4JQIA

Structure of active beta-arrestin1 bound to a g protein-coupled receptor phosphopeptide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
356
structure length
353
Chain Sequence
b'TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-arrestin-1
publication title Structure of active beta-arrestin-1 bound to a G-protein-coupled receptor phosphopeptide.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 64
structure length 353
sequence length 356
ec nomenclature
pdb deposition date 2013-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
A PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jqiA02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4jqiA01
3UGXA 5F0JB 3LHAA 2WTRB 4J2QA 1AYRA 4LL1A 4R7VA 1SUJA 3P2DA 4JQIA 1G4RA 1G4MA 1CF1A 2WTRA 4P2AA 4ZRGA 4GEIA 5F0LB 3UGUA 5F0PB 1ZSHA 4LL4A 3GD1C 2R51A 2FAUA 3GC3A 1JSYA 4GFXA 4R7XA 3LH8A 4GEJA 3LH9A 5F0MB
chains in the Genus database with same CATH superfamily
1OGAD 1XB3A 3QJOA 3WDHA 2KZ1B 2KZWA 3LHAA 3FFCB 4HFWA 1IJ9A 4KTDL 3TXAA 2OMNA 1Z5YD 4BH8B 2XWRA 3DOSA 5D6DC 1EZVX 4C58B 4AGMA 2FNWA 5JHDB 1FFRA 5ANMA 3O4LD 3OSVA 5EB9A 3WFDL 2YK1H 1JV2B 5AOLA 1DQMH 4UDUB 4GMSL 4FHJA 3TA4D 3VI3B 3U1QA 4ZMPA 4DWHA 3MCKA 3QJSB 3EJUA 1SPDA 1LNUB 1X5GA 1KIUB 3UBHA 5L4MA 5DUPL 3ZHKA 4E9XA 3F7KA 4BFOA 2QKIA 1TEGA 4NN5B 3GRBA 1CWVA 1RJLB 4ZX4A 5HHPB 4OF7A 5SWQB 4HG4K 4IBYA 2EE6A 3DV4A 4TS6A 3A6BL 4KO5A 4H0HB 4K5PA 5EU3B 3AS1A 1AZRA 1BSIA 4V1DE 1AFVH 3QHFH 1DEEA 2A2QT 3WXVL 3O4OB 1N0LA 4YWGL 5LDSA 1N3NA 4LU5H 3GRWA 3SKJL 1MWAH 3MREB 4CMMA 2DRUA 3GI9L 4Z18A 4MAUL 1MCKA 3THMH 3CC5A 3ZTJH 4N1EA 4HS3A 2IFFL 1NBVL 3FBKA 4PJDF 5LBVA 2DKMA 3P3SA 2IH9A 1NFDA 3KYMB 5EN2A 4PJFE 3WXWH 1S7TB 3UAJA 3EJQA 3FSOA 4YHYC 5IFHH 1LMIA 2OL3H 3LKSA 1KWGA 4JY6A 1AGEA 8FABA 4YE0A 1AGDB 2A6IA 1T5XB 1E7UA 4QDGA 5E6IC 4AVHA 2CLRB 3UMTA 1BHGA 1CZ8L 1PD0A 3AU0A 1U8CB 5DQ9A 5C0BB 5DJ0A 3SYCA 1A3LL 1IGJA 3AGWA 4IKJA 2IO5A 4B6ZA 5BS0D 3AQYA 4UV7H 4P46B 1AP2B 4YDJB 2A9NH 5D1ZC 5HDBF 2K9FB 3TBSB 4Y2OA 5F7LB 1EGJL 4UUJA 3BVXA 4BUGA 4PD4K 1MLCA 1NEZB 4N68A 5I1IH 3IDNB 3FTZA 3ZKMC 4I5BB 4PLJD 4LCCA 2B9BA 4L9LB 4FFWC 1JXDA 1FF5A 3M45A 4L0YA 5GISL 1Q9OB 2X1QA 2CO1A 2X44D 5E8EB 2Q3AA 3F58L 3HZKA 1IKNC 4UMSA 5LHDA 2X70A 3NACL 5IWLA 1INDL 1WBZB 3GHEH 4AGOA 1Q0XL 3JVGA 4FL4B 4U1MB 4NQCE 2R2BB 2CIKB 1HIMH 3N85H 3DHPA 5DK2B 1KYOJ 3DIDA 3ZMNA 1I1AA 5J3HD 3CFNA 1V10A 3MACH 4FLOA 4OGAC 3RTQA 3ABKB 3CUPB 3DSNB 3SBRA 3VI4F 2XTJD 4UINL 4EQ2A 2AZAA 3VXUB 5HJBA 3BESR 5HI4D 3IDXH 2P8MB 2VM4A 3FUEA 3ELAT 5DA4A 2P5PA 3G5VB 4NC0B 3NT0A 1XAKA 4KPHH 3OLGA 3SCMB 3WLBA 3FF7A 3K4DA 1ZWIA 5IKCB 4D94A 4OTXH 4JG9A 3MBXL 4PUBL 5DS8B 4YXLL 1HYSC 1B0IA 1AJ7H 1CFTA 2VN5A 5FGBA 3L1OH 1IL1A 3QZWG 4L48A 3LVTA 1RSFA 2YLHA 5K59E 5BW7A 1G9NL 4PG9A 4FFZL 4B9FA 2DQ6A 1UB5A 1QWNA 4Q2ZB 4YDNA 4WFFE 5G5DB 3PV7A 1RMFH 3I6GB 1WFOA 5T1DH 4HJUA 3ATDA 1FYTA 1PKQB 3MROB 3EZJB 3N2JA 5A16B 4AH2A 2MNUA 5IV2A 1XEUA 2BLFA 3Q8CA 4W93A 2CBMA 3OC8A 1U8HA 3GMLB 4RDBA 4LASL 4XI5D 2O5ZL 3Q3GA 4J6IA 4B27A 4HD5A 5HPMA 5HVFB 4JZJB 2W5PA 1JL8A 4BWUA 4LKXA 2VZVA 5FKPB 1P4IH 2B8OT 2JKNA 4JQIA 2KHAA 1QTSA 1QO3A 1CGWA 4D7BA 2J4WL 3ME0B 1AIFA 4U33A 2WQUA 1YMHB 5IB4A 3QS3A 3AAZA 2BFVH 4FRWA 4YGAB 2EIBA 1CI3M 1S9XA 4MJ6A 1J9CT 2G2RA 3NZ8B 4W6YB 4YHIA 4ENED 4ZXBC 1QYGL 2RTTA 5KSBA 2XJKA 4JFDD 1O75A 2ZWZA 2K9UA 5DLMH 1YZZA 3BT2H 4OLZL 3VXSA 1P69B 5I6LA 4ISVB 4OT1L 3VRIB 3K5SA 3TN0B 3QRGL 2J8UE 2VOTA 1TJIL 5DHEA 1KULA 3MRFB 5BRQA 1BFOA 4UTAL 4NGHH 4FP8L 1TZ8A 2FWLB 3BKCL 5IIEA 3V9FA 4OZHF 1MJUL 3K2IA 2BHZA 2Y7OA 3MRMB 4FMVA 4GRWF 5KVGE 3S4SA 4HKXB 1NL0L 3SDAA 5FYJU 3UTOA 1FC1A 3EYQD 1ZSDB 3X1NA 2RACA 4JG0L 1FNHA 3L45A 2LE9A 5HDQL 1UJ3B 4HKBA 4M5YL 1NICA 4L05A 5CU5A 2I9TA 5CZVH 2EXWC 1KJVB 4QF1A 1GS7A 2A99A 2WXMA 3EOBA 5LBSA 3G6JA 4G42A 1SJVA 2JMRA 3LZOA 1L9QA 1P7BA 2KT6A 1U95A 4FG6D 1F4WH 2IQAA 3AABA 3EOYG 1G7PA 1O5DT 2RHEA 4QT5A 1E2VA 3H0TB 3HE6C 2XPGB 2OI9B 1M2VB 2NZ9D 5ENWB 4EUPA 4OKVB 2HKHH 5E2WH 3BVNA 2WBJC 4NNPL 5KG9A 2PXYD 3ULVH 1AQMA 1FL3B 1BDYA 3IJYB 3U9WA 2HN7B 2NY1B 4HJGA 3GJFB 2AV7B 4LIQH 1BPVA 5F7NC 4DP0X 1G1KA 2DW5A 2PUQT 4MNHA 1EGJA 5SX5H 4R7NA 3LRGA 3U2IA 4PJIF 3OAZH 2YPLD 4MCNA 3OAYK 1NCDH 1HXMA 2HJFB 3VXMA 4NRXA 3KWXA 4WI5A 4XMVA 2NR6D 5C6WH 1RHHB 1RIHH 2Z6FA 3OJDB 1PVHA 4JHWH 3G5YA 4JO4H 4PY8I 5F9AC 3RVUC 3RY6A 4D9QD 3DHUA 3FN3A 2OAAA 5CM1A 3T6XA 1T7ZA 1XF5B 5C0DA 1JZ8A 4IOSD 4XXDA 1FORH 2W0FB 1MCBA 2VABA 2MPVA 3UZEA 5FYLH 2MFNA 3JTTA 3B3BA 1A0QH 1FFNB 2YPVH 2XWJB 1JP5A 1P7KB 4DN4L 1A6TB 5JR1L 3K71A 1KEML 3DVGB 4IRSB 4DO5A 1XH3B 4Y5YC 2RR3A 3KPPA 2YJLA 4PJ8B 4JFQA 4WI4A 2XICA 4Y4HC 5D72L 3ISYA 4G6ML 5EORL 4P2OC 3NDZE 4LT7A 3QUHA 1BVLA 1M2OA 4MNQE 4G71B 1GA2A 4AI7A 1OO2A 4OZIB 2EVIA 2IV9A 1R3IH 3MLVH 4JZOB 4M1CC 1RJYB 2E8YA 4BK5C 2BRRH 1C5DA 2F19H 3DX6A 4F3FA 4F7KA 5DUJA 3MU3A 5EU4A 1E4JA 2BZ7A 2F58L 4ZNEE 4G9FE 3VFTB 4ORZC 3QUMA 2NTFB 3T3PE 2D7TH 1C5CH 1NBYB 2G3ZA 5JXAL 1Q72L 1AS6A 3BAKA 4XBGB 5DZAA 2JWYA 5ESVB 1EANA 1ZPLA 2DTMH 5C08A 4YBLB 4FA8A 3V4LA 2X4TA 4WNJA 1ZKAA 4I9XA 3UJTL 4YBQC 3ZZSA 1IGIH 1OTUD 3BRDA 3Q8FA 3V4VL 2DH3A 5EMYA 3GEWB 4OR1A 1RLWA 5CBEB 5IB3B 2ROYA 3L4UA 3Q1SH 5C0IA 2AJUL 3P2DA 1NGZA 1YEWA 3VG9B 3UYRL 3I6KB 5F6IC 2ADGA 5I30L 1PNDA 2X6BA 3KPRE 4TXVB 3ZTJG 3B6SB 1R4XA 4ZDHA 2LHAA 1DJSA 4LL4A 3QDMA 2Q6WB 2VE6B 4GAAA 1M7IA 3UAJD 1HOEA 2HPTA 4WV1A 5MENE 5I1GL 2FJHB 4LKCB 1PEWA 1DFXA 3FFDA 3EO9L 4YSUA 5ILTH 3C8DA 4BDVA 1H15B 5CCHE 4DQOH 4PRPA 1YN7A 4P04A 5FCUH 5JHMA 2X3AA 1UKTA 1BAGA 3QEHB 3TBCA 3E8VA 2CXKA 1VADA 4JFZL 3NEXA 4JN2B 1MHEA 2HRHA 4LCYB 4ZW6A 1LQSR 3PHQB 2DM7A 5AUMA 1G7JB 2MPAL 4ZQTA 3BKJL 1KMGA 3E6HB 2WOBA 5G4NA 4X6BB 3EYSH 4YIQB 1VGEL 2YR3A 2FTAA 3MCLH 1G6RB 4LBAA 3P0VL 1PY0A 2D7PA 4UTAA 2VDMB 2GAZA 3RY4A 4U1IA 1A3RL 3IGLA 3LH9A 1QSZA 3U0TA 5D7LB 3ZTNH 2K8QA 4JFPB 5MEOA 4N2OA 4PS4L 5F88A 2Z35B 2JB5H 3CIQA 1LP9B 3SODB 2A77H 4AEIH 3MLTA 3SQRA 4DHLA 1XF4B 1TJMA 2AITA 3KYOA 3TA3B 4ZFFB 2A1WL 2J88L 4R9HA 3GXMA 4OJAA 1JPGA 4X80L 5L0QB 4QR7A 1DQQA 1K4DB 5AVRB 4I1PA 4D8PA 3LKNB 4KQ0A 2ZCZA 1DN2A 4G5ZH 1JDDA 2GBTA 3KBPA 4DZ8A 3HPLA 1A6WH 1BG9A 1I1AD 4NZDA 2P24B 3RTQD 1XGRB 1EFXB 1FZOB 4P99A 4XE5B 2YS4A 1R5IA 4GQRA 1E67A 2VR4A 5F3FA 5FM5M 2OR9H 4R5TA 1DHKA 4POYA 1BJ1H 1XGTA 4KUZH 1VSCA 1HWGB 2VLMD 4JEGB 2GIYA 3FUIA 4MASA 3IMTA 3TJHC 3GXTA 3GXNA 5D2NE 9CGTA 3IU4L 2C9AA 1ZVHA 3EIFA 3P4NA 3HI5L 1D7DA 5SWZD 3RY5A 4DKTA 1M7DB 3HS9A 1AQKL 4I2XE 2H41A 4NJAL 4Z3JA 4JKPL 4UT6L 2FWSA 1JJUA 2XNAB 1ET8A 4GRLA 5AD0B 2VDOL 3HPJA 2NX5A 3MNWB 2APXA 4LZKA 2X09A 2Q3ZA 1YUHA 2VXUL 1FVCB 2HWZH 5D4IA 1UD6A 2H2PC 3J7HA 5EO1A 1BIIB 2KS0A 1VDGA 1DVXA 5DT1H 3QO1A 1FVDB 1L9TA 1FYTD 1GPOH 3RIFK 1JGEA 5TTRA 2UVFA 3VSQA 3VTMA 2VM9A 1KG0B 1XIWC 3BKYH 3QIBB 1M1XA 3ZYJA 5E9DB 3PL6C 4YSPA 2ESVB 2VDMH 2ADIB 2YXFA 5L8KB 2ZCKL 2AJZA 1EWHA 4XC1H 2H0JA 5AAMA 5DD0L 3B56A 1E7VA 1RH8A 3JXAA 1QTYT 4QRTA 5T3ZD 2Z7UA 5D8JL 1BVKA 4S1DD 2PWFA 1KCUH 4KVCL 5C8JA 4H40A 4K94L 2IQ9L 2AZUA 3G5XB 3VWJA 2NQ3A 1GGTA 4TNVK 2EEXA 3RWIA 4JAMA 4H2AA 4L37A 1OF2B 4ONFL 4QHMA 2D2OA 3VXSD 1D7FA 4DEPB 3OZKA 1FSKB 2ZNXA 5SWSE 2OZ4H 1YMME 2HKAA 3FQ4A 2X0UA 4OZFG 3ULVF 3ESPA 5IMOB 3BDYL 1IAMA 3OAUH 1QFWM 2CHZA 3GMQA 4RZCB 1C08A 3NTCH 2L04A 3CQPA 5C0CB 3NAAH 2ZUQC 1KTLA 2VQ4A 4G8GE 5IBLD 2KYIA 5IY5B 3IU3B 4QRFA 2OYLA 1NUDA 2A4CA 1H6EA 1U2CA 3QGVA 1YNLH 2V5TA 3N50A 4AYSA 4FFYA 4P2QA 2W9EL 2ARJB 2YKLH 1SHXA 3SDAD 2PLTA 5HGHB 4YFLF 1HT6A 3S88H 5I15L 3DGGA 1SM3L 4IRJA 5DRXB 1NKGA 3GXIA 1FFPB 3QDGE 3BWUC 2JCCB 1P6AB 4HCIA 1K8DA 3W2DH 4WDIA 2CKBL 3UTTB 2E7LC 5EBMB 4PY7B 1A7RH 2FWOA 2Y6SC 1M42A 2DQEL 2KERA 4V1DA 1CYGA 5KVGL 5E08H 5F96L 1J12A 3IFPB 1HS6A 3MCYA 4ONGH 1XCTA 1MCEA 2NY4B 2EO1A 3D51A 3SOBL 4AYFB 1H3WM 3RFRA 2DMGA 4NNXB 4WAFA 1TEYA 4UT7H 2FHCA 4YDZA 3F6LA 3HNVH 4K15A 3GS0A 5IW6A 3I84A 5H37A 4QO1A 1SZNA 1YEEL 4JLRB 4YPGA 5DHYB 4PJFA 2XXMB 1IJNA 1QEWB 3NABH 2CAKA 2H32B 1ORSB 3NSXA 1E5ZA 4WU7B 4JL1A 3VXMD 1IKOP 7FABL 4QHKJ 3QUXC 3IKCA 3OAYH 1HEHC 4Y5VB 2JKTM 4PREA 2OJEA 2DD8H 4HUUA 4BSVA 4ERSH 5HHXH 4XX5A 2NXZC 3DPBA 1KBVA 4LLDB 4YLQT 5FO9A 1UH3A 4Y2DB 1U3JA 4IGBC 1NLBL 4KJQD 4NERA 5I0DA 4LARH 2ZKMX 2IAMA 1P4BL 1UWXH 4OLWL 5JPMC 5JPNA 4AMWA 1HWHB 3UTPD 5KSUB 2NY7H 1PGRB 3VFSB 4LPVA 3E9TA 1FLTX 1AO7E 3BH8B 3IE4A 3AU1A 4CADA 4DVRH 4UV4H 3E38A 3U6XA 1PSKL 2QTVA 2BCKB 1J0IA 3RVVD 2LOEA 3HRZA 5B7MA 3KW8A 3L95B 3JV5A 4MCMA 1MRDL 3V0VB 2JI1A 3NFNA 2NLJB 3NN8B 3DRQA 3Q8AA 5AWNH 1QWUA 2CZNA 2IALB 2YZ1A 3HG4A 5HJ3B 4X4YA 3DDGA 5TJWK 5IEHA 1NBQA 3ARBC 4X6DA 4AIOA 2W0KA 1RJZB 1YDPB 4M8QA 4UNIA 4YSOA 1KDJA 4EZMA 5DR5H 1JXGA 5C08D 3C5JB 3VA2C 4HUXA 3PP4L 1CG9B 5CIPB 5KYXA 5LXVA 4MDIA 4EDWH 2F54E 1QX1A 5C09A 3OSKA 2IJ0C 4R8WH 4C4BA 1D5MB 1BQLH 1E4XI 3D2UA 1MIML 1CB4A 2H32H 4X9IA 3JYBA 3TNNB 3N1MC 3QNXA 4G3YL 2HRGA 4WW2F 4JM2A 1IGYB 1MRFL 3D4GA 3ABMB 2VLLA 1NDGB 4AW7A 1WRFA 5JIQA 5ICYB 5DD5H 2V9RA 3KLAB 1H19A 2OMXA 2W8CA 4XBPB 1F3JA 3GEFA 4DP7X 2N0MA 3QDMD 1A8ZA 2FQDA 3BVDB 2QADB 1COBA 3ILPB 4FXGC 4QKXB 3QJQB 5I18H 5IB2A 4ZYKA 3ZGIA 3N43B 4PRPD 1LILA 2K6YA 1E4KC 3DSFL 1WTLA 1YSOA 2IANB 4PRHE 1Z6JT 4DKAA 3DVNA 3A4EA 2MH4A 3SDXE 5KN5A 2DIJA 3FB5A 4XMTA 4NZJA 3REWB 4FQXB 5KBDA 3ZKQD 5E70A 2BZDA 4LAQH 1MJJB 1RZKL 1TU2A 3KXFD 1WAPA 1S7VB 1WBYB 1GHFH 1P84K 3IGKA 3HEIB 1YQVL 2NY5C 2A9CA 4EXPX 1NGQH 4IOFD 3OKEB 1TQWA 2ICWA 4NQEA 2ZUSA 4DKEL 1BAFH 2WW8A 3K5RA 4Z0XA 4P59L 4NLHA 4Y88A 3BPLB 4A7GA 3BVVA 3O6MH 5DUMH 2J8UA 3D9AH 5CIPH 1EAQA 3G08B 3HS0A 1B4RA 2XYBA 4LF3B 3H56A 4P4RB 2HJKB 2K7QA 1AYRA 1JN6B 3HR6A 1GOGA 3GB7A 5D9SB 1OPGL 1SRDA 3MLSH 4EDXB 1MCOL 5I0VA 2QVIA 2BNRB 1U8KA 3KCPA 3O81A 1LP9F 3DX9A 3AG4B 3CQQA 3VFPA 2WSPA 4DVBA 4LP4A 3R8BB 1T89C 3VGAC 5L4FA 2H2SD 4ZUUB 3G6AB 3O3DA 4W9FC 1MIEH 5ECGA 4DK5A 4ZO6A 1F4XL 3HCVB 1TZHA 2EO7A 2P28B 4L0ZA 4RGNE 3AY4C 3FT3B 2APBA 3B7TA 2WJ7A 2WXHA 3LN4A 4UTBH 4MMYB 5JLZB 4L4VB 4WWOA 3EBHA 4GRLD 4LFHD 3VD7A 5I16A 1QNZL 2C8NA 1BX2A 4BK4A 2NX5D 4EI5B 1BFTA 2BIMA 2BSEA 4F33B 1LWRA 5I9QB 3RDTC 3VSVA 1BLIA 5KEZA 2BOBA 2IH3A 1N8OE 1HE7A 1KB5B 2CPUA 2E27L 2Q86B 5LNDA 3RPBA 1R5VA 3CDCA 4OCRH 5IF0B 1N4XH 4YFDB 5TDPA 3P4OA 3ZE1E 4EIBA 2P47B 1YEHH 2ITFA 4EEEA 4XNAA 5I6PA 1HZHL 2VUOA 4HP5A 5C3TA 1F11A 1TT6A 1SYSA 2NXYB 4O02A 1MSPA 5ICUA 3GHBL 5TQ2L 1S5IH 5GRJH 4AGPA 4IHBA 2LLLA 1NIDA 1SJMA 2ENSA 4OGXL 5JHLA 1VZHA 3HC4L 3MNZB 4FQLL 3VJ6A 3LNHA 1L6XA 1U8JB 1MCHA 1EO8H 2DIBA 4BFFA 4LSRL 3VWJD 3PJSA 4KI5D 2DWDA 4KKBC 3BCDA 4EO5A 1PYWA 2BFGA 4IIQB 2D3NA 2DJ4A 4KJPD 4MRCA 4S1RL 4AQEB 5K93A 5HHOA 3S36H 2XU9A 2CKNA 4P9HH 1JERA 1PZ5A 4AG4H 1ACZA 5I66B 4Q6IA 4LLUA 2EYSB 5CSZB 3DUUB 4PP1D 2G75A 3T4YA 4ZMTA 3BWSA 4PSRA 3ZHFA 1H3PH 1AMXA 2WQWA 5HYSB 1EAPB 2ZTBA 4Z7WE 2QQLL 4F7TA 3VGEA 2HPOA 2PABA 1FGNL 5FXCH 2CDFA 3FOLB 4P2QD 1CGYA 1JTOA 2ZOWA 4U2YA 2GJ6E 3OKMB 5F7EL 4GAJL 4G9FA 5IVXF 5IEKB 4BZ2H 3J8F7 4IRJD 4J3TA 4W68A 2VJ8A 4G8AC 2X4UB 4CC4C 5BXFA 2MQ0A 1KELH 3EF7A 2D0FA 1HDMB 5C07E 1CQKA 4U4BA 4MXWH 3S37L 3TH4T 4B7IA 2VWEC 3MJ7A 3RL2A 1KB5H 1ZXKA 2MTAA 5FA4A 3P1VA 1IU1A 1OT2A 3C6SB 4LCIL 1RZ8B 4OM1L 5BO0D 6PCYA 4V1DD 1Q8MA 2UZXA 2V7HA 4OCNC 3FPXA 3FUNA 1X5ZA 3JT2A 3S8FB 4AKPA 4F91B 5D1XB 3N9GL 5FYJE 4XO9A 2UXVA 4ZUTB 4FABH 2BOLA 3JZYA 2VQ1B 3BH4A 2V2TB 3S97C 2IPUK 4H8WC 3MLYH 1A7NH 4M4RB 3MJGX 5AYUL 1U33A 2VSDA 2LLGA 4ZOCA 1W2KT 4JB9L 3L4WA 3NZSA 1I85C 4FLSA 3O3AA 4GKNA 5I6NA 4FNSA 3QQDB 3BO8A 3RNQB 1ZIAA 3ARGC 5HHVH 5IT2L 2CSPA 3MUZ1 1AR2A 1A64A 4N0FB 3C60C 1NC4A 4R0LC 2DYPB 1TPXB 1ROWA 4G6JL 1D2OA 5I1LB 2OMBA 3FTXA 1R3JA 1D5RA 1J1XL 1J1PL 2FO1A 1CGUA 3WE1A 3FAWA 3RA7H 2WB1A 2IAMD 3BH9B 3UP1A 1YJDC 4LHUG 4V2CB 3BUPA 2PCFB 4EIZC 4WW1A 1JNHA 1QI3A 4G43B 4S1QL 1MFCH 4QTHB 2R69L 1M53A 3PPEA 4LRNH 1SDDB 3ZL1A 2WWKO 1A2YA 4JM4L 2HB0A 4WHCA 1TJGL 2FO4A 4YHOL 1X4XA 2JKIS 1ECZA 4ZG1A 5F9DC 2O6FA 4FG4A 4FJ6A 3ARDA 1ONQB 3A47A 4ACPA 3L3GB 1SJEA 1MHPL 1AR1B 3SGJC 1T21B 3EGSB 3F6JA 5DEZA 4GSDH 3T8VA 5C0JB 4Q6YA 4BXSV 2GSIB 3NCJH 3TBYA 3BCFA 1DE4A 4MA8L 3FMGL 4OIIL 1CLYH 5GSRB 1ZLSL 1SBSH 4Y4KB 2NY2D 4WFGE 3I02A 3LX9A 3LQAH 4Q0XH 3QFJA 5D6DA 3OKOA 2XKUA 1ZHBB 3HBPA 2BDNL 1RZJH 1DDTA 1IEAA 4KK9D 3VXRE 3L3HA 3O2DL 2ZOLA 4OD2A 5I1CH 3FO9B 1GCYA 3PAUA 1OP5K 3UGEA 4CUCA 3QW9A 4S0TD 5FDWB 1NJ9A 4N0UA 4U1LA 4UZGA 3D2UD 3GBMH 3HC0B 1E9QA 4KY2A 4L8CA 1JNNL 4HIIB 3W0WB 4YFEA 5I6XB 4PI2A 4JM2D 3KR3H 3CDGA 4FYRA 1OP9A 3BVUA 3OHXB 4WJG3 3NIDE 4PCTA 2FJFA 2IPKA 4I48B 4F15B 3DMMC 1S7UA 1U93B 3JUYA 4YVNA 4LQFH 3WN5A 4YJZL 5T5FA 4ODUB 2QL1A 1LWJA 3NJMA 2BIPA 1UZ8A 2Q8BH 4XCEB 4AJVA 5CD3B 1T1WB 4G1EB 1V7NH 5C6PB 2ZXDA 2WY3B 5HGDA 2WHVA 3ULSA 1CFVL 2F6AA 2V7NA 3M7FB 5B8CB 3EO1A 3TURA 4PJXB 1IM9B 3WEXA 5DTFA 1FQ9C 4M1DH 4CN1A 1QSFB 4HWNA 3T08A 3QNYA 1ZT4A 1G0XA 2FIKB 4G5AA 2BC4A 5IG7A 5D7HA 4XHJC 4K8RD 3EOAA 1DZBA 4OV6F 4NKDB 3SE8L 3F3HA 3L3JA 2WUBH 4ZODA 5TDOA 1IBGH 4UIKL 2DEWX 3IJHB 4FQ2H 4AVKA 5D7EA 3QHZH 3K2KA 5CF3A 3WKQA 2BSCA 1HHHB 2ICEC 3T1FA 5IVNA 3BP6B 4LSSH 2BWIA 5E23A 4LVNB 4V33A 3M1BA 4N85A 4R4BA 1LLAA 3FQNB 1O9VA 2AC0A 4PN6A 4APXA 4NQED 5JYLA 1B2WH 3BD5A 1JPTL 2WC7A 2ZZUT 3QR1A 5J89A 4MD4B 5F70A 3V8CA 1LK2A 3WKML 1A14L 5D1ZA 5HGBB 3VYOA 4NHUB 4M1GH 2C7UA 3V52L 1AXTL 3HNTL 1SBBA 3WIIH 2Z7YA 4RMBA 4OF3A 1U0QA 3QBTB 1AKJD 1QBLH 3I74A 2Z7WA 1JK8B 5DC0A 5I73C 5JW4N 2CRYA 1NMCC 3BGAA 4Z8FL 3KYKH 2X1OA 2XQBH 3EHBC 3WCYA 4GI9A 5E2JA 2WO2B 2GQHA 3DYPA 4K7PL 2WLIB 3U4BL 2WLNA 5E8DH 4A55A 1E3ZA 1UJTA 3OWEA 4RSYA 1DN0A 3QJHB 3LZPA 1IKNA 2DQHL 3ZDZE 1B0WA 4X9YA 1S7XA 3QQ3B 4J3VA 2WZPD 3WFHA 3PYCA 1GGYA 1ZEAL 4E42A 3HE7C 1DANT 4EBQH 3HN8A 3BZ4B 4J3XA 4R3SA 3W5MA 5IMLB 3IMRA 3QORC 1T03L 3ASOB 4EKJA 3CDYA 2DQDL 3RWFA 1G1YA 1FH5L 1MCFA 2X9XA 4JRWA 1TETH 4LP8A 4P4KB 4WIQA 4MJHA 4YLCA 2QV2A 2BSED 5AKSA 3EFFA 4EZKA 2DMCA 2YMOA 4UIMB 3BYYA 3PREA 4Z7OE 3DXAB 3LQZA 4NKOB 3WFBH 1AGFB 3GS7A 3PDOA 1ITBB 1F4YL 4PGEB 3B9VA 1O6SB 4G6FB 3FU0A 3CAFA 4YSRA 3G04A 1ADWA 2NY0C 4J3OG 1AXSA 3IVKB 4WJ5A 3KDMA 5E5RB 2C3HA 3HAEA 4XNBA 2JQAA 1CGXA 1GGIH 2BS8A 2KUTA 2PPCA 3E9UA 4HCRH 2F2HA 1EJOL 1RUMH 1SXBA 5CGYD 4DGYL 3CFCH 1UWGL 2IWKA 4JRFA 3X3FL 4YSAA 4YZWA 3VXTA 1BVOA 1LDPL 2R69A 3IRPX 2ZUXA 5ERWA 3ESMA 5HHQB 2E76C 3BDXA 4CNIA 1KCKA 3ESOA 5LGKA 5AZEL 1JZJA 4I8DA 2XQYA 4IBVA 5IUCA 2XETA 1CIUA 1LO2H 2VLKB 3IKKA 3SDCB 2DQMA 4HPYL 1JDCA 1NCWH 2GTWB 3DVIA 1YA5A 1IC7H 3S34L 2FBRA 2J71A 3FN0H 5HHOD 3UBGA 2EYTB 3U1SH 1W8NA 4ZUSB 5GGUB 2ZXCA 4BEIA 4ZZFA 1I1FB 4LMQE 1NZRA 3FFCE 4ATWA 2XI9A 1HQ4B 2B0SL 2XQYK 4GP5B 2XCMC 4JJ5B 5BZXA 4M8UA 2WANA 4BK8A 3FSAA 2E4TA 3H53A 5JHDE 1K4CB 2VXVH 3GXFA 4ZFZB 2K4WA 4JRXB 4ZXBA 3WTVA 1LO5B 3B9EA 2ZX9A 4ZUWB 3QCUH 1HSAA 3LKRA 5J06A 3FQRB 4I85A 5G55A 3FRUA 1UEYA 4FHBD 3QAZB 5EIVA 3VI3E 2E56A 1FG2A 4G9FD 2BSRB 5IJVA 3LEXB 3I75B 4ODWB 3ZYZA 4GXUM 3VX1A 4AL8H 3VE0B 5GHWL 3MMEA 1NANH 3SDYL 3QIUC 4IHOB 2PO6B 1D5XB 4O58H 1EHLL 1BEYH 4HMCA 4JHBA 1D9KB 5KZCB 4KKNA 3BRFA 4KQ3L 1Y1UA 5EZOH 2KH2B 2MCPH 2MTPA 2NOYA 3ARUA 4PIRF 5B3JF 1OGAB 3RKDC 3MLRH 1EK3A 2B59B 3RAJH 4WJKB 2FQEA 2Z91A 1QTPA 4FJYA 2NW3B 2BP0A 5I1HH 2BPBA 5T5NF 1YEDA 1F1DA 1GC1C 1XSOA 1LDSA 4JKMA 3GXUB 3HB3D 3NPSC 3SBQA 3O4LB 4H2CA 3MRKB 3OM3B 2J6WA 2CJUL 2ZJSH 4NYLB 1RZFL 3V0WH 4G11A 2AQSA 5AYQA 5I82A 1S3RA 2Y2YA 5CHNA 1JGVH 5FYJL 4N2DA 3CH1B 2ILLA 3HE6A 2EDLA 4KMQA 3ZKNC 1DDHB 5T1MA 2ITCB 2HH0L 4ZFOL 3DI2B 2YEZA 2UZIL 1NC4D 1T83C 4N9OB 2WBJA 4X99A 7PAZA 3D25A 3GUTA 1UCTA 5C0BE 1GGCH 1PZ2A 2FJGA 3HMXA 1HXKA 2VW4A 1S2EA 2EJ1A 3BC9A 5CZKA 3APMA 3CBKB 5JHAA 2BWQA 1I9EA 4XH2B 3GT6A 2ITEA 3EYUL 1RURL 1OZTG 3KNBB 4P57B 4Z3EA 3OXSA 1OWWA 1GYAA 1DBBL 3RWCB 1CGSH 1VFMA 1ZIBA 3UIYA 4AQ1C 3RI5K 5F1KC 4JUSA 1J8SA 3AT0A 3KD4A 3ZJAA 4NM4L 3HBQA 1QHPA 2I69A 4J28A 2EYRA 2OMYA 4JO2H 4M7KL 4MJJA 4UAOC 2VISA 1RPQA 4WK4B 1TEFA 4J3BA 1MFBL 3ARDD 4KXCA 3ULUE 3QQXA 4CW1B 3CFUA 4AYID 2YUVA 5T5NG 4C4KO 1Y1DA 5DJXA 1YYMH 3OMZA 1FE8H 4OJFH 4QEGA 4JCMA 4O4YL 4DUVA 1AHWB 3WIHL 1MLBB 4Y5YA 5I1EL 3CE1A 1Q0YL 2IFGA 5T3XH 1KENL 2P52A 3KJ6H 1BZ9A 1DL7L 3D0VB 3H3KA 4JG1H 4PJEB 3INUL 4Y4HA 5K39A 1M05A 3AXIA 4P2OA 3OTTA 2K8MA 1E4XH 3U0PA 2XTLA 5BS0B 2WNKA 2GK2A 3QFJD 1HHIB 3BZFA 1CLOL 1GJWA 1H6TA 4CMHC 4XB8A 5GJTH 2DOCA 4GXUN 2ORBH 1XF1A 2FQGA 2VKWA 2YBRB 4GB9A 2ZWSA 4NNYB 4BK5A 4JO3H 1IIKA 1ZVSA 3KLKA 3PWLA 3KBEA 4U3SB 1KPVA 2H9GB 1G6VK 3INOA 1JMXA 1SY6L 1ZPUA 3KPMB 3U7WH 4HZLB 5B39B 3PLYA 1F6LL 5E1HB 5KVMC 4K3HA 4MMXB 4E9RA 4QRAA 4HMDA 4QXTB 4JN1H 2D03H 5I8KH 3SO3B 2WCPA 4HBQA 2VWEE 5GGVY 4LSQL 3TCLA 2X4NB 3REVA 1U3NA 4AC4A 3CFBB 5TF1L 3TBTB 4ADIA 5IHHA 2OMTB 5BOZG 5E8PA 2YOAA 3SBPA 5CGMA 2HRLA 4HUVB 2E75C 3HHMA 4OD3L 4Z7UE 4FNTA 4X6CA 1UOVA 5FO8A 5KVFE 4FKHA 3DROA 3HUJB 2XTJB 3BEWB 1WBXA 2KC0A 1EJFA 1BD2A 3POCA 1AGCB 1R24B 3TCTA 1RUPL 3WE6B 4CC0A 4F7PB 2KI6A 4HEMA 1N0XL 3QXAB 3BOVA 5DRNB 2Q7YA 3RLSA 1QRKA 2MWCA 5CP7B 2W81C 4E5XA 4NQSB 1DQDH 1N68A 5GGTL 4XP1H 1J5OH 4LIQE 3KWWA 3BAXA 4NZTL 5E6ID 4XMUA 3D4ZA 4PJXF 2HFEA 1R0AL 3FU6A 3QR0A 3GO1L 1R3LA 4JDZA 3WENA 4WFHE 2VN3A 4L3CA 3LMJL 2HG5A 3ZR6A 4DZBB 3K72A 5D1ZD 3X12A 4DCQA 5IFJB 3TGXA 1CXLA 1U58A 1LEIA 1L6PA 3ZKMD 3PWUB 1JGLH 2W07B 2C9UA 3CBRA 2EDEA 6FABH 1LE5A 4YHZH 1KCLA 3R0NA 1LEKB 4LVOC 4FFWD 3OPZL 1RIVH 4HISA 4JANB 1XB8A 3WDJA 5ADOL 4JDVA 5LGHH 3RPIA 1C1EL 2GJ6A 4QGTA 1ILSA 4RDQF 3HKFA 5LCVL 4FQ1L 3KYNB 4F58H 5LAXB 3K6SA 1U2HA 1E50A 1P7HL 1XEDA 5C07A 2JTYA 2C1OA 4ZMLA 4BH7B 5IM7A 5G4OA 1MAML 2KDYA 4K9EH 1MHCA 5CEZE 2OFQA 3ZPDA 1EV2E 2WYHA 4OGAD 5TPWL 3AT8A 4JFDB 3SZ6A 4HDIB 2HX7A 3L4CA 2ZAGA 2VR6A 4G70B 3QSKB 1Z9MA 4L0PB 5DI8A 3CLFH 3TNMB 3B2XA 3KM1A 4UQ9A 4N1HB 5EO9A 1G9EA 4AX3A 4ZFOA 4NJ9L 5D96C 3QYCA 5BUGA 2AK1H 1OOAA 1SGKA 5EC1B 1KYFA 2X1PA 4K3DL 1XGZA 2H26A 3FB6B 1QLRB 1HYSD 3MUUA 3LSOB 5ITFA 3SPHA 5AG9A 5FS5A 3IJ8A 3FT1A 1PJWA 3GIVB 3DO4A 2D3LA 3QWNA 5AEAA 1DLHA 4F8OA 1UT2A 5KSVA 2XQ0A 3IJEA 2J25A 5DFWH 2CA4A 1XH2A 2YGVA 3WHXA 5I8OH 4J2XA 2E0PA 3BSHA 4JREC 5I19H 2FL5B 3GSNH 4QRRE 2HT2D 2Y7LA 2YQ2A 1XGPB 4QY8A 4W9DC 2XPYA 3RHWK 1H5BB 1OGTA 4HJJH 4ZX5A 3RWEB 4RDQG 2HTLC 5B38A 3II2A 4PJ7B 1VZIA 4LDEB 1N64L 1AE6L 1XIWA 1BV8A 2C4XA 4NPKA 3PV6A 4GG6B 5HYJE 3VB9A 2ZCLL 3PL6A 4WSGA 1EXUA 1MVYA 3U83A 2R2HB 2V17H 1DBMH 3L48A 4Y5XB 4W4NA 2IDSA 1TQBC 4QXUH 1T80A 3OF6D 2DIEA 5C0GB 5E2UL 3WFZA 4F7MA 4MD0A 1QR4A 3GYRA 2PXYB 1FIGH 4M61A 2C4FT 4BJLA 1A4KA 1MOEA 4IOIA 5EBWB 2NNCA 3BLPX 4A67A 1A1OA 4URKA 4I0CC 1I53A 4OI7A 3WXWL 2A0LC 1AY1H 1CGTA 1TTAA 1YYCA 2X0VA 4WGVB 4Z7VB 5F3HB 5IFHL 4J8QA 1S78C 4ZXBD 4OZIE 3VD2A 2V4LA 2YPLB 2NTSP 2W1NA 4U1KA 1ZJBA 4EPSA 4TOYH 3IFOB 2BM3A 1W72H 3L4TA 1FZMB 2XZAH 1QD0A 3UH8A 3CX5J 4Z7QE 1QHQA 2WMPA 2JIXA 2YAHA 4RISH 1NTDA 1KCBA 2XWTA 4KTEL 4AITA 4QRUB 1MG2C 2XVBA 4WY7H 1ZT7B 4ZTOL 2H8PA 2NY5L 3VXRA 2NY6C 5LDUA 2R39A 1Q1JL 2R56H 3AQZA 5CFHA 5KAQF 3MRPA 2DYSB 5C6TH 2WYZA 1T1YA 2ENYA 2AQQA 3FUHA 1KCVL 3DPDA 3FT0A 1A4JA 5GGQL 1JNJA 4HFWB 1KGJA 2X9YA 1NUFA 2QQKH 4PJCB 5E9NA 1BIHA 1Z9SA 3HFMH 3MKGA 3DOSB 3PXJA 4HD9A 5A7BA 1M57B 4N8CH 4XPFL 3W9EA 1QUPA 4OB5H 4KO7A 5ANMB 2F1EA 2E7LA 4L5FH 2EXWD 1BBDL 4GH7B 3GHEL 3S48A 1HKFA 3KE0A 2IPUG 1BQUA 1HIML 3MCKB 1BMWA 2VR5A 2PWHA 3UCQA 2G2PA 2Q2EB 3HE6D 1U8PA 4BKSC 1WC7A 2QKIB 4ZJ9A 3EDEA 5M7QA 2I5YH 1WGVA 1S7QA 2WBJD 3WI9A 3WUWA 5H4ZA 4BE5A 4IIQC 2I7OA 1JHLH 4JG5A 3EJZC 5EU6A 4D0DA 4D2NA 4ZX6A 3O8XC 3DV4B 4PJBF 4LPXA 3R7RA 1WIPA 2DJSA 4HIXH 1DEEB 3LHPH 1N0LB 5I75B 3L1OL 1JIBA 1VLXA 2J21A 3QUXA 4CMMB 1U42A 3NFSL 3RVUD 4XMLH 4LRIC 5DZLA 4LPUA 1UXWA 5KAQG 3BZ5A 1CYXA 3CC5B 1OAYL 5JUEL 4HS3B 3B5HA 5D7LE 1JPSH 3E8UL 5BMFL 4L23A 4E9TA 1NFDB 5DK0A 3BT0A 5K9QG 1PFCA 4IGBA 2BP8A 3LPOA 1FVEA 5EN2B 1I3GL 3LKSB 2ED6A 4JY6B 1AGEB 2J8OA 4K23L 8FABB 4LLYA 2A6IB 2PF6A 1CS6A 3QEGH 3S35L 3D09A 5I1JH 5DQ9B 2WXOA 4NO2A 1ADQH 4Y4HD 1V3MA 3K4ZA 5DJ0B 3LXUX 1IGJB 4P2OD 3B2DC 1EHXA 1MCNA 1L4IA 2GITA 2E9GA 4O51A 5E8OB 3V5KA 2FX9H 3ULUL 1KYOK 4M1CD 4W9JC 4Y2OB 2VDPL 3T8MA 3U30C 4UUJB 1HINH 2OV0A 4TLKA 4FAAB 2R29L 1EHKB 1MLCB 3T77A 2O6DA 4NO3A 4XP6H 1DUYA 2BIHA 3DJTA 3EOTL 4LCCB 1CFNA 2BSSA 4G2AA 2J5LC 5KSAA 5HPOA 3EBIA 1LK3H 3HBZA 2AV1A 3ARBA 1ASOA 1I8IB 3EFOA 4R7DB 1ZT1A 2VC2L 2PPAA 3FU5A 3HZKB 2L3BA 4L1DA 3LZFH 3SE9L 3BVTA 4FYTA 3QPXH 1I4FA 2FR4B 4GAYA 1MW3A 4YBQD 3N40P 2DBLH 4HIHA 4FZ8H 3KWTA 4DPRA 1IZJA 5HVGB 1BM3H 1XX9C 1I1AB 1NAKL 1OB1A 3BFQG 1H8SA 5J12B 3Q2CA 4P2YA 3RTQB 5J57B 2H1XA 4NP4H 5E9DE 2ESVE 4Z3HA 1BD2D 4H8HA 1URLA 3MRCA 4L8SC 3SYAA 4HU2A 4JMXA 3WLBB 1G87A 1RIUL 3UC2A 1RULL 4YHKH 2Z8WC 1ZWIB 1ZGLM 2JJTC 4FXGA 5BVPL 4H13C 1XSIA 1CFTB 5SWZB 3SD2A 3GKWH 1IL1B 1ORQA 3UTZA 5KVFL 1E4KA 5AFAA 1USQA 4NQDA 5FWRA 3FQUA 4PG9B 3ES6A 1UB5B 4H8WL 4HJ1A 1NGWA 2BOCB 4XN1A 2IIJA 1T6WA 1X6NA 3PUUA 1F02I 3V6OC 1UACH 1FYTB 2JELH 4AH2B 2AFNA 4KAQL 5IV2B 2QPEB 3DYMA 4LIQL 4FQPA 1PLBA 2YO3A 3S3JA 1U8HB 4JM0A 2WZ0A 3MN8A 5C0CE 4G7VL 1JFQL 3Q3GB 15C8H 2G9HA 4HS6A 1HNYA 1RIHL 1YEJH 4JHWL 1G9MC 1FV1A 2GBVA 4JO4L 4LKXB 4A2EA 3FDWA 2GJ6D 1FZKA 1IC5L 3NIGB 3T6VA 4HAKA 3VD5A 3LKPA 5B39G 4PLKC 4M3HA 1DANU 5DVKA 1YCSA 5T33H 4B9KC 3PG2A 1AIFB 1YJDL 3VQ2C 4PV8B 5C07D 5IB4B 1T0PB 3AAZB 1QOKA 1A0QL 2W80C 4WRLA 4N2LA 2WQVA 3VM5A 5I24A 1S9XB 2JCCE 3OHXC 4MJ6B 3H2QA 1X5JA 2G2RB 2WP3O 4YHIB 2Q8AH 3UTTE 5EF3A 2ICWI 2HXAA 4KHTH 3QWQB 4JKKA 4F15C 1MFVA 2CE6A 4YEFA 5KSBB 3E1ZA 3UC0L 3VXSB 2QELA 3DX7A 1T89A 2J20A 3QJXA 1AZVA 3VB8A 2P49B 2C3GA 4HZAA 3N1GC 4DPAX 1WYJA 4OBSA 1Q0EA 4OKDA 1UZ6F 3TJHD 2ZXWB 1JZGA 2V2WA 3K2UL 1BFOB 4OQ1A 3LXCA 4K3JL 1M7XA 1YY9C 1MCDA 3AY4A 3FO2A 5CEZL 5IIEB 4WKZA 1TO4A 2BRRL 3P73B 3QXWA 4HGMA 1ZS8A 3WFCL 3A24A 3S4SB 3SDAB 3WTXA 4CVXA 3GZKA 2YUWA 2OXHA 3UEQA 1CR9H 3AB0C 4HG4J 2H2PD 2X3BA 4OU3A 3RDTA 4XO8A 2OBGA 1FUNA 2YMXL 1RUAL 3AFLA 4CVZA 1UXLA 2DTML 1LE9B 2I9TB 4XNQA 4WU5A 4B9IA 2Y7SA 4QF1B 1XIWD 4DKFL 4H7VA 1IGIL 3EOBB 2CO7A 3G6JB 4G42B 1G5GA 3OG6B 3NZUA 3PL6D 4ODTH 5JIPA 4JVUA 1B6DA 1U95B 1GZQA 1PX8A 2IQAB 3GK8L 3JV6A 1G7PB 1U3ZA 1VPOH 2GG1A 4N8PA 3G9VA 5DQJA 1F97A 1CLZH 3RURA 4EUPB 4JHAL 1B4JH 1ET5A 3J27A 5A6IA 3BVNB 4JQIH 4QHPA 5T3ZH 5D1QC 5KG9B 1N6QH 2H7WA 4NUPA 4HZ1A 4KGLA 4W9ZA 2HT3C 1PG7X 3I6SA 3BGFB 4KTDH 3VA6A 2OSLA 2PCYA 4HJGB 1GJIA 4UB0L 4PJ7F 1W0WB 5CCGE 2G3XA 2YBGA 3SPVA 3JWOL 4GG6F 4MNHB 3F12A 4R7NB 2Y0SA 4Q4IA 2AHIA 2ZYSA 1LJMA 2FHBA 4EVNA 3WFDH 3VXMB 1HXMB 4KRPD 4PFEA 1OAKL 4NRXB 3NJFA 3AG3B 4AC2A 3G5YB 4GMSH 4TKWA 2V9QA 4TLSA 4NUJA 3RVXC 2Q7NA 2D9CA 2BY2A 4N2CA 2DIAA 5C0DB 5DUPH 3ZRSA 2E7BA 4XXDB 5B22A 5EPMA 2VABB 3ZE2E 2WLLA 3GSOA 1I31A 4RAUA 3JTTB 5T1LA 3EYSL 4P4KC 2FBJH 3VXRD 4Z7VF 3MCLL 4BKTC 3F8UB 3K71B 4TUJA 5C71A 4JVPA 3A6BH 1T7YA 3KPPB 4B50A 2IH1A 3LS5L 1M6OA 5BJTA 3JT0A 4FJZA 4JFQB 4XP9L 5BV7C 3WXVH 4YWGH 3SKJH 2A77L 4CC4A 1C5BH 1BVLB 3P0GB 4L4JA 4OD1L 4X8XA 1RFDH 5IOPA 1LQBC 1CF8H 4Z7NB 4MAUH 5CGTA 3HG1E 3MJ9A 2FRGP 3S0PA 1WIOA 1IM3A 2WO3B 3VH8A 1GAFH 1NBVH 2Y6SD 1C5DB 3NRFA 1WFJA 3DX6B 5LB1A 5LBSH 2QGBA 4F3FB 2EDOA 4R4FL 3W81A 2V0AA 4QAWA 1N26A 4Z77A 4HXAL 4Z7UA 3QUMB 3ARRA 3WHE1 1IQWL 4PJCF 4PYHA 4HSQA 4YDLC 4DF9A 3OB8A 3PXLA 1CZ8H 5ELIA 3RG1C 4ANKA 3WNIA 5GRUL 1X5IA 2IANE 5C08B 4ETYA 1A3LH 3V0AC 1XDTT 3MAWA 2X4TB 2Q2LA 1WT5C 3CXDH 3H4FA 1JS4A 3K1DA 4M5SA 3I9PA 1JVKA 1I85A 4JDEB 2EAEA 1O9WA 4XP5L 5E5LA 3TJPA 3ZKXB 4APQC 4CDGC 1EGJH 2X2HA 3ARGA 1A1NB 5I17A 3QUXD 4UZUA 3T0XA 3NIFB 4FFVC 3H9SA 5C0IB 4D9LH 1NGZB 2LU4A 4LB8A 4R0LA 4NT6A 2BWDA 2M83A 4O2CA 4QXWA 1FC2D 2ADGB 2JF1A 4PS8A 4WLCA 4ZPVA 1WEJL 2FT6A 2NXZD 5GISH 1A66A 4XCNA 4CN6A 5GZNC 3N06B 4ZDHB 3V7MA 2FLMA 5EUOF 3QDMB 2XJLA 1X5AA 5MEQA 4IGBD 3F58H 1M7IB 4X0KA 3EYFA 4WV1B 2OW7A 3B3IA 3AUWB 1DQKA 4J4PC 4NOBA 1AC0A 5CJQL 4QHNA 1G6RL 1INDH 4UWQB 4BDVB 3K6FA 4PRPB 1Q0XH 1YN7B 4MA7L 1IO4C 1ZLUH 5MHSD 3CX2A 1ZE3C 3T3MB 1OCZB 2AQ2A 1SN0A 1MJ7L 5LKNA 1VADB 1MHEB 3TEYA 1TSRA 1W91A 1WZLA 5L8LB 1SVCP 2BXYA 5AUMB 4UINH 1J9RA 2ALWA 5CKAA 4HKZA 4JY5H 3NSFA 3KXFB 4AV0A 2J7LA 5E1AA 4BFKA 5H94A 1QATA 3QDJA 4DJMA 1WJ3A 3CN4A 2GAZB 4H5SA 4U1IB 3U0TB 3R19A 3WNKA 5MEOB 2VZUA 1CVSC 3MOQA 5F88B 3WY4A 2BHUA 3ESNA 3MBXH 4PUBH 4YXLH 4N8VA 3ARBD 1LO4L 3MLTB 3V4UL 2R1YA 4L4VE 4W9CC 3KYOB 2RBLA 2IOOA 4GSUA 2YAFA 4UQ2A 1G9NH 3ECWA 4FQCH 3LRMA 1CXEA 4K3EL 5C86A 2MQCA 1DQQB 4N2EA 4D8PB 4DTGL 4YHLH 2VQTA 2WLHA 2N7BA 2APTA 3L3OC 2W92A 4P3CL 4UQIM 1QFOA 4DZ8B 1WDAA 3HPLB 1QP1A 4OIBA 2XV0A 3I3EA 1YNLL 3MLXH 4QAMB 5LN4A 5D7JC 2ZP9A 1CPUA 1R5IB 4DAGL 3FULA 5IBUG 3L3KB 4P23A 5MERA 1BXVA 3AC0A 1SXNA 2O5ZH 1XGTB 2XPZA 3DMMA 4BD4A 2Y5TA 4N2GA 2CQVA 3O6LH 4QRRA 5ICZB 3IXAA 4S2SA 3W2DL 3JWNH 1UWYA 4PYGA 3MXWH 1U8NA 2Z8VC 2ATKA 4KKRA 4OJYA 3P4NB 5EZPA 4N25A 4QRBA 3ZE0E 5DZVA 5HYJA 1EVUA 1I82A 2ZUTA 5HYIA 4NQDD 2VXQL 4NX0A 4GRLB 4BYHA 1GC1L 3HPJB 3FOMA 2NX5B 3KEHA 1QYGH 1YUHB 1KV3A 1J5HA 1NCBL 1S9KC 5EO1B 4X8JA 4FADA 4BGLA 3HNVL 1TZIA 2WLKA 3D4YA 3QO1B 1RHFA 4OT1H 5KYYA 3L2LA 4YSCA 1JGEB 2ICEA 3BLKA 3JBG7 3QRGH 2IAAC 2IPTL 3HKZA 1TJIH 2O93L 1M1XB 2DF3A 2A83B 4UTAH 4FP8H 2AJZB 4LPWA 2BP5M 3BKCH 3O6FC 5I6OA 2D2CC 1I1RA 1J8RA 1U8MA 4KBPA 1MJUH 1FNGA 4QRTB 2DD8L 4ERSL 4PBVC 1QZNA 3FU9A 2AI0L 2ZKXA 3APDA 1BVKB 4MDJA 1KLUA 2PW1A 1FA4A 1UM6L 4OW6A 4JG0H 5C8JB 2YIHA 1NCTA 1HXYA 5HDQH 4LARL 1IVTA 3VWJB 4M5YH 3K0WA 1KN2L 3PQYA 2FYYB 3RWIB 3HLAA 4JAMB 4JGMA 4L37B 2OSWA 4QHMB 1ZTXH 3GPSA 4HQQH 3Q5YA 3ETTA 5D1ZI 5I1KH 2MQ3A 2PTTA 3NIGF 2X0WA 1NCIA 4M5ZL 2EXSA 2P4AB 3TH3T 5F44A 4ANXA 2OKMA 1GIGL 4G6KL 1XCQA 1YQ2A 3GMQB 4ZD3L 1C08B 1T7WA 2J3SA 4ZMXA 2XLLA 2H1PL 4F80A 3LV3A 1KTLB 3FQ1A 4NNPH 2Q10A 2J2ZA 5DMJB 5E2TL 4RFNC 3BPOC 3QORA 2OMVA 1E5AA 3GLZA 5KSBF 2C9SA 3G6DL 3HS8A 4P2QB 3VXQA 3VWKC 3FO1A 2Z92A 1W15A 4J2QA 5ESQA 4IRJB 4LEBA 1FGVL 2GHZA 3RDTD 1JVOA 4NOFA 3BXNA 4BKLA 1DBKL 2IGFL 2NW2A 1K8DB 2AK4A 4M8RA 4WDIB 4QRPA 5JORA 1Z9LA 4GO6B 3IM1A 2FWOB 2IF7A 4EDWL 4PTUA 4PGJA 4RIRA 4V1DB 1ZLWK 4WFED 4IJ3C 5BRZA 2YN5A 1OAZL 2CXGA 1XCTB 2QFRA 2NSXA 2HFFA 4DN4H 3AGVA 5PAZA 5JR1H 1KEMH 1SN2A 1FLRL 1J0YA 5C3IA 3ZUNC 4BZ1A 1DQVA 1IAIM 3TO4A 5IW6B 5D72H 4G6MH 1KFGA 4HU8A 4MA3A 1O0VA 4QO1B 5FOBA 4I7ZC 1U8LA 4PJFB 2MNJB 5LN8A 4DO4A 4F9LA 3VDCA 4KXZI 2ZWKA 3EYVA 3ZZ1A 3Q5TA 1QFUL 2QSCH 3TH2T 3IKCB 4HUMB 4QWWC 3VQ1C 2OJEB 4HUUB 4BSVB 3V6OE 1A02N 4B5ZA 2ZWLT 4ENEC 4N2HA 5AZ2L 3DPBB 3RTLA 1KEGL 4U6YA 5J9PA 3U2SA 5JXAH 1Q72H 5FO9B 3L9RA 1RERA 2X9WA 5T1LD 5L7XL 4AQ8C 1L6ZA 3HA0A 2IAMB 3CZFA 1CU4L 4GW1A 4P5TC 2IADA 1EA9C 3WJMA 3UJTH 1X44A 3DX2A 5F7DA 2YAMA 2JI2A 4XBMA 2DYRB 1MCIA 3V4VH 3AU1B 3FT9A 4CADB 3W0WE 3MLPA 2YPKA 1O7VA 3UTQB 2AJUH 3QIUA 3HRZB 1VA9A 3UYRH 4A38A 4MMZA 4JFFA 1IM3D 2PWDA 3BLBA 3GPEA 5I30H 3ML8A 1CBVL 4OLUL 4TMPA 5KS9F 3BSZL 2GJRA 2CGYA 3NFNB 5B4MC 4X5WA 3ULVC 1A3QA 4HJEA 1QABA 3MLSL 2N0KA 3RBSA 5I1GH 1GMIA 2NY3D 5CZXC 4X4YB 5E95B 5IEHB 2NY2B 4X6DB 4EI6A 3SGKC 3KLLA 3OKKA 3CMOL 4U6VL 4M8QB 5SX4I 3FQXB 2Y9RT 2VDOB 4JO1L 5E56A 1MIEL 4HUXB 2VUYA 4JFZH 1KXTA 5KYXB 5H37H 1H0DA 5K1NA 4LLWA 3WL9A 4MDIB 2QPSA 2GTZA 3T2OA 1RK0A 2YUZA 2CUAA 2MPAH 3BKJH 1OCOB 3VGHA 3D2UB 3ARGD 2WXGA 3U6XS 2FD6L 1UYWH 1DJYA 3QNXB 3H9SD 3P0VH 3QWOA 2H5UA 4NENA 3C60D 4JM2B 1T83A 4ZS7L 1A3RH 2VLLB 4WFHD 4BV1A 4PS4H 2EDHA 4AIXA 3D8MA 3VRLF 5EEZA 3ARZA 2NR6C 1F3JB 1E5CA 32C2A 4OJDH 4F8PA 2WXJA 3NJJA 2KLTA 4LBEB 2A1WH 2J88H 4X80H 2YA2A 2YD6A 5F6HJ 4FCAA 1N4XL 5IB2B 4ZYKB 1A25A 2P9RA 2YSSA 3NIFF 4DQAA 4AQ1A 4F57L 2H3XC 3W39A 3H54A 2EDXA 3DVNB 3P0YL 1BZOA 3D07A 3FB5B 5KN5B 3K46A 1HH6A 2UUDH 1S5IL 2ZQKA 4RFOL 4XC3L 3G3LA 3STLA 1K6QH 2D73A 1TCRB 3V4PL 1BEXA 3A67L 3CGTA 5ICXA 2K3TA 1A1MA 4Z3GA 1TU2B 2EDFA 3ZDXE 2APSA 1SDYA 3QDJD 1DO5A 1P1VA 4IBQA 4DP5X 1FH2A 5A1AA 2ICWB 3IU4H 3KG5A 4NQEB 3FC8A 3HI5H 2B4CL 4TQ8A 1AQKH 4NJAH 2YGNA 4UT6H 4OFPA 3D4CA 3OZ9L 4AG4L 4Z0XB 5DVOA 4NO5A 1FL6A 1ML0A 2VDOH 3RUGE 1NH6A 2J8UB 1AKJB 1H3PL 1D5IL 2GI7A 3E1F1 3DXAE 1XT5A 3HS0B 4F2FA 3LH8A 1EEUA 3OHMB 2IDTA 4JGJA 3IMBA 4LSTH 3KCPB 1U8KB 1KTDA 3D5OF 3DX9B 3VFPB 4DVBB 1E5YA 3MZGB 1N8ZA 4BZ2L 2N56A 1SHMA 2ZCKH 4PJHE 5DJ8A 3O3DB 5DD0H 2Z4QA 2O4EA 3DMMD 4HEPA 4TNWK 4CILA 3FCBA 1Z2KA 3NZHL 4QRRD 4AJYV 5HD8C 3TESA 3QR2A 1TZHB 2XFXA 4L2LA 4Q8BA 5D8JH 1JWSA 2J5WA 1MFMA 3QFDA 3MRJA 3JWNG 4PWFA 5CILL 3LN4B 5HYJD 4KVCH 4K94H 2IQ9H 5DC4B 4XNZB 5GXBB 2ADFL 2Y3AA 1V27A 1BX2B 3FB8A 2JK5A 4OFDA 4XHJD 4AKQA 5IOKA 4FABL 3RFZA 4GT7A 3GMRA 4MAYC 3SDDC 2BOBB 2IH3B 4LESA 1OSPL 3MLYL 1R5VB 2XFGB 3BDYH 1TXKA 2APFA 4WW2C 2JJVA 5TDPB 3P4OB 1S9WA 4LHQB 5F9JA 5I1DA 3CJJA 3D39A 5C2BL 3FU7A 4NBXB 4GFXA 1F11B 1SYSB 4O02B 4LNVA 3N42F 4N2IA 4XPGL 2W9EH 2X3CA 4PJ5E 2ZOOA 3R06A 1OXYA 2C9XA 5I15H 4JL2A 1EEYB 3OKNA 3VJ6B 4JKNA 2KKQA 3SEPA 1PG7W 5F7KC 3ZK0A 3EHBD 3PJSB 2DWDB 3TLRA 5C7XL 3PQYD 4K9JA 3DA0A 1PYWB 4NQXA 4ELKA 5FOJA 3BSZA 1AD9A 2AJYL 2X89A 4BFIA 5HHOB 2DI9A 4ODXA 5KVGH 3ZT7A 1LO3H 5F96H 3UXFA 1PZ5B 1W80A 2L4OA 3IPEA 1OGAE 2XUWA 5FC9A 3K3QA 4Q6IB 4TSCL 2F9BT 4LLUB 3QJTB 2XIIA 3SOBH 3HE7D 4KNTA 1ZDQA 2G75B 2W9DL 3T4YB 2R7EA 3HG1A 4ZMAT 4JX0A 5D5MA 2VITA 3IDUA 2OTWA 1JGUH 1CDHA 2CDEA 4TVPD 3UPAA 3O4LE 1JHKL 4EN3D 2WVTA 3QORD 4RA0C 1ID2A 1NCUA 3ELQA 2KPNA 4ZRGA 2CDFB 5IK3A 1YEEH 2ZONA 1T4KA 4WHTA 1JZ3A 3QRBA 4G9FB 3AREC 3H6JA 1HL4A 7FABH 3S5LA 2DDQL 5BXFB 4ODSL 2NRDA 2ZX7A 4U1GC 4HK0A 2ERJC 2AQRA 2PW2A 3L5WA 1RZJL 2AK4D 4K5LA 4F1SA 4QRPD 3RL2B 3BJLA 2FB4H 2NY0D 2OW6A 5FA4B 4EN2A 5I1CL 4HALA 4BQCA 2UZXB 2UWEA 4Y7OC 3CZEA 2V7HB 1F86A 3KLQA 3GBML 1NLBH 3WIFA 4YBHA 5ITBL 5D70H 3RJDA 4PRIA 3M17A 3MRNA 4KUCD 1ZRUA 3MRQA 3GD1C 3ZQ9A 3S9DB 3Q44A 3TO4D 2QFPA 2J1WA 3CFJA 3OKYA 3ATFA 3HB3B 3MNMA 1KV7A 2GW5A 4H20L 5DJ6A 5JHLH 4ZK8A 4JJOA 1JUFA 1PSKH 4GUOA 4N9GA 1G0YR 1U4EA 3CZSA 4QD2E 1ZY9A 1OHZA 4LVHC 1JF5A 4ZSOE 1OARL 3BO8B 4WSKA 3ZMEA 1BZQK 5EF0A 1MRDH 4N5UA 4G7YL 4M1DL 2NUPA 5AOJA 1A5FH 5B3NA 3CXFA 1NC4B 1T3FB 4PJEE 5MI0B 5FCSH 1BVZA 5E6YA 3VFWA 1B0RA 1LYQA 3ZQXA 5BS0E 1R3JB 2Q9OA 1IBGL 1EAJA 1OZUA 4HF5L 1SYVA 2X12A 4FQ2L 2PCXA 4PJFF 3PP4H 1XD0A 3LEVL 1R47A 4FKKA 4ZMVA 1INEL 4RAHA 3K91A 1SLWA 1MIMH 3N0PB 1A2YB 1IC4L 1PF3A 5FM4A 2FO4B 2FVNA 4I13B 4QYOA 3QIUD 4G3YH 4URTB 5AOZA 5F71A 5A7EA 5F3BA 1MRFH 4GQ9L 5B1JC 1M4KA 3ARDB 2ZE0A 3WIIL 4JFFD 2VZOA 4YH6A 1G7MA 3KPQA 4KDTA 1SJEB 2FUTA 3I50H 3B43A 1G9ML 3JVFC 4HH9A 1T1ZA 1EZVY 3TBYB 1ES0A 1K2DB 3RKDD 4H1LG 1MCRA 3L1EA 4DGVL 2YEVB 4P05A 3WU1A 5FWQA 1JYNA 2Y06L 3I02B 4RFEB 4UQAA 3QFJB 3OKOB 3HUJE 4QTIH 4WUUE 1I8MB 2JQZA 3DSFH 2YHGA 2B08A 4N6RA 1IEAB 5L88L 2F8IA 3L3HB 4PEEA 5I8CA 2ZOLB 4OD2B 4G59C 3Q01A 1TDQA 4GBXC 4EBQL 1Z7JA 1UURA 2ED8A 2W60A 5J1TC 4N0RA 5H37G 1NJ9B 4N0UB 3WV0A 1E9QB 1RZKH 4NIKB 3ZKND 4L8CB 4ZMOA 4HCFA 1AHKA 2YN3A 3B2VL 4X6DF 5DZ9A 1VF5C 3CDGB 1S7RA 1YQVH 2DQIL 3IJ7A 4NO0A 1UH4A 2FJFB 1X5XA 2FHFA 2IPKB 5CINL 4DKEH 6PAZA 4JNXA 2GABA 1YN6A 3WFBL 4OCYL 3WN5B 2QHRL 4HIEA 4AM0A 2R23A 1UZ8B 4PPTA 4W9HC 3DBXA 3OMNB 5LG6A 4P59H 3UIZA 4QNPE 4XMPH 5HGDB 2ZSVA 3ULSB 2V7NB 3VRJA 1GGIL 3G5ZA 2K70A 3P9MA 3Q43A 4LRIA 1T0NA 3WEXB 5DTFB 3VFOA 3VFGL 5DD1L 4H8QA 5K59F 3QNYB 1ZT4B 3QULA 4JM2F 1KTRL 3LPGA 1B2YA 1OPGH 5FUOL 2BC4B 5IG7B 3L7EA 4GPVA 4XCCL 1KGXA 1MCOH 3EOAB 4GIOA 5TDOB 4KJYA 3VTTA 4YHYB 3V0HA 4DW2L 2R1XA 3RGHA 4N90E 3UCRA 1CE1H 1KACB 3T1FB 1F4XH 4LEXH 1LO2L 3D69A 5E6IB 4HC1A 1ASQA 4POZC 3TC9A 4R4BB 5DC9B 4XPHL 1ZGLA 1Q9LA 4APXB 2AABL 1A9BA 2O6EA 1W0VA 4JFDE 2O5YL 1LK2B 5K9KA 1OY3B 5D1ZB 4BGDA 1B4LA 2C7UB 1JGDA 5KOVC 2H4EA 5GQBA 3QIWC 3SY6A 1J0HA 2VJ0A 1RVFH 3TP4A 1XBRA 2MCG1 1SUJA 3S6CA 3ARQA 2JKJA 2E27H 4M48H 1ZLVH 4X7EC 1TNNA 3PWNA 1KXVC 3D12B 3OLEA 2V9UA 3WBDA 1I9IL 1DN0B 3FBQA 1BW8A 2ZYHA 1HZHH 4YDKL 3MBEC 2XG4A 1S7XB 2X4PA 1NPUA 4AL8L 5CLZA 4A7GF 1A6ZA 3GTTA 2J8UF 1WTGT 1E28B 1CD9B 3GHBH 5TQ2H 4DK3A 3QDHA 2VL5A 4R3SB 5T5FH 2D31B 4TUOA 1K5NA 3STZA 1GYVA 1TO5A 3HC4H 4OGXH 3MVSA 4FQLH 2E7HA 2LAGB 3LTVA 3RWFB 4G83A 4LSRH 3B9DA 3MLRL 2WXLA 1ACXA 4L8SA 4OV5A 2Q76A 3EFFB 4FQQB 5I1HL 2BVOB 4S1RH 4KWUA 4FE9A 3LQZB 1B0GA 2ID5A 2NCMA 2ZUUA 3CNKA 3PDOB 2EDDA 4JR9L 1UXMA 2JJTA 3G04B 1WFTA 1HKLL 1TQTA 1AXSB 4WJ5B 3KDMB 4POUB 2ZF9A 3FPYA 2ZUVA 5KANI 1KT2A 1C7TA 2AQPA 4Y4FC 3D39D 1HESA 1JGVL 3Q05A 2QQLH 2Z1PA 3GRGA 3GIZL 3PWJA 5I0ZA 2YPLE 1FGNH 3V0EA 4QUOA 5ERWB 2RCSL 2QVKA 2Z31C 5F7EH 1GGCL 4GAJH 1MCLA 4CNIB 1D3CA 2V3EA 5F89B 2XG5A 1UVQA 2FBOJ 1MNNA 1UM4L 1T5WA 4KNUA 1JXKA 4BINA 1QBML 1K8IA 3S37H 1KJ2A 3CVCA 5DZOA 4PJDA 3ETBF 1CGSL 1NCGA 2X89D 4MLIA 4LCIH 1AHMA 3C6EA 4OM1H 1Y0LA 1KYDA 4X4ME 3WHE0 3FTVA 2HFGL 4LMQI 2GC4C 1MH5A 2YZ8A 3N9GH 1DTUA 1JF1A 4JO2L 3TT3L 4F92B 3QZOA 5HSFA 4HAGA 3HG1D 1XTMA 2UY6A 5ANME 3QJRB 1FE8L 4OJFL 1TIUA 2Q3XA 1MVUA 4ZXBB 5AYUH 1HSAB 5TD4A 3LKRB 3O3UN 4G1MA 2JCWA 3S37X 4J3OC 3FRUB 3BDBA 4JB9H 3QZWA 1VCAA 2B5IC 1FG2B 4IKNA 5IJVB 1XTLA 2WTOA 3ZIMA 5IT2H 3D18A 3L16A 4HPOL 3T2PA 5B7EA 3MMEB 5AQ0A 1PTZA 1XR8A 4N24A 1T4WA 3FRPG 2R9HC 1MNUL 4G6JH 3VMPA 2BY3A 4P5RA 1J1XH 1I3RA 1J1PH 1X5YA 5EN3A 1QG3A 4WEBH 3MC0A 4P49A 2JSFA 3EXJA 4PV9A 4KXZH 3IN2A 4PRID 3T3PF 3UYOD 2DLIA 2BP0B 4P48A 3K8LA 2GSMB 1YEDB 5I8KL 5D7SL 1ZD6A 1XH0A 2PCPB 1MRCH 2R69H 5ALBH 1KC5L 2V33A 2HTLD 3H9YA 5EZLA 3QYNA 1NKOA 3L4VA 3QNZA 4JM4H 5CR8A 1PLAA 4FD0A 3R1GH 2JJSC 1TJGH 4YHOH 1NFDE 4XNYL 5GGRA 3VMNA 5CHNB 5J11C 4QPEA 2DJMA 3CD4A 2C9PA 3JUZA 3HE6B 1MHPH 1U91A 3L9EA 4I3SH 4JZNA 3KPSA 5JOFA 5T1MB 5HHMD 5CR1A 1QRNA 2YEZB 4X99B 1JZ7A 2WBJB 3GUTB 5D1QA 3D25B 3GLDA 4MA8H 5SV3A 5MP6L 1TKWA 1UB6A 1ZLSH 2FJGB 1DJIA 4TYUA 2J6EL 3LB6C 4ZOBA 1S78D 4UOW1 2VDNB 3VM7A 3OXSB 4K3GA 1TQCC 3KHQA 4FNLL 1RKRA 1E8YA 1KB9J 3CVHA 4RRPG 4N6QA 5GRWA 1XGUA 4AUUA 2ETWA 5DS2A 3QA3A 3QT2A 2G3MA 1JNNH 1X5LA 2EYRB 1OHQA 2OMYB 2VXTL 3FO0H 3MODL 2VISB 1I7RA 3UROR 4GQQA 1VKXA 2JJUA 4KX9A 5SX4H 2NY6D 1BXXA 5E24E 2BK8A 1Y18A 4LDLB 3RUGA 5DD3L 1EVTC 5DJXB 3T1WA 1NCAL 4F8TA 3NCCB 2CA3A 4Y5YB 2WINA 1F90L 4N1CA 3A3YB 4KV5E 1WWWX 2EH7H 1BZ9B 4WI0A 5I5MA 3OKLA 4Y4HB 3U4KA 4NC1C 5K39B 1M05B 1PNCA 4P2OB 3U0PB 5I1EH 1HVXA 3A4AA 1HJBC 1CFVH 3IDYC 5DSCB 4JFOA 3BZFB 1YUKB 4XHQA 1XXDC 2EE3A 1WA0X 1IAIL 3WEAA 2OR7A 1S7WA 3WFEL 3SE8H 2VLME 2VKXA 5FW6A 5CCKL 1ZVSB 3PWLB 2C9VA 3C75A 5DJCA 1U8IA 1KPVB 4K9EL 4UIKH 1CURA 3B7SA 3MGTA 2JLPA 4MDRA 3LPWA 3S5YA 3U7YL 1FAKT 4NO0D 5F21B 4AK1A 3E6FA 1H8OA 3H6AA 3EJZD 4OZHA 3TCLB 1JPTH 3OR7A 3REVB 4MQXC 4PBWD 2CO3A 1WT5A 3HMXH 3O8XD 5GS0C 3KCWA 3WKMH 1A14H 5E8PB 1FYTE 1FCGA 1XSJA 3QEUB 3V52H 4APQA 2X9ZA 1AXTH 3HNTH 4I18C 4X6CB 2GFBA 5IHBA 4ZO9A 2QKSA 5E4IA 3DROB 4H8VA 4U1NA 5HGGS 5KVDH 1WBXB 2QDVA 4Z8FH 5F6IB 1F13A 2JKRM 5JPNC 1BD2B 4K7PH 5DRWA 5I8OL 5DUBA 5GZNA 3U4BH 1DEDA 1RV6X 1N6VA 3C09C 2Q7YB 4FYQA 1WVZA 4PJ5A 3NIGE 4ZI8A 5T3ZE 4IRZL 4YE4L 1UUNA 4HJJL 4XAKD 2DQHH 2VDKB 4J4PA 4E5XB 2K1MA 2A6JA 1HOCA 3V9CA 3KWWB 1ZEAH 5FHAH 1T0OA 1J5CA 4E9LA 3DUSA 4L1LA 3X1FA 4BCZA 2HFEB 2OZNA 2H0EA 1R3LB 4JDZB 5GSVA 5D93C 2AXWA 3IGUA 2GJPA 4L3CB 3T9WA 2HG5B 1T03H 2IXQA 4YXHL 3K72B 3X12B 1FNLA 4DUWA 4DCQB 1FH5H 4PJIA 1JGIA 4UNTA 2EEBA 2EVJA 1U58B 1S4IA 2UY7A 1LEIB 3ZVVA 1GCFA 3WEBA 1LE5B 2UV3A 5AB0A 5A2KH 1F4YH 2EP6A 1DO6A 2ZKYA 2XWCA 5AL8A 2R2CA 1QVOA 4ADGA 3B2PA 4JDVB 2YOCA 2XZAL 4LQ1A 2GJ6B 3ALXA 3RPIB 4B97A 5A3IC 4FXKC 1YEGH 4ABUA 4E0RA 4DGYH 3PWPA 4IK7A 2ATAA 1MWAA 1P4UA 3K6SB 4HWUA 3X3FH 4JE4B 4M93C 3LKQA 4PS7A 5C07B 4GO8A 3ZW3A 4W9KC 1LDPH 2C1OB 5CS7A 3L3OA 5IM7B 1J0ZA 1VACA 1MHCB 3KJ4C 3CLWA 4W70A 3G6JE 4CJ0A 4QJ4B 1T0MA 5DI8B 1UOKA 1F2QA 3C5SA 3R8QA 1E90A 2V3DA 1FFOA 5EO9B 4EIGB 3S34H 4ZFOB 4X98A 4N8CL 5GS2D 2EIKB 4AMKL 1KCRL 4OB5L 1WD8A 2V6HA 4KRLB 4KX8A 2H26B 1JRHI 3MLWL 4OI9A 5ITFB 2XA3A 1E43A 2B0SH 5JW4R 4FERA 1JF6A 3B5GA 3IWVA 4BH8A 4BA0A 2KDGA 5KSVB 2JQMA 1MDTA 1DLHB 2F15A 4ZSOA 1YNTF 3MTRA 1XD1A 4WO0A 3FUJA 3IJEB 1G1CA 1FFTB 1Z1WA 4KDWA 3WHXB 1IAOA 3WJJA 2RMNA 2VR9A 2RH0A 2VL4A 4Z0BL 4L1TA 4FTVA 4TL5A 3RL1A 4N26A 4NWUL 5AW4B 5HXMA 4QY8B 1OGTB 3CVBA 1LNUA 3OZLA 3SY0A 3MR9A 3D2TA 1BQ5A 5B38B 4P06A 2QVTA 3KPTA 3KS0J 1XIWB 4KTYA 3PV6B 3SDYH 3PL6B 5D4HA 5C92A 3CX5K 1EXUB 5EO0A 2AW2A 1SXAA 1IKFL 3WEMA 4E36A 3VXNA 5CD5D 4KQ3H 3UTPE 1SUHA 4OLXL 2XWBB 4JQXA 4F7MB 4PLKD 3SKOA 5CSBA 1WA2X 2FZ3A 4M61B 1A4KB 3VCLB 1TVHA 4WSJA 4IOIB 3MRHA 1A1OB 4CSSA 4XRCA 4Z7NE 2WN2A 1G43A 1E27A 1NAMA 5E5MA 1W6WA 3U48A 2CJUH 4KRPB 1FCCA 3QEGL 4U1KB 5FF6A 3VGDA 3U6RA 1S7TA 1TJXA 2WMPB 4NI3A 3T09A 1CE6A 5FYJH 2SODB 3C8KA 2E3VA 1P9MC 1IIIA 2XWTB 4Y8AA 3WGVB 4WUUA 1ZTMA 2HH0H 1SXSA 2CLRA 2UZIH 1NMBH 2ZUQB 3Q6FA 1YY9D 5CJXC 3WOVA 2H8PB 3VXRB 3DTDA 5B21A 3MRPB 5AZUA 4KK8C 4XPBH 3MV7E 4TQIA 1T1YB 4FX5A 3VWKA 4X4KA 3FUFA 3US1A 3EYUH 1RURH 4LHJB 1AG0A 1E2ZA 4AKOA 2PWEA 4B9JA 1DBBH 3ATEA 3PAZA 1Z9SB 3WO4C 3ZZLA 3W9EB 2CM5A 2CMRL 2J57A 3LDBC 2WKGA 4NM4H 3BKMH 2OSXA 4QHKI 4XMXA 4M7KH 1SQ2N 2E4FA 2CLVA 6TAAA 4IRZA 4X5QA 1V55B 1MFBH 1SHSA 2ZWYA 1KNOA 2FX7L 3GRWL 1E2WA 5B1CA 3KPSD 2DAVA 4O4YH 4XVUC 4NP4L 1U8PB 3WIHH 1WC7B 2CNZA 3AMLA 1QRND 1Q0YH 3WKYA 4U1MA 5TDNA 1KENH 1S7QB 5D1QD 1DL7H 4QHLB 3RP1A 3WUWB 3T3ME 3INUH 2HT3D 5C97A 2JXMA 3NPZB 4ZOAA 3UX9B 4OZFA 4D0DB 3GMOA 5EF2A 1Q94A 1TMQA 4YHKL 1CLOH 3FYEB 4PRDA 2OK0L 3QZLA 4TULL 3B4NA 4BQ8A 1ID5I 2P8MA 5BNXD 3QUXB 3B7YA 1MFUA 1MW0A 1FNSL 5D6CA 1UXWB 5FDYA 2R4SL 5ETUB 1BLNA 5EV7A 3RVXD 4UQEA 3FTGB 1SY6H 4IDLA 2D7NA 2NXZB 3SDXF 1A6PA 3BPCA 1KY7A 1Y6KR 4KX7A 4RGOL 5TE6L 5EU7C 1FBIL 1UACL 4IGBB 1CMOA 2BP8B 1FVEB 4MCZA 5JPMB 1H8LA 1J0JA 4LSQH 2RAMA 1L0PA 4P5TA 1F45A 3A22A 1WUZA 4LLYB 5TF1H 5ES4B 1KCWA 4JFYA 4NO2B 2FT8A 4UANA 5JW3H 2BHFA 15C8L 1PKQA 4GKSA 2IBZX 1OLZA 1YEJL 4OD3H 2ARWA 1WA1X 1ZTXE 2ZKWA 2GITB 4O51B 5CEXA 4JS7A 4LOUC 3V5KB 2Y7NA 4E41A 1VJSA 2GC7C 2EIDA 3ZDZB 4NS0A 4LGSB 5MEPB 4TM9A 4JZJA 5TGBA 1JZ5A 3T77B 3WN6A 1N0XH 4NO3B 1DUYB 3GFUA 5FV1L 2AVGA 1OAUL 2M1KA 1OGPA 1CFNB 2BSSB 2EABA 3O6KH 4NCDA 2BIOA 5LXGL 2AV1B 3ARBB 3SGKA 3LN5A 1BQSA 4NZTH 1SEQL 4FYSA 1IFHH 4G8EA 2R4RL 3QPQD 3BGMA 3DX4A 3V79C 4QLWA 1R0AH 3GO1H 1BGXL 5DJDA 5C0AE 1I4FB 1KTKE 1BAWA 1QBBA 2OPCA 1ETJA 3LMJH 4GAYB 1THCA 4I88A 5AVUB 3FZUC 4HIHB 5KUMA 1AYOA 4APQD 3CFEA 4K4KA 4X9FA 3APFA 1ZCRA 5DVNA 1PEZA 1OB1B 5BZWB 1JXFA 1IEBA 4FFVD 4AE1A 5SX5K 4DOHE 2EICA 1V54B 3OAZK 1N5AA 2YPVA 2X4SA 4JRYA 4Q74A 1KBBA 1V3JA 2Y2WA 3OPZH 1JWUA 1JZHA 1L9RA 5GZND 3MRCB 1PG7L 1DZ0A 3OMIB 3PNWA 3QQ9C 4PJ5D 5LCVH 3II1A 4HKXA 1HQRA 3TIDA 4J4PD 4NKIH 4FXGB 5CWSA 1FO0A 3EBAA 1ORQB 5EC2A 3UTZB 4KDVA 2QSVA 3ZE1F 4NQDB 3VD3A 3K0YA 2I60H 1BFSA 1LWHA 1VPOL 3FQUB 1MAMH 2E6PA 2YXVA 4KI5E 4Z3IA 1NGWB 1KJVA 5CFAA 2WZ6A 2AJ3A 4X4MA 1IGTA 4JQIL 5ESAA 5T3ZL 2A5UA 2EQDA 1N6QL 2OSYA 3FQ2A 3X14A 4O2FA 1PFOA 2B1AL 4OAWA 2VMDA 1M2VA 2QMJA 5I71C 4NJ9H 5B1AB 3VGFA 3CU7A 4ABQA 4K3DH 2AQ3A 1TZOA 4PBDA 2X41A 2R0WL 3UL4A 3F00A 1OK8A 2WNWA 2G9HB 2HKFL 5CBAA 4HS6B 3M88A 3AS0A 3OC5A 4YSEA 4JGNA 4P5KA 1FZKB 4P2QE 4M7ZC 2DICA 3T2NL 5C0FA 3LKPB 5FHBL 3PWPD 3PF2A 4NKMA 1DR9A 5IB5A 3TWYA 2ITDB 4RNRA 1QMUA 1DJXA 3E0GA 3Q2NA 2FBJL 2V37A 3E80A 4U1SA 4Z7WF 4HW6A 3UO1L 3EO0B 4MWFA 5IHLB 1N64H 1AE6H 3K6OA 5D7JD 1M7UA 3DX7B 2ZCLH 3LOWA 3VGAB 5A2LH 2ZYIA 3WGUB 4MHHI 4V11A 2FH6A 1C5BL 3RGVC 1Y7VA 2ZF8A 4D9RD 3IN0A 1RFDL 1CF8L 4KKPA 3SJVA 3FT2A 1UG9A 1KCSL 1BQKA 2V2WB 2Y3NA 2QT6A 4JVWA 5E2UH 4DUXA 1KXQA 3EDDA 3FO2B 3I9GL 1E9PA 1BQHG 1GAFL 1VB9A 5BO1H 1QPXA 4WKZB 4N87A 5LBSL 1ZS8B 4BXVA 4E5XG 4M6AA 4BM7A 1P5UC 4CVXB 4NAQA 5IJDC 1MF2L 5D7KD 2JKLA 2OXHB 3P30L 3RDTB 2F8VA 1A7BA 1OW0C 3AT9A 4FTVD 4MAYA 3C87A 3SDDA 3WMQA 4BSWB 1N6UA 4M3KB 4CVZB 1IT9L 1N10A 1WSST 4TF4A 3UG5A 2BP3A 2DPKA 1UEMA 4GP8B 4WU5B 4XNQB 3VFTA 3FUKA 3CXDL 4S1SL 4WW2A 5IHUL 2CO7B 4KTEH 4M03A 2UXFA 1FWXA 2CO6A 2HA1A 3QJUB 1GZQB 4J12A 4XBGA 3QH3A 4FI7A 2YD0A 1NOLA 3JV6B 2NY5H 3O6FD 4ZTOH 4EQ3A 1Q1JH 2BY0A 5DQJB 2JLLA 2RA1A 2OYMA 2QMKA 4D9LL 4RLDA 1CXHA 2BNUA 1T6VN 4RMSA 3C2SA 2YD9A 1KCVH 1JWMA 3BUIA 1OP4A 5GGQH 1UQSA 4JKLA 1ZVYA 3KGUA 4WWPA 5F0LB 1EIBA 5EA0L 1E6OH 3HVNA 3KPNA 1ZSHA 4WZ9A 1F4HA 4XVSH 5DZPA 4GYBA 1R3KA 3SPVB 4XPFH 2VDPB 4PGCA 1SLXA 3F12B 3Q9QA 1X9RA 4EVNB 3ARFA 1BBDH 4G82A 4KK5C 1SMOA 3F5WA 2Q6WA 2OJZH 3X13A 3FCUB 4TNFA 3EAKA 1NOFA 4NUJB 4NUMA 2WCGA 4AYEC 1I8UA 3T5WA 4X6DE 2VC2B 4KROC 4YC2C 5EPMB 4WUUD 4ZW7A 1DVFC 2WLLB 3GSOB 4RAUB 3SQOL 2DM3A 2G60L 4BWWA 5T1LB 3WTSA 3NA9L 4X7DC 2VO8A 4PMEA 2EADA 3DOIA 4M6OH 4JY5L 3CSFA 1DQJA 1QFPA 3PY9A 3BUBA 1PD6A 4TUJB 4JN2A 2QGCA 4YSSA 3V0FA 1BQRA 1M1SA 4N2MA 2V3FA 5GJSL 5C09E 3DTXA 3VWKD 5BJTB 2IH1B 1M6OB 3HJEA 4AGQA 1SEBA 3AREA 3HZMA 3U9UA 1WQVT 1YEIH 4KH2A 4PGDA 2Y2TA 3AS2A 1P0SE 3QUML 5IVOA 2DLEA 3NFSH 3FUMA 1T04A 3N1PC 3MRRA 1R34A 4FQCL 1OAYH 5IJBC 3QAQA 5JUEH 4JFPA 5C0NC 1IM3B 1UD5A 1FAIL 3E8UH 3VH8B 5BMFH 1AQ8A 4YHLL 4PJ9C 5TQ0L 1NFIA 2HT2C 1XL6A 3FTSA 4Z77B 3BWZA 2XN9A 1XQ4A 4Z7UB 1I3GH 3MLXL 4UAHA 2NY3B 4K23H 3MUGA 3S35H 4TSBL 3W56A 2PPDA 5FW7A 4KC3B 3BWUF 4Q14A 2MEJB 3K74B 5DXWA 3BEVB 3IMSA 4AQAA 2ZWNA 3NIDF 4GLRI 4K07A 3O6LL 5FM8A 3GXPA 4PLNC 5LUMA 2VM3A 1CI5A 4ESKA 4OCXL 2APWA 2VIRA 3MXWL 4Z9KB 3ULUH 5DRZA 2VDPH 4XXCC 4N90D 3ARGB 3UAEA 5I17B 2R29H 1RZQA 3H9SB 4QWWD 3QXTA 2C9RA 3C60B 3EOTH 4R0LB 3S8GB 4O2CB 3PHSA 3FU3A 4NQEE 4LVEA 3JSSA 3L4YA