4JQIA

Structure of active beta-arrestin1 bound to a g protein-coupled receptor phosphopeptide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
356
structure length
353
Chain Sequence
TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of active beta-arrestin-1 bound to a G-protein-coupled receptor phosphopeptide.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Beta-arrestin-1
total genus 64
structure length 353
sequence length 356
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jqiA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jqiA01
2WTRA 4LL4A 5F0JB 1JSYA 1G4RA 4GEJA 5F0LB 3UGXA 1SUJA 5F0MB 4ZRGA 1ZSHA 1CF1A 2FAUA 1G4MA 3LH8A 4JQIA 3GD1C 2R51A 4R7XA 3GC3A 3LH9A 4GFXA 1AYRA 4R7VA 4LL1A 2WTRB 4GEIA 5F0PB 3UGUA 4P2AA 4J2QA 3LHAA 3P2DA
chains in the Genus database with same CATH superfamily
2O5XL 5FXCH 5B1JA 4KGJA 1AP2B 4O2FB 1MH5B 1UADC 1VPOL 4AVHA 3P4NB 3NZ8B 2Y22A 2C1OA 2ITCB 2F74A 4BH8B 1LQSR 2Y6SC 5AL0A 2O6DA 2WJ5A 2FT6A 1FZJA 4KTDH 2VLME 5CZVH 4G6AD 5I1DA 4NPYB 4F57H 3K1KC 4KRMB 5I1DB 4NQXA 1MFUA 4PVLA 4XXDB 4Y19E 2DY2A 1QA9A 4DGWC 1PZBA 3TT3H 4O00A 1WA2X 3NCXA 5GJSL 4PMFA 3O6FB 2ZKMX 3VI3A 5B7FA 3EAKA 3KYKL 3KLQA 4YBLC 2IQ9L 3VWJA 1KJ2H 3CFEB 5IMKA 4KXZH 2GPZA 3U4BH 2FYYA 4E41A 5I1GH 2ZT9C 5DRWA 1MZZA 2DWYA 2RACA 1G7LB 1DVXA 1BVNT 2X38A 2E0PA 3MLSL 1PAMA 1PZ5A 3D4ZA 4Z7NB 4FCHA 2YRBA 3PGDA 2X3AA 3GB7A 1G0DA 3HB3C 4ZAKB 5B1CA 3T6ZA 4JDTL 3PPEA 1HH6B 3IDNA 2AS5M 1Q38A 5SWZA 3II2A 5E1IA 5DR5H 1A3ZA 1SEQH 4PJGE 4AIOA 3WSQH 3OKNB 1DHKA 3K6NA 3BGMB 1J1PH 2Y07H 2DJSA 3ZL4L 4QHNA 3BUQA 1DLFH 4R4FL 4L9LC 2OL3A 4N26A 4Z3HA 2IGFL 4RESB 3RG1C 2VDKL 5FO7B 1DBBL 3FUJA 3MFFA 4KMLB 2JJTA 1CG9A 2R51A 2IG2H 2WZAA 2P8LB 2PXYA 3GLEA 1J0IA 4I3RL 3MLTB 1XGUA 4QHLA 5ANMA 3SPIA 2EE0A 3FTXA 1H19A 4IMLB 3JV4B 2PTUA 3H7BA 4ZDHA 1E3ZA 2F19H 3GM0A 1RK1A 3DOIA 3FKUS 2IDCA 4M7LT 4QRSA 1KBGH 4YXHL 3HHRB 1NPJA 1SFDA 3MLXH 4PHZA 3PGFH 5D1XE 3LPGA 4Y2LA 1P7KA 5IMLB 5JQ6L 3BAJA 3QUKA 5DSCA 2VLLA 4Y9EA 1DN0B 3CFMA 4QXTB 5GS2D 1CGSH 3TLRA 4DK5A 1MFAH 1MUJB 3GMLA 1E28B 3KW7A 4P2YA 3NDYE 5CNHA 2NY3D 3SDCC 5EU4A 1JN6A 2CD0A 4M8RA 4AYFB 2Q76A 3MV8B 4QY8A 3L95A 3IU4L 4JPSA 4Y4HC 3UL4A 2Z0UA 3F84A 4OD2A 25C8H 4P3CL 2R15A 2P45B 2OFQA 3QRLA 5KS9F 4BHUI 3VNYA 2I60H 4OLUL 2EO7A 3FU9A 4HEME 3JV5A 4JFZL 4TQEL 4W9DC 4FADA 4L3CA 5CKAA 4A7QA 3B5HA 3GI9H 5MEQB 1NEZA 1U91A 4NO5B 2QSVA 4NN5B 4Q4IA 4N24A 4KV5E 1T66C 4AKPA 4FJZA 5ICZB 4UILL 1CL7I 2HT4C 3N3EA 1LDPL 1QSZA 5GGTH 1UKTA 2EDTA 2VDPB 2UZYA 4N1HB 4NAQA 3RA7H 2UXFA 3L4ZA 3SJVB 3AMLA 3NIDF 2FATL 1QVOB 2VLRE 4HZAA 3D50A 4ZUUA 3RVVD 3RWIA 2JJSC 4QEGA 1I7ZB 3TA3B 3V7AE 4NN6C 4FFYL 5FPIA 5L2KD 4EE2A 4D9RE 4CW1B 2NLJB 3S96A 2EE9A 1KV3A 4TV3A 5DTFB 2WP3T 3SYCA 4IEFA 4N9OB 1HQ4A 1KGIA 5KSBE 1ML0A 4G6MH 3NPZB 1N2RB 1U2YA 4BRJA 1XMEB 2FJFA 1F5WA 4YGVB 4PMEA 2VR4A 2DQUH 4KBPA 2KMWA 4PJIB 1JV2B 5BMFH 2HN7A 3VD5A 4AE0A 3Q13A 3IT8D 2PXYC 3TPKA 2C3XA 1JK8B 2L0DA 4M5YL 4RMUA 4OB5H 4NO2B 3D2TA 1UM6H 1M57B 1VHPA 3PABB 1WAEA 4WFHE 1BAFL 3GC3A 1YEGH 2XNAB 3MNWB 4NUGH 4Y5YC 5E6IB 3T65B 5DRZA 1E4HA 1OM9A 4XZUB 2WIMA 3BQVA 4JANA 1EFQA 2OR9H 4I2XB 5DHVB 2ZWKA 4NOFA 5GZNC 5JHDA 1UKQA 5KYUB 4PJ9C 1YEJH 3CSTA 1U8KB 2P8PA 4J3BA 4NAJA 3DO7B 4IJ3C 4P48A 3CUPB 3FT3B 4TULL 2NY2C 2XG4B 4P3DA 1OQXA 3WXVH 1XIWA 3GJFB 3L4UA 2O1AA 5EDSA 4YHOH 2IADB 4Z7QB 2CAKA 3V52H 5ETUB 3FUMA 1QRNB 2ZUTA 1RHFA 2YOCA 3EGXB 1HEJC 2NY1C 3QWRD 3TJEL 3D39A 4CVXB 4G6FB 4B96A 4IGBA 1AKJA 3EF7A 3ECVA 3HPLB 4AH2B 4NZUL 3DUSA 1G7MA 3BRDA 5EF0A 4YVUA 4MJ6A 3QG6B 4LEXH 2DWTA 5I1EH 4B5EA 3M7OA 1RURL 2IAMA 2JQAA 5CJBA 2EINB 1IEAA 3JUZA 3GBEA 3BHBA 4XODA 5KSAB 3LOWA 4BWUA 4A1RA 3H9SB 2WOBA 4FXKB 2R27A 4HHWA 2E75C 4W9IC 3TO4A 1NAMB 2VZ3A 1U4EA 1NANI 5ESAA 2EUZA 1JPGA 3S88L 2WLNA 1X4ZA 4E9SA 1S9YA 3IDMA 4PJXA 2Y5EA 4JHUA 3VO0A 4Z7NE 4LIQH 1BIIB 3FTGA 1NIAA 3ZGIA 3CDCA 1JPFA 3P4OA 3EFOA 3UTPD 2VXQL 3DGCR 2J44A 5AD0A 1AYOA 2IAAC 4OUUB 1RP8A 4PJCB 2P5ED 2PF6A 5FM4A 3T77B 1ND0A 5DURD 2ZPKL 1UOWA 4LHUB 4NQCA 5EUKB 3FRPG 1UJ3A 4F7CB 4P05A 2BJMH 2E6PA 3FT1A 5B7EA 5JHLH 3WTYA 2Z93B 1RURH 3GBNH 5E0QA 1VFMA 3IETA 1M7XA 1SLVA 2JK5B 3OHXC 3RI5F 2GKIA 3ARUA 4KAQH 4QTFA 3VXRA 2JKTM 2XN9B 4M56A 4QTIL 2N0KA 2WNXA 4Z8FH 1GGBH 4KKCC 2I27N 4M1CC 4HWEH 5HHMD 4E41D 4HZLA 3OGOE 4UNVA 3GSXB 1N8ZB 4GAJL 4Z3TA 3QNZB 4JFOA 4QJ3B 2EUVA 6PAZA 1SYVB 1JWMA 5GGRA 2EADA 1QTYT 3D2UD 3ZL2A 1ZEAH 4EIGB 4RDBA 4NQVB 3G5VB 3CAFA 3NPSC 3RILA 4R96B 3DLQR 3EO0B 1MZYA 1NGYA 4OKVA 5T1LB 2EDYA 4K3DH 3IWVA 4OJEH 1QFOA 3MBEA 4MHHI 3KAAA 2WXIA 2MCG1 3CFJB 3WIHL 2X10A 4W9JC 2VSCA 4D9QD 3PWLB 5BW7C 2DQDL 3QYCA 5E2TH 5GPRA 5DHEA 3BWUF 4E5XG 3MV7B 4AZ8A 4KK8D 3BEVB 2WGXA 5E5RB 5CLWA 4Y1AE 4JG9A 3VFOB 5EIVA 1W91A 3EG9A 1DJIA 3V9CA 3V9FA 4PJEA 3DYPA 5J6SA 2P5WA 2NCEA 3QWOA 3I2CL 1DJWA 3AG2B 3WKNA 1YECH 2V9QA 4PJFE 2N7SA 3ESVF 2R8SH 3FU5A 4WKZB 5KVEE 5FHBL 3UJJH 2VDNB 4P06A 2W9LA 2D03L 2ZOOA 4UM8A 4J23A 1XAKA 4NDMA 2YRLA 5D9SA 2A7BA 4PVBA 2NTFB 1IGYA 4ANUA 1GJWA 3I9AA 5C3IA 1IEHA 1RQ5A 5C0BB 4OI8A 4OIIL 1CU4H 3T2QA 5IMKB 5DD6B 3LV3A 2H9GB 3UJTH 43CAA 5I6MA 1UEMA 2WVTA 1HYSD 3QK0A 1L0PA 1NPUA 3IJHB 4GBXC 2AMGA 5FKPB 3NJFA 3SB3A 4G59C 2YZ1A 3B2XA 4PVNA 2IQAA 2DIBA 3MOBH 5FW8A 2NR6C 5EZPA 4D3CL 2HMIC 2ZOTA 3E6FB 1OP4A 5A6LA 2WQAA 1CDUA 4B9ZA 4JPWL 1XH2A 4E9LA 3A6CH 5BRZB 3OKDA 3GJEA 4U1GB 5JDSA 4E68A 3BUYB 4FYTA 4XHJD 4DQOH 3JWNC 4TVSa 1GYAA 3QR0A 4WGWB 4NN6B 2XZCL 1E8YA 2DYPD 3AS3A 3J07A 4CILA 2H6UA 3CE1A 2IMMA 4YR6A 5HYQA 5L6YL 2OULB 5TE6L 3ARSA 3REVA 4G80B 1NGWA 4P5TB 5L2JB 5CINL 2YD0A 4R9HA 3UYPA 5C0JA 3WIFA 1XSOA 1VFOA 2MEJB 3GLDA 3QNYB 4YDJB 3KW8A 1AGEB 2A74B 1ROCA 3ZR6A 3Q8AA 1RIUL 4KVPA 4A6YB 5I2IA 4X80L 3B9KA 5JMRA 3VACA 5J9PA 3ISRA 4OAWB 5JQ6H 1EUTA 1ZCRA 2GAZA 1OE3A 5D2LB 3S37L 3V5HA 2I69A 3CVHB 2ZXEB 3CHRA 3G6JB 2J6WA 5I24A 1TTAA 1XX9C 4P5TC 5FUZH 5C07A 4Z7NF 5C08E 3LHAA 2AI0H 3SPVA 5L2KE 4LZKA 1K5NA 2Z7ZA 3P2TA 2XWXA 3T3ME 1KCVL 3HI5H 3WO4B 2WWKT 4HCRL 4BV1A 3KPSD 1ZA3B 2XIIA 5LGHH 3TWCH 1T04A 5TDOA 5D1QD 5IB2B 1U3NA 1OSEA 2YA2A 3FQRA 4IOFC 4R4FH 1XH1A 2J1KA 2Z35B 4U3XA 4YDMA 5FWQA 4ZFOB 2ZAIA 1MJJA 2OMYB 2F8VA 3ZXAC 3L3HB 1BFSA 4G1MA 3UTTE 4C47A 2YPVL 2CM5A 4B9IA 4MJIE 1UXWA 3QUXB 4NQTA 1SEQL 2ATKB 5E2WH 3ECQA 3EH4B 4JGJA 4MZIA 4POYA 1JPTL 4X9GA 2FD6H 1FORH 2EEDA 3OPZL 4JY6A 2QZQA 4WO4C 1KYAA 5JW5A 3EFFB 2WYZA 1TG8A 2QGBA 4U1SB 1UM4H 2IBZY 1MF2L 3K0WA 3VXSE 5D72L 2ESVD 3BQUA 5DXWA 4LSSL 2DW5A 4KHTL 3UACA 3ZDYB 3K46A 4M43L 3ZE0B 3K71B 2XTJD 4BD4A 2E59A 3D85D 2H0EA 4XCCH 5LWYH 1OPGL 3DURA 1S7VA 3IDYB 3WJMB 2FEEL 2IAMC 2VW7A 5GJSH 1FIEA 4P46A 3BE1L 4Y9BA 1MWAB 2D4DA 4LVHC 1AYRA 3QNXA 3HZYB 1H9VA 3IJEB 2DDQH 1Q90A 1Y6NR 5DTFA 5GS0C 1PFOA 1UXSA 4N20A 4MMZB 3QW9A 2EDMA 1J1OH 4C55A 1ZIBA 2G3XA 3VFOA 4LVEA 2FB4L 3LQAC 1P5VA 1RMFH 3G5YA 3BAIA 2ZXAA 3IF1A 4FNQA 4PWJA 4YXKH 3K74B 2VN5A 3FBKA 1YNTA 3KXFE 1BZEA 3QZOA 2E4TA 3G6AB 5IVXE 4L0ZA 2W95A 4I48B 1C16B 5KSAA 4ETQA 5CN1A 4B97A 3W0WB 1DTUA 4WKZA 4UIKH 4I0PB 4TNFA 1Z0NA 3B9VA 3AAZA 2FHBA 3MRQB 3IDYC 2WXKA 3MV8D 5C9KA 5I76A 4Z5RB 5AVWB 4MFHA 4A63A 2NY5C 3H8NA 3NJGA 1W8EA 4X6CF 2FJSA 3T65A 4AGNA 2FBRA 3RHWF 4C83A 4K3GA 5I1CH 1GXEA 3FQUB 3AC0A 3LKSB 4PGBB 4NB7A 1RUAH 3PWPA 1F18A 5AD0B 1T20B 1DN2A 2VMJA 4QXGL 3VVWA 2WXPA 1R3HB 2FZ3B 5J06A 1DQMH 1DVUA 3N1MC 4UIKL 3VSVA 4ZO9A 4L1BA 3EBGA 4PRIE 3QWQB 2GSGB 4AGLA 1LK2B 3F83A 1G9HA 5KANG 1F11B 1PJWA 2QQQA 1SJEB 2YGPA 5EC1A 3US9A 4UOZA 4CMHC 3UP1A 3QZBA 5C09E 2NDGA 3DSNB 3SDXE 1SBSH 3CZFB 4GKSA 2JK5A 1FJ1A 2BSEA 5TDNB 2EQDA 3HNVL 1MFBH 3K8MA 2G75A 5D6DC 1E3XA 1F3JA 4PJFB 5LB1A 5D7SL 4AYGA 4NHUB 2CGRL 3O6LL 2G9HA 4LOVA 4F2MB 3PABA 3RGVA 4PLJC 1AANA 4X6EB 4X0KB 5KVGH 1J86A 2X0UA 2YMXL 1CXHA 1UWGH 5GIRB 3T09A 5JO5A 3FUDA 4JO3L 4OFQA 1M1XB 4KKBD 1YJDL 4IBUA 3U4EA 1CLZH 4HHGA 2ORBL 3BPCB 2EC9U 5IBTH 4MA3B 4N6QA 5FECA 4Q9RL 4NPJA 4YDJA 4PP2B 2HT3D 1RZ8A 3VQMA 3UBXI 3QFGA 2GJZB 2FBOJ 3RUGA 1A66A 2VDOL 3U0PA 1JPTH 1JVKA 3S96B 4U1JB 5GGQH 3L1EA 4B9FA 3HFMH 3Q01A 4KZEL 1XF2B 3LKNB 3WHE0 5JIIA 4OLYL 3DV4A 1TFPA 3FFDB 3HI1A 2MHAB 1AR1D 4FRWA 4G70B 4OFPA 4PJBF 4U6XA 1UCBL 3V0HA 4LVOC 1O7SA 1S5HB 5IBLC 2GUYA 2EYRB 2VWEE 4GAGL 1VADB 4AJWA 2A1WH 1EJOL 1OAUL 4N87A 2XX0A 1R5VA 2AJYL 2WTOA 4JAMB 5FO9B 8FABA 3FNKA 2UUDK 2V9RA 4GBXA 3SDYL 2FVNA 1RZKL 1TO5A 4WTQA 2BVPB 2LHAA 3V6OC 3FL7A 4WFFE 2WCSA 4GSRA 1H3GA 1MCCA 1WS7A 2VLKD 3MAWA 5LN4A 3OWRA 2FWSA 4KC3B 3GXMA 1BQHB 1L7IL 3QULB 2WWMD 1IAIM 4HWBA 2YD8A 4ZD3L 1BYNA 3OMNB 3RL1A 4BZ1A 3PV7A 1K8DA 4KTYA 4M5ZH 2P24A 1XL6A 4K94C 1MFVA 1QACA 3QIUB 4HWBL 2N7AA 3S3PA 2H2PC 5FYKL 3B2PA 1XH3A 3TC9A 4CL7A 4WK2B 1DN0A 3T3MB 3BGAA 4WGKA 1YMMD 4L2YA 2WO3B 3VYOA 3DX4A 2VXTH 1JWUA 4FMVA 3DBXA 5TH2B 4AQOA 4M9PA 3ARFC 3SDDA 3EBIA 4APQB 5T1MA 3AT8A 3FMGL 1OB1A 3HG5A 3QAZC 1KCRH 1U95A 4XP6H 5LCVL 1TR7A 3VGBA 4HISA 4E9WA 1AI1L 1RUML 2ATAA 1OB1B 4D3CH 1WT5C 2AK1H 1KG0B 2PPCA 1Z9LA 2VDQB 4YSQA 5L4MA 4ODSL 1E9PA 3VFNB 4PTUA 3NACL 4E42B 1AZRA 4Y4FC 5C0CB 3HUJA 4Z0XB 2O5ZL 5FA3A 4XXCC 4PGBA 4DN4H 3C60D 4M00A 3P9LB 5DQ9B 4QHNB 1TZOA 5AVXB 4M93C 4C83B 3QYNA 1B3IA 1FAIH 1UOKA 4J8RB 4PJDE 3NK4A 2GBAA 3I3DA 1RFDL 5DVLA 3KGTA 3FUEA 3ARRA 3H56A 2YXMA 1MCKA 1TSRA 2WXFA 4U3HA 1ADQH 5H35B 4RGNE 1S9XA 2ZAHA 3D7PA 4JG1H 1FA4A 2YAOA 2NLJA 4KTEH 5A3IC 2Y0SA 1R24B 2UY7B 3MRMA 2ZCHL 1K5NB 1ZSHA 2DQHL 4P2OC 1EEQA 1LGVA 2DI7A 3TCLA 3DUUB 4EKJA 5JA9A 3PU7A 5DRNA 1F3JB 2NTSP 1OT4A 1YY9D 2BNQA 3B2DC 1NFKA 1KMGA 4J1UA 3EZ8A 1CS6A 3DUHA 4XMUA 3BZFB 3BP4B 3QQ3B 1Z32X 3QQ4B 3K6DA 1CD8A 5E2UL 4MQXD 5CBAB 4DK6A 1SPDA 3MLRL 3HNTH 2C26A 3MACL 1AGFB 5DFTA 4ZMXA 3RPKA 4YFLI 5HDOA 4QXTA 3EYUL 4R5TA 4KXBA 1T5XA 1OKEA 3BC9A 3PP4H 1QUPA 5CZXC 3GMOB 5E8DL 3QCVL 5IMMA 4KY2A 2AJ3A 2X6MA 3LNHA 1WEJH 2BRQA 5I17B 3TIDA 3WS3A 1L0XA 4NNPL 3MV9B 1DVFD 2HLFD 4XP5H 5LUMA 4OGXL 4KZ0A 4H1LB 2NXZB 4PJ9D 4GMSL 1AO7D 1A6VH 3VAEA 5LAXA 5AB2A 4FLOA 1W0VA 2UXTA 2OK0L 2QQNL 4N22A 1AO7B 3VXMB 2KLSA 4CMMA 4LOFA 3CN3A 5KSAC 5F3BA 1AIFB 5E4IA 4B9JA 5INCB 3SE4A 2TAAA 3AB0B 4A7GA 3GUTB 3RPIA 1MJ8H 4JX0A 4R4BB 5I75B 3GEFA 1JI1A 3C6SA 1ZVNA 3O9WD 3P4MA 1KLFB 3GO1L 4H25B 4NJ9H 1ET5A 1JP5A 3HPLA 3SPGA 5A2CA 3QDJD 5IQOA 4OZIF 2A9BA 5BVPH 4ZTOL 2AQRA 3S35H 4ZOBA 2LQRA 2VITB 4KROB 3UTSB 3S3CB 5IHBA 3POHA 2P5WD 2B7DT 2K70A 1GY1A 3QAQA 3ISWA 1BJMA 4DETA 1IGYB 4HUNB 4IHOA 4NDMB 1E67A 1KGCD 4OFIA 3BWUC 3UTZA 3QPQC 1GCFA 3W39B 4EDWL 1J12A 3O3BA 3ZJAA 2YD3A 1B4JL 1CI3M 1WYJA 4NS0A 5JTWA 1LK3H 5MEPA 1I9IH 3MRRB 2D4FA 1F6AA 1AZCA 1F4XL 1ZAGA 2NOYA 5I1KH 4PJAA 3GD1C 4FZEL 4GO9A 4M62H 2JKJA 4HFWA 1D5IL 5GZND 1MIMH 5GSVB 4BFJA 12E8L 2NXZD 3Q0HA 4HFWB 3HBGA 2YS4A 4PJ9B 1QLEL 3JTSB 4XOCA 2APXA 3X3GL 3MV9D 1K2DA 4J39A 3LPWA 1JVOA 1EGJH 3GI8H 2XT1B 3EO1A 4ZX5A 1U42A 1BXAA 3BAEL 3F6LA 2H0PA 4PP1D 5D96C 2ZSWA 3MJ9A 3MOAH 1EXUA 2X4NA 2VDNL 3FC8A 5KYYB 1CDGA 4EZLA 4QRRB 4YHOL 2ENQA 1J1XH 1S7RB 2Q6WB 3MV01 3MJ9L 4FFZA 3V6OA 3D0LA 5DYFA 4AEHL 4GI9A 4RGND 2A73A 4G6JL 4ZYKB 1TTBA 1PMYA 1AZUA 3CN0A 4UANA 5JHAA 4WW2F 4QKXB 5CGBA 3UP6A 1NIDA 5E9DE 3DURB 2UZXA 4H26B 4QCIB 4YHYC 2NY4C 2Z7WA 4NUGL 1JERA 1NICA 4XCFH 4LQ1A 1FFNB 3Q1SH 1AHMA 2F8IA 4YX2L 4YDNA 2QHRH 5T1LA 4ZMQA 4YC2B 4Z3EA 2X4TB 5CIPA 2WWOA 1I7UA 1OWRM 1IAII 4X6DE 3NK3A 2J8OA 4B6ZA 2DB8A 3CZSA 4XOEA 1DFXA 5AAWC 4R97C 3U25A 1NOFA 3H9HB 1PDKB 3TT1H 4I13B 1JXGA 5HYSG 5I8OH 3H9HA 4RMSA 3P4OB 1CTNA 5J57B 1B9ZA 2P7TA 3GMOA 2OX5B 1JZGA 2B5IC 1KB5B 3QHFH 4JO8A 1OK0A 2FECL 5GRJL 7FABH 1GZHA 2XC8A 2QPSA 1Q1JL 2IFFL 1YMMA 4P49A 1HHGA 4G6KH 2YFNA 3A4FA 1NGPL 3QDMD 4JFHE 5DJDA 3UAJD 2MNWA 3UZVA 2I5YL 4PWIA 5M7QA 1TCMA 1VCBC 4LSVH 4MD0B 3C2SA 1AFVH 3RGVC 2H2PD 1HWWA 4QRAA 1OAYL 4Y16D 1NFAA 2Q8AH 3LRHA 4ALAC 1IGIL 5A2LH 4YSPA 3AUWB 4L3AA 1JRHI 3ZKMD 4D9LL 3LCYA 4FS0A 4ZUTB 3OZ9L 5BXFB 3RKPA 2EKSA 3ECWA 3ARFD 4UMGA 3VXUB 1YG9A 3G9AB 4ONFL 4FNRA 1WT5A 3DIFA 5B1AB 1JUFB 1TZHA 3KNBB 4R7XA 3VI4E 3MA7A 1DDHB 1K3ZA 1GTNA 3PAUA 4H8QA 4MS6A 2O72A 4GG8A 1HXYB 3UIYA 5FUCC 2VXVH 2WYTA 5E70A 5ERWB 1DFBH 2EILB 4TOYL 1JGEB 5HP5A 4QRTB 5E1AB 5F6IC 3GSUB 4B3VA 4HIEA 2Z31C 3BKJH 3QEGH 4XNQB 1KCUH 1LILA 4ZX4A 2J2ZB 3IN0A 2BMKB 4NKIH 4K5PA 5D7LB 3QCUH 1J18A 4A67A 4PY7B 2QLVB 1ZJBA 4DGVH 1XMWA 4K2UH 1M05A 2ZP0T 1C5DB 3HG1A 3L16A 4KH2A 1FYTB 5H37A 3F7YA 2HSIA 1SQ2N 2XXMB 2HKHH 2QFPA 2F7QA 4ZAKA 3WTWA 2ATPA 3KHOA 1EBPA 4NKOA 5ADOL 3D1MC 1DSFL 4L5FL 5I1JL 3X12B 1I8KB 3HUJF 4YHPB 4TTDD 5E24E 4AC2A 1JPGB 4PRIA 2IH3B 2HX8A 5LBVA 3R8QA 4G83A 4E5XA 2Z31D 3D2UB 4LLWB 1B4LA 1PCSA 4WU5B 4P2RA 2Q8BH 1P4LB 3NCWA 1OSYA 2AK4D 4Q2ZB 1G7IB 1FL5B 1GRWA 1LQBC 1ZT1A 5F97E 4JEGB 3NIGB 5D9SB 1ET7A 1E40A 2TRYA 1CGYA 1GCYA 2XN9A 4KUCD 2VDKH 3WNOA 3P73A 4Z77A 4KGLA 3JV4A 4RCAA 3BPNB 1R3KB 4DN3L 3IGUA 4HCRA 1KBBA 2Z3FA 2K8QA 2X89A 2Y7NA 2KBGA 3IAGC 3WEMA 3H9ZA 2FSDA 4JG5A 2BVPA 5A2FA 4H8WL 4K5NA 4L4TA 5IQLA 4GQ9L 3C6LD 2CWRA 5DD3H 4PSPA 2WB1A 3QO0B 5AG8A 2CRIA 3BVUA 5C6WH 4PTUB 2I9TB 3EYOA 4JMNA 2P5EB 1ZT4A 4HWZB 3LN5B 4NUMA 3CFCH 1ZLWH 2M26A 5J6GA 5J89A 1CICB 1GL4B 2ZCZA 1Q9LA 3ABKB 5D7EA 3MBEB 4PTTB 3BUYA 2W07A 1A14L 3MO1B 1RXLA 1VEOA 4V1DE 5F9WC 1KLGA 4OZHF 1ECZA 2HP4A 1EVUA 4MMXA 2X4SA 3MREB 4IBYA 5IESL 1COBA 4Y2OB 4DESA 4XMXA 2CHZA 1S9XB 4TYUA 5HHOB 3V95A 4HHAB 4A66A 2OSLA 4UOJA 4AYBA 4JM4L 4RFEB 3PWNA 5I28A 5DF0A 3ULAB 2DMGA 4MMXC 2J8UB 2F9BT 3NESA 4N0FB 4B7IA 1ZT7B 1Z9PA 1XO8A 5CEYB 4PWKA 3P02A 2Y23A 2FYVA 5ADOH 2COQA 3ILQD 1BYOA 4FQXB 1A3QA 1X9LA 3BKYL 1HSAA 3VGAB 3D48R 1CK0H 3HBZA 4WWID 4IMLA 2OJZL 3N85H 1A6ZA 3HHSB 3LNGA 3PPSA 4F9PA 5E9DB 5KOMC 3ARDA 5J0BA 1JGLL 1KCUL 4WEBL 4WSKA 1SXAA 5DJ0A 3ML9A 4K94H 5EBLA 4K8RH 4YIQB 5T1DL 4P5MA 3RWDA 3CVIH 5GGUB 4L1TA 4ONGH 4HXBH 4MJJA 2J3SA 2OMBA 3K6OA 1KPRB 4YEFA 4XC3L 3F85A 4MNGA 4QJ5B 2BDNL 4FQCH 2XG5B 1NC4B 1GGCH 1OSPH 4WW2B 4B9YA 1ZLDA 3H42L 3TL5A 3KS0H 5HD8D 3OKDB 3OJDB 4PR5B 4NQCD 4ONHA 2A9MH 4D9LH 1MIEL 3PGDB 1NCIA 2I25N 5JHBA 1GIGL 5KYUA 4OZFG 1QO3A 2XN2A 4WQOA 4BYHA 1AFVL 1G9EA 1NDMA 4XRCB 5IQ9A 2I5YH 4MAYC 2PXYB 5LDSA 2JKWA 5KYYA 3HR6A 3ZT5A 2ODHA 3BN9D 1NKGA 3LKRA 3FO9B 4IRJB 4WFED 3VXNB 3OXRB 3QEQA 4LLUA 4I77L 3QQXA 1OP5K 4F7PB 2EVJA 3C5ZA 5HJDA 2A9DA 4U4BA 2VXQA 2JJUA 1HN1A 3O2DH 5HDQH 4BZ2A 4CBZA 2B08A 1JHLL 4J12A 4ZUVB 2APVA 3JTTB 4R8WL 1QSFB 4M6OL 4PV8A 4Y1AD 5CUSL 5KVDL 3DX7A 4NENA 4X6BA 2K4WA 4EDXA 1WK0A 2B2XH 2CH8A 2UYLA 4JRXE 4BZ2L 2XFGB 2VNCA 1AKJD 2Z93A 4QXUH 4JVPA 4D0CA 4YHKL 4BH8A 4NFDA 1D7DA 4YX2H 1HHIB 4ONOA 1JTPA 3GMQB 2AXFB 2Y2TA 2GJ6B 3IAPA 3H6JA 2W9EL 3KD4A 3KM2A 4U6HA 4YHML 1JI2A 3V4PA 5T3ZE 3HPJB 2NUPB 1MCPH 3LAFA 3A22A 1GW6A 3DKHA 3LNDA 4F91B 2X05A 4L4VB 4MBOA 2ADIB 4C8XA 2F0CA 4E41E 3N1PC 1J1XL 3NZHH 3FB7A 2ZKXA 4NP4H 3V8CA 1W2KT 2XWTB 4KKPA 1IAIL 4N5UA 2HG0A 4PAZA 5IEKA 3K5SA 4DKEL 1DQTA 5JXEC 1HC1A 3QUMA 3IAQA 4WNSA 3RTQD 4E2OA 4BK5C 5F7EH 3GK8H 1C7TA 1TJGH 2O6PA 1OP3H 2MKWA 3ARBD 4DP2X 1XF4A 2MH4A 5CEZE 3LIZH 2VOTA 5CO1A 3X13B 1WE5A 3QFJA 5F1SA 1ERNA 4E9XA 3RVTC 2YWYA 1TIUA 1G9NC 4H0IA 4D2NA 5C1MB 5C7XL 1GGCL 1OSPL 2FX8H 1F6LL 2DJUA 5ACLA 1XR8B 3B83A 5LCVA 2MQGA 2C7UA 2X9YA 3QI9B 2AANA 4S1QL 3EHBB 2V3FA 3GFUA 1F90H 4RH4A 2C1PA 1Y18A 4K7PY 1A9BB 4Q89A 5T1DH 4CNIA 4W9ZA 3PIQA 3EXLA 1FVEA 1QMUA 2G5BA 3L9YA 3O8XC 4PRHB 1L9SA 1A9BA 3FO1B 4DW2L 1U36A 3CH8A 3I75B 3QC5X 1QEWB 3HRZB 3F58L 4XZ4A 4DEWA 3A67L 1Q9KB 1XGYH 1IC7L 4XOAA 1KXQE 1UWXK 3GHEH 4HJUA 2PXYD 3T0BA 1I1AB 2RQEA 1U3HB 3WMQA 5F9JA 4DJMA 5C08D 2O6FA 3Q5OA 3ZTNL 5SWZE 5AKVA 5C0AD 2VLJE 1ONQA 1KCBA 3P54A 1JK8A 2WWNA 2EDFA 3QJZA 1HXKA 3F65A 4F1SA 4KNTA 4FP8H 1JNLH 1KC5L 3HRZC 1R34A 3NQKA 4ILDA 5HGAB 5HHVL 4RETB 3WUZA 1T0OA 4Y4KD 5KEZA 2CDEA 1A3LL 1TSHA 1DLHB 3L13A 4J7RA 4AQ8A 2D3VA 4Z7UA 2YD2A 1L9NA 3D06A 2XWCA 4JFSA 4ZDHB 3W9EB 3WNKA 2FQDA 2ZUUA 5FCUL 3WXWH 1MNUH 2MCMA 4ZTEA 1NGXA 2H41A 2P43B 3H9SD 4LASH 3TEZA 4PHXA 4BFIA 1N59A 2VR3A 3KVQA 3UYRH 1RLBA 4FFVC 1BAWA 2OX5A 3JWOC 4XH2A 4XP5L 4X0KA 4MD5A 1N3NA 2HB0A 3A6BH 4Z7UF 3JWNG 2ZWYA 5IHZB 4P2QA 4FAAB 4NCC2 5D6CA 4YXLL 1MCHA 4CDHA 4DUXA 1RZJH 2YR3A 1NFDF 1XT5A 3RHWK 5C6PB 4HIIA 4MAUH 2R69L 1PD0A 2RH0A 4LO9A 3MLRH 4FQHA 4LU5H 5DZOA 1NLBH 1XF3B 2QQLH 3SOBL 4BJLA 3EH5B 5DJAA 4YFEA 2E6QA 2ZWZA 3RIFF 2OMTA 3X17A 2MQ3A 4MKMA 1TPXC 3JTTA 3NABL 2NY3C 5AKTA 5I9QB 1PJ9A 2WLIA 1J10A 1C08A 3E80A 3HE6C 3SCMD 1T7VA 5KUMA 3TIEB 1LD9A 4XPTH 4YHIA 1RUKL 4M93B 4YHNA 5TE4H 4GFTB 4KTEL 4HULB 1C8QA 1B3JA 2HJFA 4Z95H 1KB5H 1LE9A 3M46A 3VXRE 4G11A 4OKDA 5EU6D 1YN6A 4ALAL 1DL7L 2AXGB 4TUUA 4X83A 2CHWA 3D12B 4GG6F 3GT6A 4GJTB 1RZPA 2OXGA 5I1IL 1FAIL 2XIBA 2XV3A 5D1QE 3WIFB 4X4ME 5CLYA 2HTKC 5HHNB 4KMQA 1AC6A 5BO0D 3HR5B 5FK9A 2V5TA 3GHEL 1IC7H 1QFUH 3NACH 3FB6A 4U7SA 5FO9A 4MASA 5FUOH 5FYJH 3DPDA 2ITCA 1NWPA 1FL6B 4K9EH 3MKKA 2XVBA 4JDVB 5E2VL 2AGJH 1IIKA 1LVEA 3QUGA 1B2WL 1F4HA 3D09A 1PNCA 5CJOL 5EEWA 1XH0A 3MNZA 4NKIL 4WF7A 4XOBA 1WC7B 1IKFH 3CFUA 1RJZA 5DD5H 5EF2A 5KG9B 3LD8B 1IGJA 2HRHA 3ISYA 3GMMB 2DEWX 2VXTL 2FX8L 3PNWA 4XN5A 1S7VB 3NH7L 5MERA 3WFDH 2V7HB 4MD4B 2VLKB 4WI8A 1I9JL 2DQFB 1IGJB 4M7KH 4BK4A 4ZMOA 5CJQH 5I18L 4HT1H 1RUPL 5TQ2L 4JK0D 2OMXA 1MCEA 1H0DA 2NR6D 2ARJB 4M3JA 3UBXG 1TXKA 1INDH 4N8CH 4OZGB 4Y2DB 1WTGT 5E6ID 3GRWA 4LPUA 4HYTB 4QY8B 3ULSA 5I0WA 4X7EC 1T03H 3OZ9H 4HJJL 3EJRA 5KVEH 2KQNA 4BFBD 3N5AA 3LX9A 4HPYH 4BQ8A 4AC4A 2V2WA 4GRWE 3KLAB 1E8XA 5BO1H 5LGKA 3H9SA 3KXFB 2EDBA 1OHZA 3H54A 1FZKA 1Z3GL 5TGBA 4GW4B 1NPNA 4YK4C 1T5WB 3QFJD 1G84A 4N2FA 2IJ0C 2PN5A 2ESVA 3BQUD 4M7LH 3W0WE 1PLAA 3DRQA 1T1ZB 3VWKD 4GQQA 3QWOB 3PWVB 1UH3A 4PCYA 2BVEA 1KTKE 4GFXA 4XMVA 4KO9A 4NYLB 4S0TD 4K7PL 3ZMEA 3P9LA 1J0JA 2CJTA 4UUJA 2X87A 3IFLL 2IPKA 2PPDA 4KO7A 4DK3A 3VFVB 6CGTA 1LO5A 3QXAA 5C07E 1LK2A 3OKLB 1YPZA 3BN3B 4XNDA 3WG7B 5DUJA 5EZIL 5E8OA 4XAWH 4PJ6A 2FLRT 1NMAL 1G7QB 2R4SH 3ECBA 4DIXA 4ZUSA 2ZUVA 4N3UA 1KENH 2WGNB 4A04A 4EOWL 4HU8A 3CXHJ 5DUBA 5AOLA 3QT2A 4TMPA 3SDXB 1OP3K 3QUYA 3WYRA 5J8OA 5ANME 2V5SA 2IQAB 3ZUCA 3JUYA 1W72A 4UT6L 3U83A 1FZOA 2XXFA 3ESUF 4ODTH 1MCWM 2IV9A 2J20A 2F58H 3QQDB 2V2TA 4HC1L 3FT2B 3F7VB 1TDQA 5CF3A 2YAEA 2ERJB 2NY6C 2R0WL 4AIZA 5DZLA 4LEBA 2D7NA 5BRZA 4Y9GA 3MROA 3QUZD 4PRNA 1W15A 1XXDC 2EEXA 4U7MA 2K6WA 3LZFH 1G7HB 4M29A 2L4OA 5EO0A 3MXWH 7CGTA 3GSVB 3EADA 1IBGH 3LH2H 3N42B 1L9PA 2YSTA 3HNVH 3GZPA 1E4XI 3V0WH 3P4LA 1R0AH 3CHQA 1UJ3C 3M1BA 2E56A 1KJ3H 2ZG1A 2UYLB 4LCYA 4GI8A 5EZJA 1EXUB 2X4NB 3MRHB 4XP9L 5JOPE 5HHOA 1O6VA 2VZOA 2ZX7A 2GHZA 5EOCJ 5K9QI 1G1CA 1V8HA 2PTVA 3BT2H 4IS6A 2QGEA 5FDYA 1G6RA 4CMHB 2WPGA 4X98A 4PD4K 2R83A 3FHEA 1DQML 3EGXA 3Q48A 4IIQA 4OCLC 3WFDL 1FVDB 3NVQA 1JXKA 2ZUQC 1EAPA 3P3RA 3SOTA 1D5IH 4UDTB 4AV5A 3U4AA 3MLUH 3OAZK 1XGQA 4FQIL 1IKFL 1FFOA 1OALA 6TAAA 3DX0A 1LK3L 3FTSA 2LOEA 3DRTB 3S34H 4XNQA 1N70A 5EUOB 1J9SA 4D7BA 1BF8A 4EDWH 4WNQA 4CADA 3TVMC 1PQZB 3NTCH 4UOW1 3C12A 3L81A 2OJEB 5DZPA 2KLTA 1ASQA 2IBBA 1MCDA 2CKNA 3PWJA 4FQ2H 4YBHA 5E9DA 3GTNA 3WY3A 5FB8A 1M3JA 4XN4A 4DSYA 4HGMA 1VKXA 4ODVH 1RJZB 4YXKL 3KL3A 3HAEG 3N0AA 4RVBA 3UTZB 4I18C 4O2EA 2ZWNA 1KYOJ 4XAKD 3KJ6H 4NJ9L 4AMWA 3EOAB 1FNGB 1XTMA 2CNYA 3HNSL 1PL3A 5EORL 3RX7A 5ALCH 3L3JA 4ZPTB 5FCSH 1ETZA 1U21A 3BH8B 2YPLD 5I73C 3VXOB 1EHXA 3IFNL 2WB7A 2XTSA 5IFJA 3RTLA 4OQTL 3BE1H 2OI9C 4S11A 1JVLA 4XN8A 3X11B 2FK9A 4PM1A 1Q8MA 2ZOLB 4L29B 1FG9C 3FTWA 4KHTH 3NIFF 4YBQD 2QV4A 1GC1C 2Z31A 3WD5L 4GMSH 5GGSY 1IAKA 2CDGA 1EXHA 3MBED 5AOZA 3F12B 2A6DA 4NNPH 5G4OA 2X7LB 4PRHE 2AVGA 2TRHA 3MSPA 3R0MA 1GYUA 3VG9C 1BZOA 1QRNA 4YXLH 5SWSA 1KGYE 2JB6A 1Q9OB 4HIJB 1IL1B 2ZAGA 3N06B 4OJAA 2VABB 4PGCA 3CFNA 5FA3B 1WIUA 2BIIA 1ZHNA 5EIQA 1T2XA 1QLFA 1JGVL 3P40A 1KEGH 3VM5A 4FCAA 3JWOL 2L7QA 1MNUL 4RGMB 4OLZL 2DBLL 5ABAA 5I5MA 3SPCA 4NC0B 1MW3A 1KFGA 5AW9B 1EJ6A 4M4RB 1DO5A 3WTXA 2EZ0D 1BPLB 2FJUB 3NCFB 2QR0B 4OCMC 1DBAH 4J2QA 1D2PA 2AQTA 5HSFA 5BV7H 4DHLA 4PJ7B 2NX5E 1T0NB 4JPVH 4WY7H 3FBQA 2CR0A 2Z4QB 4ZOCA 3G04B 1TU2A 4I8DA 4U2YA 3UZQB 3T71A 1N8OE 3O4LD 3BEWA 1YC8A 3K6FA 1U8LA 3KPSA 5EU7E 5G5DB 1YEKL 1NUDA 4GW5A 5DS1A 3QQ9C 1DJYA 5H8DA 4O9HL 2FWOB 4LPCA 3QIBB 4KK8C 1P4IH 3S35X 1J8HE 3A67H 1OB0A 1CFTA 4N2KA 2W65A 2AQ3A 4GOSA 2KLRA 2J88H 4UOQA 1HHJB 4Z77B 2YGOA 4ZPVB 2BY3A 1KCLA 1LO3H 5DU7A 4DGUA 3IK2A 2FX9L 3MV9E 3FH7A 1KCRL 4XP6L 4LSPH 1G9MC 3VG9B 3LKQB 1XF4B 2WWMC 4CN1A 3CX2A 3CPLA 4NBYB 3K3QA 4KKBC 4ZMZA 3VI3B 3SDDD 3MRNB 1WD8A 2Y69B 1AGFA 4OZFB 4CMMB 3ARGD 2Q3ZA 2ZICA 1ITCA 2CG9X 4M1GH 2QPFA 3MOBL 4H0GA 4ECNA 4PJ5B 1FNLA 2XBDA 1FHNA 1NEZB 1PY9A 1U91B 1ZIAA 4HV8B 3KR3H 3X1GA 3ULSB 5E9AA 1I8LA 1OD9A 4LRIC 2C1PB 4OM1L 2XQYA 3MV9A 2XZQH 3LPPA 2A6JB 3NJVA 1C5DA 3HG1B 3ZKQD 4UV4L 3UBGA 1OW0A 3O4OB 2C8NA 1SUHA 3MGTA 5EIIG 1KACB 1IQWH 1YNTF 1JNJA 2QQKL 4ZUUB 2KS0A 4RWYH 4GW1B 4LRIA 1E4WH 4QDGA 1EDYA 3KYNB 3B5GA 3ALPA 5F9JB 7FABL 1CYWA 4PREB 4MXQD 1AGDA 5DQ9A 3WELA 2WC7A 3ARQA 3P2DA 3UROR 4XMLH 2A1WL 4L0YA 1N7ML 1TQUA 2RFXB 4GKLA 3TPUB 3JV6A 4XWGH 4JFQB 5H4YA 2DLEA 5KBLA 3RU8L 1YNKH 4OV6F 1MAMH 4YNYB 2I07B 4X99A 3DJSA 2VM4A 2WXRA 1O5DT 1E4KC 2PW2A 3JV6B 2DQDH 2FQGA 3G08A 1FFPA 1QTPA 1SMAA 1ZLVH 5HDBE 4P07A 3AU0A 3KPNA 3QUMH 3TBYB 4QNPE 1XEUA 2NY4D 1VZHA 3UFIA 32C2B 3LNIA 4JO2L 1JZ7A 1G9NH 3V7AG 4OZGE 3VJ6B 1F13A 5B21A 4LL9A 2AW2A 5L7XL 4PJ5D 5EBLB 4KZDL 1FYTE 3ARBA 5A40E 1P7KB 2ORBH 2HFTA 4GAJH 1FV1B 2GTZB 5TPWL 4JPKL 1BDYA 1YYLL 2FO1A 1UWGL 1E30A 1IBHA 2GTWB 3G5XB 3VXPB 3Q3GB 4HWEL 2ZIDA 1CURA 4P9MH 3LDBB 4Z8FL 4WW1B 3VXPA 3HUJE 4LLQB 1CMOA 3VX0A 4JO2H 5L9DH 1GVIA 3CSBA 4JN1H 4QKTA 1DZBA 2RIKA 1GA2A 2P9RA 4QTHA 4N8VB 1UM5H 4QHUA 1JTOA 3OR7B 1QP1A 4RFEA 4Y4KB 4B95C 1S7SB 1W80A 3PJLA 4Y7MA 5KYWB 3IYLW 4D7PA 15C8H 3RU8H 3CK0L 3PHQB 1DJGA 2CBOA 5D2NA 1AJ7H 1N7MH 2PYFA 2VXQH 2OKMA 2VERA 2EXTA 1JZ3A 4FXKC 3OZLA 4XMLL 1NMCC 5DVPA 1ZVYA 3RJQB 3WE6B 4P5KA 1R3JB 4BSWB 1QASA 3DX7B 5ANMB 2FWOA 3SJVE 3UERA 2VB5A 2F74B 1ZV5A 3DJRA 3QZWA 4LVOB 5MHSE 5B1BB 1LWJA 4BQ9A 4WU7A 4DT2A 2FJHA 5JIQA 3DNKA 4POZD 1OF0A 3VXSB 4W9KC 3AXLA 1VFUA 1S78C 2FJHB 4YAQB 2VMCA 2KQMA 3WGVB 4HLZH 3LKQA 3CSGA 3MXVL 3CFDB 4DQAA 1IKNC 4JZOA 1N4XH 4JN2A 3PL6D 2ITDA 4JRYD 3ULVE 3HJ0A 2B3RA 3FT4A 1LEIB 1UXWB 3GXIA 3QUXA 4XC1H 1KGXA 4P2QD 3DV6A 4G9FA 4ZFGL 5CAYB 1RL1A 4PH8A 1NCAH 2P5WE 2J6EA 1CCZA 1WAAF 2ICEC 4BRVA 4O02H 1LXMA 1M71A 4LSRH 4FLRA 2YPLE 4P4RB 3S36L 2VWEC 1LEKB 3U36B 1FJ1B 4GKOA 1F2QA 2GB2A 1BGXH 1JGEA 4GRWF 2RCSH 2ZOWA 3BZEA 3ETTA 4AEFA 3FQWB 2FEJA 3ZQ9A 2YKLL 4MMYB 4JB9L 2CO4A 4AJVA 3HIZA 3CXHK 1G0YR 1MW1A 1S8DA 4FE9A 1NCOA 2ALAA 4FI8A 4MNGE 4NKMB 4P46B 3VWKB 3V79C 1E9PB 4IBSA 4O9HH 2PP7A 4OGYH 5GQBA 1UM6L 4WHYG 3B2UD 3HE7B 1MCQA 2LFGA 1KPVA 3VSUA 5DUMH 1T21B 2WAHA 2Q2EB 5E2UH 1BVKA 1TZGH 2GABA 4LEOA 4F58H 3TPUA 4B5ZA 5DMKA 2V33A 2YUXA 2X89D 2Z92A 1LO5B 4UTCA 3R06B 5BV7L 4PP2A 3TWCL 4Y2DD 4FABL 2H6PB 5DHXB 4UB0L 2VJXA 1PX4A 1USZA 2YO3A 5K93A 5EDXA 3GPSA 1K4DB 35C8L 2VM3A 2N56A 2J21A 1A8JH 1Q94A 1SY6H 1W0YT 2GBUA 3FQRB 4K55A 3T2NH 4NERA 1T0NA 3DV4B 2X9ZA 1D6EA 5FUZL 4MSWA 4Y5VB 1ZGLM 4YE0A 5I82A 3T0EA 3RTQB 2B20A 4G6AC 3V5DA 1BFVH 2Y3AA 4ZAKD 4F58L 1JRHL 1TCRB 4HOXA 5K1NA 4WAFA 2A9CA 3D3VA 2KDGA 2F7PA 3AUVA 2HFEA 4WWNA 4PJEF 2JLPA 5GGTL 4CU6A 2HKFH 4YE4L 2NY3B 4TF4A 3MR9A 5JW3L 3EOBB 1RY7B 4A38A 5ECJE 3ZYZA 3BQUB 2QDVA 4DTGL 4EI6A 4DGVL 3TX4A 1OE1A 3LRKA 3FRPB 1U8KA 2PWGA 3FK3A 2X4OB 2MCAA 2DQ6A 1VFBA 2AQ2A 3NN8B 4JDZB 2CIIB 4MA8L 1C7SA 2EKSB 1AQKL 1E5YA 1H6TA 4Y4HA 1PAZA 3IU4H 2CO3A 1OK8A 1ZHKA 4WCYL 5EZJB 2SEBA 1WPCA 3V0AC 4O02L 2AV7B 4Y4HB 5AVYB 3IVKA 3FQ4A 4BA8A 1GAFL 3OQ3B 1TQWA 4UNTA 3V6ZA 4PJ5A 4OZIE 2RALA 4JKPH 3NA4A 3HKZA 3AWGA 4WO4B 3T4YB 2FYYB 3T04D 1AD9B 1RSFA 5A43C 1JV2A 1C16A 2CM6A 5JMOC 2CMRL 1U41A 3SGEI 1V54B 4WTZG 4HAGA 4U1MB 5KYXA 4NGHL 3STZB 2MCPH 4KRPB 4H2AA 2ED9A 4LNVA 3IXTB 3CSPA 5DEZA 4J3OD 4NKOB 1G7JB 1DEDA 4UDUA 1T5KA 1A25A 3S34L 1VKXB 4K8RC 2LVCA 3HG2A 3BAWA 5FB8B 1MQ8A 5C0BA 3IE4A 3BXNB 1UCBH 4ZX3A 3B37A 4ZNEA 1R17A 1V3MA 4BINA 2Z1KA 5HDWA 3KJ4C 4GSUA 1WA1X 4P2RB 1Y6KR 1J1PL 5E9NA 1D2OA 2NQDA 4IHBA 4XPFH 3UZVB 3OKLA 4L8DA 3UC0H 2A0LD 1M9SA 4HS8H 4XP9H 2JE8A 3GIVA 3SDCD 5BW7A 4JDTH 3SGKA 1JZ5A 4F3FA 2FQEA 4J4PD 4V2BA 5IFHH 2XZZA 4HEPG 1AXSA 4D8PB 3HBQA 1CICD 3TFKD 3WFCL 1UD2A 3ZDZB 1C5BL 2IOIA 1NLDL 1PZAA 2BSRA 3LZFL 2V5RA 3VXUA 4XVTL 3FQUA 5DVNA 5EO1B 2R0ZL 1CLZL 3TP4A 1HYRC 3UCQA 1QFWI 4OUOA 2WV3A 5E6IC 5ALBH 2V9UA 5KG9A 4NZRL 4DKFL 4NO3A 1G9MH 5FKPA 2YMXH 3DPBA 1CR9H 1Z1WA 5TPWH 5AWNH 2X53A 4MA3A 5ALBL 4YZWA 5EZLB 1OW0C 3C6LC 4ODTL 1I1FB 4NQUA 5DMJB 1WV7T 2NY0B 2Q2LA 2HJLB 2XQYG 4BXVA 1CUOA 4EEEA 5D7SH 1HEZA 3LN5A 4PRNB 4CN6A 2Q7YB 3UTQA 4GMTH 3TFKC 3EBAA 5D7KE 4PGEB 4L9DA 3FZUD 1A0QH 1ICTA 3PY9A 3ETBJ 2FNBA 4K71B 2Y9RT 3QXDA 4NPKA 2NSMA 1FDLH 5L0QB 3QUYD 5T3XE 3M1BB 2FEDD 4A37A 3RTQC 1ETJA 2O5XH 3DX8A 1GY2A 5AZ2H 3MPCA 3P11L 1ILSA 4LL1A 4KQ4H 4PJEE 1O75A 2DIAA 1RVFH 3U0TB 1M1XA 1PBYA 3IETB 3P73B 3DMMD 4GS7B 5I1KL 2WSKA 1EBAA 5DJYB 2B9AA 3D3VB 4HP5A 5CFHA 3BVTA 1A7BA 1BLIA 5HI3C 4Q2ZA 5JXAH 1LLAA 1CF1A 1WBZB 2VZ1A 4UTBL 1SNRA 5CP3A 4RWYL 3ZOAA 4XMKL 3V0JA 5HVHB 5C0IA 2VSDA 5IWLC 2HJKB 4TVPL 2L8AA 3CFDA 4U6YA 3L3HA 3WJJC 1DDTA 5D1XA 4YWGH 4F8QA 4AK1A 3ZE1F 4HQQH 4YOKA 3CIQA 4JFYB 1KF9B 5L4IA 3TA3D 2XKNA 1NCDH 2ZNXA 2HYMA 1URLA 2XI9A 3KR3L 4LBEB 4GXUN 4YDKL 5F0MB 1RUPH 1BX2B 4WFFD 1X5FA 3M17B 3APCA 1F1GA 1JD9A 4JRYE 4JFEE 4AGPA 3ULVD 4XXDA 4NUQA 3GXTA 4MJIB 2O26U 5DRXB 2WBJD 4FG6C 2KI6A 3FSAA 4QRTA 4P23D 4OM0H 2YQBA 3T6XA 4I5BA 4AQ1C 3QARA 2OK0H 2BNRD 4LCWD 4ZODA 3QIUC 2YXWA 2J73A 5D72H 1QSFD 5EEUA 1M2VA 3ZYOA 1MFNA 2VRAA 2NSQA 1F86A 4XVJH 5GHWL 3VA2C 4NQSA 2R29A 5AOJA 4I48A 3O3DB 4GT0A 2ZSWB 5E4AA 3BX7C 4F9LA 1YMME 4NEHB 4Q6IC 5F3BB 3BWSA 1L5GB 4PBXA 1YEGL 4KKZA 1ONQB 3INOA 5D2NE 4K7PX 4KX9A 1BAFH 3BGMA 2W8CA 4MCZA 1RZKC 1QFWL 4KXZI 1I1RA 2HTLC 3C09C 1RUQL 3T6QC 1HL9A 4MYWB 2NPLX 3QXAB 1JZIA 5ENWA 1U8PA 4G7YH 3VFTB 4Z3GA 1AMYA 3GXFA 3UAJA 4A2FA 3HN5A 3RRQA 4NENB 4JPVL 4X6BB 1DL7H 1DLHA 5ESVB 5BPPA 2DQUL 1EZLA 3BIKA 3QH3B 1OAJA 1NJ9A 3LB6C 1JGUH 1FFTB 4Q4EA 5LO7A 1QRND 3SBPA 3U2SA 3TA4D 1OP9A 3ZE2B 1YEFL 2W94A 3CFKA 3MCKB 1JGUL 3UPCA 4CC1A 5IVXB 2A9NL 1BD2D 2XWDA 5KSBB 2DBLH 1K5WA 3LKPA 1HX0A 1EO8L 2ENYA 4ZUSB 4L4JA 1AXSB 1EUUA 2QBWA 2DEYX 4KQ3L 3IGAB 2VQTA 4ADGA 3V8OA 4J4PA 1N64H 3APNA 3QDJB 4KDWA 3MJ8B 4Y19B 5DUML 1HDMB 1CBJA 4LT7A 2FATH 1FNGA 1XB3A 3CFQA 4ETYA 4PS8A 1Z0MA 3E3QC 3QDMB 4EIUA 1H3UA 4LDCA 2XJKA 3OWEA 3DVGA 2XY1A 2P52A 4NIKB 3GBMH 4XB8A 5IHHA 4RDQG 3X3FL 4UZSA 2XSKA 1F45A 1S5IL 2GG1A 5FYJU 3KLHD 2FUQA 2C1OB 4NHCH 1YEEH 4BDVA 3X1FA 1F6FB 1OD7A 1ES0A 1NFDA 1OGAA 2DIEA 2WLYA 2J6EH 3CZFA 3L5WA 4GKSB 3WNLA 2VZVA 4DQOL 4R7NA 3NQIA 1NINA 4FJ6A 4H2CA 1OCCB 3MGOA 5KTEH 4TL5A 2BHFA 1ZD6A 2JFCA 4JFDB 4NO5A 2CR6A 1ZPUA 3SDAC 4MD5B 4ZFGH 3ZKND 3FF8A 2IDTA 4KHXL 4RIRB 4W9GC 1VACA 2HH0H 4UDTA 3C9NA 1NAMA 4UT7H 2BY0A 4N90D 5JYMA 5ALCL 3ZKMC 2EIMB 1KDJA 5CJXC 3S8WA 1UT9A 3U0PB 3FT9A 4NLHA 1L4IA 5I74B 3J7HA 2CE6A 4Z7VE 1J5IA 4O58L 2XQBL 4P5KB 1XD1A 4X9FA 1QSEB 3O81A 2F5BL 3DECA 1FGNH 3MJ7A 1GGUA 4HKBB 1P7QA 5LGYA 3ZKNC 1D5MB 2CUHA 1BAGA 2Q86A 2G2RA 1OGSA 3L3OC 4I3RH 2P26A 2X5PA 2N3JA 2FIKA 4EI6B 3KPLA 4LCUB 3MRMB 4HJSA 1CFNB 1S6NA 4GAGH 4WEMB 4K3EH 2OMWA 3MLUL 4XP4L 4RZCB 2PCPA 1RVFL 5MEOA 4LLVB 1QBLL 4KQ4L 4MCYA 1DLFL 5IJVB 2H1XA 4DP5X 1ZY9A 2G0LA 3KWWB 4PS7A 1P9MC 4KKLD 1WIPA 3L6FA 3EJSA 4OGAC 1ETZB 2O6EA 2HMID 1TTCA 4WV1B 3KPRD 2BWIA 1CXKA 3HZKB 4BEIA 1RHHB 3TZVC 2IXQA 5C8JA 1A0QL 1TFHA 5IW1A 1U8MA 1IBGL 1WWBX 2VUKA 3EJCA 3LH2L 4X4MA 4XH2B 4ZNCD 1Z9NA 3LVTA 4L3EA 2C9UA 4U33A 3ATFA 2JCCE 4P57B 4JPKH 5DZJA 3RYMA 3VW3H 2MTAA 1P1ZB 1KJ2B 2YEZA 3FTZA 3HG3A 1S7QA 4S1RH 4CSTA 2YMOA 1JZEA 1G9ML 4APQA 3ZE1B 1KJ2A 3GRBA 3ZKXC 4J3SA 3O8XD 5AAMC 5L7XH 1IKNA 2MSPA 2LVEA 3FYEB 4QHMA 1AQDA 1RZ8B 4KOCA 1TYJA 1QSFA 4M6AA 2YMTA 4PGCB 3BGFC 2Z7UA 2NMSA 5D55A 4KJYA 4IBZA 4Y5XA 5E8OB 4AQEA 3VD9A 4L2LA 1S9VA 4KTDL 5IFAH 2ARWA 3UXFA 5IFHL 2W5PA 5SV3A 5IJBC 5E5UB 5EUOF 1U3HA 3L7FB 3VH8G 4IRJA 3KJ4B 3LIUA 1RSYA 5HPOA 4CVZB 1N6QL 1UATA 1A8ZA 2KT6A 3E8VA 4KJWD 3ZW3A 2E7LA 1W9XA 2BNQB 4AYEC 3VFWB 2O93L 3EDEA 4U0RC 1MRCL 1YEIL 3L4VA 2G75B 5G5DA 3FHAA 4TTDC 3U30B 4RLDA 3S88H 4W9HC 4FYSA 3MRBA 4JFWA 1I7ZA 3S8GB 3ZU8A 1JZHA 2Y7MA 3NCYS 1UEYA 1W0WB 4ADJA 3NRPA 1T1WA 4Q9QL 4QAWA 3CX5K 3B7RL 1CF8H 2MCPL 4NQED 4LNRA 3SCMB 1GIGH 3U46B 1D9KB 4HPYL 4D9RD 1H8LA 4DZBB 4XNXH 4XMWA 5AQ0A 1NFDB 1OGAB 3QI9C 5B3SB 2F5AH 1MJJB 3AG3B 4F8NA 1BJ1J 3C75A 3PNWB 3PAYA 1NBYA 4ODUB 3FU6A 2OZ4A 5SV4A 2VRQA 1I1AD 4G7QB 1ZDSA 3B9KD 3BZ4A 4UINH 5J1AB 2VR7A 3KM1A 2H47C 3PV6B 1TKWB 2HT4D 4MX7B 4LGRB 5E6UB 2ZX6A 1IE5A 3B9EA 4E0RA 4JCLA 2EE3A 3CVIL 4WCYH 5T1MB 4MJ4A 3V4VL 4PWEA 5B22A 3IFOA 1AQKH 1ZT4B 4HCFA 4HWZA 4IBTA 4M8QB 2FX9H 4FXGA 5DD5L 5IKCA 3CSYB 2CU9A 5F0JB 5J11B 1UZGA 2BSSB 4ZMNA 1A65A 4LSSH 3MODL 3P3YA 3B9KB 5E23A 3SJVA 3QI9D 2OJZH 2A6JA 2CK0L 3KYAA 3SN6N 3EGDA 3RUGF 4H44C 4XCYA 3W82A 1QSEA 5DMIL 2FD6L 4K7FB 5EOQL 2Y5TA 3C8KA 3M6DA 3OB0K 2K0RA 5E6ZA 5DGRA 5E2WL 2HVJA 4JPIA 4JM2C 4X4ZA 3D39B 2X4TA 3CLFL 4CVXA 4GSXA 1GSMA 5F9AC 1SHSA 3VRLE 3SQBB 2R69A 3MV7A 4AZ8B 3RAJL 1XGUB 3VI3E 4APQD 4PJCF 1KBWA 4UM9A 2E5EA 1DBAL 3VX1A 5CJ5A 4HCRH 2BCMA 2DKMA 3KBHE 2GY5A 5IM7B 4PLOB 5ECGA 1JE6A 1XBDA 5C08B 2J5LC 3SE3C 5IVXA 5EULV 1PYWB 2WY3B 1S9WA 4WU7B 5F21B 1LP9B 3K91A 4X7DC 1WUZA 4Y4FB 1OAKL 1MLCA 5JPNB 4FABH 1JYWA 1IZKA 1XF1A 4M48H 2YPLA 5CWSA 4PRBA 2D7OA 3SDXA 5IB1A 1MHPH 5HPMA 1L6XA 2Z1PA 4HMEA 5BUPA 3HC3L 3RB7A 3T3PE 1RZFH 3DXAB 4X4YB 3K5RA 3N50A 3KLAA 1ORSB 2DOCA 2Y7LA 5FYJD 3P9MA 5KSUB 1NIBA 2R2HB 3WLWC 5I1HL 1QQDA 3UTPE 5HHPB 5DQJB 2P5EE 1XGRB 4J3OF 3C08L 3B9DA 3FOLB 2RCSL 1S7XB 3WY2A 3ZDWA 1FBIH 4LASL 5C0AA 2MNUA 4I4WB 1L3NA 3A3YB 4I1PA 4MNQD 3IFNH 1MRFL 4R7DA 5EIIB 4IK7A 3HRPA 1VESA 4MJIA 2GT9A 4CA4A 5EC2A 1G7QA 3ECBB 3CQQA 4P46D 3C9NB 5DJ2B 4P0DA 2Q8BL 4XC1L 3ZKSD 1QR1B 3VQLA 1PNDA 3IJSA 4NQEA 1CVSC 4ZSOE 2UZYB 4MA7L 4GG6B 5I16A 2F8OA 4UQ2B 1QR1A 4GEIA 5KJRL 4YXHH 5SX4I 5EUOA 3O6KH 1LJMA 1CFMA 1THAA 3EJPA 3QJOA 5I1JH 5B8CC 4BKLA 3FO2B 1E6JH 1HTYA 1NCTA 3MLYL 1FVEB 3NFSL 5EH1A 5GSRA 3OTTA 2H2SD 4LCIL 5KZCD 3F7QA 4LOUD 4RGNC 4XCNA 3PFUA 3LQZB 3RY4A 2WQUA 3IB4A 3NTCL 3WKQA 4U3SB 1JK9A 4DP8X 4MQ7A 4XCNB 3I6SA 5BV7C 1DQVA 5B1JC 2FLBT 1G7JA 4UDUB 2WZ5A 2ZXWB 3ULUF 4NNYA 3VRJA 1SN0A 4DVRL 3I6KA 2J7LA 1KEML 3MCG1 3BW9A 1TQVA 2ZX5A 4MDJA 4Y1AB 5BS0E 3K7UA 1AS6A 3L5HA 4G3YH 3C5SB 2CO7B 3CXDH 3I6KB 2Y07L 2HWZH 1ZT7A 3GSQA 1KN2H 2IADA 3FTVA 2PP9A 15C8L 1WD9A 3MLVH 1R5WA 3EYVA 2HPTA 3BZ4B 4M6ML 5E2TL 3AVEA 2QTEA 4EAEA 1OAQL 1SOSA 2VXUL 4V11A 2LABA 4K3DL 5HI5D 4JANB 2IBZX 4JHAH 4AH2A 5JORB 1P53A 1WRFA 3ILEA 3WI9A 1M7UA 2Q8AL 2V2WB 3IDNB 1IM9D 3KEHA 5EPMB 4HJEA 2H32H 4HF5L 1OZUA 1ETB1 4RGOH 4Y5XC 1S4IA 3JZ7A 4PB9H 2N7BA 4G6KL 2RR3A 3RZCC 1IGML 3L5XH 1X5AA 4RX4A 4XVUC 2X88A 4IGBD 1CJYA 4OZFA 4V33A 1P0SE 1VB9A 3AREA 4FFZH 4W9EC 2OSWA 2V2XB 2C3VB 1FIGL 4NWTH 4Z0BH 4N86A 3FYIB 2IWGA 2KKQA 4FQHB 1X9QA 2GJJA 2DF3A 5ERWA 3ARVA 1CDBA 1Y18B 3IE9A 3JQOB 1G9NL 1UH2A 1ZLSL 1OLLA 1FLRH 2OV0A 1RZJC 5KVGE 4RZCA 4HUXB 1UCTA 5BZWA 1QO3B 1CD1A 2P5WB 4AQAB 1NMAH 1T4KA 4LCCC 4HUXA 1TJMA 4LVNC 4CRPA 3C6LB 1CXLA 4MSWB 4Y5VA 5C08A 1LE9B 3AM8C 3LRGA 1SHXA 4JJ5B 4I89A 4HEMA 4ZOEA 3TH2T 3UJIH 2ZNWA 1YAIA 3UEQA 5DZ9A 4GKNB 3WFEL 1MHCA 1P4LA 2HVKB 1C12A 4TPRL 3BEWB 3QR1A 1BM7A 1T0PB 3B56A 3LNFA 5G55A 3AWFA 3BUDA 3ZPDA 3QFDA 4LSUH 3RX5A 3LS5L 4M7LL 1K2DB 3G6JA 1VGKB 3ARGA 3QIWB 3QORD 3VGFA 3BVXA 2F54B 5CSBA 3FAWA 2DMCA 2X3BA 2CKBH 4X8CA 1IQWL 5JLZB 5ITBL 2DJ4A 3KLKA 3BP5B 3ZDYE 2WVSA 5EF3A 3QZLA 3KH4A 3D87B 4AEIL 2HKAA 3EYFB 2WTPA 4IRZH 3SQOL 2Z91B 1EAQA 4OM1H 4HD5A 3S8FB 4XHJC 1M7DB 1F1DA 1T83A 1VCAA 2OMZB 1KNOA 3QDGE 1U2HA 3QEHB 1SDDB 2Q3XA 3VM7A 3KL5A 3RFZA 2VN6A 5IEHA 4UU9B 1S78D 1A6PA 4H0LC 4K5LA 4WWKB 4M7KL 3H42H 1TKWA 4KNSA 3AJ7A 2CRYA 5KW9H 4AT6A 3ESNA 4UBDC 2X1XR 1MNNA 2IPTL 2X4PB 2NY7L 3TNNB 4Z7OB 5C0AE 3TONA 1JWMB 3LQAH 4MJID 1I9IL 4RFNC 5EA0H 4KRPC 3NIGF 3DGDA 3ESPA 2IANA 3SGDH 5CSZA 3T2PA 2UX6A 1JS4A 3MREA 4DH2A 4ENED 5CEZD 4PGEA 2W80C 4N9GA 4A68A 4PJFF 1BJ1H 3DOSA 3ROOA 1CGXA 5GSRB 3NRFA 3PDDA 1BQRA 4GIPD 4QRFA 1MVUA 1CYXA 1FP5A 4EKXA 4HJ1A 4FLQA 2A5UA 1MFDH 1NCCL 5DHYB 3CZEA 2KPNA 2G0KA 2XX1A 5I1IH 1QWNA 1U3HC 4X50A 2L7JA 3G5ZB 3MKGA 1KB5A 5BRZD 1UTDA 2ILLA 3V4LA 2X2JA 4H20L 4CVUA 1J8SA 4W70A 5IREA 1UA7A 2FO4B 1MKFA 3Q6FB 1CL7L 2J8UE 3VD2A 1KB5L 3FT4B 4ZO7A 1EDHA 4HS6A 2P4AB 4D8PA 5IG7B 2BIOA 2LU3A 2XG5A 3EH2A 4KK5D 2Y25A 3GIVB 4Y4FA 1Q9KA 3MRFA 1MI5B 4YL4A 4JVUA 2OTPA 3RWDB 2CA3A 1JGVH 2VDQL 3GHBH 1P6WA 2CBTA 3EW3B 4R26H 3FFCE 5BUAA 1FH5H 5BOZG 1MFEH 3MRBB 3QXVA 3UAAA 3T0VA 5IMLA 1J9RA 3LQMA 2BSSA 3DO7A 2GITA 4P23C 3TBWA 3UEZA 4JQVC 5E5MA 4ZXBD 3SYPA 3IKCA 1XD0A 1HWGB 5E94B 4PJ8B 1C9SA 1WTLA 1J9TA 4N68A 5DWPA 4XO8A 1HH6A 5E8DH 4O2CB 3T8VA 3U2IA 3UMNA 5HHMB 1A6AB 1OAQH 1YQVH 2J1WA 5DK2B 3TTSA 2GIMA 4OF7A 3G3LA 4KK5C 1DCLA 1AQMA 3MLVL 5F8RC 4OGZA 1S7TB 3WCYA 1JZ6A 3GGWB 4HEPA 4L8SB 4M61B 2I60L 2VM9A 1UGKA 1HHHA 4JRXA 4PJ8D 5T3XL 1PD6A 2OMVA 3Q9QA 4MNHA 4HJ0C 1M7IB 2V4LA 4ZMVA 2YD1A 2I85A 5I5JA 4FHJA 1RK0B 2WW8A 4CU8A 2NY5H 5ICZA 5TF0A 4Y9FA 1XGTB 4G9DB 5AAMA 2N0MA 5F6HI 2H6OA 5AVUB 2JCWA 2N01B 4X42A 4NQEB 2JCCF 5HI3D 4PJ7F 2PKDA 4G7VL 4OSUH 2P8MA 2AERT 5GGTA 5FYKD 1R33A 2ED8A 2XVLA 3K0YA 2EVGA 3MRIA 3GKWH 1A1MA 5ICXB 4BFGA 3G7TA 3BIAX 4N6RA 1MH5A 5LXVA 1LO2H 4OF3A 5AENA 2HFGL 3RY6C 1QTSA 2BS8A 1B6UA 3OKOA 2R0KH 5JPMA 4OCWL 2OTUA 1S46A 3D4YA 3MNZB 3MR9B 1M1SA 4YGVA 2QSCH 4YSEA 2EDRA 5LCVH 1MY7A 4PG2C 3KH3A 5IB5B 3BW9B 1DBBH 4TLTA 1QR4A 3BKJL 3RWFA 3MJGX 1RK7A 2EXSA 3DUUA 4EUPA 4GKZA 3EJUA 4IDJH 4TRPH 4MDRA 5T5FH 2GJ6E 3ATDA 4Y16A 4BSJA 3V5DB 2GSIA 1CBVH 4Z7WB 2AXJA 4QYAA 3ZL4H 1PTZA 5IW6A 2XQ0A 3ABLB 4JKLA 4XVOA 2W0LA 2AFNA 3HVNA 3RJDA 1FPTH 1S7SA 3VWJB 5IFJB 5JW5B 4MD0A 3FB7B 4WI7A 4M5ZL 2EDDA 3MRGA 3T2OA 3VD4A 5IJKA 4ZUWA 3VMPA 1NMBH 2AC0A 4HIHB 3AACA 3FQWA 1NKRA 2FGWH 2X6AA 4YMPA 4JQVA 3HC3H 1GS7A 5F7YC 1XZ0B 1FI8C 1P4BH 1D5BA 4UOW0 3INUH 3O4LA 3TYFA 4HUWA 1YC7A 2BINA 5D1ZB 1Q1JH 2IFFH 2KDYA 5FC9A 4AMKL 4F7TA 5I19H 4KK9D 4PG9B 3VFTA 5GRJH 1I9RL 3P9WB 3DTDA 3F5WA 4KO6A 1AHWA 4Y4KC 4YBQC 5E4EC 4PVMA 5AB0A 1UOVA 4JFXB 4LBAA 3TCTA 8PAZA 3W5MA 2XPGA 3B3IA 4FJYA 2Y36H 3FUIA 4KK6C 3KWVA 3UZEC 1XV8A 5I66B 2GW5A 4P5MB 4DOHB 5D4HA 3FU7A 1YNTB 3UPAA 1JNNL 5KSBA 3BKCH 1QBMH 3VXSA 2E74C 3BVNA 3HS0B 3QJFA 3RLSA 3CC1A 3HFML 2IH9A 2MPAL 4KOBA 4XPBH 5DEFB 5DQDH 5IMOA 4BZ2H 4HKBA 3IDXH 3MNVA 4X6DB 2VDOH 5H94B 3N40F 1VIWA 5CUSH 1YPZF 3KCPA 1LP9F 2QMKA 3SKOB 2EH8H 5D71H 3TEWA 4ABVA 4DP4X 3LHPH 3V6BR 4PJ8A 2R56H 1F0LA 2YOAA 4N0YH 1KJMB 2GITB 1B4TA 5CD5C 1KT2B 4TKWA 5EO9B 3SZ6A 3V4VH 2R0LH 5J3HC 2QFRA 1YUHB 2R9HC 3B7TA 2A2QT 4O2FA 4LVNB 4P5TD 4AM0A 1P6AB 4QI3A 5C0DB 1CXIA 2JSFA 5BO1L 2CGRH 4GUOA 4JM2B 3C2AL 1IT9L 1W8NA 3DIVA 3JTSA 2VQ1B 2UWEF 3LH9A 3SE4C 3RWCA 4PS4L 4X6CE 4GAYB 3S5LB 3EJTA 1ZHKB 4DP0X 1JF5A 1FRGL 3NEOA 1CFSB 1EV2E 3O41B 2ZXDA 3ZZLA 3N2JA 4P5SA 2WZ6A 3VI4A 1L0YA 2VAAB 2XV6B 3B9KC 1C1EL 4HT1L 1CGVA 5KAQG 5EMYA 2B9BA 2UUDH 4QD2E 3PHQA 4XC3H 3IU3A 1NTDA 2X4PA 4S1DD 3HOGA 3O3AB 4OLVL 1NH6A 2HT2C 5M94B 3OKMB 4EJ1C 4FHKA 1F4XH 3T8XA 4Z76A 3C6EA 3II3A 4EI5B 5BZDA 5I1CL 1VADA 2IH3A 2XVGA 5IKCB 1FVCA 5LGJB 3DOSB 3QZWG 1E5ZA 1OTTC 3V5HB 3NMEA 1I8UA 5DC0A 5TF1L 3QS2A 5FUOL 4M7ZC 4YEEA 3BKYH 4M7JL 4H8UA 5AAPA 1D6EB 1JK9B 2YSSA 3L54A 1BBDH 4F7MA 1R46A 1NM4A 1QYGL 3ECUA 4LCCA 3V10A 5HVHC 2EIKB 1JDDA 3NJJA 4PJCE 4U05A 4O51B 2Y1AA 2VDRH 1XBRA 3DETC 5F7BA 3VXOA 2Y36L 3I9GL 4OLWL 3FB8B 1J1OL 4Q6YA 5B1KA 1EZVY 4OQTA 1J7VR 3G6JE 4JLRA 5L0QC 3A4DA 1AOZA 2KC0A 1UXMA 1T7ZA 2NY1D 2IGLA 4P4KD 5IG7A 4ACTA 5F1NB 3PWUA 5ACZA 4WLCA 5IW1B 4NZ8A 2OMXB 1D7BA 3QO0A 1OPGH 4ZXBC 3BISA 1FGVH 1VA9A 4Z7VB 4ENEC 1P4BL 5F1OB 1OM3H 5DO2D 2AJ3B 3PQYD 5JW4N 4L05A 4NQSB 1HU8A 3O3BB 5MEPB 4CNIB 1CTOA 3HZYA 2FGWL 4GXFA 5SWSE 1AR1B 5HXMA 1WC7A 4DAGH 3L4XA 2R1YB 3DROA 3B34A 3H7LA 5EU6B 5CILH 4GQ9H 1HFUA 1XR8A 1HS6A 1WFJA 3FO0L 3DROB 3PJSB 1SZNA 3QCVH 1UFGA 5EU6A 3T5WA 4ESKA 1JYNA 3IM1A 5I30L 4P4KC 5CGYD 3P1VA 1DR9A 2NX5D 4XO5A 1S9VB 4DN3H 1CBVL 3QIUD 2IANE 4DO5A 1CO1A 4GXVL 3WNPA 4S2SA 3POCA 4CC4A 3AMKA 2F53A 1A22B 4BKTC 1CZ8L 4XRCA 5IQ9B 4JMXA 4YQXL 5KSVB 2HVBA 1JTTA 1DJXA 4EIZC 4MRBA 4JRYA 5EOTA 5C97A 4C56E 3TOPA 4F7KA 2G60L 2F68X 4WNQB 1A2YB 3MLZH 4CADB 3UCRA 1F97A 1Q4NX 3M1CA 5C0CA 4U6VL 4DGYH 5DYOA 1FGNL 3HN3A 4X80H 2E7HA 3PJNA 3TO2B 2EH7H 5JW4M 3IJSB 4IHOB 2Y72A 1S3KH 1UOLA 1DSFH 4L5FH 3TO2A 3P4NA 3N43F 3K8LA 3PGCB 1Z5LB 3CDZA 3ME0A 2DWSA 1MCRA 5FIEA 3NT0A 4W9CC 4UT7L 5FGRA 5C7ZA 1ES0B 3L5WB 1A6AA 1PZCA 2HH0L 5K69A 2OW6A 5FW6A 5C0IB 4JM2F 2W0PA 4FXLA 4L0PB 2Y06L 4U3SA 4YL9A 3ZZQA 3VB8A 1HILA 4X8JB 3OG4B 4K5OA 2XETA 1I1AC 1VJSA 1ZLUK 3IGFA 3CFIC 2Y24A 4QO1B 3U9PL 3UPRB 1E5AA 3A6CL 3QPXH 2VXVL 3L3IB 5F7MC 5ACMA 2QKIB 4GRLD 1VERA 2CUIA 2VIRB 4NRXB 3O2WL 4JPWH 1AO7A 2PNDA 1NCWH 2VN4A 3F04A 3EO9H 2OM5A 3N91A 2YJLA 2DZEA 2X12A 3QQDA 3IMUA 3CMOH 3OGCB 4WTWA 4OZGA 4Y2DA 3VXNA 3X3FH 5IZ7A 3G5XA 2X7LA 3DX8B 4DP7X 3Q43A 1SJXA 3QNYA 2QVKA 4XN2A 5F7EL 3WEXB 4GT7A 4R0LC 1SYVA 5GGRB 1HI6B 2ZX9A 3MCLL 4DERA 3SSGA 1OAYH 4U1JA 1JPST 2X42A 1MFEL 1UA6L 4N0RA 4ES8A 4DKEH 5I6NA 1MOEA 5INCA 4J3WA 2FX7L 3I50H 5FWRA 2O30A 4UQ3A 3V5KA 4FNLL 1PLGL 5B8CA 1Z9OA 2VXSH 1B6DA 1WQVT 1MRDL 5DVKA 4HJGA 4YO0B 4QRRD 4DO4A 4Q8BA 2R8SL 1TTUA 4C57C 3VCLA 2BP8B 1MI5D 1GZQB 1XGQB 3AY2A 4Q9BA 3HE6A 5DJZB 4P9HH 4AYDC 5A6MA 6FABH 5I8OL 1IC4H 4RMQA 2IGTA 1TVDA 5IQMA 3ZDXF 2D8KA 4X5WB 4YNYA 4U1KA 4WFGD 1FUNA 2W38A 1QSFE 4PJAB 4EQ3A 1SJHB 3PQYE 4G1MB 4JRFA 5BZXA 3UABA 3GSNL 4AI7A 1E50A 1BF2A 1EDQA 4AUJA 5F3HA 1WISA 3C8DA 2YPLB 5D7LE 1MCJA 1A6TB 1CGUA 2W59A 4QXUL 5GGQL 3E1F1 2P1YA 4U1LB 1OCWH 3REWA 3ULUD 1PIGA 1YY8A 5IHLB 3DC0A 4QNPF 4L4TE 1HWHB 3O2VL 1JHLH 4WWOA 4G6FD 3MRIB 4X4XB 2R1XA 4AGMA 1TQCB 4G6JH 4J3OC 3MJ9H 2A4EA 4OH2A 4WU5A 4ELMB 1O6SB 2YPVA 3HAEA 5I15H 4OCSH 2ZWSA 4XO9A 2XKUA 3D39E 1U8IB 3FHQA 3KLDA 3PCYA 3UTSD 5TDNA 1E8WA 2H3NB 3N40P 3WHE1 4Z78A 2A83B 3BRGC 1CI5A 1IB5A 3BUTA 4LP5A 3AREC 3KYMA 3AU1B 1NBQA 3AQZA 2X1WL 4RQQB 2PO6D 2F53B 2V17H 4GAYA 3S5LA 3RWCB 32C2A 3L1GA 4TQPA 4WWKD 2B15A 1EA9C 3ES6B 1HH9B 3S48A 2A9ML 3S3BB 3G6AA 1S7UA 4HQQL 4PRPB 4DGIH 4FC3E 2AMUA 3ZKXB 1Y6MR 5DJ2A 5DWUL 1JDCA 4M5TA 1SF3A 4NXSA 5IGXH 3C5ZD 4LAQL 5GZNA 4IIQB 2GSMB 4AOFA 4FZEH 4M62L 4R2GC 3EJYD 2AQNA 4UTBH 5HYIA 4HXBL 3V6ZB 1ZWIB 5K9QG 4TNWF 1X5YA 3OXSB 1JAEA 3TJPA 3EOTH 4K94L 5LBSA 4B60A 5CEZH 1RUAL 3CBRA 3SKOA 4KI5D 4GSDH 1MCSA 3O3EB 2D7MA 2ICES 4XPHL 3S3SA 1DJZA 1E4JA 3WFHA 3MDJA 4Y1TA 3DVFA 1GOFA 2NSXA 1WGVA 3AXLB 1FO0A 1TMCB 4ZOAA 1MW0A 1J05A 2FEEI 3UO8B 4LNRB 2Q86B 2XA3A 3WEAA 4NQDA 1H3PH 2EDLA 3ZO0A 2CXKA 2F53D 2EUXA 3MQIA 2B5IB 3VD7A 4LEXL 2E9IA 1LEIA 4A7TA 4ICWA 2GC7C 1N6VA 1MFMA 4WK4B 4MCYB 2JH2A 2HG5B 1NFDE 1OGAE 3CVHH 4K3JL 1G6VK 2Q20A 3ZRSA 2R7EB 5C0NC 1BD2B 1FIGH 3CPUA 4Z0BL 1JHKL 2WHVA 2VLRA 2BSTB 3GSOB 3MFGB 4DNLA 4JO4H 3RFZC 2K9UA 1EMTH 1TTGA 2CIKB 1E5CA 1AAJA 3MRKB 4ZQKB 1VACB 3L5XL 4APQC 2HLAA 4OLXH 4DPRA 3N41B 4LOEA 4URTB 1RJYA 2HRPH 2LTQC 3U7WL 3ZK0A 2PCYA 4PB9L 4LLDA 1QHOA 4HF5H 4OIAA 5I74C 2X1OA 2DKSA 1XIWD 1DANT 1MF2H 2A6DB 2OR9L 4XVTH 5BZDB 2CCVA 3FW6A 3OBAA 1QI3A 3GSWA 4KKRA 4P2QE 1KZQA 4WJKB 5GS0H 2YD4A 1XIWB 4LIQE 3S9DB 4QIRA 5FKAB 3RNQA 5TDPB 1XHHA 1PSKH 2TSAA 3CZNA 4GBXD 2Z0BA 5FKAA 4NM4L 3DI3B 3DJZA 3LY6A 2P49B 3SKMA 3BCFA 3BH4A 4P3WA 5HHXH 3KPRE 3VD3A 1K72A 2CR3A 4AYSA 1EEYA 3IFPA 3D9AH 4Q0XL 1W72L 5I66A 3LN9A 2EYRA 3SY6A 4FXGB 2K1MA 4YHLH 3FN9A 4GW1A 2P8LA 2J12B 1WP6A 4HC1A 1IARB 1TTRA 3G08B 2QT6A 2CHNA 4IKJA 1U6AL 4OI7A 3NBNA 1REIA 4B9CA 3NIFE 4Y0GA 4TS6A 1OE2A 3QJXA 5GS0D 2X4RA 1EEZA 3K1DA 3T3PF 3MYJB 4J8QA 4XNZC 9PCYA 4BH7A 2Q1EA 4NGHH 3QFDB 2VLMD 2P8MB 4HSQA 4YPJA 2WD0A 1OANA 2QMJA 4A2MA 1C12B 2CSPA 4WDIB 4MJHA 5HDBF 4X5PA 3CDYA 1QQDB 3HZVB 3KPNB 3TBYA 2HKHL 5FOBA 3MV7D 1R3HA 1EFXA 1BF5A 1I3GH 4BFRA 1JFQH 2WXNA 1FFPB 2W0FB 3CLWA 2Z31B 1NGXB 4OLUH 2YBRB 1WG3A 4PWGA 1MQKL 3VFPA 2DQGH 5FS5A 2BM3A 1QW9A 4R90H 1IBYA 5KVFL 1GSKA 5D7IE 1IV8A 4LPWA 2I32A 3OLDA 1WS8A 4QOKB 5D1QC 3QDMA 2JI3A 1DE4A 1E8ZA 2CA4A 1JFQL 1GMIA 2PO6B 1U8QB 4JE0A 1X3DA 4UU9A 5FYKH 2BVQB 2BNRB 3Q44A 4HWBH 4LCWB 4RFNB 1EWHA 3X2QB 4Z7VA 3EF4A 4QF1A 3UGXA 3VTMA 5GS1C 4PP1C 4E41B 3HG1D 4IBLT 2IDSA 4U1MA 3T8XB 5F7AA 5DI8A 4ANKA 3QUXC 3CFJA 4I87A 5CCJA 1TEYA 1T2JA 2YIHA 5ESQB 1JYXA 1W8OA 4FQLL 2GIYA 1I3GL 1MHPL 2Z8SA 4KI1A 4EZMA 2MOQA 4IU3B 2FCBA 2LAGB 2WYHA 1BIHA 4G80A 2J56A 2QVIA 4IU3A 2V5YA 1WZLA 1XGTA 35C8H 1AXIB 1V7ML 2IG2L 2FEDC 1NSNH 1RIVH 4FKHA 3LKNA 4NUJA 4PBWD 3WDJA 4XX1E 1MVYA 5C2BH 3OMIB 3TT1L 4CSPA 4FQXA 4ELMF 4D94A 4GUCA 3PWPE 3LN4A 2KZBA 5C07B 3ZSTA 5ITFB 1J5OH 3U2JA 5DR5L 3GSOA 3QA3B 4WFGE 1DBKH 1X9UA 4JHZA 5EOQH 3NUKA 5ICUA 3Q1SL 2HFEB 3MC0A 3MCKA 4OGYL 4WEUD 1M71B 2YRZA 4E36A 5DHDA 5FX3A 3JVGA