTA 5DK3A 4WEBH 3LMJL 1D5ZB 3RZCD 2HFFB 4J1UA 5DZOA 1RIVL 3OAYH 1E4KA 4KK5C 3QPQD 3EYQC 5DD0H 3QDJA 5DFWH 3WIIL 4ODSL 3LDBC 1U8MB 3SDDB 3ARWA 4OLZH 5F1KC 3TBSA 2KUTA 3MJ7B 1A7NL 4YHPA 4XRCB 5GRYA 4DZ8B 1ZHBB 4PJ9A 5C0AA 2ZSWA 2ZSVA 4NJAL 4DOHE 4MXVE 3VFTA 3SKMB 2WV3A 3QQ3B 5CEYA 1ADQL 1NC2B 1IEAA 1XGPA 4C58B 1MJJB 1WFTA 2EE3A 1DDHA 2IQ9L 5ACZB 5KBNC 4O5LL 5IVNA 3BPCB 1R5VA 1XGUB 4OV6F 3K4AA 3WDIA 5B8CC 5IB2B 1RHHB 3N0PB 4XHQA 4ODTH 2G2RB 3RWFA 1XFPA 1RMFH 3VG9C 5BV7L 1QUNA 4KGLA 4ONFH 4WUUB 1QFUH 2I24N 2OMBA 3VWJD 1KPVA 1MCBA 3L9RB 4BUHA 5CEXB 5IJKC 1KEGL 3DV4A 1S9KC 4PP1C 5I0DA 4PLJD 5KW9H 4QT5B 2KKQA 1J1OL 1G84A 2DTMH 2VXUH 3T65B 3LSOA 1U6AH 4IRSB 3MLTA 2XZAH 4LLYA 3QA3A 3KYKL 4J7RA 5TFSH 5CS7A 4UAOB 2PYEA 4GG8B 3GHEL 3S97C 4B41A 4PBVC 2NPLX 3BSZH 4XVTL 4C59B 5EOCJ 3BP7A 1JPGB 5CILH 4MQ7A 1MIMH 2ZCLL 1ZA3B 3GGWB 4PRPA 1K4DB 1AXSA 4UUJA 4MNQB 3SO3B 5IB1A 5C0JB 1D9KA 3OJVC 3AUVA 3ZT7A 1I7UA 1PDKA 1GGIL 1CLZL 3BT2L 4BZ1H 1BREA 3DSNA 3DROA 3MMEA 3BKJL 3RDTD 4YFLF 1FAIH 1PKQA 2XZCH 4HJJL 4WUUE 4Z0XA 4KJPD 4AQOA 2FYYA 2XIDA 4H8WC 3NTCL 2IPKB 3TO4A 2A0LC 1U42A 4JREB 2Q7YA 4DKAA 5BW7A 1RK0B 3ZKMC 4M93C 1T03H 5T5FL 8FABB 2IBGA 5DJ8B 3FB8A 4LFHG 5J3HD 1WEJL 4U05A 1R24A 5D1ZA 2R4SL 3LIZH 3F6LA 3LKQB 3QUKA 4CU6A 1E0OB 4KVCH 2YBRB 4F7MA 4HLZG 2OX5A 4G8EA 3ARRA 3QUYD 3TYGL 2JJSC 5IBTL 5FYLL 1FVEA 3ZYIA 1JNJA 5FDWA 3ZZ1A 5IBLD 4MNQE 5D1XC 1GIGL 5K9JL 4BQCA 3QXWA 3LHPL 2OSLB 1R3JB 1IL1B 2HJKA 4PPTA 5FM8A 1BEYL 4OAWA 4XHJD 4HXAL 2IAMC 3H8NA 4WY7H 3IKCB 5I1IH 5IKCB 5FUCC 5E6ID 3EYOB 3IFPB 2IQAB 5KVEL 1P53A 4HC1L 4GKZB 2RFXA 3QEGH 3MBEA 5TH2A 3BFOA 1AXTL 4BQ6A 3ARBA 2XNAA 4O51B 5SX4I 2OZ4L 1OTUD 4KI5C 4QHUA 4IHOB 3V5KB 4EZMA 1PZ5B 1IKNA 2DN7A 4X99A 4HHAB 4BELD 1YYLL 4RAVB 4FXKB 3G08B 3GKWH 4RWYH 4MWFA 5JPNA 1ZMYA 5FIEA 3OPZH 2AVGA 2ED7A 5FYKH 4FMKA 1N2RB 1HWGB 1JF6A 4B50A 1TQBB 1DQDL 2V5YA 3WJJC 3ARVA 3BJ91 4O02H 2PYFA 2DMCA 1QQDB 2PXYD 1JPFB 4M1CD 4YQXH 4NN5B 2V9RA 4EIGB 4KJQC 2GY5A 3WMSA 2O5XL 3F7QA 1E6JH 2P5WA 3RWJB 5ITBL 5I71B 3AS2A 1EEZB 1DCLA 5D93B 2J2ZA 4ZFZA 3RIFF 1FPTL 1HH6B 3OZ9H 4U6VH 5EB9A 2GYSA 1ULVA 2VLRB 1AXIB 2J88H 4JFXA 3ETBF 1NUFA 1EBAA 1T4KB 4NRZB 2O5YH 4K8RC 5HHPA 5D71H 4R97B 1MJ8H 3TZVB 2MPAL 4XH2B 2B4CL 2UZXB 1U91B 3OKLA 3QYCA 2MCPL 5TE4L 1HINH 3KPSB 4JPIA 3WHXA 2NY1C 1AQKL 4P3CH 2ZUSA 3IJSB 4R4BA 5HDLA 5HYJA 2W07A 1HHHB 3MV8B 1NAML 5EBWA 4G5ZL 5I1CH 1K5NB 3VGAB 3DMMA 4QTIH 8CGTA 3D2UB 5D7JA 4I0CC 1F6AB 4XPFH 3IRZA 2KZ1B 1FC1A 3OL2A 3MJ8B 4EKXA 2DICA 3PWPB 4MCZA 3ARFB 4WEBL 1LE5B 3ISWA 4ZQKA 4EIZC 1HXYA 2D31B 4LHUB 5I2IA 4OIAA 4U3CA 5KSVB 5E56A 2VLRE 4WHYH 1K8IA 1Z9LA 1UB6B 1X6LA 2NTFB 3DUSB 1FSKB 2VYRE 4I0PD 4RFEA 4N8PA 1KJMB 2J7LA 4NBYB 4U7MA 2EDYA 2YXMA 2E27H 1E4JA 1H15A 2YD5A 4OLZL 3VWKD 1U95A 2QL1A 3ZT6A 5DMYA 1UVQA 4TRPH 1KBGH 3STLB 4XCFH 3LN5A 3QEQA 3KPSE 4JKLA 5HGBB 3MUHL 5EU5B 35C8H 1MVFA 4LP5A 3BP5B 3MV8E 5CJ5A 3H9YA 3K8LA 4MLSA 1QFWH 3N85L 1Y0LB 4JPKH 2HAZA 5DA0B 5F7EH 4ODTL 5KVFH 3T0AA 3BPOB 4GKNB 5I1AA 1RMFL 1ED3A 1T6VN 3B2VH 3NGBB 1HZHH 2E8YA 2VLJD 3VD7A 1G9NC 3WEXB 1KIQB 2QADC 3PWPE 2XKNB 4LOUC 2VIRB 3V6FB 4Y4KB 1TJGH 3WDJA 5KW9L 3IU3B 1K8DB 1G7IA 3I75B 2VE6A 3LS4L 2DTML 2VXUL 4XCEA 1NFIB 2EIEA 4GAYA 1YEDA 1U6AL 3OAYK 2V5MA 5D1QB 2XZAL 4Z7WB 4K94C 1IQDB 3SJVA 4IDLA 3HZVB 2DL9A 3DVNB 1ZT1A 4G7YH 3OJMB 1LDPL 2ARJB 4DKFH 1MI5B 2EDJA 2NXZB 3RUGB 1M05B 5C0RH 5IMMA 3BSZL 2XQBH 1U8KA 3CFDA 4LCCB 2B1AL 5HHNA 4GBXC 5F9JA 1QLRB 4PTTB 2W65A 5CILL 3PHSA 4MAYC 4LSQL 5F3HB 1MIML 1RUQH 2DI7A 3L6FA 2CIIA 1ZEAH 5JPMB 4QWWC 4OGAD 4NZTH 1LILA 2Z8RA 4HKBA 5LGHH 1D5BB 3NIDE 1T20A 5EIIB 4X6CA 2PW2B 4LSPL 3UTTA 4BZ1L 4KQ4H 2ARJQ 5JW5B 3SY0B 3WLBB 1FAIL 2EXYC 1FC2D 2XZCL 3FCTA 3GMQA 3IU4H 4I5BA 1GPOH 4UDTB 1LO2H 4G9FB 5DUPH 5HYSB 1KV3A 2G5BA 1T0NB 4Y19A 3T3MF 5JIPA 1GGCH 1AGDB 2BMKB 3QRGH 3VDCA 5DUMH 3TNNB 1H3UA 1B6DA 4I48A 1T03L 3RPIB 5CGYD 4G6KH 1NAKH 2WBJD 3PNWA 3I6LE 5F70A 3V6BR 1WCBB 2ZPKH 1IE5A 2B0SH 4KU1A 1T1ZB 3HNSH 4Z7WE 4JFEB 3VXQB 1BX2A 3LIZL 2X4PB 5DGQA 2E6QA 4HKJB 2IH3B 4JFDA 1MI5E 2R1WB 1DVFA 5C09B 3GMOB 3RUGE 1HH9A 1WF5A 3E8UH 3DI3B 5JQ6H 4Z0BH 1I1CA 2AERT 4PJDF 4G8GD 4UB0H 2ADIB 1HYRC 3QAZB 4E5XB 5J1AB 2XWBA 2EH7H 2F74B 1Q94B 4NT6A 4F9LA 2DYPA 3V79C 1A7PL 3I3DA 2YR3A 3DYOA 2FH8A 3VI3F 4G9FE 2R29L 3E6FA 2EYRB 4BA8A 3UPRB 4QXGH 2M26A 1T5XA 4NQDB 5HHVH 3QEGL 5K9QG 2NLJB 3MLXH 4CVUA 1EAPB 3VGFA 2KQNA 5E9DB 3UC0L 4KVNH 4XB8A 4GXVL 1EO7A 4Y5XC 4MB3A 4MQSB 4JFEE 2F58L 12E8H 1X5XA 3RWEB 1YPZF 2NY6C 1FO0A 5T1KD 3SKNA 4LCWD 2L0DA 3CFCL 1ACYH 5C09E 3O9WA 4YE4H 4OF6A 4RWYL 4RAUB 3VFNB 3U9UA 2Z93B 4ODUA 4E41B 3OPZL 3F7VB 3VJ6A 3GBML 3ILPB 2NY2B 3Q2CA 5FYKL 1U3YA 4LNRB 2BCKA 4DVBB 4MNGB 1BIHA 3L3IA 3QG6B 4L3EA 2CDFA 4NQXB 4NUJB 1ZLWK 3RU8H 1CDYA 1QA9A 3N1PC 4N0RA 1L0YA 4UIMA 4HUUB 2X1WL 2Y5TA 3OR6A 1E6JL 4Q6YA 3QNXA 3OKMB 1NMCB 2AV7B 4NQDE 1Q9OB 4Z5RA 5I18L 2VAAB 4PLKD 3OZ9L 3O2DL 4U6VL 5E9DE 4XP9H 2J88L 5EC1A 1F11A 5BZWA 2BSSA 4XX1G 5HPMA 3U6RB 2X44D 5C07B 2FO1A 4WU5B 2JCCB 1YJDL 2VL5B 2FRGP 4QNPF 4U6XB 2V5TA 1EO8L 1HINL 5E4IA 4E41E 2BSTB 2BJMH 3HPLA 4Y4HB 4P3CL 1FNLA 5DFVD 4OKVB 1EK3A 3BMWA 4MNGE 1KENL 5I1CL 5HD8C 3QQ9D 5LAXB 4QTIL 3TT1H 3BXNA 4YJZL 1CXEA 2CKNA 5H8DA 1D7FA 4HIHB 5ERWA 2VABA 2DMBA 3IDXH 2NY5C 3C6LA 4TSCH 4U1LA 4NDMB 3QI9D 1P7QD 2X4UA 1MCIA 2ITDA 5CUSH 4F15C 5KVDH 4KKBD 2APFA 3NFNA 3WNOA 1WLHA 4XI5C 3S37H 4NQTA 1EZVY 3SE3A 1BZ9A 1T0MA 2ZWLT 2HKHL 5B3NA 1IAKB 2Y72A 4Z7VB 5EBLB 4JFZH 3SGJC 2C26A 43C9B 5C07E 5TPWH 1AKJB 4NM4H 1GXEA 2JCCE 4AIXA 2UWEF 3B2UD 4KK6D 4TRPL 3Q5OA 5FGCB 1UJTA 2V2TA 5GRJH 4QF1B 4WFEE 1CE6B 1RJLB 4XCFL 3EGSA 4P2OB 3QWRA 1CL7I 2BDNH 3MNWB 4TUOB 4KWUA 2ESVA 4WI5A 35C8L 3H7BA 5IVZA 5IEKB 1P7KA 2YXFA 3IFNH 1UH2A 3REWB 3I6KB 1KB5L 2YD4A 1JMXA 2VRAA 1SMOA 4X0KA 1D6VH 5F7EL 3G9VA 2Z31B 2YZ8A 3GSVA 4MJ6A 4ZNEE 3B2VL 4OZGF 4MJID 1LD9A 5TDNB 4UILL 2HT2D 1UXWB 2XKUA 3HZYB 4U1JB 5C2UB 3AMLA 4W6WB 5E08H 1ES0A 1TJGL 1YY9C 3WXVL 3PL6A 5I6XC 1QD0A 1FV1B 4GMSH 4P2RB 3SDCA 4RMVA 3BZDA 4EVNA 4Z7VE 1Z6JT 3QULB 1ZHLA 1NGYB 1ZVSB 2Q6WB 2ZOLA 4KTYA 1F4WL 1J0KA 3ZDXF 3LEXB 3O6KH 5FGCE 4DKFL 1J8HA 2VXQH 5E8NB 3P0VH 1BFOB 2JIXD 5C0RL 4HWZA 2XQBL 5DMKB 4ZUVB 1E27A 4OLYH 3HZMB 1JTTA 1RUQL 2XY1A 2AEWA 1OB1A 1ZEAL 4PR5A 4NZTL 5FKPB 3T0VA 3MX0A 5C0GB 3B8SA 2ERJC 5LGHL 1OAUH 1T5WB 4HIXH 5DJAA 1BD2A 4LHQB 4KQ4L 4I2XB 3IU4L 5I17B 1GPOL 4ZUSB 1LO2L 1OARH 2A6KB 3CCHB 1ZV5A 3EOAA 3M1BB 2DF3A 3VFWB 4X4XB 5JDSA 3QRGL 4JZNA 1YDPB 5DUML 2A6DB 5FM4A 4OUUB 1A6WH 4G6KL 5H94B 1NAKL 4P2RE 5CBEB 2FJFB 2ZPKL 3RTQC 3HNSL 4NCDA 5DJCB 1LO0H 4HKZB 3INUH 1JGEA 3G5XB 3MFFB 2YA0A 1U41A 1K6QH 2DBLH 5C0IA 3KYAA 3BQUC 5DYOB 4U6HB 1G7MB 1JWMB 5GGSA 3WIFB 4Z0BL 3AAZB 2X1PA 4YO0A 5FOBB 4UB0L 2BVEA 2CLRA 3P0YH 4UQ2B 1B2WL 1I7TB 4C56B 3ZE2F 1VFMA 3C8DA 5BJTA 4I2XE 2CD0A 1J9CT 3GMRA 2JJVA 1IAOA 4XTRC 5D7KD 2LAAA 1HNGA 3KWWB 4QXGL 1T22B 4JE4B 3F7RA 5HHVL 3MLXL 1S7TA 4HCRA 2XTJD 2HFTA 3MV7A 4KVNL 2X42A 5T33H 1PX3A 5C0FA 2YRPA 5EU6B 5D7SH 3RGVB 2DLIA 4PJBB 4ZAKA 4JB9H 3VFMA 1G7LA 1NCUA 3TPUA 4IMLA 4Q9RH 4OBSA 4YE4L 3MR9A 4P4RB 3L3JA 4FFYH 4NZDA 5F1IB 4AQ1B 2F5BH 3FO1B 4M7LL 5EA0H 3MGOA 3VDBA 1U3HD 3ROLA 2ICEB 2YPLB 3FB7A 2Z4QA 4TVPH 1I8MB 1ZHKA 3QEHB 1JFQH 4C56E 1CIDA 1PQZA 2NW3B 3FMGH 3GSQB 4K3DH 3KPRA 3RU8L 3EYFB 1JZ6A 2J5LB 3V5HA 4P5KB 5DVOA 4O2FA 2C1OB 4IEFB 1T0PB 4DUWA 1INDH 3U30C 3C5SA 3MACH 3B9KC 3P40A 2OQJB 5KSAD 6FABH 1JGLH 1RZKL 3JUYA 2H8PB 2NQCA 5ENWB 1PX4A 3C6SB 1GC1H 2XWJB 3DX6B 4FQHA 5EU6E 3WS6C 1UQSA 4PJBE 2E9IA 1N26A 4P46C 3VFOA 1MHCB 2W9EH 3AMKA 3LKSA 3HI1B 2OS7A 4PGCA 1VFOA 4OGXH 4GQ9L 1FLRH 4ELKA 3F5WB 2V5SA 2XA8H 1BOGA 1QR4A 3TVMC 2BJML 2R23B 1A47A 1A6VH 2HWZL 4S1QH 1ORSB 1DANU 4Y2DD 3KXFA 3VXRB 5HPOA 3EOBA 3O6FC 4ELMF 3PGDA 4AEHH 2YPLE 1IQWL 4Y8AA 5GS2D 2NYYD 3BH9B 3TT1L 4UT9H 2ATPB 4R9HA 4U1HB 5DHYA 4JG1L 3IDXL 1FCGA 4J3WA 4AMKH 2B20A 1CK0H 1GGTA 1UADC 5CUSL 1MJ7H 5KVDL 3VXPA 5DD6B 5ALCH 1XF5B 2A9NL 3QXAA 1HXMA 1SQ2N 5I1DB 4NQSB 3S37L 4HKXB 3D48R 2QR0A 3X3GL 1FL6B 5DK2B 1XF3A 1JPSH 2ADGA 3FO2A 4R2GC 1LEGB 4JFZL 4NO3A 5TQ0L 1DQMH 4NM4L 5ESAA 5E8EA 4NFCA 2P8MA 1QKZH 5GRJL 1FDLH 2Y6SD 5KS9A 4TVPE 3GRWA 1CZ8H 2ORBL 4YR6A 5DRXA 2AJSL 3VDAA 3P77B 2BDNL 1F4YH 3PGCB 2BFVH 1VSCA 1C12B 1YNTA 3IFNL 3VXRE 1MCFA 1I1FA 4G42B 2RAMA 4C57C 5K93A 3V6OE 4PRHA 1D6VL 2A6JA 2DQCH 4EN3A 1EUTA 3CH1A 3HMWH 1G7QA 1RJZA 1ZANH 1F6LL 1QO3A 1NLBH 5EUKA 3VFVA 1UKSA 5J9PB 4KDWA 5JW3H 5E08L 3ARPA 1LHZA 3QIWA 3QFDB 4K9EH 3LQZB 4GMSL 2OBGA 5KSBB 4QRTB 4M8QA 5GIRB 3BEVA 1AQDB 4LARH 2YRLA 1N8ZB 3QNZB 4JJ5B 5L2KB 2R56H 3EFDL 3WNMA 3BO8A 5E94A 4M3KB 3O6KL 3BZ4A 3NCYP 5TDOA 3REVA 5J13C 1CT8A 1H5BA 3DVGA 2VXQL 3HG1D 3P0VL 3NIGF 2YD8A 1BBJB 5DQ9A 3VRLE 3KYOB 1A0QH 5CSBA 1AR1C 3ZMRA 3TCLB 4OLYL 4XAKE 1N6VA 1Q9LB 1UH4A 5IW6B 4NJ9H 4HK3J 2B5IC 4X8JA 1KLUA 1IC7L 1OAUL 2HLFD 4HIXL 2BZDA 1HSBA 4JFYA 3DO3A 1M1SA 2X4RB 4K7FB 5AD0B 2HVJA 1A8JH 1OARL 1W0VB 2XYCA 5EUOA 1BWWA 5JIIA 2AJ3B 3LKNA 4D0CB 4NRXA 3H9HB 1ZSDB 4R8WH 1BWMA 4UT6L 4PYGA 5EWIH 2AS5M 3GSRA 3P3YA 4LRIA 3LKOB 4Z7NF 3Q48A 5ICZB 5KSBE 1CFTA 3P0GB 2EYTB 2WUBH 4L4TB 4YGAB 2FL5B 5L2KE 5IM7A 3AB0B 5JLZB 1LO0L 3VH8A 5IUSA 5IEHB 4AIZB 3VWJB 2AJUL 3D85B 3IVKB 1K6QL 3QQ4A 2G9HB 3FRPG 2DBLL 1U8JA 4JFOA 2IAND 5IWLC 3SE9L 4JANA 3C60C 2JB6B 5CMAA 4FFWD 5FDYA 1A6UL 3P0YL 2ZG3A 1KLFA 3B8YA 5DRZA 5JORB 1A6TA 4MVBC 4I3RH 1H8OA 1Z9MA 1C7TA 5T3XH 4JZOA 5D5MA 4G8FB 1AO7A 3UXFA 5ANMB 3CFKB 4JFFA 3HE7C 3OB8A 1O7VA 1DUZA 3L5HA 1KXVC 2WINA 5I1LA 3BW9A 3W5NA 5FA4A 3EYVB 4I3GA 3QIUC 1HYSD 2F54A 4EI6A 5T33L 3ALXA 1WBYB 3TPKA 1P1ZA 3F7YA 1MCPH 3ARED 4L4TE 3X12B 5D7SL 4X98A 1BVZA 4EDWH 5ELIA 4AY0A 4PGBB 3QFJD 5I75B 2NR6C 4FFYL 5CFHA 2AV1B 4M7JH 5T3ZH 2F5BL 1CBVH 1X7QB 3SGDH 3LRSA 5EA0L 5IR1A 4IM8A 4YEEA 1OAXH 1I1AD 1OF2B 3ZO0A 3IAGC 1EHAA 2EDWA 1CIUA 4LSVL 2VDML 4A2MA 2HKFH 3FMGL 4J3SA 1EERB 3DV6B 3K74B 4ORGB 3VGEA 2VLMD 1MEXL 3PABA 1FN4B 3MXVL 5ANME 1INDL 3MACL 2JE8A 4G6FD 4MJ5B 1JGLL 1VESA 2F15A 2ICES 4G6ML 4WRLA 1UJ3B 1NKOA 1GC1L 2D0GA 2RBLA 1P4LB 3P4NA 3SDAA 2CIKA 4RDQF 2GTZB 3ZDZF 4PJ9D 5C0AD 1YUHB 2V17H 4MD4A 4OT1H 5K9KA 4ODHH 2W9EL 1ZLUH 2ADJB 4PRID 4FG6C 1FLRL 4QRPD 3GJFK 4Q6IA 3QEUA 1OP5K 4BKLA 5CJBA 5KSUB 1A6VL 4X9GA 4S1QL 2FO4A 5E24E 2JELL 4UT9L 1RJCA 1C08B 2HMID 5ECJE 5E95B 3FT2A 5EZLA 1WAAE 3FONB 3ARGB 2MQ3A 1CK0L 3P4MB 2GTWA 1JWSB 2W91A 3L7FA 4UAOC 5C9JB 3CNKA 3IDMA 3WJLC 2HTKD 1S7WA 1JRHL 1X44A 2WANA 3BKML 2EDHA 4F7TA 1JZ4A 4CMHB 1Q9WB 3KLSA 3EJYD 5ID1A 3WYRA 2FECI 1JPSL 4P4KC 3PWNA 1XCTA 4PTUB 5GS1B 5T3ZE 4D0DB 1RZ7H 1NCAL 2VQUA 1DQML 4WIQA 1DLFL 1QKZL 1FDLL 3MCKB 2A6IB 1J05A 5GSVA 3MGTA 4PRPD 1CZ8L 1MCQA 3CFJA 3ARDA 4K2UH 1RZGA 4XNZB 1BAFL 4F9PC 4GG6B 1N59A 1F4YL 5F1SA 1JIBA 4JQVA 2FD6H 2FB4L 4JREC 5INCB 1A4KB 4NFDA 3WIHA 3VXMB 2XG4A 4RQQB 4N90E 4MX7A 1HOCA 3MRGA 4FQXB 2DQCL 5IW1B 5I8CB 3K3QA 1YY8B 3G5YA 4PBXA 3HMWL 4QCIB 2MCG1 3ES6B 4PJEA 2EKSA 2X1XR 1NLBL 4PG2A 4J3VA 1T3FA 1S9VB 4LLQB 2MOVA 1JCKA 2R0WH 3WUWG 5JW3L 4EOWH 2YC1B 1KEMH 3MJGX 3UYPA 1A6PA 5D1ZD 4K9EL 4U3HA 4MNHB 3VRJB 3P30H 4OF3A 2R56L 3TFKC 4BQ9A 3MRDA 1C5DA 3VGHA 2JB5H 4P2QB 5DRWA 3SCMA 2PO6A 1CG9B 2UYLB 3BGMB 1A0QL 2ADFH 5C0EA 4X7TB 4M43H 5GSRA 4F8TA 4GG6E 4NKOA 4P23D 1F2XK 4NJ9L 3BVNA 2MKLC 1WC7B 2FR4B 2NZIA 3VU2A 3W11C 3VXME 1VKXA 3PV6A 2P5EB 1CGUA 1OTTD 4RSVA 3UBXB 1CICB 4RMRA 3MNVA 3ECBA 5FF6A 1BQHB 2DL2A 4HS6A 3KHQA 4JZJB 1J10A 1V3MA 1YYMH 3ARBD 1RFDL 1SMAA 4KC3B 4CAGA 4HBCH 4R96A 4YBQC 5EWIL 1X5GA 5SWSA 3R1GH 1NCDH 5J4MA 1AGBA 4JM2A 1TQBC 1QZ1A 3S5LA 4TUJA 4KMLB 3RWCA 1U8NB 4HWBH 2G60H 4P2QE 4X5XB 1YMHA 5LGJB 1UZ8B 4XBGB 4IRJB 2M2DA 1RHFA 3D9AH 4NN5C 3NFPA 1F58H 2GT9B 3FKUS 4B7LA 3KR3H 5GGQH 1T2JA 4OUOA 5I71C 2W60A 3IFOB 4MXWL 3GB7B 3ULVH 4KKCC 5D93C 2P5EE 3ZT5A 1KPRA 2A73B 2H32A 3MRMB 2P5WD 3G6JA 2UV3A 4MCYB 5L7XH 4KKAD 3LKPB 4R26H 5E00A 4R97C 5T3XL 1VFBA 3TZVC 1FVCB 2FSEB 3ZKQD 3OKDB 1Y18A 3KPPA 2CRYA 3RL2A 4F2MB 2HT3C 4N9GA 3NZHH 3QO1A 4Y8DC 1LO5A 1FVDA 4KK8C 4RZCB 3RX7A 2CUMA 2QHLA 2QQKH 4UIKH 4IS6A 4P2YA 2XOTA 3U7WL 3DXAB 1OSPH 2H2SD 3KLHC 4HZLB 3VGAC 5EORH 3CK0H 1A1OB 1T1XA 4NN6B 5HYJD 1J88A 2BXYA 4H5SA 5HYQB 4ZS6C 2J6EH 1XF2A 4M7JL 1VFAB 3U0TB 5HJ3A 5T3ZL 3BP4B 3SKUD 1CBVL 3RKDD 1U9KA 1B0RB 2E3VA 3MV9D 4FMFA 2V2WB 4U1SA 3VFUA 4XPBH 3O3DA 5DJZA 4S1RH 2HKFL 3GIZH 1Y6NR 5HYFA 4UV4H 4BFEA 1FSKC 4L8SB 3LV3B 2Z91A 3WNPA 3BN3B 2R1XB 2W9LA 2VSCA 2AXHA 3BOVA 5IF0A 4LLMB 4MSWA 4ZPVA 3T3ME 4KQ3H 1OP9A 1NJ9B 4TNVK 4NQCB 2OJZH 4LLWB 4MD5A 2Q8AH 5HDBE 2BNRA 2UVFA 4LMQE 4U1NA 5DS8B 2V17L 3QEQD 4ZODA 3WFBH 4EEEA 1YPZB 2YPKB 3DXAE 1XZ0A 4OT1L 2ZUYA 4W70A 4ODHL 4XGZB 3T4YB 5I16B 1EH9A 3QUXA 3UTQB 2ZCHH 4EI5A 3ULVE 2FJGB 4LAQH 2J12B 3SGKA 1JNNH 3BPOC 4M02A 1CD1B 4M62H 5DT1H 3NGBC 5DXWA 2APXA 4QRSB 3PWJA 1GOGA 3RNKB 1LQSR 5A3ID 1Y6KR 3EO1B 3IDJB 2HH0H 1R6VA 4PGEB 3BP6A 1AP2A 3GSOB 4RAHA 1HQ4A 3F6IA 4X5LA 4HWEL 2P47B 2GCYB 4P3DA 4L8BA 1E28A 4HEPG 3VI3E 5EFIB 3PQYB 1RURH 3CIQA 3FHAA 4L29B 1TCMA 5F89A 2F53A 4Z7QF 1FNFA 1XIWD 1KJ2A 2BNQD 1QLFB 5D7LA 1IGJB 1MRFH 2NXZC 3KYMB 3GKZA 4R3SA 1JGUH 2IG2H 4X6EA 3SJVD 4NQCE 4LCCC 1UM4H 1VACA 2WP3O 4POZD 1TVBA 1NDMA 3U2SA 3G04B 5BXFB 1TZIA 2I9TA 1RZ7L 1YPZE 3P9LA 4PRBA 1BFTA 4G43A 4YAQA 4WFHE 1FZMA 2BK8A 4YXKH 1AC6A 3UTSB 1ZLUK 1HKLH 3IDYB 1OAKH 4FQCH 1R3KB 4WI3A 3G6AB 4LLUB 3UTTD 2FD6L 3LEYH 3P4OA 3TBYA 4ESKA 2GK0B 1NGQH 4M8VA 2Y36H 2V2XA 5F3BA 4WO4D 5BQ7B 3SN6N 1S5HB 3PQYE 2HT4D 3MSPA 2VO5A 4MXQC 4IBLT 4RDQG 1X9QA 4JRXB 3MRHA 4J3OC 1WWBX 2R0WL 3MRPB 4EOWL 4XVSH 3BZEB 4X6CF 1CDGA 4GH7B 3IFLH 2RHEA 3P30L 1DVFD 4KROD 5TQ2H 4LDEB 3OB0K 5IB5B 1HILB 4LDOB 3MYZA 3GSWA 3QAZC 3QNYB 5ICXB 4NKDA 1ZGLP 2DS4A 2UWEB 4WWKC 4GW1A 3QI9B 2JK5B 4Q2ZA 5LVEA 3W5MA 4QNPE 4U6TA 3UTSE 1C5BH 2W0KA 4TUKH 4M43L 15C8H 3OGOE 1M6OB 2XFXA 5EH1A 1FZJA 3HE6D 2DWEB 4KRLB 2DYPD 4TPRH 4XP1L 4RGOH 2BRRH 3OJ2C 1ORQB 1X5LA 2Q76B 3E2HC 2E9WA 4JAMA 3HC0A 1E6OH 2BOCB 2BERA 1HHIB 2VXTH 3DX7B 3KDMA 3MROB 5DVMA 3MRLA 4OZGB 1QTYT 4JRXE 3L7EA 1NANH 3HRZA 4YHNA 4M4PA 3FQTB 1M71B 4WV1B 2LTQB 2XY2A 4O2EB 3R1GL 4L3AA 4CNIA 3O9WD 4NKQB 1ZAGA 2VDOH 1H3WM 2UWEE 2IPUG 4HWBL 4MZ3A 1ETZB 4XMPH 5CD5D 1C5CL 1KB9K 4NQEA 3RWHA 3C5ZA 4DZBB 3N9GH 3RRQA 1P84J 2VL4A 2X40A 2EEAA 4ONGH 3D9AL 4FTVD 3UP1A 2GJ6B 1F58L 3FT3B 4V1DB 5IFJA 1M7DB 3KR3L 3ZHKA 2WIIB 3CFBA 5IK3B 4U1IB 3ULVL 3EYUL 5KG9A 3T4AA 4WW1A 1HE7A 1U58A 4IOSD 5L7XL 2WMPA 4OIIH 4I77H 4ZNCD 4LSDA 3I3BA 4OZGE 4M03A 4J3UA 1L4IA 3WKMH 3RWDB 3R4DA 1KGCD 3JV4A 3MUGB 3NZHL 4UI2A 4FQIH 5IG7A 2DQDH 2G75B 4P5TC 2P8PB 1RQ5A 2C7UB 2QQKL 4UIKL 1CLOL 4JHWH 5JNYA 3ULUD 3ZDXE 1NSNH 1OGAB 4KTEH 4D9RD 2GUOB 1KNOB 3CK0L 1P2CA 4OQ1A 4V2BA 1FH5L 3AXLB 2YD6A 2J6EL 4PD4J 3SE8H 2DKMA 3D3VA 2HJFB 3OJDB 1FBIH 2GJ6E 4U6YB 4V1DE 4JGMA 3ARXA 5F9AC 4OD3H 1GZPB 5I8OH 3FOLB 4Y1AA 5C0DA 3L5XH 2GITB 4ODVL 5C1MB 3ULUF 1T66C 3GIZL 4HBQA 4EQ3A 4UV4L 3KPNB 2E7LC 1XR8B 1XGQB 2NY3C 2BY1A 5F6HJ 4YX2H 3DSFH 4NSKB 1QVOA 4HIEB 4M3JA 2X89D 4XPAH 3FFDA 3FQNA 3U4EB 3QJHA 1MY5A 3RIAF 1X3DA 5IMKB 2HJLB 4P2OC 1FZOB 4HUXA 3BRGC 3HKFA 1W0YT 1MPAH 5JR1H 5TE6H 2Q8AL 3FQXA 4HK0A 3BWAB 4IRZH 1VEPA 1DBKL 3W9DA 4ZXBA 1OGAE 1EFXB 2VC2H 3RVXC 4FQQA 4WFFE 2ZCHL 3KYNA 3S8WA 2Z31C 1JNNL 1A4JB 5C08A 1FZKA 4XNYH 4QRRB 5FO9B 3K4DA 3HNVH 1FL5B 4KDTC 3E3QE 3WFZA 2ZUTA 4NKMA 3OAZK 3OX8A 3NBNA 2E7BA 2CDGA 1LK3L 2HH0L 1XH3B 5T1DH 2IADA 3IJHA 3QDMB 2VDQH 1CFNB 4K3HA 1FP5A 1QNZH 4XXDB 1RURL 3NN8B 4U3XA 1BGXH 3BHBA 4XWOD 2W59A 2K3TA 5GGSY 4BFBD 4BZ2H 2AEPL 2YZ1A 4CMMB 4O4YH 5L88H 1MRFL 4GJTB 3DURB 5DK0A 2CLZB 2W0FA 4J3XA 4DVRL 1JGUL 1J0IA 2IG2L 2Y7QB 1OVZA 1UM4L 1A1MB 2VWEE 5IQ7L 1MAJA 2YUWA 4LNVA 3RZCA 1JGDA 2P48B 2EO9A 2A77H 1J8HD 2HG5A 3B9VA 3IXAA 4QGYA 3X13B 4WNQA 1MFNA 1AHWA 5JXED 2Q8BL 1ND0A 1WCQA 4UOW1 5DJ0B 4YXKL 5E5MB 1HKLL 4FQCL 1OAKL 4QRRE 2FLRT 3LEVH 3BI9X 1SY6H 3QPXH 3KPQB 5E7FA 1BD2D 4PJ8A 4Q9QH 4MD0B 1U8QB 3LEYL 4ELMB 4POYA 3F62A 3EHBC 1KN4L 1NMAH 2Y36L 5DQJA 1OD9A 3U82B 3QDME 3D5OF 2NW2A 2PNDA 2FBOJ 5IROA 3WN5B 4U1KA 1P6FA 4GRLD 1S7VB 4G6JH 3ILQD 2AK1L 2EDKA 5I1JH 4XVSL 3OXRB 4Y2DB 1OQXA 4OCLC 4O58H 3VG9B 3K1DA 3BH8A 5TQ2L 1IRAY 2D4FA 5DMJB 2Q87A 3HB3D 4YK4B 2H3NB 3DUUA 3JWNC 5JHLL 4NWTH 2DQUL 3TWCH 1C5BL 2R9HC 4TUKL 4H8WH 4UQ3A 5FO7B 1CF8H 2ENYA 4TPRL 4RBPH 3T3PF 2R2EB 1G7HB 5CD3B 1X5AA 3TN0B 4ELME 4RGOL 4XXCA 4HC1A 2XACC 5IFAH 5HDQH 3VXUD 3FQUA 1UWXH 3RNQA 5C92A 5IVXA 3VXNA 3DYPA 4GAGH 2OZ4A 3C60A 2AEIT 3MFGB 2X4SB 3RDTA 3RGVC 4WTXA 4JDVB 1IAIM 4BFIA 2FIKA 2BC4B 1WUNT 3U7YH 3MV7D 4N0CC 4JDZA 2X4QB 1GGBH 2W38A 3C87A 5B38A 4X4MA 1MCLA 1RJYB 4NN7B 2VERN 3QIBD 3TIEA 3GJEA 4KMTH 1FNGB 4WJ5B 3BUYA 4L3CA 4XMPL 3I6GA 3N9GL 4YNYB 1NC4A 1L7TH 1ZT4B 4ONGL 1EBPA 2J5LC 4QXTA 2NY0D 3UAJC 4UTBH 1KULA 4WFGD 4HWUA 4E42A 3P11H 1UM5H 4XCCL 4OGYH 4Y5VA 3O8XA 4R6UA 4NGHH 32C2B 5E8PA 1MCOL 5DJ6B 4I77L 3D69B 4MA3A 4HX1A 3WKML 5FGSA 2RCSL 3DRQB 4QEGA 3FB6A 4LK4A 5E6IA 4FQIL 2DQDL 4HFUH 3SDDA 5DJ2B 1ZT7A 5E03A 2DLEA 4JHWL 4KK5D 1NAMA 1A6AB 3EYQD 4X7SL 5B4MD 1HHGA 4KTEL 3V6OC 3NIGE 4J3TA 3SE8L 2APTA 1GC1C 5D6CA 3DBXB 1FBIL 2O5ZH 1UWGH 1K9TA 4WGWB 4OCMC 2YSSA 1K2DB 2ZKHH 1XGUA 1J1XH 5L2JA 5IB2A 1RHHA 4OD3L 3D6GA 2CK0H 1I8KB 1ZLSH 1MFAH 3L5XL 2IJ0C 2DBJA 4JGJA 4ZFFA 1V3JA 4ISVB 5IW3A 4CN4A 5JIKA 3VXTB 4GKSA 2VZ1A 1QEWA 1MFBH 3Q3GB 1W0WB 4YX2L 3WSQH 3H0TA 1C1EL 2PXYA 3RBSA 4H1LG 4XPAL 2AXGB 4QT5A 5J6HB 4PS4H 1RUKL 1KYOJ 3CVIH 5JR1L 5TE6L 4Z7NE 4YHOH 4IRSA 4CN6A 2DKSA 4ZUWB 5IQ9A 3I02B 1F8TH 4DW2H 4PP2B 3F7PC 1V7MH 5FUCE 1RZIA 4LLDA 4JFHE 3VI4F 1WWCA 1G6VK 4HGWA 1J0HA 1GOHA 5EIVA 4IOIB 2VC2L 4CADB 3VA2C 3GSNH 1IAMA 1SVZA 2A83A 4XNYL 4OZHA 3OKKA 4FRWA 5CZVH 1ZA3A 5SWQB 1YEJH 3M8OH 3MRKA 2P42B 4HMCA 3CAFA 4ZO8A 1GGYA 4ZUUA 5KS9F 4UDUB 5HHOB 5A43C 5KZCD 1CDUA 5MHSD 1QFHA 4M6MH 3O4OB 2VDQL 4M1GH 3O6ML 1UZ6F 1QNZL 3QIWD 4LVHB 2BHZA 2X4OA 3CDYA 1U2CA 1DQJA 1BGXL 1L0XA 1R3HB 4BZ2L 5F7KC 5I1EH 5L88L 2A0LD 4NUGH 2PETA 3PHOA 3PE9A 3HUJA 5DC9B 3ZKMD 4LAJH 3GSNB 4M61A 5IHUH 1B88A 3NABH 5LWYH 3NIFF 3QPQC 4MLIA 3TM6A 3LPFA 4J1UB 4ZPTB 3HR6A 2ITCB 3VRIB 1S7QB 4K9EC 1L6ZA 4DN3L 5E8OA 2PTTB 3LEVL 3QDJB 1SY6L 2IWGA 1N7MH 1H3PH 2OXHA 4ENEC 3TBSB 4YHPB 2BVOA 1NMAL 5HHOE 4XPTH 2ZSWB 5D1XD 2ZSVB 1PZUB 4LGPB 1LE9A 3GUTA 2EIZB 2ZOKA 5DEFB 2EO1A 5CEYB 3PJSA 1IEAB 3AB0C 3TJHC 2IQAA 2MTPA 1QP1A 4G6JL 2D0HA 1R5VB 3MRNA 4JHBA 2AJXH 3VWJC 5I1JL 4AL8H 4CJ0A 4O58L 3RWFB 2VDKL 4W6XB 2C4XA 2YD3A 3TGXA 1KPVB 5FO8A 5EUOF 4HHAA 1XMWA 2COQA 3RVWD 4RAVA 5FV1L 4KI5D 2NXYB 3CFEA 3WXWL 2QKIA 5HHMB 2F9BT 5CJ8A 1RIUH 4NWTL 2YPVH 3TWCL 2P4AB 2WLZA 3O3EA 4P57A 1N2RA 4H8WL 3LSOB 1YZZA 4KAQH 1CF8L 3QDJE 4YGVA 3MLTB 4LLYB 3MRBB 3QA3B 2R2HA 3Q6GH 4M7LT 5DRNA 2EDBA 4JQXC 2PYEB 3QXDA 2ILLA 4YBLB 5FUZH 5D7IB 5FV2A 5HDQL 4CU8A 4X83A 1AO7D 4GBXB 4GAGL 3BP7B 1PEZA 4MAYB 2DQTL 1QPXA 3ESVF 1TENA 1S78D 3K46A 1E4XH 4WW2A 1QFPA 1AXSB 1EEZA 4UUJB 3GMMB 3X14B 1RUAL 1D9KB 2F54D 2Q3ZA 4KJPC 1I7UB 1UA6H 4RWHA 2NY4B 2VLRA 3N1FC 5C0BD 1GGBL 5I75C 3RWGA 3DROB 3HS0A 1PKQB 1MOEA 2FYYB 3QCUH 4ODWA 3TO4B 4RFOH 4GO6B 4X4ZA 1QSEA 1KTRL 4HS8H 4KMTL 5DSCA 1YQ2A 4K8RD 1U91A 3BYTA 2Q7YB 4ZOBA 2YOCA 3NVQA 5HHME 4LHJB 3FB8B 5FK9A 5F8RC 1L7TL 5EOCL 1HHHA 3NAAL 4JR9L 2NY1D 3VXSA 3D0VA 3QUKB 5JDJA 3QUYC 2PYEE 4YHYB 4UTBL 5H35A 4KV5E 5D7IE 5EZIH 3P11L 1UM5L 1OP3K 3RY6A 3P9WB 4G8GA 4L4VD 4D2NA 5I0ZA 3O2DA 4LU5H 4G8EB 1UJ3C 1LDSA 4RCAA 5B3JF 5SWZA 1FVEB 4JFPB 1GJIA 2VXVH 1I3RA 1W8NA 3PWPA 3K8KA 3ARFA 1VFUA 3RGHA 1S7UA 3SDAD 2LU7A 1CDCA 5IBUG 1UB6A 2HJKB 5FKAB 3BD5A 1PKQE 4OAWB 4MDIA 4HFUL 4AEIL 3SEPA 4KUCF 4NZJA 3STLA 2CJUH 3MBEB 5TH2B 5I30H 5I8EA 5HGBA 2BSRA 2RGSA 4X6DA 1S7SA 5EU5A 5T1KA 2XNAB 4LCWA 3ARGC 1U8HB 3SOBH 1SJHA 5J6GA 3GM8A 2O5ZL 3BP5A 1UWGL 4QHUB 4UNUA 4FQJH 3SDXA 4M5ZH 1J1XL 1Y0LA 3MLZH 4X99B 2DDQH 1MWAL 3J8F7 1ZLSL 1MFAL 1H3VA 4MWFB 5JPNB 1UENA 2QBWA 1N64L 3R8BB 3VCLA 1MFBL 1KJVB 5GS1C 3WSQL 1FNSH 1U8PA 6CGTA 4Y4KA 4UOW0 4X6FA 4QOKD 5TF1L 3I75A 2CGRH 5FM5M 1QSFA 2QADD 3CVIL 4YDLB 1CGSH 3QSKB 2X4TA 1JHKH 4YDVB 5D1QA 3EIFA 4XNZC 3K1KC 1BJMA 1F8TL 4Z7OF 4DW2L 1F13A 1V7ML 1MI5A 1KB5A 3GMLA 3JV0A 3B9EA 4HWNA 3RUGA 2ICWA 4ZFZB 3S7GA 1QBBA 4P9ML 1BIIB 4RISH 1EDQA 5FECB 3GSNL 4YHLH 5CZVL 2WBWB 3CXDH 5JPMA 3AS0A 5HHPB 1YEJL 3M8OL 2DQGH 3L95A 4HUWB 1IC4H 4KY1H 5JW5A 3OKLB 4UDTA 4MYWB 4XBPB 3WHXB 4JPIB 4M6ML 2OL3L 5HYSA 5MP6L 4M1GL 2WWKO 3DTXA 1F3DJ 5EBWB 5MEND 5HVGB 3DMMB 3RPIA 5I1EL 1DJSA 3TIDB 5D7JB 4NUGL 1WCBA 5JMOC 5IHUL 3MXWH 5ISZD 4PJEF 2X4PA 3NABL 5LWYL 3CSBA 4HKJA 2GAZA 1Q1JH 3GMOA 2LQRA 4I0PC 4ZQKB 1IZKA 3SDYL 1IGCH 3VWKC 2L7JA 3ZTJG 2HRPH 4RFEB 1T83A 4FA8A 1N7ML 4JZJC 4G8IB 2F74A 4FXGB 1CTOA 1N6UA 1UVQB 2DLGA 2WIMA 4NYLA 1S9XA 1CFVH 1A7RH 3LN5B 3QEQB 5BVPL 4M7KH 2FX7L 4HQQH 1I1YA 3OGCA 5HDOA 1CWVA 2EYRA 4K94L 3LH2L 1OPGH 5D96B 1JYNA 4HLJA 1QBMH 4NBZB 5I19H 3OG4B 5SWSD 1FL3A 2AJXL 3JWOC 5E9DA 4MJIA 4AL8L 5D8JL 1YEFH 2J8UB 3ULSA 5I1AB 2PW1A 3NPZB 3VFRB 2AAVA 1ED3B 4XZUA 2ZUVA 2B8OT 1LO4H 4O2CB 2EECA 5A16A 1K3ZA 2R0LH 4YC2C 2Z93A 4WVRA 1V7NH 1Q8MA 1G7IB 1RIUL 2NY6D 2YPVL 4YZFF 1JWUA 4Z18A 3DGGA 2H6PA 2E8ZA 1UACL 4KAQL 4GAYB 1YEDB 5EU7E 3Q6GL 2JIXA 4P48A 1KXTB 4JM2F 2FGZA 3AY4A 2NX5B 1TPXB 1BECA 2OI9B 3QEQE 5IMMB 3CFDB 1U8KB 1AC0A 5HHNB 5F9JB 2W65B 3ZKXB 5KVGH 3L6FB 3OKMA 1Q9KA 1A7QH 2ATKA 2AV7A 3DETD 1E4XL 1Q9OA 1JZ3A 4HKBB 5GRUH 3ULVC 4K3GA 1ROWA 4NN6C 3G6JF 2J8UE 1NPUA 5DEZA 3GMQB 3FCTB 4I5BB 2BRQA 4GRWF 2ED9A 2NZ9C 3ZL4H 3QCUL 2I9LB 2JCCA 2WAHA 2G5BB 3W0WD 1I8LA 4RFOL 4Y19B 1XF1A 2WBJC 4F7CA 3TA3A 2R15A 4I48B 3S36H 2AK4D 4AM0B 3WO4C 5F1OB 2XI9A 1DUYA 4Y4HA 3PNWB 1QYGH 4L8SC 4FZ8H 3RTQB 4TVSa 4C83B 3O6LH 1BX2B 1IC5H 4NPYB 2P43B 2E5EA 3BMVA 2NX5E 5I9QC 4JFDB 4KJYA 5EZIL 1LO3L 2E6PA 1DVFB 3NZ8A 4I13B 2DAVA 4XNMB 2V5RA 4IMKA 3OKYA 1HH9B 4XP6H 2Z92B 3PWVA 3U48A 5GGUA 1YNLH 3BQUB 4PB0H 5HD8D 4JRYB 4NDMA 3JUZA 3TH2T 5C6TL 3UDWC 1QR1A 2VXVL 4RGMB 4J8RA 1FO0H 1NCWH 3RX5A 1WICA 1ZK9A 4NT6B 5IFHH 4PJ7B 5F21B 1IAKA 5KOVC 4Z7VA 4XI5D 2YS4A 3H3PL 3QDGD 43C9A 1AKJA 3QUXD 1JPST 3E6FB 3QXTA 4TSBH 4EI5D 3JXAA 1T7YA 2FBJH 2NCMA 4HD9A 1II4E 4X6BA 4JY6A 4Q9BA 4MS8C 4Y19E 2YMXH 1OL0A 4I3SH 2CJUL 4XC1H 5I30L 3EO0B 1DLHA 4TUOA 5DD3H 4H20H 5D2LB 3SOBL 3REWA 4FQJL 4HIIB 5INDB 3IT8D 4M5ZL 3C5JB 1FO0B 3C08L 2DDQL 3SKNB 4JFDE 4WI2A 4YUEH 3Q1SL 1UCBL 5BMFH 2IBZX 3O9WB 4S10A 3LQAH 1WTGT 4JKPH 1N6QH 2XN9D 2VQ1A 3BRFA 2HFEA 4ODUB 4JRYE 2F53D 1IZJA 4U1JA 1FNSL 2BCKB 3O81A 2XG5A 4L1DA 2DLTA 3L3IB 2XPGB 1A7BA 1FCCA 4TYUA 4L3EB 5JIHA 3T0WA 5DR5H 4PJ7E 2CDFB 2CGRL 4LLAA 1CGSL 4JEGB 1JHKL 4PFEA 3IDYC 4OLXH 1DQLH 1QA9B 1SM3L 5KSAA 3WFHA 3JTTA 4L8CA 5E8DH 4JY5H 2Y5TB 4LSSH 3QNXB 5EO9B 5E8NA 3B9KB 5IB4A 1UC6A 3UMTA 4Z5RB 4DGYH 2OR7A 4RISL 5DMKA 2JJWA 3T09A 5AWNL 2NY5L 5EC1B 5SX4H 1F11B 2BVPA 3MOBL 5D2LE 2BSSB 3CXDL 4L9LA 1PG7H 5DF0A 5HPMB 3CVHH 5FKPA 3FO0H 2DQGL 5DZLA 2BY0A 3OAUL 4JY4A 4OZIB 1IC4L 1SEBA 5DFVC 2AI0H 4I2XA 5I17A 1RI8A 2RR3A 4KRPB 1CS6A 3CCHA 3HPLB 4E9LA 3Q6FA 4PJ5B 3H9SA 3EYSH 4Z77A 3R06A 4NNYB 3EO9H 2WUCL 1NCCH 2AABH 4L3EE 3QI9C 5H94A 2D7OA 3BXNB 4KKBC 1SHMA 2QTEA 3ARTA 4XCNA 5ERWB 2VABB 5FHAH 1SEQH 1WFUA 1MAMH 5C0CD 3C6LB 4PV9A 4U1LB 2C3VA 1CLYH 1MFCH 4YHMH 4NOBA 3CVHB 3TBVA 4PUBH 3IDUA 3L3DA 4CDHA 3C9NA 4MAUH 4U1MB 3QT2A 1P9MA 1J5OH 1IGCL 1BZ9B 1T0MB 3BYYA 3F65A 5IMLA 4KK6C 1CGTA 2HRPL 3AAZA 4X7DC 4B5EA 5F6IB 2AXJA 1YEEH 4YDIH 1R3LB 4HGKC 1T1YB 1FQ9C 4C56A 4OZIE 2CPCA 2V2TB 2DKUA 2F8OA 5J11B 1A7RL 4GLRH 3EGSB 4OCSH 4WV1C 2LTQC 1HWHB 1G7JA 4X8XA 5AZEH 2ESVB 3H7BB 5IVZB 1JPTH 3SQOL 1T22A 4YXHH 4HDIA 1QBML 4PJ5E 5I19L 4XTRD 4FNLL 3L3HB 4X0KB 2JJTC 2HT2C 3ELAT 1HHJA 3O4LB 3GSVB 4MJ6B 1F42A 5FYJD 5ESVB 4ZDHA 3PDGA 4TNWK 3GMPA 4OCNC 3B9AA 5TF0A 2X1QA 4NQED 1RAMA 1LO4L 2XZQH 1NFDB 3MNZA 3GK8H 5GRVK 5LBSH 4TTDD 1ES0B 4PGDA 1XCQA 1IM9D 2R0LL 3PL6B 1WT5A 1V7NL 4F58H 3S96A 3SDCB 1LMKA 3HG1A 4EVNB 5BO1L 4L1HA 1ZHLB 4NNPH 2ZOLB 5H37G 2YPLA 4AT6A 1IEBA 2G5RA 1CVSC 4ZFGH 1CFBA 2N7BA 2PKDA 3E0GA 1QFOA 1J8HB 3ZKNC 5GS0D 1IGYA 3AM8C 4HWZB 2WZPD 3T0EA 4M48H 1E27B 5J0BA 2ESVE 5KVGL 2AQ2A 1OB1B 1A7QL 4PR5B 3KS0H 3SGEH 3TYFB 1NEZA 3GJFA 4XPHH 5GRUL 4NNXA 5DJAB 2CK2A 1TNMA 5EZJA 2OJEA 4OCXH 1KCUH 3O4LE 2BVTA 5C9KA 1CFSA 4EDXA 5HHXH 4YIQA 1NFDE 5JDSB 3D3VD 1GAFL 3S36L 5JOPE 4K23H 4JO3H 3V0WL 2GW5A 1VERA 1P69B 1KLGA 1ZTXH 4DN4H 3U0PA 1ORSA 1QYGL 4PJCA 4OQTH 4FZ8L 4A2LA 4OV5A 1GCFA 3JVGC 3V7AG 1IC5L 3TVMD 2AP2A 1K3IA 1JGEB 2ATPA 1J8HE 2OTWA 5J06A 5DURD 4XP6L 4ERSH 5C0IB 5F96H 1YNLL 2VWEC 5E6ZA 5GGSB 3NCBB 4HFWB 1OCWH 3EJZC 1XF5A 1NCWL 1QRND 2CLRB 2GY7B 2B2XL 1CQYA 1QHPA 2VISA 5IFHL 3UBXI 3TO2A 1G9MH 3GHBL 1LEGA 5EZOH 4ETQA 2DM2A 2AXFB 3GMRB 5EO1A 4RFNC 1IAOB 3RI5K 2FBJL 4A6YL 1KTDA 4R2GD 3HR5A 3RAJH 2YMXL 5EIQA 1KIUA 4I3SL 4N9OB 3WHE1 3F58H 2PF6A 4P59H 1S7TB 4AYFA 5DD3L 1FFNB 2BNUB 5AUMA 4HF5H 5C0FB 3QFJA 1MRCL 4RIRB 2APBA 3D0LA 3BPNB 2K7PA 4ZAKB 1WWAX 3VFMB 3TPUB 1I3GL 3PGFH 3FN3A 3H9ZA 1MCSA 4YUEL 3AU1A 3MR9B 5JHDD 1U3HC 3L3JB 3LQAL 4JKPL 1N6QL 1JN6A 1ZXQA 1CLCA 3MGOB 3CSYB 5HGHA 4Q58C 5ALBH 3ROLB 3UCRA 5GGRA 1ZWIA 2Z4QB 3KPOA 4I9WE 1ZHKB 3ZTJH 2WW8A 4AENA 5KSBA 5CKGA 1PQZB 3PHQA 4LSRH 3KPRB 2IMNA 2X7LB 4X5WB 1NQBA 4OLXL 1DQLL 4OF7A 4PY8J 3QNZA 3U7AA 3V5HB 4O2FB 4AIOA 5E8DL 4JY5L 3HC3L 4CVZB 3H3BC 4N0FA 4N8CH 3C5SB 1UFUA 3CDCA 4F57L 2YN5A 2VDLH 3KYOA 3ME0A 1T7WA 4PJ8D 2D7QA 1L7IH 4ONOA 4LMQI 3TCLA 2E7CA 3S4SA 3R8QA 2HP4A 4PRIA 5JXAL 4ZSOA 1PG7L 3WN5C 3CVHL 4FQHB 3DIFA 1AR1D 3KPMB 3FO0L 4QRPA 1UQSB 1UWEH 4ONHA 3LRHA 1UB5A 3VFOB 3GBLA 1HSAB 3LKSB 2X4RA 3O3BA 2XT1B 4PGCB 1PLGH 4Y2DC 1IGIH 4ELKB 1W0VA 1BOGB 2YEZA 3NCJL 5CEZH 2HN7A 5D9SA 3CZFB 3KXFB 3EOBB 3EYSL 1YEGH 3PGDB 4YK4C 1ZSDA 3EO9L 3S35H 4MB4A 1NCCL 2AABL 3GRWH 5FYLD 3LKOA 5ICZA 1I3VA 3CGTA 4R0LA 1ACZA 3KPRE 1I4FA 2EYTA 3O45B 4GXUN 5DHYB 5LG1A 1YMMD 1IMHC 3BEWA 1SEQL 5FHAL 1CLYL 4P0DA 3VXPB 4YHML 5IEHA 5EPMA 4MZ2A 3TN0C 4PUBL 1HXMB 1B3JA 4MAUL 1J5OL 3VMPA 4YDJA 1PYWA 5FYJU 4PJXA 2QR0B 1A3RL 4WHTA 1XF3B 4P4KB 3FO2B 4P9HH 4Z95H 1BBDH 1TJHH 2JB6A 1YEEL 4YDIL 4HH8A 5CBAA 5E8EB 2P8MB 3C60D 4UT7H 4F8QA 5IT2H 4OCSL 4D3CL 5A2KH 4YR6B 2VDPL 5DRXB 4KKLC 2UZIH 2VZOA 4JVUA 1OD7A 4NN7C 4MVBD 1S7RA 4FQ2L 1ONQA 4YXHL 3KXFE 2H41A 1I85A 1DSFL 4PRHB 2A6JB 4QHKJ 1TTGA 5IVXF 3HE7D 4RMTA 4EN3B 4I18A 3CH1B 4S11A 4Z7UB 2VLLA 1DL7L 3X12A 4IIQA 5HBBA 1RJZB 1QO3B 3QIUD 5F7UA 5EUKB 1N3NA 3VFVB 2XZQL 1RVFH 1NC4D 3GK8L 5LBSL 4PGBA 2AV1A 3KJ6H 2VH5H 3W2DL 4GW5A 2GKIA 5DMIH 4WCYH 1TLKA 3GM0A 3TBTA 4ALAH 4FHBD 3NCCB 4M8QB 5KTEH 3FTGA 5CEZE 2NR6D 4NNPL 4UINH 3O8XD 3BO8B 5E94B 4O9HH 3BZ4B 5M94B 5TDOB 4P23A 1FIEA 3DVGB 4KDVA 3LVEA 1WAAA 4Q74A 5DQ9B 3OXSA 2FHFA 4M48L 4ORGA 1UT9A 2XQYK 3O0RH 3N1QC 3HAEH 2H1PH 4S0TD 4MJ5A 2VOTA 3BJLA 1A14L 4X8JB 4XPHL 1KLUB 3OF6D 4ZTPH 3SDDD 5I73B 2P7TA 4PRHE 1HSBB 4JFYB 3ZTNH 1P4LA 4OCXL 3R0NA 1KCUL 3RVTC 4OFYA 1GVIA 2HVJB 4Z7UE 3U4BL 4G9DA 1ZKAA 5HHXL 1UYWH 1F4XH 4LEOA 5EG6C 5DI8A 5CHNA 5EUOB 1MHHB 5MHSE 1OHQA 4QXWA 3LKNB 2ADJA 4NRXB 2RJMA 3I50L 1NC2D 1V8HA 1WZKA 4K23L 1AY1H 3GSRB 1G6RA 2K1MA 5KSUA 1CFTB 4I4WA 4DN4L 1ZTXL 4HPOH 4LBEB 4OQTL 5HGGS 4NO2A 4FG6D 5IM7B 5E2JA 2VUOA 3C09C 3HAEB 4WUUD 3VH8B 4AK1A 2MQ0A 4TSAH 2ZUQC 1C08A 4X80H 1SYSA 2P46B 3QQ4B 5T5NG 4ERSL 5F96L 1G7PA 1U8JB 1GHFH 3P4MA 4JFOB 2X70A 4WGVB 3ZSSA 1D5MA 1OCWL 2MMXA 4JO4H 5F97E 4KK9C 4JANB 5CMAB 4ZO6A 4IRSD 5FGBC 2R2CA 1MHEA 3PP3K 5AAMA 3IB4A 1QSVA 5EU4B 1LK2B 1A6TB 2ZNXA 1G9ML 4PTUA 4R4NC 2DQEH 5EZOL 1FFRA 1W2KT 3ZE0F 5EUOE 4JZOB 1JZ8A 4PV8A 2A6IA 4JFFB 1UEYA 1DUZB 3AREC 3F58L 5I1LB 4MNQD 4J2XA 5DJYB 4P59L 5FA4B 5D6DC 4GG6A 5BS0B 5HI4C 3JWDH 4XMKH 3EAKA 2F54B 5FA3A 4EI6B 3O4OC 5MI0B 1J7VR 4WDIA 4HF5L 1DBBH 1P1ZB 1Z9OA 4LVHC 1DBML 3OKEB 3O2VH 2D4DA 4LCUA 1A4KA 3VXMA 4CBPA 4HG4J 1PY4A 4FQXA 4NZUH 5IW1A 3MV9A 2PR4H 3N1GC 3I85A 2BY2A 4LDLB 1YY8A 4OZHF 4XWGH 2WQRA 3ES6A 3UZVB 4K7PL 5DO2D 2MHAA 1S9VA 1UGNA 5IR1B 1MELA 5ALBL 5HTSA 1NANI 1XF4A 2I27N 1V05A 4CRPA 4JPVH 3T8XB 4FZEH 5DEGB 3VRJA 1E4KC 5DD0L 3SE4A 5JTWA 1FE8H 4LPWA 2Z0BA 3J7HA 3QQNA 1PEWA 1A6ZA 3PABB 1BFVH 4P2QA 4JFFE 1NCAH 3HN3A 2H26A 1P5VA 2UYLA 2VDLL 4PJ9C 4HT1H 5EO0B 1L7IL 5BS0E 3HUJF 1Z5LB 4ZOEA 1FYTB 2F54E 3P4NB 3SDAB 2CIKB 2HVKA 2FR4A 5C3LD 4MD4B 5HGDA 1G9EA 3GSXA 3SKOA 4HSQA 4FQLH 3MA9H 1PLGL 4QTHA 3HNTH 3UBXA 3ZLQC 3L3GB 1IGIL 1M7IB 4RNRA 1CICA 1A02N 3W11D 4OD2A 4ONFL 1IT9H 1BQHA 3QEUB 1QFUL 1H0DA 3QH3B 4Q6IB 4BKLB 5B3JE 1O7SA 5CEZL 1HHKA 4MDJA 2L4OA 3DYMA 3LOWA 2FO4B 5FUOH 1YEGL 3S35L 2NXYC 3GRWL 1P5UA 5B39G 3MV11 3BZFB 2YHGA 4Z8FH 1MH5A 1MY7A 1XIWA 2HTKC 3BAEH 3S3SA 2BNQA 4YBQD 4JQIH 2K7QA 2GTWB 5TFSL 1U8NA 2VDNH 2FEDD 3IDMB 4X5XA 4YBLC 5KANI 2VKXA 5LGJA 1S7WB 5MEOA 3CH8A 4Z6AT 4IRJA 4F7TB 3CX5J 4ZO9A 2A1WH 1KCVH 4UU9A 2GT9A 1FYTE 4OCYH 1TZGH 4P9HL 3PWNB 4Z95L 1XCTB 1TJHL 3IFOA 3GB7A 2AW2A 3LQMA 1CGYA 1D9KC 2A73A 2NY4C 4UT7L 4MCYA 1J05B 5IT2L 5GSVB 2YWZA 3MGTB 1EUUA 3LKPA 3CFJB 2OR9H 3ARDB 2CDEA 1RZGB 4N1CA 2EE2A 1N59B 3DX8A 1FVCA 1H3TA 2FSEA 2ICCA 2VLRD 4HJ0C 5C2BH 2QEJA 1AD0A 4WO4A 3TO4C 4Y16A 4F2MA 3QO0B 4OF8A 5BW7C 3TZVD 5FYKD 4RZCA 1HOCB 4OIBA 1QSED 2HT3D 3G5YB 3TJEH 25C8H 4D9QE 3X17A 4PJEB 4KK8D 4HUKB 3EOYG 3KPSD 4Y4FA 5E5UB 4WW2F 1T3FB 1RVFL 3QCVH 1EXUA 4YHYC 4KVCL 2IALA 2GSGB 3LCYA 5HYQA 3QDHA 3MV8D 5IB3B 3KJ6L 2VH5L 2DQIH 3U0TA 3VXSD 5DMIL 3KLHD 1OW0A 3MGAA 2CXKA 4WCYL 1REIA 2XQYG 4ALAL 1F90H 1LVEA 1B0RA 5KJRH 4P99A 4X9BA 1KOAA 4UINL 4ZS6D 1PGRB 3MRDB 4O9HL 1C5DB 4KTDH 5E2TH 5EOQH 4WWKB 1MREH 4BK5A 2AJVH 3HE6A 5DRWB 5SWZD 4QKXB 3SCMB 2PO6B 1KPUA 3PWPD 3ARFD 3TV3H 5C0EB 2X9YA 5GSRB 4UV7H 4DQOH 1NGPH 4WY7L 4NKOB 4H1LA 1JHTA 5I1IL 4U7SA 5F7DA 4LLMA 1OTTC 5DC0A 3BVNB 4WHDA 3WHE0 4WTZA 4X9IA 2X2YA 4WI8A 4ZTPL 3E2HB 3MBEC 3PV6B 4NQCA 2HA1A 5CSZB 1X4XA 4LLWA 2E9JA 3ZTNL 2D3VA 3QUZA 3KLAA 1VDGA 2FHCA 4QY8A 5DS8A 3MNVB 5FF6B 4PJEE 1UYWL 5L8LB 3PWUA 3THMH 1SYVA 2UY6A 4XGZA 5I16A 1IKNC 2Y07H 3FAXA 2J1KA 3WFCH 4X7EC 3GKWL 4R96B 2ED8A 1AY1L 4J6RH 4GRWH 3BKYH 1AGCA 4QRSA 5BCAA 3RNKA 2N7AA 1AGBB 3UROR 4JM2B 4HULB 4O02L 3S5LB 2FIRT 4TSAL 5DGRA 4TUJB 4FTVA 5DJDB 4GSDH 3RWCB 4GQPH 2GCYA 1FIGH 1B4RA 4PG9A 4YDLC 4W6YB 4X6DF 5E5RB 4YQXL 4Y4KD 1OTSD 1GHFL 3FB5B 3PQYA 5K59F 3NFPB 4JO4L 3SDXF 4OZFA 1QSFD 3I6LD 2W60B 1UXSA 5D1QD 2AQ1A 3B83A 4KGJA 3ZKSD 3UX9B 2Q20A 1KPRB 3G6JB 4D8PA 1MI5D 1S7XA 2NXZD 4GRWB 2O5YL 4CU7A 4S1SH 5B38G 3VFGH 1AIFA 5D71L 2VDRH 5E00B 1MJ8L 1F3JA 4NP4H 5EBGA 1Y18B 5E2UH 4HV8B 3AGVA 4L8DA 3FFCB 3RL2B 3QO1B 4PREA 1FVDB 3MRCA 4YZFE 4P5TB 3JWDL 4XMKL 3VGBA 1VHPA 3O2VL 4G9FD 2YK1H 4M1DH 3RUGF 4LKCB 3DMMC 3UTPE 1KF9B 1T1XB 3RKDC 2HTLC 4NZUL 5D7JC 2PR4L 4H5SB 2LABA 4XPFL 1S5HA 4XWGL 2IH1A 5HJ3B 3QG7H 4MA7H 4JRXA 5CINH 3MRPA 2LU4A 3MODH 5DJZB 4MXQD 4JFED 1YECH 4LASH 2D7MA 4FZEL 2X89A 1KT2A 3G6JE 3A6OA 2NY3B 4GRWE 5EU7C 4CGTA 2E27L 5ICXA 1BHGA 5F9DC 5IF0B 4ZG1A 1BFVL 4MSWB 4ZPVB 5GHWH 1JHLH 2CR6A 1KBGL 2XZZA 4S0SD 5I66A 3FFCE 5CWSA 3GBNH 1I8IA 4HT1L 4XP5H 2LVEA 3WD5H 1M6OA 5DHXB 1MVUA 2BNRB 5MEPA 5D96C 2YA1A 1YC8A 1QFWL 1ORQA 1KJ2H 4Z76B 2Q76A 4JPKL 4FQLL 1KTLB 4WEUD 3MA9L 5D4QA 1T6WA 4R7NA 2CUIA 4GAFB 5KVFL 3HNTL 3T0BA 3CUPA 1IT9L 2XWTA 5E9DD 2VB5A 1HZHL 2I60H 3EOTH 5CLWA 1RK1A 1SJVA 2XTLA 4LF3A 4HLZH 3FQTA 5FUOL 3SBWA 4FS0A 4PB9H 2GFBB 1AP2B 4JO2H 3UO1H 4Z8FL 4PRDB 4P3DB 1WSST 2EZ0D 4L8BB 4NC0B 1E28B 3BAEL 3V0VA 4D94A 3A6CH 4PJHA 4U31A 4WTWA 3RZWA 2VDNL 5F89B 4G7YL 1FFQA 2NY2D 5FYKU 2UUDH 4BQ8A 1TPXC 3OHXB 1KJ2B 2OI9C 2GHWB 3AC0A 5D7LB 4BSWA 5GJTH 4RGNB 1T1WA 1AH1A 5GZND 2A1WL 4X6EB 3ZHDA 1KCVL 5JXEA 1MQKH 1TVBB 1NDMB 3FT3A 4OCYL 4V1DA 1M7DA 1TZGL 2BNRE 3U2SB 3ZKXC 2IBZY 1RIHH 1TZIB 2I9TB 5IK3A 2EICA 2AGJH 3P9LB 4PRBB 5JOEA 4G43B 5CJXA 1X5HA 4YAQB 2R4RH 1FZMB 1HCFX 2SEBA 5DUPL 2OTUA 4QHMA 3RWDA 3ZHLA 2J8HA 2DQHH 3P4OB 1GGCL 3PF2A 2EDEA 5GGTH 3TBYB 2HT4C 2VN7A 1IBGH 4GRLA 3CPLB 2V2XB 2GEEA 4WFED 3TA3D 2MQCA 3BIAX 3L3OA 3TJEL 2B0SL 25C8L 2APWA 1TXKA 1OGAA 4ZUTA 1H3GA 3MRHB 5ICYA 3QCVL 1WIOA 3M17B 4Y4HD 5CKAA 1DN0B 1DVFC 1WFNA 1HK6A 1LP9B 5D7LE 3E8UL 1T21A 4RGNE 2NMSA 2DQIL 3ALPA 3D39A 1UM6H 5JQ6L 1EZVX 4I8DA 1F90L 5LCVH 5KJRL 1PW3A 3N50A 4RGMC 2JCCF 1YQVH 2ENSA 1HI6B 2OP4H 3GSWB 5DLMH 5SX5H 2Y1VA 4KTDL 4NKDB 3MUJA 5E2TL 2EH7L 1MREL 2AJVL 1A64A 1B4JH 4GW1B 4H88H 4F9LC 5MEQB 1U93A 3KPNA 1XR8A 1IM3A 3TV3L 1O0VA 4Y5YA 2AJYH 4DQOL 4UV7L 1NGPL 3VFPB 1T66D 3AFLA 2XFXB 1FZJB 3VXUA 2J8OA 2CKBA 3DHJA 4ODXA 1LEKA 4UTAH 2HJLA 4TQEH 1AKJD 2PCPA 2LV4A 4JAMB 5IVOA 3KDMB 2Q1EA 3MRLB 4P2OD 4G6AD 3MRFB 12E8L 3ORJA 5ACLA 1AJ7H 5J12B 3KG5A 5JA9A 2Y07L 4YHNB 1ACYL 1LP9E 3QIBA 3O9WC 3T2NH 5D70H 1GYAA 2C9AA 4LKXA 4QRRA 4J6RL 3RVXD 4Z7VF 1URLA 4BH7A 5A2JH 1FL5A 1BQSA 3BKYL 4NHUA 2Z31D 3K2UH 4LLVA 3QWOA 2DRUA 1PG7W 4DEPC 4GSDL 4PRNA 1HQRA 5F88A 1FIGL 4NQEB 3C5ZB 3QDMA 1OSZB 3RWHB 2R8SH 4KZEH 4OBRA 1OOAA 4XXDA 3LN4A 2VQTA 5IFJB 1JJUA 5F7NC 3VGGA 3CMGA 4P2RD 2DJUA 3UYOD 3QZWA 2EIDA 2AKRA 4WUKH 4CMMA 3L5WA 3DURA 5KG9B 3T4AB 2BVUA 2PN5A 3QHFH 4M5YH 3P2TA 1U58B 4XP9L 2FJHA 2VXSH 3LQAC 5I1GH 1DQQA 3RVVC 1J18A 1JV5B 4S1SL 3VFGL 2VDRL 4NP4L 5C70A 2B1HH 5E2UL 4JCLA 1JF5A 2DJ4A 2R0KH 3B9DA 4EUPA 3FOMB 3K7UA 4OFPA 1ZGLM 3JV4B 4S2SA 4JN2B 3ULUC 5IG7B 4KRPC 3KPQA 3D1MC 5DQDH 1T80A 2UVEA 1SBSH 2YK1L 3BUTA 4M1DL 5F44A 2MFNA 1P2CB 5J56B 4JFQB 4NQEE 4NJAH 4BH8B 43CAA 3H9SD 2X5PA 4DKEH 3D3VB 2BHYA 3MYJA 4M9OA 3C6LC 4TSCL 3QG7L 4MA7L 5CINL 3DRTB 1E4XI 5B8CA 2VN4A 5LQBH 3IF1B 2YD7A 4Y1AB 1MCNA 1ITCA 4JVWA 2DM4A 5F8QC 1IARB 4QYOA 3ZDYE 1U8LA 1VEOA 4UNTA 3TH3T 3SE3C 3S6CA 1KG0A 1TZHA 4M4RA 5IJKA 1KIRB 5F6IC 3IYLW 1CVRA 4GS7C 1SJEA 4OZ4A 5TPWL 1L6XA 1QVOB 5T1LB 5GHWL 1JHLL 4BYHA 2YD1A 2VITA 5J11C 3GBNL 2VZSA 3TBWA 4HUXB 4XP5L 4KXZH 3WD5L 4ODBD 3FQXB 3STBA 4C56D 2R2EA 2CLVA 3FT4A 2R9HD 4ZXBB 3RVUC 1P84K 1KJ2L 2GI7A 2IFGA 4FQQB 1K4CA 1I9EA 3KYNB 4H26A 4JLRA 5C08B 4NC1E 1KCKA 5BV7B 3A67H 1EEYA 2W0PA 3K2MC 3VA6A 1J1PH 1XR9A 3KS0J 1EJOH 2BC4A 2VLKA 3VGDA 2DIAA 5CIPA 2X4QA 1GGIH 1CLZH 3OX8B 1RSFA 4PB9L 2CDGB 3BT2H 2XXMB 4Y1AE 5EU6D 4ZFOA 3D25A 3RGVD 4ZS7H 3PL6C 4JO2L 2HLAA 3V4PH 4HJJH 1BZ7B 4N0CD 5E7BA 1PJ9A 1GRWA 3SDCC 1MLCA 4OD1H 1PBYA 3NTCH 4APQB 1Z2KA 1F02I 4HS3A 4WJ5A 1BVLA 3BHBB 3CFIC 3UEZA 3CXHJ 5DK0B 4LPXA 2W0FB 3G9AB 1ZT4A 2YPLD 4N1EA 1WEJH 4ZYKA 1MQKL 4MJ4A 1RULH 2JKXA 3RZCB 1JGDB 1VGEH 3IXAB 2HG5B 1GZQA 3MPCA 4GW4A 3L1OH 4WNQB 4BSVA 4PD4K 3T0ED 1AHWB 2A38A 4JRWA 2JJSA 3UAJD 1R5WB 5C08E 1OWRM 5J57B 4NQVA 4NRYA 3D69A 1F3RB 1D5XA 1I7ZB 1ITBB 5HYSG 4PJ8B 4PJAA 1WBZB 3UJIH 5D1XA 3V95A 1PAMA 2DQHL 5K9JH 1CD8A 3G5ZA 3Q0HA 5GGTL 1S8DA 1IBGL 1A6WL 2DQFA 2IAMA 1D6EA 5DQJB 4KJWC 3SPVA 5DJ2A 4TVPD 2D7NA 3K81A 1A6AA 5JW4R 2Q86A 3INUL 4HC1H 4N0YH 3LPGA 4N8VA 3VXRD 1ZVYA 4YFEA 3HLAB 3M45A 2CH8A 5GGRY 5LCVL 3BH8B 4QHNA 4LCYA 4DCQA 3VFSA 5DLML 2MJWA 3DUUB 4ISVA 1B4JL 4H88L 4D0BA 2YWYA 3VXTA 4TN9A 4Y7MA 3OBAA 3Q3GA 1ZE3C 2AJYL 4PJCF 4UQ3B 2XRAH 4HK3N 3WJJA 2AXGA 5IV2A 4HUMB 4I1NB 4TQEL 4LCIH 3RNQB 5IVXB 4K71C 5TGBA 3PP4H 2I07B 3HPJB 5C0BA 4JM4H 3RDTB 3BPNC 1AJ7L 4JB9L 4ZAKC 2FIKB 4BFIB 4XAKD 1MWAA 4JDZB 1MCKA 4Q9RL 1NBYA 3JV5A 5CP3A 3T2NL 3WDHA 1NGWB 3O3AA 4W4OC 4F37K 5HY9A 4UZGA 5B38B 5TE7H 2LVCA 1G9MC 3SO5A 1BF2A 2R69H 2NNAA 3K2UL 5EN2A 1H9VA 3TIEB 3GJEB 4UDUA 4TVPL 4PLNC 5BOPA 5F93C 1JFQL 5TE4H 3BUYB 4L3CB 4EXKA 2P8LA 5L6YH 1NGZA 4K3DL 1F4HA 2R8SL 5F1NB 1NC4B 5DVNA 1JGVH 3X11A 1MCJA 4L4VA 2GSIA 5DMGC 1NAMH 1R3HA 2W9DH 3OV6A 4QHLA 1VADA 3IAPA 2WM0A 3QUYB 3VD9A 2X4NB 5L2KD 4E42B 2VJXA 6FABL 3QHFL 2C4FT 4Y5VB 3GSNA 2K9UA 1OAYH 5IVXE 4GMTH 1JZ2A 2V7NA