3IVKA

Crystal structure of the catalytic core of an rna polymerase ribozyme complexed with an antigen binding antibody fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
SEVQLVESGGGLVQPGGSLRLSCAASGFYISYSSIHWVRQAPGKGLEWVASISPYSGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARQGYRRRSGRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system / rna
molecule keywords Fab light chain
publication title Crystal structure of the catalytic core of an RNA-polymerase ribozyme.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 224
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ivkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ivkA01
3DRQB 3EO0A 5J6GA 2FR4A 5AAWA 5KZCB 2IF7A 1AHWA 4BJLA 4P46C 4MAYD 3PV6A 2CO7B 2PR4H 3RY4A 1TTUA 3HAEB 1PGRB 1H3UA 4UDTB 3BPLB 1NCCL 4AEEA 4GLRI 1A1NB 3I9GL 1ZLVH 2G9HB 1TVDA 2R1XA 3JV0A 4L4VE 5GRVL 3I3EA 12E8H 1FJ1A 1MLCA 1RUMH 5B21A 3PGFH 1XGRA 4G43B 5IFAL 1MELA 3LQZB 5DJXA 1SBSL 3KNBA 1I8MA 1KOAA 3ROOA 2AJXL 3NAAH 4AIZA 2HT2D 2X5PA 4YXLL 1UG9A 1F11B 1G6RL 3L3DB 3KYOB 4FP8H 5JLZA 4ZOBA 4F80A 5ENWB 5I71C 2OTPA 2YA0A 5L2KA 5JIPA 1ZVSA 4ZO6A 3MV8D 3V8OA 2PYFA 5CINH 1NFIA 4JY5H 1CFQA 3NIFE 2MKLC 4RFOH 5K9JL 3L3HA 4XMPH 4M7LH 5F88A 3L95A 2VDLL 1HHGA 4KTEL 3F7VA 2SEBA 5D1XD 1RIHH 1HSBB 3WKML 1I8KB 2C3WA 1NEZA 2R69H 2DKMA 1HQRB 3JWOH 2H6PB 4OLUH 1EHXA 3MO1A 1A7RL 2EDJA 2KL6A 4PJHF 5GRYA 1DQJA 4OLZL 4OM0L 2FHCA 4HFWA 1R3LA 3K0WA 5IB3A 4Z8FL 5EOTA 1NAML 5ESQB 5I1KL 4KJQC 5FDWA 3BKJL 2OZ4A 5ADOH 2AJUL 3MODL 2QADD 2LFGA 4YHML 3DSFL 1DFBH 1VGEH 2XYCA 3M17B 3E2HB 4HDIA 2HKHH 4ZO9A 4YHNB 4S1SL 4NZUH 4KKLC 3V95A 1I1YA 3DROA 3WD5L 1P7QB 4BELD 1VESA 1MCIA 1OTUD 2OJEB 4JHWH 9CGTA 4LPUA 4F8QA 2AEPH 4JQVC 1KPVB 5HI4C 4WI4A 1JYWA 5DJAA 4O51A 4XZUB 3SE3A 4ZUTB 4XP9H 4CBPA 2ZUVA 3GIVB 1RZJC 1ZXQA 4Y2OA 4RISL 3NIGF 1OAZH 1WZMA 4X9GA 3VMOA 1CFSA 5EG6C 5BRZB 1MQKH 5IW6A 4WHCA 4LBEA 3UO1L 3W11D 5E6IB 4D0DA 1MNUL 3RL1B 1EHLH 3ARDB 5I1EL 3HUJA 1G7PB 4U7KA 3KJ4B 3FFCE 4JY6B 2BC4B 1H3TA 1N5YL 1PZ5A 1KTKE 1OB1B 4HK3N 4R90H 4MNQB 1ZT4A 5HHOA 4ZUWA 1MCJA 2HN7A 3LEVL 2BSTB 4EI6A 4RAUA 2FJHA 4E0RA 2GT9B 1Q9KA 4D9LL 1XH3B 4XTRC 4P2RA 3FL7A 2J8UE 3G08B 4R4ND 3SGEH 2VITA 3C5ZD 3SKMB 3BZFB 2X70B 4X7CC 5D6CA 2B2XL 2EYRA 3JWNC 2FD6H 4RAVA 5CD5C 4OQTL 2BVOB 4HKBA 4YUEL 1G7HA 5E5UB 4OD3L 1A4KB 1PD6A 3O2WH 4X5WA 1FNSL 4ELMA 4RGOL 4L8CB 2ERJC 4AL8L 4WDIB 4WHDA 3N1FC 4R8WL 3V6OA 4UTAH 3AB0C 4UUJA 5DUPH 4M6AA 5ABDE 1C1EH 3I6GB 3WV0A 3A6OA 3GUTB 4QRRA 3QUYA 4DJMA 4K9EH 4U6HB 5D93B 1JRHH 4P2QD 4Q7DA 3FFDB 5TQ2H 3V4VH 4I0PD 5LBSL 2XWTA 4ZPVA 4S1DD 5HYJE 3EAKA 4Y4HB 3QA3B 1FBIL 1SYVB 3RWDB 4U1MB 4DKAA 5TPWL 5GS0D 5DFVD 1Y18A 3AREB 2UZYB 2Q1EA 5AYUL 5DTFA 1UH4A 4LAJH 2W59A 1AGCA 1RUQH 2P24B 3GGWB 5K9OB 4PRNA 4WU5A 1MHHA 4KI5F 4H1LA 2F19L 1F4WL 2I60L 3FT2B 3W0WE 3QEQD 1KCUH 3ARVA 3TA3D 1WZLA 5D5MB 4HJGA 4N1EA 1T2XA 3OGOE 4I48A 1BD2E 3O2VH 4KDTA 3B83A 5C6PB 4ZUSA 2EE2A 4HS3A 2FO4B 5HTSA 5F9JB 1M4KA 5HGAB 3ETBF 4M1CC 4I18A 4PY7B 3SDXA 3MRCA 3W9EB 4P0DA 3DVFA 1MUJA 3D2UB 3MRNA 4WI6A 3OKEA 5GHWL 5D2LA 2MMXA 2YKLL 5HHME 4UINH 3U0WL 4M6NL 3QYCA 4PJ9D 5GGVH 4JO4H 5IFJA 3CSYA 4P9HL 3BDYH 2CH8A 4PG2A 2P8PB 3LY6A 4S2SB 4UOW1 4XB8A 3MV8E 5JO5A 3RVUD 3QJHB 5KOMC 3MSPA 2BX5A 3G6AA 3QFJD 3RZWA 2JELL 2FECL 4N0CC 3F7PC 5DRNB 2LVCA 4U1IA 5C09B 1AQDB 4OGYL 4LAQL 4DN4L 5IVOA 4XWOD 5HD8D 5I8EB 2R0WL 1FGVH 4X5XA 4NWTL 1MCWW 3FCTB 3GSRB 3DUSB 4CVXA 1XMWA 3CXHK 3ARYA 1K8DB 3LH2L 4NFBA 5IG7A 4CAGA 5D71L 3JTTA 5GQBA 4PJFF 3GMOB 4HCRA 4LVEA 3DWTA 1FNEB 1BWMA 4UT7L 1F4XL 5C08D 2FHBA 3LSOA 2VZVA 3NZ8B 3V0VB 4P5TA 1KTRL 5F6HJ 2FWOB 2E7LA 2NY4B 1A2YB 2A1WH 2A0LC 1HINL 4FXLA 4XX1G 2ZG3A 4LSQH 4Y4KC 1U3HB 1U8OB 2IPTH 2VR9A 3PQYD 4NHUA 2R2HB 2GK0A 4ODSL 2R29L 3RIFF 1EJOL 4OCRH 4OCWL 1HNGA 2AXHA 5TF0A 2DJSA 3TZVB 4NUGH 1MFCH 3MV01 1NCTA 4MA1C 2B5IC 1A6TB 2AK1L 3B43A 4P59H 1DVFC 2FX8H 3LQAL 4K7PL 5FIEA 4Y4FD 4MXWH 1I9RL 2HTLC 2NCMA 1S5IL 5A16B 5T5NG 3Q3GA 3T4AA 3UTSA 3GZKA 2VRAA 2IAMB 4AJ0A 3QULB 5FUZL 3GIZL 2NY0D 3EYOB 3GFUA 3BP6A 1EEUA 1NJ9A 3TBWB 3M8OL 3MFFA 3EBAA 2W9EH 4IJ3B 1W72A 1KLGB 4XPTH 2O5XL 5KG9A 1R5IA 3EZJB 4WCYH 4OLWL 5D7IF 4UILH 1RIUL 1MCCA 1X5JA 1I7TB 3VFOA 5J1AA 1KIUA 4ZODA 3CDYA 4GUPB 5DO2D 5CZXC 2IGFL 4XCEA 1OT2A 5HVHB 1ZT1A 1MFAH 1A7PL 4XNQA 3WFDL 3GSUB 3VXUB 3HE7D 1EPFA 4ETQA 3LS5H 2ZUSA 5AD0B 2AKRB 3MRPB 1CIUA 1JN6B 4IIQB 4JFDE 2EC9U 2HJLB 4P2OD 3LD8C 1D6VL 3DX8B 3FO0L 1P4BH 1RVFL 4ZQKA 1RUPH 3RNKB 5GZNC 2A74A 3PGCA 3E3QC 5E2TH 2A77H 4K2UL 5T3ZL 3SKUD 1UT9A 1XGQB 1QBLH 5JW3H 5TDPA 4GRWB 2W0FB 2OP4H 1SQ2N 1C5DA 1F42A 5TH2B 4DCQA 2IWGA 2CGRH 5GIRB 1UM6L 4V1DA 4P46A 2HFGH 4OKDA 4KI5D 2X9WA 4HPYL 2A6KA 3Q5OA 3MNVA 3RIFK 3EO0B 5J6GB 1JF5A 3NPSC 2GAZA 4PV9B 1KULA 1F58H 4WFEE 2QSCH 4MQSB 2ZG1A 1OM3L 4Q6YA 1LMKA 3IJYA 4DUXA 1C08A 3PV6B 4LRNH 4MJID 1OAQL 3OWEA 2Y25A 3VFGL 3D9AL 2IH3A 4LSPL 1T21A 1J8HD 3RI5F 5IIEB 2H32A 4YHYC 2AERT 3OJ2C 1T6VN 1DTUA 3WHXA 2E7BA 2NY6D 4QTHA 1NGXB 2GITA 4AIXA 1MLCB 3ZKXC 2YEZA 2Q7YA 3WFBH 1KIPB 2Z31C 1I8MB 5DJYB 4M5YH 3ROOB 2R2EB 3WNLA 3N06B 2NY5H 1OSZA 1A21A 4QHNA 4B50A 1EUTA 3G6JF 5I18H 4YFLF 5IB2A 3DYOA 3C5JB 4JRYA 4PGJA 1G7IA 1K8IA 2GCYB 2YC1B 5DJ8A 4TRPH 4LVHC 3U7WH 4AK1A 1NBYA 1IL1B 3NOIA 4LCWE 1HWGB 2ARJA 2AJ3A 2J88L 1RZ7L 5SV4A 3PABA 4L3EA 3E8UL 4FQIH 1FZOA 3H9SD 3SKOA 4DVRL 3L95B 1S9YB 3F7VB 3O8XD 4LSSH 2MQ0A 3DBXA 1CK0H 4J12A 4JCMA 1N6UA 1RJCA 1DQDL 3K2MC 3X17A 5AG8A 4DFHA 5JOFB 5IW1B 1RK0B 3VXPA 1PZUB 1FCCA 4I4WA 4WIQA 4XBPA 2VDOL 5D2NC 4HUMB 3CFCL 2HG5B 2Z8VC 1WTGT 3SCMC 2YA1A 3LB6C 2CJUH 3VRJB 3H3BC 3RUGF 3BJLA 5DR5H 2HA1A 3P9LB 3QWOB 4ERSL 3MLRH 5I0DA 4J6RL 1EO7A 1K6QH 2XQYG 3NGBB 3IU4H 4KAQL 3MRGA 3MUGA 4WU7A 4NQED 4Y19E 3ULUL 1FH5L 2ADIB 4ZNCD 1UJTA 5ACZA 5E24E 1R3HA 4PJ5B 4X5LA 5FDWB 4F9PC 3UTQA 3EOAA 1R3JA 3T0EC 4JQVA 1CICD 3WNNA 5CJOH 4Z7VA 5B3JE 3T65A 2ZUQC 2AJVH 3P0YL 4ODHL 5AAMA 4DTGL 1XCTA 1NGWB 4KROB 5CS7A 2AEQL 2VERN 3SDAC 2A9MH 1RK1A 3MCLL 5TE4L 5I2IB 1HZHL 1TZHA 1I1YB 3DROB 5JOPD 3RI5K 2R2BA 1UA6L 2GJ6D 1R0AH 3SE9L 4D2NA 5EORL 3DETC 5IK3A 1MAKA 4M8VA 3UYPA 2FEEI 1MFEL 5H2BA 3P0GB 3DURA 2OBGA 2NY1B 4O51B 5DJAB 4LSUH 3V4PH 1J8KA 1HQ4B 1INQB 3MOAH 1I1CA 3IJSA 2QLVB 4RX4A 5SX4I 4G8IB 4XP6H 1AY1H 4HIHA 4ZS7L 5IW6B 3X14B 5IB1A 4HMEA 4NT6A 4LBEB 1SVZA 4D0DB 1I9JH 4PD4K 5JZ7C 4LLWA 1PG7X 1KBGL 2L7JA 3MRRA 2MPAL 3HUJB 5BOPA 4NKDA 5IM7A 3EYFA 5GS0H 3VD3A 3EYSL 4ELKA 4YDLB 5HHOB 4ZUWB 1GAFH 3EOTH 3IGAA 1KPRA 3BH9A 5SWSE 1GGBH 3B9KC 1CDYA 4E0RB 2ADFL 1Q9KB 2UVEA 5KJRL 1XF5A 4KKBD 1AO7A 3N1GC 3GHEH 1FNGA 1SM3H 4GG8A 5D6CB 4G7VL 4M02A 4HUVA 1HXMA 2MSPA 1G7HB 1JNLL 2YUWA 5IMLB 1QFWL 4ELMB 1TPXB 4KQ4L 4XH2B 5IQ9A 4G7YH 1X5KA 5MEND 1NPUA 1BZ7B 4OCXL 4FFVD 5EIIA 2O61B 1N0LA 3WS6C 5L2KE 4PJDA 2IQ9H 3AMLA 2WLYA 1MCFA 2VC2H 4OUOA 1YUHA 2OZ4L 4YK4C 5E94B 1RAMA 1TIUA 1JBJA 3H7BB 4RWHA 4BH7B 4EJ1C 3MACL 1BJ8A 3F6IA 2V2TA 3IDMB 1J1OL 4DK3A 4N0UB 3HB3C 4XPGL 3LRHA 3ZTJG 4ZXBC 3WFCH 3VI3E 2MHAA 2R2CA 2XG4A 1W2KT 1IGYA 3OR6A 1KGCE 1NCBH 4AM0A 3OAYK 4MLIA 4P23C 5ESAB 4MJIE 4S1QH 1WC7B 3IFNH 4GG6B 4WO4B 1H3XA 4OFPA 1MWAB 3UYOD 1PG7H 4LOUD 3I50L 4H1LB 5AUMA 1P6FA 4L9DA 4OGAC 5J6HA 2FGZA 5F21B 3MRKA 4Q2ZA 1ULVA 3VWKC 3BRDA 2V17H 2X1PA 5E0QA 1CR9L 3CH1A 3EJZC 3NIFF 1N8ZA 5F1SA 4UIKH 2C4FU 4JFEA 4IRSA 4XC1H 4QRPD 5TJWK 1IE5A 4JO1H 4J3SA 4KH2A 5GISL 2LU4A 3EFDL 4I18B 3IB4A 3MRCB 3LEXA 4RWYL 5D1ZB 1MUJB 4PR5A 4WWID 4XXDB 3TEUA 4WEMB 2FLBT 3HTLX 4LDEB 2N7AA 1A7NH 4GW4A 4EUPA 2Y72A 4WFFD 1MF2L 3FOMA 1LP9B 1E4WH 2YMXL 3DTXA 5LGHL 4N8VG 3HE6B 4BFBD 1WIOA 2QHRH 2CKNA 1HH6B 4D94A 5HYSB 3MXWH 4X6FB 4TUOA 3G6AB 4K94H 4JQIH 2VAJA 3QDJB 3GSOA 4DKFL 3QUZC 5GS1A 3CVHL 4H0HB 1EDQA 4X9HA 3DMMD 5BS0A 4U1GC 4P3DB 1YN7B 2IFGA 4HH9A 4OQ1A 3BP7B 3H9SE 1OQXA 3TWCH 4LSTH 3IDGA 1A5FH 1BQSA 1QBAA 3PWVA 5CKAA 2Z4QA 3MJ8A 3WO4B 2AABL 4X5XB 5IWLA 3BKYL 2WBKA 1KEGH 2F74A 3KG5A 1QRKA 1OSPH 1LNUA 1RJZA 1FQ9C 2OSLA 1RMFH 2ICEB 3MREA 2EIBA 4WFGD 5CBAA 4HSQA 1GZPA 5BQ7A 4JKMA 1RUKH 3C5SB 4LHUD 5E8OB 4Y4KA 3DV6B 5I17B 5DD1H 4PJIA 3LSOB 4P5TB 3GB7B 5CJXC 3O4OB 5F71A 4P2RE 1BBJB 2E7HA 1D5XA 1YEHL 4OZGA 2YXMA 4Y5XA 5K59F 2DIBA 2I27N 3EDDA 1DVFA 1U3JA 1Z5LB 1LEGB 4XCNB 4NRYB 1R24A 2RR3A 1TZIB 1J5OL 5BV7L 2K7QA 2GK0B 2MCPH 2PYED 2DN7A 2FEDC 1QFUH 4D0BB 3X3GL 4AH2A 4MQ7A 2I25N 4E41A 3LKRA 1IAMA 2DD8H 3FONA 2IJ0C 1BFTA 4U31A 1PX4A 4JAMA 1AFVH 1A6WL 4OJFH 4TOYH 4PJXA 4JDZA 3U4EA 4QRRE 2HAZA 3U6RB 1MRCL 1XCQA 4NQSA 1IFHH 6FABL 3KHQA 4NO0A 5FKPB 3SGDI 1LDSA 3T2PA 2J8UF 5M94B 5EC1B 5C9JA 2E27L 3Q3GB 3T4AB 3UTSB 3EOYG 4DAGH 3C9NA 3OXRB 4NN6B 1GL4B 1ZANH 1U8MB 1A14H 1U8QA 1DQML 1NJ9B 5IFHH 4WI5A 5C0BB 5MEPA 3MFFB 2DQJL 2B4CL 5HY9B 3QT2A 3BPCB 3U4BL 5KG9B 1K4DB 1M7IA 5BVJA 3BD4A 4OZ4A 3ESVF 1R3KA 2PKDA 4YXKL 5J1AB 1URLA 4M5ZL 2KBGA 5L8JB 1CGVA 4BSWA 4XCEB 5MERA 1EFXD 2DBJA 4XNQB 3DPBA 3PXHA 4MD4B 4D0CB 4PRBA 4ETQB 3OR7B 1I3GL 2ORBH 3VA6A 1WWBX 3EO9L 3SDXE 1V7NL 5B38B 5KVMC 4LEXL 5EU6D 2DQCH 4PRIA 5GRXG 3V5HA 5D2LE 3U7AA 1WJ3A 1UB6A 4JY4B 4HUWB 5ICZA 3BO8A 4MZ3A 1FFPA 4XT1C 2A74B 5I75C 1KPUB 4HCRL 3JVGC 5C71A 3VCLB 2Q76B 1RHHA 4S0SD 4YBQD 5KS9A 3PJSA 3D39B 4NN7C 5HVWA 3ILPB 4KRPC 2EC9T 3MR9A 2EIZA 4FQQA 4P46B 5ID0A 3L6FA 25C8L 4HV8A 3REWA 4M6OL 1N0XL 4JLRB 5E9DD 4PJ8C 4RNRA 3MNVB 1LEIA 4CMHC 1FVEA 4O5LL 3QH3A 1H8NA 4N9GB 3QDGD 2WSKA 1WICA 5FHBL 4EN3C 3K3QA 5DDHB 4GRMA 3IJYB 2XWBB 4LQFH 2V5YA 1MEXL 3U9PL 1N6QH 2Z31A 3AU1A 2H32B 3BKMH 3KWWA 3QWRD 4QRPE 1N2RA 4KJWC 4ZFGL 1DLFH 4YAQA 5DVKA 2BCKA 5FM8A 4OCSH 4XBEH 4RMQA 2VDQH 1YEDA 4Y5VC 5I71B 2EEBA 3I75B 4G5ZL 1NLDH 4NZRL 2PUQT 2NXZD 4DOHB 1W72L 2P4AB 4G6AD 1IM9D 3VXQA 1OSZB 4OIIL 2X10A 4QHNB 2APVA 5CGMA 1PLGH 4OZFA 5IB2B 1YECL 4PJ7A 4JRYB 3TM6A 1VDGA 1G7IB 4KK6C 5DJ8B 4JM4L 1X6LA 1NBYB 2C1PA 5ITBH 3FKUS 3CMGA 3CUPA 5I1DB 2FCBA 3ZYIA 2ENYA 3RWEB 5IEHB 1MPAL 3PABB 4PJBA 3WLBA 3D0VB 4YJZL 4L3EB 1ACYL 2R23A 3SKOB 3GJFB 3O6LL 1NDGA 3WFHA 1FO0A 4K8RC 2OXHA 2DWEB 1LO3H 4LPCA 3VXPB 4I4WB 1ZHKA 4XBPB 4RBPK 3LZFL 3LKSB 1U0QA 3LRGA 4J8RA 3T0EA 3ULVC 4LMQE 2ZCLL 5KZCD 3IDIA 3S37L 2P8LA 4QRSA 2EDOA 1TLKA 4JN2B 4WW1B 4LCYA 3TH3T 3GK8L 4AQOA 4WU7B 1EX0A 3V5KA 3WDHA 5ACZB 3C60C 4CDGC 5C0NC 1CLYL 1GHFL 3WDIA 1M6OA 3JUZA 3NCJL 2DTMH 3UTQB 3EOAB 2VABA 4Z7VB 4POYA 3T65B 4MSWA 1XIWC 3WIIH 1VFAA 2VQUA 1H3VA 1MLBB 1SEQH 2X4NB 4AG4L 3QCVH 1RK1B 4OZHE 3K8MA 3VI4E 2D9QB 3DX6B 3MFGB 1V5JA 2E6PA 2KPNA 1NCDL 2R2BB 1CT8A 4I3SL 1KG0B 2PW2A 1X5YA 5LJYH 1BF2A 3MYJB 2C3VA 1H3PL 2X4RA 2KKQA 3NZHH 3HMXH 3REVA 3T8XA 1GC1H 3DURB 3VMPA 2V2XA 3QO0A 1KTLA 2YPVH 1DLHB 1P4IH 4JKKA 2N7BA 3BKCL 4V1DE 1B0WA 4MQXD 3PHQA 3S36X 4AMKH 4Y5YC 5KAQF 2E3VA 2CIIA 3BVNB 4ONGH 1X4YA 1UYWL 2VZ3A 4C56A 5EZIL 3MRRB 5DQJB 1Q0YL 1CXEA 4I5BA 4NKDB 4UI2A 1NCWH 1L6XA 1IAIL 2EH8L 3EYFB 1SJEA 4K3EL 3BHBB 3IGAB 1CLZL 1KPRB 4BUHA 2W0LA 1LE5B 3V0WH 2ERJB 1AO7B 1EIBA 2ZG2A 4PJCA 4FFYH 1A9BB 4AEIL 1AKJA 3AB0B 5B39A 4OGXL 3AUVA 3V7MA 1ADQA 2I9LB 2OK0H 1MRDL 2NTFA 4R4FL 4F3FA 3L9RB 3OAUL 1KCVL 2UY7A 1HXMB 3QQ4A 3C8HA 2YPKA 3QDMA 4P99A 1U8KA 2CRZA 1T1ZA 4IDLA 3QIWB 1YNKH 4FN0A 5IQ9B 5DEGA 4X8XA 1YEKL 4TVPD 5IHLB 2XZAH 2R8SH 4TTGA 3IFPA 2WBJA 1JHLH 1W8OA 1P7QD 3QI9C 1H5BC 1PEZA 5DQDH 1JGUL 1ZA6A 2V2TB 1MFDL 2G75A 4PTTA 1UVQB 2GSIA 1JHKH 2GTWB 5DHVA 2VN4A 4O2CA 2HJFA 4L1HA 2YSSB 1IGYB 1IGCL 5JQ6L 3K2UH 3P11L 3SDDA 4QXGL 2OS7A 3S36H 1RZJL 1CVSC 1BEYH 3DHJA 4MVBD 3VH8G 4JJ5A 5BRZD 3EGSB 2YUZA 2X4PB 1LHZA 3LMJH 3Q5TA 5AUMB 4X6CB 3ZTNL 3VFWB 3ARDD 4Q2ZB 4LKCB 1S7TA 1KB5H 1IC7H 3RY6A 3ZHLA 2VLRA 3CX5K 5DFWH 3CJJA 2EXWD 3GMPB 3UZQA 3CH1B 1N8ZB 5DVLA 2D7NA 4MNQD 2D03L 4LIQL 4ZAKC 3CFBA 3DI3B 3VFVB 3Q48A 5I19H 2PW1B 3VE0A 3LEXB 2AV1B 1AGDA 4PR5B 4GAYA 2YS4A 5T1LA 4XVSL 1AC0A 4GW4B 2FLRT 3L5WA 3VFRA 5H37H 4TSBH 3FOMB 4X6BB 3RA7H 1MCHA 3DTXB 1A3LH 5L7XL 5AG9A 2F5BL 3WXWL 1UWEL 4N90D 2C4FT 4H20L 1CDBA 2H3NB 3NVQA 3GSOB 5FO7A 1Q9WB 2IG2H 5LQBH 4G8GA 5BS0B 2W65A 4PP1C 3RVXD 2PF6A 3TFKD 4YIQA 3BZEA 1S9XA 2BY1A 3TH4T 1G9NL 3PWVB 4PB9L 4S1RL 2Z4QB 4LIQE 3GBNL 5BJTA 5C0GA 4L3CA 3UX9B 2XT1B 3DV4A 3DUHA 2F74B 5CJXA 1OTSC 3UTTA 1RJZB 2IQAA 2H26B 3HR5B 5DMIH 5F3HA 4JO2L 4Y4HD 1AI1L 1GZPB 3TLRA 1UZ8A 2FATH 3IETA 5BQ7B 2QQLL 3ARED 4EXKA 4LLYA 4Y4KB 3VFSA 5E8DH 4GRWF 1OW0C 5JIKA 2H1PL 4Z0BL 1MY7A 2DS4A 2JKXA 3UEZA 5GGUB 1YYLH 1CD1B 2QEJA 2KH2B 2APWA 4XMLH 3ULUF 4J3TA 3GSNH 1D5XB 4MA1B 1XGTA 2B5IB 1FORH 3KPSE 2HMIC 4W6YB 1DVFB 4LLUA 1CCZA 3HMWH 3WS3B 1J9CT 2IFFH 3W2DL 1NMAH 3NCYS 2IANB 4ODXA 2BVTA 1UZ6F 1W0WB 4APQC 4TQEL 4AH2B 4MQ7B 4E41B 4ZFFB 4J1UA 3LKRB 1U8IA 1AD9A 3FONB 1ZAGA 2H8PA 3BEVA 1AGEA 4P5MA 4UDUB 4ZSOE 3D2UD 1T83A 4PJDE 4PJXB 4KUCD 2F54E 3PP4L 1B88A 3WXVL 2ICWA 4NO0B 1DBAL 2KQNA 2CDEA 3QPQD 4U4BA 3GHBH 4TUKL 4KRMB 1HIMH 1OOAA 1C5BH 3QCTL 3SE4C 3C9NB 1YMME 2CRMA 1U8QB 1IGIH 2AJYH 5MEPB 4I77L 4GBXC 1D9KC 4IOFD 1A6ZA 3V4UH 4KJYB 1I4FA 3SOBL 4Z5RB 1R3KB 2D7TL 2NR6C 1IKFL 1FAIH 3OF6A 4L8BA 2AQ1A 3LD8B 2I9TB 1I7ZA 4JFHE 5IB4A 4JHZA 4JFEE 4PRBB 3BSZH 1KB9J 2VB5A 3JVGA 3K4DA 3G5XA 5IFAH 3ZZ1A 1SBSH 4I3RH 4PRIB 3L3OA 2QL1A 4NKIL 3RGHA 3WL9A 3KPLA 3MXVH 3Q6GH 4EIZC 2NTSP 3HN3A 2HFTA 1I1AC 4CUCA 2Q7NA 4QKXB 1U3HD 3O41B 4PJ8A 1G0XA 5F7YC 3NPSB 1RHHB 5L9DH 3L3IA 1I9IH 5KS9B 1UB5A 1MHCA 1I1RA 4M7ZC 4U0RC 1H0DB 3TZVD 5J57B 3ZSTA 5TFSL 3MR9B 4UZGA 1OTTC 1PDKA 2P42B 4OFYD 2EIZB 2BSED 5SWQA 5ID0B 5TGBB 1KACB 3L6FB 3REWB 3MJ6A 3QIBC 5HDOA 3QQ3A 1BLNA 2VDLH 5A2IH 1LEIB 1P84K 3LCYA 1FVEB 4KTEH 4PBVC 4YHYB 4BQ8A 2ESVA 3GBML 5C07A 3WKMH 1NLBL 2BNRA 2VZ1A 4YPJA 3ARWA 1INDH 3MLTB 3IU3B 5LWYL 3PWLA 4GRMB 1R5WB 5A3IC 1T7VA 4FQXC 4WW2A 4YZFE 2WLZA 4XPFH 3H8NA 3ZKXB 4TNVK 4U1SA 4P49A 4JFPA 4Y5VA 4OI7A 4Z7QF 4HJJL 4PJIE 2Z31B 3V5DA 3SQOL 4JJHA 1D6EA 3AU1B 3KWWB 5IQ7H 1P53A 1P7KB 1UGNA 1NAMH 1N2RB 3BKJH 1ZGLM 4OZGE 5CEYB 3MODH 4X98A 4YHMH 2KZ1B 4YHZL 1YEDB 4LVHB 3CFEA 3EOBA 3VXUD 3R8QA 3HUJF 1IVLA 1KT2B 2CDFB 3VXQB 3WD5H 4YWGH 5HGBA 4WNQA 4N90E 3DXAD 1J0KA 4Z7NF 2NYYD 3H2WA 1E6OL 2UZIL 3RRQA 5ESVA 4GRLD 2I26N 3ZYOA 1YPZB 2MJWA 1G7QA 4PRHD 3AMKA 4OD2A 5EIVA 3MLXL 3UC0L 2A6IA 8CGTA 5JW5A 2C1PB 3K1KC 1GYAA 4HC1A 1TENA 1ONQA 1UCTA 3CIQA 3JTSB 5D2NB 2G60L 1KIRA 5F9DC 1AH1A 4GKNA 3SCMB 3S96A 3WLBB 3BIKB 1M71A 4M1DH 2YRZA 4NQDA 2XQBH 4JHAL 1MCKA 3UO1H 2VE6A 1MNUH 1FO0B 4P4KC 3DYMA 2BSSB 5I1EH 4ELMF 5FECA 3IDYC 4DGIL 4D3CL 3C60A 3C09C 1MREL 1ZHKB 5CHNA 1S7XA 4WTZG 3T0EB 3LEVH 3B8YA 4LPYA 3IDIB 1KJVA 2ZUQB 4QRSB 3U36A 4LCYB 2EDEA 2DQUL 2Q86A 3SDAB 2WP3O 3O3AB 4D9LH 2E9JA 3V6ZA 5D1QC 2ITDA 1ND0A 3V5KB 5F44A 3MRBA 4OQTH 2VABB 4F33A 1VFAB 3IVKA 4OD3H 1FIGH 4Z6AT 4YDVB 2XFXB 3FOLA 4UNVA 1OP9A 5C0JB 4AL8H 3T2NH 3MBXH 4R8WH 5CP3H 3V52L 4RBPH 5CMAA 4HWBA 4DEPC 4NRXA 3C2AH 1S7RA 4PLOB 3JWDL 1M7XA 4KDWA 1AGBA 4OIAA 4PJEA 4PGCA 1NH6A 2H2SC 4UT6L 3REVB 4BH8A 3T8XB 1CBVL 5FAAA 3NH7H 2V2XB 4YEEA 2YK1L 1DEEB 3TVMA 1I1FA 4I8DA 5FF6A 2ARWA 3KPPA 1D5ZA 4KPHL 5D9SB 4PRPD 5DUBA 5FCSH 5TPWH 3SDXF 1ERNA 4QHMA 1XF2B 3DECA 1XF3A 3FB8B 5D2LF 5AYUH 2DL2A 3FN3A 3B9KB 4XVTL 5JA9A 4IRJA 1UKSA 4I5BB 2AGJH 4PJAE 1OGAB 1QEWA 3IDXH 1SJEB 4NC1C 1CZ8L 3QJFA 1B6UA 2R9HC 2Y36L 4KMTL 5LGKA 3KLAB 4FQHA 1LO2L 5CKGA 4HAFA 2R0ZL 1XT5A 4FS0A 1U6AH 3INUL 4MHHG 3OV6A 1BMGA 3FRUA 2G5RA 2X4TA 2CMRL 1P4LA 4LGSB 5JORA 1FO0L 1CN4A 3QXDA 3O3UN 1FYTB 4J23A 2NTFB 4TSCL 1HHIA 3BAEL 4F3FB 2CUHA 2V9RA 2YUXA 2YKLH 4H26A 3QQ4B 3U0WH 4M6NH 4DVBA 4PJ5D 5JW4Q 1H5BA 1X4XA 2YPKB 4NO3B 4PLKD 1IARB 2XI9A 3HC0A 2BHUA 1CDJA 5T3XL 3U9UA 3FQNA 4PJ7E 2HVKA 4ZXBB 2C3XA 4KHTH 1JV5A 3WN5C 3IFPB 4P23B 4NO5A 4XNMB 3I02B 3MJ9L 3VU2A 4KU1A 3ZE2E 3KR3L 3F5WA 3RVWC 4PJBE 5ISZA 2G75B 3I2CH 2R0WH 1FFRA 4PTTB 2GSIB 5DHVB 1EMTL 4Y7MA 1TJIL 2HJFB 4NWTH 2NY1D 4JRXB 2BXZA 3VWKB 3BZDA 5EH1A 3WFZA 5T5FL 3BMVA 5E2VL 4XCFH 3KPMA 4PREA 5FO8A 5JXED 3MLWL 1RU9L 4UB0H 1ZSDA 3EJYC 4JJ5B 1A1MB 1JPTL 2B39A 5T3XE 1MVUB 1CE1H 4ZDHA 1GPOL 5BMFH 4UT7H 3O3DB 3P3YA 1GJIA 3WFEH 1FVDA 3RTQD 2WM0A 2APXA 1HINH 1QO3B 2FHFA 5HHOD 4IHOA 2CIKB 3LN4B 3CFBB 4IDJH 4FNLL 3VE0B 5KSUA 1NCAL 3DXAE 5BZDB 2R29H 3QUZB 1EJOH 4GAYB 4K23L 4P4RA 5T1LB 4U1GB 4OCWH 3KPOA 2AV7A 3MNZA 2YXFA 4X8JA 3VFRB 1QHOA 2DBLL 2AK1H 4PRHE 1XAUA 5J9PA 3VDCA 2ED9A 3E6FA 2XRAH 3HS0B 4XP4L 4ZTPH 3P4NA 4JRWA 4JFXB 5AEAA 3QUMA 4DW2H 3OJVC 1HHHA 3QNYA 1P5UA 1S5IH 3QG7L 3V6BR 3PV7A 4UOW0 2W65B 3TIEA 4JFYB 1ADQL 5F7MC 5FUZH 5HHVL 1LD9A 4TVSa 1SY6H 4EI5A 1FRGH 1JYVA 3JZ7A 1OW0A 1WTLA 3QO1B 4XRCA 3M8OH 5BJTB 1LQSR 4HPOL 4C56E 1KEML 3UTTB 2O5XH 5IMKA 3UROR 2IQAB 5F89A 3SKNB 5TQ0L 1MRFL 3VW3L 1UZ8B 3IETB 1DBJH 4ZPTA 3MBEC 5DK0A 4NP4H 5FOBA 1ORQA 1LDPH 4LLYB 1ZV5A 3RL2A 3WMSA 3P4OA 3ARUA 4KKNA 4WO4D 1A7PH 2VH5L 1EO8L 5GRUL 5C0CA 3PWPA 5D96C 1AXIB 4PJCE 5DJ6A 4CU8A 4N0FB 1Z9MA 4UBDC 2PO6C 1WEJH 2DIAA 3EUUA 5F1NB 2X09A 4U3CA 4U6VL 1D6VH 4XWGL 1RJYA 4ODXB 3QDME 1FCGA 4K2UH 4HS6B 4IMKC 5T3ZH 1HDMB 5DS8B 2ZCKH 1U8IB 2H8PB 4MJ5A 5D1ZD 3SE4A 5A1AA 1Q1JL 2G2RA 3HNSH 1OCWL 4K71C 2CDGA 5D7LB 1A4JA 3S88H 4GQ9H 4ZO7A 3TESA 2ICWB 3KDMA 4PRPE 3RKDD 2FJFB 3MJ7B 3STZA 4PGEA 3WEXA 1D9KA 5I1GL 2PTTA 4PGBA 3HE6D 4HPYH 4HX1A 5JUEH 4XB7A 4YGAB 3QDJD 3EFFA 4QHUA 5IHUL 5F9WC 2C1OA 2DI9A 3EKCA 2R4RL 3ZHKA 4HXBL 1FFNA 4MB4A 5IBUG 5F72S 3C6LC 3SE8H 1D5BA 3P0VL 4E5XB 2XY1A 2BJML 3MLZL 1I4FB 1BAFH 5I8CB 4LSPH 5FYKD 3OZ9L 4L8BB 3O0RL 2L4OA 2VLRE 4AEFA 1NSNL 1A7QH 5I75B 5DWUL 1I1AA 1M7DB 1BZ9A 4XXCA 3L7EA 1HCVA 3FT3A 4GW1A 2JJSC 3CK0L 1TDQA 3G5XB 2H41A 2VXQH 4L9LC 5HPMB 3VXTB 1FL5A 1PW3A 4NN7B 3L3OB 4HK0A 3H3KA 5IEKB 3FZUC 4KRPB 2EDXA 2AEWA 1IGML 1HKLL 4WJ5A 5GZOC 4D9QE 4WWKC 1VKXB 4H8WL 1KNOA 4QOKA 5KOVC 3EDKA 1PKQA 2APBA 1T4KA 4CMHB 3O9WA 2DLGA 4NQTA 4KRNA 1HYSC 1TTFA 4N8VB 1F3JA 1MHCB 5DMGD 4G8GE 4MGXA 4NKQB 3N0PB 4EN3B 3MROA 3E6HB 1RZ7H 4IOIA 4FQXA 4MNGB 1UEMA 2P45B 2X89A 2BDNL 4Z7VF 1BIIA 4KVCL 1OP3K 4DVRH 2DYPA 1BFOA 4QXUL 2JIXA 1R3IH 4NYLB 1DUZB 4XCYA 3MGTA 2D31A 4U7SA 1DQDH 1IEHA 5C07B 2BNRB 3LKNA 1MI5D 3EO1A 3UTSD 1NGPL 3MZGB 4NM8H 5ANMB 4B7IA 3GO1H 1T1XA 4BSVB 1NBQA 4C83B 4GRWH 5DD0H 4V2BA 1REIA 4JFPB 4Y5VB 5C0BD 4Y16C 4J6RH 1S7SB 2OTWA 4GJTB 5EFIA 3V5DB 5DA0B 5EZJA 2WUBH 3ULUH 1FH5H 3N9GL 4LHJB 2A83B 2YWYA 2UYLA 4LLAA 1HNFA 3STBA 4LGRB 4TSAL 4U0QB 2EO1A 4W6WB 1U8JB 4C4KT 4BA8A 4JHBA 1N4XH 3EOBB 4PTUA 5B22A 5I1JL 4OLXL 1ZHBA 5DD6A 2QSTA 1INEL 4JKWA 3GSWA 1UA6H 2H9GA 3G5ZA 1AXTH 3CC5A 3SEPA 3SE9H 1X5XA 5EORH 2P46B 3HRPA 5J3HC 5ESVB 4C54A 3RZCA 1MFEH 5CIPA 3ROLA 2COQA 1KJ2B 3BE1L 4OD2B 4M8QB 2A6IB 2NW2A 1T7YA 4OD1H 1S9WA 4JN1L 4YHKL 1DL7H 3GJFK 5DGRA 2X05A 1KIRB 3MCG1 3CVIL 4RGNE 3S96B 1MHEB 2C7UA 5C0IA 4ZS7H 4F9LC 4NQDB 3D39D 3KPRA 4BYHA 5C6TH 1TTGA 2VE6B 5C9KA 1NFDE 3UTZA 2MPAH 4Y88A 5FECB 4MWFB 2E6QA 3VFMA 2XPGA 2ZNWA 5I6XC 5CHNB 3QRFM 1YZZA 1S7XB 3CLFH 2V7NA 3EYSH 5EO9B 4HLZH 5KAQG 4O02L 4XPAH 2NX5D 3MOBH 4PJDF 4RFNC 3MTRA 4HUNB 2V7HB 3KLDA 1XIWB 4HWZA 3U36B 3RNQB 3C8KB 2M8XA 4R96B 2YBRA 2WUCL 4UV4H 1NMBL 1SVCP 2OXGA 5KJRH 3O3BB 1C12A 3V6ZB 4G42A 5DC0A 5JW4M 1ND0B 5AYQA 1ZTXH 3UJTH 1ZGLB 4R3SA 4M4PA 5ICYB 5F96H 2GY7B 3MRBB 5KSAB 3LIZH 4QTIH 4RSVA 2NY2C 5IOPA 3ARFA 2UZXB 4F33B 5JHLL 2HT2C 5BW7C 1FFOA 4HBCH 4KQ4H 4YHPA 4O9HH 5FYLL 4IBLT 2VN7A 4W4OC 5CLTA 4NRXB 4Y5YB 1TQBC 4X6CF 3QHFH 3S4SG 4FABH 1N64L 1GOGA 4PGCB 3UBXG 4BH8B 4Q9CA 2XIDA 2OZ4H 5FYJU 1A6UL 3W82A 5EU5B 3MACH 3TYFA 1I1FB 5FF6B 5A2LH 5DRWA 4OF8A 4JRYD 1DQLL 1A6VH 3VD4A 4HT1L 3QCUL 2FJGA 2BNUA 4JPKL 3CXDH 1NC4A 2DM4A 5IR1A 1KLFA 1XF3B 2ESVE 3K74B 4JZNB 4YBLC 2AI0H 3SDCA 5EZOH 4L3ED 5IGXL 1A6PA 1JE6A 1QEWB 3U79A 1S9VB 4NHCH 2ICCA 3I50H 3CCHB 3D25B 3QIUC 3TNMB 1MH5A 1N59A 4LHQB 2IH1A 1UM4L 3VFPB 1R5VB 4HC1L 3SO3C 4P9HC 4RCAA 4X4XA 3FO1A 4KJQD 3MRQA 2EO9A 1YEJL 3U83A 3ULVL 4O58L 3KXFA 4ISVA 1YNLH 3MA9H 3FRUB 3GSQB 3HC4H 2X4TB 2D7QA 4X6DA 5BOZG 2GQHA 1DE4A 4OT1H 3QXDB 4RWYH 3WN5A 1F6AA 4KKLD 5MP6H 4ZD3L 4H26B 1HHJB 4KGLA 3ZT6A 1OF2B 3QI9B 2OMNA 1H5BB 3AY4C 1KELH 1MF2H 2DDQL 3HC0B 3QR2A 4YFDB 4CVZA 3U9UB 5HI4D 4PS4L 4GXVL 3FQNB 5DI8B 1RUAL 2E8YA 3GI8H 4B5EA 5GXBB 4DKFH 2BOCA 3D1MC 1NGZA 4JFFB 1NAKL 1YQVL 4NO5B 5CP7B 2GUOA 4HGKC 1QOKA 5GGQH 3UTPE 1KFAH 2DQIH 4OZGF 3F5WB 5HHQA 3F12A 4QWWC 2E8ZA 1RZIA 4MD5A 4ODVL 2AABH 4LP5A 1MI5E 1C7SA 3BKYH 1VGKA 4L3AA 4DQOL 4P2YA 1WUNT 4HKJB 3KPMB 1UJ3C 3P73A 3VXMA 1P2CB 4RX4D 4OZIB 2WZPD 3U2SB 4ZAKB 2CR6A 4PJXF 1CXLA 3A67H 3T0AA 3PWNA 4K3JL 4ZDHB 1F3DJ 1QP1A 4D9RE 4XTRD 4OSUH 3SKJL 2GYSA 3NIDE 3MLSH 4EBQH 1J18A 2P5WA 4DZ8A 4ZNEE 5HGHA 3LQAC 1NEUA 3GJEA 3MX0A 1YEHH 1TZGL 5CD5D 4X9BA 4MQTB 1I3VA 4LLVA 2VLLA 2XTJE 4Q9QL 3SGKA 4NIKB 1BVLA 4U1JB 5F9OH 4L29A 3VXSE 1MWAH 5EOQL 1AO7D 3BGAA 3GMLA 4H1LH 2E9WA 3X3GH 3MNZB 4X8JB 1U91B 2XWJA 3BDBA 1JWSA 1OQOA 5J9PB 1EAPB 1T5XA 5KW9L 5I1IL 3E6FB 4YO0A 4AQ1B 5DURB 1JWUA 4PJEE 5HGGS 3G6DH 3A6BL 1T22B 3RWJA 3MV9D 3RIAF 1HHHB 3QNYB 4OCYL 1U42A 3QIWD 2LQRA 4LSRL 5MEOA 3QB7C 5T33L 2YOCA 2E27H 2OL3A 5CILL 4J4PC 4A6YL 3F7YA 5C7XH 3MBEA 1LD9B 1O0VA 2ZUTA 1CE6A 1HH9B 4XRCB 3ARGC 2DQJH 5J06A 5ACLA 3KVQA 4YFLI 5DEFA 4Q97A 3U4BH 2NX5E 5IMKB 5KVFL 1BFSA 4L4VA 2PO6A 4ZPTB 2BMKA 1ORQB 4U1NA 3T0WA 4C4KO 3RX5A 5KS9F 5I66A 2Z91A 4M5ZH 1HI6A 4BZ2L 2AK4B 5FA3B 2P5EB 5T1MA 1FAKT 3HLAA 3PWPB 3VD9A 4NGHH 4APQB 5DJ0A 35C8H 4IMKA 1QG3A 1JGLL 4M1CD 2V5TA 5DJ6B 4UTBL 1V7NH 4K55A 2UWEA 3IDNA 2UY6A 1IM3B 3FO2A 4KWUA 5EUOA 2X4UA 2F5AH 2V2WA 2XV6B 1RJYB 2VDML 5GRJL 5GGVY 1XFPA 5KSBA 4JGUA 4MDJA 4R9HA 4M7JL 4FHBD 1CGSL 5L0QC 1FE8L 2X42A 3OGCA 2M2DA 4FQ1L 4MJ5B 5FV1L 1OWRM 3BEWA 4N0CD 2CDGB 3T1FB 1QKZL 2CLRA 2FGWL 3T4YA 1NEZG 3G5VB 1UM5L 3KDMB 4GBXB 1QSFB 4PGEB 1D9KB 2HH0L 4NQXA 1W0VA 2J1KA 1N0XH 4M6OH 4HX1B 5ISZE 1NL0L 2HLFC 4OF6A 1JMXA 3W9DA 3EFFB 4QHUB 1G6RA 3CZFB 1JZ4A 1RULL 5FHBH 1CLOL 4XPHL 2X41A 2XKNA 3S37X 4JG0L 2X4QB 3HG1E 3ZDYE 3OKOA 1MEXH 2JJSA 3U9PH 2OR7A 3RIAK 4EDXB 3QUML 1RQ5A 2QQKL 5T1DL 2Q8AL 3VH8B 1KSRA 5FA4B 1DN0A 2RBLA 4O4YH 4HWEL 5DUML 2A0LD 1XR9B 3ZE2F 1FV1A 1I1AB 4CRPA 2QHLA 4GW1B 5T5NF 3ZO0A 5ID1A 4NZRH 2B0SL 5F7UA 4LKXB 3L5HA 5DA4A 4M7ZB 1BVKA 4U0RB 4HK0B 4FQJH 4CW1B 4X80H 1FIEA 3WNKA 1TVHA 4XCCH 4TUJB 5CGYC 1DVFD 4HS8L 4WJ5B 4WUUE 4Q6IC 5HDBE 2P47B 3QIBB 3BXNA 4HKXA 3D3VB 3OKKA 1DQQB 1VERA 2IAND 4XVUC 1VPOL 2HTLD 1U2HA 3VWJC 1YEGL 2R1YA 5E4EC 1MPAH 4W6XB 4FQXB 1ACYH 3GMQA 1QR1B 4JM2A 4P2CG 2F53A 3O6ML 1BFOB 4KK8C 3KGRA 3SJVA 4NO0D 4QXTA 5I16A 4PRAA 3FHQA 2EYTA 1IZJA 5F8RC 1T5WA 2BVQA 1Q72H 3EO1B 3LZFH 2PTUA 4G9FA 1X5HA 2A9NH 1JPGB 1U95B 3QSKB 4F37F 3S37H 1S9KC 1TJGL 5CZXD 5SX4H 2FSEA 1B0RA 1ITBB 5DO2C 4FQPA 1FL3A 4F7PB 3GK8H 3U0PA 5DSCA 1T7ZA 2CO6B 1ZT7A 3HE7C 2DQEL 1FNHA 1IC1A 5C0CE 2E9IA 2GIYA 1CLYH 3ZDZE 4NCC1 3NCJH 3GNML 2JB6A 4OKVB 5EBWA 1P1ZA 1HILB 4FXGA 4HZLA 4P2OC 1OP3H 3KLHD 5D7IB 3MLYH 4RAHA 5GZND 2O5ZH 3EYVB 3MUJA 4XAWH 4MHHI 1ZHBB 5KVGL 2ZP0T 5E1AA 1NCDH 3GSWB 2H9GB 2H32H 1U8PA 3MV9E 4MXVE 4F9LA 5HYJA 2VLKE 2P8MA 1G6VK 4BZ1L 3QRGL 1CXHA 1FZMA 4P4KB 2A6JA 4XPBH 2NW2B 4RMTA 4MAYA 2VIRA 3BKCH 3IDYB 4RDQG 4PJCF 3C09B 4NUJB 4F7MA 3GMRA 2D0HA 5CJQL 2ZCHL 2C7UB 2GTZA 1X44A 3CU1A 1CWVA 1UYWH 5ALBL 5FM4A 2A38A 5EO1A 5EZIH 3UTZB 1MJUL 1IEBB 2BSRA 3VD5A 4YHLL 5D1QB 3FQXB 1IAIH 2XPGB 1JNHB 4UT9L 3TBTA 4YXHL 4HUXA 2ADGA 2V7NB 5I15L 3AAZA 3HNVH 4K3EH 3L3JB 2VLMD 4HWZB 1CLZH 4ZO8A 5ELIA 1ZEAH 5I8KH 4CKVX 5BW7A 1AD0B 2YBRB 2GFBB 3BP4B 3A6CH 2VQTA 1C12B 4R2GD 4QT5A 3IDJB 4G42B 4M6ML 3AS2A 3N50A 3GJFH 3HI6L 3TCLA 4DEPB 4OGXH 1CIDA 3BDXA 2P44B 2VLJB 3M1BA 4R4FH 2AJSL 2QSVA 1KCVH 5C70A 3MV8A 4MNHA 1TQCC 1AJ7L 3UDWA 4GAJL 5DMKA 1DBKH 5CUSH 2Y07H 4CU6A 4EXPX 1TCRB 4MDIB 4OF0A 4QOKE 5FV2A 4HXAH 1PKQE 5IB5B 1HOCB 1OAYL 3QNXA 3RHWK 1BBDL 3DVGA 1GGIH 3QZWA 3TPKA 1MIML 1CLCA 3I3BA 2VL5B 3RWHB 3SE3C 5C2UB 3IXTA 5DRWB 4XP1L 1D5MB 3AFLA 3G6JB 3W5NA 4YDJB 3O8XC 2FJGB 5GS2D 5JQ6H 1NC4B 1RZFH 3GI9H 3O3EB 1N3NA 1QRNB 4QXGH 1RZJH 4HQQL 3FMGL 4JZOA 2ZUUA 4OV5A 4GSDL 5BZWB 3VXRB 5LXGL 2Y06H 2LV4A 2B1AL 3SCMD 3LB6D 4QHLA 3BQUC 1JGDB 1AIFA 1MCOL 1NKRA 5KANG 4JCLA 1E27A 4FTVB 2IH1B 2ZPKL 4I9WE 4NDMA 4WI7A 4ODUB 5FGCE 5K33A 4L8DB 3FO1B 5DJ2A 3MGAA 1QQDB 1NGQL 3MRQB 5D7SL 4L8SC 3PP3K 3DSNA 1B0GB 3KXFB 3T0ED 4U2YA 4Y1AB 5TF1L 1FLTX 4X6DB 4NM4L 2YPLE 1DE4B 3SDAD 2DWDA 2CRYA 3P4MA 3WN5B 1F6AB 1KLUA 1ZS8A 1L0YA 5GGRY 2QKIA 3OXSA 2NLJA 1BQLH 1A9EB 1WCBB 1GGYA 1HEZA 5LCVL 3LKOA 5EU3A 3DETD 4CVZB 5L7XH 3RP1A 2F5BH 1ZWIB 3FQRA 3WXWH 3V8CA 3GMNA 2BNQB 4H20H 1J87A 2BOBB 4V2CB 4LPXA 1R6VA 3HZMA 1GGCL 3ISWA 1Z3GL 2BOCB 3LN5B 4DUWA 4Q0XH 3MLVH 5GJSL 4LCUA 2GUOB 3QUYC 1UJ3A 1FDLL 5BVPL 3O6KL 4KC3B 1B90A 4NQCB 3KPRE 4MD5B 1X5AA 5E2WH 1DBBH 5JZ7D 4JDVB 4ZYKB 1Z9LA 1VGKB 2AJZA 3DGGB 4Z7UE 3TN0C 2QQQA 2PR4L 5GGRA 3P73B 4QRQA 3C5ZA 4JO2H 1S7VB 4LASL 3O45A 2QQLH 4NNYA 1KCSH 5BV7C 5F97E 5C0EA 3B9KD 3L3GB 3RWCA 5FDYA 4Z0BH 2APFA 1E6JH 2XQYK 4N0RA 1OGAD 12E8L 3ORJA 2FZ3B 2PXYC 1RUML 3HPLB 3PGFL 4Q9BA 3GJEB 2O26U 4KDTC 2YHGA 4MX7A 2OJZL 1IAKB 3NCMA 1WZKA 3MNWA 3ELAT 4U3HA 1WQVT 3W2DH 4P2QA 5L6YH 4I0PA 4BQ6A 3D18A 3GMLB 5EOCL 4TQEH 4FFVC 3DVNA 2XWJB 4J4PA 1FYTD 1JWSB 2B4CC 3QEGH 1ZHLB 4IM8A 4YO0B 1MHPL 1JWUB 2XA8L 3PP4H 5CINL 3TCXA 1BJMA 2DI8A 3ARGA 3PDOA 4JY5L 2VSCA 1YDPA 4RFOL 4Q9RL 3S4SA 1C5CH 1DBAH 4LL9A 3ZE0E 4TUKH 2XA3A 4XMPL 3HB3D 4CNIA 4F7TB 3HA0A 4ZXBD 1A1OA 5F70A 1KENL 5SV3A 4X9IA 3MBEB 2ZKHH 1RIHL 5DD3L 4BKLB 1VEPA 4P23D 1CE6B 4HIEA 4EUPH 2HFEA 2R69L 2X1WL 3PUCA 1KCRH 2W38A 1RZGB 4I77H 3JWOL 1V3JA 4OLUL 5DEFB 3BN9C 4XGZA 2ZWLT 2BVPB 5D96B 5ITFA 5INCA 2Y7QB 4L4VB 2Y5TA 4QNPF 2PO6B 1PYWA 1BM3H 3AXLA 3HRZB 4JRXD 5ACMA 3IKCB 3VWKD 2BMKB 5KVEH 3HKFA 1XGPA 3MLPA 3ES6B 2FECI 3EJZD 3IXAA 1CFNA 1OAUL 5ADOL 5T1MB 4H5SA 1DFBL 1DR9A 1VGEL 1F6FB 5DJ0B 5CJ8A 2VUYA 4K71B 4NZUL 3QFJA 3OKLA 4NKMA 4HGWB 2OQJA 3F6LA 3FO2B 2R4SH 5I1CL 1SJHA 2FX7L 4NKIH 1HSAA 3MRLA 1BFVH 1HE7A 4JHWL 4WUKL 4XP5H 5JOEA 1QLRB 4LCWA 4WW2F 1F3RB 2VDNH 2AEPL 5EBGA 3VGAC 1SJVA 3BD5A 3OGCB 4PJHA 3EYUH 5JPNA 5K9QG 3QUZD 3ZHDA 3BEWB 3DO3A 5F9WB 4XP9L 3T4YB 1A3QA 2YN3A 4NO2A 5TFSH 3C6LB 4HMDA 4L4TE 4GKZA 3OKNB 4JR9H 1QPPA 1MQKL 3QQ9D 5C08A 1EHLL 1G6RB 4LCCC 2WMPA 3D87B 1WLHA 3GBMH 1NLBH 5D72H 2CK0L 3T0DA 3VXME 2XKNB 4R90L 4LCIH 3Q6FB 5DHYB 3PQYA 4L9LB 5DJCA 1K9TA 3UTTD 5CEZD 2OL3L 2P5WE 4Z9KB 3NACL 3OX8A 2FD6L 1FV1B 4LFHG 4Z78A 3VFUA 4HIIB 4Q6IA 3WUWA 4WWKB 2VQ1A 1MCQA 1OD7A 4NOBA 3ULVF 1A0QH 4XNXL 5FYJD 4YBHA 4Y4FA 5ID1B 1KYOJ 3R4DA 3OAZH 4F7CA 1F97A 2FEDD 3VWJA 4EDWL 1BVKB 1AXSA 1QNZH 3V6FA 2XZQH 4NC2B 5I73C 1F5WA 2X7LA 2D4DA 5DUPL 3HC3L 4YR6A 1C1EL 1MCDA 2IBZX 2P49B 3MV7D 4FG6C 3S97C 2UZIH 4PP2A 1JF1B 1SHMA 2XNAA 3V7AE 4D8PB 1NAMB 3OKMB 4G6JL 4K9EL 1JRHL 2FNBA 3UC0H 4X4ZA 3V4VL 1LK2A 1CFVL 3FB7A 3OJDB 3DO7B 2ZOKB 3OPZH 3UZEA 3FFCB 2ZOLB 1UXSA 1U8NA 1KN2L 3GMQB 5D7LD 2R0KL 3T2OA 3MRFA 4Y16B 1RUQL 3UBXI 5C0AD 1G7MB 2EYTB 3HE7A 2BVQB 2P48B 4MCYB 5SWSA 4DGIH 1FG2A 3B2VH 2EXYC 2HRPH 3IAQA 4NPYB 4N5UA 4AT6A 3MOQA 1KCUL 2J8UB 5J8OA 4Z77A 1QHPA 4P2OA 5CWSA 8FABB 1B0RB 4PJEF 4LDOB 1FL3B 2DQUH 2I24N 3O2VL 4LK4A 2JCCE 3U0PB 5HYQB 1JUFA 4QCIA 5DSCB 2WWMC 3HHRB 4NJ9L 1QACA 3N1PC 5I30L 4OF5A 2JB6B 2UWEE 3I6KA 5D8JL 5EBWB 4UINL 4FXGB 1OAXL 2WAHA 5JNYA 4H0IA 5EUOE 4ORGB 5GGVL 5FKAA 5EBLB 3BDYL 5KSBE 2FL5B 4HJ0C 1QFPA 5E1AB 4PJGE 4X83A 2VZUA 1VEOA 2JE8A 5HYJB 4A2LA 4G3YL 4YBQC 5CLWA 3OB0K 3LOWA 2OR9H 2HLAB 4UT6H 1J05A 4KRPD 3TJEL 3U0TA 3GMMA 1CBVH 2A6JB 4N8CH 2ENSA 2VIRB 4MJIA 2DICA 1FGVL 4FRWA 5I6XB 1I8IB 3GMRB 1B9ZA 1YA5A 1K2DA 43C9A 2GTZB 4RFNB 3PDDA 1IC4L 4EN3D 3WE6B 1QSEE 1FYHB 4XVTH 4OZFH 5EO1B 3W0WB 4MS8C 3D0LA 5JHDE 3VRIA 1BD2B 4H88L 5ALCH 3TBTB 2J4WL 3RU8L 5GS2H 5IBUB 3TJHC 4KMTH 2NY2B 4WI8A 5C07D 1OGTA 3P9MA 4EUPG 3DIFB 4Y2DB 5B4MD 1HHKB 2HWZL 2A1WL 2FBJH 5IVXA 2VXSL 2VWEE 1AGFB 1DZBA 4NFDA 5HHMB 4QT5B 3QG6A 5DJZB 1HXYB 4NWUL 2IPTL 2CMRH 3TCLB 2OTUA 1FO0H 1TQBB 1H8OA 1FVCA 3BAEH 3MV8B 4MNHB 4OAWA 1RIVH 4G6AC 4NUGL 1MFCL 1IGFH 3BP5A 3T0XA 2HYMA 1WWAX 5DMKB 4P59L 1WFTA 4OZIF 2FX8L 3ZDYF 4M43L 3WIHA 3P9WB 2CQVA 1JPST 3X13B 3H9SA 2ITCB 1Z9OA 4KK6D 1DBMH 3O8XA 4X7DC 3ARXA 4LU5H 4YBLB 5DFTA 1YQ2A 3DARA 5GGSY 3TBSA 3KR3H 3LS4H 5DMJB 5A2KH 3BQUA 3CSPA 2HTKC 4BM7A 1CDCA 5F7HA 3QIUB 1ZOXA 3RWIB 4HIXH 2F53E 1WK0A 3AROA 4K8RD 2W9EL 3SJVE 2JK5A 3SO3B 1N3NB 4NQEA 4JZOB 3CLEH 4XPTL 2YD9A 5F6HI 4C58B 5F1IA 4WCYL 1RU9H 5FO9A 3NN8A 4UILL 4L8SA 4G9FE 4QHLB 3CFKA 4NQDD 1AIFB 5HDBF 3VFTA 1CICA 5T1KD 3CVHA 1JPTH 4S10A 5CSZB 1E27B 3EHBC 4U1HA 1GPOH 4GH7B 2GI7A 3BESR 4F15C 1MFAL 4PB0H 1L7IH 4NKOA 4X9FA 3LS5L 1RJLA 5DJ2B 5C0ND 4AENA 3R1GL 4JDTL 2O5YH 2GJ6A 5FK9A 4CMMB 4JGJA 3PHOA 3C08H 1JHTB 1XIWD 4XHJC 3G5YA 1P4BL 5I0ZA 4P5KA 4CADA 4ORZC 5D7JC 4M7KL 3MV7E 5SWZD 5CEXB 2A77L 4J3VA 1G9NC 1NUFA 2IBBA 1RY7B 1I7UB 1ODAA 2DBLH 3BYYA 5KSAD 1UKTA 1ETZB 3LKOB 2Y1VA 2NNAA 4XP4H 5EC2A 3X3FH 1J86A 2CGRL 3HZMB 2HFGL 4LNRB 4RZCB 3TN0A 4LCUB 3QG7H 4MQXC 3QEUA 3ZDZF 4X7TA 3MMEB 5C0AE 3PP3H 4O2FA 5HHVH 1RURL 4URTB 1F58L 3W39A 2QSCL 2C9AA 3AM8C 5EU4A 1WBYA 1KEMH 2ATPB 2Y23A 5DT1H 4F7EB 1QFWI 2PXYA 5EN2B 5TQ0H 1N5AA 3LKQB 2EECA 4G8EB 3O45B 4NNYB 4MXVF 5K9KA 4IRZH 1S7WA 1IEAA 1DEDA 1DJSA 4JPVH 1X4ZA 4JFDB 1EO8H 5GRUH 3I6LD 3SBWC 5MENA 4OCLC 3MRHA 5DHVH 5KVDH 4KY1H 5E8EA 4MX7B 3S5LG 2AQ3A 3FN0H 4IRSC 3MNWB 4U6VH 3OHXA 2CLZA 4Z7WE 4LF3A 4LNVA 5ADPH 2NQCA 1OAKH 3E2HC 1ZHNA 3QUKB 1BOGB 4TRPL 1Q9OB 1K5NB 4F57H 1XGYH 4F2MA 3FQUB 4Z95H 5FHAH 5KSVB 3QI9D 4PYGA 4EEEA 1Q94A 3ARGB 4HW6A 1GIGH 1KJMA 2DQGL 4WV1C 3S4SB 3V79C 5FGSA 4FQIL 5GS1C 5LG1A 4HWUA 4DZBA 5GRZA 3O2DA 3UBXB 3BWAA 1BQHA 1MCBA 5IHUH 4LSSL 3KPQA 3HNTH 4JFFD 1AC6A 3FQWA 4HIEB 4WI3A 2R4RH 4GQPH 4HXBH 3F7RA 5IKCA 5IWLC 2X4OA 4KJPC 4LLQB 4QRPA 4XGZB 1M05A 5ITFB 5IJVA 3MLRL 2GY5A 2Q6WA 1PYWB 1K6QL 2ZSWB 5J89A 1IZKA 3BN3B 1OP5H 1WBXA 1WT5A 1PBYA 2IPUG 4MAUL 1OPGH 3CXHJ 1XGPB 4MA3A 3CAFA 1L9MA 4XBGA 2EXWC 5TDOA 1NSNH 4LPWA 1CFNB 4OZFG 4KKAC 3SPVB 4H5SB 4ZAKD 5CJOL 2AJVL 3WIFA 5L0QB 3LV3A 4U1LB 2VISA 3CK0H 1OHQA 5IV2B 3ULSA 4Y5XC 3FQTB 3H9HA 3OKLB 4NKMB 4YFEA 2OQJB 5CEZH 4HFUH 3MA7A 2GJJA 2FYYA 4RIRA 2NW3A 1HSAB 3ALWA 4GO6B 3T3MF 2A6DB 4LCWB 5FYJH 3T3PE 2QQNL 3H7LA 5JPNB 4LSUL 3V4PL 1S7QB 4OCMC 3LKPA 4LCCA 2YA2A 1EV2E 1JP5A 3FO9A 3MOAL 5LKNA 3VG0H 2WIIA 3IJHB 4PP1D 1LILA 2IC2A 3TFKC 4XP6L 1AY1L 5DMYA 1NUGA 2BDNH 1MCRA 4PRDB 1GGUA 1I9JL 4ONHA 2NY3C 5F7EH 4QHKJ 4X7EC 4AY0A 2NY7L 4LLDB 5GS0L 4PLJC 3M07A 4G9DA 2QSQA 4R7DB 3IRPX 4HF5H 4Y19B 3TH2T 1UWGL 3QFDB 4HH8A 3EOTL 1EEZA 2N1KA 2XZCH 1FGNL 2ILLA 5L2JA 2EYSB 2JJWA 4K7FA 2DF3A 1ZA3A 3N9GH 3GHEL 4ZOEA 43CAA 1GXEA 2EZ0C 2GJZA 4QRTA 1SM3L 2Y4SA 5HJ3A 1QFOA 2XKUA 4QRUB 3VDBA 2HMID 1FLRL 3OX8B 4OCNC 4OZHA 4TSAH 1YN6A 5HHXL 4Q6IB 3KPNB 2YZ8A 4IS6A 1U8LB 5SWZE 1T2JA 3ZTJH 3VRLE 4U33A 2AK4D 5FCUL 1IAIM 4I13B 2P5ED 4P2QE 3VWJB 4HUKB 3PWPD 4OLXH 4APQD 1AXSB 3V6FB 1FZJB 5E4EB 2X7LB 4YR6B 3VXOA 2IQ9L 2AP2A 1N26A 2VC2L 3FRPG 2MNUA 1VCAA 3CH8A 1L0XA 2M26A 3WBDA 2FR4B 3R06A 2Q8BL 3MGOA 4JN1H 1AHWB 4YDIH 1Q0XH 3GSNA 2YRPA 3CX2A 3CVIH 1QLEH 4LARH 2ZJSH 3QEQE 3ALXA 2DM7A 3L5IA 3RJQB 4S1QL 1QTYT 2FB4L 3IFNL 1T20A 4GBXD 1EFXA 1QSFD 1D9KD 2IMNA 3HE7B 1PG7L 5SWSB 1FG2B 2R1XB 3QHTC 4X4YA 5B39G 2NR6D 4AT6B 5EU6A 2VZOA 2V17L 4KUZH 1FJ1B 1LO4H 4P3WA 4P2OB 5CWSB 5ECJE 5FGRA 4EIGB 5IT2L 1XGRB 4XMKH 4M9PA 1JUFB 4QCIB 3U1SH 5DJXB 3UAJC 4UIKL 3ZE0F 4XC1L 3L1OH 4OLYH 3KNBB 4RQQA 4HG4K 4JO1L 3JWDC 4AIZB 3TBYA 2JF1A 3ALPA 1G9ML 5KANI 1K4CA 5EU7E 1BIHA 3UPRA 4C59B 4P3CL 3QFJE 2DQFA 5JLZB 1A7NL 4G80A 5FKAB 5L2KB 1I1AD 1CGTA 1ZVSB 4UQ3A 5FYLH 1KF9B 2VMFA 2Q3ZA 5E9DA 2OYPA 2PYFB 4PGZA 1NFIB 1CFQB 4K94L 4JQIL 4PJHE 5HHPA 4FFZL 1N64H 1WBZA 3L3HB 3X11A 1J05B 4FXKA 4R4BA 5F88B 3TWCL 1HHGB 1Z0MA 3U0TB 4LSTL 1A5FL 2SEBB 4WY7H 3QIBD 4MJIB 3PIQA 1NEZB 3D3VD 4X6DF 4LQ1A 4WI9A 1K2DB 5C08E 43C9B 1OSPL 5KTEL 3QWRA 3OB8A 3MO1B 1RMFL 4U6XA 2FDBP 3QHZL 1DQJB 1RUKL 3D85D 1U92A 4UIMA 2DQHH 2CKBA 4HFWB 2WW8A 1R3LB 4LMQI 1SEBA 5IB3B 3D0LB 3VRIB 4BK5A 5EOTB 3T09A 1A7OH 1KJ2H 3PQYE 1EHAA 4K8RH 4TTDC 4DN3L 1Y6KR 4CVWA 4I2XE 1OGTB 3OB0H 3P9MB 1IM9A 4HKZA 1TQCB 4HDIB 3NIGE 1YEJH 2ZZUT 3NFPA 1JWMA 3ULVH 4CGTA 1SYSA 4DGYH 1T1YA 5HVHC 1C16A 2OTUB 3N1QC 2HJKA 1FVCB 2MCPL 3KYKH 2F15A 4ZD3H 1MJJA 5CGTA 3MLUH 3BP5B 4NBYB 5IROA 3GSVA 1DP0A 3QP3A 1U3ZA 1AFVL 5M7QA 4TOYL 3MRIA 4PS4H 3H9SB 4GRLC 4YEFA 1IFHL 1D5IH 5J11C 3O8XB 1CFSB 3BOVA 1YQVH 2F8OA 3WNPA 4U6YA 1E28A 4DAGL 2X2YA 1QUNA 2DLFH 3BQUB 4N8PA 2IBGA 4J7RA 3HFMH 2J6EH 1PZ5B 3NA9L 4RMUA 4UV7H 2ADJA 4P4KD 5DLML 2JK5B 4FZEL 1ZT4B 2HN7B 4UAOC 4GXUN 4EI6B 2AXFA 4HWBH 3HAEA 4RAUB 1PSKL 2FJHB 4UDTA 5FO9B 4L8SB 2Z35A 3KJ6H 1A1NA 4P2RB 3CVHB 2G9HA 1YEIH 2VITB 3KPSA 2E9BA 5D7JA 2EYRB 4PD4J 3QDHA 4XAKD 4AZ8A 4RAVB 2EDNA 5I1HL 4GOSA 5D1QD 4Q58C 1MIEL 4HKBB 2MOVA 1CDHA 4G43A 2ORBL 3CSBA 4X5WB 3LQZA 1AR1C 2DQCL 3L3KA 4PG9A 3G5YB 3O4LD 3ZKMD 4P5KB 4CADB 1NCNA 4UUJB 5F9AC 4ZSOA 3L3DA 3ZL4L 3KYOA 1FN4A 5EOQH 2F54A 4QRRB 3QUYB 3X12A 4KI5E 4U6TA 2OMBA 1IAII 2VLJD 2XWTB 4ZPVB 2H2SD 3AM8A 5GGTH 3A6BH 4YE4H 2JJTA 5J1SC 4F58H 1Y18B 2VXUL 1YMMA 1V3MA 1VFBA 3TN0B 2WBJC 2IADA 4ESKA 3QEUB 5DTFB 4X7TB 1AGCB 5CILH 4XNYH 4WRLA 5HI3C 3WSQL 4O2FB 5BV7B 1HSBA 2UWEF 5K9QI 1J8HE 4JVWA 4PRNB 4M93C 4WU5B 2A73A 1I8KA 1MHHB 1EXUA 2M1KA 5EUOF 1CFBA 4BFIA 1HQRA 3RVVC 3WIHL 3SBWA 4JG1L 3SDDC 5KSBF 2PXYB 1A02N 1WZ1H 4HJGB 5KVFH 2J5LC 4I48B 1Z0NA 5CP3A 1ZLSH 4KTDL 4ZUSB 5K9KB 1CGWA 1NC4D 1QRND 4HS3B 1S7WB 1IEAB 4Q74A 3K81A 4LSVH 4CL7A 3PG2A 3VXRD 3SDXB 1B4JL 5IVXE 2ID5A 3MRNB 3OKEB 4OCSL 5D2LB 5B3NA 5B8CC 3RY6C 3MRHB 3SDYH 1WWWX 3NFSH 4FTVD 5E8EB 4UTBH 2Y9RT 5SX5K 2EKSA 5IFJB 3NGBC 4MXQC 4BFGA 3CSYB 3BIBX 2UVFA 1P7QA 2CLZB 5JO5B 3S3JA 2VDMH 2VDRH 1II4E 1FFQA 4PLKC 2HT3C 4WV1A 5GRJH 4LF3B 4PJFE 4Y1AD 5E00A 1IC5H 4POUB 4U1IB 3FHAA 4FQ1H 5EA0L 3ESUF 4XZUA 5F7LB 4ZUTA 5ITBL 2VDPH 3GIVA 3RGVD 5HPOA 5FGBA 4CVXB 3ME0A 1T6WA 1T03L 3JUYA 1YJDC 2HH0H 3NPZB 5BRZA 5F3BA 1G0DA 4XNUH 5F7DA 4DKEH 3BWAB 2BNQD 1RPQA 3KPTA 5IG7B 3T0VA 2XY2A 3JTTB 3RL1A 2FRGP 4JO3L 3P4LA 3FQWB 1RULH 1LO3L 1IRAY 2BC4A 4NQEE 1NGYA 1T66C 1DUYA 4XPHH 4LEOA 5IKCB 3S34H 3EJYD 4MNQA 2IMMA 4NQCD 4QRPB 2BFVH 1M05B 5J1TC 5MHSD 5IJVB 1JPSH 1TETL 1DDHA 2Q8AH 4U2ZA 4OFKA 1IAOA 1WBXB 3G08A 1JL8A 3RDTD 5DF0A 5DC4B 1IBGH 3RTQC 5JOPE 3SKMA 1T0NA 2X70A 2Y6SD 3BZFA 3F8UB 2H2PC 4H8WC 4NHUB 1CF8H 2GJ6E 3BI9X 2BVOA 3VGAB 3NTCL 4K07A 3WIIL 4FFWC 4JM2F 1A4KA 3QCVL 3BT2H 3FAWA 4JFZL 4FMFA 2XN9D 2NW3B 4RIRB 4WDIA 1P9MA 3MUY1 5GRVK 2ZUWA 3I6GA 2BK8A 1F8TH 3NZHL 3HMXL 1GC1L 4U6HA 3FFDA 3LKPB 4LCCB 3K8LA 1YEGH 1T83C 4DKDC 2WIIB 3BP6B 3TYGL 4RMVA 1SYVA 3RWDA 4AMKL 1OLLA 1QFHA 3AREA 1W72B 4ONGL 4LPTA 1R5IB 1NUNB 3O6MH 2E5EA 5JDJA 1PKOA 2P24A 4ONHB 3TGXA 4RGNC 1KCKA 2EDLA 5K9OA 2AW2A 4HWNA 5FUOL 3VFOB 1V05A 1NCWL 4XC3H 1J0ZA 1ZT1B 4G9DB 5JXAL 2K3TA 2Z0BA 3LPWA 5D5MA 1TJGH 5HDLA 5M95B 2UV3A 4W4NA 5L2JB 5K93A 4BQCA 1ZE3C 4K7FB 2FO4A 43CAB 3O2DL 1Z6JT 4FFYL 5F9JA 5MENE 3RAJH 5HGAA 5I73B 3NCEB 4I1NB 4L4VD 4UBDD 2PO6D 3O4LE 5A2JH 4ZQKB 1SJXA 3L5XL 2OK0L 4OZHB 1VSCA 3GNMH 2BZDA 1SY6A 1JNJA 1Z2KA 3PGCB 5EWIL 1O5DT 4OBSA 3ZKND 4JB9L 1KIQA 3S5LA 1YNKL 4KHXH 2L7UA 4Z0XA 2DMBA 2P8PA 5TDPB 3STLA 4YDKH 5KVGH 4OIBA 1TCMA 1C5DB 1OARH 2R8SL 4DCQB 1BGXL 4RMRA 4V1DB 3RQ3A 1JHLL 3RX8A 3OKYA 3QAZC 2A6KB 1UXWA 1EZVX 4BZ1H 1AQDA 5DQDL 4WGWB 2GAZB 5I74C 5I8EA 1J0HA 3HR6A 5E1HB 5JA8B 1QZ1A 3MRMA 3FCTA 5E6YA 3DUSA 4PJAA 3K2UL 1C08B 3O6FD 3S36L 2HRLA 3S3PA 3K4AA 1BEYL 1E4KC 5ALBH 5FXCH 5J7CC 3C6LD 2IH3B 4QO1A 1T21B 5CJBA 4YHLH 2KQMA 3GMOA 3WHXB 1CDGA 4YGVA 3WO4C 4QTHB 4X4YB 4NFCA 2GITB 3NZ8A 3V0VA 4WW2C 3B8SA 2VXTH 3V0AC 1A2YA 2YEZB 2E7MA 2Q7YB 3WCYA 4HBQA 4WFFE 3UJJH 5JDSA 4RQQB 4M6MH 1DQTA 3QXWA 4FQ2H 1U3HA 3TBYB 1U8OA 1UCBH 5ERWA 1K4CB 5EZLA 4P9ML 5FM5O 1RZKL 3SGJA 2DQFB 2FH6A 3TZVA 3FZUD 1K8IB 4M4RA 1AJ7H 1NUDA 1A6TA 3RA7L 4OFYA 4M48H 3RUGE 4UQ3B 1A3LL 4WWKD 2ARJB 2AJ3B 3TNNA 2IG2L 4YQXH 3QUXD 5LQBL 1BBDH 2XG5A 1FZOB 2HP4A 1MIMH 3TT3H 4WFGE 4LSDA 3QULA 3DBXB 4FQCL 3EYOA 1FPTL 1NBVH 4OM1L 4PBXA 2P43B 4E9LA 4RRPA 2DKUA 3WUZA 3FMGH 4GSDH 3P30H 2MCG1 5DMIL 4JPWH 3BW9A 2FATL 1KJ3H 4X99A 3HCVA 1I7TA 3CFDA 3FFCD 3MRGB 3MUGB 1MCOH 2V5RA 4LRIC 4NN6C 4GUPA 5I8OH 2WK2A 4Z7OE 1R3HB 4Y16D 3MJ9A 2ZPKH 1NC2A 1UACH 1R3JB 3VXUA 4NZTH 2PYEE 3WJLC 3BYTA 4XMLL 2R39A 2B1HH 3GSNL 1XCTB 3DXAA 1FORL 2AKRA 1JN6A 1J0JA 1SYSB 3HMWL 1TZHB 4CN4A 1EGJH 4GRLA 5TF1H 1JK8A 2XN9E 3DX8A 4K3DH 3H9ZA 4PRHA 1NMAL 5CSBA 4JVUA 5CCKH 2DI7A 5DD5H 5IK3B 2J2ZA 2XTJC 5DK3A 5H2BB 3J7HA 4U3XA 3GSVB 1XGQA 4PGDA 5LCVH 1F4HA 5J3HD 3MRIB 4POZC 3MC0A 2W0FA 3IJSB 5TH2A 4ALAL 3HPJA 1GGCH 1FNAA 5ILTH 4HIHB 3OSKA 2YD6A 3THMH 3GHBL 5GJSH 3EW3B 5GS3A 5IB1B 3FRPA 4NT6B 1HIML 1E28B 3O6KH 4OB5H 5E8PA 5E5MA 1C5BL 4LLWB 4ODBD 5HYJD 3TVMC 4PV9A 1MQ8A 2DQDL 3WLWC 3DYPA 1IGIL 2AJYL 5IM7B 3VRLF 2X1QA 4F15B 2ADJB 4ELKB 1GOHA 2J3SA 5J12C 2QTEA 1XGUA 2VDKL 3QPXH 3BH9B 3V4UL 2AXFB 5DHXB 4LASH 2GHWB 4IRJC 2Z35B 2JB5L 5IIEA 1FAIL 1XF5B 3LVEA 5EU6E 5BCAA 1FNGB 2ZUYA 2DOCA 4GG8B 1NGXA 2P1YA 3KPSB 5D7JB 3W0WD 2EDTA 4HUVB 2RGSA 3ARZA 3JBG7 3BSZL 1BD2D 1UENA 5H94A 1KIPA 2OJZH 4I3RL 2NY2D 5DJYA 1J7VR 2IALA 3L3KB 1CU4L 3U46A 2R2EA 2YD2A 4PG9B 4KKCC 4Y2DD 5E56A 5EIIB 3MXVL 3Q6GL 5F7KC 5CBEA 4ZSOB 1FN4B 4PJDB 2CKBL 5HHMD 5L88L 5E2UH 2EDHA 2F54B 5EOCH 1OL0A 3C5JA 3X12B 1PAMA 3E1F1 2GCYA 1BP3B 1YUHB 2YC1A 4PRPA 5E9DE 5L9DL 4DGVH 1JTTA 2HT4D 3WHE1 1I9IL 4W68A 3QQNA 1IL1A 4AYFA 1MHPH 2XA8H 3QDGE 2CPCA 2MHAB 4HHAA 4Q9RH 3OR6B 1YEFL 1YMMB 1PY9A 4AM0B 1VFBB 4HEPG 2IADB 1G7JA 1CI5A 2Z9TA 5IMOA 1X7QA 1S9YA 3S98A 1KENH 3V2AR 3MQIA 5DD3H 2A73B 5JOFA 3VA2C 5IW1A 1RK0A 3BGMA 1INDL 3G04A 1EXUB 1CVRA 3DRTA 5E6ID 4BFIB 1ZGLP 2HG5A 5J6HB 2BP3A 4KK9C 2C3GA 3MRKB 3VRJA 4M62H 1IT9H 4XPFL 4WVRA 5B8CA 1C7TA 3P9LA 3QWOA 3S3SA 1UQSA 3QIUD 3ZMRA 1G1YA 2W07A 3U30C 5E2JA 3UJIL 4JFEB 4IRSB 2ADIA 5IQ7L 5HDQL 3VFNA 3OTTA 4PJ5A 1OAUH 4X7SL 4MCZA 2WP3T 4EUPB 1NGWA 2EKSB 4ZTOH 3BPOC 5DGQA 5I2IA 1EUUA 2D7PA 5I1CH 2FX7H 4YWGL 3CX5J 2VUOA 4TUOB 4WUKH 4WV1B 5GS1B 1AR2A 5E00B 4HH9B 1KC5L 3GEWB 5AZ2H 1PQZA 3IDGB 1HQ4A 1INQA 2WBWB 2YWZA 3TC9A 5B3JF 1CD0A 1U36A 3NABL 5JXEA 3MJ8B 4DUVA 4AEHL 4G8IA 5K59E 4NNPL 4M1DL 4QWWD 3B2UD 5F3BB 1U58A 1LNUB 2XQBL 4TNWF 5F7DB 3X14A 1IKNC 2OSLB 3MREB 4U49A 5CBAB 1J0IA 5SX5H 3TO2A 1VA9A 4WTWA 4EI5C 4B0MM 1NGYB 2CK0H 4U05A 3RTQA 1DUYB 4LEOB 4PJIB 5CZVL 3SHSA 1FL6A 1EK3A 5IVNA 1MFBL 4OZGB 4Y5XB 1DDHB 4WHYG 1IAOB 5E7FA 2CXGA 2OL3H 1FC2D 1T0NB 1BF8A 1R24B 3BPNC 3UCRA 5JR1L 3NACH 2R0LH 2I07A 5C2BH 4L5FL 4RGMC 4XNXH 1FIGL 5IMLA 4GAGL 5HI5C 4JFDD 4XH2A 4JAMB 4EDWH 3OJMB 1BZ7A 1Z9SA 4JDZB 3U4EB 3T2NL 2O61A 3MBXL 1XCQB 5GPRA 1D3CA 4NQSB 1A64A 1TMCB 4K3HA 3HC3H 3C2AL 1MCWM 1JYNA 1KN4H 5LVEA 5C9JB 5E99H 3RX7A 3VD7A 5E94A 4G6JH 2NY3B 3NH7L 3H7BA 4BH7A 1X6NA 5HYIA 3PF2A 3VJ6A 4L1DA 2V9TA 3QIWC 3IDMA 1CFVH 4N0UA 2R56L 4TVPL 5C09D 4B7LA 1NFDA 4J4PD 3QXUA 4CJ1A 1KN2H 2B8OT 5ESAA 2R0KH 4JE4B 1M7IB 1WC7A 5BVJB 3ARGD 2VSDA 4OZ4B 4GG6A 4WO4A 2AGJL 1NCCH 4WFED 1MWAA 3IDXL 3I9GH 3C87A 1RFDL 4J3XA 1CTNA 2V5MA 4BSWB 5MERB 4LP4A 5T3ZD 2V6HA 2CD0A 3IAGC 3VI3F 1TVBA 1U6AL 2LTQC 4TNWK 2CLVA 4NJ9H 5DZLA 3Q1SL 2AJXH 3V5HB 2NY4D 4YXLH 1UB6B 4OLVL 5D1ZA 1G6RH 4TVPE 5ICZB 3BO8B 1FFPB 4XXDA 5I30H 5D8JH 4XXCC 2FO1A 3RVTC 1OAXH 3LHPL 1H9VA 1KIQB 1LP9A 3ZE1E 3S5LB 3PJSB 4Z0XB 3S7GA 3STLB 1AE6L 3HE6A 2DLIA 5FFLA 1HH6A 5HYSA 4KHTL 4X6FA 1BQUA 3QDJA 4KMLB 5K9JH 3DJ9A 4FQQB 4N0YL 3W5MA 4G3YH 4HV8B 4P3DA 1YN7A 3CDGA 1JZ8A 1LEKA 4RNRB 1E4KA 1UXWB 2DM2A 3BP7A 3TJEH 5IVXF 3JSSA 3O9WC 3QH3B 4LCWD 5I1LA 3I2CL 5GJTL 2BRQA 2VKXA 5BRZE 2HLFD 2IAMD 3MRMB 4PJAB 1UADC 3BIAX 4XCFL 1IC4H 1J0YA 2ICEA 1A7RH 4UB0L 3ARSA 3C5SA 4OLZH 4OM0H 4MNQE 5E8OA 3GKZA 4Z8FH 3L5JA 3DV6A 5I17A 4YGVB 1KTDA 5I1KH 4H88H 5TE7L 1CE1L 4YAQB 5BMFL 2J4WH 3RU8H 1P84J 2BCKB 3GB7A 3WFEL 2AJUH 2GKIA 3DSFH 1BBJA 1QYGL 2HWZH 1L6ZA 2VXSH 4S1SH 1YMHA 4Y19D 5JDSB 3LDBC 3MZTA 4IDJL 1Z5LA 4NWUH 3K1DA 1LEGA 4XCNA 5ERWB 4NRYA 5EZLB 1TZIA 4OZFB 1CL7L 5E08L 4D0BA 4PJ7B 1W0YT 4JFQA 1ZLWH 1MCEA 3KAAA 5CGYD 4M43H 3CUPB 1YC7A 1NDMA 2XRAL 3U6RA 4ZTPL 2RFXA 1T04A 4RISH 4DW2L 4XVUD 5FKPA 3TNNB 4PJBB 2ICWI 3VWJD 3EDFA 3T04D 5EC1A 2R23B 1MI5A 3RZCC 3UPCA 2W9DL 1NDGB 3WFHB 1SY6L 1M1SA 3OXRA 4LRIA 3ULUD 1U8MA 1FRGL 3BD3A 2LAAA 1N5YH 5C0BA 4KK8D 4TPRL 4J8RB 4JREC 1VEMA 5HY9A 3WJLA 5LAXA 3BPCA 4TULL 1K4DA 3L7FA 2P8LB 4ODTL 5JW4R 2KZWA 3SQBA 2YD3A 3BW9B 1H3GA 1DBJL 4JQXC 4X99B 3HCVB 3TF7C 4NP4L 3CFDB 4ZNEA 4OV6F 1LDPL 5D5ME 1I3RA 1M6OB 2B2XH 1NC2B 1L7TL 3EYQD 5IMMA 1NMCC 4MD4A 2QBWA 4D0CA 5SWSD 4MSWB 4YUEH 5IBTL 3OR7A 3R1GH 3DXAB 4JDTH 2QV2A 1HK6A 5B38A 1WEJL 3VXSA 1FNSH 1S8DA 4RGOH 1CXKA 4J3UA 2GW5A 2VZTA 5E4IA 4GRLB 5C1MB 3V7AG 1JK8B 1E4JA 4RDQF 3KLHC 5J11B 3GRWA 4JY4A 4NSKA 4PRHB 4HUWA 3ZYZA 1CT8B 1KPUA 2PW2B 4M7KH 2EDQA 2C3VB 2X4RB 3ARFC 1U2CA 2RHEA 3HI1A 5JQHC 2ZCKL 3VCLA 2Q76A 3HNSL 2NZIA 3QO0B 1KTLB 4PGDB 5LBSH 3D39A 4Z18A 5I9QC 3S88L 4GQ9L 3PHQB 3ILPA 4QLRA 5C09E 1FBIH 2BVYA 3HPJB 5L2KD 1JGEA 2CIIB 4UAOB 1T2QL 4JLRA 1E4XI 5J56B 1J12A