3IVKA

Crystal structure of the catalytic core of an rna polymerase ribozyme complexed with an antigen binding antibody fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
SEVQLVESGGGLVQPGGSLRLSCAASGFYISYSSIHWVRQAPGKGLEWVASISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARQGYRRRSGRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Crystal structure of the catalytic core of an RNA-polymerase ribozyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system / rna
total genus 41
structure length 224
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ivkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ivkA01
3M07A 1DE4B 3WNMA 1VFBB 3E8UL 4YHYC 5CJOL 4FFZL 3ZTJH 3OGOE 3OB0H 3KPMB 4GRLD 3BSZH 2QKIB 35C8L 5IBUB 1TQBC 5K9JH 3V4VL 2NTFA 4ZS6C 3CZJA 3QXDA 5IWLA 4IIQA 2CJUL 4MQ7A 3H9ZA 2X42A 4XXCA 1CICA 3QWOA 2Z35A 3BP6A 5BZWA 3KVQA 2H6PA 4HH9A 4X4XB 3OGCB 2B1HL 4IRSC 2CLZA 1T83A 3CFJA 5DRZA 3LDBB 3C60B 1QFUL 4R90H 5H94A 3GGWB 4PD4K 3VXMD 3G04B 1XFPA 2DQCL 3BQUB 3LMJH 4NM4L 2Z92A 1JGUL 2CMRH 2ZSWA 4F37F 5C71A 3BDYL 2PTVA 4MZ3A 3R0MA 5C09E 1NEUA 3TO4B 4UU9A 4QT5B 4L8BA 4F37K 5J6HB 3GMMB 1Z5LA 3D25B 2R69L 5T3XD 4XP9L 4OZIA 4HWZB 5HD8C 5B39B 2GJZB 4Z95H 4FABL 4OLEA 3WSQL 2E7CA 5D9SB 3ES6A 3N1FC 1ZVSA 5F88B 3WLWC 3KJ6L 1RJLA 3OXRB 2CUMA 3FB8B 4C56D 1OAUH 4WV1C 4EBQH 8CGTA 4LLMA 4YZFF 3LSOB 5GJTL 1U95A 1P9MA 3BEWB 4PV8B 3H8NA 1MHHB 2MHAA 1FVEA 4NRXA 4U6XA 1NC2A 5E9DD 1FPTL 1G7JA 2Y36L 1DN0B 1DQLL 4BYHA 4ZAKB 5DHVA 3UTPD 15C8L 4FG6C 1LVEA 4XVUC 3T3MF 4YDKL 5IQ9B 2FX8L 5ID0B 2R1XA 1FAIH 3CCHB 3L95B 4YH6A 5SV4A 4BZ2H 1RJCA 4YR6B 4KKCC 2XY1A 1QVOB 4HFWB 3SDAC 4F33B 5E8OB 1A14L 1G7MA 3A6CL 4W4OC 1G0YR 3X13A 1TJIH 3UZEA 2VUYA 5DJDB 1I9RL 4N5UA 5EC2B 1FZKB 1ITBB 1EMTL 3SHSA 2R56H 4J3TA 4NWUL 1MHEB 4HEPG 4K7PH 4P2OC 4YO0B 4NO5A 3C6LB 3U82B 3ALWA 1J1PL 4OFIA 2PXYA 2VDKL 4KMQA 3HUJF 4PGBB 1WBZA 2QQNH 2AJXH 3R8QA 3TLRA 3ZKXC 4EN3C 4LVOB 4MCYA 2NX5E 4P9HC 5K33A 1I3RA 1XIWB 3VFOB 1IC4H 1D6EA 1UWXH 4LAJH 4Z7VE 4QWWC 2DQIL 3RWIA 3VRIB 1JCKA 5D1XD 2F53E 4Q9RH 3JXAA 1EGJA 3LEVL 1WBYA 5DVNA 1U9KA 2Y23A 4NQSA 4DZ8B 1RUQH 1WZLA 4Z7UB 1L0QA 1JE6A 4JPIA 1KTKE 3CFIC 4PRNA 1H8NA 3NIDE 4LK4A 5F9JA 2YZ1A 1OAKL 1HHKA 4BFEA 2PNDA 1KJVB 3IXAB 5AD0A 2AV7B 4X4YA 5C0FA 4BQCA 2Y25A 4JAMA 3BIKA 1FZOB 4LSVH 5CGMA 3GSRB 1L7TL 12E8L 3ULVH 4OZGB 5GRXG 5KN5B 5JR1H 3WFDH 4I5BB 2W92A 5KSBF 1J88A 5MEQA 2XYCA 4Y0GA 1HXYA 2D03H 5SWQB 3NBNA 5F89B 1NFDB 1RZJL 1GSMA 4EDXB 4PJIF 1MFBH 2QHLA 4FQCL 5B8CC 1L7IH 1P69B 1T03L 2BRQA 2Q6WA 1CFQA 1IZJA 4PJCB 4PP2B 4JHAH 4IRSD 5DQ9B 3AXLB 5FO8A 1IT9H 2MPAH 2XA3A 4ETYA 3QQ4A 5CHNB 2JIXD 4IMKC 4X6DE 2KZ1B 2YN3A 4K23H 1JZ6A 1UVQA 3AAZA 4JFDA 4KRLB 4ODVH 1KTLA 1RK1A 4BQ8A 4NN7B 2VMFA 1NGXA 1S7SA 4RISL 4XWGH 1Q72H 4BJLA 4QXWA 5HD8D 1A64A 3KPPB 4ELKA 1CGWA 1NGPL 1U8PA 4DN3H 4PJAE 1PQZA 5E2VH 3MRPA 1R5VB 5D8JH 1T21A 4E42A 1DQML 2BDNL 2H26A 3KPTA 3BMVA 4LF3A 1MLCA 4G8EB 5ETUA 3WLWD 2X2YA 1P7QA 2HFFA 1BP3B 4RNRA 4ZFFA 4PJ8B 3ZO0A 1I9IL 3T0WA 5GGSB 5JLZA 2R2CA 5ESQB 4E41A 5CD3B 5EPMB 4KQ4L 2M2DA 4D0DA 2BNQE 3SGEH 3VGGA 2FEDC 5DHYB 2DOCA 5I6XC 3IFLH 4PJ7E 1FYTA 5E99L 4FG6D 1ZHKB 4MA8H 5DWUH 4UTAL 4XVUD 1C08A 1FZJA 4JQVA 4PJGE 3SE9L 1MCRA 4BH7B 1EHLH 1BFOB 5B4MC 4PJGA 1CL7H 5FCUH 1A0QL 5HGBA 5IFHH 4QOKD 2AJUL 4HDIA 4Y88A 1GGCL 4Y5YC 4KKCD 5C0DB 3HI5L 3SDAD 4OZFH 4H8WL 5DUPH 3SE4C 3P11L 4XVTL 5CWSA 4NHUB 3WS3A 2N4IA 5CEZD 2R29L 4KI5E 5GIRB 4NQXB 5GS1C 5DQDH 3B6SB 5MEND 4LSSL 3CFEA 4U6YA 5D2LE 2O93L 3NFPA 4LCCB 3SDXF 1LK2B 5D2LA 4P2OD 3GSOB 1S9WA 2KUTA 5J6GB 1YEKL 4LEOB 3MRQB 5DI8B 4U7MA 3V5KA 4EN3D 1CFVH 3RGVC 3IFPA 4HK0A 1ZV5A 1D9KA 5HI4C 4IMLB 4M61B 2BK8A 3B5GA 4FP8L 3GKZA 4QWWD 3SDCC 3WNPA 4HMEA 4QGYA 1FFPB 2GTWA 5DRWA 2EIEA 5I1HH 2EDEA 4CL7A 3TF7C 5DUBA 4LKXB 2H2PD 1I8LA 3ILQC 4XZUA 2H9GB 5EU3B 1ZAGA 1HH9A 3WIFA 1LO0L 3PWJB 4OF6A 1CU4L 3C9NA 4LLVB 2X9YA 3HFMH 1VADB 1XR9B 4MXQC 2BHUA 4HZLB 3ROLA 1CXFA 4YE4L 1C16A 3V9FA 3SGJC 3WKML 4C58B 3ROOB 2VISB 4YHKL 3O9WC 2VLRB 2XTJB 3C2SA 3MCKB 3SKOB 1EFXD 1SYSA 3MLVH 1NDMB 4UB0L 5LGHL 1AY1L 1HSBA 1OSPH 2BY2A 3LRSA 1U58A 2J5LC 3QR2A 1KF9B 2AK4E 5DLMH 1D6VL 4A6YL 2AK4A 5DJYB 3GIVB 2LVCA 3M17A 3MLYL 5HDBE 4GRLA 3AU1A 2HFGL 2VL4A 3QPQC 3NCBB 2IH1B 3FMGL 3X14B 3IT8D 4LLAA 3MLXH 3MV8D 3EGSA 5GGQH 2BNRE 1XF3B 4IS6B 1JP5A 4JRXE 4LHUG 2FH6A 4J7RA 3X3FH 4OZ4A 4RMWA 1QOKA 2NY7H 3FRPA 4WI9A 3P0VH 2VWEC 1J1XL 4K3EH 3ARPA 2XWBA 3NTCL 4I18A 4HPOH 4OQTL 3QQ9D 2NTFB 4L8SB 1N64H 1DQJA 3QXDB 3OG4B 4IIQB 4LASL 5T3XE 1EEYA 4LGSB 1CICB 3QWOB 2Z35B 1MCSA 5JHLL 3BP6B 5BZWB 2H6PB 4HH9B 4OGZA 3TPUB 1MREL 1IAIH 1NCCL 4MWFA 4XNZB 5DRZB 2ITDA 5CD5C 1QSEE 4MJ6A 5H94B 2IQAA 5J1SC 5EU5A 2O5XH 1QSEA 4R4NC 3ZDXF 1FLTX 5JW4M 2Z92B 3QXAB 4Z5RA 5C0RH 2VLJD 4QRQA 1NMCC 3DX8A 1YEHH 4UU9B 1HINH 5C09B 1MFDL 5EZIH 2FEDD 2C1PA 3H42H 1MIEL 5MP6L 2J88L 2VR9A 3FB6A 1ZVSB 2C7UA 2C3HA 1A6TA 5B4MD 1KC5H 2FL5A 3FRUA 1RJLB 3VFPA 1PAMA 1MF2H 4ZO6A 1RZ7L 3I2CL 2QQQA 1U95B 2Y72A 4O9HL 5BO1H 3KNBA 5IK3A 2EDDA 1QSFE 3RTQC 4JPVL 2MHAB 2HFTA 1FVEB 4NRXB 4U6XB 3FT4B 3V6FA 4U1LA 3E0GA 1NC2B 2Q8BH 5KOVC 2F74A 4FFYL 3O4LD 1G7JB 4Y89A 1HNGA 5EU6E 3ZE0E 5DHVB 3L3OA 3J7HA 2R2HA 1UEMA 1PZUB 3VRLF 5E2UH 4PJ9A 5DEFA 2R1XB 1CQKA 4RBPK 2VZTA 4ODWB 3QDMD 3MRLA 2VDNL 1MCFA 1DEDA 1MLBA 3E3QE 3RGVD 3I75A 5HI4D 5FKPA 4HWUA 1JZ5A 2ZUQC 2LTQC 1CR9L 2DIBA 2DDQH 3SDCD 2AERT 2ICWI 1UZ6F 4P49A 2EC8A 1JGLH 4ZPTB 4P3CH 4PGDA 2R4SL 4KUCF 3MV7D 2FSEA 3ILQD 4NO5B 1FBIL 2P5WD 2HT2C 5D1XA 3EDKA 4PJEF 4MZ2A 2PXYB 4P57A 1Z2KA 1AD9A 2X89D 2PCPA 3BO8B 2QADB 3S36H 1DP0A 2X1XR 4Z7UF 4MXQD 4WNQA 4PJFE 3RIAF 4MCYB 5KVFL 1FLRH 3RIAK 3BUYA 5F9WC 4JM2F 1U8JB 1I3RB 1D6EB 3O3BA 3O9WD 3MLUL 4P5KA 3W2DH 4JQIL 3KS0J 3NCYP 3MOBL 3RWIB 4APQC 25C8L 6CGTA 2F53B 4OZGF 1WBYB 4XMLH 4B5EA 1N7MH 2UZIL 4NQSB 5IVNA 3O3EA 3NFSH 3RJDA 5TPWL 4PRNB 5B21A 3O6MH 3MYJA 4BSVA 2GEEA 1IGIH 3BPOB 5BMFL 3U0WL 4EXKA 3QPQD 4Y8AA 4UINL 5F9JB 1HHKB 2P8LA 5EDXA 1NAMH 1NFDF 2XN9D 3K4ZA 5AD0B 1V5JA 4X4YB 5C0FB 3BIKB 4M6OH 2D4DA 3L5HA 4PJCF 1LK3L 5E6IA 1VFAA 3OJVC 4IRSA 1KV3A 3TWCL 4WI3A 4NN5C 5TGBA 5FUOH 3DYOA 3D9AL 4YDIH 2QHRH 4JR9H 5MEQB 4UOW1 1HXYB 3TO2A 2BMKB 1OD7A 4ACPA 1T7XA 3K8KA 1BAFH 3IJYA 1U91A 4NYLA 5D7KD 2Q6WB 5LWYH 1CFQB 1EPFA 3ARYA 4UILH 2P42B 2JJWA 3K8MA 5DJ8A 5CD5D 5FO8B 4KH2A 3K81A 5D70L 5J13B 1UB6A 3QQ4B 4OUUA 2XWTA 4R4ND 1IJ9A 2O26U 3H9HA 4WEBH 4ZNEA 4JFDB 4TN9A 1KTLB 3L3GB 1NGXB 4WV1A 2FZ3B 1GGIL 4LL9A 1S7SB 3AGVA 3BESR 3PUCA 5EZOL 1F02I 3WLBA 4ELKB 1U8PB 1I3UA 5DD0L 2ATKB 1PQZB 2GKIA 4XPAH 3MRPB 3PP3K 4LSTL 4E42B 5J56B 4G6FD 5DTFA 1WCBA 5IFAL 1MLCB 5ETUB 3F58H 3AC0A 4P48A 1P7QB 5D71L 3H0TA 2HFFB 5E00B 3F7PC 5I1DA 5EORL 3LH2H 4RNRB 4ZFFB 1HILA 1WC7A 3WFBL 1X5AA 2J8HA 4LPVA 3RTQD 4QOKA 1PFCA 2XQYK 2HWZH 4E41B 1PYWB 1Z3GH 3SDAA 5DJ2A 2Z93A 4YHZL 1G6RL 1B6UA 1IGTA 4OT1H 4PB9H 3P9LA 5TJWK 4GS7B 4IDLA 4LLYA 4XP5H 4CGTA 2B1AL 3BH8A 5TDPA 5GGVL 4PJ7B 4PS4L 4OV5B 1C08B 1FZJB 3JVGA 5A2IH 4PREB 5MENA 1O0VA 3MPCA 1BWWA 4PTUA 4PJGB 5DMGC 2HLAA 3T08A 2BFVH 2YKLL 4P2OA 2ZPKL 4TSAH 3B2UC 5IIEA 5L88L 4N1EA 2FBOJ 1KOAA 1KEGH 1K8DA 3VFSA 5GGUA 5IMOA 3IDYB 4XB8A 1MH5A 3WS3B 2VDPH 3ARBC 1UXWB 2GJJA 4EN3A 4BKLA 3W9DA 4DVRL 4JFED 1H8OA 1FORL 1N4XL 5IHBA 4YHOL 4U6YB 4G42A 1HHHA 4OLZH 3NFPB 5D2LB 4HQQH 2ICWB 2Y6SC 1V7MH 3FO9A 5FOBA 1NCUA 3KPRD 1S9WB 3ZKMC 3PWLA 1I7ZA 1IKFL 4FMKA 4GW4A 4PJDE 4IDJL 4NGHH 3OHXA 4PJDA 2IFFH 3VMOA 3V5KB 3IFNH 3IFPB 4HK0B 1D9KB 4N0YL 1U92A 3UTSE 1RZFH 5CGTA 4APQD 2C26A 1ODAA 5DRWB 4OF7A 4DEPB 2OSLA 3QRFM 5DUBB 5HYSG 5E24E 1EFXA 2VNCA 3WIFB 3UPRA 5JORA 3HZVA 1CDHA 3C9NB 5DD5H 5DMIL 1VEOA 2AJYL 3WD5L 2DLIA 2DLFL 4NN6C 1JPTH 4ONGH 2F19L 1KEMH 2AJ3A 2VLLA 3EYUH 2VLME 5B8CA 5IG7A 2LQRA 3ROLB 1T0MA 1C16B 4RFEB 4W4NA 4HJ0C 1X9QA 1JWSA 4XPGH 1NUFA 1KG0A 2NY5L 2J12B 4IMKA 4M4RA 4NPYA 1T5XA 1ORSA 3LRSB 1DSFH 3H2WA 4WVRA 2XKNA 3OKLB 4PY7A 4X6BA 3RDTB 4XPTL 2AK4B 2ZG1A 4MA1C 3M17B 5IESH 4GRLB 2AABL 3AU1B 1MQKL 5FYKH 5F96L 4UTBH 3EGSB 2IMMA 1NLDL 1I3VA 3BHBB 3RL2A 3S35L 4L4VD 5I8KH 1ES0A 1T1WA 4OM1L 1YQ2A 4G6KH 5CSBA 3GBNH 3HLAA 4WW1A 4OZ4B 3U7WL 2CR6A 4JFZH 1A7RL 2X9WA 1CD8A 4LSRL 5CKAA 2XWBB 4I18B 2UVEA 1EHNA 1DQJB 4I2XE 5DVOA 3ETBF 4I3RL 1JPST 2EXWD 1R3JB 3KYOA 2NW2B 1IM3A 3HCVB 4OZIF 1C8PA 5I8OL 1CDCA 1CQYA 4IOSD 1BQHB 4HUMB 1CVRA 2ITDB 1NSNH 1KB5L 3MCG1 1KPRA 2X7LA 3K4AA 4MJ6B 2IQAB 1X3DA 4K8RH 5EU5B 1MJ8H 1QSEB 3O4OB 1A47A 4JDVB 1KN4L 1JV5A 4P59H 4MSWA 1ADQH 4QRQB 4MD0A 4TVPD 4Y5YA 4JPKL 4P9MH 2V2WB 3TYGH 4YLQT 3RZCC 1JI1A 3TC9A 1E4JA 1MFAH 3M8OL 1I8MA 2W9DH 3SE4A 4JO2H 2Y4SA 1BX2B 7FABH 3EKCA 5FO7A 2AXFA 2D7TH 2C1PB 2IPKA 5IMLA 2AI0H 4DTGL 3T0XA 3GUTA 2A0LC 5GS1A 3MRCA 5IQ7L 2OZ4L 5JO5A 4EQ3A 3JV4A 2C7UB 1A6TB 3PF2A 3O4LA 4M62L 5DMGD 1PZ5A 3O2VL 3FRUB 3L3JA 4GLRI 4ODHL 3B2UD 1F97A 3VFPB 4YDLC 1OGAE 5ACZB 5CINL 1OGAA 2FX7H 4ZDHB 3NIGE 3ARBD 3Q1SL 4OF0A 4U0QB 3V6FB 4U1LB 2ZNXA 1I8KA 2MCG1 3L3IA 3GHBL 4PBVC 4WI4A 4XAWL 2HRPL 1NL0L 4Y5XA 2F74B 4K3JL 3MXVL 4R97B 2LU3A 2CRIA 5FUCC 3RVTC 5J1TC 4MNGA 2Y6SD 1BM3L 3SDCA 3L3OB 3PIQA 2R2HB 5FYJD 5EU6B 3BX7C 3ZKMD 5ISZE 1A2YB 5LQBL 4PJ9B 5DEFB 4WENB 3CZFB 3GMPA 1OTSC 2FHCA 3TM6A 3E6FA 3MRLB 3MV7A 3E6HA 2B4CH 2GFBA 4RWYL 3G6JA 1DCLA 3I75B 5FKPB 1GH7A 3SJVE 3STLA 1QKZL 3X3GL 5H37H 3DHJA 4HJJL 4X7TA 3MFFB 4LGPB 3OR7A 1FFOA 4YXLL 3SGJA 2DTML 2HRLA 1HHJA 5T5FL 4BQ9A 3VGBA 4NRZA 3ULUH 4NFDA 2I27N 2FSEB 4AMKL 4OM0H 2NY3B 2E27L 2Z8SA 2XPGB 4NNPH 4P57B 2XZCL 4LARL 4QRPE 3U4EB 2PCPB 1AGBA 1OAZH 4HIJA 4HGWA 3BD5A 3BN3B 4W70A 3WUWA 3MODH 3BUYB 1JI2A 4HJ0D 5I1CH 2XN9E 4OD3L 5LGJA 2ZNWA 2VXQL 3GSNA 3OAZH 3F7VA 1RURL 2XN9A 4M6MH 1EA9C 5C0BD 2EKSA 4JFYB 4LVHC 2FEEL 4JFHD 3DURB 1QTYT 1G84A 3RQ3A 1Q0XH 2HKFL 1F4YH 1RU9L 3QHFH 4YHYB 2YK1H 5B22A 3QG7L 4RGOL 2G5BB 4YQXH 1KCVH 1YMMD 3MYJB 4BSVB 3N1QC 3CIQA 4QF1B 4I9WD 7CGTA 5C0JB 3O8XA 4CU8A 3ARDC 1VA9A 3VH8G 3V52L 3GI9H 1NCWH 5E6IB 1VFAB 4IRSB 3V4PH 3EZJB 1OP3H 3FTGA 1YYMH 1MRFL 1I1CA 2A6IA 1CF8H 1NGQL 5KSUA 3RAJH 4IRJC 3N0PB 3GM0A 3MLTA 3F7RA 3TO2B 4F15B 2PO6C 3BKYL 2ARJB 4G43A 4PJXE 1U91B 1ZTXL 3GIZL 4NYLB 2MCPL 3VFRB 4XCYA 1ZA3A 5DJ8B 4HXBH 3REWA 1GHFL 3P4OA 5BJTA 4CU6A 1MWAH 3EZ8A 4GXUM 2QJDA 4OUUB 2ZWLT 2XWTB 5ILTH 1EZVX 4Z7OE 3FT3A 3AREA 1F3JA 4WV1B 2B2XH 3RZCD 5DMJB 3MBEC 1ERNA 4Q2ZB 4MXVE 3WLBB 3O0RL 5EIIB 3BZ4B 2FIKA 3H7LA 4NWTH 2H2SC 5C0IA 3U7YH 3J8F7 3ALPA 2A0LD 1XR8A 1WVZA 3VFGH 5I8EA 5DTFB 5ID1A 4DAGH 1TJHH 1NCBL 1SBBA 1ZMYA 3OMZA 3H0TB 5C6PB 1PW3A 2R8SL 5I1DB 1MIML 1HH6A 3MXWL 1WC7B 3AS3A 4OLXL 5C7XH 4XGZA 4PJGF 5FGSA 4MDIA 3WUZA 1F90L 3BAEH 1Q0YL 3SDAB 2Z93B 2VQUA 2VJXA 4YNYA 1IGTB 4F58H 2V2TA 2W0KA 3P9LB 1WTLA 3EYOA 1C1EH 2P8PB 3RVTD 4LLYB 1UM5H 2D7QA 5T33H 3BH8B 4MXWH 1A9BA 5TDPB 5CFHA 4R6UA 4KI5F 4GFTB 4RRPA 3V0WL 4K2UL 5MENB 3BRGC 2G60L 1OTSD 4HKBA 4PTUB 2HLAB 3LQAH 3KPRE 4P2OB 5FYLD 4JFPA 5IIEB 3KPRA 3MV11 5HHOD 1K8DB 3SKJH 1C7TA 3VFSB 5GGUB 3MBXL 5IMOB 1A02N 1MH5B 4XI5C 1TENA 5MI0C 1T4KA 3FO1A 4P99A 5IEHA 2BVPA 3IB4A 4WO4C 3ZKXB 2H8PA 3U2SA 4BKLB 4EN3B 2XRAH 1MCIA 4G42B 1HHHB 3V0AC 4ZD3L 2DBLL 5FOBB 5SWZD 4FQQA 4XP6L 4APQA 4HUVA 3K1KC 1I7ZB 3IFOB 3ARUA 3BGMA 4GW4B 3LKOA 3KHOA 1IC5H 3OHXB 4N1HB 4XNQA 3UDWC 4PJDB 4DKFH 4JY5H 3QH3B 3CFKA 1AKJD 3QDJE 1NEZA 1T6VN 3PNWA 1U92B 1MY7A 3UTSB 5JOPE 4CW1A 1GGYA 1MHPH 1FNHA 4HXAL 2Y5EA 1T3FB 2OSLB 2A77L 1SYVA 4S1RL 1QBMH 4HT1L 5DD1L 3UJIL 4LLUA 5DO2C 3ZTNH 2QBWA 1EFXB 3UPRB 2CUHA 3TCLA 2VERN 4XC3L 1H5BB 1LO2L 1U6AH 1VESA 3ARDD 4QO1A 4KZDL 1SVZA 4RMRA 5I1LA 5IOPA 5B8CB 1S9YA 5IG7B 1SMOA 4JPWL 3UYRH 1JGVH 4OCXL 4OCMC 5HSFA 5I2IB 4KVCH 1JWSB 4KDTA 1RFDH 1OTTC 1KG0B 2N56A 1OQXA 1FIGH 2YUXA 1B88A 4WJ5A 2BJMH 2W1NA 1T5XB 1GGUA 1ORSB 4IRJD 4JRYD 4X4ME 2PO6D 3I6LD 4HIEA 2XKNB 4X6BB 3VDAA 4X0KA 4G8IA 4J12A 4JKPL 1MNUL 4GG8A 3TBTA 3GSWA 3OZ9H 5MHSE 4M1GL 5F1OB 5GRVK 3TEUA 4J2XA 3FO0L 3S8WA 3FN0H 1U8KA 4JHWH 3RL2B 1FDLL 3HZKA 2AEWA 1B2WH 1ES0B 1BFVL 1MCPH 3LKPA 4HJGA 3HLAB 4WW1B 1GZQA 3MBED 1JZ4A 4FNLL 5GGTA 3TESA 1TVDA 2XA8L 2H2SD 4LSPH 4I2XB 1HDMA 3KYOB 1IM3B 1YEIL 3I6GA 1JYWA 1OWWA 2X7LB 5ELIA 1IBGL 1IQWL 1CZ8L 2GCYA 3AS2A 1AH1A 4D0CA 1JV5B 4MSWB 4MD0B 4Y5YB 1EGJL 1RVFH 2LAGB 1MVFA 2PTUA 4J6RH 4XPBH 1I8MB 1ND0A 2A74A 5CP3H 4WFGE 2AXFB 4I0PC 5IMLB 1CLZH 1DQQA 1U3HB 2YXFA 3ARBA 5GS1B 3MRCB 1ED3A 5JO5B 4Q9BA 3JV4B 1J7VR 1PZ5B 2BCKA 3L3JB 1S3KH 5CJQH 5JW4N 5L7XH 1W72H 4NHCL 5FOJA 2MMXA 3EDFA 3U4BH 3VI3F 1OGAB 4XI5D 1KIQA 4F9PC 5AZ2L 3QDGD 1J5OL 1G9MH 4WO4D 3NFNA 2BX5A 1F3DH 4G8FA 4Y5XB 4YX2H 2J6EA 2P47B 2DJ4A 4O58H 1PDKA 4MNGB 3DECA 2EH7H 1JNNH 3DX9A 3W0WD 4PRAA 4R2GB 1VSCA 1S5IL 4X6CE 3VG9B 3GMPB 1NCAL 1CK0H 2PW1A 4QHNA 3E6FB 3WJLC 1OAXH 3E6HB 1U8LA 3T65A 2GFBB 3VFMB 1QA9A 2HTKC 3STLB 3UX9B 1EO5A 4F7MB 4KHTH 4AYFA 1QFHA 1T2JA 4KPHL 4X5XA 3OR7B 4DW2L 4LCIH 1V7NH 5L2JB 1HHJB 3S5LB 4AZ8A 4NRZB 1CGSL 3JTSA 3WO4C 5C0BA 2ZUUA 2B7DT 5DO2D 4WFEE 3RI5F 5FGRA 5HDLA 5HDQL 2F8XC 3TIDA 3VXTA 1AFVH 2J5LB 3LS5L 4QRPB 2R4RH 1AGBB 4XWOC 4MNQE 2GK0A 1YQVL 1P4BL 1YMMA 1P84K 4MNQA 3DHMA 1K2DA 1R6VA 1TZHA 5KVEL 5LGJB 4XNYL 3F7VB 2XN9B 1OTTD 1JGDA 4RA0C 2EKSB 2GSGA 1X44A 1DLFH 2AV1A 4RDQG 1TDQA 5ALBL 4H26A 4NKDA 4X6FA 2A83A 4CADA 4LVEA 5BV7B 1WWCA 2DI7A 1BQUA 5GRUL 5DZLA 3S3SA 3QA3A 3EAKA 1A4KA 4HWEL 3O8XB 2VITA 5JDJA 5FDWA 2IPTL 1NGZB 1MJUH 3I02A 5D72H 4Y8DC 1RD6A 2BERA 5EWIL 1LMKA 3FTGB 2ORBH 1UKTA 2A6IB 4J3XA 5KSUB 4XVJH 43C9A 4MAUL 5D5MA 1DBBL 1EBPA 2A9NH 1GOHA 3NPZB 3DO3A 3MLTB 4HW6A 4EDWH 4KRMB 1PBYA 2A6DB 4G43B 1HKFA 3RZCA 4NQCD 4U1NB 1JZ2A 3HI1A 3OJDB 1S7QA 5F1SA 3RNQA 4XCYB 1ZA3B 3NPSB 4JVUA 4HKZB 1NC4D 3QNXA 3REWB 4BZ1L 3P4OB 4NZJA 5BJTB 1LO3L 1QPXA 4G6FB 5EIQA 1RUPH 2R0ZH 2V17L 2XXCB 4DGIL 3FT3B 1OPGL 4N9GA 4RIRA 4XPFL 1A7PH 3AREB 5BXFB 1F3JB 3O2WL 5TF1H 1AO7E 5TE6H 3QAZC 4TUKH 4I0PD 5LVEA 1F4WH 2OX5A 3SE3C 2C3GA 2FIKB 4NC2B 2AEPH 5C6TH 1OAYH 3WIHH 4FQJL 1D5MA 5I8EB 3CK0H 1U42A 2VXTH 5ID1B 3CVHH 4U2ZA 5FYKU 6FABL 2KBGA 3TT1L 4G7YL 5E1AA 3LIZH 4PJBE 1W0VA 3HNSH 4PJBA 1HH6B 3NGBC 1KB9J 4K3HA 1H3PH 4UIKL 4L3EE 4XGZB 4MDIB 2IJ0C 4PJHE 5A16A 5HHOA 5C1MB 2XZQH 2OI9C 4YNYB 4S10A 3VFUA 2V2TB 1BMGA 3E8UH 2VXUL 3EYOB 5CJOH 2HT4C 5E8DH 4FFZH 5C2BL 4MCZA 4F80A 4KGLA 2CO6B 4H20L 1XZ0B 4HKBB 4M00A 4PPTA 5I1JH 3VXOA 4JFPB 5SWZA 3KPRB 1K4CA 3IU3A 4MQTB 2HTKD 1JWMA 2VXSL 4OB5H 1ZKAA 4KROC 3ULVE 2J3SA 4GO6B 1T4KB 3FO1B 5IEHB 5GRVL 1VERA 4U6HA 5DJXB 1IL1A 4NM4H 1WEJL 3U2SB 1AKJA 1T7YA 2NY2C 4N0FA 3HNVH 2Q87A 1T7VA 5F9WB 3MRJA 1YPZA 4KAQL 3NZHH 4R8WL 5T3XL 4JM4H 1KENH 1UCBH 1QFWH 5EOQL 4JKWA 1C5BL 1J12A 4QCIA 4JZJC 4R4FL 1A6AA 2IPUG 1S7TB 4FQQB 4APQB 3N9GH 1I7UA 2NR6C 3BGMB 4OLVL 3D39E 3LKOB 4WEUD 1EAPA 1F3DJ 1SM3L 3D39A 3RVUC 4XWOD 3P9MA 4GJTB 3TA3A 4FQ2L 1VEMA 3KYKL 5JQ6H 4TSBH 1NEZB 3PNWB 4TULL 3ARDA 5C08D 4S0TD 3T77A 4ONOA 4RCAA 4I13B 4CW1B 1TZIA 3KPQA 3QULA 4HIHA 1BGXL 4NN5B 1SYVB 1ZT1B 4ZODA 1IEBB 4LLUB 1EXUB 3QUXA 2EO1A 3TCLB 3I3BA 4IRJA 1KULA 2PO6A 2CLRA 3QZWG 5DQJA 2XI9A 2AVGA 3HKFA 4LHQB 5IOPB 5JHDD 4L4TD 4ISVB 2NNAA 1JK8A 1OARL 2ZJSL 1J0IA 4MVBC 2AXHA 5KW9H 1HIML 5E4EC 3V7AE 3JZ7A 3QXUA 4NQDD 1RMFH 4GG6E 5CZXC 4G3YH 4YXKL 1U8HA 4WJ5B 1VDGA 3BJ91 4H88L 2EDKA 3VWJC 4PG9A 5JW4Q 4HIEB 3V6OC 5BS0E 3W5MA 3NH7H 1Z6JT 5EULV 4G8IB 4YXHL 1YEFL 3MBEA 1S7XA 1M7IA 4GG8B 1Y6KR 3TBTB 5GGRY 4K8RC 1RI8A 1OAQL 2FCBA 4LU5H 4ZS7L 2GT9A 4N5EC 1U8KB 4TTGA 3V5HB 4Z8FH 2HP4A 3HZKB 1UWEH 2NY0D 5I75B 4OZFA 3LKPB 2FGWH 4HJGB 1IFHH 3L7EB 2VLKD 1FSKB 3EOAA 1GZQB 1X7QB 1D7FA 1UACL 2VXVH 4TRPL 4JE4B 2AJZA 1XH3B 5E8PB 1MCOL 2J4WL 4MGXA 2NQCA 4WFHD 3IXTA 2I07A 3EJJX 3QPXL 1HDMB 4PG2C 2X44D 5I18L 1XF2B 4NKIL 3KPSD 3I6GB 1YEEH 3HAEA 1DZBA 5B38G 2Z91A 1LDPH 1GRWA 4UT9L 3QUKA 5C07D 2GCYB 5BZDB 3H9SE 4WW2C 3S34L 4R4BA 4NRYB 4KI1A 3H9SA 4D0CB 4GQ9L 3BE1L 3GHEH 5DJCA 1N6UA 2V6HA 3MV9E 3MX0A 2X10A 1R3KA 3MV9A 2CK0L 4XNUL 1G7PA 1ND0B 3MJ8B 2A74B 2ICEA 1F5WA 2MQ3A 2HT4D 1B9ZA 3GMNA 3RPIA 4HUNB 1DQQB 4JO3H 3QDGA 3OWEA 1I1YA 1NKOA 2EC9U 3TNNA 5SX5H 1AGCB 3VXRD 4ODXA 1ED3B 4OCLC 1RZJH 4HG4J 2BCKB 4WHTB 3VMNA 2XG5A 1KCKA 1Z9MA 3W0WA 1CLOL 3SDDC 3L6FB 3KLAA 2MTPA 1LWRA 2QQKL 2V9TA 4ZFGH 4KMTL 4KROD 4QXTA 4Z77A 3OAUH 4LRIC 1MCQA 3NFNB 4KTDH 1CD1A 2NY2D 3G6JF 2YPLD 4G8FB 3ARXA 4WCYH 1RUAL 4D9LH 4BSWB 3DX9B 3OKEB 1JNHA 4LAQH 4NZRL 4WWID 3V4UH 2NR6D 1GC1L 1NLBH 2PW1B 3LPWA 4X6CB 4QHNB 3T2PA 1E6JL 5CBEA 1S8DA 2AXJA 3QP3A 3RVUD 1FG2B 3BI9X 3T65B 1BD2D 1QA9B 4OCWL 3DPBA 2EO9A 1EO8H 1FGVL 2GK2A 2EE6A 4X5XB 1PX4A 3MJ7B 4XAKD 1D5ZA 3KPOA 2DRUA 4R26H 1H15B 4X7CC 5F8QC 3JTSB 5AZEH 4Z18A 5C0BB 4UT7H 5FECA 1P1ZA 5FYKD 5EU7E 3MACL 4O2EB 4M5ZL 3TIDB 4M9OA 3LEYL 5DVKA 4X7DC 1L4IA 1RZKH 4RX4D 2GK0B 3BT2H 4DKDC 1YMMB 4MNQB 1WQVT 4MVBD 1K2DB 1TZHB 2VH5H 2DQUL 4B7LA 2D0FA 4ZTOL 2MOVA 1JGDB 3BEVA 2GSGB 5CZXD 2WBJC 5F1NA 2AV1B 4ZO8A 5D7SH 3VWJD 3VXSE 3DSFH 3VW3L 3ARGA 4X6FB 2A83B 4YHPA 1NBZA 3FZUC 4OLWH 4PGZA 2E6JA 4TNWF 1HOCA 2PF6A 2HT3C 1XGQA 3QA3B 4M43L 3E1F1 1J0YA 3IDGA 5I15H 2R23A 2VITB 3QIBB 4WWKC 4LNVA 3FO2A 5FDWB 3I02B 4HCRH 5EUKA 4RGNE 4DUWA 2I5YL 4N5ED 1MUJA 1KELH 4XXDB 1BVZA 1XAUA 4KV5E 1N59A 2H1PH 1KCRH 1QSZA 4JHZA 4JFQA 1LP9F 4MLIA 1NC4A 4MNHA 1I9JH 3K0WA 3BDBA 1YEGL 3SGEI 3D85D 3F12A 3SOBH 2Q8AH 1XGUA 1SBSL 5D5MB 3T0EC 4X4ZA 1C7SA 4Z7OF 5DXWA 4M7JL 3RZCB 1HCVA 1X5KA 4B50A 3HI1B 1S7QB 1J1OH 1CL7I 4I0PA 3HMXA 3RNQB 4NUGL 2VR4A 5CEXA 1I1RA 4X6EA 1QUNA 1A3RL 3OAYH 4P3WA 3QCVH 3D6GA 1IQDA 2XFXA 1ZGLA 1KFAH 1Q9OB 4EI5B 1KLUA 2APBA 1YC7A 5T1KA 2QQLH 4YDLB 5I66A 5FV1L 1DBJL 3CXHJ 1AO7B 1JMXA 1OP5K 2B0SL 1TJGH 1QR1B 4UAOB 5F9AC 3S6CA 4F9PA 2GUOA 3NVQA 5CAYB 3JWDL 5DMKA 5IT2H 3WFCL 3VXUD 1CT8B 1D5MB 3LQAC 3LDBC 1INDL 3QO1A 4NNYA 3GJEA 4KK8C 4GXUN 4OIIL 3CFDA 5E1AB 3SDDD 1JHLL 2DIAA 2CKBH 2FD6H 4PJBB 4U1MA 4TSCH 4UNUA 1CTOA 1MJJA 3WJLA 2VDOL 4LCYA 4KTEL 5DRXB 1QACA 5A16B 1YNLL 4PFEA 2AJSH 1BEYL 1N8ZA 3VFUB 3FQXA 1M1SA 3HZMA 5D7LE 4AQ1B 5KVGH 3Q2CA 4MCZB 5D7LA 3SQOL 1RIVH 4J8RA 1FC2D 2FATH 4L3CB 3QO0A 3D2UD 3WHXA 1T80A 4HS8H 4XNMA 2CGRL 2ESVE 2ESVA 3VXOB 4X9BA 3QWQB 4KHXH 3VD5A 1DL7H 5GRZA 3IU3B 1R24A 2IGFL 4WRLA 1X6LA 4U6HB 1DUYA 1HHGA 4L29A 3MLPA 2NY5C 1FVCA 4HWBH 1OL0A 1AKJB 4N0FB 4ZAKC 3MLZL 1NCDH 4WUUD 1NGWA 3MOAL 2YUZA 1YPZB 3MRJB 3VJ6A 5EBLA 2IEPA 5C08A 2X40A 5D7JA 4QCIB 3T3PE 3Q5YA 1A6AB 1J8HE 3VI4F 1YYLL 4LVHB 1PLGH 4F8TA 1J8HA 1DANU 5C0CD 4M7LH 5HY9A 1C12A 5DR5H 1EAPB 4Y19D 3UYOD 3VMPA 3D39B 5E2TL 3TA3B 3P9MB 1LO4L 1RUMH 4U1HA 3HS0A 3F65A 3ME0A 4ZUWA 1JBJA 1BLNA 4WY7L 3VG0L 4XMPH 3T77B 4Y4HC 2WBJD 3OJMB 4P2YA 1TZIB 2UWEE 3ECBA 4O02H 3KPQB 1CD9B 4HIHB 1IGYB 5FHBH 2UWEA 3C6LC 1K5NB 5ANME 3FZUD 5ANMA 4FQHB 4NCC1 3N06B 3JWNC 4RAVA 2HT3D 4N8CH 4OLUL 1CD0A 1RK0A 2MSPA 3NN8A 3QUXB 3O3DA 4JDZA 4Z76A 3F7QA 5LAXA 4IRJB 2H45A 1JFQH 2PO6B 4WWKD 4LVOC 5LKNA 5DQJB 5J4MA 2IMNA 2RGSA 1XIWC 1JTOA 5T3ZD 3EBAA 1JK8B 4D9QE 4N0UE 1GPOH 4N0UA 5F3BA 5GQBA 1IVLA 1NBVH 2F8OA 2KQNA 3CFCL 3GNMH 1WZ1H 4ODTH 1U8HB 3LN5A 3HC3H 2I9TA 2C3XA 4HPYL 3DRTA 4LRNH 3T0ED 2HVJA 1BZQK 4PG9B 4GW5A 4UI2A 2VLKA 5GZOC 3CXDL 1S7XB 1J05A 3RBGA 3SE3A 4OZHF 3R4DA 2GT9B 2ZKHH 1CGUA 4CN6A 1QPPA 2VDLL 4OZFB 3B5TA 4QHLA 3EOAB 4YFLF 1R3HA 5ESAA 1LGVA 2AJZB 5C07A 3MLUH 1AD0A 4NCDA 5HPMA 2VDRL 1WBXA 2I07B 5JUEL 5IROC 2UZIH 5L8LB 5SWSD 4KK8D 3VXRE 4O5LL 2Y9RT 3VXRA 3U0WH 3V5DA 2GSIA 3PWUA 4BUGA 2Z91B 1HE7A 4PD4J 3W9EA 5D2NC 4WHYG 5IMMA 4R4BB 3H9SB 3QB7C 4M93C 5DJCB 2IBZX 1FNEA 1KTDA 4XX1G 5BV7L 1R3KB 3MRBA 3MV9B 1S7UA 4ZUSA 4PUBL 2OCFD 2ICEB 3C08H 4G5ZL 5MI0B 4X8XA 1TVBA 1I1YB 5J11B 4LGRB 1X5ZA 3TNNB 4EQ2A 5E95B 4ODXB 4P3DB 2YPLA 3U30C 5CZVH 5ICZA 1PSKL 4NFCA 4P4RB 1Q1JL 3ORJA 2QV2A 5ERWA 2D31A 3CX2A 4LBEB 2F15A 4GOSA 2DQGL 3MREA 4JZJA 3GKWL 3HR6A 1AE6L 5FM8A 5FK9B 2Y07H 4J3SA 3TJEH 1IAKA 4GQPH 4U1SA 4D94A 5LBSH 2HFEB 1EJOL 3WUWG 4QXTB 4Z77B 2YD5A 3EYVB 2VO5A 1BD2A 1CD1B 1JF1A 4ZAKD 2GW5A 4Y1AE 4N68A 2DD8L 1GGIH 4R7NB 3RWDA 4LNRA 5C0GA 4EZMA 4XAKE 1JNHB 5EO0B 5HJ3A 1WISA 1SEBA 2E6QA 4N8VA 3WL9B 5FYKE 5AG9A 5CBEB 1CLYH 3DXAE 2Z0BA 5D71H 2RAMA 4GLRH 1BVKA 1C5CL 4PIRF 5I19H 3RY4A 5JMRA 5E08H 5EORH 4PRHE 1BZ9A 2DWDA 3S97C 4Y4HD 1JNLH 3L5IA 4LCCC 1P5VA 4RX4A 3IKCA 2F5BL 5DVLA 3CMOH 3C6LD 4L5FL 1D5ZB 5INCA 3KPOB 3RL1A 2RIKA 5C0EB 3U36A 4YHZH 2OMBA 1QLFA 3NIFE 4HGMA 2BVEA 1BJ8A 3KR3L 3MGTA 5DUML 4UNVA 4XMKL 5JNYA 2AEQL 3VWJA 5KVDH 2BOBB 1UM4H 2DLTA 4ODSL 5EN2A 1OM3L 1NMAL 3V6OA 3BISA 2ENSA 4GXVL 3HZYA 1XIWD 3I85A 2ADGB 1ZLSH 1T04B 1BBJA 1MCHA 2JF1A 3WS6C 3L5XL 4U6VH 5HGAA 5IMKB 3FB7B 3BEVB 3EYQC 1ADQA 5KS9F 2MQCA 4Z9KB 2XXMB 5I74B 1UYWH 5IGXH 5GS0H 4UZGA 3UBXG 1ZWIA 3ARGB 1NBZB 5GZOD 1M4KA 2YBRB 3F6IA 4PGCB 5E0QA 1N4XH 1XGQB 5LCVL 4KFZC 2NPLX 3FQTB 4NQVA 5D5MF 3IDGB 4X7SH 1I3GH 2R23B 3IJHA 2W60A 5EUKB 1MUJB 2XQBL 4RGNB 2OS7A 1NMBH 4QXGL 1N59B 1N0LA 1OTUC 1S9VA 4JFQB 1MI5E 1PG7L 4K3DL 1CXEA 1NC4B 4MNHB 3WIIL 3QUMH 2BY3A 1NAKH 1H3UA 1WAAE 5KJRL 3F12B 4WW2A 1XGUB 3S37L 4OAWA 4CU7A 5DEZA 1KXTB 4S0SD 2YRLA 4DVBB 2HJKA 2YPVH 2OL3H 3TBSA 4JFXA 1DBKL 3T4YB 2MNUA 4I0PB 1MFEH 1K6QL 3AB0B 5D93B 3D0VB 4GAGL 3BKMH 2LVEA 2DLFH 3O6LH 1IQDB 5TDNA 3P77A 2V5TA 2XFXB 1ZGLB 1Y18A 1OGTA 2COQA 1ZLVH 5T1KB 1X5FA 1UH4A 4OGYH 2I9LB 3SDDA 4R9HA 1CFTB 4PJBF 1QP1A 3FB5A 4LFHD 5I66B 4L8SC 4BH8A 4K9EH 2VOTA 4BQ6A 4LRIA 1KN2H 2GUOB 4M3KB 5DMKB 3ULUE 1U36A 1G9NH 1R3IH 2FR4A 4ZOEA 3NMEA 1UWXK 3QO1B 2JJVA 4NNYB 3GJEB 4D9RE 1FE8H 2K7QA 2G9HA 3CFDB 5FB8A 4U1KA 5ALCH 1FO0L 2ZCKH 1ORQB 5HHME 3NZ8B 4U1MB 4OTXL 3LHPL 1I1AC 2CRMA 5JW3H 1MJJB 1TVHA 1FL5A 4JB9H 4JKKA 4LCYB 5TE4L 3D48R 4G9FE 4OM1H 2EDXA 4WHCA 4RSVA 4OI9A 4G9FA 1N8ZB 3N1PC 3HZMB 5H37G 2K3TA 3D69A 5D7LB 2EIZA 3V95A 4J8RB 5GRJL 2VN4A 4I1NB 1CLCA 3QO0B 2D9QB 3WHXB 4G8GD 4WUUA 1YPZF 1KGCE 4XNMB 2O5ZL 3TT3L 5H35A 5HVFB 1TETL 1X5XA 2ESVB 2OQJA 2O5YL 4OBSA 1NAMB 1DFBH 1EBAA 5C0CA 2OXGA 4Z7QF 1R24B 1YZZA 4KKAC 4Y19A 3KXFD 3TV3H 1DUYB 1HHGB 4L29B 8FABA 2DICA 1FVCB 2EYTB 3QHZH 4QRTA 4JPKH 3FFCD 3QT2A 3VJ6B 1EERB 5EBLB 3HMWH 5D7JB 4DKAA 5IB5A 2WBJA 2YUWA 2FBJH 4JG0L 2ADIA 1J8HB 3BZDA 4DTGH 5HY9B 1HKLL 4OCYL 3NACL 3CD4A 5IQ7H 5ECJE 4CKVX 4EUPA 3PWPE 4U1HB 2Q7YA 4ZUWB 4NP4H 3PWPA 4WWKA 1BLNB 2IWGA 3LPGA 3INUH 3EYQD 4XP4H 2R0LH 3H6JA 4H25A 4M03A 3ECBB 1J11A 4GBXC 4KQ3L 1C5DA 1G7HA 2UWEB 3HC4L 4YBHA 4CMMA 2EDYA 4CVUA 2X5PA 2P5EE 3PDDA 2OR9L 5ANMB 3SO3B 4RAVB 2P5EA 5HVGB 2QADC 2QSCL 5AYQA 3T0EE 3WFEH 3NN8B 3O3DB 4JDZB 1B3JA 1I7TA 2BY0A 3IF1A 3Q6FA 5LAXB 4QRRE 3T0EA 3K1DA 2ILLA 4QTIL 3RUGE 3Q6GH 1UT9A 2Q3AA 3L3KB 1OTUD 2DMBA 2ERJC 1QSVA 2B20A 2XTLA 5LJYH 1A6ZA 2NTSP 2YRPA 1N0XH 4HIXL 2J6EL 1I9EA 2E9WA 4N0UB 5F3BB 3DJ9A 5CMAA 4POYA 2WMPA 1DE4A 1VFBA 3X3GH 2I9TB 4L9DA 3DRTB 2VZOA 3UJTH 2HVJB 2W9EL 4GW5B 3BPOC 2VLKB 4PRDA 1IE5A 2YD9A 4N90E 5BQ7A 3P0GB 3T2NH 3QAZB 5DK2B 5HHPA 2Z31B 5IBTH 4OCRH 4Y2OA 3OGCA 5ENWA 3QFDA 5EUOA 5I1IL 5IM7A 4OQ1A 5SWSA 3GGWA 3G04A 4NZUH 4Y4FC 4LPCA 3MZGB 4OFYA 1GVIA 3BSZL 2DJUA 1S9KC 2ICES 2OK0H 4QT5A 5F1KC 1AD0B 3P4LA 3D25A 4NQTA 1N5YH 2W59A 5HPMB 1RJYA 3ZE1E 3A67L 3JSSA 4HUKB 1AI1H 5F7EH 1S7RB 2CDFB 2OI9B 4JN2A 1BIIB 4RGOH 2EYRA 3LS4H 4R90L 4AH2A 3VXRB 3LMJL 5GRWA 2GSIB 3PWUB 2DQEH 2NW3A 2CMRL 5C09D 1I1AD 2DM4A 5IMMB 3QXTA 1QNZH 4PV8A 3IDMA 1FNEB 1KTDB 1MHHA 3MRBB 4YGVA 4ZUSB 3U1SH 2EDOA 4NBXB 3UPAA 4C4KT 4G9DB 3N50A 3QNZB 1G0DA 4Z95L 1TVBB 1H3GA 4ZAKA 5GJSH 5ICZB 1IM9D 1YY9C 2Y06H 5ERWB 1OAUL 2D31B 4EBQL 3HG1E 4ZXBC 4X80H 4JZJB 3PXHA 4FS0A 5AUMA 4YR6A 2DQTH 1IAOB 4RFNB 2PYED 1IAKB 4U1SB 4F33A 4KKAD 1NC2D 1DDHA 1YEJH 2F54E 5JIIA 3QI9C 3FN3A 1ZVHA 4OGXH 1BD2B 1JF1B 4HLJA 4OCSH 3IDIB 4U0RC 3ZKQD 1MPAH 1CDYA 4Y1AB 2VC2L 3RWDB 5D6CA 4CN1A 4LNRB 4YIQB 4Y4HA 5C0GB 2X4SA 5HVWA 3O0RH 1FAIL 4BZ2L 1A1MA 1RZKC 2EE2A 1T66C 2X4QB 4RQQB 5IVZB 3IDYC 3DXAB 1LEKB 4U1IA 4ELMF 1BVKB 3GMRA 4NQUA 4R3SA 5DRNA 1TJIL 1DBAH 1LO5A 1XIWA 1A3LH 1KB5A 4PRHB 4KRPB 1MY5A 1R0AH 3BP5A 3IKCB 4GBXD 2R56L 5K59F 3BH9A 1G7IB 5INCB 4K7PL 1ZT7A 4W81A 5E4EB 3U36B 1QLFB 5C0AE 5DF0A 2QADD 5C0AA 3MGTB 4DZ8A 1NGYA 2SEBA 2FJHA 5JNYB 5F3HA 5KG9A 1KYOK 4FZ8H 3VWJB 2QQNL 3P0YH 3WNLA 2AJXL 2AJVH 5EN2B 5IHUH 1D9KC 3PHQA 3HZYB 3QRGH 1ZHLA 2C9AA 2NX5D 5I16A 3L7FA 1EDQA 3IXAA 1BBJB 3IDJA 3NCJH 2W38A 4BFBD 4U49A 1IC4L 4MJ5A 4LPTA 4U3HA 3MA7B 2BVTA 4Y5VC 5HGAB 3DI3B 2BXYA 2F53D 1OCWH 4Q9RL 5KN5A 4I5BA 4WTZG 3CDFA 3MRFA 4OSUH 3LD8B 3T0AA 1RUQL 1P4IH 1ZWIB 2HG5B 2DM2A 5CP3A 3KPLA 4PBXA 3V7MA 3K8LA 2I24N 4EDXA 4ZO9A 1WFTA 4NQVB 2DBLH 1HHIA 3QXWA 4FQLH 4NBYB 4F7EA 4RMSA 3IJHB 2W60B 2E7HA 4O4YH 4LSVL 5DQ9A 5FM5O 1U93A 5IROA 4AEHH 3ULVL 1REIA 1Y6MR 1WIOA 1S9VB 5JR1L 3WFDL 2R2BA 3D3VD 4P2CG 4Y4FD 4GUPA 4CUCA 2AQ1A 3RDTC 2D03L 2QTEA 5D2NA 2WINA 4OAWB 2DLGA 1MFBL 3ZDYE 1L7IL 3KPPA 4JZNB 1KUMA 1OLLA 2HJKB 3TBSB 4JFFE 4JFXB 4WU5A 1R5VA 4JHAL 1UB5A 4JFFA 4RFOH 5DD1H 1IT9L 5AG8A 4CDGC 1IAIM 3KJ4B 4K23L 4M5YH 4ODVL 5TDNB 1Y18B 1OGTB 4H5SA 2WK2A 1LILA 3MV01 4XWGL 1Q72L 3SGKC 3FB5B 4DN3L 1YNKH 4MJ2A 1INQB 4RZCA 4DGYH 5E2VL 5D8JL 3U9UA 1NFKA 3JWOH 3TP4A 1O7VA 1P7QD 4C57C 4JRWA 2FR4B 1ZHKA 1YY9D 1IC7H 3GI8H 5TDOA 3WXWH 4NCC2 4KY1H 1QBAA 4KDWA 5AWNH 3O4OC 4ZXBD 2ITCB 4I4WA 4U1KB 4G8GE 3D0LA 2BSTA 3HE6B 4G8GA 2YA1A 5FKAA 5HHMB 1SJEB 4WDIB 2FGZA 1TVHB 2MJWA 3PXJA 1FL5B 1G0XA 3QI9D 1FDLH 1BOYA 3BP4A 2BNQD 3CLEL 3MJ9H 3IFLL 4G9FB 4MA8L 3D69B 5DWUL 2EIZB 4XBPA 4M8VA 4L8CB 2X1QA 1UQSA 3KXFA 5GS3A 3T2QA 1J9CT 5J12C 1EHLL 1D3CA 3BYTA 1CL7L 5FCUL 3FFCA 5IFHL 5J6GA 1T66D 3RWEA 3DX6A 3LB6C 3VXNA 2DKMA 2OQJB 3T0VA 5DUPL 4S1QH 4Q6IC 3OX8A 4V2CB 4JCMA 2C3VB 4KI5D 5C0CB 1ZGLM 3PG2A 4IMLA 1IQWH 1A7NH 1XF5A 3TPKA 1QHOA 3DIFA 4M61A 1K3ZA 4R97C 5DQDL 5I17A 8FABB 1QFOA 4QRTB 2JB5H 4ONFH 3PE9A 4PJ9C 3QFJE 5IB5B 3ARQA 1GAFH 1FFQA 2UUDK 2ADIB 2ID5A 3T1WA 3RIFF 3PWJA 1S7VA 1D9KD 4M6NH 4F3FB 5A2LH 1CFVL 5F9OH 3RIFK 1FFNA 4YBLC 3V79C 4TOYH 1XR9A 2Q76A 5L2KE 4IM8A 3PWPB 2JB6B 1CIUA 5E5MA 4LCWE 2NCMA 3OKMA 4LCWA 4H25B 3MCKA 5AZ2H 3GO1H 3SKOA 1G7HB 3OSKA 5I1HL 3ZE2E 4LLQA 3QHTC 4CMMB 4PYGA 2NY3C 1XT5A 2WIMA 4GMSL 4QHMA 2P5EB 2NY6C 4ZOCA 2HAZA 3SKMB 3BFOA 4HF5H 1P6AB 3Q6FB 1N6VA 3HFML 3T0EB 4GKSA 1CDBA 1HWHB 3G5YB 4LHUD 4LSUH 4YPJA 2JLLA 3FQRA 2IH1A 3HAEG 1Z9LA 3RUGB 5CUSH 1A6ZB 5TQ2H 5ADPH 1RUKH 4IS6A 1ZANH 3V0VA 3MLVL 3RDTD 3D87B 1MHCA 5C2UB 2AK4D 1AXTH 2ZG2A 5DLML 2VAAA 4PRDB 3G6DH 3RP1A 4I3SH 4PB0L 5BQ7B 4L8SA 4NOBA 4YHNB 1MJ7L 5JXAH 5HHPB 3FKUS 3MLXL 3RVXC 3P4MA 2PKDA 4M8QA 3TPUA 2BNRD 5E6IC 5GGQL 2BSED 5ENWB 4JRXD 3QFDB 3NA4A 5EUOB 5ITFB 5IM7B 3X3FL 5SWSB 5BRZE 4N9OB 3GRWA 5DDHA 3X17A 3H3BC 2NY7L 4L4JA 4F15C 3P0VL 3QXAA 2CRZA 1A6WH 3LKRB 5A2KH 4K3EL 3FOMA 4XNYH 5C09A 1I1AA 4HLZH 2NYYD 4HPOL 3E2HC 5J8OA 1UWGH 1RJYB 5DFTA 1E4XI 2BOCA 4AG4H 2WUCH 5GGVY 2YZ8A 4KJYB 4XCEA 4JG1H 4JN2B 1KIUA 1IAIL 4WI5A 1GC1C 1VKXB 2EYRB 1QSED 3O6KL 4AH2B 5ITBH 4IEFB 1WF5A 3WHE0 3IDXH 1IM9A 2IPTH 2NW3B 4IRZH 5C0RL 1EHAA 1YEHL 2EDTA 1HINL 2D4FA 2JJUA 1AQDA 1W0WA 1OVZA 3IDMB 5EZIL 2PYEE 1PX3A 2DS4A 3H42L 4YGVB 4KUZL 2PYEA 3FT4A 3Q5TA 4OD2A 4C54A 2V5MA 3VCLA 5T1LA 5F97E 1WZKA 2P4AB 2WIIA 2RJMA 5E6ZA 5IVXE 3CJJA 5IF0A 5IVXA 1KC5L 1JHTA 1QBBA 2Q3ZA 4GSDL 3LB6D 4JDTH 3B9VA 3EFDH 4DK3A 3HG1B 4ODWA 5AUMB 4LIQH 5BO1L 1QSFD 1DDHB 3C6SA 4KKLC 4NQEE 1MCLA 2V17H 2F54B 4NQEA 1CE6A 3QDAA 1GGBH 3DYMA 1AIFB 4QXUL 5EU6D 1JRHL 2CR3A 4PJ9D 3STBA 3JVGC 5J57B 3LY6A 3MGAA 3HHRB 1A5FH 1WWAX 2V9RA 3HMXL 4Y4HB 5D6CB 5E2UL 2X4SB 4GKNA 4ZPTA 1YJDH 1F2QA 3UEZA 1G9EA 4GBXA 3PV7A 1SY6H 1A1MB 4Z7NE 5I1KH 1S9XA 3BO8A 1TPXC 3NIFF 4U1IB 1KJ2H 2LV4A 1KXQE 2DIJA 3GMRB 2DDQL 4R3SB 5DRNB 4G6JH 1U8JA 1LO5B 2DQDH 3C8KB 2NX5A 1KB5B 3MUJA 1K85A 4QY8B 5DA0B 3BP5B 1VFUA 4GAFB 1JGLL 1OT1A 4P3CL 3BH9B 3IJSB 4Z7VA 4X9FA 1ZT7B 2NY3D 2F53A 5K9QG 5ADOH 2VXUH 2NY6D 5C0AB 1NGYB 2SEBB 3MNWA 2FJHB 2PUQT 5F3HB 5KG9B 3S36L 4R0LC 3PHQB 1ZHLB 5I16B 1FLRL 3L7FB 3IDJB 4MJ5B 4X99A 3W2DL 3MR9B 2GJ6E 5F72S 3GSVA 5I76A 1VGEL 3MRFB 4XMLL 2A6KA 1N7ML 3D3VE 1TFHA 3D3VA 3MLRH 4Y4FA 3NFSL 3KPLB 5H2BA 2BMKA 3JWDC 1H5BC 3AMLA 3O6ML 4KAQH 1XCTA 1IGIL 3N85H 4ZS6D 3B3IA 2Q20A 1KACB 4WW2F 5E7BA 1NAML 1HHIB 3RVXD 3O2DH 2RFXA 4F7EB 5E6ID 2PETA 4M6OL 2X4UB 4OLVH 1U93B 3RY5A 2L4OA 5AYUH 1WK0A 4X8JA 1CDIA 1BHGA 43CAA 1W72B 5FUOL 2R2BB 3QCUH 4YDIL 2QHRL 4JR9L 4X6DA 4GUPB 4AJ0A 1QLEH 3L3GA 5CILH 5D1ZC 1WFUA 3R0NA 2P7TA 2FZ3A 5D2NB 5T1DH 4XT1C 4BELD 2WINB 1HNFA 1BAFL 4M93B 3OJ2C 2ATKA 4J1UB 4FQ1H 4WU5B 5KBNC 5LWYL 1WGOA 4UILL 4PJAA 1UB5B 4JFFB 4M7KH 3LKSA 2BP3A 2APWA 5LXGL 5J89A 2JELH 4TQEH 4NJAH 3U30B 4WEBL 4RMQA 3ULUF 5E00A 1URLA 1JUFA 4XBEH 4AEEA 4H5SB 4ZXBA 1KXVC 3REVA 4D3CH 3VE0A 1PYWA 1CDGA 1HIMH 4RZCB 4XPAL 1QFWI 3U9UB 5DEGA 3QI9A 2GY7B 4PRIE 3S7GA 2FJFB 2BNQA 1KLFA 1YC8A 2UVFA 1EAJA 3F58L 4PJ7A 4NKQB 3OAZK 4OV5A 5TDOB 2DI8A 4PREA 4S1SH 4I77H 4YUEH 5HYJE 3LH2L 4I4WB 1ZHBA 5HYJA 3GZKA 1FH5H 3D0LB 2BSTB 4CVXA 2I60H 4G8GB 3U46A 2EH8L 2MQ0A 5FKAB 2HWZL 4NM8H 3GMLB 4JREC 1Z3GL 4KKLD 5GHWH 2H3NB 5KANG 3BP4B 4PB9L 1U3HC 1T0NA 1UXWA 4XP5L 1M7DA 4F8QA 4M1DH 5FF6A 5F7UA 4M48H 2EEAA 5MEOA 4XBPB 4Y16B 1UQSB 3KXFB 4RWHA 3CU1A 1JWUA 2ICWA 3FFCB 1X4XA 3MRRB 4K55A 2ADJB 1OP3K 2XWJA 3RWEB 1EVUA 3DX6B 1UJ3C 3VXNB 3KS0H 4QLRA 1KEGL 1ZHNB 2FO4A 3I9GL 5GGSY 4NOFA 4P23C 4HCRA 5MERA 2J8UE 3OX8B 3AFLA 2VDPL 2J8UA 3UYPA 5GISH 3FN9A 4Y5XC 4KVNH 1XF5B 5I17B 3DIFB 1AGFA 4LQFH 3LQMA 1B4JH 1D5XA 3B8YA 3FAXA 4OLZL 3RWCA 4Y5VA 3DGGA 4HQQL 4BM7A 1AJ7H 1V7ML 4PYHA 4R2GC 1HEZA 3MRHB 4XNUH 3VG9C 3QFJB 3CSYA 5CCKH 3TGXA 4JN1H 1I7RA 4XCNA 4NGHL 1ZK9A 4ZOBA 2IFFL 3KYAA 4OUOA 1S7VB 4U1JA 4JO4H 3IFNL 1FFNB 3UTSD 2Q76B 3KLDA 3UTTE 1K3IA 3OBAA 1RZFL 4LHUA 1UENA 2DLHA 1RIUH 5E5MB 4RFEA 3OKMB 4LCWB 2NLJA 2WWMC 3FQNA 2G75A 1UEYA 4LLQB 3U9PL 5DT1H 1XGTA 1NJ9B 4QHMB 3O6FC 3OKLA 3RDTA 4MA7H 2KH2B 5DD5L 1FGNH 3U7AA 1TTFA 4YZFE 2X70B 3UJJH 3W82A 2OXHA 1JPTL 4GKSB 4ONGL 1KEML 2VLMD 3EYUL 1BQLH 3FQRB 2CSPA 3S96A 1JPSH 4Q0XH 1HQRB 2CKBA 4QNPF 4XPGL 2PTTA 4MAYA 2VR5A 3BHBA 3O41A 2EIDA 2BNRA 2EDLA 2IBZY 3V0VB 4HX1A 4JRXA 5D1ZD 2WNGA 5EUOF 3T3ME 3TJHC 4DOHB 5BV7C 1DSFL 1MHCB 2VQ1A 4YEEA 3S4SG 1MEXH 3W39A 3MROA 2HH0H 1GIGH 3FONA 32C2B 2VAAB 1OLZA 3BKCL 4L1HA 3O8XC 3SGKA 5IESL 4PGJA 3OPZH 4P2QE 5FYKL 2APFA 4FXGA 1BBDL 1QBLH 4EEEA 4P2QA 1R3JA 2YS4A 4UTBL 4YEFA 3P4MB 2NW2A 3HCVA 4M8QB 3HE7B 1BF2A 1BQHA 5I8KL 5FM5M 3ZT5A 3RX7A 5E8EA 4G6KL 3GBNL 5B3NA 1A22B 3B9KB 2VABB 4JFZL 5DDHB 4JDVA 4QYOB 5BRZB 3U4AA 4QEGA 4K7FB 1ZT4A 2V2WA 3FOMB 5GRYA 1I1AB 1LEGA 1SMAA 4HWBA 3HUJE 3D18A 5CEZH 1BX2A 5A2JH 3MLWH 1U8OA 4NZTL 2BOCB 1S5HB 2ZCLH 1JNJA 3NPSC 1CFSA 4XCEB 4OKVA 2V5RA 3QSKB 5TFSH 1NSNL 2YC1A 1F4HA 4N8VG 4K8RL 5KANI 1MJ8L 5INDA 3AREC 1VGKA 3ZL4H 1IM9B 4M7ZB 4P59L 2GTZB 1ADQL 3TYGL 3KGRA 3PQYE 4P9ML 2I5YH 5ACZA 3EO0A 1AQDB 3QJHA 3PQYA 1MFAL 1IEAA 4XNXH 1W0WB 1ZLUH 2EDJA 1UH3A 1WWWX 2W9DL 4JO2L 7FABL 4Q6IA 4ZDHA 1U3HD 5HGDA 4D8PB 2D7TL 4P9HH 1VENA 1QSFA 2PYEB 4OD2B 2AI0L 1F4XH 5DC4B 3VCLB 3TH2T 4Y2DC 5T1LB 3VWKA 2WIIB 2C4FT 3ZDZF 3DVNB 5IF0B 5J1AB 5ACLA 5D96C 5IVXB 1JHTB 2WUBH 5EU6A 1A2YA 1SEQH 1SJVA 1QLRA 2NY1C 5HHXH 3CZFA 1OGAD 3RVVC 2OR7A 4P23D 5KSBE 2FX7L 1NQBA 5KSBA 1AC0A 1UGNA 2AQ3A 2W65A 3C6SB 4JANB 4JHBA 3WNOA 3CX5K 5CSZA 4NQEB 2CDGA 3MA9H 1CE6B 3HRPA 3DUHA 3MFFA 4ZQKA 4B7IA 4R2GD 5ISZD 1UZ8B 3K46A 1DBJH 4NO0D 3ZHLA 5AAWA 4GKNB 2B0SH 4GBXB 1AQKH 4J4PC 2RQ8A 3FFDA 5I73C 1UXSB 2B4CL 2XPGA 1EHXA 4E0RA 3U4EA 1S9XB 3SJVD 4Y4KC 3G5VA 1GCFA 4MD4B 1JHLH 3GBMH 4PJFA 5JOFB 3VFWA 1JYVA 2IALA 2NX5B 2WWMD 4J3OC 1FN4A 4ZO7A 4BA8A 2ERJB 1UM6H 4Z7VB 4DQOH 4JFYA 3ULUL 1A8JH 2ADFH 1NCNA 4P2RE 1GOFA 3DETC 3DURA 3THMH 4OM0L 3O6FD 3PGFH 5ICXA 4HBCH 4NNPL 4QRPD 1A6UH 1FC1A 3MNWB 4DN4H 2G5BA 3IGAA 1OAZL 4BFGA 4QF1A 5C0JA 4G6MH 2IG2H 1TXKA 5I1CL 1P84J 4ZFOB 2RR3A 2WLYA 2W91A 4EIGB 4M6ML 4X99B 2VRAA 3OR6A 3GSVB 1F58H 1FL3B 5DD6A 3TJHD 5I76B 1Q0XL 5E2JA 1F4YL 2A6KB 1PD6A 4XP1H 2YK1L 3D3VB 3QUYC 4Y4FB 4MJIE 5SV3A 5B3JF 5H2BB 3O8XD 1NANH 1J87A 4YQXL 1KCVL 4MJIA 4MLSA 1XCTB 3IU4H 2ARJA 4LLWA 2D7PA 3B3IB 5DYOA 1SJHA 3NABH 2HYMA 3VFRA 2RFXB 4GAJH 1NCWL 5C86A 1OOAA 2CXKA 4E9LA 4KDTC 1DEEA 4X8JB 4YPGB 43CAB 1S7WA 3V4PL 5IHLB 1QHPA 2OMNA 3SDXE 1CF8L 5FUZH 5J3HC 2JE8A 4X6DB 3SDXA 3RAJL 4H1LG 3WDHA 2P7TB 4YHMH 5F7WC 4PV9A 2CIIB 4Q2ZA 1HQ4B 1FNLA 3ESVF 5EIIA 3BZ4A 3VFNA 3IETA 5J7CC 4PJAB 3LKSB 4HXBL 1U8NB 5I75C 3JV6B 3ARED 2HKHH 3RWGA 1FSKC 1E6OH 1BZ7A 5T3ZL 1JUFB 4XC1L 2B2XL 4ZXBB 3REVB 1TNNA 1Q9LA 4TUOA 3VE0B 3AY4C 2A2QT 4NWTL 1RY7B 3U7YL 3MNZB 4MB4A 4Y2DD 5DEGB 3VFGL 4DCQB 3QI9B 2OJEA 2P8PA 2BNQB 2BNUA 1TJHL 4ZMAT 4GMTH 1GL4B 3HC0A 3MLSH 4U0RB 2B39A 3CXDH 5K93A 2NY1D 4KRNA 4WIQA 3WN5A 5HYJB 1ZHBB 4HKXB 3RVVD 5F93C 4CMHB 1P7HL 2DN7A 4CVXB 4WHYH 4EUPG 3U46B 5FV2A 4Q58C 3BAEL 5E2WH 4F58L 1PGRB 1NFIA 1C1EL 5D7IE 1T0NB 1UM5L 1M7DB 4MXWL 5D7IA 5FF6B 5SX4H 5DJAA 5MEOB 2EKJA 1OF2B 1U3YA 1A7OH 1A9EA 5HYSA 1JWUB 1CBVH 1FQ9C 1FL6A 3PGCA 2HT2D 2Z8RA 1KIPB 3LQAL 1F45A 2XWJB 2DM3A 3IFOA 1K4DA 2FX9H 2FO4B 4Y4KD 2PR4H 1XEDA 5MERB 1MOEA 4JO1H 3QH3A 4R0LA 2J8UB 3EYSH 3GSNH 2YD1A 3B9DA 2XRAL 4MB5A 1AGFB 1F11B 3UTSA 3QUMA 1D5XB 3RWCB 4WI7A 4Y5VB 3DGGB 3RZWA 1MCCA 9CGTA 1HEZB 2A9MH 3DETD 5BW7A 3WFZA 1T3FA 3CSYB 2R0KH 4XRCA 4XCNB 1I7RB 3ARRA 5IBUG 4ERSH 1IC5L 2OL3A 2BY1A 1T89C 2W0LA 4JY5L 3ZDXE 4DKFL 1XF1A 4U1JB 3QDJD 1H5BA 1PSKH 4ODUA 3JTTA 1YEDB 3UTTB 4LHUB 4HS6A 5JOPD 5F6HJ 2WP3O 1MRCH 5DURD 3L1OH 1MHPL 2NLJB 5I2IA 2A1WH 3FQNB 2G75B 1KCSH 3TZVC 3QUYD 1QBML 4NBZB 3SPVA 4K7PX 4F2MA 3ZTNL 1XGTB 3RRQA 5L8KB 5D1ZA 3B9AA 4NKOA 4HC1H 1U6AL 5B39G 1NH6A 4Z0BH 1EEZB 4LMQE 1JGVL 2H32H 3S96B 2CKBB 4KVCL 5I1GH 4X9GA 1YA5A 2PTTB 4MAYB 1K9TA 1RFDL 3EIFA 4AIOA 3O41B 5J3HD 1FIGL 2BNRB 5CJ8A 1CXIA 1WFOA 2OJZH 4HX1B 2BJML 4JRXB 3VRLE 3UTZA 3PV6B 1VPOH 4U2YA 4UBDC 2VQ1B 3W39B 3MROB 3FONB 1IGMH 3A6OA 5EIVA 2F5BH 3GFUA 4L5FH 3BKJH 3QIBC 2ED7A 2IBBA 3JBG7 5MHSD 4FXGB 3P40A 4QRUA 4YBQC 4I2XA 4P2QB 5CSGA 1QR4A 3FN0L 4XMKH 4JHWL 3QCTH 4DUXA 1Y0LB 1CN4A 2ZUVA 1B2WL 3QJFA 1L6ZA 4JJHA 4FQXA 3UC0H 1MCPL 5E8EB 1UZ6E 4P5MA 1WZMA 2BC4A 4L9LC 3I6KA 3K2UH 2F9BT 2Z9TA 1V8HA 4Z6AT 1ZT4B 3PJSA 3O3AA 1B90A 4PJEE 4JY4B 4KJPC 4LSPL 1LEGB 4G7VH 3D18B 4FFVC 1U8OB 3BZFA 3HUJB 1U3HA 1YY8B 1CFSB 3ARFB 1ZXQA 4OKVB 2YC1B 4WGWB 2ZUTA 1G7QA 3LN4B 4EI5C 5INDB 5J12B 5IVXF 1VGKB 4D0BA 3BPNB 1UJ3A 4OZGE 3EO0B 3QJHB 1RVFL 3PQYB 1IEAB 4J6RL 4XPBL 2ATPB 4P23A 4UAOC 4Q6IB 4WFGD 5HGDB 5I8CA 1MAJA 1CLZL 1QSFB 4C55A 3TN0C 1YJDC 4LP5A 4UV4H 4NJ9H 4UV7H 3VWKB 1BJ1H 2IANE 4FQIH 3DYPA 2IANA 4POUB 4WFFD 3RKPA 5ISZA 5CJQL 1QLRB 2P43B 1HI6B 4NO0A 1I85C 1BECA 2FLBT 5L7XL 1W72L 1PEWA 3P30H 1XGRB 3ILPB 3U4BL 1K6QH 2ZP0T 4Y7MA 5KSBB 3LCYA 1A6VH 3GSQA 2E9JA 3VFMA 1G9ML 2W65B 5L6YH 4OD1L 5TQ0L 4YBLB 4MHHG 3CH8A 5CSZB 4F7MA 2CDGB 4XBGB 4XVSH 3SJVA 4YX2L 1OD9A 4GKOA 4O58L 5KTEH 4ZQKB 1OB1A 3ZYJA 2EH7L 1KJ3H 1JNNL 5E8NA 5L2JA 3S5LA 4U3XA 1QFWM 4PJ5E 3IAGC 4TNVF 4Z7VF 1N6QH 1OAXL 3FFDB 1M6OA 4TNVK 1A7QH 2X4TA 4E0RB 3L3DA 3O6FA 3CDYA 4NC1E 3VH8A 1GYAA 4QRPA 2NY6B 3ET9F 3G5VB 1UA6H 3OKDB 2FDBP 3LQZB 3ULVC 2RCSL 1FRGH 4PJFB 2QSQA 4ESKA 1KIRB 4XCCH 1J18A 4OTXH 3VFWB 2IALB 3T0DA 3NIDF 1FN4B 3BGFC 1V7NL 4LCIL 1IGJA 3ZSSA 4FRWA 3BN9C 4WI2A 3TZVD 1MAMH 4WFED 1UH2A 4P2RB 5ICXB 4AL8H 1AFVL 3ZT6A 5EZLA 4LFHG 3TA3C 2R4RL 3IGAB 4EVNB 4MNQD 1GGTA 4OJFH 4XHJC 1ACYH 1NGZA 2O5ZH 4BSJA 5C9KA 5CGYC 4F7CA 4JQXA 4H0IA 2CQVA 4ZOAA 5DGRA 1J0ZA 5SX5K 3OR6B 1DLFL 4CVZB 4ZTPH 5DD6B 2DJSA 5GGTH 4UBDD 5E70A 4EOWH 2GYSA 3QUXC 4TVPH 1QD0A 4XB7A 4X6DF 3WXVH 3VGAC 2K9UA 3QIBD 4MJIB 3EOTH 3MRNA 2A6DA 4LLWB 5DYOB 2CPCA 4PJXA 1SJHB 3C2AH 3E2HB 4U1NA 1MJUL 4M1CC 3OJDA 2CLVA 4LMQI 4TPRH 5DA4A 4HKZA 2D7MA 2XQYG 4ALAH 4YGAB 4PJAF 1Y6NR 1DEEB 1F8TL 1S7WB 5DZNA 3CVIH 2ORBL 5HYFA 3SDXB 4XVJL 3TH3T 3T1FA 5BXFA 3F5WA 3Q5OA 2A9NL 4DK6A 4EDWL 4KJPD 4PV9B 4FFVD 5FCSH 2W9LA 5F7NC 1A1NA 3VFNB 3IETB 1UFUA 3H9YA 4Y2DA 2WW8A 5FYJH 4EI5D 1RUPL 1DQDH 2EDBA 5I0DA 3RWGB 1QQDA 3RA7H 4PJ7F 1P4LA 3QWRD 1BZ7B 1A7PL 4LLDB 4QTIH 4ZYKB 5EA0H 1AO7D 3LVEA 4JCLA 5TF1L 5TE6L 4C59B 2VLRE 2XTJE 3MCLH 1W8NA 5I71B 4F7PA 4TUKL 1Q9LB 4TUOB 1F4WL 1WSST 3TN0D 1CXLA 2AEPL 1HN1A 4DFIA 3WIHL 1OAYL 4WTXA 5C6TL 2OJEB 2VXTL 3CVHL 2W9EH 2BNUB 4FOMA 5FM4A 3LKQA 2AQ2A 3HC0B 4DFHA 2VDQH 3LIZL 1XZ0A 3QEQD 3HNSL 1G6VK 4Q74A 3WN5B 5JZ7C 2ZZUT 1H3PL 5D2LF 4L3ED 3OTTA 2HLFC 2IQ9L 4J4PA 2XY2A 3I50H 2XZQL 1TPXB 3MSPA 4Y4KA 1NFIB 3AROA 3LZFH 4V1DD 5E8DL 5J11C 5DJXA 5FIEA 3NCMA 2J8UF 5D7IB 3EYFA 5DJAB 3ARZA 5BVPH 1HSAA 3H7BA 1BVLB 4HHAA 2BVQB 4S2SB 4UUJA 1AHWB 1T22B 1A9EB 5HYSB 2YMXH 2JJTC 3WE6A 2YHGA 1FL6B 5I1JL 3PGCB 1S7TA 1D5IH 1BFTA 3A67H 4IBLT 1K4DB 4OLYH 3IS1X 5L0QC 4HWNA 4UT6H 3GRWL 4OB5L 1JHKH 2VDMH 3ULVD 1BJ1J 1QEWA 4R0LB 5KVMC 1HXMA 3QIWB 3S88L 3QDJA 3HNVL 3NZHL 3QUMB 4JM4L 1KENL 1UCBL 1QFWL 3BN9D 4OZIE 1VFOA 3QIUC 3M1BA 1FZMB 2KL6A 3UO1H 3HNTH 3OAYK 4HUUB 1T1XA 3N9GL 1CGYA 3CSGA 1ZT1A 4XRCB 3D39D 1IEBA 5F7KC 2OL3B 3TA3D 1EXUA 3QUYA 4XHJD 1EVTC 4FZEH 1L0YA 5JQ6L 4TSBL 2DQJH 5CGYD 4ODUB 4U4BA 3JTTB 4PRPE 4ISVA 4QTHA 1FIEA 4HS6B 4PRPA 4K94H 5HDBF 4KK6C 4KXZH 1FO0A 5EZJB 2NXZB 1L9NA 2WM0A 1ZGLP 3PHSA 2BRRH 3QUXD 4FHBD 4F2MB 3SPVB 2FEEI 2KPNA 5EU7C 3GMQA 3QQNA 4DKEH 4X4MA 5D1ZB 4JGJA 1IARB 3HPLA 4NKOB 2VC2H 5FO9B 1CWVA 4M1CD 3S36X 3DWTA 4F57H 5JW5B 1KCUH 4LOUC 2F58H 5HDOA 1DVFA 2KKQA 1E28B 3P4NB 2CDEB 5KW9L 1RMFL 3EDEA 3V5HA 5I74C 5D1QC 5CEYA 2KZWA 1NUDA 4G3YL 5GS2H 4WTWA 3BP7A 3ARGC 1AXSA 3L7EA 3UTZB 2E8YA 1X7QA 5TE7H 5BS0D 2L0DA 3MJ9A 3NH7L 3BWUC 1XH3A 5TF0A 5E8PA 3PL6A 4HIIA 3OV6A 5K9KA 3AY4A 1KLGB 1PY4A 3PP4H 2BHYA 4QRUB 3DUUA 1PKQE 4LU5L 4RGNC 4P4KC 1PKQA 1RHHA 1XF2A 4Z8FL 1UWEL 3QJFB 4FQXB 4ZUUA 4BUHA 2FGWL 1IFHL 4P5MB 2BC4B 3DNKA 3I6KB 5BZDA 4YK4B 5FYLH 2UYLA 2VXVL 2FO1A 4NRYA 2XZAH 3ARTA 1FNAA 1QYGL 3O3AB 3PJSB 4HAGA 4PJEB 4JREB 3MJ8A 3BUTA 3BZFB 5JA9A 5L9DH 3MRMB 4OF8A 5DC0A 3AB0C 3CLFH 1FVDA 5D93C 1YECL 1AGCA 1RIHH 1U8QA 2H2PC 1YEEL 4Q6YA 1P2CB 4ZFOL 1LD9A 4JM2B 1G7QB 5JZ7D 1LDPL 2VN7A 4WHTA 4FQPA 1Q8MA 3H9SD 4NO2A 5KSVA 1FNSH 4PLKC 4WFFE 2HLFD 4D0BB 3L6FA 3QEUB 3ZE0F 3FCTA 1CI5A 3B2VH 3MV9D 3GHEL 1KPUA 1UJ3B 5H8DA 2YD3A 2UZYB 1FYHB 3FQWA 1AGDA 4P23B 4XPHH 1T1YA 5I8CB 1FCGA 4LVNB 4JO3L 5FHAH 4BQBA 5JDSA 5ACMA 1H8SA 2GI7A 1NDGA 3ZHKA 4L1DA 2IANB 4BSWA 2R0WH 3OKEA 1E4XH 1ZEAH 5ISZB 4NO0B 4X6CA 5HYIA 3CU7A 4KZEH 4ZFGL 1MVUB 4GAYA 3OKNA 1EEUA 1FG2A 1T89A 3OAUL 3GSQB 4JFDE 3SGDI 2HJFA 4KTDL 2GAZA 1RULH 2F5AH 1MCBA 4OFKA 3SJVB 1F3RB 3JUZA 3NAAH 2ZSVB 4WCYL 4D9LL 4PJFF 1OB1B 3QIUD 1RPQA 3MJ7A 1OY3B 2XZZA 5E8NB 4LAQL 1H15A 3V4UL 3U79A 3QQ9C 3MRGB 1NLBL 1IGFH 3S98A 3TZVA 3VXPA 4M4PA 5MEPA 1ZE3C 4O2EA 4PJ5B 2M26A 3ELAT 1M6OB 5A43C 3OF6D 2X4TB 3L3DB 3O6FB 4YHLH 3VH8B 3V8OA 1H0DB 3A6BH 4WUKH 2DQHH 4NIKB 3R1GH 4UIMA 1EO8L 3VD7A 5JQHC 4KK6D 2Z8VC 4E41E 1MRDH 1IGJB 5D7JC 4R26L 4NT6B 1RAMA 2D3VA 5AZEL 3CLEH 4UT7L 4GW1A 4F7TA 1FYTE 4DGVH 1A6PA 5C3TA 2CD0A 5EZLB 1FNGA 1EH9A 4ONHB 4Q9QL 4LOUD 1RZKL 2X4OA 2HN7A 3BT2L 3SE8H 3QIBA 1NPUA 1Q9KA 3DVGA 5JIPA 3PDGA 2M1KA 4Z0XB 4F7CB 2VH5L 2AK1H 3C8DA 4XXDA 3GJFH 5D1QD 2AGJH 2BZDA 4QHKJ 4ORGA 1F6LL 3ARGD 5D7SL 3C09C 4GH7B 3ZKSD 4HK3N 3VXSD 4LEXH 4DJMA 3DSFL 5EOCH 3SO3C 2DKUA 3TYFA 5I30H 4YFDB 3Q48A 3GBLA 4OLWL 4L9LA 2DYPB 4OCNC 3TVMB 4HLZG 3MRNB 5FAAA 5I15L 1XGYH 4JGMA 4J23A 3H3PH 4LPWA 4PJXB 4RGND 4HCRL 2CLVB 4P4KD 3HAEH 5E5UB 1KELL 1IGCH 3NCCB 3QEGH 3MO1B 4YWGH 4XCFL 2H1PL 1KCRL 4LIQE 1KNOA 3EFFA 5F71A 1HZHH 4B53A 1I9JL 3QQ3A 1F42A 4EI5A 1Q9OA 3SOBL 4OKDA 2Q8AL 5DD3H 3T1FB 3F5WB 3EUUA 3QWRA 2YD6A 3N1GC 3K80A 1AO7A 1QR1A 3CFBA 2OBGA 2Z31C 2YPKA 1J1OL 1QO3A 1A1NB 1B0GA 1T2QH 2FLRT 2NXYC 1DTUA 3TN0A 1CT8A 2OP4H 4GMSH 2E8ZA 2VZSA 1E4WL 4Y2DB 1SY6A 1DBMH 5IB1A 2ZCHH 3T2OA 3QCVL 5D6DA 4KK5C 5T1KD 1QQDB 4PLKD 1KFAL 5D96B 3RU8H 1P4LB 3QEQE 2NY4C 1KJ2A 2NY1B 2QQLL 3QEQA 4CRPA 1I85A 3BJLA 1CE1H 1TZGH 4FTVD 5DRXA 4L3EA 4F7PB 1TJGL 4PJHA 5IT2L 3U48A 4V1DE 2MKLC 4V1DA 1KTRL 3LKQB 4L3CA 5D7IF 35C8H 4PB0H 3JV0A 3V4VH 5KAQF 4ORZC 2CKBL 5IB4A 2FD6L 3DARA 2CJUH 1MJ7H 4TSCL 3O3UN 2X4NA 4JKMA 4HUWA 2A6JA 2B1HH 5I73B 2V7NA 2CK2A 1E0OB 3D1MC 4AENA 1QFUH 2AJSL 5C0IB 5JIKA 4Y4KB 4PJDF 5D7LD 3VXME 2DQCH 5KVGL 3QUZC 3VXMA 1RIVL 1JGUH 2FATL 3B8SA 4JVWA 3BDYH 3EYFB 1HSAB 3H7BB 4HHAB 4UUJB 4IHOA 2R69H 1YMHA 2ESVD 4HS8L 4MQ7B 3CC5A 3WE6B 4XP9H 3W5NA 3MOQA 3QZWA 2A38A 4KHXL 4RFNC 4FABH 3WSQH 2CLZB 1DL7L 3CUPA 3CFJB 3O2DA 2J1KA 3O6KH 1QEWB 3KJ6H 2FHFA 1HXMB 3QDJB 4C56E 4HWBL 4L8DA 2ZSWB 3EJYC 4U1GB 1NCDL 4C56A 1ONQA 5D7JD 5GJTH 4L8BB 4Q9CA 4LQ1A 1Z5LB 1U3ZA 3CPLA 5HHVL 1PG7W 4EJ1C 1J8HD 3B5HA 1IGYA 2NZ9C 3FRPG 3M1BB 4OZIB 4KUZH 1K5NA 5DURB 1PLGL 1T1XB 3UZVB 5EBGA 4FQHA 4M7LL 2JKXA 5DR5L 5IEKA 1FPTH 4TUJA 3ES6B 5E9DE 1ZLVK 2Y36H 3S9DB 1DQLH 3QUYB 5E9DA 2CXGA 15C8H 3QEHA 3UTPE 1RUML 4K07A 4YDKH 2FX8H 4GSDH 5F6IC 1BQHG 2VSDA 4KJQC 4RAUA 4XMPL 4GRWH 5M95B 4KRPC 4LLMB 4QTHB 4PRPB 1ZLWH 4X5WA 5C6WH 4O02L 2D7OA 1FO0B 2X09A 5FHBL 1A14H 1QG3A 3WV0A 4IJ3B 3A6CH 5EG6C 4GG6A 2BHZA 2VKXA 3GMQB 4N8CL 2DWEA