4JQIA

Structure of active beta-arrestin1 bound to a g protein-coupled receptor phosphopeptide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
356
structure length
353
Chain Sequence
TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-arrestin-1
publication title Structure of active beta-arrestin-1 bound to a G-protein-coupled receptor phosphopeptide.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 64
structure length 353
sequence length 356
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jqiA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jqiA01
4ZRGA 4LL4A 3UGXA 4GEIA 2FAUA 3P2DA 4GFXA 5F0LB 4LL1A 2WTRA 5F0JB 1SUJA 4R7XA 3LHAA 1AYRA 1G4MA 3LH8A 2WTRB 2R51A 5F0PB 1G4RA 3GD1C 1ZSHA 3UGUA 4GEJA 4JQIA 4P2AA 4J2QA 4R7VA 1CF1A 1JSYA 5F0MB 3LH9A 3GC3A
chains in the Genus database with same CATH superfamily
5DZJA 1WEJH 1OO2A 3I6GB 3SGDI 3QJZA 2XWXA 3EGSB 3U2SA 4P8QA 1I1CA 1PY0A 4BUQA 2WKGA 2D4DA 4JQVA 4KUCF 2LLNA 3MRBA 4DVBA 3RPBA 5EC2B 5CJ5A 4J6RH 3ZW3A 4F3FA 4FKEA 3AABA 4C47A 1UZ6E 1B9ZA 1XCQB 3QXTA 4IK7A 3FYIB 2VC2B 1XGRB 3ZR5A 4X7DC 4YVNA 4Q8BA 4PP2B 5GRJL 2FD6H 2OYMA 3L4XA 4Y9CA 1GAFL 4N0FB 3O11A 4JFEA 4H0LC 3BJ91 1MAKA 3D34A 1B0GB 4NM4H 2N7SA 5DYOA 2W1NA 2DBJA 1J05A 1TO5A 2ICWB 4KQ0A 4AEIL 2B3RA 4LLYB 3ULUC 4Q9QL 1FAKT 3QB7C 4P46C 4UTAA 1JZFA 4K9JA 4YSCA 3QDJE 3FO9B 4FJYA 5DT1H 2NSXA 3IFPB 5CJOH 4XMPH 3T3MF 4TTDD 1BQLH 2OXHB 1LEIA 1NEZB 4K8RC 4IBWA 3HHSB 1S3KH 2JKXA 3UPRB 1F0LA 1Z9MA 4IS6B 5C0GA 3FU0A 4LB8A 3ELQA 3FSWA 5F0MB 5F3HA 1X9LA 4WRLA 4ZUUB 5JPNB 1YMMD 4LEOB 5E2UL 4PJGE 4DQOH 1E6OH 1ORSB 1SN2A 3DPDA 5HYJA 2UXTA 4ODSL 4IMKA 2HT4C 2PR4L 3R4RA 3FT2B 3U0TA 3O4OC 4PGBA 3QJFA 4HJIA 5DWUL 6PCYA 1OGTA 2V0AA 1N3NB 3KVQA 4FABL 3QHFH 1I9JH 4E41B 2BVOA 3KYNA 4Y1SA 2XTJC 3UYPB 4WHDA 1FLTX 4OH2A 5K1NA 2A9AA 4N8VB 5HGBB 3TV3L 1A6AB 4G6KL 4JQXA 4LVEA 2XY1A 3GC3A 2MKWA 4YFLF 2ATAA 2J8UF 1NIBA 1X5HA 4F5CA 1T4WA 5HHNA 3DHJA 4OD1H 5J6SA 1EEYA 3ULSB 3BVDB 2ZOUA 3I6LD 4Z3EA 5JOEA 1E4HA 4KO5A 1PNDA 2Z0BA 2FK9A 3GDCA 4ZX4A 1BVLA 1JXDA 4NQSB 2WCPA 1QUNA 1G43A 2HVJB 3PXJA 5T33H 3GSUB 3FDWA 1Q0YH 1KTLA 5EC1B 2NY4D 2J72A 2IAMB 4YNYB 5DTFA 5TDNA 5CINL 3CVCA 4XNBA 2DLFL 4WU5B 3NZSA 2XV6B 5I66A 1IFHH 3D85A 2AMGA 3A4AA 4P9MH 3BZDA 5T1LD 3P9MA 1BX2B 3SKOB 3ESUF 2CKBL 1UC6A 1P7QA 2YRLA 1M53A 1ZSDB 1R24B 4NYLA 1M7IB 1Q90A 3FSVA 2J12B 1R1CA 4C4UA 3AT9A 3NTCL 4R0LC 4OF7A 4YIQB 4OGAC 2NX5B 5D2LA 3L4UA 4B7IA 2FJGA 4QWWD 5CEYB 5F9DC 5I6KA 3OHMB 2CCWA 5TFSL 2FZ3A 4WNSA 2C9PA 2NR6C 4WTQA 2AJVL 4KUZH 2E4FA 1IM3A 1I8KA 3HA0A 5EO1B 5L6YL 1MREL 4KI5D 3LVTA 4DW2H 3VXSA 1QKZL 1RIVH 1ECZA 2A7BA 1U3HC 4H1LB 4NIKB 1NKRA 1F3JA 3DBSA 2APXA 1BFOB 1FQ9C 2VQ1A 3FFCB 3KNBA 1M3JA 3LRSA 3C6LD 1YY9D 4LSRL 5H4ZA 2K9FB 4ZMWA 1U9KA 3KPQB 3PGFL 3QDGB 4X4KA 3DJZA 1KMGA 3GHPA 1ZHKA 2FSEA 2NNCA 4KRPC 4LGRB 3KLHD 2K70A 2G5UA 5BQ7B 3RVXD 2WWNA 2WIIA 5D8JH 3CZJA 3O0LA 2A77H 5KVFL 1H15B 4C55A 1TLMA 4QJ5B 2VLLA 3EIFA 4OFKA 3I9GH 2JK5A 2Z9TA 2DTSA 3BH9B 4UT7H 4NBYB 3LZOA 5EZJB 2E7BA 4CN4A 2TSBA 2FJHB 4U3HA 3SE4A 4DO4A 1OW0A 3MBEA 4Y88A 1EGJA 1F11A 4R3SB 5KSVA 1BQKA 4YAQB 2NRDA 1N6QL 1QR1B 1DTUA 1IGFH 1JGVH 2QJDA 3KPNB 3S2CA 2JIXD 5D7EA 4F20A 1NICA 4PWEA 4OI7A 4H20L 5BZZA 2I60H 3SPVA 1IO4C 3NJNA 2WOYA 3NCXA 4PJCA 1AD0B 5F7AA 1J8KA 1KOAA 3IDMA 2UZXB 4ANVA 5L4FA 4I48A 5C6PB 4P59L 4UWQB 1R0AH 2VLME 4Y9EA 4CVZA 1W9XA 2E0PA 2J5LC 2OR7A 5CN3A 3JTTA 5GRVK 2MIZA 2HFTA 3EOAA 5E4EC 5EPMA 3CXDL 3MQIA 5AW7B 3DRQA 2JKJA 2YOAA 3P69A 4JAMA 2BIOA 1ACYH 1HTYA 4GKZA 4Q4IA 1TMQA 2WWMC 1BYOA 2WW8A 3B2VL 1HJCA 2ZD0A 4Q6IC 3WMPA 4U1GC 1AS6A 2CM5A 4NIYE 4NKMA 3L9RA 3R7RA 3T65A 1MVUB 2DLIA 2VITB 3BN9C 3VVWA 5BJTB 2ZOTA 5B1JC 1IEAB 4L1HA 5LN8A 4ZK8A 4YLBA 3D9AH 3VG0H 2YEZA 3JWDC 1PLGL 1KTCA 2PYED 2JXMB 3KJ6L 3RWEA 2N0KA 1XZWA 4MMXB 1ZA6A 2E47A 4JFVA 3RIFF 1IU1A 4G6AD 2I5YH 4LLWB 3KL0A 3C5XA 5D5ME 5SWSD 4JB9L 3OLDA 4Y9GA 1HN1A 1XCTB 5DFVD 5IHUL 4LSSH 2Z7WA 3VD1A 1HXYA 2QADB 3MLUL 3L1EA 4QGYA 1VGKA 3CFIC 3S5YA 1I8LA 4IHOB 5DJCA 3B7UX 1A9EA 3AB0B 1MCQA 1U21A 2KS0A 4JFYA 3KHQA 3TT3L 2CG9X 1EEZA 3ECQA 3K5RA 5EU5A 1H6FA 4WDIA 1CI3M 4I85A 3UIZA 2DQ6A 4UNTA 5DZVA 3MC0A 4GRWF 1IGCL 4A6YA 2UYLA 2X4OA 3FKUS 5DRNB 1H0DA 2QKSA 1JZHA 3GBML 4RFOL 1OAXH 2XXMB 1CQKA 2GCYA 3ULVE 1UHVA 5DHVB 5LNDA 3OV6A 1S78C 2H2SC 5D96B 4AGMA 5IHZB 2FX9L 4ODXB 1JERA 2DBLH 3V2AR 1J9TA 1OD9A 4JJOA 3DVGB 1HILA 4ZZKA 4GMTL 4XBMA 1WZMA 2WZAA 5DVOA 4OZFA 3PP4H 4LCWA 2Y9RT 3PDGA 5LVEA 1QLEH 2HSIA 3LPWA 2NY4B 3I50L 4YHNB 2HH0L 4U1KA 3PHQB 5HJDA 3MRPA 1E4WH 3LPFA 3V7AG 4YDKL 1CBJA 3U48A 5DVLA 3O6FA 4JFFB 4AGPA 1TJIH 5DO2D 5AAMC 3MNMA 1D6VH 1XT5A 4EIBA 5KYXB 3MLRH 5ADPH 1TJGL 3UC0L 1CGXA 3AREB 3O2WL 4JS7A 5SWZD 3VXRD 2D7PA 1JNHB 3KPMA 1QRKA 4FQXC 3DIVA 5EUKB 5D1XA 1UD6A 1T04B 3QNZB 2NNRA 3DYOA 5DQJB 3KPSE 5KVEL 3LEXA 4PCYA 1KPVA 4HPYL 2CO1A 3ZE1F 3N1PC 1M9SA 3EJYD 2FRGP 2GJZA 2VXQL 3FQNB 4MQSB 1HHIA 1JHKL 4PRPA 1GGIL 4BGLA 3LSOA 5DS8A 1NBVL 4G9FD 5EDSA 1UD3A 4PJHA 5ABAA 3ZO9A 5DDHB 4LKXA 2RIKA 3MRNB 4UU9A 1JDCA 4AMXA 4XHQA 1N12A 2W9EH 4AKQA 1BVKB 5I1GL 1DBMH 1T20A 1K9TA 2XKUA 3O2DH 1BVOA 5GZND 4GXUN 2N1TE 1NCAH 3C6LB 4KKBD 2PW1B 1KJ2L 1M1XA 2RJMA 3LHPH 4LESA 1O5PA 1A7OH 4AEFA 2DRUA 4CRPA 3HE7A 3BKJL 4R4FL 3QORD 3ZE2F 3RBGA 4MSWB 1I9EA 3GYRA 3GSVB 4XC1H 3C5ZD 1GGTA 2H3NB 4K9EC 4M43L 1EV2E 2ISDA 5AKVA 3EW3B 3UTOA 3LEVL 5GQBA 4QXGH 1JNNH 1S5HB 5BV7B 4Y2LA 3FT4B 1BZ7A 3UBHA 1UEYA 2G9HB 4KGLA 5ESQA 1QEWA 4KMTL 1EJOL 4ZMNA 4NP4L 4ANXA 1DVFA 4DT2A 5HYQA 3HNSL 3QDJD 2BNRA 2OL3L 3L48A 5CZVL 3ATDA 4HHAB 2P52A 4F57L 2GFBA 4I0KA 3HN5A 4ELDA 1C1EH 4OKVB 3LZPA 2QVKA 1HL4A 4XP9L 4Q6KA 2FECL 1GVIA 1W0VA 2GJRA 4AYDC 4CU6A 4U1LB 3S88L 1SBSL 3FT3B 2HWZL 5A1AA 3SDAC 1OSEA 2A83A 3U6XA 2ZKHH 4A37A 1C16B 4JZJB 1JVOA 1F58H 1TT6A 2QL1A 5JIIA 4V1DB 2ZQKA 5E5RB 3T0AA 1LP9A 3MRDA 2AK4E 3K4AA 3ZSTA 5CKGA 4Y2DD 3VW3H 4DP0X 1PW3A 4KY1L 2CDEA 4M7ZB 4F9PC 5FWQA 5IMOB 1E28B 1X5KA 5I24A 2GTQA 4XNYH 3GRWH 5DGRA 4JKLA 4U2ZA 1I8IA 1Z0MA 3ZHKA 1WFMA 4F9LC 5B22A 4KZDL 2I85A 5J13C 4IMLB 3ZN6A 3IPFA 4QRPB 5DZAA 4FG4A 1Y6NR 3QUMB 2Z93B 2QQQA 2VL5A 3VXTB 1BCIA 3OPZH 1DQJA 5BRPA 4KJPC 5E8DL 5AZ2L 1TYJA 3LKQB 5DSCA 1H8NA 2BK8A 1V27A 3UZEC 5F97E 1MVYA 1V5JA 5SX4H 2L7JA 4KOCA 4X9GA 3EGXB 3L3DA 2AS5M 1EVTC 3P0YH 4NN6B 4PI2A 2WQXA 2C1OB 1BVNT 1BQRA 2BOBA 2A74C 3BVVA 3GSNB 4HUWB 4Z0XB 4TVPE 5C08A 2VISB 3N1QC 4N68A 1PBYA 4M5YL 5E51A 3SBQA 1OAUH 3CDGA 4F7EA 3J27A 3HPJA 3P1VA 4OQTA 5HDQL 3GS4A 4Y9BA 1Z9LA 4TUOB 3SKMA 2NMSA 4P9HC 4P46A 2KDYA 3CUPA 5TF1H 4AYSA 5I8OL 1A3RL 4M1CC 2KZ1B 4BFEA 2OZNA 5EIIB 2VXTH 3TCTA 1KBBA 5I82A 3ARUA 5BNXD 5SX4I 3VX1A 2DQIL 3ABZA 1YEHL 4V33A 1Y0LB 1XGTB 5D70L 3R1GL 2F68X 4NDMB 4OFIA 3D2UB 1DQQB 4QRUA 3DX7B 2VTFA 4QTIH 6FABH 5HYIA 1DQDL 4LU5L 3V0JA 1JG9A 4PM1A 5EZLA 5FA4A 1BPLB 1HH6B 2WKLA 4RQQB 4FKKA 3SCMC 2Q86B 3S36H 3FAXA 1ED3B 3MLYL 1GXEA 1OAKH 4GFXA 5CWSA 3TA4D 1FN4B 4X80L 1HE7A 4X6DF 1AXTH 4IRSD 5EUOF 4AM0A 1RZFL 2YPLB 1MWAL 4L1SA 4AYGA 2G4GA 3EO0A 3UCQA 3WKML 3DX2A 3WD5H 2XT1B 1R33A 3ZKQD 2WXQA 2VUYA 5SWZB 3NCJH 4GQ9H 1S6NA 3AS1A 4HU2A 4NX0A 2V6HA 4JG1L 2DIJA 4P4RA 3VYOA 2IIJA 2B0SL 1Z3GL 2EKJA 12E8L 3N41B 3W57A 4KXDA 2WO2B 2DW5A 2IH3A 4UQBA 2P5EB 4LEBA 5K9QG 2JB6A 4KHTH 1W8OA 2Y1AA 3O6LL 1T7VA 1KN2L 4OD3H 1I1AB 3OKDA 2HMID 1ZA3A 2DQUH 2YSSA 3RWFB 4KQ4L 5A2BA 4OJFL 4X5WB 4G9FB 2HPTA 1MZYA 3FUEA 4XI5C 4B9IA 1AR1D 3KLKA 5C07A 4TLSA 1QO3A 3UTTB 1NLBH 1RSYA 4XNQA 1BFTA 4G6JL 2V7NB 3O3DA 1RK0A 1T0MB 4NGHL 2KHAA 5L88H 4RWYL 4XMWA 4XOEA 4H44C 2AV1B 2MOGA 2MPAH 5L8KB 2R2EA 2YHGA 4MB1A 2BSEA 3WFCH 1XF1A 3QULA 4R0LA 2VLMD 3Q2LA 3NP4A 4TRPL 4OCSH 1XXDC 1G7IA 5EH1A 2EDNA 3B3BA 3C5ZB 4HWBL 3ARDD 1NWOA 2NR6A 3BXNA 2F1AA 1SXAA 3QEQB 3EJRA 5EMYA 4X0KB 2IOIA 1D7DA 2ZPKL 4L9LB 3ZQXA 1QBAA 1QVOA 2KPNA 5TK2A 1TVDA 2GAZA 3QFDB 1BZ8A 3PJSA 1UXLA 5DVNA 1KTDA 1TTRA 4M4RA 3B5TA 1TKWB 1U3HA 5I26A 1OP3H 1EUUA 4G7VL 3EYUL 2VDMB 1KB5L 1OE1A 5C09B 4XRCA 4BSWA 7TAAA 2H26A 5BS0A 3EJZC 4L4TB 3US1A 1U3JA 2XFGB 1Q9OB 4M8QB 5ABDE 1UJ3B 3GXIA 4NCDA 1GW6A 4N28A 3SKJH 3QRFM 4DEUA 4P2AA 5IMKB 4FG0A 3CXHK 4N2IA 2O26U 1AG6A 2GTZA 2PTVA 2J71A 3MRFA 5FB8A 1LO0L 5KSBB 4HKJB 3S4SA 3EUDA 4D2NA 4OZHF 5IB2A 5A7EA 1HHGB 2FO4A 3PXLA 5C97A 2O61B 3TCLB 1LO3H 2J7LA 4OZGB 2CR3A 2VLRE 3LB6C 5CLXA 1RZKL 1TCRA 1TQCC 1ZWIB 2WTRB 2P48B 3E2HB 5I71B 2LU7A 1B0WA 1FUNA 1Q1JL 4X6EB 1HNYA 2VNCA 1WF5A 3ULVD 3P0VL 1AGDA 5MENE 3VI4F 5E1IA 1SLUA 4HS3A 4QXVA 3NJLA 3HBZA 4MDRA 4TKWA 3ZE0F 5HYFA 1PKQA 4DGIH 1I7ZB 1KCUH 4PJFA 3D12B 4X8JB 4J3VA 3CFDA 5CCJA 1CDCA 3BRFA 1P2CA 2OR9H 3LEYL 4JO1H 3T5WA 3SY0B 2D3JA 1G6RH 5CBAA 1M7UA 3QJOA 1Q0XH 4QUOA 1UM4L 5CMAB 1CTNA 2ID5A 4P2OB 2PWDA 3TF4A 2CK0H 2HRHA 4W9CC 4O4YH 1KXTB 4HIPA 3L54A 1X4ZA 1KCKA 1V3LA 4Y4HC 2ADYA 4K07A 3WEAA 2XWBB 3KPSD 3L2LA 4K3JL 1V3KA 4JL1A 4MJHA 3WEXA 1HQ4A 2C7UA 1P9MC 1OV8A 3KW8A 3TJHD 4HA1A 3C09B 3O9WC 1TJMA 2D9QB 1EDHA 3WEOA 4PV8B 4HW6A 3WJMA 1JP5A 1YYLL 1TTFA 2PPAA 2NYKA 2AEPH 3FRPA 3FUJA 3HPLB 2X53A 3U4BL 1KZQA 3QJHB 2OMVA 3IU4H 1WH0A 2C4FU 4G7YL 3REWA 2VAAB 2X4RA 5EOCL 3IKCB 2L8AA 3QAQA 2BVQB 4M6NH 1I3UA 1RLBA 1T7WA 1SRDA 1JZ4A 2R0LL 3BLPX 1QP1A 3TA3C 1CWVA 4ODUB 3B2XA 1WP6A 5JR1L 1T1ZA 1HIMH 4IRSB 4GXUM 5FUOH 3TYFA 1FCGA 4GIPD 4JREC 4OCXL 5CGYC 1QPPA 5K9JL 4Q0XH 1UZ8B 5CJXC 5LBSH 3C75A 3NJKA 2CBQA 3SOBH 3KPLA 3OPUA 1VLXA 4LLMA 4BSVB 2ITCB 4YXKH 3EYSL 1IVTA 2AXFB 5FKAA 1KLGB 1HDMB 1HXMB 4UDUA 3PL6D 1SZNA 1FE8H 2WXGA 3HJEA 3WIAA 2JSFA 4N2LA 4ZQTA 1JF6A 4ETQB 4HUNB 3V4UL 1YEKL 4NQVB 4OZ4A 4R7DA 3QDHA 4K7PX 2ENSA 4LLAA 2ZNXA 3QW9A 3GMMB 3ATEA 5HGDB 2NY3B 3FU7A 5GS1B 4URKA 3N9GL 2VC2L 3BUIA 4PY7B 1HWWA 3LDBC 4HH9A 3UG5A 3X11B 1ZK9A 4ACPA 4YR6A 5AAMA 2YAHA 3OG4B 4JJHA 1NL0L 5FFOA 2YD8A 3AWFA 3S6CA 2AXHA 3QNYA 4HDIB 3MLPA 4U33A 1QLEB 5C9KA 2WWOA 3ZTEA 4JO2H 3FQ1A 3UP1A 3HZMB 4FQXA 5LB1A 4PJBA 4P2YA 2FJFB 5GSVB 4LVHB 1Y6KR 3DPBB 3S34L 2AK4D 3CVIL 4Y8DC 1AY1H 4J8QA 3AMKA 1N8ZB 4YC2C 5ALCH 3O6KL 4L8BB 2YMXL 2JELL 5FOBA 5TDPB 1CLYH 2R7EA 2Y6SC 3SPHA 2G75B 3TVMD 1VFMA 1Q4NX 5FEBA 4AM0Q 1Z5LA 4XMUA 2D4FA 3IJYB 3VG9B 1KIRB 1PLAA 3ABKB 4M1GL 3MRCA 5I0WA 4HFUH 4D0BB 3NAAL 5F8RC 3DX8B 1ZLUH 1T5KA 2DQDL 5J0BA 1G9EA 2B39A 3I2CH 4GS7C 3ZTCC 1OHZA 2ICES 2X1WL 3QNFA 4UV7H 3QH3A 4JG9A 5GGUB 1A6WL 4UQ3B 1ZVSB 3V8CA 1KPUB 1RFDH 1NCCL 2YD4A 2VDOH 1ZY9A 1IIIA 2YRPA 2CGRH 2VXSH 1ASQA 2LU4A 3OBAA 1GZHC 4TVPD 4B9ZA 3INOA 2B8OT 3MMEB 3PWPA 4Y5VB 2K8QA 4PJXE 5J57B 5AVWB 4JZOB 4OB5H 4PCKA 4QRAA 4RBPK 3KWWA 1FFOB 3KGSA 5HVWA 2BNQE 1IGIL 5FCUH 4LCIH 4MCZA 2CIKA 3TIDB 4FHBD 5HYSA 4K7PL 3DJ9A 5DRZB 1II4E 4O02H 2EH7H 3P4OB 3O45B 4OJCA 1KTRL 5EV7A 5B38A 1FF5A 2ENQA 1FC1A 2PPDA 3BWSA 2FEEI 2DN7A 3SJVB 2PW2B 1LVEA 3N1MC 1KIPA 1DE4A 3SDAA 2BSSA 2OZ4H 3VH8G 4DCQB 2P26A 3P4LA 3AY4C 4HFWA 1I75A 4YXHH 4FFZH 4JZNA 5E00B 1CZ8H 4ZUTB 1JGUL 3UTQA 5IWLC 4NCC2 2CO6B 1NC2B 2V5MA 2Y2TA 1YDPB 4GW4B 5KVGE 2E3VA 1XB3A 4YHKH 4F9PA 1GR7A 5IJBC 4PGDA 4IBTA 2BLFA 2ZWLT 2CO7A 1TO4A 5DJ8A 4XPBL 3CFBA 2PUQT 3FN0H 4YL9A 1BIIA 3AUWB 4MXQC 4W9HC 1MDAA 4JHWH 4X6CE 3LKOA 3BKMH 4G8IB 1B4TA 4P99A 1K4CA 1RZJC 2IH1B 7FABH 3WTYA 4PJDF 1KC5H 1Q94A 4XNUH 5D2NE 1T21A 3HG3A 3ESPA 3KPSB 4AGLA 2UY7A 4FP8L 1DBKL 2B4CH 1GGYA 3C12A 2GUYA 5ALBH 3NRFA 2A6JA 2QZ5A 3R8BB 3QQ9D 2OSXA 3DOHA 3IETB 3BO8A 3V0IA 2BJMH 4G8GE 3MX0A 3QZPA 5D7LB 1UJTA 4H2CA 4MNGE 5CD3A 2OLDA 5AVVB 2CLRA 2NCMA 2IPKB 2FQGA 1AHWC 2BRQA 2NY6C 4DZ8A 3IJEB 4DTGL 2WTOA 5E2TL 2OKMA 5EZIL 1HEHC 4MZRA 3STBA 5DCCA 4QHLA 1HZKA 2JVUA 4JDVA 3LN5A 1EDYA 1VENA 3CMOL 3ESMA 4RFNC 4HK3J 4H88H 2WSDA 3U25A 4HIXH 1OSZB 4CILA 4QY8B 4DEPB 4KK5D 1NMBH 4MJ6B 2XWDA 1Q1PA 4X9HA 4Z7NB 1CN4A 3WS6C 2IBZX 4BKLA 4XCYB 1DVTA 4G8EB 2QVFB 5EZOH 2VLJA 1RK7A 2V9TA 4AZ8A 4I1NB 4G11A 5H37A 3VGGA 3CGTA 5JHBA 3KS0J 5CP7A 3LQAC 2PR9A 4GRLC 4LSVH 3HZYA 5CBEB 1OGAE 2CJSA 4JDZA 3VRJA 3ZTNH 2EIDA 4BK5C 4ZX5A 5JTWA 4FQLH 4WGKA 2VSCA 1KT2A 4ONFH 1KNOA 1KELL 4F58L 1U8JA 2XDHA 3PGCA 4JDEB 3T2PA 4PRIB 2FT7A 3MFGB 3VXUE 4PJEE 3NIFB 1RUPL 3KR3H 2LLLA 2MH4A 4IBVA 3F6IA 1FH5L 2E9IA 5GS0L 3WHE1 4PIBA 4YDIH 1PLCA 3H42H 2AK4B 3SYAA 4UAOC 1LK2A 4YGVA 3RX5A 5EEUA 5DMIL 5FUZH 2Q6WA 3D39A 3NZUA 5KYYA 5MP6L 2WLKA 4E9SA 4ODVL 3BGFB 4G8FB 5FXCH 4CMMB 2VLRD 4L3EA 3NA4A 5AALA 4YHLL 5HJBA 4MA8L 1HEJC 1AYRA 5JHLH 2OMWB 4G9DB 2OMTB 2OX5B 2Y25A 4KROB 1QBLL 1XSOA 1ZXKA 2EZ0D 4OCMC 1RZ7H 3UO1L 3AXIA 3TT1H 3H4HA 3L7EA 2WQSA 2ADGB 5CEZH 5I75B 4C83A 1RLWA 1C7SA 1VAHA 1JPSH 1TMCB 3JT0A 5MEND 4KKAD 5C0CE 3TWCL 1MJUL 5F72S 5TQ0H 4N2CA 3BAXA 4A1RA 3FCSA 4MQXC 4DP6X 2EDMA 3RNQB 4N85A 4HX1A 3MRGB 5CKAA 1IBYA 1SOXA 4HMCA 1QASA 3KXFA 1CFSA 1F6AA 3UBXA 1FZMB 4TULH 1J9QA 4Z5RB 2JJSC 4ZD3H 2AI0L 5DUJA 3S96B 1N7MH 3BN3B 1DFBL 3ARVA 1S5IH 1KFAL 1ZLSH 2Z8VC 2HJFA 2I07A 1YEJH 3W38A 1JRHI 2FEDD 3CQFA 3BPNB 2QLYA 5K1VA 2XY2A 4PU2A 2EKSB 5JA9A 4X4XA 5DJ2B 3OB8A 1GC1C 3MJ8B 4TQPA 4WEEA 3TTSA 2J1KA 4WGVB 3K2KA 3W2DL 1HCZA 3GSXA 3MBWA 4HJGA 4HUKB 3P11L 2LFGA 5F3BA 4NJAH 4PVNA 4H40A 4UQCA 5AKTA 3BZFB 4LSPH 4JQIH 1GS8A 2G60L 1CQYA 4K3EH 4Z3HA 4DK3A 3SDCD 1RUKH 1QMUA 3X13A 4KXAA 2A9NL 4WKXA 4HEMA 4UUJA 4ZAKB 4ZYKA 4M7JH 4QRBA 5BW7A 4OM1L 5HHOA 1AKJA 2IJ0C 5LCVH 2FB4L 5T3ZE 4R96A 2AW2A 1U8NB 3MRQA 1S9WA 1NCDH 1ZE3H 3OX8B 4EI6A 1H3XA 3TBWA 3G6AB 4P4KC 2ADIA 4ZUWB 2WUBL 4H25A 3P54A 2XZAH 3SBWC 2ZAHA 1M6UA 3D25B 2ESVE 2XJLA 3II2A 2NXYB 3U4EA 35C8L 3A22A 4P5TB 4JHVA 4ODWA 3EDJA 3Q8BA 5L9DH 5I1DB 5IQ7L 3LKNB 4H8WL 4EI5D 3KPOA 1T3FB 4OY9A 3TASA 5IQMA 1JD7A 2F5AH 4ORZC 2VIRB 2QR0B 3MOAH 4J5VA 1G9MC 2XN0A 3MLTB 3G6DL 4KBPA 4X6DA 1NM4A 5K9QI 3JT2A 3CCHB 2BDNH 3PGDB 2DQJL 3ZXAC 5IHLB 3V0VB 3FCUB 4AUYA 1MHHA 2DMHA 3NGBC 1EFXD 4XNMB 1CB4A 1NC4A 4ABQA 3KW7A 3VFNA 1RMFL 2IH8A 4FFYL 1OZTG 3D3VE 5JOPE 1GIGH 1MW3A 3K6FA 2VDKL 4NO2B 3NVQA 5HJGA 5EEZA 2VR4A 5BV7L 1A4BA 4LBEB 4LLVB 1BOGA 2FDBP 4XP5H 2H5UA 4Y4HA 2P8LA 1KB3A 1YEIL 3QWNA 4HKBA 1OL0A 4IIQC 1Z66A 1P9MA 1OTUD 2BERA 3O9WA 3WS3A 3EOTL 3MCKA 3S9DB 2IPUK 2HKHH 3IGAA 4QHNA 2VZSA 3FH5A 1A1MA 4BEIA 1S7QA 1IM9B 4PLJD 3RAJL 5LGYA 1A66A 1A1NB 4QHUA 5E6YA 2PWHA 3JV0A 4FCHA 1XBRA 5B21A 1DZBA 5F89A 1NPNA 4LVNC 4ZUVA 1MEXL 3TA3A 1I31A 1XX9C 4XPFL 3LRGA 1FG2A 4IKLA 3JWNH 4LFHG 3K2IA 4UTBH 4U31A 3ARFB 5T5NF 4QO1B 3O81A 1NAMH 3GMPB 3GS7A 25C8H 1KCSH 1S7UA 3EAKA 3N85H 3ML9A 5AVZB 5CJXA 1BZQK 2KMWA 3ZU8A 3L3IA 4YVUA 1JWUA 3CFEA 2ATPB 3FPXA 3D0VB 3P4MA 4FJZA 5JO5B 5F9WC 1JS4A 2CJTA 2FJUB 1VFUA 1CF1A 1HYRC 3AITA 3QUML 4NLHA 5HXMA 3KGTA 1YCSA 4MWFA 4XPTL 4NT6A 4PLKC 3VFVB 3PDOB 1IL1A 1LO2L 1IGJA 4YDLC 3H55A 5GHWH 2BNQD 1R5IB 1T1XA 2QMKA 4HKXA 3TJEL 4DP7X 5A3ID 5KAQF 1WEJL 3BISA 1M7XA 4L3CA 2A4ZA 3IRCA 5LQBH 2DQEH 1ZJBA 3H85A 2AQTA 4WK4B 4GUOA 2BP5M 3D0LA 5TGBA 3UGUA 2A1WH 2OTWB 1KPRB 1MCDA 4OZHA 4MKTA 3ZT7A 5MENB 3EFOA 1XSKA 2CRMA 5KVMC 4OUUA 1ACXA 2KERA 2B1HH 3LZLA 5IQNA 3QPQD 4FLOA 5ID1A 4ABVA 4GY4A 5BZDA 2FD6L 4Y1TA 2AANA 5IW1B 2DDQH 2YFNA 4RISH 3UZVA 5KYUB 4UTAH 1L0YA 4NM4L 3GJEA 5FDWB 3ZDZE 1IGMH 4HIEB 5IMMB 2DOCA 3KYAA 1GCFA 4LRNH 3C60B 2HTLC 4Y4FA 1K2DA 2JF1A 5DT1L 3E3QE 4OLVH 4ETYA 1H6TA 3VI4A 2B5IB 3EYFA 4J3OF 2ZICA 4XMPL 4XNXH 5CJOL 2IO5A 2JKLA 2XIDA 4BKTC 2ZOWA 1G7LB 1AGBB 1S3KL 4DN3H 1DO6A 3Q2CA 1JPFB 2GSIB 4KO6A 3L17A 3ZJAA 4C4KO 5F88B 3QQDB 1AD9A 1XMEB 2D0GA 2Q76B 4XPHH 4ONGH 4B5EA 1MIMH 1VZGA 2O5YH 1VRSA 1E6OL 4HZLA 4DQOL 3TGXA 4PJ5D 1GZHA 4XP6H 4G8GD 3RPIA 3SDCB 1UWEH 4DGUA 1U8IA 2EE3A 2Z4QB 4EJ1C 4D7BA 3QI9D 2NNAA 1E5ZA 1IAKA 3BSZA 4L4VB 4WV1C 5IHBA 3GQFA 3CIQA 2VDOB 2X4PA 4ZMOA 3QHFL 1I9JL 1CDJA 3F7KA 4XX5A 5CLWA 2WXIA 2K3TA 1OQOA 2XFXB 2PPFA 3QDMA 2WAQA 1UQSA 5FO7A 3PABA 3FQWA 4JRYB 2D7NA 1YYMH 3H9HA 2FLMA 2XKNB 4OD1L 6CGTA 1PZ5A 2RBLA 5ID0A 1YN7B 2AC0A 1U2YA 4GO8A 4RA3A 3O8XD 3HE6D 5IEKA 1BZEA 5E9NA 2CDGA 4AIEA 5F7DB 5E1GA 2SEBA 3FB7B 5T33L 4ZFZA 4KK6C 5C0EA 1Q0YL 1UWXH 3AY4A 4KI5F 4PCSA 3WE6B 4E9VA 1WFTA 2WNXA 3K72B 4S11A 4O02B 5IWLA 1Z9PA 1JGEA 4X6FA 2VO8A 5JIPA 1IFHL 2Y69B 2C3XA 3L5JA 3OKNB 1T0NA 5I2IA 1OGAD 1W8EA 2ZXAA 2R69L 2WQRA 3FUDA 1MI5E 3KVPA 4LKCB 4P9ML 3TM6A 5LWYH 5KYWB 8PAZA 1F3DH 5I8EB 2Y7LA 3FN9A 5K39B 1JOIA 5AVYB 4C54A 4X4YA 4J3XA 5DJDA 2WC7A 3DOSA 3HC3H 4K5NA 1HEZA 4P23D 3MLWH 3BP4B 3DXAA 5FM8A 1PSKH 1DVZA 4A7TA 5C1MB 1ZGLM 3AWEA 1HAWA 3OKEA 4OIAA 3VXUD 5E0QA 1WO2A 4FXKC 5E94B 4CVWA 3G6JF 3MA7B 3NJVA 1WS7A 3O6MH 5BVJA 4S1SH 4WWKD 4U1JA 3QEHB 3UJTH 4DW2L 4BXVA 4TTDC 4NUJB 1GGUA 1RIVL 3SB3A 4WI0B 1JJUA 3T4AB 1LLAA 1ZHBA 1M71B 2YJLA 4A7QA 3LZQA 1TNNA 3EJQA 4OCRH 2NW3A 3VXMB 1OT1A 1KN4H 3SKUD 3SE6A 2DI9A 2VMDA 2CMRH 5ITFA 2MCMA 5LN4A 3CIAA 1AG0A 5C0CD 1UATA 1AZCA 3L45A 5LNEA 1G7HB 2DM7A 1U3NA 1V10A 3B9KA 3FB5B 3GNMH 1OARH 4DO5A 4DGYH 5B39G 3AXLB 5D8JL 2AERT 4UIKH 5D1ZI 3GSQB 4I0PD 2A77L 5CR8A 3U83A 4FFWD 1VF5C 4ELMA 1EGJH 1YJDC 3I9GL 3WS6A 2ZUUA 3BQUB 4UT7L 3X1NA 3ESVF 4JFDA 4KV5E 2ZOLB 32C2B 4PVBA 2FCBA 5AVXB 4LCWE 3KH3A 2N59A 3AACA 3C2SA 1EERB 1IGFL 2X88A 1JGVL 4JDTH 2BNQB 5KUMA 1GCYA 1SXCA 3FTZA 1SDDB 1NFIB 2Q7NA 2I60L 3O3BB 5FF6B 1U8LB 2F53E 3P9LA 3S5ZA 1SF5A 3RWCA 2NY4C 1BVNP 1I7UB 4ABWA 5I1HH 1R0AL 3IXTA 5E0FA 1WZ1H 1TTGA 2BMKB 1KENH 1NFDB 4WKZB 1DQKA 3L4VA 4RMUA 3N55A 3PPEA 3X17A 4G71B 4W68A 1JGDB 4ZTPH 5LXVA 3B9EA 4P48A 3BWUC 5T3ZD 4M6AA 5FLUA 1WUNT 3MLXH 4NSKA 1ACYL 3DUHA 2PP7A 3QUYD 2ZUYA 4QWWC 3Q8AA 4X6CB 5D9SA 3ZLQC 3N06B 3H3PH 2QMJA 4ZMTA 2ESVD 2YEQA 3IS1X 3CSYA 2VZUA 2GB2A 4QF1A 1E9OA 5DMJB 3V5HB 4PGEB 5D2NB 3D9AL 4KI5C 3VG0L 1HKFA 2DY2A 2H8PB 2ZAIA 4JFWA 3ZHDA 1D9KD 2AQQA 3DSNA 1XTLA 4NO3A 3JVFC 5DQDH 2I5YL 4ERSH 3I6SA 1D5ZA 4ZDHA 4RNRB 3V0EA 4A63A 2I9TA 2AGJH 2VZ3A 2IPUG 3ATFA 1B9KA 4HIJA 4LSSL 4NLAA 3C6LC 1YY9C 5F9OH 2H32B 5AUMA 3SQOH 1UB5A 2JJSA 1DP0A 1MRCH 1S7SB 3C5SA 4MNGB 4M5ZH 1T2XA 3LCYA 2OR8A 1P5UB 5DRXA 3RB5A 4AZUA 3O4LA 4PJDA 3RVXC 3D3VD 3FYEB 3Q5YA 3IPEA 3TBCA 4YSQA 4FYSA 1J8HA 1X7QB 2CHWA 4E5XA 5A40E 1XXFC 5JIMA 4KJYB 3BOVA 3N41F 1K8DB 3IN0A 5I0ZA 4NO0B 4ZG1A 2BVTA 2NSMA 1TJHH 4MLSA 3F05A 3SE3C 2W65A 3N42B 4PS8A 3O8XB 3ARZA 5E2VH 1JNJA 3HS0C 4OI8A 2DBLL 3U82B 4J3WA 3D8MA 4DZBA 3Q44A 1BJ8A 5F93C 5B7FA 3PP4L 2WBJA 4K2UH 4MQTB 1XGZA 5DD5H 5AYTA 3U2IA 1QLEL 4QRQA 4XGZB 4GRMB 5E4IA 2ENPA 5AVQB 3VD7A 1E4WL 1A0QH 1FSKC 2D7TH 4QTHA 4JO5A 2ATKB 4MA1C 1MQ8A 1WWBX 3HUJE 2G3NA 1T0PB 1FNHA 1OGAB 1TJIL 2Q3XA 1OP9A 3CLEH 4P2CG 1D6VL 4NRXA 5J89A 2I9LA 3L7FB 2FJSA 3MLRL 1QFUH 3VGEA 4P4KA 5ADPL 2EXYD 5G55A 1TJXA 1XV8A 2AK1L 4HQQH 3ZYZA 3SD5A 4KX9A 3BD4A 3QUXD 4P23B 1DQIA 2YO3A 4P2QE 4U1HB 3VWJD 3WFHA 1OLLA 5LKNA 3BFWA 3VXUB 3UTSB 2NXZD 2JKSA 4N20A 1W15A 4NZUH 3GGWA 4BFKA 5JLZB 2V2XA 2M83A 1QSFB 1RZ8B 1OCCB 2JQMA 3I6GA 4UILH 5FA3B 5DJ0A 5CILH 3OXRB 4WWKB 3OGCB 5I74B 1A6VH 1RJLB 3PF2A 1L9QA 3NFPB 2X9ZA 3QO0A 5DVKA 2AHIA 3WIIH 2V5TA 2YUWA 4FQQB 3VFPA 5C08E 3CC5A 1MCJA 4KKRA 2W9EL 1DBML 1THAA 4OVUA 4NN6C 5L7XH 3O2DL 4G6AC 4NQCA 4Y1AB 1RSFA 4Z77B 3OKKB 1NCAL 2HLFD 4U6TA 4FA6A 3LHPL 1A7OL 4D3CH 2PTTB 5DFVC 4PR5A 5C0CB 4ES8A 1YUHB 2OTUB 1U30A 4PJGF 1FVEB 4IIQA 4LNRA 1OP5K 5IB3B 3HAEA 3GT6A 3LKSA 4XC1L 1MCHA 2XV0A 3DRTB 2Z8SA 1UWGH 4QXGL 5IB1A 1JNNL 4JHZA 2OYKA 3IFPA 2APVA 1TF4A 2AQNA 3OLEA 2GEQA 3TBTB 4Q9RH 1NEZA 3TZVB 4OZGF 3HNVH 4BK8A 1BAWA 5D72H 1FVCB 2O4EA 1LO5A 3S3JA 4WJ5A 1PZ2A 1KJVB 5DUBB 1ZGLB 2IWGA 2JFCA 3AW5A 4TUJB 4YK4B 4NRYA 4MB3A 4Y4KD 1C1EL 2BRRH 2ED6A 2YOCA 4YBLC 2GY7B 1NDMA 4Y19B 2HAZA 4ES9A 4QGTA 5FECB 4Q6YA 3NN8A 3OJDA 3CX5K 2L7UA 2ZONA 3S36X 1VJSA 1O6SB 2IGTA 3I02A 3HRZB 4W81A 1SEBB 4DO6A 2EIZA 3WFBH 1KY7A 2EEAA 5IBUG 1N3NA 3GM8A 4PJAE 2FR4B 3LD8B 3BIKA 2J25A 3CG8A 1JN6A 4G42A 3NA9H 5DO2C 1FHGA 4N8VA 1P4LA 5DI8B 3VW3L 4DNLA 2MQ3A 2CKNA 1EDQA 1KBGH 4MMZB 4X7FC 1VFAB 4QXTB 4RRPM 3GXDA 4XNYL 3KD4A 4X5XB 2FO1A 2BSTB 3GRWL 3ULSA 4YSRA 2OMUB 1DZ0A 1NH6A 4MXWH 1C5DA 4CGUB 4RX4D 1UGNA 1DN0B 3QUYB 1WIPA 4B96A 3I3EA 3JUYA 4O5LH 4AQ8C 4YPJA 1QSVA 4PMEA 3EJYC 5C07E 3OPZL 2XN9A 1M56B 1AO7A 2ESVB 4N8CH 2PP8A 1UVQA 3U2SB 3EHBB 1J11A 5T1KA 2J1ZA 4HOXA 3DV4A 5GIRA 3MRBB 3CSPA 2R4SH 2V8LA 1CLOH 4DVBB 1BMZA 3MRMA 4QCIA 3ESOA 4XMKH 5C0ND 4D0CA 3WXVH 4F3FB 2QPEB 4K73A 3FW6A 1X9RA 3P0YL 2VRAA 2OFQA 2FUQA 2FSDA 4X5RA 1BFSA 1G94A 3W5MA 1MRDL 4IU3A 1R24A 3ULUH 4DF9A 1OAUL 4A2MA 5GZNC 2RHEA 1CR9L 1MI5D 3HN3A 2NX5A 4MGXA 3O11B 1QTPA 3QORC 4KH2A 4H5SB 1VFBB 1W0WA 4K8RH 5DYOB 2JKWA 3MNDA 5TF1L 1T1YA 3C5ZC 1KXHA 2AZAA 4BFGA 3CZNA 1PCXA 2WVTA 2VXTL 1W72H 4GIAA 4GW1A 3CAFA 4DVRH 4IKNA 4PLOB 4LQ1A 1JZ5A 5ISZA 5DEFA 1MCLA 1SHXA 1NPUA 3PIQA 1LEIB 3NJMA 6FABL 4QTIL 1F1DA 5C0GB 3FFCA 4CW1A 1FV1A 2VR9A 5IVXA 2ZYHA 2F7PA 2FUTA 4WI8A 1UJ3C 1F90H 3S36L 2R0WH 5HYJB 1IZKA 5IVOA 4WV1A 5E8NA 2XN2A 4N90E 1AXTL 3V6ZA 4M6MH 3MJGX 1XGYH 4XH2A 3U0TB 4PGBB 3QJFB 4G82A 3S3BB 1OGTB 3RL2A 2BVOB 2EDQA 3NCJL 4GQ9L 3MJWA 4J7RA 3NACH 4Y2DC 5EU6E 4NC0B 4OIFA 2V3EA 1LO4H 4XAKE 4XZ4A 3WJLC 3JZ7A 5ENWA 2H1XA 3ZDYE 3SKNA 2OA9A 5HHNB 5E9DA 2NXZB 1HL5A 3DLQR 3PNWA 1EEYB 4KHTL 1OE2A 3KPNA 1QWNA 1UG9A 2E76C 3F7VB 3S3PA 3E2HC 4PJ9D 4OD3L 1O0VA 5C0BA 1BVLB 3TN0D 4M7KH 2DQUL 4GEJA 3P3UA 1CD8A 2J2ZA 3DTDA 1AD0A 4RIRA 4LCWD 3RY5A 1FFNA 2UZXA 4C59B 1KTLB 3WFEH 4IIZA 1CIDA 5TDNB 5DTFB 5BOJA 2AJZA 4NWUH 4AOFA 1DFXA 2OBGA 1YNTA 2CNZA 4B7LA 1NLBL 3GXUB 2J5WA 2X4NB 2GBUA 5I66B 3BT2L 1SNRA 3D85B 4X8GA 5L88L 2F53D 2ZZUT 5E6RB 5AZUA 1PQZA 1T66C 3P9MB 4XE0A 3OAYK 1P7QB 2MPAL 5DD6A 3WFCL 4CSSA 3M7OA 4QHMA 3B2UD 4LIQE 2QTEA 4S1DD 5EU3A 4OCSL 3TNNA 4FXKA 5T5FH 2Q1EA 4GKSA 5D5MF 3TEYA 1NOFA 4DETA 1EBPA 3GO1H 1NQBA 4LMQI 4N0UE 4OFYD 4TLUA 1JPGB 3NT0A 5D2LB 4HUXA 2FJGB 2F6AA 5JQHC 2FZ3B 3ASOB 4F37K 3DVNA 3ZDZB 5FCSH 1I8KB 4Q89A 4AK2A 4NN5B 4PJ8D 2FQDA 4NBXB 5F0LB 3BH4A 2AQPA 3VXSB 3HZ3A 2WB1A 2X70B 3R7QA 4FX5A 5AVTB 4Y4KB 1F3JB 1YMMA 4HUUA 3QFJE 4YDZA 2VQ1B 1KGCE 2ICEC 4FXLA 4A7UA 1XCTA 4GXVH 5K9OA 1JXKA 3KNBB 1N26A 3SKJL 5FYKH 1TSRA 3BP6B 3LRSB 3QWQB 4BCYA 3DTXA 5KANG 1A6ZB 2ZXCA 3PDDA 4DKAA 3UG3A 4HCRA 1Y1DA 4XODA 1U42A 1ZHKB 3U0WH 3FFOA 3BDYL 5JQIB 4IRSC 4OJDH 5DC0A 2WIIB 1RHFA 1F6FB 5DWPA 1AQDA 5CP3A 1SVZA 1ADQA 2DMBA 4QNPE 3T77A 1PIFA 4BIKA 2VLLB 1LO3L 3D52A 2JK5B 1IILE 4WU7A 1BSIA 4X83A 3HIZA 1WZLA 1U36A 3GMQA 5DHVA 2F18A 4M7LT 1S7WA 4FMKA 3UYOD 4MLIA 1DVFD 3FTSA 3L3JA 3QJVB 1BAFH 1F11B 3A4FA 4I88A 4KVCH 2K6ZA 5E4OA 5KSVB 3GHBH 4JK0D 4A68A 4XBPB 5JW5A 4YHNA 4HU8A 2HMIC 1E40A 2JV6A 3PHQA 4MYPA 3DETD 3SPVB 4PJCB 4I7ZC 4BFBD 2Y23A 1E6JH 3D05A 4DGIL 1AR1C 2GPZA 1KCUL 3AROA 4X5QA 5T1LA 5TK4A 4POYA 5KYXA 1K6QH 2OR9L 4W9GC 4CVZB 4JO1L 3MAWA 4LOUD 1OB0A 4X9IA 1G6RL 3U6RA 3JTTB 2K9UA 1JNHA 2ZKXA 2W0KA 1A14H 3EOAB 1PZAA 1B88A 4FC3E 4ZODA 5EPMB 2YC1A 1Q0XL 2C9AA 3QS2A 4MD0B 1NGWB 1H8LA 1QYGH 3QXWA 2G2RA 3BE1H 3O3AA 2CK0L 1M2VA 4GKZB 4O4YL 3QAZB 5JXED 3N40P 3ARDC 5FGRA 1ZPLA 2DYPD 3CZKA 3IB4A 4P2QD 5CGMA 5KYNA 4FGMA 5IJVB 3W11D 5H4YA 4NKMB 4NNPH 3T65B 5JPMC 4Z7NF 3V52H 4PWGA 4HEPG 5DDHA 3MRNA 4ZS7H 3X2QB 2WP3T 3IE9A 5FM5M 4YFLI 5CHNA 4GUPA 3VG9C 2AEPL 1U95A 2Y36H 2QZQA 1BVKA 2YEZB 1IAOB 2EDOA 4R4BA 2MSPA 3QZWA 4BZYA 2HUHA 2NZIA 3GJFA 3H1ZA 3IU4L 4HGMA 5IF0B 1ZA6B 3GI8H 4EQ2A 2RGSA 3SO5A 1P1VA 4M6NL 5EZPA 4EI0A 1ANUA 1XSJA 1N2RA 4MSWA 1SY6A 1SM3L 3WO4B 2VM3A 1E8XA 3F8UB 2JH2A 1HXYB 1HIML 3FFDA 1F4HA 1NCWH 1VGKB 2AMUA 5FUOL 3G6JA 5DJCB 1SXSA 1A9EB 1X44A 3IF1B 4Q0XL 4XN7A 1TFHA 2NNXA 4JFYB 5IR1A 5LBSL 1EEZB 5EU5B 3SOBL 1HHJB 2WXFA 4WDIB 4ADJA 4J12A 1IBZA 4K94L 3CJJA 2WN2A 2UYLB 2X4OB 4YXKL 3DGCR 4PGZA 4A6YB 1GS6X 3SE3A 1H0DB 4M48H 5J12B 1CGWA 1NBYB 3HS0A 4IRJD 3RGVD 2X41A 1FE8L 2GYSA 4N9OB 3L08A 2P5PA 4N2EA 3HOGA 2JIXA 4DP1X 3MZGB 3HFMH 2NY5C 1IQWH 5M94B 2R56H 4WGWB 1HILB 4FEMA 1H8OA 3CHXA 4OZFB 4U1LA 3IJSA 4LCWB 3ULVC 3NPSB 1FFPA 5CO1A 2C4XA 4U1KB 4L0ZA 3MRPB 1C16A 4NWTH 2G3XA 1XR9A 1AIFB 1IAII 3F3HA 3O6FB 3MREA 1MW2A 1XF3A 5D7IA 5DF0A 5BO0D 1IQDA 4JO2L 1I53A 3R06A 3MODH 1MFDH 1E28A 1B4LA 4NENA 3ECVA 3KPMB 4JX0A 4LQFH 5D1XB 2N3JA 1P4IL 1AY1L 1ZMYA 3ILQD 3P9WB 2EQDA 4NAJA 1MOEA 2Z92A 3LEXB 4IMLA 1KPVB 5ALCL 2Y7MA 1N6VA 2GC7C 5IOPA 3DK2A 1N0XH 1CLYL 1MCIA 2GJZB 4YSUA 4WUKH 3TBSA 2JKTM 1HHIB 4PRPB 5KVDH 3LKQA 4M8VA 3LSOB 4GSXA 5DS8B 3TJHC 2VUOA 5E8EA 3NYKA 1QLFB 4OSUH 4EUPG 2PYEA 2Y07H 3EGXA 3HC2A 4PJHB 3LJ3A 5F7NC 4HFUL 4UU9B 4WEBH 3V7AE 3GSNA 3I2CL 3DX6A 4Z0XA 4K9EH 4UV7L 1T20B 5SWSA 1RFDL 3B3IA 1MJ8L 2ITEA 1CL7L 2VDOL 4HISA 1M1XB 1M3IA 4LPYA 4DP5X 4MHHG 3HE7B 2CIIA 2FEEL 2VXSL 4TUOA 4YWGH 3OTTA 4P5MA 2FQFA 2HTKD 1WA2X 2Q20A 1KEGH 1CCZA 1U92A 2AV7A 4OB5L 5EIIA 4OW6A 4NN7B 1RL1A 1BZ7B 3E9UA 2IDSA 1XGTA 4HK3N 1GHFH 3BPCA 2W94A 2YZ1A 3H9YA 3NABH 3BSGA 3EUUA 5ESQB 1VKXA 5FCUL 5DYFA 2VE6A 5HPMA 4RDBA 4LCIL 3DX7A 1JFHA 1DVFB 5HYQB 4PV9B 5E08L 2BNRB 3PL6C 5AENA 4O02L 2EH7L 3GK8H 3STZA 2Q86A 1SQ2N 1TPXC 2O6PA 2HX9A 4BQ9A 3L2NA 2OZ4L 5HDBB 3VSQA 4FF9A 1UH4A 2GJ6E 4FFZL 2A83B 1CZ8L 3R4DA 4B41A 4G6FD 4AYFB 2EDXA 4YHKL 2XG4A 1KY6A 5SWZA 3VXRA 5M95B 4G5AA 1LP9B 3MRDB 4N90D 3MRRA 4POUB 4CL7A 3FN0L 2K6WA 2CDEB 3GF8A 3NJIA 1Z3RA 1L9MA 4JHWL 2BXYA 2R9HD 2YS4A 4N22A 4QRFA 3BKML 5EBMA 1KB9K 1FNGA 1I8IB 5D4JA 3FSAA 5TE4H 7FABL 5EU6D 1KC5L 1IGTB 4PFEA 4XNUL 4QAWA 4XAKD 4XB3A 4P2QB 1QBBA 2NSQA 4NM8H 2VL5B 3BGFC 1E0OB 4G9FA 2B4CL 3LV3A 1DQJB 3TVMC 4MCNA 3CC1A 1J0KA 3MRHB 4ANWA 5ALBL 5DSCB 2C9QA 2K3HA 1UKQA 3VU1A 5B8CC 2BJML 5AW5B 5IY5B 4P9HH 5GZNA 2ED9A 1L6PA 3RTQD 2Y3AA 4WI3A 2IDTA 5C08B 5E23A 2F54A 4OLUH 3QORA 1BQ5A 3CDGB 4F7EB 4YSAA 3HPJB 4MQ7A 4CU7A 4QJ4B 4TQIA 5F21B 2E9GA 3SKMB 4N2GA 5J56B 2K4AA 4D8PA 4X0KA 1RKRA 2X42A 3CUPB 2WV3A 1KEMH 1QHQA 3V9EA 5I17A 3JV6A 1TFPA 1E2WA 3Q8FA 4HIXL 4XC3H 1DUZA 1JWMA 4GMSL 1TYEB 1NMBL 3HC4H 3T2NH 2BCKA 4PS3A 2WLLA 3TJEH 4E5XG 3QIWD 3QDJA 1Z5YD 1DVXA 1FP5A 3C9NA 3RGVB 4PWFA 5EZOL 4PYHA 4HC1A 1ND0A 4V11A 2PCFB 3AT0A 1FPTH 5FA4B 2CSPA 1T1WB 3UCRA 3LY6A 4LSVL 4MNQE 4ZTOH 4GBXA 3ZTNL 1WG3A 4Z8FH 4FQLL 4FMVA 3O4OB 4IU2A 4PJGA 1UADC 1BLNA 3QFJD 3VAEA 1CUOA 1KGCD 2C3VA 3RVUD 3ZTJG 5K9KA 4ONFL 1FG9C 1T83C 3KCWA 5IB5B 5BRZA 4YN3A 3D09A 1FO0A 2XTJB 1MCKA 1V7NH 2F8IA 3EO0B 4Y2DA 1A7NH 3WY3A 2O61A 1ZTXH 2VN7A 2TAAA 5B3JE 1OLZA 4E9QA 3LX9A 3WJLA 4DP4X 2VRQA 1HH9A 2CKBA 2VMFA 1A4AA 2KI6A 3KR3L 1OPOA 3E0GA 4OCYH 4HF5H 4TS6A 2P5WE 4P4RB 4YDIL 3H42L 5EU7E 3OLGA 2IH3B 2ZT9C 4K7PY 1EXUB 5FUZL 2JB6B 3T0DA 1OP4A 1Q9WA 3OKDB 1ZA3B 1I1FA 2VXVH 2YSSB 5JHLL 2EIKB 3SDDA 1DDTA 1VEOA 1WFIA 2G30A 5TPWH 3WTSA 1I7ZA 3IYLW 1RZ7L 3TT1L 5C07B 5CEZL 1QO3B 5TDOA 2CRIA 1ITBB 2Y1VA 3LRLA 1JPSL 2H6UA 3HB3D 1F86A 3QQ9C 5KS9E 1QAWA 1RK0B 3UH8A 5FW7A 5TQ0L 3QUZD 4QYOA 2NY7H 3DIFA 2R2EB 1NUGA 1LDPH 5CMAA 4R0LB 3QULB 4AEHL 5L8LB 3M45A 2KQMA 1G7IB 4LHUD 4TULL 4DOHE 4ZD3L 3V0HA 2OJEA 3DUUB 4CN1A 1N7ML 2Q7YA 4UQIM 4BM7A 1S5IL 1QVOB 2PN5A 1ZLSL 2R27A 1YEJL 1VADA 2GAZB 3OLIA 1TYRA 3PJSB 1KTDB 1DBJL 4KK5C 4M4RB 1U3HB 1DANU 1CVRA 3L9EA 5EO9A 3VI3E 2D03H 4BSWB 4XRCB 2H26B 5BS0B 2DMKA 2ICEA 3QIUD 1CLZH 5CU5A 3ARBD 3TH4T 2QSVA 1JYXA 2CQVA 4NJAL 4ZSOE 4LDLB 3ZTDC 1XAKA 1YA5A 2YKLH 4LSPL 4JQIL 3EOYG 1H5BC 2PXYD 3MRKB 4K3EL 5F1NA 4PS7A 4KRPB 2C1PA 1RUKL 2ROYA 2E6QA 2GUOA 2P7TA 4YHOH 3FUNA 2GBVA 3ARFC 2EADA 5IROD 1YEGH 2GTZB 5AB1A 4M7JL 4WZ9A 1HSBA 5FB8B 2YUZA 2A6IB 4G6FB 4Z95H 3TT3H 4NZTH 3S4SB 3W0WE 5LCVL 5IB2B 3IGLA 4ZX6A 5FPIA 1XZ0A 4LOEA 1NCDL 2ITCA 1KBKA 5CJQL 3W9EA 2FO4B 3P77A 4UYQA 5LDSA 2XC8A 3LOWA 4KJWD 2DMGA 5FOJA 3UYRH 1NEPA 2XZAL 3HR5A 5FGCB 3RVTC 1S7VA 2E9BA 1H3WM 1F2XK 3EYOB 2XWTA 1NGQL 2EDEA 1XCXA 1T6BX 4A2GA 4F8OA 5L9DL 5HGDA 3ZDYB 5D1QE 1GGCH 3VMOA 3S3DB 4N5UA 2Q9OA 3UAJD 3V79C 2XV3A 4PY7A 2HH0H 5HY9A 2F5AL 4PIRF 3V4VA 4NQDE 1UD8A 3EXJA 1HOEA 1PD0A 3GRBA 2F74A 2VN5A 3MOAL 4HS3B 4MZIA 1A4KA 2EZ0C 1ZLVH 1PKQB 2J5LB 3L4TA 2BDNL 3CZLA 2GEEA 3TEZA 2V3FA 4PJFB 3CFDB 2WANA 2XBDA 1BZOA 1P2CB 5E4EB 2E7CA 4KKAC 4R6UA 1PTZA 3RTQB 2FJFA 2A4EA 3AQYA 3APFA 5GSVA 5CBAB 4L29A 5I1KH 4AGQA 2XA8H 4LF3A 1GIGL 1ZLWK 5AW3B 3B6SB 1IC1A 1YVLA 5KVEH 3ARDA 1SYSB 4XP5L 1AIZA 3MV9A 2BOCB 1UM6H 4U1GB 4X8CA 5EOQH 4OJEH 5HDLA 5J7CC 3FTVA 3D2TA 5JPMA 1DQTA 3HKZA 4P3DA 4PWJA 1FL5A 2HKHL 1KYFA 1TETH 2G0LA 1GPOH 4PJXF 3CFNA 2H41A 3QIBD 4N0UB 1HQ4B 2C7UB 1SN5A 4TM9A 2R51A 5IJCC 3FUMA 2B5IC 2FEDC 1MLCA 3L5HA 1NGZA 3QIWB 4IRZA 3SZ6A 4JFOA 2HX7A 3WJMB 3DROA 1LE9A 2APFA 2XPGA 2HN7A 1N68A 4H1LG 3ISRA 4UCFA 1ZVSA 2OMVB 2MCAA 1BECA 4X7TA 3IMTA 1UASA 1Y18A 4UTBL 3BKJH 2J6WA 2YMTA 4BUHA 1E27A 1W91A 1NAML 5D5MA 3N85L 25C8L 1KCSL 3SDCC 1T1ZB 4QT5A 3QDME 4M43H 3UMTA 2BIPA 2EAEA 3NSXA 1NFDF 4NQEE 5DD0H 3EXLA 3LN9A 4MB4A 2WM0A 3KLAB 5KBLA 2PKDA 1GZPA 3GS0A 1JFQH 4F1SA 1E50A 2IBZY 5HVHB 5KANI 3KPLB 3LN4A 3PJLA 4LLMB 5GGRA 3D1MC 1AHMA 4LOVA 5CSBA 4F33A 3MUZ1 1XTMA 2DWTA 4UDUB 1QSZA 3UERA 2BO0A 5DRZA 2NZ9D 1J0JA 2VDLB 5GS2D 1IIKA 5GHWL 1OSPH 4OZ4B 4X6CF 1Y6MR 2IFFH 2LVEA 3AVEA 1MXDA 1QSEA 3CK0H 3FU7B 1OD7A 4XN8A 4EI5C 3RILA 5LQBL 3I84A 5EOTA 1MAMH 2DQEL 4HH9B 3VXNB 3MNZA 2OS7A 5G2NA 2VN6A 4YR6B 2A1WL 2CO6A 3IBOA 5L2KE 4X4ME 2B1HL 1D7CA 4FQXB 4FQHA 5B7EA 2GJ6D 3CVHA 3LNEA 4PJBB 1YEDB 4Z3GA 3ZY7A 5JHDE 2ERJC 2QV2A 1UH3A 4RISL 4O58H 1KJ2A 2CK2A 1VDGA 1VGEH 3DGGB 4LHUB 5C0AE 4UTAL 4UANA 3M1CA 4LPTA 2Y7QA 4NUGH 1IGML 4LPVA 3CTTA 1XQ4A 2OI9C 5JDJA 4CBPA 4LRNL 5FOBB 3NIGB 2NUTA 4MDIA 2R7EB 3BMVA 5HP5A 1OTUC 3PP3H 4HJ1A 4OLVL 3B5GA 4GT0A 2YAQA 1W6WA 3T9WA 5K69A 4XNXL 5KAQG 1Z5LB 3MUUA 5F1KC 3KBEA 1JTPA 4ODBD 1U8OA 1D5IH 2WLIA 4DN3L 3EDDA 3MRCB 4PLJC 3N42F 3ARWA 4Z78A 2IDQA 2GHWB 3Q1SH 3W56A 1CDHA 4CGTA 5DVMA 3ARBB 4EE2A 4XPHL 1ERNA 4ONGL 1QX1A 3QH3B 2O5YL 1DL7H 1FCCA 2CLZA 4L18A 2FGWH 3BSZH 4XP6L 4CUCA 2Q7AA 1UTDA 2W9LA 3MU3A 2EJ1A 5IBLD 1UWEL 2IGFH 1WT5C 1WAAE 1J10A 1KJ3H 3D4YA 3DJTA 1J18A 4TTGA 4BQ6A 2DWDB 4FL4C 1NFKA 3BKCH 3GSWA 3QARA 1VSCA 4BBWA 4N0YH 1IZJA 1ZIBA 4Z7VE 3KWWB 5T1DH 4JGNA 3HI5H 3L4ZA 4MJ6A 2EDRA 2EXWD 1THCA 5ANME 2NTFA 3S98A 1YYML 3BQUC 3L81A 4GINA 1MFUA 3PL6A 4J3OG 4XWGH 5D7JD 4MCZB 5DJ6A 2CIKB 4YOKA 3V0WH 2AEIT 4M3JA 1C8PA 4JY4A 4XMLH 1UURA 2WSKA 3FQUA 1WHPA 2FX8H 5JQ6H 1T03H 3UC2A 1KLFA 5B38B 4HYTB 3ZRFC 5F44A 5EA0L 4I87A 5A3IC 1KIPB 1DE4B 1EEQA 3SDAB 2EDYA 1X5LA 2BSSB 1SHWA 3VDBA 1G1OA 2VDPH 4CBZA 1MJ7H 4HFWB 4PB9L 5K33A 1GY2A 4JZNB 2WLMA 4MNQD 3PHSA 3UTQB 1KACB 4UB0H 1AI1H 4LP4A 1NCBH 1RZJH 1LTXA 1CFNB 2DLTA 3CNKA 1CPUA 2VWEE 4PGDB 3BVNA 4G72B 4FQIH 4R2GD 2CO7B 5DJ8B 1A8ZA 3CFBB 3MJ6A 3QPQC 4AI7A 3HC3L 3NBNA 4YX2H 3U46A 1RP8A 5I30H 1BIIB 1U8CB 1JWSB 2AK4A 3MLWL 1A5FH 3FTWA 1PSKL 1UA3A 4JR9H 3T2QA 3C8DA 3WG7B 1R46A 1B3JA 1PG7H 3LQMA 3LKOB 5J13B 2DMCA 3II1A 4K5MA 4ZMZA 3O6LH 1X5JA 5HGAA 3QR2A 4KZ0A 5AVSB 2XWRA 3TVMA 1Q94B 4S1QH 2ENJA 2P5WD 4S2SA 4LNVA 1E4KA 1MY5A 1T21B 3O6ML 2Z8WC 2UY7B 4S1SL 1D6EA 1AQMA 1TZHA 1D2PA 2GTWA 3H6JA 3PWNA 4UMGA 4G2AA 1BLIA 4F8TA 5B8CA 3SPCA 4GJTB 3SPGA 2A6JB 2EEFA 5D2NC 1I8MA 2X44D 1PD6A 3DSFH 3BO8B 3LIUA 4MJ5A 3OXSB 4ZT1A 3WLWD 4OCRL 4M00A 1KN4L 1M2OA 1YMHA 1JSYA 2CMRL 2JCWA 5CD3B 2UXVA 2CLRB 3FONA 5GRWA 4HD9A 5I1JH 2PPCA 1PJWA 2O5XH 3WAJA 1KV3A 1B4JH 1ITCA 1LQBC 4MB5A 4TRPH 4PRAA 2XTSA 4DZ8B 1FZMA 3WY1A 4JKMA 1NBZA 4KXCA 3E7JA 3GNML 3H2WA 2QBWA 1OARL 3OL2A 5ILTL 4DGYL 1JZ2A 3SGKC 1J8HE 5KW9H 4QHLB 4UIKL 3BW9A 3QI9C 4JDVB 1S4IA 5F7EL 1FWXA 1P5UC 1SFDA 2EDLA 3T8MA 3ZE1B 2R0KH 2W88A 3WTVA 1MCEA 3LN5B 1EGJL 4C57C 4PTUA 4OCWH 3LQAH 2X7LA 3PLYA 1JIBA 2B2XH 3HG4A 3PXHA 4MHHI 5IK3A 5DLMH 5C0DB 2WO3B 4FJ6A 2NW2A 2BY0A 3HG0A 4BKLB 4WI7A 2VLJB 3NCYP 4AZ8B 1QPKA 3TO4D 4JPIA 3M7FB 1E8ZA 3O8XC 3HE6C 1OCRB 3T6XA 4I13B 3VD2A 1A3ZA 2W5PA 5CP7B 2QT6A 1PYWA 2XBZA 4YFEA 2EO1A 1L0PA 3HZYB 1YC8A 4CC1A 4JDZB 3VRJB 2YK1H 1WA0X 2QGCA 3LMJH 1DSFH 3HG1E 2BS9A 2Y6TE 4HWZB 1KT2B 5I1HL 1KNOB 4POZD 1U8JB 5AVUB 3RJOA 3PGCB 1KENL 3NEOA 4EZJA 1YG9A 4XCEA 1U93A 3K4ZA 4ZTPL 2XQYK 4XP1H 1CXHA 5D7HA 3B2DC 1CU4H 1JCKA 3W0WD 4KJQD 1BDYA 4P23C 1JV2A 3MLXL 1LK2B 4YGVB 1MHEB 3FOLA 3BRDA 1YEFH 1EPFA 1NUDA 4OFQA 3D39B 5KYYB 2A6DA 3LKNA 4L3EB 3A67H 3H3PL 3IRPX 4AJVA 1WCBA 3MLTA 4DP9X 4PJ6A 2ZTBA 4ZFOA 4WWKC 1QI5A 4LHQB 4RZCA 3LNGA 5D1QD 5AYUL 4NQCE 1I8UA 2VQ4A 3B4NA 3CFMA 1AQKH 2EIBA 4OKDA 5KZCD 2YGVA 3E1ZA 4C83B 3MRLA 3V10A 2E8ZA 2AJ3B 4NQDD 4ERSL 4JHAH 2NQCA 3AJ7A 4DPAX 3FCSB 4YH6A 2AGJL 5F9OL 4P5SA 4MYWB 4LBEA 3SQOL 2ZXBA 1MRCL 3KXFB 2ZWYA 3OMZA 1CFSB 1F6AB 1YN6A 4M5ZL 3UBXB 5T3XE 3AWGA 5T1MB 4N26A 4P5KA 4A6YL 3GIZH 2Y5QA 4XVOA 1GC1H 4WF7A 5DC4B 5EBWA 4I0PC 4NRZA 3G9VA 4Y4FD 1DO5A 4FFWC 5EIIG 2LGNA 2LR4A 3RVWD 2HJFB 2I07B 5DJZA 3K1KC 1JHTA 4GPVA 1YYLH 2IQ9H 2X6VA 5DK3A 1TJHL 1A1NA 2EIEA 3AS2A 4X4XB 5CM1A 5DXWA 5L4JA 5E2VL 4HBCH 4GAJH 1EMTH 3ZTJH 1JZ8A 1H5BA 4YK4C 3MBWB 3GSXB 4HJGB 3UXFA 2Q3AA 3SD2A 3TP4A 3APDA 4K2UL 2DD8H 5DD5L 5I15H 2AQ3A 3VM5A 3AQZA 3THMH 5JOFA 3B1TA 2KBGA 4PRBA 3L3OB 3FL7A 4R9HA 1A0QL 1UM5H 2D7TL 2OCJA 3IFOA 3Q2NA 5C6TH 3X13B 1L6ZA 1E5UI 3L95A 4OCXH 5DC2A 4UUJB 4ZYKB 4JY6A 5K9JH 3MCLL 3CLEL 3CPLA 2ZE0A 3RIAF 4A7VA 5C7XH 5HHOB 1AKJB 3LD8C 1QFUL 4YXLH 4R96B 2XIIA 2WNKA 4XO9A 3MRQB 3MJ9H 1S9WB 1P5VA 3GRGA 3MJ7A 4HQQL 4JPKH 3WI9A 4EI6B 5MEOB 1GYWA 2YPVA 1NMCC 2ZNWA 4LO9A 4Z7WA 4NQED 4MMZC 3TBWB 4Z3IA 1TQCB 2VDRB 3GD1C 2RCSH 3FF8A 4XXCC 1G9MH 4LDEB 1CFQA 5D2LF 4NZUL 4ZW7A 1CXKA 2VLRA 3BUYA 4ODWB 3QUYC 3ZMRA 3VXOB 2XI9A 4UILL 3HHRB 2IADA 4UTCA 5CILL 1G9HA 3TJPA 3ZDZF 2HT2D 1A6VL 2VC2H 3PG2A 2WHVA 3FS9A 3JTSA 2Y7OA 2VR8A 2OTWA 1U33A 3QK0A 2YGNA 5HHQA 4TVUA 2B15A 1WC7A 4FYTA 3AM8C 2ICWJ 2WUCL 5PAZA 4ZQKA 1D9KC 1UT1A 3BUQA 3GTVA 5L7XL 4TNVF 3HAEH 2M1KA 1NC4B 3VFNB 5L2KD 3JUZA 3MZTA 4D3CL 5KYUA 4C58B 2EDTA 4NJ9H 3DGDA 1DQMH 3N1FC 2HP4A 1BOGB 2WZ6A 2HCZX 4HIEA 5IMMA 1TTCA 4ZW5A 2P8LB 4UINH 5JIDA 5JHDD 4P3WA 4HKBB 2WPGA 3BDBA 1UWGL 2GBAA 5IW3A 5C0AD 3O9WB 3WS3B 4MDJA 3MCKB 5A7BA 1A64A 2GT9A 4Q9RL 4QHNB 1XF2A 4L2YA 2VABA 2ZJSH 4RAUA 1A1MB 1A6PA 4M9OA 4PUBH 5D72L 1S7QB 5IVXE 5K59F 1UKSA 2BHZA 2GSIA 2DEWX 3QQDA 1D5BA 4PH8A 1B4RA 1GMEA 2ICWI 4QHUB 2LT9A 2IXQA 1HXKA 2BRRL 2F2HA 4HP5A 2FH6A 4Z7UE 2IVFC 3VI3B 4ZUVB 2X4TB 3B56A 1GGBH 3SDCA 2YBRA 4MNHA 4PJCF 3VSTA 1USQA 3W1ZA 2Z4QA 4IEFB 2DYRB 1DUYB 1MDTA 3K91A 3IWVA 2VDQH 5L4MA 4DN4H 2YIHA 3K6DA 3L3IB 1JWUB 3CFEB 3NA9L 4NHCH 4NFCA 1Z9OA 3P4MB 2EXYC 2R15A 1KBGL 3WHXB 5DD3H 4U7SA 5AWNH 4PS4L 1KYOK 1DANT 3CFQA 4M1DH 5F7KC 3QUXC 1A3LH 4MWFB 4NT6B 4H0GA 2F9BT 4MXWL 3VWJC 1G1CA 1MQKH 3GEFA 2NXZC 1IL1B 1L0XA 1IGJB 4O5LL 1FVDA 4I2XE 5AB9A 3S8FB 3FQ2A 3U36A 4EI5A 1T1XB 4XB7A 5FO2A 3FHAA 2PPEA 1JZ3A 1XB6A 3Q5OA 3LDBB 4XO3A 3ECBA 4N8CL 3WE6A 1PX4A 4L3CB 3QFGA 3IBEA 5HHXH 4KRMB 1KJMB 1HCVA 4XMKL 2GSGB 3NH7H 3D0LB 5TGBB 5KZCB 5CCGE 4LKCA 1YEWA 5KYWA 2R59A 1RPUA 1D5XA 1EFXA 3AZUA 4NQDB 3EFOB 3ARSA 4K3HA 4ECNA 3ULUL 5AOKA 3GXTA 3NSDA 5ID1B 2HLFC 5BZDB 1MNUH 4OF6A 1ASOA 4RH4A 4MJIE 4RSVA 2JNZA 3UZVB 4EXPX 4K8RL 3GJEB 3TXAA 2AP2A 3L5WA 1XMWA 3EO9L 1RVFH 3KYMA 1W72L 4Y4FB 1K2DB 4PGCA 3O3UN 4DVRL 3QEHA 2CUHA 3EYFB 2EVIA 2DJSA 4GS7B 5JYLA 2CCLA 1N5AB 3E3QC 5DJYA 3KEDA 2W0FA 3MGTA 4Y4KC 1AD9B 4GKOA 3FT9A 1PCSA 2D0HA 2RFXA 4DGWC 1HHKA 1F90L 3E80A 4XVUD 2R0WL 3RX8A 2XQ0A 2ARJA 2ZSVA 2B9AA 4EBQH 3DO7A 1O7SA 1U8IB 5D7KE 4M6ML 1XGYL 2NNAB 2BZ7A 1IAKB 4B9YA 1J88A 1I4FA 1GKOA 2VUKA 2X4PB 3CMOH 4GP8B 3STLA 4QOKA 1JK8B 4PJXA 3QDMB 2DL9A 1UQSB 1J8HD 1NUFA 2BC4A 3GFUA 2H1LM 1RP9A 2DTMH 3F85A 3NACL 3NRPA 4LHJB 1LO4L 4NP9A 5EHFA 3ELAT 5JW4R 4Y5YC 1QOKA 3H9HB 4EDXA 5ID0B 1KB9J 1F5WA 1PZ5B 3IGUA 2YEVB 3KVDD 1OW0C 3TBVA 2K0RA 4MJ4A 5I23A 5IEKB 4N6RA 5DS2A 4YQXH 2CDGB 4LZKA 4M7KL 4R7LA 3O3BA 4EAEA 1IMHC 1C12B 5FF6A 2SEBB 1U8LA 2FTAA 4ZFZB 5D4HA 5C0EB 1I7RA 3WOVA 3WFEL 2XWCA 2XQYG 1I7UA 4NWUL 4PJHF 4ZRGA 4GH7B 1G9NC 1JGEB 3TFBA 2D3NA 4X6FB 3QNXA 4F58H 1SVBA 1UKTA 4IJTA 5C0NC 4WKZA 1PX3A 2G5BB 4LAQH 3GSOA 5CSZA 1HS6A 2VDPB 3HG1D 3OF6D 4FLSA 3KEHA 1PF3A 2E5EA 4X4YB 5DJDB 1J5DA 3DOSB 3OAUH 4UOZA 1HEZB 5T5FL 3DXAB 4OIIH 3MDJA 2Q10A 1AGEA 3GO1L 2E86A 3T3ME 5C7ZA 1R47A 3DMMD 4KMQA 2IH9A 2XG5A 3OKEB 3TIEA 3MBXH 4ODVH 4S0SD 4X6CA 4V2CB 3IMRA 5C0AB 1URLA 1A2YA 3NDZE 1AJ7H 3I85A 2GIXA 4EKXA 1QBLH 5D2NA 3RDTD 4U1JB 4GG6A 2H8PA 1KG0A 2B9BA 5HSFA 2EEBA 4RMQA 4XCFH 3VCLA 5IHHA 1H9DA 4R8WH 1A9BA 2WBKA 1ZHBB 5AW9B 2NW3B 2XYBA 4HCRH 1YO4A 4GXVL 2FQEA 4PJ5A 3M1BA 4G8GA 2E7LA 5FYKL 5ITFB 2O1AA 5HJ3A 1YJDH 4MNGA 3SGKA 3UO8B 4MAYD 3TEUA 3QI9A 5CP3H 1ADQH 1P5UA 4B9PA 3B9KB 3U0WL 1G7PA 1ASPA 3CZEA 2J8UE 3LVEA 2B7DT 2CUAA 1I8LC 4NQXA 3SPJA 3KPPA 3ARGA 1LP9F 4J23A 5DHVH 1A6TA 1P53A 5C86A 3I9AA 2I25N 5T3XD 4ELMB 4ZTEA 2YXVA 2H9GA 2EXTA 1SMOA 1UOKA 3P0GB 4JFDB 5J12C 1BAFL 3HE6A 4KVCL 1ZLDA 3KHOA 1Q8MA 3GHBL 5MERB 1MIEH 2R2HA 4PJ9C 5LAXA 4RZKA 2VRKA 4U7MA 3TN0C 2Q8AH 5JW3H 2BHYA 3ZGIA 3P9LB 3MTRA 3WGVB 3RWCB 1E6JL 5IB4A 4K0OA 5ESAA 1K6QL 4OM1H 3IXTB 3QVAA 3ZX1A 1ETZB 5AL0A 4EZLA 4K3DH 2AQ2A 3QHZH 3EZ8A 1PZDA 2BSDA 1A14L 3T3PB 4HD5A 4KFZC 4UAOB 2LFEA 4IK6A 3B2UC 2MTAA 3Q01A 1HSAA 1EJFA 4S1DC 2UX6A 2CA3A 1QYGL 4PJEA 3ULUF 3BE1L 2RMNA 3JWDL 3EH2A 3CDYA 3Q8EA 3U4AA 3RKDD 4FG2A 4WWKA 3U1SH 3OGCA 5D9SB 4R7VA 4NNPL 4EZMA 1NIFA 3F84A 3CSYB 3GJFH 4ZS7L 1NJ9A 5EFIA 3V52L 1EXHA 3K46A 4QF1B 1E9OB 2EINB 2W0PA 2BIMA 2Y36L 4PJ8C 4XN4A 3RL1A 3Q9QA 2BXZA 5FYJE 1ZCRA 4R7NB 5KSAD 4WO4D 3DSNB 3FHQA 4HWEH 1UFUA 1D5ZB 4ZDHB 5J11B 4AC2A 4AIZA 5C0CA 2I9TB 4NNXA 3SY6A 4HIJB 1YQ2A 3FTYA 5AUMB 1GOGA 3D5OF 4PBXA 4M5SA 2CM6A 1JYVA 2L7QA 3C5SB 1HVXA 4D9LH 1NCWL 1WD9A 4I0PA 3DRTA 5DRXB 3O4LB 1D2OA 4MBOA 4HBQA 4QLWA 4ALAC 4HJUA 1IE4A 4FHKA 1ZLUK 1J8HB 3GI9H 4DUWA 4LCYA 4ELKA 4M48L 4F27A 4YE0A 3R19A 4FLHA 1L9OA 3J7HA 4HAGA 1LEKA 1DVFC 4XPAH 2W65B 3HFML 1IQWL 1K3ZA 2BIHA 2R56L 4NKOA 4DZBB 1CYWA 2WBJB 1OE3A 5FFGA 3N43B 5F7YC 2OM5A 4QRQB 1BF8A 2WXHA 2YAMA 5A2KH 2G4EA 3DETC 3OZ9H 3H8NA 4L5FH 3VGFA 2OK0H 4NWTL 4NZJA 4QTHB 3CSFA 5E1HB 1QACA 3NEEA 2Z31D 3QEGH 4QPEA 5AAPA 2MTPA 4NRXB 4KK8D 1QRNE 2YXMA 1K5WA 4MMZA 4LOUC 4P4KB 3KM2A 3MODL 1MFDL 2XZQH 4XXCA 2AXGA 1UOWA 1CXLA 4U3SA 1CDUA 4JVWA 3LXAA 4ZO7A 3WFHB 1KV7A 4S1RH 1WITA 4M61A 3GGWB 4CVUA 1N0XL 2PP9A 4DGVH 4JFPA 2V2XB 4OF0A 5JXEC 4WUKL 3WEMA 3QUGA 1YQVH 3VRLF 2B08A 1F2QA 5DJ0B 5KVDL 5G4OA 2X87A 4JBSA 3OM3B 3W11C 1F3RB 3ZOAA 3GSNH 5FDYA 1OIOA 3RDTB 4FZEH 3DYPA 4JO4H 3AM8A 3QXAA 4OSUL 3MO1B 2Y07L 3QO0B 3FSZA 3VFPB 4WEBL 5B1KA 4YJZL 1KWKA 1D9KA 3IAQA 5ECGA 2QFRA 5G5DB 3CC5B 4PVMA 4CJ1A 3ZZQA 1U8QA 2F54E 3NGBB 1MG2C 2VERN 2A2QT 1TEFA 2IAAC 4K9EL 2A9DA 4LFHD 2ZP8A 3WHE0 1R34A 3QZBA 3BKYL 4HZAA 2A4CA 4NQCB 3D4CA 2LV4A 3S8WA 3QYNA 3LPGA 5TQ2H 3TC9A 3TNMA 3HMXA 3S5LA 3AAZB 4PR5B 4H5SA 1VFBA 4GRWE 4YWGL 2BP0B 2Q8BH 2VMCA 4LNRB 1KTJA 4IIQB 5HDRA 4Y16D 1KEGL 3D3VA 3HAEB 3LKSB 4U2YA 2ORBH 2I26N 2FGZA 4MJID 4BRVA 1JPEA 3OR7A 4H13C 5IB1B 2YJQA 1TUPA 3HS9A 1CG9A 1GHFL 3D48R 3NABL 5C3TA 4AQEB 2CJ3A 4C56E 3WIHA 1I9IL 3DJSA 1LO5B 4WJ5B 4IRJC 2X4SB 3RGVC 4LVNB 5GISH 2X1OA 4FTVE 1TQTA 4KX8A 4NRYB 3FAWA 2XETA 3ZDYF 3GK8L 3L1FA 4N2BA 4PRNB 1NDMB 2XRAH 2DLEA 3NQKA 1QATA 3HLAB 3NN8B 3OJDB 5BRZE 4KQ3H 3C08H 3LIZA 3I02B 2A99A 2EIZB 5EDXA 3WIHL 3FQYA 4PJFF 3ZK0A 5CFAA 3KMDA 3K6SA 2HVKA 2Y22A 5D1QA 2ZYSA 4Z7OE 5LDUA 5F9WB 3BIKB 1WBXA 1TVHA 1JN6B 4G42B 1P4LB 2VDQB 4OAWA 2OP4H 3QUXA 2AF2A 4OGAD 5D7KD 5IFAH 1BVZA 3NESA 4LLUB 3VWJA 4JM2D 2CXGA 3CDZA 2VXUH 1WISA 2HT3D 4YDLB 2J20A 2HXAA 3F7VA 1CICD 1C5DB 1HOCA 3ILQC 4GQPH 5TE4L 1YHPA 4OLXH 2ITDA 2YAEA 4GKNA 4KVNH 1TITA 3T4YA 4KHXH 3CV5A 4E42A 4NM8L 1CGTA 3BD3A 2XN9B 1AO7B 1UVQB 4EO5A 1ZANH 4I1RA 1CD1A 5T1KB 1L7IH 5IFJA 1SEQH 2X4NA 3DV4B 5GIRB 4FQJH 5HI3D 3MRMB 4QCIB 3B2PA 5A6IA 4D0CB 3U2JA 3ZE2E 2R69H 3R0NA 4F1ZA 4F91B 3CX2A 4P9HL 3K2MC 1IX2A 4OZIE 1AOZA 3VFGH 4IU3B 5C2BH 2BOLA 4OLUL 2GIYA 2ED8A 1JXJA 5JMOC 4E0RB 3QRGL 1SPDA 3V6OA 2YD6A 4JPQA 3NFSL 4M5TA 4ZNCD 2E6JA 3VU2A 3FQTB 1JPGA 3C8HA 3ZDWA 1W0WB 2HTKC 1DVQA 4ODHL 5KVFE 3TEWA 1KEML 2VDMH 1SOQA 1T1YB 2Y7NA 3B34A 2VOTA 3RHWF 1TOXA 4XC3L 4HC1H 2GKIA 4ADGA 2P80D 4GW1B 3HC4L 3T2NL 3SOTA 5FO8B 5ISZB 5DEFB 3LRHA 4QNPF 1D3CA 3PIQB 2X70A 3BIAX 4Y4KA 3CQPA 2QQKH 4ESKA 1GA2A 4LPXA 1I3GH 2AEQH 1FPTL 2IDFA 3SEPA 1P84K 4ZXBD 1FV1B 4CW1B 5IVXB 3BP6A 2X4QB 4JHBA 5FLVA 1B0IA 4G59C 4ZTOL 1A6ZA 4ANUA 1FO0H 1F4WH 5EO0A 4Z8FL 2EDDA 1DJHA 2X0WA 1JZ6A 1ZT1A 1OQXA 1JPST 4WV1B 5E8NB 4TSBH 2HG0A 1ACZA 2XIBA 5H94A 3V6ZB 1QFWM 4XH2B 3FT0A 1WAPA 2OJ1A 1NOLA 3G5YA 4GI9A 1V7NL 1A7NL 1ZTXL 3RL2B 4O9HH 4H0IA 4IHBA 4PJBF 1EFQA 4N2NA 3BZ5A 5DMGD 4Y5YA 3X14A 4OCYL 4WQOA 4HF5L 3U0PA 4FXGB 5EBLB 2XNAA 1GJUA 2XZCH 1KBVA 1OCWH 4RX4A 5ENWB 3SKNB 1JPTH 1A02N 2R9HC 4RMRA 3QHTC 3MRJA 5E9DB 1WD8A 3ZUNC 1MJJA 3PNWB 3NIGF 4XBPA 3HBPA 5TF0A 1RJYA 5C0BB 3LPPA 2VXVL 5E7BA 2J2ZB 4RIRB 4OD2A 1FFNB 5TPWL 4LP8A 2AJZB 3QZOA 5IUCA 2W95A 1YNTB 1HESA 3HG2A 4PRHE 4H8UA 3QZMA 3TBBA 3W82A 1PQZB 5KBPA 4IBYA 3RTQC 2NY7L 5DD6B 3MV9E 3C87A 1MI5A 1WFUA 1LDPL 1BQUA 4QHMB 4MD0A 1NGWA 5EU3B 3TNNB 4FXKB 5G4NA 3OAZH 2EYRA 4GKSB 4ZW6A 1CLVA 4HUXB 5IJVA 2W9DH 3QXVA 1NDGA 2EYTA 4EDWH 1AYOA 1B6DA 4NKQB 2H2SD 1MRFH 5DU7A 4RRPA 3DVNB 2F8VA 1H3PH 1JI1A 1IAOA 3K71B 2D03L 3QIWC 1UEMA 2V2WA 4EVNA 1T7ZA 5IF0A 1CLZL 1HCFX 4DEWA 5LJYH 1YMMB 2IANE 1NM9A