4JQIA

Structure of active beta-arrestin1 bound to a g protein-coupled receptor phosphopeptide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
356
structure length
353
Chain Sequence
TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Beta-arrestin-1
publication title Structure of active beta-arrestin-1 bound to a G-protein-coupled receptor phosphopeptide.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 64
structure length 353
sequence length 356
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jqiA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jqiA01
5F0MB 4R7XA 4ZRGA 2FAUA 2R51A 2WTRA 3P2DA 5F0LB 5F0PB 4P2AA 1G4MA 5F0JB 4LL4A 1AYRA 3GC3A 4J2QA 3LH9A 1ZSHA 4R7VA 1G4RA 4JQIA 3GD1C 4GEIA 3UGXA 4GFXA 4LL1A 1SUJA 3LHAA 1CF1A 3UGUA 2WTRB 3LH8A 4GEJA 1JSYA
chains in the Genus database with same CATH superfamily
1T0NB 5DZAA 4Z18A 5CLZA 4ELMA 4R4BA 1JD7A 1X5MA 3L3IA 4BWTA 2AXHA 3NK3A 3WO3B 1CGUA 3MRJB 4OFVA 4PJ6A 3MA7A 5B8CB 5H94A 4PS4H 1SXSA 4LEOA 3KPLA 4XN9A 2FL5A 3NJVA 4QTHA 3UTQA 1OP5H 3O9WC 1EBPA 3ULUE 3BKML 1SVBA 2VDNB 4X6CF 5IJDC 1I7TA 5FO8A 5IEHB 2QV4A 1JFHA 1K8DB 4GUPB 4Y4KD 1FZJA 2FSEA 3BH8A 3BMWA 4GUQA 3HG1D 4OJAA 4ODSH 5KOMC 2JJVA 4NZTH 4KDWA 5IMOB 4QKTA 4X9FA 5DA4A 3DSNA 3BWAB 1AXTH 1NC2D 4U6HA 3VWKC 2Y07L 5IF0A 5CZXD 3L4UA 1LK3H 1RMFH 2ZXBA 5I23A 3BZ4A 4XBEH 2Y25A 4G8IB 4GKSA 1YEEH 5F6IC 3SYOA 4F93B 1IM9D 3ARSA 5F9AC 5BMFL 1UD2A 4LAQH 2CO7B 4BQCA 3VXSD 2ADIB 3G3LA 4AQAB 3ARGB 4AGOA 1A6UH 1EXHA 3CN4A 5DWUH 5FHAL 1W8OA 2E8ZA 4K8RC 2FRGP 5EO1B 2ICWI 5DSCB 2WBJA 1IGJA 2RH0A 4DEUA 1FL5B 2WGXA 3UC0L 3D39D 5KUMA 1KEGH 3H42L 1DEEB 2OLDA 4Y8AA 4QYAA 1QNZH 4YLCA 2CM5A 1GGYA 4WI6A 1D7FA 2ZCLL 3CDYA 1DANT 3IRZA 3NCFB 4HZLA 3ZDXB 4ENZA 4M9PA 4QT5A 4NZDA 5DZPA 3D52A 4LF3A 1FBIH 2FQFA 3P1VA 4W4OC 5D7HA 1J5OL 3LEXA 3FT2B 4NUGH 1N5AA 2Z34A 3EF4A 2E6PA 3S97C 3WO4B 4G8GD 4J7RA 5IR1A 3IJEB 1WZAA 3VO0A 2YMXH 1ODUA 1WTLA 4WIQA 4M8QB 2ALAA 3NN8B 3MRJA 3PYCA 4JMNA 2BXYA 4AG4L 5B8CA 1CFQB 2AJZB 2CA4A 4NO3B 5D71L 2E6QA 2GC7C 4L4JA 1MDTA 3QIUC 2FX8H 3B2MA 3F7YB 4TVPE 3QO1B 5HI4C 1J0KA 1E7UA 5SX4I 4X7DC 2AI0L 3NBNA 2X1QA 4NZ8A 4GS7C 5IT2L 3QDGE 1R5VB 5IEHA 5HJ3B 4NXKA 2R83A 4A2LA 4GUPA 4C4KO 2F8XC 3SJVB 4IIZA 1GGTA 1PG7X 4C55A 1EGJA 5HHPB 4O02H 2FATL 2IDFA 2F5BL 2VAJA 3FFCE 5IMOA 3ZL4L 1EO8L 3BWAA 1Q1JL 3L5WB 4OF6A 2IOOA 2LHAA 5B3SB 1VHPA 2NW2B 1CXFA 3D7PA 2BH0A 4QRPB 4G8IA 3RL2B 3VXUA 3X17A 2ZSVB 4IBWA 4FOMA 5DUML 1GGBH 4BFIB 3QJQB 4IKLA 2ADIA 3LKNB 1QRNB 4AQAA 4Q7DA 2V9UA 2Z7WA 1FNLA 3ARGA 4FQQB 3IDYB 4Y19B 3VRLF 3HS0C 5DSCA 3IBEA 4LSPL 4JRWA 1FL5A 3JWDH 2B5IC 4H0GA 4WK0B 1AQDB 5DHXB 3MNWB 1N0XH 1DEEA 2BOBB 5J12B 1EHLH 3WGVB 2XIDA 3FQXB 1QD0A 1DJHA 5SWQB 4PRIE 3GS0A 2H8PA 2LFGA 4X8JB 2ZNWA 2E6JA 5CHNB 5KS9E 4MJIE 1FJ1B 1RU9L 3V4UL 1AXSB 4YSCA 4BKSC 3SE8H 1CGTA 2VN6A 1NIFA 3FT2A 3INUL 3W1ZA 1BQKA 1GZPB 4RGND 5I75B 1KTDB 1W0WB 4OGYL 1UM4L 4BZ2H 3IJEA 1RPKA 1XEUA 4NZUH 3S0PA 1XGQB 4CKQA 3QHFH 4N5EC 3ZN6A 1S7RB 4M8QA 2CUIA 3DRTB 4WFHE 4HSCX 2YPVL 3NN8A 1FL3B 3LQMA 5EEUA 4JFPB 3KW7A 1CFQA 1WS7A 2AJZA 2VQTA 4NO3A 5DHEA 2GJZB 2BPBA 1EBAA 4IOFD 3ATAA 3TO4D 5FM8A 3CPLB 3F7YA 3QO1A 3VM5A 1KB3A 5AVWB 1I7RB 5TK2A 3WI9A 1BQLH 4Z7WB 2QBWA 5E99H 3FZUC 2ITDB 2VC2H 4UV7H 5SV3A 4FLHA 2R4SH 2QDVA 1NZRA 5HJ3A 1OE2A 3BC9A 5GS1B 3SJVA 4JFZH 2B77A 1RFDH 2OL3H 2YPLD 4TSBH 5HHPA 1HJCA 1MIEL 3FTZA 3ZU8A 3QEQE 1WCQA 1SDDB 3PV6B 2YD5A 5CKGA 1SMAA 4FGMA 5FYKL 3QR0A 2NW2A 4ZTPL 5GSRB 4FFYL 5IMKB 4QRPA 3RL2A 3VD2A 3CD4A 1ZE3H 1V3MA 3IPEA 4JRXE 4HCRL 3NCMA 4BFIA 3FU9A 4IGBC 3WTVA 4WNSA 1SHWA 3LKNA 4PG2A 1QRNA 5I0WA 3RVUD 4ZG1A 2JCCE 3MYJB 4FQQA 1KG0B 1PAZA 1YPZF 4Y19A 5KZCD 2CH8A 1YMME 3AS0A 4QLWA 3SOTA 2AANA 1SN0A 1G94A 4HCFA 4AW7A 2IWEA 4Z7OE 1V55B 4LPYA 1X4ZA 2J8UF 1IT9H 3MNWA 1UUNA 5J3HD 3WKMH 3MGOB 5EN2B 2BOBA 2H0EA 3LV3B 1MLBB 1P5UB 5SWQA 1OW0C 5EIIB 2FT6A 2BNRD 4X8JA 2P46B 4Z7VB 5CHNA 4XAKE 1FJ1A 1AXSA 3I75B 5HHOD 4PBXA 5JHDB 3N40P 2BWDA 1GZPA 3LXBA 3NIDE 4F8QA 4EUPH 3ZYOA 3CZFB 2VZ3A 4KPHL 1W0WA 4OLXH 3VXOB 2G0KA 2YD7A 1Q0EA 4GXUN 1XGQA 4PJDF 3BIAX 4U6VH 4M93B 2O26U 1BLIA 2KYIA 1S7RA 4AKOA 3DRTA 1W72H 5AVUB 1FL3A 3GK8H 5IQ9A 4JFPA 5BO0D 1NEZB 3A5VA 1KBVA 2IF7A 2VLRE 3FSAA 4HCIA 3CPLA 2LQRA 5K59F 1F1AA 1ILUA 4QPEA 1WFMA 4YDIH 3BDBA 4A68A 3I02B 1G5AA 3BAIA 4Z7WA 4N0UE 3AS2A 2ITDA 4AXWB 1CZ8L 4LLWB 3GPEA 5LBGA 3CFQA 5E2VL 3D9AH 1SQ2N 1WZ1L 5GS1A 2XWCA 3ALXA 1KV7A 3LD8C 2DEWX 1QLEH 3ZE1B 1F97A 5E1IA 4JM4L 3TCLB 2OXHB 1H6EA 3CFKB 4TTGA 1D2OA 5LNEA 3P02A 4ENED 2B9AA 4XN7A 3OF6A 3F7RA 3QZMA 3P3TA 1SDDA 3PV6A 4JM2D 5D6CA 2DD8L 3FYIB 3QIWB 2YRBA 4FLOA 4KZDH 4WQOA 5GSRA 3HE6C 3MRLA 4NO2B 5IMKA 4F15B 4Q6IB 5GRZA 4YX2H 3FW6A 3NABL 4AMWA 4QJ5B 2WNGA 3QXAB 3FC8A 4N22A 3GTTA 4OLWL 5FKPB 1QSVA 3FUNA 2NW3B 5I15L 3RFZB 2BVPB 2OR7A 5CFHA 1AHMA 4UDUB 3VTTA 3V6FB 3MYJA 1KG0A 2VZUA 1UWXH 3S5LG 4FLRA 1DUYB 1EEUA 1W6LA 5FO7B 2VXTH 2ADYA 2O72A 4PJEF 2G9KA 5E5MB 4PJ9D 1OD7A 4ZMYA 4F57H 2A4ZA 2ED7A 2BSEA 2XWJB 4WUKH 5D7LB 5DJ2B 4WNQA 3MGOA 2DTMH 3NCYS 4ILDA 5D4HA 3SCMD 4PI0A 4YGAB 1MLBA 1P5UA 4LHQB 3O2DL 5EIIA 3MYZA 5GRUL 2OPCA 3VD7A 2WOYA 4WUUA 2EDQA 4KZEH 4R0LB 2WXOA 4FI8A 5FYLL 2UY7A 2V7HB 5CBAB 2QKIA 3I75A 1DN0B 1W0VB 5JHDA 1E40A 1WF5A 4NERA 3VSUA 4CRPA 1JJUA 3CZFA 1KDJA 2XXGA 3VXOA 4L0PB 3QQNA 4XPAL 1CXEA 2EQDA 5E2WL 3MN8A 5DC4B 2CPUA 2YO3A 4CADB 1TO4A 4HJJH 2VOTA 2KUTA 5LXVA 1F2QA 5SWSD 1QBAA 2WBJC 2X3CA 4MQTB 3VFGL 1KYDA 4BZ1L 1NEZA 3KW8A 3VRJB 3MA9L 1GPOH 4JB9L 3ZDYF 4DTGL 1UOLA 2PWGA 3DX4A 1LO3L 3EO0B 4Y4FB 3EBAA 4V2BA 3FULA 3DSFL 3I02A 2J55A 3CX5J 3NZHH 4AXWA 2R69L 2VDLL 5GRWA 1KCWA 3LZNA 4B53A 3W9EA 4HWEL 3T8VA 3P0VL 32C2B 1K8IB 3ESUF 5D96C 5ENWB 2OZ4H 3TCLA 2OXHA 3CFKA 4PJGB 5E9DE 4RISL 5HYQB 5KJRH 1JWSB 3QIWA 1AY1H 1P6WA 3C08L 3L9BA 1O0VA 4GIOA 4NO2A 1FPTL 5ELIA 2C1OA 3N1MC 1QBLL 1QPPA 3QXAA 4OIIH 5IQOA 2XZCL 1RUPH 1OT2A 5FKPA 3UGXA 3RFZA 1DBAL 2BVPA 1S5HB 4UDUA 3SYCA 3V6FA 2HYMA 1E4XL 4O02B 3QNXB 5CLXA 5E7FA 1DUYA 5FO7A 5ICXB 1PNDA 5JQHC 4PB0L 2H2PD 4R26L 5B1AB 4JZOB 5E5MA 3S2CA 3ARFD 5DJ2A 2XWJA 5D7LA 2P5WD 1RZKL 3WKQA 3X3GL 1U95B 3QC5X 3QPQC 3E6HB 1HCVA 1SF5A 3HFFA 3G6DL 4R0LA 3US1A 4PRPB 2V7HA 3RVTD 4D3CH 4TRPL 5CBAA 2NDGA 1DN0A 1W0VA 2DQDL 2QV2A 2NT0A 2DW5A 2C7FA 2AEPL 4IMKA 5LCVA 4FFWC 2AQ3A 4H44C 5KBMA 3DTDA 4FC3E 1HQRB 4Z7AA 3ARGC 4CADA 3CN2A 2EICA 5AALA 1FV1B 2R9HD 3VRJA 4JANB 1S3KL 4UF7C 5JR1H 4L9LB 3HNTH 3ENEA 3D18B 3EO0A 4KZCA 4Y4FA 4UU9B 5AVYB 1LO5B 4ZPTB 4XP9L 1ITBB 1Q90A 2VXQL 3S8FB 2V5YA 3A22A 4PJAF 1RVFL 2R59A 1HXKA 3GXUB 3HMXH 32C2A 1TENA 1BSIA 1K8IA 3B2XA 5DD3H 3CPUA 3W2DH 2R0ZH 3FQTB 4PJGA 3WO4C 2XKSA 3V79C 5HYQA 3AROA 4WEUD 2FH8A 5IWLA 3J7HA 2JK5B 5FO9B 3U2JA 1CUOA 3AG4B 4H8WH 3ZO9A 3AXLB 2AW2A 2B2XH 3JYBA 4DP2X 1PZUB 3TWCL 4KKNA 1S5HA 2FQGA 2OL3B 4XTRD 4O02A 3QNXA 2XZQL 3MKKA 3BVUA 3P0YH 3JV6B 4HWNA 1R3JB 4PV1C 4Y5YA 5DUJA 2YQBA 2X2IA 5ICXA 1NPNA 3IN2A 4POZC 5BV7H 2FD6L 1BYOA 1UFUA 1HILB 2EAEA 2FZ3B 2XA8H 4JZOA 4P57A 2QQQA 4ZAKB 5GISH 5J8OA 2JSFA 4A67A 5PAZA 4DN4L 1CC3A 1CU4L 3BLPX 1U95A 4KRMB 3TF4A 3GXNA 3KHOA 1WSST 1V5JA 3E6HA 4ZZFA 3WELA 4ZT1A 1MSPA 4PRPA 4XCNB 2FJUB 2GK2A 1J88A 3CN0A 1QTYT 3WS6C 2X1XR 4PP1D 3BWZA 1EA9C 1TQCC 3W39B 1A1MB 3LIZL 4J2XA 1H3GA 2XUWA 3N04A 1UATA 3T2LA 4KHTH 4K5NA 3BKMH 1HQRA 1SLUA 4OCNC 2BCMA 3IDYC 1OT1A 4BFOA 3C5ZB 4GAGL 2GQHA 1FV1A 1VKXA 4JANA 4Q52A 1N3NB 3QUXD 5I1AB 1YNLL 4L9LA 3ZIMA 1GW6A 3OX8B 3D18A 3RP1A 5FS5A 1QSED 5J12C 3BPNC 2NZ9D 4EUPB 4ZPTA 1OGSA 2Y07H 4A39A 4MXVF 1J86A 1LO0L 1U8PB 4K7PX 5D9SB 2C9SA 3WE6B 1FNEB 1RUAL 1P6AB 4XXCC 1D9KD 2YMOA 1JHKH 1AC6A 1NCOA 1CXHA 1IC4L 1IGCL 1A7OL 1IKOP 2A4EA 2WLLA 4OTXL 3C8HA 5FA3B 3T2PA 5TDOA 3LY6A 4UV4H 3FQTA 3M45A 4UOW0 1E4HA 1TF4A 4GLRI 4QHPA 3X1FA 4KWUA 1SUHA 2BSBA 5FHAH 3H56A 5I75C 1ZHKB 1ETB1 6FABH 4AYBA 3OMZA 4IQHA 2CR0A 5FO9A 1T80A 4UQIM 1MELA 3U1SL 3SPVB 1MFNA 5I19L 1D6EB 3UTSB 5LG6A 3AXLA 3H42H 3V8CA 3QJFB 3QQ4B 1MZZA 3UTTD 3NIGF 5J6SA 4PS3A 5IMMB 4PCKA 2DQGL 1GVIA 2IGTA 3QRFM 2OL3A 4I0PC 1MOEA 1KCBA 5BRQA 4ETYA 4PJIE 4N2AA 1CT8B 3SIKA 1YA5A 3JV6A 1R3JA 2AV7B 2DJ4A 4LCWB 5JZ7C 2DY2A 2AFNA 3H1ZA 2PPAA 4FULA 1J5OH 4FE9A 2FZ3A 2GI0A 5F1KC 3VGEA 5IHZB 1EDHA 4ZAKA 4Y2DD 2VYRE 5GS1C 5HGBA 4XP1L 1NIEA 4GOSA 1V7ML 1PDKB 3DXAB 4XOAA 3K1KC 1HHGB 2YUVA 3UG5A 4I9WD 5CEZL 1CIUA 1B3IA 5DZJA 1J10A 5DURB 4XCNA 4AQ8C 4JKMA 1JGLL 3L3KB 4AG4H 3EGDB 1HNFA 3DUUB 3G5ZB 1S8DA 2H6PB 2FT7A 4BIKA 1QG3A 3VQLA 3W39A 1GHFH 1A1MA 5CGYC 3WE1A 4LL4A 3GLAA 3T6ZA 2AI0H 4GIAA 3T09A 1AR1D 1FQ9C 1LWHA 5IT2H 1ZEAL 2YQ2A 3EJQA 3P4MB 2HRPL 4N6RB 3C5ZA 2IBGA 1MWAL 3N9GL 3DARA 3AT8A 2ZWYA 3B7SA 3HB3B 4YL4A 3FB8B 4LCUB 5I1AA 2ATPB 3OX8A 2FATH 4QKXB 2GJ6B 4TUJB 3B4NA 1EO8H 1ZVHA 3KPRD 1Q1JH 3LJ3A 4DGYL 3ULUD 1MRFH 5IQLA 1FDLL 5AOIA 1U8PA 4E9XA 5D9SA 4J3OC 2K6YA 3WE6A 1FNEA 4DVBB 2ISDA 2WYZA 3TVMD 3T5WA 4FYSA 3Q1EA 1PY0A 2WJ5A 5DUMH 1NINA 1PZDA 3TFKC 3RNKB 3N43B 2XTSA 5FA3A 4G82A 4IS6A 4PMFA 1EDYA 1MI5E 2HUEA 5D7IF 1TQWA 1CR9H 4GFXA 3K8LA 1QO3B 4JO4L 4UIMB 1ZHKA 2XX1A 1KPUB 2XN1A 4JZNB 4Z0BL 3ZSSA 2AC0A 1OARH 3PJSB 4B97A 1B4RA 4A6YB 2DBLL 2UUDK 3QDJB 4LSPH 3LZLA 1T7WA 3EFDH 3SPVA 3IXAB 1D6EA 3UTSA 1NCAL 3OR6B 4BM7A 3ZTJG 8CGTA 3EJYD 3L5XL 2KI6A 3QJFA 3QQ4A 5IMMA 1QVOB 4JO2L 3ZYIA 1KBGH 1JRHI 4LQFL 2D9CA 4NT6B 2DN7A 3GRBA 1Z9SB 3VW3H 3V0JA 5E8NA 1CT8A 5I0ZA 4E41E 2AV7A 2FJFB 1RU9H 4LCWA 3V4UH 4ADJA 3SJVE 5F7HA 3INUH 5IHZA 4XHJD 4LBEB 5JYMA 4P04A 1U6AL 1DLFL 4PJBF 2PO6B 4P5RA 4OGYH 1UM4H 5L4JA 4CW1B 4DWHA 3M6DA 1NBZB 3DXAA 1PDKA 3TONA 3FB7A 3MLWH 1HHGA 2X70B 4N2FA 2UZYB 2WVTA 2Z1KA 2YPVH 3QWRD 4M02A 3QIWC 3L3KA 5FUZL 3EGDA 4Z3JA 1JOIA 2D7NA 3DUUA 3G5ZA 5HVWA 2H6PA 4Q6IC 3PFQA 1FO0L 1QRNE 4LPTA 2ORBH 3I9PA 5BRZE 1CDJA 3OM3B 4Y19E 4L3ED 3RFZC 3K6OA 4AKPA 5F7BA 2Y36L 2NCMA 3P4MA 3GT6A 4N6RA 1OAKL 2MNWA 4MWFB 2UYLB 2UWEE 5IMLB 1MQKL 2OP4L 2V5MA 4PVNA 4A7GF 1BZOA 2CBQA 4GEJA 1PY4A 3FB8A 3U4BH 2ATPA 4TVPD 4LLAA 2AHIA 4M3JA 3S35L 1GZHA 2GJ6A 4TUJA 4DCQB 5E2TL 1ZT7A 5L2KD 4YE4L 1E2ZA 3BQUC 5FYKH 4CBPA 2HX7A 5EOCL 3SDDB 4PWHA 2K7QA 4ZTPH 4DERA 4FFYH 4R0LC 4DVBA 4OI7A 3QDGD 5T1DL 1F2XK 2IJ0C 1RIVL 4F5CA 4KI5F 3RNKA 2YKLL 4HCRH 4KMTL 2NY0B 1J18A 2KT6A 1FCGA 1JNJA 4KK5C 3FFCD 4LLQB 1QO3A 2YEQA 4JZNA 5ESVB 2YJLA 1AI1L 1UADC 2F9BT 3PJSA 5J57B 2YWYA 4A6YA 4NQEB 2ZKHL 3QDJA 1DJSA 2WUCL 4OJDH 4XOBA 2APXA 2LAAA 3IXAA 2P3YA 3SQBB 3VI3E 3DTXB 4QIRA 2P5EA 1KGXA 3OR6A 1UGKA 2X6BA 3KBHE 5F96L 4Z0XB 4XMTA 4NT6A 1CICB 4MZIA 2BW4A 1Z9SA 2F6AA 3O6FB 4Y4FC 5IG7A 1ZVSB 3GJEA 3HAEH 3CVCA 4FX5A 1TFPA 3AG3B 4I85A 4WENB 1JV5B 3IWUA 2YUXA 3LHAA 4RMTA 4LBEA 3LPFA 5I73B 2L7EA 1YJDL 3H2QA 4KPHH 2IFGA 3OKOB 1GIGL 3HUJF 4CW1A 1NBZA 4PRID 3DOHA 4JO8A 2KC0A 4PYGA 5IBUB 2KZKA 2X70A 2UZYA 2NY6B 4YH6A 5IWLC 4MJID 1WAEA 1I1CA 2K4WA 2XG5B 3DYPA 3TWYA 1DSFL 5JPNC 2DM4A 5IUCA 2ZXEB 3GQFA 5BV7B 4HGWB 4Y1AB 4R8WL 2Z6FA 5J4MA 1T04B 4J3TA 4PP2B 4LSSL 5J7CC 3O6KL 1J0HA 5KUKA 1WBYB 1CZ8H 2AJUL 4WFHD 1DTUA 2X2JA 4XNXH 3ZMRA 1NPUA 4Z78B 4G43A 4H20L 4P2OB 4WHCA 4K3DL 1WZ1H 4MWFA 4LXFA 5T1MB 5F7UA 5FW7A 3DX7B 2UYLA 4ZJ9A 4MYWB 5IMLA 3PLYA 3EYOB 4UT7H 4FAAB 3FU5A 2J72A 3FTWA 2YIHA 5CD5C 1Y7VA 2XWBB 3QRBA 4DCQA 3B8YA 4Z7VE 2DD8H 5ESAB 3M88A 4KITB 3LN5B 4TSAL 3OAYK 2D3JA 4N2EA 5IW6B 1BXAA 3GSOB 4RFNB 3MOAH 3V0GA 5BRPA 2Q7YB 3NABH 5CP3H 5DU7A 3IF1B 4AH2B 5GSVB 5I15H 3VWKD 4EQ2A 4HH9A 3PWJB 5HGGS 4LLQA 3QEQD 3FCTB 2IWFA 5ESVA 4ZMQA 1D5RA 4PGDB 4NQEA 2W60A 4HCGA 5F0LB 1G6RL 2YD2A 4OF8A 3CHSA 4AT6B 2XLLA 4P3DB 1DBKL 1FN4B 1AP2B 1WISA 3SQBA 1M71A 2CU9A 3DTXA 3CMGA 1QTSA 2WCSA 4Z0XA 1CICA 1PG7H 3A4DA 3O2DH 4JHBA 1XD1A 4L9LC 5GRUH 1A3QA 4M1CC 3ZKXB 5CAYB 3O6FA 3FN0L 5CU9A 1ZVSA 5FYLH 2J6EA 7FABH 1ZTXL 5EMYA 3FQUB 3Q06A 4NQTA 1JV5A 5IB4B 2V5SA 3BX7C 1AJ7H 4KX9A 1A02N 4XCEB 3RTLA 5HGAB 1BDYA 4AGLA 1CJYA 4UT9L 3OKOA 3QUZB 1WICA 4FG4A 4XPAH 5E2WH 2VDKL 3ESMA 5ERWB 1NCTA 2IV8A 5H4ZA 2DQ6A 1E27B 1C16B 2VDRL 2XG5A 1UXLA 3VFGH 2VN3A 4JO3L 4BZ1H 3MA9H 3N41B 4JB9H 3CHQA 5CSZB 1OT4A 5C0EB 1T6VN 4HGWA 4JFYB 4Y1AA 1P84J 1OY3B 1T04A 1AH1A 1DN2A 4ZOEA 4ZQTA 1AZUA 4CMHC 4PP2A 4FFVD 3DSFH 4Q0XL 2NUPB 2XWTB 2QLVB 1CLZL 1WBYA 3WKNA 2R69H 2DRUA 1TTUA 3QG6B 4Z78A 3D12B 1DL7L 1NM4A 1LMIA 3QIUD 1ZTMA 4P2OA 5D55A 3P0VH 2F1AA 5T1MA 4HWEH 3DX7A 2QEJA 3FO0H 2VLRD 1QR1B 4XPHL 4ZAKC 4RWYL 1WTGT 4MVBC 1KCUL 2XWBA 1J9RA 1Z5LB 3NCYP 1G4RA 4RISH 5HYSB 1ZE3C 5ESAA 3THMH 4AC4A 3TNNB 3LN5A 2CGYA 4LMQE 4G83A 3P3SA 3C08H 3AG2B 5EC2B 4NGHH 5I1DB 5IW6A 3KDPB 3GSOA 1FPTH 2W0LA 3LKRB 2Q7YA 3EYQC 1QBLH 3IF1A 4OZHF 4AH2A 2XZCH 5GSVA 4BGDA 4XNYH 1QHPA 1DBAH 2VDMB 4K7PY 3FKUS 1VJSA 3S48A 1E4XH 4HGKC 3U7YH 4DEPB 1BG9A 3FCTA 4KTDL 4N3UA 5KANG 5D2LA 3T0WA 3BT0A 4PGDA 2VJXA 3RZCD 5I6OA 2V6HA 4PB0H 1KYOJ 4P3DA 1FN4A 2R1XB 1AP2A 2WLJA 3HE7B 5AKRA 3C5ZC 3X3GH 2XC8A 2FLMA 1LWJA 3T2NL 3JWOC 4WV1A 2D0FA 4ZMZA 3S96B 3CZNA 2VRKA 5DXWA 4DSYA 3CFUA 3G5VB 3R06B 1R3KB 3FQUA 5A7EA 2DQDH 1AZRA 1P7QB 4PBVC 4H5SA 1PG7W 2UZXB 5IB4A 5BUAA 4HXBH 5T3ZD 3LHPL 4XCEA 5HGAA 1RH8A 2AEPH 4GI9A 2VUYA 3VMNA 1JWMB 4GBXB 1NEZG 5FCSH 1F3DH 2OCCB 3QUZA 5HJBA 1KIUB 3HNSH 1UCBL 1UUSA 4XCCL 4OJEH 2OFQA 5ERWA 1E27A 3QWQB 3FQ2A 4CSZA 4HWBA 2WXJA 5AWNL 2BZCA 4HIXL 4ZUUA 1S3KH 5CSZA 4Y2OB 1VIWA 5C0EA 5ALCL 4JFYA 1AIFB 4H1LG 4W9KC 4M7ZC 2B15A 2BLFA 2FWOB 5CP7B 1WQVT 2MEJB 1YPZB 1YHPA 2EH7L 4XP9H 1IARB 4QRRE 1KB5L 2NUPA 2VXQH 2XWTA 4ZMTA 3SYAA 4B27A 3S9DB 4GT0A 1RVFH 3QG6A 3QIBA 4IJTA 4R83A 1TO5A 2FJGB 2XQYA 2R1WA 3DHMA 3GSVB 3QORA 1Q72L 1HKLH 1QR1A 5DVOA 1MW2A 3CVIL 4B9KC 4F24A 1P5VB 1Z5LA 1EXUB 5GGRY 5HYSA 1I3RB 3TNNA 4F7CB 4H26B 4PBDA 3MRPB 5EC2A 5I1DA 4QLRA 3MBWB 2LOEA 1YRKA 3BGFB 3LKRA 3UPRB 2Q10A 4PU2A 5T1JA 2Q8BL 3D1MC 3H9YA 2VXSH 2CA3A 3TWCH 1ZK5A 2P47B 1E8XA 3I9IA 3L95B 5E9DD 3UBXI 4PJDB 5D5MB 2VSDA 1M1SA 3DPBA 2XZQH 5E2UL 5E4OA 1UXMA 1FE8L 4YPGB 4HDIB 2FD6H 2I60H 4IGBD 2R1XA 3HE7A 4GUOA 2VKWA 1ZPUA 4JEGB 4OLVL 2YRZA 2ILLA 2CR6A 1CU4H 1R46A 4M6ML 4DN4H 4NO0D 2ZSWA 3EJPA 3HB3C 1UEYA 3LXUX 4J3VA 2BVUA 4OLUH 1GZHC 3S96A 2WHVA 4R90H 3G5VA 3GIVB 3R06A 3QDME 3PJLA 4HW6A 4K94L 1R3KA 2X28A 2GABA 5GGUB 4IKKA 1P7QA 3UP1A 5IJVB 2UZXA 3A3YB 4MB4A 4WJ5B 3LIZH 1PU0A 1Q9WB 3D4GA 4UTBA 4GBXA 2HTKC 1MFEL 5GRXG 2K6ZA 1KIUA 1V10A 3CSPA 4CUCA 1KLUA 2OSYA 1SOQA 4X6BB 2HVBA 1CYWA 3ZE0B 2RFXB 4GAGH 5I8EB 1P1ZB 3OKEB 3GO1L 2ZXQA 3T0DA 5LAPA 3F01A 1UOVA 4Y2OA 1YNLH 4HJ0C 5D1XE 1AIFA 1BZQK 2JKTM 4NO5B 3ASNB 2V17L 4JG1L 5CP7A 1YPZA 2GEEA 3VU2A 3OL2A 1LO0H 3DVGB 3FU0A 2EP6A 2UZPA 2IANB 3MI6A 1RUAH 3BAXA 5E6ZA 1TQVA 1MG3C 1GH7A 2YLHA 1IC4H 1IGCH 1A7OH 2JKXA 3MRGB 3T3PF 4OTXH 5FYJU 5JXAL 3BW9B 3GSVA 1LO2L 2HTLC 1RZQA 3V9EA 1P5VA 2GCYB 4RGMB 4XXDA 2VLME 3L3JB 2PO6C 1EXUA 4TLKA 2X05A 1I3RA 4F7CA 4OCXL 4H26A 1SLXA 4JG9A 3UYOD 3O8XB 3MRPA 4OZ4B 3U1SH 4XPTL 1XB3A 2N1KA 4F9LC 3MBWA 5TTRA 2K78A 4HEME 2XKNB 3MNMA 4ZS6C 5IHWA 1FORL 2AJXL 3L95A 4QRQB 2G75B 2XTJE 4PJDA 5D5MA 5HDOA 3HE6D 1NUGA 2JKWA 1OE1A 4MZ3A 2WWMD 4XVTL 4LOUC 3RVWC 1NAML 2YKKA 3FQ4A 1S7WA 3ABZA 5HHMB 1OEZW 4XP1H 3VACA 1V7MH 1C5DB 1G4MA 3K6NA 5CEZH 3E9UA 2F19L 3BLBA 3R0NA 4JFDD 1AE6L 3GIVA 3CZEA 5KAQF 5BJTB 4FQ1H 3SDDC 5GGUA 2BP5M 5IJVA 4BCZA 4UOJA 1OAJA 4J6RL 1Q9WA 4LHUA 2NY0C 2YAFA 2XOTA 5L88L 1OQXA 4KKZA 3GBML 4KK8C 2IAMD 1PYWB 4X6BA 1SOSA 2ZCKL 2HRPH 1NM9A 2RFXA 3P30L 3UTSE 5I8EA 1MWAH 1P1ZA 3KLKA 2TRYA 3KBFA 3OKEA 4JFOB 3N9GH 4L9DA 1ZA6B 3BUYB 5D7SH 3KCWA 3FQYA 3CMOL 4G70B 3FU8A 3GM8A 3QWNA 3G5WA 4GQPH 5C09A 2F7OA 4NO5A 4QHUB 2P44B 3NH7L 4B5ZA 4LCWE 1EAOA 4LEXL 4MQSB 3DVIA 1FDLH 3DVGA 1GR7A 2NSMA 3POHA 1BAWA 1T20B 2IANA 4GEIA 4JQIL 1G7JB 3O6FC 4WWNA 3VA2C 1QTPA 2N7AA 2EH8L 3MRGA 2DYRB 3BW9A 3U0WL 2B0SH 1VGEH 1FA4A 4ISVB 1NMCC 1DFBH 2GCYA 5I73C 3L3JA 5A16B 4JO4H 4Z0BH 1FZKB 2DBLH 1W0YT 3O8XA 1YN6B 3VFVB 4HT1L 5FO2A 5LJYH 1ASOA 2K9FB 4OZ4A 4AVIA 5G4OA 1D7DA 2VDLB 1NCAH 2X4RB 1T1WB 3L5XH 4JO2H 3KXFA 2XKNA 1RHHB 4CN4A 4LQFH 4F1ZA 1ZD6A 5BV7C 1AS7A 4PTUA 4QRQA 2G75A 5K1JA 1X7QB 5IVZB 2QSQA 1H9DA 2DQTL 3L13A 1LQBC 1DJIA 3EF7A 4K3HA 1NANH 2WYTA 4XP6H 5EU6B 1FNFA 2CHNA 4P2OC 1U6AH 4OV6F 1DLFH 2IWKA 2GJ6E 3IDNA 3ALPA 3VQMA 5JTWA 1H6TA 4PIRF 3UMTA 4YXLL 4JDVB 2WWOA 4X4ME 3TEYA 3AUVA 1C5DA 1OTTC 3U2IA 2IDTA 4PJAB 1HYSC 4KUCD 3QE5A 1IM3B 5D1QB 1G7HB 3S34L 1EHKB 5FUZH 3V0AC 1JGEB 4J12A 5BJTA 4H7VA 4RQQB 4M00A 1EZLA 3QPQD 3MLRH 4P9HH 3RPIB 3T3MF 1AQKL 3IDJB 3OXSB 5CU5A 4RBPK 4PS8A 3VUAA 4LLMB 4TQEL 4DT2A 1Z32X 3WKYA 1A1OB 2MFNA 3ULAB 5TE7L 4TYUA 3QDJE 4R2GD 3UC2A 3WJLC 2GYSA 1U91B 12E8H 2G3MA 1OAKH 1CD9B 4JFOA 2LU3A 3NCCB 5IY5B 1ZA6A 3BUYA 2W0KA 2OP4H 4FFWD 4Z7NF 5LQBH 5IVOA 3ZKND 2QR0B 3ZE2F 3MV01 4FHBD 3EJCA 1C5BL 1ZSDB 3A4EA 4M3HA 4NPYB 3OAYH 4UZUA 5E2TH 5DFTA 4QHUA 1MPAL 4ZO6A 4YE4H 1ZGLP 3EUDA 1M57B 1T20A 1A6PA 2CO3A 1G7JA 4XCFH 4BSVB 5DC0A 4HS3A 2HLFD 2XPGB 5T1DH 5AB0A 2PCXA 2YXWA 2L3BA 4KMTH 2D7QA 2B16A 3MLTB 2VR7A 4ISVA 2A9AA 3HJEA 3D69A 4EIBA 5A16A 1KIRB 1FZKA 1JMZA 1AI1H 1MFCL 1SJHB 1MHCB 2ZKHH 1YN6A 3VFVA 2WUCH 2M83A 2DI7A 3WNIA 2GJPA 1I3VA 4R3SB 2WINB 1BVNP 4L2YA 2X4RA 1UWFA 1T1WA 3A67L 3GINA 3ILDA 4P46D 1RHHA 3ECVA 1PZ3A 2UX6A 5F96H 5HHXL 4F37F 1MI5D 2WQWA 2GUOB 1E3XA 5CJBA 1ZLVH 3CG8A 4G1EB 4U6XB 3MODL 1X7QA 4L4TD 2WXMA 5IVZA 2D3NA 4ANVA 1PLBA 5E08L 1EMTL 2R51A 3NDYE 1FVDB 4WW1B 1GOFA 4IRJB 4OZFG 4BCYA 3KLDA 4ZO8A 1YJDH 3JZYA 1GIGH 2J7LA 3PHSA 4JDVA 3B9KD 1KYAA 4QJ3B 4XNBA 1JZ7A 1J1OL 5BW7A 1NGZB 2QPSA 4NN7B 3JWNC 4E41D 3MLUL 5C07B 1IM3A 1DSFH 1G7HA 3RX8A 4TOYL 5DQ9B 3RY6A 1JGEA 4AGNA 3ISWA 4RQQA 3GWJA 2UV3A 3I50L 4P2RE 3RPIA 1ETZB 3IDJA 3OXSA 4NC1E 1JGIA 4R8WH 4LLMA 4F37K 5LDSA 1AO7B 4AUYA 1CDCA 4UB0H 4LSSH 5A6MA 1A1OA 4OM0L 3QJRB 4ODVL 4NQEE 3MLXL 5F0JB 3S4SB 1BG1A 2XBZA 1LYQA 2EDWA 1JG9A 2AJUH 4Q6KA 4DEPC 1U91A 4H20H 4F58L 5F9DC 4K3DH 3WHE1 1QFHA 5GRYA 3IGUA 3VNYA 5CM1A 4G6FD 3K2UL 2QR0A 3HE7C 1ACZA 4AQ1B 3C5JB 2AV1B 4Z3GA 1ZSDA 5BRZD 3TYGL 4NPYA 1WRFA 3OHXB 4X6CE 2NY5C 4JPVL 4YMPA 1A9EB 5LGHL 4TSAH 4CGTA 2JI1A 1YEIL 1AC0A 4QR7A 4BSVA 4NUQA 1LTXA 4O4YL 2XPGA 5B3NA 2BIOA 1BXVA 3ECWA 4OZGF 5C7ZA 3ABMB 1OANA 3PIQB 4X9IA 2EC8A 3S6CA 3MLTA 1NBQA 1HQ4A 2OTWB 1ZDSA 4DKAA 2Z8RA 1KIRA 1T1ZB 2ZJSL 2GTQA 1FNSL 2VISB 4OF0A 5C0GB 3GKZA 4KY2A 4DPBX 4R3SA 1DBKH 2WINA 2VN5A 4H8HA 3C8KB 4KJWC 5DS1A 4QF1B 2AERT 3MNDA 1DJWA 4GRMB 1RIHH 1BFTA 3A21A 4DF9A 2GUOA 2NOYA 4O9HL 1QFWI 1VFBB 4U6XA 4CKVX 3GSQB 3DBSA 3FN0H 4H8QA 5FGSA 2NYYC 1L9MA 5AVQB 3BVDB 4IOSA 2WJ7A 2WUBL 3ILPB 1FVDA 3PFUA 3TPUB 1VEOA 3N40F 4YSPA 1FNAA 2YA2A 4I0PD 2YRPA 1U3YA 4UT9H 3DX6B 1KBWA 3DJSA 1TNMA 2OMXB 2VDKH 5AAWA 2YXMA 4POYA 4MS8C 1NGZA 1BZ7B 4W9JC 2VDRH 4HULB 3CHOA 1X5GA 4D9LL 2YSTA 1YNKL 5DQ9A 3TA3B 2L04A 2YOAA 3NEEA 3NUKA 3PUUA 4KKBC 5CGMA 5D7IB 4PTTB 2ZX6A 3G6JA 1OTSC 1AO7A 1I4FB 4P23B 3VG0L 3Q8AA 4Q0XH 3S4SA 4YZFF 5J1TC 4OU3A 1OHZA 4JHVA 1BBJB 1HOEA 1UG9A 2CLZB 1DL7H 5I1CH 1J5DA 5E5RB 5CGYD 3VYPA 2F15A 4CJ0A 1AYOA 4XPHH 5HJDA 4RWYH 1IX2A 4L2LA 4AQ1A 3C5JA 5DJ8B 2AV1A 5EUKB 1VADB 1CS6A 2BNQE 1IGML 3OHXA 1W91A 4M48L 1A9EA 1N4XL 1BM3L 2CG9X 4FA8A 3FF7A 3VD4A 1F3JB 5L8LB 3QA3B 2CO2A 3E0GA 5K39B 2YOCA 4PCSA 4G3YL 4MJHA 3PIQA 4WKXA 4PJBB 1MWAB 2VWEE 4PIBA 1HINL 2OTWA 3QCVL 2AABL 5FLUA 3RVVD 1HSBB 3QZWB 3IGLA 4KTDH 1T1ZA 5EA0L 1ODAA 5C7XL 3TL5A 2VISA 5AVSB 1QWUA 1GYUA 5E6YA 5C0GA 4YK4C 4J28A 4OSUL 1TITA 3C8KA 4QF1A 1MXGA 4GRMA 3VXQB 5KVGL 1KB9K 1QWNA 4LSTH 4DO4A 3T2NH 4ONOA 3VRLE 3EBHA 4OJCA 1NPJA 1F56A 2WQRA 3GSQA 1ASQA 1QKZL 4TLTA 4PJXF 3IDGB 1HC1A 3ILPA 3TPUA 5KBLA 1S5IL 4ODXB 1ZS8B 4U2ZA 3N3EA 4KQ4H 3LHPH 3SOBL 1DP0A 3VAEA 2PWEA 3TF7C 1W8NA 2OMXA 4XCCH 3MNZB 4RGMC 1BZ7A 3VGDA 2C9PA 3GZKA 3MZGB 4Z3IA 5TF0A 5AWNH 3TA3A 5CLTA 4HWUA 3OJDB 5ALCH 4B9GA 5F9OL 5AG9A 5D7IA 5KYYB 1NGQL 4P23A 5IQ7L 1I4FA 5F70A 1Z9PA 5GHWH 1F45A 1OM3L 1KB5H 3K72B 3MLSH 3IJ7A 4GP8B 4OZFH 5CJOL 3KWWB 1NA8A 1BBJA 2AITA 2CLZA 5ESQA 4N86A 1V3JA 1D7CA 2AQ1A 5T1KD 1HHIB 2W59A 4RLDA 2H3XC 1FGNL 1JIBA 4GSUA 4ZNEA 1AFVL 3CVIH 1DR9A 5DJ8A 5EUKA 1BXXA 1FO0B 1VADA 2XY2A 3QDAA 4U3XA 5SX4H 4LDLB 1YC8A 1YVLA 2RACA 4PUBL 3PQYB 5BOJA 4OI9A 1F3JA 3QA3A 5K39A 3L3DB 1DQTA 7PCYA 4GI6A 4PJBA 3CFNA 2GI7A 2YC1B 3BQUD 1HSBA 2CNZA 3FRUB 3QZWA 3UBXB 2HSIA 5E2UH 1IGTB 1FE8H 2A6JB 4I9XA 1F3RB 4AC2A 3NEOA 5DK0B 4NLAA 2NNAB 4OLVH 3VXQA 4M1GL 5EEVA 1MAJA 1YPZE 3OXRB 4FXGB 4M5YL 5B1JA 1DVXA 1T5KA 4AK2A 3C60D 2Z31C 5FHBL 2NNFA 2ZWKA 4K94H 2J8UE 4DFHA 2NXYD 3IDGA 4XVJL 2D4DA 2ZXAA 5LHDA 4ODXA 2R2CA 1ZS8A 4X5WA 2NLJB 4LBAA 5JHMA 1A6AB 3WNOA 3NJJA 3O3BB 2Y1ZA 5DFVD 1UA3A 1RCYA 1JRHL 1PVHA 3V9CA 1MFEH 3ZKMC 2BCKB 4M4PA 4N24A 2GVYA 3MNZA 4WW2F 3BVVA 4HK0B 4NQCB 4AKQA 4C56E 1F13A 2ENJA 1WC7B 3GO1H 2ZIDA 4ALAL 2NXZB 3OJDA 4W70A 4E5XB 3STLB 4PJDE 5DMIL 3IMUA 5KYYA 5JXED 1S9WB 2XQYG 2V17H 4X83A 1HOCB 1DQLL 1FFOB 1OQOA 4JG1H 5JDSB 5JW4N 2C9VA 1KPRB 2KS0A 3K72A 3PL6B 3KWWA 1WP6A 5E0FA 1ZPLA 5FYKE 4RZKA 5CCHE 3JWNG 3KYAA 1HHIA 5JXAH 1EH9A 1LO2H 2QVTA 5DHVB 5K59E 1ECZA 1MCHA 1XSKA 4U1IB 2RHEA 2G2PA 1FO0A 1HL4A 4QHNB 4OCXH 3WDIA 4UQAA 3CU1A 4QRRD 4BK4A 3PQYA 3RKDC 4R7NB 3NA9L 5BW7C 1JTTA 4U1MB 4PW9A 5D1QC 2AEIT 2LFEA 3K74B 3L3DA 4B6ZA 3RY6C 3DO7B 1A47A 3W11D 5D72L 2AJXH 2YC1A 3MBXL 4RSVA 3S8GB 4OGAC 4DPRA 3FRUA 3STZA 4B0MB 5EOTB 1HN1A 3UBXA 3V7AG 1RZKC 1IGTA 1SXZA 4ODBD 3S7GA 2A6JA 3W0WB 1NAMH 3WL9B 3FT9A 4YJZL 2VZTA 2NNAA 3K80A 3ZRFC 2Q5BA 4G42B 1ID5I 1UM5L 3D8MA 5AZEL 3RPKA 4OY9A 4H88H 3OXRA 4FXGA 3QJVB 4GG6F 1NKOA 2F19H 4LPVA 4PJEE 5TQ2L 5HDBB 3CHXA 1AE6H 3SDXF 5I5RA 1D5ZB 2Y2YA 2X12A 4JN2B 5J89A 4RBPH 3WYRA 1CDYA 1G6RB 3L3GB 2PPEA 2XVLA 4B9JA 4J6RH 2HUHA 2HFGH 2NLJA 1A6AA 5F72S 5HY9B 5F0PB 3GXMA 2V7NB 2K45A 4P5TC 5L88H 2BCKA 3GBMH 2IBZX 3K3QA 1A65A 1KULA 2ZCKH 3VTMA 3ARDB 4W1TA 4EKJA 4NQCA 4HK0A 2I32A 2Q9OA 3FN3A 4V1DD 3SE3C 3QDMD 4HHAB 3UH8A 5J1SC 1WC7A 1IBGL 3D48R 1PD1A 3CMOH 2AQ2A 4L29B 4MAYB 3A6CL 4PN6A 2E7LC 4E5XA 4O58L 3I74A 4HUCA 1S9WA 1WJ3A 1HOCA 1FFOA 4RX4A 4XO9A 5JDSA 4D0DB 4LEXH 3D2UD 2Z92A 3PL6A 3R8BB 6CGTA 1BYNA 4JQIH 3IMSA 1WAAA 4BK8A 1JHLL 3ZDYE 3KPNB 2EH8H 1E4JA 3ZY7A 2CXGA 2VSMB 1S7XB 1E43A 3UTZB 1ZV2A 1R24B 2OV0A 3MV9B 4APXB 5HHME 3U0WH 5DHVA 5JDJA 2WSKA 2VGLM 4IRJC 2HLEB 5D1XD 4KVNH 4U1IA 3VYNA 3ZZLA 4EVNB 3D85B 3P73B 4UM9D 1TSHA 4QHNA 35C8L 5A6IA 2AK1H 2IQ9L 4R7NA 1WZLA 1R3HA 4ABQA 3AJ7A 4U1MA 1QLRB 2B59B 1AMXA 1I8IB 4NX0A 3QCUL 3DO7A 1G7LB 3VXMB 3TBTB 4F9PA 3CVBA 5HHNB 4OF5A 3BN9C 5DJCB 4D0BB 5HYJB 3L4YA 4FFZL 4K71C 2DQTH 5FYLE 2A77L 2XV0A 2ZKYA 2A9MH 1FLRH 3W0WA 3WL9A 1F4WL 2OCJA 1TJXA 4J3SA 3EKCA 3OJ2C 4G42A 2PR4H 1CCZA 4CU6A 4YXLH 3QUYA 1PX4A 3P11L 3UIYA 2XTJD 2Y6SC 1JVKA 4L4VB 4XN2A 5JIHA 2KHAA 4NP4L 4YWGL 4LHUG 3OHXC 2NRDA 3S34H 2VM4A 2Z91B 3FU6A 4JAMA 4JN2A 1G6RA 3L3GA 3HRPA 1AQKH 1CWVA 2OMYB 2WLIB 5AYUL 1A14L 4TQEH 4K7FB 2V7NA 5TE7H 3HHSA 3BSGA 3FCSB 4UMGA 3PCYA 4JRYB 5I5JA 1WWAX 2XETA 3ARDA 1ILSA 4NJ9H 2G3ZA 4L29A 4MAYA 2F8VA 3E1F1 5ISZA 1J8HE 3QJXA 5I1GL 4WKZB 3MJ9A 1C5BH 2OI9B 4QHMB 4XN1A 1MPAH 4D0DA 5EOCJ 4I0CC 4JJ5B 4DKDC 2R1YB 3ZZQA 2RJMA 1OCOB 4LKCB 5EU6E 1K5WA 4W4NA 3KPNA 1S7XA 3UTZA 1R24A 2X6AA 1IKFL 3MV9A 4APXA 1S9YB 4EVNA 3CC1A 3D85A 1WITA 4ZD3L 2FJSA 4EQ3A 5I16B 4J4PD 4AY0A 4PJAE 1INQB 1MFCH 5EO9A 5D1QE 1XAUA 5CMAB 1GRWA 4PLKC 4ZFQA 1QLRA 2B59A 2Z4TA 1BQUA 1PEWA 3A67H 5JW4M 4NP9A 2CGRH 1K6QL 1RLBA 1G7LA 3LCYA 3VXMA 4FQXA 5TPWL 3TBTA 5HHXH 5KSAB 4NOFA 5D7JC 5HHNA 2E5EA 5DJCA 4D0BA 1MCEA 4P23C 3MODH 4NUJB 5HYJA 1Z2KA 3EDFA 5E8PB 5E08H 3TIDB 1EMTH 3K2KA 1U41A 1JZ3A 1WFNA 4BWUA 2YA1A 4XMXA 4GP5B 4IW4C 2XHNA 3ZK0A 1MJJB 2HX9A 2DWEB 4MNQE 1Q8MA 3V52L 4XI5C 2FSDA 3ZYZA 4JCWA 1IRAY 4L4VA 1V27A 1J1OH 3F6LA 4KJPD 4P4KD 3BESR 1E6JL 2LE9A 4B95C 1JDAA 2Z91A 3K0WA 2DLTA 4TOYH 2W80C 4ZTEA 3TEUA 2JLLA 3I50H 1RXLA 2P43B 3PG2A 1DVYA 1CGWA 1VRSA 3B37A 2OMYA 3QDHA 5GZNA 2XN9E 4Y4KB 2R29A 4LU5H 4K7FA 4OM0H 1IGFL 3VSVA 2EKJA 2BFVH 3MLXH 3FCSA 5I76B 4U6TA 4JRYA 4AVJA 1GKEA 4F58H 1GSKA 1NC2B 1UTDA 1RURL 1V7NH 2VR5A 2HTKD 5CZVL 4WKZA 5HHVL 1IM9B 3T4AB 4JPWH 4QHMA 4NQDE 3TYGH 3KZ8A 4BSJA 4JPVH 3VXSB 1SM3L 4JJ5A 1DBJL 3LTVA 5T5NF 2R1YA 2XXFA 1YEIH 2EINB 5B1JC 2YXVA 1JP5A 3L4VA 4LKCA 3LKPB 4O4YH 5BZZA 4HKZB 2MCG1 1KXVC 2MTAA 2ZPKL 4HJ0D 1TZ8A 3K91A 4PQXA 2ZZUT 1VEMA 2O5NA 3NACL 1S9YA 3UJJL 1NMBH 1SXNA 3D39B 4PVBA 4ZFGL 4PMEA 2YBGA 4MXVE 5I16A 3A0OA 4R7LA 2CK2A 5AOMA 1INQA 1EAQA 2NUTB 2ZJSH 1FNSH 4W81A 5C07E 3OLIA 1SFHA 5CMAA 2VIRB 3DI3B 5DF0A 2HTLD 4MLIA 3N5AA 4HZ1A 1BZDA 2YAHA 3ZSTA 2D3VA 4BQ8A 1F1DA 2PO6D 4TNWF 3VCLB 1AO7E 3IDUA 2DH2A 2FEJA 5I6PA 5JHLA 5KSAA 4MD0B 1G7IB 2IOMA 4G8GB 3OZLA 4NUJA 5I82A 5E8PA 5IBLD 1G0XA 4YBHA 5G55A 4EIGB 5H4YA 4PRNB 3TIDA 4NI6A 2UX7A 1HL5A 2WUBH 4ZS6D 3NIGE 2M26A 5CN2A 3VI4F 1MJJA 1IILE 2DWEA 4WTXA 3WIHA 4IK6A 3Q0HA 4FABL 4YSRA 1J0YA 4BUQA 4LOUD 3RVWD 1KZYA 1O75A 3C75A 3SBQA 4D9LH 1A5FL 1KTKE 5KW9L 5A2JH 4Q4EA 2XYCA 4TNWK 5BQDA 5A2CA 2OJ1A 5DRZB 1PX3A 4AV5A 1R0AH 4Y4KA 1NAMB 1A22B 3VG0H 1FSKB 1GC1L 3HG1A 1B9KA 5I76A 3SDDD 4YDLB 2ZKMX 2ZICA 2NDFA 4RAUB 1NC2A 3C6EA 1I9IL 5A3ID 1MVUB 4Y7OC 2Z7UA 4MAUH 4OCWL 4JHWL 5D1ZC 1SN2A 3EOBB 4P2RD 1VEPA 3BPLC 4KK8D 4XZUB 4I48B 3TIEB 1IM9A 3H4FA 5CJQL 3RX9A 3T4AA 5FDWB 1ND0B 3CN1A 4EN3C 1IGMH 3NIDF 3NESA 4IIQB 3VXSA 5HYIA 2YAPA 1N4XH 4X5RA 3BO8B 2XACC 1BM3H 4FXGC 4N26A 4IRSD 3LKPA 4HKZA 3B3BA 4BFEA 3EXLA 2ED8A 4YXHH 3CXDH 4G3YH 5EZJB 2Z0UA 1FP5A 5T3ZL 2AEQH 4LDEB 1Z9OA 4TPRL 2LLLA 4Q8BA 1HINH 5KVMC 3D39A 3QCVH 2AABH 3T0AA 1HTYA 5EA0H 4FI6A 2NUTA 5C7XH 4K73A 3DBXB 1LL1A 2XXMB 5AL0A 2VIRA 1KYFA 4YDMA 3DV6B 1IQWH 1QUNB 5D2NE 4A66A 1I53A 3TEXA 1HVXA 3F6IA 4NB7A 4AV0A 2HXAA 5IGXH 2VN4A 3T3MB 3NAAH 3VCLA 5KVGH 2H45A 1RZGB 1LWRA 1S9XB 1SYSB 5JIKA 2NXZC 5LBVA 4RGNB 2LLGA 2IDUA 1G7IA 2ATKB 2V3EA 4G8GA 3OKKB 3I6SA 1QKZH 3F65A 1YJDC 3KDMB 3NSJA 4N28A 4XVUC 5CEZE 2OCFD 5DK2B 2Q87A 3UFIA 4ZXBC 1PZBA 3B9DA 4PRNA 5DVNA 3CXHK 1NICA 1S5IH 4B50A 5JMRA 4Z5RB 3SOBH 2EKSB 2FX9H 3GB7B 2Y22A 3C6LD 2GY7B 3CH8A 5SWZE 2VXVL 1IL1B 3ZTDC 5DDHB 4KXAA 3NCEB 2QZ5A 3TO4B 1ZANL 1ZIBA 2DM3A 4Y9BA 1XF4B 1XGUA 4DO6A 1YEHL 2ZX9A 2BDNL 1NCBH 1KGIA 5LBSL 3MXWL 2B1HL 1Z1WA 4L48A 2YARA 4YHLL 4R4FL 3S4SG 2VDOL 3N06B 5E1QA 2DJUA 4ZW3A 5DRZA 3SGDI 3OMAB 1NGQH 1BHGA 3OGOE 4OUOA 3UGUA 1HYSD 3W5MA 2BVQB 1OM3H 2VJ8A 1ZMYA 5CJOH 4JDTL 5AB2A 2WC7A 4UI2A 2BHUA 2A2QT 2A4CA 4RAUA 2VERN 4F8NA 1RJLB 2VM9A 2NQ3A 5I1EL 1MVUA 5MEPA 1XH2A 1XF5B 1H15B 1BD2D 2LLNA 1ANUA 1FGNH 4PGCB 2IBZY 4M6NL 3S3CB 3EOBA 3WV0A 1AFVH 2ED9A 4LO9A 4I48A 4XZUA 3KPQB 3TIEA 5IZ7A 1OB1B 5FDWA 1ND0A 3J27A 2K3TA 4DK3A 4PUBH 2RA1A 1BW8A 1OO2A 1N9PA 5E2JA 2F53E 5D6DC 4ZO7A 4NI3A 5KZCB 2WTPA 2Q8AL 4FXKC 3QRGL 1CQYA 2MTPA 2WN2A 4TUOB 5EZJA 1SPDA 1VB9A 2ODHA 4I1NB 4M7LT 3I3DA 3VXRE 3ERXA 2J21A 3VFRB 2BNQD 3ABKB 1ED3B 3ARRA 3DBXA 5K9OB 3GJFK 2BNRB 3DV6A 4KI5E 4K2UL 5CZKA 1QUNA 1UJ3B 3EOTL 4GMTL 4UUJB 5IESH 2JJTC 2O5XL 1B4JL 1HKFA 3ZLQC 4LEEA 2AQSA 3E8UL 1RZGA 1S9XA 1SYSA 4MAYC 2ZUUA 4M5YH 4Q74A 2ATKA 3D51A 3HPJB 3OKKA 4JPIB 5FHBH 1IB5A 4B7LA 3KDMA 1YY9C 4IBUA 5DK2A 2YHGA 4XVJH 3FQNB 1PLCA 5T5FL 4C47A 4XPFL 2OS7A 3S36X 4Z5RA 2O5YH 4ABVA 4OF3A 2EKSA 2C4XA 3GB7A 3RIKA 5DDHA 1JRHH 3B43A 4GSQA 1JNLL 3TO4A 1WS8A 4RDQF 1I82A 3UADA 1XF4A 3K6DA 4BE5A 3RRQA 3BT2L 4MDJB 5A2BA 3ARBA 4OLYL 1T0OA 2ENSA 4PJFB 3FQ1A 2DKSA 4G2AA 1MCRA 1GOHA 2GPZA 3SKNB 4OZGB 1CFSB 4ZODA 2GC4C 1INDL 3SYPA 3HUJE 4YBQC 1N2RB 1UD8A 4NRXB 5DMIH 3FPXA 2EDOA 2X38A 4IU2B 1DQLH 3IU4L 2YPLA 2BVQA 2V8LA 3QFJE 2KPNA 5CINL 3WXVL 1TLKA 1T1XA 2AGJL 3VX1A 4JM2B 1KBBA 1E6OL 3QS3A 3LOWA 1RJLA 3FQWB 4HYTB 1XF5A 1U3ZA 5C0AE 1OK0A 2EYRB 4EXPX 5FV2A 5CD3B 3KPQA 3NJLA 5DTFB 1XGYL 1OB1A 5K69A 5E03A 1DYZA 4M03A 2EE9A 3BYTA 1LEGB 3UO1L 3PREA 2GHWB 1NEPA 1A4JB 4FCHA 4I18C 4RFOL 5I8KL 3UYPB 1CVSC 4JR9L 2JJWA 3NA9H 5FLVA 3G04B 3QZWG 4J8RB 1B9ZA 4Q6YA 5IHBA 1H5BA 4TUOA 3LZFL 1IFHL 2XZAL 5D72H 1D6VH 4PJ9B 2PR9A 3I9GL 1AHKA 1MCJA 1QFWM 3UDWA 3R18A 4WSKA 5EHFA 3VFRA 3EH3B 3SCMB 4OKDA 1ED3A 2DQJL 3M07A 4PGEB 1TG8A 5K9OA 2BNRA 2XIIA 3ZHKA 1UJ3A 4L0ZA 4UUJA 4M6AA 1U30A 4WHTA 5HHOA 1UM5H 1CBVH 3B3IB 1HZLA 2QKSA 2XXCB 3SKMB 3V6BR 2OI9C 4JPIA 5TQ2H 4KJWD 1OVZA 3K4ZA 1KZQA 2IEPA 4XNAA 1PJWA 5CR8A 4MMYB 3FQNA 5FGCB 4XNUL 2H32H 2O6EA 3PWVB 2G3XA 5J06A 1JF6A 5SWSB 3RGBA 2MOVA 4KKLD 4NUPA 4P9MH 1JZ5A 1PMYA 1MY7A 1YN7B 4MDJA 4KKAC 3KWXA 3A6BL 3QWOB 5C0RH 3CTTA 4PJFA 2DOCA 2KQMA 1VSCA 4KXZI 1DUZB 4QWWD 1IBGH 3SKNA 4OZGA 1CFSA 1S2EA 1X9QA 1YG9A 5DC2A 3A6CH 4JO5A 3AWFA 3FAWA 3HC4L 2EVJA 4HLJA 1CD1B 1N2RA 4NRXA 5GGSB 3V4VB 3QCTH 4IU2A 4D0CB 5KSAC 1CGXA 4R7VA 1RZJL 2PW2B 4G6AD 4ADGA 5IQNA 4JM2A 1FHGA 2P9RA 1JHLH 4EKXA 1N5YL 4KQ3L 1YEGL 5EEWA 4KKBD 4C56D 1PTZA 3FQWA 1XXDC 3QULB 1OTSD 2N59A 3P3RA 4AE1A 1KTBA 2EYRA 3C2SA 4LESA 5CD3A 3FUJA 1GYVA 1UWEL 2HZHA 2IH9A 5DTFA 5IQMA 5EZLB 1LEGA 2V2WB 35C8H 3UYPA 1A4JA 2IQ9H 1BFVL 5FYKD 3G04A 5CGBA 4J8RA 3UBXG 5LLIC 3QJZA 2HG0A 3QCUH 4LEBA 4LLDB 2TSBA 2DMKA 4PJ9A 2YAEA 3RX7A 2P5WB 4KFZC 4Y4KC 5LNGA 4EZLA 2Z35B 3REWB 4FFZH 3SCMA 5C1MB 4PGEA 3SQOL 4YSOA 1ZTXE 4OZHE 4X4ZA 4XPGH 1CE1L 3TYFA 1F4WH 5FWRA 2IV9A 3WUWB 1IVTA 2IOIA 5F7LB 2F2HA 3B3IA 5CXPA 2P5PA 2ZF8A 3SKMA 2DWTA 3T4AC 4G1MB 4NP4H 2YAOA 2FGZA 3ROLB 3PUCA 4N2LA 1PKQE 4TULH 1IQDB 4X7FC 4ZFOA 4MMYA 2OMBA 3PWVA 2BZDA 5AYUH 2CRYA 1DQQB 1AXIB 5SWSA 3DVNA 4UILH 1A14H 2X1WL 3O2VL 5DRNB 1XCXA 3P9WB 3MMEA 1YN7A 3CGTA 1GKOA 1W9XA 5DUPL 3AQYA 5DJ6B 5LWYL 4HBCL 1DUZA 2RGSA 4YFDB 4KUCF 5C0JB 5I1GH 1CD1A 4G7QB 2CE6A 2ESVE 4JFVA 4WGVB 5E4EB 5GGSA 3V4VA 5JW4Q 4D0CA 1WT5C 1B88A 3MUGB 2G9HB 4HAFA 2EUZA 1MFMA 4FQIL 4D9RE 2PW2A 5SX5H 3VYOA 2UVEA 1EJOL 3DGGA 1BZ9B 2BX5A 3WCYA 1I75A 3QULA 5FR3A 1IKFH 5F88B 5AL8A 3TASA 5AVZB 3S36L 4ZD3H 1QZ1A 4QTFA 5EZLA 1CLOL 2V2WA 3IE4A 3QARA 4WO0A 2FBJH 1AMYA 4BKTC 1R9FA 1K6QH 2QGBA 5TFSL 2PYFB 1IAIM 3ARFA 5M7QA 1H6FA 3EH4B 2P5WA 2Z35A 4HZAA 3REWA 3ZMEA 1HXMB 1KIQB 1OZTG 3SGKA 5ICUA 2WZPD 3KEDA 1B0RB 2HMIC 2QTVA 2AJYL 4IRZL 5EWIL 3WUWA 3WJMA 3EH2A 5F7EL 5EF3A 1HEJC 1N70A 3PV7A 3MAWA 2Y9RT 3NPSB 4Z95H 3BKYL 3IFNL 4H4NA 1KJ2L 4GUCA 4JVWA 4X6FB 4DUWA 3SPJA 3ESNA 1LJMA 4G1MA 4LLVA 1L4IA 3ROLA 2IAAC 3F7LA 4IIQC 1LD9B 3L6FB 1IQDA 1SXAA 3DX8B 1MCIA 2Q76B 2FYVA 3AZUA 5C6TL 1MW0A 1DQQA 4JK0D 3K0YA 2Z31D 2C4FU 2F08A 3PE9A 5AW8B 4OZIB 1KN2L 1IGFH 3QUXB 1EO5A 3DJ9A 3O0RL 3DX1A 5DRNA 1QSEB 3WNNA 4DQOL 1KTCA 1IV8A 3L3HB 3MBEC 5DJ6A 5IJKA 5AYQA 2W07B 2DMGA 1QYGL 5AUMA 5C0JA 3NEXA 1XFPA 1D9KB 4KAQL 5J9PA 1NWOA 4J3XA 5CZVH 3PP3H 4N20A 4FFTA 2Y7QB 3HMWH 3US0A 4GQRA 5EBGA 2CO4A 2G9HA 1DBJH 4DGVL 2H3NB 2OMTB 3CIQA 3R8QA 1SOXA 3F83A 1BZ9A 1Q1PA 3SPGA 2CJ3A 2MIZA 2CBOA 3NACH 1TEFA 5F88A 3KPMB 4NKIL 1J8HD 3KD4A 3PP4L 4ZFGH 1SEQL 2VSKB 3UTTB 1TXKA 3GSXB 3N44F 4QOKE 3F84A 3L4TA 4LOVA 1Q0YL 2PP7A 1FC2D 3T3PE 1KB9J 3OG4B 4GPVA 1WBXB 1Z5YD 3RURA 3WIAA 2ZAIA 2IH1B 3TBSA 1BJ1J 2F7RA 1P7HL 2PYFA 1BPVA 1NIAA 1UZ6F 3PF2A 3VD9A 4Y2DB 1O5PA 1FNGB 3DKHA 1HXMA 3CSTA 4KRLB 3CU7A 5D1QD 3K1DA 1KIQA 3IFLL 2BY1A 1B0RA 3RWHB 5IVXB 2IFFL 4LPCA 1D5MB 1MH5B 4NJAL 4OGAD 4A37A 4M61B 5B22A 5EU5B 4LRNL 2OXGB 1HZKA 1LDSA 2DICA 5IM7B 3O3DB 5EBMB 1E5CA 4IKJA 1IC0A 2IPUK 4X6FA 1YEJL 2BJMH 2HT3C 2QMJA 3MNVB 3HBPA 1LD9A 3L6FA 3F7PC 3OKDA 1A5FH 3DX8A 3RVUC 1AR1B 5B7FA 2Q76A 3D39E 4OZIA 1F58L 2F61A 4MNQD 4NC0B 4FADA 4JFXB 1F5WA 1DCEA 1GC1H 3QUXA 4N0FB 3ZX1A 5J3HC 4U1SB 1XSOA 1QSEA 3OC5A 3IAQA 3L3HA 4YZWA 3KPRB 5L7XH 3GSNL 2W07A 4LSDA 2BO0A 4ELDA 1ZHNB 1QFUL 4OCWH 3WGUB 4N8VG 3DHUA 4P5TD 3TVMB 1UJ3C 1D9KA 2H32B 5GS0H 2XN9D 4G8GE 1MRCL 5CJQH 1MEXL 3WN5B 4EI6B 2Y7QA 3VXTB 2W91A 5E56A 3LKOB 2K1MA 2H3NA 5E5UB 4QMEA 2OMTA 4EN2A 3L5JA 1GY1A 1QACA 3K7UA 3ARXA 2B4CL 2YD6A 4ZOCA 5T3ZH 3R1GH 3KPMA 4TPRH 4NYLB 1KN4L 2C3XA 5CO1A 4ONGL 2JKSA 3GMNB 1ZT4B 3Q2CA 1RULH 4NQDD 4KVCH 3GJFH 5TH2B 3GSXA 1IC1A 1JZDC 3QUML 3ATBA 2XWRA 1WBXA 1H6UA 4IRJD 4ZI8A 1PNCA 5MI0C 3FB5B 3V10A 2ADGB 4JN1L 3T6XA 2J4WH 3QW9A 4FG2A 5C0IB 3DTUB 4Y2DA 3AU0A 5AW9B 5CSBA 1FNGA 3LPWA 5DZVA 4FEIA 3MRDB 3O4LA 2FIKB 4ENEC 2WO4A 3GRWL 3RWHA 1BGXL 5IVXA 3MV11 1D5MA 1MH5A 1FZOB 2Y5TB 4M61A 5BVJB 1PBYA 2VXVH 1TZHB 5EU5A 4M5SA 1JPFB 2A6DB 2OXGA 1ZANH 5IM7A 3O3DA 3X1GA 5ABZA 4ODSL 5EBMA 2WGNB 1YEHH 4C83B 1PZSA 1SQMA 2BDNH 3ABLB 5TF1L 3LRLA 2HCZX 4QRAA 2G5BB 3MXWH 3OKLB 5LBSH 4L3EB 2B1HH 2CKNA 2VR9A 4GNKB 4MA7L 3EJSA 1M9SA 3HRZB 1MAML 2VDOH 1RMFL 2ZOUA 4L1HA 1NLDL 3PGFH 3DUSA 4XBEL 2VL5B 1RPQA 4WDIB 4MX7B 4WTZA 3HZKB 2D03L 2W5PA 2YD4A 4JFXA 4LAQL 4PJ9C 4LNRB 4ERSH 2EDHA 3Q8BA 5BVPL 3LZOA 4N1EA 1R5WB 4U1SA 1A4BA 4OIBA 1AZBA 1NCHA 3SCMC 3KPRA 3CAFA 5L2KB 3QSKB 1YEWA 2BIPA 5I1EH 5ECGA 1ZHNA 5T3XL 3T3ME 3C5SB 3TVMA 3UZQB 4KO5A 4M6NH 3QDGB 3WD5L 2H32A 4Y5XB 3KGSA 3CDFA 4EI6A 1EFXD 1B4LA 1QHQA 1TKWB 2WQAA 4FDWA 3WN5A 5A43C 3VXTA 2XDHA 1KBPA 3LKOA 3RVXC 4YHOL 1BQRA 3FFCB 3GS4A 3CVDA 4KNTA 2Q8AH 4Z7NE 3QRGH 5IW3A 2X9ZA 3H53A 1AZZC 3W9DB 5EUOE 1JV2B 3ZE2E 1FBIL 3B1TA 1A4AA 1C8QA 2YFOA 3LPOA 4HPHA 4NYLA 1MCCA 2BOCB 2Y06L 2ICEB 3RKPA 3GMNA 1ZT4A 2QQNL 1GY2A 5TH2A 5DZNA 1F4AA 4X6EB 1JF5A 5HTSA 1T7YA 4K2UH 5DVPA 3EOTH 4GMTH 1QSFE 2H7WA 4OH2A 4X9GA 4CMMB 2O5XH 2VW7A 5I30L 1B4JH 2DJSA 3FB5A 3E8UH 2ADGA 3DV4B 4HUUB 3SZKC 2ZX7A 2ZWZA 3AT0A 2FX8L 1E3FA 5C0IA 4B5EA 3SN6N 1LXMA 4QRFA 4PRIB 3MRDA 1JAEA 4JVUA 4XNQB 3HIZA 2FIKA 3T77B 1RKRA 4XPFH 1OP5K 3QWRA 5D7JD 4MA1C 4MJIB 5KS9B 5KYNA 5L2JB 1FZOA 2Y5TA 5BVJA 1TZHA 4RIRB 1JPFA 2A6DA 2Y2TA 1SBBA 4R9HA 1RAMA 4C83A 3DA0A 1MF2H 3MRHB 4HGMA 4OLYH 4DP5X 2G5BA 3DYMA 3OKLA 4U7MA 4YBLC 4L3EA 3GSWB 5CEZD 3HRZA 3AACA 1R33A 1INDH 3S3PA 3MC0A 3N1QC 4MCZB 4W68A 2VL5A 4AIOA 4WDIA 1X5AA 4YDVB 5SWZD 3ARYA 1GGBL 1U4FA 2F5AL 2H2PC 3IU4H 3HZKA 4MX7A 4WFGD 4XN4A 2X87A 4LNRA 3ZGIA 3WXVH 1R5WA 4WUUD 3DDGA 2RCSH 5IEKB 2AGJH 5LKNA 3BP5B 3CFJB 4XB8A 5L2KA 1FVCB 3CFCL 4GY4A 5EU7C 3SGKC 1KOAA 1AACA 3IMWA 3C5SA 3UZQA 3K5SA 3QDGA 4KDVA 2GT9B 4Y5XA 3RVTC 1BQSA 1AGFB 1N0XL 3STBA 1XGYH 1TKWA 4Z7IA 3VWKB 4RFOH 5I8KH 5JQIB 2D7PA 3JVFC 5IHLB 3FFCA 1KLFA 4NQSB 5E6SB 1BP3B 4MZRA 3W9DA 1WG3A 1JV2A 1EFQA 3QXVA 3LZFH 2XZAH 1UEMA 3AM8C 1B6DA 3QHZL 2BOCA 2J88L 1NBCA 2ICEA 3HLKA 4QHLA 1BMZA 1HWHB 3CDGB 2J6WA 2DL2A 4BZ2L 2DQJH 2OULB 3BVTA 2GFBB 4X6EA 5I28A 4WU7B 2JCCB 3QC6X 2F53D 4FJZA 4OZGE 2LVEA 4CMMA 3V6ZB 1ADQA 3IS0X 3DV4A 4HUUA 3HR6A 1SHSA 1RIUL 1BF5A 2I07B 2FX7H 3O6MH 1H8LA 3VXRD 3ZQ9A 5E4EC 4U3CA 2HT2C 5B38B 4KK6D 3HHMA 4PRIA 4FXLA 4JJOA 2FGWL 3GDCA 4XNQA 5BZXA 3WTXA 3T77A 4KI5D 1SMOA 2YD8A 5KG9B 1CF1A 5JUEH 2AK4E 4YDKL 4MJIA 5KS9A 2XPYA 1UFGA 5L2JA 2AMUA 2WIMA 1F8TL 3HS8A 4RIRA 1WK0A 2MQ3A 1REIA 5J0BA 3NIDB 3DETC 1FIEA 3A6BH 1E8YA 3GSWA 1J87A 5FUOL 2J3SA 3BKCL 4XTRC 4I8DA 1J7VR 5E4IA 3QIUB 3HC4H 4MCZA 3BRFA 5EG6C 4S1SL 3QFGA 4YDVA 4L3CB 1C12B 3B7UX 1HT6A 3ZW3A 1ZOXA 4ANXA 2VLRB 4Y1SA 4XPBL 4GS7B 3B5GA 1RZJH 3KEHA 1JPSL 1SDYA 3BP5A 3CFJA 4KQ3H 4N90E 1FVCA 2OYPA 3RWFB 5KSBF 3L3OC 4LSUL 3LH2L 4N0UB 3QYMA 2EADA 5ETUA 5E70A 2H9GB 4AITA 2GT9A 5KANI 1AGFA 4YZFE 3UZVB 5DGRA 3VWKA 1BJMA 3QFJD 2D8KA 5FGCE 4U1LB 2W9DL 3EBGA 5D1ZD 1D7BA 3QEQA 4FQCL 4NQSA 4AW4A 4BQBA 1MWOA 3RZCB 4TQPA 1CYXA 4K3EL 4K0OA 2AXGB 2UXFA 3MCG1 5C0AD 4EN3D 1QASA 1C08B 1PX8A 2LGNA 4H25B 1JTPA 3UJIL 3JV4A 3CDGA 4N8PA 2BSCA 2APFA 2LW3A 3QUXC 4M3KB 3SQOH 3BAKA 3T9WA 2GFBA 4WU7A 4TN9A 1GCYA 2JCCA 1OF2A 2WD0A 5LN4A 3AC0A 1E65A 1KCVL 3VD3A 4M6OH 3CUPB 2MWCA 2LT9A 4B9PA 2A74B 2XFXB 2I07A 3E2HB 1D9KC 1T7ZA 3A23A 1JL8A 4MXQD 4DOHE 3V0WH 4XX1G 5B38A 3MZTA 5ICZB 3GJFB 3D4ZA 2E56A 5B39B 4TUUA 4W4OA 4KI1A 3UABA 3WFCL 2NXZD 5KG9A 3UAEA 5ACLA 3DIDA 3D9AL 4MRBA 3OMNB 3NIFF 2JIXD 2OMUB 4NLHA 1BLNB 2DIEA 4P0DA 3O2VH 3P40A 4ALAC 4ZXBD 4A7SA 1IUZA 2C3VB 4WI4A 3VGGA 3QEHB 4PJXE 3PNWB 2ENYA 5LWYH 3RIFF 4KZDL 4F80A 3CVHB 5MERB 1LE9B 3QIUA 2P5WE 1R3IH 4L3CA 1NIBA 3C87A 4N2DA 2VLKD 1C12A 5CEXB 1XEDA 5IB5B 3LNDA 3DHPA 2VLRA 5ES4B 5EU7E 4FQIH 3FHQA 4PRHD 4B60A 4Y2DC 3OC8A 4D2NA 2V9RA 4UMSA 4WWKC 4Y4HD 1EJOH 5AW2B 3RWFA 2VZVA 3BZ5A 2YR3A 4I89A 4IJ3C 4N0UA 4AMKH 3LKQB 4HC1H 3GMRA 4FKHA 4WUKL 3S37X 3UTPD 2I69A 5GGTH 1USZA 3K4DA 3KYNB 5EOQH 3S36H 5GRJL 2DTML 3SE9L 4HU8A 1VPOH 1XH1A 4JW3A 4HIJB 3UZVA 3E8VA 4WU5B 4Z76B 2IPTL 3BCFA 4HIIB 5E9DB 4KZEL 3D06A 4U1LA 4BRVA 1ROWA 3I85A 2DLEA 4MHHG 1FIGL 4TM9A 3UPAA 2BY2A 3GI8L 2WZAA 4NQQA 1AR1C 5I1HL 4FMKA 5TFSH 1YZZA 4IGBB 5KVGE 1C08A 4H25A 2YQGA 4FYRA 4WSGA 5F97E 4NO0B 3QUKB 4X9YA 3HS0A 1RZ8B 5GZOC 4LSQL 3DLQR 2AJYH 5EWIH 5LGJB 2NY3D 1WIOA 1UC6A 5F7EH 1AD9B 3EO1B 3QHTC 3CUPA 1KIPB 1WFUA 1GPOL 2OA9A 2A74A 3HG3A 3IJ9A 2UXVA 3NTCL 4L5FL 3RWCB 3TVMC 3QAQA 1N6QL 1NDGB 3IFNH 3O81A 1KJ2H 4RFEB 3WN5C 1A4CA 4P3CL 5HI3D 1CDUA 5T8IA 5DD6A 1HEZB 1BFSA 3HN3A 3M7OA 4AL8L 1SVZA 5ICZA 1OSPH 3NZHL 4NWUL 3QISA 2FYYB 5CILL 3AMKA 1SN5A 3B7RL 2X4QB 2AQNA 4IKNA 2OMUA 3N0AA 1BLNA 1I8KB 1KN2H 2OZ4L 3LN4B 3WSQL 5BOPA 3O0RH 2R27A 2H0PA 1TSRA 2C3VA 1C1EL 5MENE 4LCIL 3QEHA 3PNWA 1NBYB 3OTTA 3FT4B 4UQ9A 2J12B 5FFLA 1QYGH 3CVHA 1EVTC 3IWVA 5MERA 4KAQH 1LE9A 1OP3K 1Z7JA 2Y4SA 4B3VA 1S7SB 2SODB 3ZHLA 5CEXA 3NP3A 5IB5A 5HBBA 4XHJC 4PJHF 4K9EH 4DGVH 4GSXA 4JFWA 2X6UA 4G71B 3U4EA 3GLDA 3KHQA 3T0EE 1UWXK 2IGLA 3LKQA 4NKIH 2B3IA 3H9SE 2MPAL 2CWRA 3PP4H 1OWRM 2ESVD 3KYNA 2OMNA 2ZUXA 2D0GA 4Z76A 1ECYA 4HIJA 5A40E 4WU5A 1N26A 4D8OA 3F64A 4HIIA 5E9DA 2KZWA 5FIEA 1XZWA 3U6XA 1JPTL 3HE6B 5HDQL 3C6SB 2W81C 3RUGF 3MLYH 4HIQA 1ZXKA 4IGBA 2AS5M 1NEUA 2HKFL 1XGPB 3FNKA 1QSEE 3TLRA 4HISA 3WUWG 2WXHA 3CXHJ 5C70A 2BY0A 3CZKA 3QUKA 4HKJB 1OGAE 4NO0A 1RZ8A 3IMBA 1L6ZA 4F20A 5D93B 2IFFH 1MCFA 2CLRB 4JFDB 2C9XA 4NJAH 1MCKA 2VMFA 1AD9A 1N8OE 3EO1A 1DZBA 1KIPA 2ZOOA 2HVJB 3RWCA 4LRNH 3PAYA 5KYWB 4YSEA 5JR1L 1OW0A 3NRQA 4Y5XC 4QY8B 3LEYL 1NDGA 4RFEA 1YEJH 5FM4A 1DQVA 2ZP0T 1HEZA 1RL1A 4BGLA 2IAMB 4UQ3B 4U05A 1RZIA 4NCC2 2X4QA 3LKSA 1PQZB 5EORL 1J9QA 1F58H 3UTTE 4HLZH 1I8KA 3IKCB 4GG6E 4MNHA 3LN4A 1PJ9A 3IETB 4KDTA 5TJWK 2GBVA 4N25A 3ZRCC 2ICEC 5F7WC 2CDFA 1JI2A 2VQ4A 5EULV 3SDXE 4HUWB 1VACB 1NBYA 2KPWA 4FYQA 5EF0A 2WXPA 3GSNH 1BZEA 3LXAA 1QFUH 2X6CA 1WD8A 3FRPB 1BCIA 4H8WL 4UDTB 5T5FA 1AGCA 4MQXD 1QBBA 2H47C 1S7SA 1MRCH 1N19A 3L1OL 2UZIH 3RPBA 4YEEA 5K5YA 3SSGA 1JYWA 4N4YB 1KXQE 4ANUA 5ITBL 3B5HA 5CUSH 5DQDL 5H37A 5I8OL 2B4CH 4PCTA 1E4WL 1AS8A 1BQHG 3GSUA 5D96B 3L48A 1NAKL 1KN4H 4PJ8D 5GJTL 3ATFA 4ONGH 1G7MA 4S0TD 2BVEA 2GBTA 1S6NA 1X5IA 3L5IA 3LQZB 5IOPB 3BSZA 4HKXB 2EE3A 3QUMH 1TTBA 3HE6A 2IQAB 3C6SA 4QRSB 1CPUA 1GW0A 1W16A 1J1XL 1E5ZA 2ZYHA 3Q43A 4JN1H 1SLVA 2PTUA 1IKNA 1XL4A 2EJ1A 3CFMA 1MVYA 2D2CC 2A9NL 4X5LA 3CLFL 2ZOLB 3KLSA 1XGPA 5DZOA 3LZQA 1XH0A 3MREB 1J8SA 1JTOA 3KPRE 4HKJA 4KHTL 4QOKD 2H4EA 5I74B 4ZUSA 3KPTA 4PJIB 3GRWH 1BGXH 4XRCB 2CLRA 4JFDA 1U42A 4Z7UE 2VT0A 3AREC 3WFHB 1E2WA 1GGUA 2HVJA 3F2LA 4HS8L 4EE2A 5KYWA 3IRPX 4QY8A 3Q6FB 3QUHA 1HL9A 2HA1A 5TF1H 2VDQB 4DKTA 3GHBL 3ALWA 1AKJD 2WP3T 4G5AA 1CLVA 4MA7H 4R2GB 2IAMA 1MAMH 4UQ3A 2HG5B 1AGDB 1TR7A 1NLDH 3F8UB 1JHKL 1FI8C 5ANHA 4P2QE 2GY5A 3WDHA 1PQZA 4LCVA 4QCIB 4S2SB 3TTSA 2ID5A 3IKCA 2D03H 2WMPB 1HE7A 5BVPH 3IETA 3PU7A 2KZ1B 1E90A 4UV4L 4IM8A 4AUJA 1EZVX 2JTDA 2YBRB 4HUWA 1VACA 2ZWSA 3V9FA 6FABL 5DMGC 2BSDA 2RTTA 3CFIC 2HJFB 2JCWA 4NC2B 5T3XH 4FI7A 2CBPA 3T1WA 3FRPA 2C9UA 3WD5H 2YGNA 1R3LB 4UDTA 2YEVB 3OZ9L 3C12A 4BFFA 4CAGA 1LNUB 2Y7LA 4BH8B 4YHOH 4M8VA 2ERJC 5DT1H 4KK9D 5C8JB 4EZJA 1U8HA 2X5PA 3FB6B 5BNXD 3LPPA 2VR6A 4BK5C 2Y06H 2QQNH 2FECI 2XRAH 2C4FT 4FTVE 4WI7A 4P46B 3V0VB 3FUMA 1T0NA 1LQSR 4L3EE 3ZHNA 1MI5B 4U1KB 1AOZA 2QQKL 2A6IB 3LQZA 5IOPA 4HKXA 4L4TB 2IQAA 3RDTC 4QRSA 4ZUVB 1GS8A 4FFVC 5I30H 1DBBH 4CVXB 5AOLA 1TJHL 1T3FB 4YUEL 1GHFL 4MJ5B 2ZOLA 3LX9A 1UD4A 4AYFB 5FKAB 4L8CB 3MREA 2VLJE 4NBXB 5L2KE 3ZRSA 4KNSA 1M42A 5DHYB 3B9KB 5FA4B 3WUZA 4L3AA 3B83A 3MCKB 3VG9B 4PJIA 3BZEB 1BF8A 4XRCA 1PS3A 4FG6C 4FNRA 2VRAA 2VL4A 1QR4A 1K8DA 4XO4A 4E41B 1HL8A 3V4PB 3WFHA 1IAMA 4JY4B 2WLYA 3Q6FA 1F11B 2HMID 3QEGH 1IGIH 1HYRC 2X9YA 4WTZG 1MRFL 1GC1C 5C92A 2HG5A 1AGDA 3UG4A 4NN5B 1TQCB 2PP9A 1TETL 2P1YA 3RZCC 5C2BH 2CZNA 3DO4A 2ATAA 4QCIA 1JERA 3G5XB 4LHJB 4S2SA 5I0XA 5JW5B 2F5AH 3W5NA 4JPSA 1JXGA 2CO7A 2WMPA 2LAGB 3OBAA 4G6FB 5DJDB 5KVEL 1NCCH 1F86A 1CR9L 2YBRA 2OW7A 1HFUA 1KELH 5BRZB 5G4MA 1KJ2B 4EZMA 1WWWX 2CXKA 5EO1A 1FF5A 1OARL 1RUKL 3CFCH 3SPCA 3V8OA 2HJFA 4JFEB 4BD4A 4F8PA 4AEFA 4UNVA 3EFDL 1R3LA 3RU8L 2J8HA 2Z8WC 3BPNB 5FCUL 5FM5M 2UWEB 3MBED 1KBGL 3S8WA 2A74C 1LNUA 3E2HC 3B56A 3G7TA 4BH8A 1KMGA 3T2QA 5FDYA 3VW3L 5C8JA 1PAMA 1M53A 2G4EA 5E6IC 5TDPB 1NJ9B 3QHZH 3FB6A 4PY8I 1L0PA 2WQUA 2WXKA 2J88H 1BPLB 1YC7A 4X6DF 3G9AB 3ECQA 4P46A 3V0VA 1JZFA 4WWOA 2BRQA 1CF8H 3KYKL 1MI5A 3PWNB 4U1KA 3EBIA 1KBKA 2A6IA 3MLWL 3MRRB 4YOKA 2QZQA 4L4TA 3W3BA 4UOZA 3BSHA 4ZUVA 1BVLB 2K70A 4CVXA 5GPRA 2CIKB 4G8EB 4FA7B 1RIUH 1T3FA 2D3LA 3VI3B 4MJ5A 4I0PB 4ZSOE 2ORBL 4GW1B 1YUKB 4AYFA 5FKAA 4L8CA 5C0BE 2DI8A 3P54A 4JMXA 1X5XA 2FGWH 3B9KA 4KVPA 2J1ZA 5DHYA 5FA4A 2QHRH 4BUGA 3MCKA 6PCYA 3BZEA 3BH4A 3MRQB 1QSFD 1R5VA 3CQFA 1CGSL 4UZGA 4E41A 4YDKH 3KH4A 4MNGE