3SN6N

Crystal structure of the beta2 adrenergic receptor-gs protein complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
128
structure length
128
Chain Sequence
b'QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYKMNWVRQAPGKGLEWVSDISQSGASISYTGSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCARCPAPFTRDCFDVTSTTYAYRGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(s) subunit alpha isofor
molecule tags Signaling protein/hydrolase
source organism Bos taurus
publication title Crystal structure of the beta2 adrenergic receptor-Gs protein complex
pubmed doi rcsb
total genus 27
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2011-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sn6N00
1S8DB 1G7LA 3N9GL 1TETH 3NCEB 4QY8A 5EUKB 4M43L 5HI4C 3O6KL 2WZPD 2NR6D 4XNUH 3BD5A 1W0WA 2FSEA 4KROB 1TFHA 5FKPB 5JW5A 3MA7B 4N8VA 5BV7C 3C60D 4YPGA 3TZVA 1AKJA 1HE7A 1F4WH 5CGTA 4K3JH 4OF3A 1NBQA 3RGVB 1EVTC 1I9EA 3VXPA 4B7IA 4CKVX 4PY8J 1MCNA 2I9LB 4HMCA 2NY6B 3B5HA 1PSKL 1YNKH 2R15A 4NHCH 4R4BA 5D1QB 5TDPB 2HG5B 3BD4A 1MY5A 4KK5C 1NAMB 1HI6A 3D6GA 5MI0C 2PYED 3JXAA 2UWEE 1MQ8A 4AT6A 1S9VB 2YD2A 1MQKL 4H0IA 2IFGA 1ITCA 4MAYA 3BZ4A 4F58L 3GIZH 4NHUA 3OZ9L 4HS3A 2GKIA 1CXIA 3GSNL 1JGVH 1UXSB 4L3CB 2JCCA 1QFUL 5MERA 2X4QA 3MRFB 4NT6A 1NMCC 1CZ8H 3GMNA 3G04B 3LKPA 1A9EB 1CK0H 3BKJL 2E6QA 4KWUA 5HYSB 5E08H 3CSYA 1KB5H 5LBSL 1XGYL 2X1WL 4IJ3C 5IR1B 2Q3ZA 1DBBH 4JPWL 1QSVA 5DYOA 3B9KB 5DSCB 4OLZH 1JHLH 4JPVH 5DZLA 3OJDB 2ZWLT 4JLRB 1YQ2A 3GSRB 2OSLA 1KEML 1ZHBA 1LGVA 1T22A 5DUBB 3T0EA 1XGUA 1A1NB 1JNLH 5DEZA 4UIKL 5D6CB 2OR9L 5F96L 2DWDB 3C9NA 3IKCA 4WWKB 3MRCB 5I19L 4MD5A 1OLZA 1U58B 2WP3O 4GRLA 4LLAA 2VN7A 3O3UN 3LIZH 1I8MA 3HPJA 4MQSB 3RWCB 3ARBA 1CFBA 1SYVB 3SOBH 5DRWB 4U2YA 3F7VB 4XBPB 3FO9A 2AABH 3ROOA 1UEMA 4LLWB 4NQCE 1Z0NA 1PDKA 1ZHNA 4K7PY 4OD1L 4HKJA 3OV6A 1J0JA 4DK3A 5EZLA 3RIAK 25C8H 4L4TB 4CDGC 5INCA 2QLVB 1CIDA 4ZS7L 5E4IA 4NQVA 2WQ8A 4YHMH 1A6PA 1Q8MA 1C12A 1DLFH 5F1NB 1NCCL 4ZUUB 1H15B 4NOBA 2QSQA 3NCYP 1WJ3A 5H2BA 4NQDE 1FNGA 5TPWL 3LY6A 3SDDC 1BIIA 4XPGL 5BV7B 5CKGA 1QEWB 3LRSB 2CQVA 3D39D 2CLVB 4XMLL 1NGQL 3PWNB 4XP5L 1EIBA 1F90H 3VMOA 1BVKB 3V0VA 1S78C 3SCMB 2IPUK 3RPIA 4PTTA 2OTUA 4LPUA 4UMGA 3BKML 1DQML 4Z0BH 3UC0L 2Z4QB 5IR1A 1B0GA 4HHAA 1S7RA 5FM4A 3NIDF 1SJEB 1MFNA 2H6PA 4I3SH 4I13B 3X11A 2HYMA 4S1QH 1CGSH 5J1AA 4JY5H 1I1CA 1U8PA 1LO5B 3V52H 1RHHB 5E2UL 1CF8L 4TSBL 5E2WH 4J3TA 5ISZB 4PJAB 1YPZB 3BJ91 3Q1SL 5EN2A 4K7FA 4HKZA 3RY6C 1A7OL 1Q9LA 3B43A 1WT5C 4QKXB 1DSFH 4HT1H 4JCMA 3MO1A 3CIQA 1VEOA 3FT3A 1X5FA 5B4MD 1YJDC 4CMMB 1IAIL 4JFYA 5AZEL 3QRGL 1NBZB 1LHZA 3U4BL 3VWKB 2VDPH 2YEZA 4CADB 4HKXB 4HZAA 1MVFA 1BJMA 1GOGA 1OY3B 1T2XA 4FFYL 2X4UB 1MFDL 1SMOA 5IK3B 3ARFC 1U9KA 4OM1H 5JOFB 4L8SA 5FHAL 2V2WB 1WV7T 3T0EC 2A0LD 5AZ2H 4XP4H 1J7VR 5D6DC 5FUCE 1N7MH 4NSKB 4J3WA 2Y1VA 2VITA 1ZT1A 1INQB 4ORGA 2DKUA 3QWRD 5CEZE 4QOKD 2BNQD 3BMVA 4HWBH 4M5ZL 4HLZH 1P2CB 1LO2H 2NY4C 1MCIA 2P7TA 3CCHA 4TPRL 4EXPX 3PWNA 4NN6B 3E8UH 4OTXH 4WV1A 4EBQH 4HCRH 3OXSA 4N5EC 1KCSH 1M7IA 4PG2C 3VD4A 3RIAF 1I3RA 1QLEH 4JN1L 2W38A 5BV7H 1W2KT 4RFNB 1ZLWK 4OJFH 4QXUL 1NANH 2YEZB 4CADA 3OKDA 3ZTNH 4D2NA 5KTEL 4CU8A 5KS9F 5GISL 1F4YL 1MHCA 2C1PB 4JGUA 1WFNA 1MCQA 4K8RC 1VDGA 5J7CC 4YUEH 1QYGL 2VH5L 1JWSB 3HNSH 3SGDI 2JELH 3IDMB 5CJQH 2NQCA 2W0KA 3X17A 1CFTB 5DEGA 1CQYA 1FV1A 3G6JE 3SE8L 3NABH 1T89A 2Q20A 4HFUL 1JNNH 4G80B 3OKLB 2R56H 2Z92A 5E95B 1D9KB 1UWGL 3MXWL 3BEWB 2XV6B 2EYTB 4F3FB 2ITCA 4OF5A 2KZ1B 3H9YA 3VWKA 4CMHB 5DD6B 3QBTB 4JPIA 2RCSL 2H9GB 5F3BA 1CL7L 3G5XB 4JVPA 5IW1B 2HP4A 3W11D 1Q9KA 1WBZB 3VFUB 1IM9D 2Y5TB 1ACYL 4X7SH 3V95A 5GGSB 1R3IL 2CPCA 3PDGA 3O0RL 2ZZUT 4ZUTB 2F5AH 4GG6B 1RHHA 2JB6A 3ULUD 2FCBA 3D9AL 3O2WL 1EAPB 5M94B 4Z7VF 5LGHL 4LFHD 1PYWB 1KJMB 1KULA 3ULVF 1JPSH 3G6JF 2GIYA 3VRIB 3MOQA 4HW6A 4HJJH 4F9PC 3O6LH 4DUXA 1DUZA 1CTOA 1U2HA 5BOZG 3HFMH 1PEZA 4LF3A 1RJYA 4HMDA 4Y4KB 1TNMA 2ZKHH 5BRZA 3NN8B 1GPOH 1QO3B 3EYFA 3QWRA 4ODSL 2GT9A 4GMSL 3BQUD 3DGGA 3TNMB 4DGVH 4F7MA 2D9CA 1IAMA 4M03A 4ZO8A 3HE6B 3REWB 3QDGA 3T1FB 3SDDD 3FB6B 1HXMB 2A6JA 1CLYL 3JV4B 5IB5B 3E2HC 3AM8C 3C5SB 3HI6H 2VIRA 1JN6A 4NPYA 4LPCA 4WJ5A 5ERWA 3GM8A 4PLKD 4PRHE 4YQXH 4ZTOH 4MXQD 1GL4B 3U7WH 3RL1B 4XAKE 5FUZH 4YEFA 3O4LB 2UZIL 3MCKB 4KMTL 1UM5L 3R1GL 4M48L 5JLZA 5F6IC 1A7RH 2NX5A 3RZCB 1NFDE 3VDBA 4I2XA 1QR1A 5ISZD 3T4YB 5J12C 3KJ4C 2MQ0A 2DQHL 5HPOA 2PKDA 5GS2D 4EEEA 4X9IA 2IH1B 3DROA 1DEEA 3ZTJG 3MPCA 2VNCA 3TT1L 4R3SA 4M1CD 4HAGA 1MHCB 1J86A 2WUBH 3IDNB 4UV7H 2AEIT 4EZMA 32C2B 1MCOL 1JGDA 4O2CA 1SVCP 4OLXH 3VWKD 1QBLL 1EO5A 1JHTA 1T2QL 4WFFE 4GLRI 4RAUA 4HIXL 1EXUB 2GY7B 2KBGA 4Z7WB 1D6VL 4FQQA 4MB4A 2PW1B 3G5ZA 3RZCD 3BZEA 4HUMB 3RKDD 3ARFD 3DXAE 5E8PB 4C56D 1NC4D 4S1SH 4YIQB 4I18B 1W8OA 4PJ9A 3OAZH 3BPCA 4HZLB 3ES6B 1ZT7B 4HEME 4TULH 2ZUXA 2KQMA 2CDEB 1NBVL 1AE6H 3BD3A 3GSXA 4KKBC 2VDKH 1RJCA 5IESH 5KVEH 1H3GA 3BW9B 3E6FA 5D72L 3MV8A 3MLXL 4MAYC 5CEXA 5C07B 4OKDA 3PWUB 4ZUWA 2BNRE 4G5ZH 4V1DE 3ARSA 3OPZH 4XVUD 1YEHH 3MLZL 2WUCH 4XBEH 5TF0A 4S1RL 4IRSC 4QRUA 1V7NL 5HYJB 4FQCH 1KCUL 3RTQB 4MNQE 2APFA 5KZCB 2MQ3A 5IB3B 3UBXB 5IFJB 4N8VB 1X3DA 3M17A 1HSAA 5IP4A 3SE3C 4I18A 1IARB 5D70L 3BYTA 3QR2A 4HZLA 3HC3H 4EI5D 3QIWC 3ULVH 3ZLQC 1JGUL 3KNBB 2IADB 3N1QC 1Z3GH 4JM2C 1SJHB 3FQUB 4OI7A 1H3XA 3BSZH 1A2YB 2VJXA 4QYOB 4Z7QF 5SWQA 2NXZB 5AD0A 4JM2A 3HHRB 5I16B 1KCRL 4GXVL 3HI5H 1TPXB 1QHPA 2VDNH 2C4FT 4LSSL 2OTPA 4EKXA 2NY7H 5JPMB 3DMMC 3ARDC 1NCBL 1QRNE 3LQAH 1DDHB 1OTTD 4MJ4A 1R3LA 4X5LA 2GCYA 1LDPL 1DVFC 4LRIC 1CD1A 3ARRA 1EFXB 1KXQE 2FGWH 2A1WH 4MXQC 4KAQL 3MV8E 1VADA 2VISB 4HS6A 3UYPA 2X4SB 5AG9A 3IFPB 4M1DL 3OHXB 5DUML 4OV5B 1G9MC 1NMAH 3H9SB 3HG1B 1M7DB 4MA7H 4Z0XB 3GRWA 1MIML 3A6BL 1U41A 1CLCA 1KIRB 3BGFB 3DV6A 4FQ1H 3VE0A 5FA3A 1I9RH 3JV5A 2R69L 2W0FA 4NKMB 1UA6H 5DRXA 2DJ4A 3GI9L 4R2GD 1MH5A 5GZND 4M1CC 1YN6B 4YEEA 1CD9B 3LB6C 4GRWF 4PJ9C 2LU7A 4WFHE 5I1IL 4U1SB 4UDTB 5IMOA 2Q8BH 4ODWB 4O2EA 3U46B 4U33A 2B4CL 5TF1L 3L3DB 3OGCA 3HN3A 2DQUL 4K55A 1A5FH 3WFBH 2WBJC 4JHZA 3EYOA 1U8LA 4PJXA 3CZFA 1T5WA 4NQEB 3O6FC 1K4CA 3F7YB 3H42H 3DTXB 5DYOB 2QL1A 4A2LA 3B5GA 3ORJA 4MNGE 5KSBE 1UGNA 1C5CL 4ZFFB 5IW6A 3JWOL 1S9WB 2W07A 1XGTA 3C60B 3IDYC 5L8JB 4X9HA 1N59B 5GGRB 1S7WA 5C0EA 4XRCA 4H25B 4YX2H 2OJZH 4QRTB 3QEQD 4KKBD 1YZZA 4XCYA 4F9LC 3DSNA 2L4OA 3H9HB 4NQCA 5FYLD 1HILA 2VERN 3TBVA 4HK3J 3GGWA 3FCTB 3S9DB 4YDVA 1QSEA 3ARFA 2UYLA 4KJWD 1HNFA 4BSWB 3O9WA 4XVTL 5F21B 2HRPH 4MQ7B 1JTOA 3U7YH 4ISVA 4H1LH 3MJ8B 1H3UA 4M6NL 5LGJA 1FIGL 3MLYH 2ICWB 5ICYB 1K4DA 4XWGH 5EA0H 4GAJH 2OMBA 3S5LA 1EEQA 5FF6B 3L3IA 1IGJB 3S36X 5C2BL 3OHXA 2ILLA 3RKDC 5GGRA 4NZJA 2DQFA 2WM0A 1IFHH 3SJVE 2H32A 2GITA 3UTSE 2HFFB 3GMLB 3PQYD 1R0AL 1KYOJ 1N2RB 3K0WA 4PJ8B 1AP2B 3DO7B 1E4XI 3QUYB 4YR6A 4OBRA 5DJYB 3EO1A 4D0DA 2Y06H 1P4BH 1R3LB 4JRYB 4HC1L 4JFPA 2YBRA 3AB0B 4EIZC 2AEQH 4L5FL 5C09D 4LSRL 4RQQB 1IC5L 1FORL 2B2XH 3L3DA 4M43H 1UQSA 2X9YA 4XMKH 2E7LC 2B39A 4E5XA 2VXVH 3TPKA 2CMRL 2R0LH 4PREA 3QCUH 5HHVH 5KSAA 1N64H 5D5ME 4MYWB 2Z8RA 1IL1B 3CDCA 4LEOA 5BVJB 4RMTA 3ALPA 1DL7L 1PKQB 4S1DC 4OF7A 2NY2D 4KJQC 4Q6IC 3HZKB 5C92A 1C1EH 1AGCA 4ZXBB 1W0WB 1FN4B 4LSVH 2OK0L 2YXFA 1KENH 2W60B 4NNPL 2FX8L 1RJLA 1E4KC 2DL2A 4N90E 3PF2A 5F1IB 1OHQA 2NX5E 1DE4B 4G9FA 1R3JB 3EFFB 3IU4L 4IMLB 1QFUH 3MRLA 1JF5A 2Q7YB 3H9SD 3HG1D 3B4NA 4H5SA 4YXHL 3U2SB 2XA3A 1OF2B 3UTTB 5LWYL 1KLUB 1XH3B 4EIGB 4KUZH 4NRZB 4PY8I 2BVOA 5EO1B 3T65B 3WDHA 3BH9A 4NN7C 3L3KA 5FYKD 3GMPB 1WCQA 2EXWD 3GMQB 1OAQH 4ZPVA 3C6SB 4JFDB 1MJUH 3WJJC 4NNYA 4QY8B 4MGXA 2W1NA 2YPLE 2GTWB 5GXBB 2ADJB 4DUWA 1QNZH 2CLVA 2XZQH 1LD9B 3C2AL 3QDMA 3OAYK 4J3SA 3HS0A 4ISVB 2P8LA 3MGOA 5J11C 1QUNA 3QHZH 3U79A 1UENA 1V5JA 5FYKL 1O7VA 4RAUB 3RU8H 2GTZB 1TZIA 1PEWA 1FYTE 5JHLH 1GSMA 2AEPH 5E1AB 2VDLH 1U91A 4O51B 4KRMB 3ZE1F 1F4AA 1WCBA 3H9HA 2RJMA 2CD0A 3BH8B 2CR3A 1OCWH 3EHBD 3LEVH 3MBXH 4P2QD 5EIQA 2IQ9L 1E4JA 4TOYH 3FTGB 1JNJA 1N26A 1UZ6F 3CFKA 2DYPA 1U58A 4G6JH 3SO5A 3WO4B 3CU7A 1T1XA 3H3PH 5D6DA 1NBZA 5IQ7L 5C6TL 1QACA 4LVEA 3VGFA 1KG0B 3DIFA 4FXLA 5ILTL 1OQXA 1GC1H 1MI5B 4XP5H 2ZCHH 5JO5B 4D9QD 2I26N 2VR5A 3IS1X 2SEBB 1F4HA 4X0KB 3QFDB 3GSRA 1F58L 4ZUUA 5IGXL 5D2LF 5D7SL 2BVTA 4I3SL 1AP2A 1F2QA 2HJKB 4Y5YB 4BM7A 4KH2A 2OZ4L 4F3FA 1KLGB 1GGBH 4DCQB 3QYCA 2WIMA 3RAJH 4XVJL 4M62L 2LTQC 5DJAA 4TUJB 1IC4H 4J23A 3QG7H 3AB0C 3MUGB 3CFBB 5GGSA 2FJHB 3OB8A 4NJAL 1ZLVK 3SJVA 1LNUA 1OB1B 4JZOB 2P8MA 1S5IH 4OIIH 2BHZA 3HNVL 2JJTC 4PPTA 1CGUA 4JDZA 4KGLA 2EEBA 4U1HB 4X0KA 4KK5D 5I8KL 2QQLL 4RAHA 4MJID 4HIHB 4L4VB 4Q9RL 1T83C 2UWEB 1HHIA 2CDFA 2VLKE 3AXLB 5JNYB 3W9DA 5HHPA 3KPRD 1G84A 2CGRH 5TGBA 4FQIH 4TUOA 1AFVH 4OCXL 1RZIB 3L5IA 3BH8A 1IT9H 5D2LE 1YDPA 1ZK9A 2R8SH 4BQ9A 1D6EA 4DN4L 3EO9L 5T5NG 2J3SA 2FYYB 2NCMA 2AI0H 4WENB 4S1DD 1K6QH 1D5XA 4BJLA 4LARH 4P2OB 2C1PA 2GK0B 4RGNC 2IAMB 1U93B 3LS5H 5F71A 5BCAA 2Y4SA 3KS0J 1HH9A 3SDAA 3GKWL 3IDMA 5GISH 1CDUA 1H9VA 1RZKH 3F12A 4OZHF 4GRWE 1IKFL 1EVUA 5IFHH 1RAMA 5C9JB 4B5EA 5D1XA 4G8FB 5IJVA 1P2CA 4R4BB 1A7QL 1TQCC 4MS8D 1UM6H 1M05B 2FATH 5DUPH 2XN9B 2XIDA 4ODTL 4IOIA 5TPWH 1I7ZB 4P2RB 5KVFL 1J8HD 4HBCH 4OGAD 3RGVA 3INUH 5T1KA 5J1SC 5C0GB 3MREA 5BMFL 1ULVA 2EC9U 4LCUB 4WCYH 2CIKA 1M4KA 1QBAA 1IM9A 2F54A 3PHQA 5FOBA 1D9KC 1IC7L 3SDDA 3MRHB 1L0YA 2BFVL 2ID5A 2VXUH 5BXFA 3QFJB 2VLKD 1RK1A 2JIXA 2YPLB 5EUKA 3MLVH 3CMGA 2J6EL 5B4MC 5EFIA 1KIQB 1WBXA 3LPGA 3SN6N 4RGOH 3LCYA 4MVBC 3CC5B 5DS8A 4M6OH 2DB8A 3MRIB 1YECL 4YNYB 2DAVA 3MLUH 4LPWA 3RWDA 3HMXA 1BIHA 1LE9A 2YWYA 3O2WH 5B38B 4FOMA 4PLJC 3UYOD 2FL5A 3IDIA 4R2GB 1JPSL 1U8HB 1X9QA 5CS7A 3L5WA 1NAML 1XF3A 5ESVA 4Z5RB 1W72L 2ZCKL 3NTCL 2A6DB 2ICES 1MIEL 3REVA 3SDDB 5FOBB 3QDGD 5L2KD 4OM1L 5I1AB 2AK4A 2BVPA 3TA3B 4U7MA 1BZ9B 1KF9B 4Q74A 3W82A 1EUUA 4U6XA 4ODSH 5KANI 3BKJH 4DGIL 3TPUA 4PS4L 5HD8D 3SE4A 3MGAA 3F8UB 2PYEE 1EBPA 2Q86A 3G5ZB 5F7UA 5AUMB 5SWZE 5IJVB 4DQOH 2NY6D 5EC1B 3RWGA 1G6RB 3MJ6A 3EYFB 3KR3L 1KCSL 3T0WA 3T77B 2OSLB 3LKOA 4HIIB 3K8LA 5F7DA 3MUGA 4HKJB 4U1MA 2V5TA 1Y6MR 1IGJA 5EH1A 1MFEH 1WBYB 1OTUC 4LCWE 4M7LH 4XHQA 5D5MF 2D7MA 3Q5YA 1T03L 1I75A 2A0LC 2IBZY 1YNLH 1FYTB 1NDMA 2YD5A 3EO0A 3FO2A 4YUEL 5C6WH 4ZDHB 1ND0B 5C07D 3VG9C 4K23H 3JV4A 3O2DH 5TDNA 1WEJL 1OVZA 5GGVL 5FFLA 4KTYA 3VXTA 1QSZA 3RX8A 1HXMA 1KC5L 4XGZB 4Q6IA 3D0LA 5F7MC 1EXUA 5SWZD 3WS6A 5D1XB 4C56B 4OD1H 5HVFB 1FAKT 2MQCA 1QFPA 3QIBD 1QFWL 4C59B 25C8L 3ARBB 3BP6A 1DUYB 3D85D 1FBIH 3P4OB 3QH3A 3ZTJH 1LO4L 2VLRE 3CU1A 3CD4A 3HC4L 4PJCB 5GRZA 5CSBA 3D3VB 1DQJA 5D7JC 1TZHA 2ICCA 5EBLB 2BVYA 4X7EC 4AY0A 2OM5A 4S1SL 1J1OH 1I8KB 2HTLD 4PGBB 3CH1B 3VFMB 2IFFH 4JFXB 5E8OB 4JO1H 3HE7C 4I1NB 3BKMH 3KVQA 5JQ6H 5E8NA 2BOBB 4RX4D 5E5MA 1F3JB 2WW8A 3S88H 5L0QC 3GHEL 2EYRA 2VQTA 4GMTL 2Z35A 3BPOB 3Q2CA 3AFLA 4HWUA 2QADD 4OCYH 3VI4F 5DWUL 2DLFH 5E2WL 5EC1A 4JFED 1IGYB 2VDOH 5EU6D 3TN0A 5D7KD 1K4CB 2C3VB 2BNQA 3D39E 5ESQB 3QNZB 3QAZB 3W11C 3OXSB 2WLYA 4WI5A 1IGFL 3IGAB 5F7YC 3V6OC 1KIRA 4WU7B 2UZXB 4X98B 4LVNB 4LIQH 5SWSB 2H8PA 4LAJH 1Z3GL 1WZKA 4JFDE 1A7NL 3LQMA 3FB7B 3IS0X 4KKCC 2YD1A 3O41A 1T7XA 1HHGB 5GS0D 5L2KA 3QUZA 4HDIB 1ZWIA 4XP4L 1SM3L 5FM8A 4ZTOL 5EBWA 4OZFH 1UB5B 4WI2A 5SV3A 3PWPA 2X4RA 2V2WA 4XZUA 1QQDA 3S34H 2X4SA 3LQAL 3WIHA 1V7ML 2FGZA 3WHE0 4K3DL 3BP6B 5GZOD 4J12A 1JGLL 4PJFE 3TV3L 1Q0YL 3L95B 3BT2L 5F1KC 4E0RB 5AD0B 3ARPA 5E94A 4OLUL 1BOGA 3CDYA 3Q6GL 4WHTA 2WINB 1NJ9B 2DDQH 4WO4B 3FQUA 3DXAA 3O3BA 4G6KL 3WFDH 3UDWA 4F37F 2V5SA 5KSVB 4YWGL 2I9LA 1K9TA 3L3HB 4P3WA 1JE6A 1F4YH 4X6CB 5HHOA 4NNXB 3SE9L 4OCRH 3L1OL 4J4PA 4PGDB 4P57A 4XMPH 4KHTH 4PRHB 1ZGLB 3HNSL 3QUZB 2P8PB 4HDIA 1R3KA 4HWEL 4XPFL 4NCC1 3IXAB 2FH6A 4ODVL 1LEGA 3IRZA 3P0VH 2XWJA 3QIBA 5DR5H 3R06B 4G9FE 1UQSB 3WNOA 5CKAA 3QIBC 4TSCL 5IT2L 1H8NA 5E9DD 4MJIA 2WP3T 2J1KA 3IFNL 4IS6A 2EO1A 2R9HC 3ARGC 4E42B 4RGMC 5D1ZA 1C16A 1CICA 5E9DE 2R2EA 3RY6A 2F53D 3O2VL 4NM8L 4Z7OF 4CRPA 1E4XH 3SDCB 1ES0A 2EIBA 3BYYA 4I48A 5HGBB 3WV0A 5D7IB 4NNYB 5L2KB 3RVTD 2HFFA 1IQDB 4P2CG 3VWJB 3MFGB 3OMZA 4XCCL 3HTLX 2ERJC 1QQDB 4MQTB 1AQKH 1PG7W 5TE7H 1T4KA 1TMCB 3MRBB 5FM5M 2DMBA 3QQ9D 4LCCB 1PLGL 2BX5A 4YGVB 3I6LE 2K3TA 4WWKD 4IDLA 3IB4A 5IK3A 3OGOE 3NFPA 5IB2B 2QADC 5A2IH 3IU3A 4HUWB 4TRPH 3HPJB 3RWCA 3WD5H 2JIXD 1TVDA 3O6LL 4XB8A 1PFCA 5GGQH 1LEIB 4ZUSB 1HHJA 2BSRB 5C9JA 2ADFL 4I18C 5E00A 3DROB 3RVUD 1FHGA 1UWEH 5F7NC 2APWA 4PV9B 2XPGA 4H26A 4GMSH 5IMKB 3I75A 3GEWB 5L7XL 4HKZB 3FCTA 2BSTA 4ZYKA 2ZP0T 4ZOAA 5IBTH 2H26B 3VXUD 3G5YA 5KVGL 4UTBL 3V4PL 5D7JD 2VZTA 3MA9L 4HIEA 1RJYB 1CDCA 2I5YH 3WFCH 2X41A 1ZWIB 1II4E 4LKCB 4Z9KB 4Y5YC 1G7MA 4U6YB 1P1ZB 3LDBB 4P46D 3DHMA 2VZSA 4PJFF 5I1CH 5ICXB 1GOFA 4YH6A 1KB5A 2DWEB 3WIIL 4QOKA 5T1DH 3UXFA 1UH2A 3KPSD 4LQ1A 5ANMB 4FQXC 4PJ9D 3Q5TA 4L1DA 4FQ1L 1UWXH 4YHZL 3IJYB 3VJ6B 4NWUL 4JDTL 4OCMC 1HQ4A 4L4VA 1D5IH 1UA6L 2VABA 2HFGH 5C8JA 2W9LA 4ALAL 5E8EB 1RIVL 3QCUL 1BFOA 2VXQH 2Z31B 3T8XA 2VE6B 4UB0H 4MX7B 4K94L 4NO0A 5EO9B 1RZKC 4YBQC 4FTVA 2CDGB 1TJGL 1NEZB 3VFNA 3G6DL 1DVFD 2J88H 1TDQA 1T2QH 5FYKE 4P5TB 4MZ2A 1CE6A 2J4WL 2FJHA 3NFPB 5A2JH 3LAFA 4JG0H 4XPAH 2ZOKB 1D6VH 5BS0B 2JCCB 1FFOA 1ZVSA 5T3ZL 3SY0A 4QGYA 3C8KA 1DN2A 5EOQL 3H9SE 3HG1E 5C3LD 1NDGB 4IBLT 1KT2B 1Q9WB 2N7BA 3OSKA 3FAXA 1FYHB 5F7EH 2VZ1A 3DX8A 4YK4C 5GZNC 1FVCA 3ARGD 4N5ED 3LH2L 4FXGB 3WN5A 1NMBH 1QPXA 4NQDD 5IHUL 1KXVC 3X3FL 4Z77B 2PXYB 3MLXH 4YO0B 1YEJH 3TJEL 4LCCC 4H26B 5IMKA 3ZKMD 4JFHD 4CVZA 3QIUD 1KCVL 5MHSE 4A6YL 4DKEH 3RQ3A 3U0WL 4XBEL 2YPVL 5GSVA 2W60A 2CLZB 5DA0B 4UIKH 1GAFH 4KKLC 2I9TA 2P46B 4DVBB 1BM3H 3QNYB 1XGPA 3OAYH 3C08H 3HS0B 5GGVY 1MFAL 3FMGL 1X6NA 1FL6B 4R0LA 1P9MC 4UNTA 4H8WC 4YHNA 4JZJC 4H5SB 1S3KL 4XNMA 4I5BB 5K93A 3WHXB 2AK4B 2BVPB 3KXFE 5IEKB 5D70H 1B90A 4RGMB 5IB3A 1HKFA 1AJ7H 3BJLA 4PJXE 2VKWA 1PBYA 3NCBB 4KVNL 1MCCA 2XN9A 1LP9E 2B1HL 3QZWA 3GO1H 3LZFH 4KY1L 2D03H 1SEQH 1I7TA 1JZ2A 1NEUA 1U8MB 1LQSR 5TFSH 3ZDYE 3MRNB 2CXGA 4LSSH 2VZ3A 3U4EB 3GDBA 4XCFH 3EOTL 3WYRA 5CZXC 4KI5C 1UACH 2YKLH 3T1WA 1FORH 3N50A 2DI7A 4JKPL 3VXSB 3LKNB 1FIEA 5ACMA 3PGCB 3P77B 3P73A 2I24N 1T7YA 1JPST 1CFNA 1R5IB 1NLDH 4GUPA 2YUZA 1T83A 3STLA 3H6JA 2CK2A 1JWSA 3U6RB 2PW1A 5DO2C 5IQ7H 3K1KC 4JHBA 3GSQB 4RBPH 2VXTH 3ILQD 2NTSP 2V6HA 3WNMA 1JYXA 1FJ1A 1FZKA 3V52L 3HLAB 5CSZB 1CF8H 4TSBH 1VGKB 1Y18A 3BQUC 2B7DT 1HHIB 3UTZA 5FO8B 3ULVE 1M7XA 4XP9H 3P0YH 4DW2L 4BQ6A 4QHKI 4HIJB 4GRMA 4WI7A 5I1IH 1QFHA 2DQTL 4KHXH 1QSED 5TF1H 3T2OA 1XFPA 5EBMB 5K9KA 1OL0A 1YMMA 2X4TA 4KC3B 4R26L 2J8UB 1PAMA 4H8WL 3SDAD 4URTB 3OB0K 4WFGD 4UDUA 1MFCH 1MFDH 2HN7B 3C2SA 4F33A 3TO2B 3UTSD 5E5MB 1U92A 5FHAH 4PB9L 4WFGE 4WJ5B 1PY9A 5DJCB 5D93C 3B9KD 1YJDL 3RX7A 3MOBH 1YEEH 3WFHA 1JF1B 5J13B 4MSWB 3OKEA 3GMOA 1WIUA 4N8VG 4TNVF 1BZ7B 1I3GH 5AYQA 4G6FB 2KZWA 3F7YA 4FQXD 3DX7A 3P30L 1DQJB 2QQLH 1RJZB 5M95B 1QP1A 5FK9A 1DBJL 5CD5D 1NUGA 3FOLB 2WWKT 2EH7L 3F5WA 4HFWA 3T4YA 2YBRB 4UV4L 2CUHA 2L7JA 5B3JE 1VFMA 4EBQL 1HILB 1EMTL 5F89B 5BQ7B 4MJ5B 4P2OA 3PJSB 1WZ1H 3RZCC 3QFJD 4OV6F 4U05A 4YHNB 4JE4B 5JQHC 3WEXB 1OB1A 4JZOA 3STBA 4DUVA 1AR2A 3X3GL 2K7QA 3QUYA 2XFXB 4M6NH 1LO3H 3D48R 3C5SA 3U4AA 1CL7I 4XP1H 1L9NA 4YXKL 5D8JL 3P2TA 1FCGA 4GAJL 3JUZA 3IDGB 5DJCA 2EDLA 2ADIA 2CIIA 2YD9A 5EZOL 1A14L 2A77H 3MOAH 3ZT7A 1BVZA 4PTTB 4K2UL 4YHKL 5I66A 5B39B 1KN2H 3IFLH 2HWZH 1XIWB 2VQ1A 1RZKL 4K94C 3C6LC 4QF1B 2E9IA 1AH1A 3WXVL 3VXQB 2PW2B 3NCFB 1A7QH 1TQBC 2DD8L 5DGQA 5H94B 1UM6L 4PY7A 1OGAA 5D93B 3HB3D 5LJYH 3S3PA 2AJVH 2R1XB 5GGUB 1BD2E 5F3HA 1R5WA 3KLHC 3T0BA 2AEQL 1MHPH 4M4RA 5C6TH 1CL7H 1J05A 3DV4B 5DD3H 1DQLH 1LEKB 3MRRA 1AHWA 4LDLB 2AJZB 2M2DA 4DGYH 2NY1D 4G9DA 4X7SL 4KXZH 3QUML 4CN6A 4U6XB 1FVDB 5C08E 1P5UA 1C08B 4K3EL 3EHBC 2ARJA 1G7QA 3WFZA 3AC0A 5L6YH 5IB1A 3CFDB 4U6VL 1K8DB 4KK6D 4WI4A 4G7YL 3QCVL 1EFXA 1OAYH 4HWZA 1NGXB 3BGMA 1CU4L 1JYNA 5C0JA 3F5WB 1FAIL 2UY7A 2AEWA 5FUOL 5ITFB 1JVKA 2Q8AH 1JJUA 2XA8L 2GK2A 4JJ5B 1JF6A 4GRMB 1YECH 3PQYB 4HV8A 1BHGA 1FNSL 3T0EB 4N9GB 3EOYG 3QJFA 2GW5A 4ZAKB 2DIJA 2OLDA 4L9LB 3I75B 5KAQG 5JW4M 4QHMB 1KEGH 1KENL 4FFZH 5SWQB 2VDRH 2OX5A 1YN6A 4K71C 4PRPD 3FB5B 3KJ6H 5E7FA 3U6RA 2YRPA 4PJDF 1G7HB 1S9YA 3IU4H 4GJTB 1K3ZA 1SBSH 2R1YA 5I8KH 4FFVD 1LEGB 1YNTB 1J0ZA 4F15B 3WFHB 3O3AB 1BF2A 4LEXL 1T04A 2AQ1A 4Z7WF 3HI6L 3OKOA 1MVUB 3DVNA 5LWYH 1FC2D 1QG3A 4YAQA 3P9LA 3ARYA 4LCCA 4H88L 4YGVA 4O9HL 4FXKA 3AGVA 2N4IA 4Y89A 4OV5A 4DZ8A 1I85A 4M48H 3LSOA 4MA8H 1CICB 1FV1B 1RZGA 2ICEA 1U8HA 5IMLB 1J0KA 4F7TB 5FYJD 1OF2A 4PRPE 4QHLB 3AREA 3T4AA 3IVKA 3NACL 4HPYH 5DZOA 3A67H 1P4LB 2LVEA 2XZQL 2VR9A 2X4OA 3BPNC 4ELMB 5HDOA 1BLNB 4QRUB 4UINL 4ZG1A 1CR9L 1BVLA 4RMSA 3P4NB 5J6HA 3WJLA 1T03H 1IM3A 1B0WA 4OLXL 3G5VA 3PWPB 3NH7L 3C5JB 3ULSB 4PJEB 3LKSB 2FECL 5CGYC 4WDIA 2AJYL 2E7LA 3GK8H 1T66C 1PG7L 3MV9B 4HWBA 3G6AA 4LASL 5IB1B 3BO8B 4IM8A 5I15H 1NC2B 4FQLH 5TDOA 3INUL 4EUPA 4XNYH 4OM0L 4PR5A 5BVJA 1RUKH 5AYUL 3TYFA 4U1JA 1FDLL 4N5UA 2ZG1A 3NPSC 4Q9BA 4UAOC 4RMQA 4PLNC 2BFVH 4JB9H 3UO1H 2X4OB 3VGHA 4QRRA 3KLHD 5J8OA 4GQ9H 3WUWB 2EZ0D 3MLVL 3L7EB 1GC1L 4N68A 5KSUA 5KSAC 1MJJA 3LPWA 3CFEB 2WUCL 1QO3A 3EYVA 2OL3H 3GGWB 4S1RH 3L7FB 4X6BA 2X10A 3MBEA 5GGTH 4G6AD 1AI1H 4KKNA 2XN9E 3S88L 4DZ8B 4GW4A 4BQBA 5IGXH 1AO7A 3M17B 5FB8B 3UROR 4XNMB 2XN9D 5ICYA 3NVQA 2FWOA 2DLEA 4X8XA 4NWTH 2MCPL 4MB3A 3OF6A 3ZKNC 4E41B 5KSAB 3VG9B 1FO0B 5DRNA 1W72H 2ZCKH 4FQHB 4BYHA 4U1HA 2X7LB 3VXUE 1PD6A 1IAOB 1IAIM 1JGUH 4OZIB 5B8CB 3NIFF 2ESVE 3SDXA 4KJYB 2Y07H 3E3QC 1OP5H 4D0CB 1I7UB 4F7EB 4GXVH 4PJEE 5J0BA 1ZLVH 2ESVD 1HH9B 4MVBD 1YC7A 2DI9A 3SQOH 4D0BA 4WFED 1RULH 4C56A 5DLMH 1NCBH 3LD8C 4JZNB 1EHNA 3NZHH 5CJOH 3EOBB 1VACA 5I1GH 4FFVC 5ITFA 4Y5VC 1KT2A 1CN4A 1YUHB 2VTFA 1A9EA 1MFBL 4YFEA 3S35H 5HYJD 5JOEA 3PNWA 4IJ3B 5HYSA 3SEPA 5HVHC 4PGJA 1T21B 5C08B 5HBBA 1TZHB 4KJQD 3S34L 2XQBH 1V7MH 3MNZA 5HHPB 3W9DB 4UOW1 5T1KD 4HIHA 2EKJA 1KJMA 1NAKL 1Y6NR 2BSTB 2VMFA 4FTVB 5MENB 3T09A 3FKUS 1DQQB 1MPAL 5GRUL 2CLRA 3FB8A 4WY7L 1OM3L 1AO7E 1WWCA 2Y23A 1D5BB 3D69B 3FQRA 2ICWJ 2CSPA 4OKVB 2YRLA 1YEDB 4LGSB 4TNWK 3NN8A 4UT6H 5KOMC 1IKFH 2Q8BL 3O6FA 2NY6C 2QHRH 3QIWA 1EFQA 2H2SC 3MJ9H 3IDUA 3BRDA 2VOTA 3D85B 2XACC 4GW4B 3SKJH 3HC4H 2YK1H 5CEZH 1IAOA 4K7PL 4YDKH 1AIFA 2EXWC 5IHZA 2BK8A 1F6LL 1LK2A 1N6QL 5EU4A 2F53A 1R5IA 5E70A 5K59F 4HBCL 4QRSB 5ESVB 3F7PC 2P5EE 4NSKA 3ZO0A 4NC2B 4NRZA 1U95A 3V5DB 1OGTA 1YN7B 4BFIA 5DURD 3DJ9A 1IEAA 2VE6A 4XPBH 5EULV 1D5MB 4KTEL 1U8OB 2R4RH 3IAGC 4YX2L 3BESR 4FP8L 2NLJA 1T0NB 2P47B 2YUVA 4M6ML 3BIKB 2R1WA 2H26A 1CXEA 1XCTB 1EJOL 1HINH 2XG4A 4HFWB 1I7UA 3HRPA 5E2VH 4ETQA 4WI9A 3IDXL 2Y6SD 4WV1B 5J3HD 1TLKA 1MRDH 5I75C 4G42A 1UCTA 4X8JA 2J2ZA 3VFSB 4W68A 4PV8B 5GRJL 5HI3D 1TZGL 3VCLB 4OFDA 1KJ3H 2O26U 4O4YL 5HYSG 4XVTH 2LAAA 4F37K 4JO3L 5I8EA 1VFBB 4O5LH 1BMGA 4HS8H 3L3OB 3OF6D 5EU6B 4CVXA 1FIGH 3MLYL 2BCKB 2D31A 4F33B 4YBHA 3ZSSA 2WK2A 3HR5A 5ADPL 4G80A 1BF8A 1BAFL 1MSPA 4HBQA 3X12A 1MIEH 2VLJA 2XQYK 1HEZB 4Z78B 5EO1A 3T65A 5TE4L 1WITA 1FZMB 1Z5LB 2FR4B 5LGKA 4BSVA 3MMEB 2X1QA 4U7KA 3MBED 2HFEB 5DJ2A 2N56A 2Q7NA 4DGIH 3QXUA 2VUOA 5L7XH 4N90D 3L3JA 2FIKA 5LAXB 3RTQA 1GOHA 4EOWH 5C0AA 3MUJA 4RQQA 4HC1H 3RGVC 2EC9T 3TPUB 4FFWD 2BDNL 2WSKA 1ORQA 3QDJD 4OQTH 2FJFA 4GKNB 4RISH 2MJWA 3BMWA 3K8MA 3KNBA 3MJ7B 1LO5A 2DDQL 2HLAA 4G6FD 1XR9B 5K9JL 4JRYE 1LK2B 1G9MH 1YPZA 2V2XA 3SDYH 4MNQB 4LPVA 3ULUE 4ZQKB 5GS0C 3UBXA 5EC2A 1ZT7A 1DQDL 5L8KB 3HCVB 5DVLA 2R0ZH 1EZVY 4WUKH 3MRMA 2XYCA 4NRXB 4YHPB 5CCKH 4MWFB 3GSUB 4N8PA 2A9NL 4R8WH 3RWIA 4WEBH 5HHMB 1G7IB 3MLWL 4WW1A 3O8XA 2I9TB 5DR5L 5GS1A 1X5LA 2BRRL 1YY9D 2D7OA 2A6KB 2EXYC 3VFWB 2EDQA 1TTFA 3CLFL 4WO4C 2A9MH 12E8H 1EEZA 1TIUA 5C71A 4KQ4H 3HC0B 2HLFD 2MHAB 4W81A 5IHZB 2H1PL 4R7DA 3NFSH 3QJHA 3CFJA 4G6ML 2NTFB 3I6KA 3BPLC 4IDJH 5CZVH 4NDMB 5I66B 3DVGB 4X98A 1EGJL 3FQNA 4PUBH 1H0DA 1OAKL 3VRIA 4WWKC 1UXWA 4J6RL 1AQDA 2R29L 2DLGA 4ODUA 2KPNA 4HXBH 1ONQA 5ESQA 1I8KA 3D3VA 3O45A 4AENB 5D6CA 4NQTA 1RUMH 3VXOA 2EDBA 4KI5E 4YLQT 1PLGH 3D18A 1HIMH 3O4OC 1T1YB 4GG8B 5F88B 4MD5B 3SBWC 3IDNA 1MI5A 2VDOL 2O5YL 5D2NA 3R8BB 4CU6A 1MUJB 4OZIF 4GH7B 4NJ9L 5BS0E 3T1FA 4NBYB 3IJHA 3QXAA 3VGAB 1GVIA 3MRQA 1U93A 4OZGB 2PCPA 1ED3A 5TH2B 2BNQE 3FMGH 1CLZH 5FYKH 3RBSA 2O5XH 3JZ7A 4QRPD 1J18A 1FFPB 4WTWA 3F6LA 5CWSB 4QXWA 2VDLL 5EZLB 2C1OA 5EORL 2AGJL 2VLJD 4HGWB 3NCJL 3S7GA 3DURA 5FO9A 4X4XA 1T0MB 5CMAA 3DVFA 3ZHDA 1RURL 3PP4H 1ZEAH 4FQ2L 4F57H 4NM4L 4TOYL 3RHWF 1SYSA 5C0FB 4PJBE 1V3MA 1XGTB 3MFFA 4LCYB 5IW1A 2Q3AA 5J13C 2IPTH 5EOCH 5DMKB 5HDQL 3GBMH 4WTZA 3WIIH 3O8XB 3FT2A 4JRXE 4X4YA 2A38A 3I3BA 4G43A 5T5FL 4JG1H 4Y19E 2NY5C 3AU1B 3RWJB 5I6XC 4TVPH 1E6JL 1NUFA 4PGCA 2WBWB 1X7QB 3RWHB 4ONGL 3HLAA 4RFNC 5DEFA 4RAVA 4JGMA 4PJIE 2YZ1A 1TJHL 4XC3H 3BZFA 2JCCE 4RIRA 4LDEB 1KUMA 3F65A 4ZQKA 1P7KB 3EJZC 1CVRA 1QR4A 4P9HL 3G6AB 2W0LA 3RWGB 4KTDL 4LKXB 1UXWB 3SGJA 1URLA 1CTNA 1MCFA 2BNRB 2JJUA 3B6SB 1GGBL 2V9RA 3U2SA 1HN1A 2CRZA 2M1KA 4P2OD 1FL3A 5IKCB 3FQXA 3H3KA 4PJBF 1BQHG 2KH2B 3P0YL 1OSPL 1YEGL 4KZDL 5F97E 5CSGA 2EDJA 1UG9A 4Y7MA 4NJAH 2EXYD 5DHVH 3T0DA 3TVMC 1KFAH 3TA3A 2Y5EA 3MJGX 3ZYJA 3ZE0F 2V2XB 1RY7B 5D2LA 3MV9A 2QSCH 2HH0H 3NCMA 3TCLA 5HGHB 2NW2A 5IOPA 5CHNB 4G8IA 3HNTH 2VZVA 4FQXA 5EUOE 4MWFA 4PB0L 5IVZA 5IB2A 4KI5F 4CVUA 1KCVH 3K74B 1H3TA 4IMKC 5EPMB 2QQNH 4ODHL 3B6SA 1E4KA 5J1AB 4F9LA 3CUPB 3DX6B 1AFVL 1XF3B 1D6EB 2WWKO 2Z93A 3KPNA 4ENED 4LLUA 1DLHB 2PO6C 5B8CC 5DJDA 1SJXA 3HUJA 4ZUVB 1G7PA 4X7TB 3DI3B 4MAYD 1C5DA 4QXGL 4K9EC 1M71B 3GSWA 1NGQH 2WIIB 4WRLA 5I9QC 4PBXA 4ONHB 3UC0H 1OAUH 4N0CC 2AV7A 1Q0XH 3CC5A 4V1DD 5CZXD 1EO8H 3WS3A 4OD3L 3MROB 4W4OC 4QHNA 3LVEA 3P9LB 4GW5B 4KY1H 2D03L 1CGSL 3HR6A 3RNKB 4Z6AT 3TN0B 1WTLA 1CE1H 2HTLC 3TC9A 5TFSL 3MRKA 4KKLD 4FMKA 4ELMF 2LE9A 3ETBF 3RWEB 2VSCA 3SO3C 4FNLL 1AIFB 4XCFL 1SYSB 5EU3A 1FL3B 4PJ5E 5IKCA 4FTVD 4GXUN 4PRAB 4L8CB 2PXYC 1MWAH 2XNAA 3KLSA 5KVFH 5T1KB 2IANB 5CBEB 3LKRB 4GRWB 5D1QD 4BFEA 4FTVE 3U0TA 4IIQC 1IZJA 5CJXA 2XXMB 1OP9A 4NNXA 3B2VL 4P5KB 1BLNA 4PGBA 4NFCA 3U4BH 4OGYH 1OAXH 2A73A 1JWMB 3BIKA 4TYUA 4PJIF 5KVDL 1FE8L 3QEUB 1XF2B 2I25N 1U8JB 3DX8B 2VXTL 5D4QA 5IROA 3S37H 1GZPA 2CKBB 3VXME 4JDTH 2XY1A 3EGSA 3ARGA 3LHPL 1L4IA 1ETZA 1WAAE 5HVHB 3CVIL 3MV7A 1HHKA 3BKYH 5GIRB 3OQ3B 4KKAC 3CZJA 1KGCD 1ZLSH 1GJIA 4LCYA 3G6DH 1N59A 2OJEA 5FUOH 5FCUH 2O5ZH 3MACL 2Z8WC 1X4XA 1J8HA 3KYNA 2XTJB 5CP3A 1CFQA 3QXDB 1JNHB 3FB5A 3MV9E 4MX7A 3GZKA 2EE3A 2GFBB 5SWSA 4OZ4B 4PJ7F 3LB6D 1P6FA 4YHLL 3GNML 1A1NA 3WNNA 1RUPH 5D1XD 1CE6B 2VAJA 2SEBA 5DJXA 4AT6B 1AY1L 1YEEL 4UU9A 1KPRA 1G9NC 4HKBA 3DMMD 3I84A 4Q2ZA 3IKCB 1S7XB 2NNAB 4WWKA 5E6ID 3K2MC 4BSWA 4TN9A 3AS2A 3LH2H 2AJUH 2X9XA 1JMXA 3GUTB 1Z0MA 1UKTA 1GGUA 2ZUUA 4QNPE 4WHCA 2ZNWA 1NCWL 4ZFFA 5IW6B 1O5DT 3JTTA 4P2RD 3Q5OA 4CBPA 2R0KL 1J8KA 1S7TA 1GAFL 5E2TL 2QTEA 3QQ3B 5ETUA 3VI3F 4MA8L 2NY3B 3UPRB 2BOBA 1CFQB 3QXDA 3UJTH 5C0EB 2A6DA 1MFEL 4M7LL 4JEGB 1AD9B 4IHOA 3QQNA 1MAJA 1SVZA 2F9BT 4M7ZB 2CKBA 2DQGL 1EA9C 4XP1L 1U6AL 5F6IB 3NACH 3ZKQD 3N1MC 3L7EA 4ODXB 4KJPD 1KC5H 4X7CC 1FC1A 1IGIL 3RVXD 4PGEA 3TF7C 1ETZB 2IMNA 1E6OL 3EYOB 4XP6L 1MAMH 1CXHA 1CR9H 5CILL 3GO1L 3LZFL 5FGCE 4MNHA 4HQQH 4ZFOL 1KXTB 1FBIL 5JHDD 2GYSA 3GK8L 2EDNA 3QNXA 4Y1AD 2VDQH 4GBXC 4LLMB 4E41A 1LVEA 1WFTA 3M1BB 4UT7H 2HVKA 3RUGE 4Y19B 1MCWM 1UM4L 2C3WA 2PXYD 5I73B 2ZKHL 4TSAL 1J1OL 1KLUA 1XH3A 4MA3B 4ZOCA 1AD0B 2A74A 1QKZH 2DQCL 3HE6D 4WVRA 4LOUC 1MJ8H 1S7UB 2AK1H 4HIEB 1NEZG 1FDLH 3KPQB 3MRDB 2CKBL 1OSZA 2XZAH 5DVKA 5HHNA 5C0AB 1VPOL 3GHEH 3C6LD 4FZEL 5IFAL 5MHSD 2H41A 3TIDB 4EDXB 3U9UB 1T7ZA 4KK8C 3HUJE 4ELKA 3LMJH 2FJFB 1KPUB 4GKNA 4XWOC 4G8GA 2A6KA 1TVBA 3T3PE 1R6VA 4PRBA 3SPVB 2UZIH 5J56B 2ADGB 1U8KB 2F19H 1WQVT 1AI1L 3S3SA 4HUWA 2OYPA 3DRQB 1JPFA 4XP9L 1INQA 1FRGH 3CMOL 4LSQL 3U0TB 5FKAB 1VGKA 1Y18B 3TYFB 3PHOA 2VXSL 2NY1C 4NN6C 1G1YA 4AIXA 5AWNL 3BPCB 3TT1H 1VFAA 5LQBL 1A8JH 1EO7A 1PX4A 3VFPB 4M1GH 3FQTA 4UV7L 4NQEE 3PWJB 4PJ5B 5DJ0A 1B88A 3UAJC 1XGPB 3SBWA 4X8JB 4WGWB 1GC1C 4HX1B 4NUJB 4OLVH 1I3VA 3DVIA 5D1XC 3PWLB 2CR6A 1SM3H 5IFJA 2ZUYA 4EDXA 5AEAA 1XGYH 3AVEA 2P8LB 3QUKB 3SDAB 5F1IA 35C8L 4NO2B 4ERSL 4MA1C 5DLML 3DMMA 1RIUL 1R3JA 3TGXA 5FDWA 1RSFA 2VSDA 1RZJL 2I60L 2BNQB 1BD2A 2MPAL 4GKOA 4CVWA 3CK0L 2DL9A 3TV3H 3FO0L 3MV9D 3T3PF 4HUXB 3QZWB 3RJQB 4C4KO 2AK4E 3GMQA 1F45A 3BN9C 3J8F7 5INCB 4CW1B 1KJ2L 3DBXB 1T66D 1N5YL 4BZ2H 2H8PB 3UTOA 4IEFB 1IKNA 4HGWA 1A6VL 3VFGH 3X3GH 1L6ZA 5ADOH 3O6FB 3OKNA 2KUTA 5GRXG 1L0QA 1YUHA 3CH1A 4OD2B 4OLWL 4X5WA 4JM2F 1S7VA 1R5WB 4WY7H 5EZOH 3SPVA 4YFLI 4J1UB 4LASH 3VFSA 3NGBC 2QR0A 3RDTA 1OAZH 1Q38A 2Z4QA 4Y5XC 2NW3A 5C0DA 1J5OL 2PCPB 5LKNA 1RUAL 1U8LB 3UTSB 2NXZC 4G8GE 1JCKA 2V7HB 4TSCH 1RMFH 2ZSVB 1A64A 1BWWA 2DM4A 4ZS7H 2Z35B 4QCIA 2N7AA 1Q9WA 1E4WL 3ET9F 1N4XL 2VQ1B 3HC3L 3MNZB 2UUDH 3ULVL 4JLRA 4D3CL 1XIWA 4G6AC 1FVCB 3ALWA 4WTZG 1GHFL 4MXVF 3MCG1 1MELA 5DD3L 4XXCC 2DLHA 5I18H 4JO2H 5IVXF 2CO6B 1F90L 2ARWA 4ONOA 2DYPB 4QEGA 2CDGA 5I0ZA 5T33H 3B2UD 3ZKND 4TUJA 5D5MB 2F5BH 3LEYH 2DBJA 5DC4B 4BZYA 2AV1B 3QB7C 1BFSA 5IWLA 4BA8A 1QTYT 4YDIL 3TNMA 5DRWA 3K4ZA 4EQ2A 2MCPH 4NWTL 5DD5L 4KK8D 3GIVB 1FAIH 3P4MA 4N9OB 3OJVC 4KJPC 5B39G 1TZGH 5EBLA 5ELIA 3S36H 4AL8H 1HCFX 3I02A 3D0LB 4Z76B 1A6TA 3VXRA 5I1JH 5IHBA 1AXTL 4H25A 1L7TL 4D8PA 3AY4C 4EN3C 1NGXA 3BGMB 2Z91A 4G7VL 7FABL 5ITBL 1CLOL 1KEGL 5C6PB 3QRGH 2VDRL 1UJ3B 3WLBB 1YY8A 1KELH 4ELME 1IBGH 2JJSC 5ALBH 2ZOKA 1J88A 1FG2B 5M7QA 3HMWH 3S6CA 2EDWA 2I5YL 1CCZA 1MWAB 1ODAA 5JIKA 1JYVA 4C58B 1Z9SA 4OAWA 2BVUA 2XICA 3RL2A 3HE6C 15C8H 5I30H 4PJ5D 3ZYOA 4HK0B 4NBXB 3WHE1 4HAFA 1PJ9A 1X5IA 3VFWA 2DQUH 1RVFL 3QULA 3UJIL 4Z8FL 1WWWX 2UUDK 5H37G 2KL6A 1XF2A 4GKSA 5T1DL 1UJ3C 4OGXL 3ARFB 3QWQB 5DHVB 1C7SA 3PE9A 4X80L 4U1JB 4OT1L 1KTDB 4CN1A 3D5OF 1GIGL 1IAKB 3DYPA 5CLWA 4C57C 1LO0L 4Y88A 5J11B 2UY6A 4OTXL 1J0HA 4PG9B 4IMKA 5I74B 2FR4A 2MKWA 4ZS6C 1JUFB 1CG9A 5HJ3A 1U8IB 2XG5A 1GGCL 2NY4B 1EERB 1RZJC 2CO7B 2FH8A 5K9KB 4POZD 2QHRL 2J88L 4J3VA 4P3CH 5HGBA 3IJSA 3GBLA 3MJ9L 2P48B 3B9KC 1K8IA 2AJYH 2DQDL 4RRPA 4F8TA 1IM3B 1HWHB 3KHQA 5T3ZE 3SDCC 4K8RL 1UKQA 1JNNL 4F7CB 4P46B 1UWGH 3W9EA 1NJ9A 2AQ2A 4G8FA 1U8MA 1VFOA 1BZ7A 2V5RA 4WI8A 1KN4L 3PWVA 2VLJB 2JB5H 1OWRM 5DT1L 2EDKA 3QDME 1MHHA 3UO1L 3X3FH 3MRMB 3WKMH 4UZGA 4LCUA 1Y0LB 5E2VL 4PRHA 3TJEH 1NANI 3ESVF 5CZKA 4EUPB 2F58L 2Y06L 2ZJSL 4I9WE 1NL0L 1A3LH 3AS0A 4L1HA 4JQVC 4JHWH 1MFAH 5DHYA 3EDFA 3R0NA 2V2TA 4Y4HD 4JQVA 4RMRA 5EDXA 1ZHLA 2GAZA 2VUYA 3VD3A 1S3KH 3O3AA 2QV2A 3QQ4B 3M07A 4YNYA 2QADB 2VIRB 1KTLA 2R2EB 8FABA 3HPLB 1WWAX 4ZD3L 1JZ7A 2VO5A 2DM3A 1KIQA 3PWVB 3CCHB 4XT1C 3N85H 1H15A 1KPVB 5C09E 3VGAC 4H1LA 1RZGB 4F80A 4PLJD 5D7JB 2HRLA 2DQJH 1S7QA 3U30B 3KXFB 4HV8B 2NR6C 2HVKB 1IM9B 3EOTH 3BDBA 1YPZF 3NZHL 4OGAC 4F57L 4EUPG 1JGEA 2ITDB 1TETL 2EKSB 3DPBA 5F9JB 1VA9A 4P23D 4Y2DD 3VH8A 3D87B 1MFBH 1X7QA 3RWHA 3LV3A 2E5EA 3VFNB 2FX8H 3VA6A 3U7WL 1WFOA 1A7PH 1P84J 1QSFB 1HH6B 4U1IB 3SKOA 4JDVB 2R1YB 5C86A 5KOVC 1NLDL 1MCJA 3BUYB 4RFOH 3WXWH 4ZMAT 2XQBL 3JV6A 3PGFH 4JO4H 3GJFK 3FONA 4M7KL 1IAKA 3UTTD 4ELKB 4LLDA 4KZEL 1NGWB 2D0GA 4NZRH 3QPXL 4MHHG 5D7LA 4WO4D 2A9NH 4R8WL 2FHCA 3ALXA 3CVHB 3BW9A 1BQLH 1CT8A 1RZ7H 5EU5A 1MCBA 3RGVD 1OM3H 1Q72H 1T89C 1KB9J 3VXOB 3TO4B 4FFWC 1F97A 1MJUL 2XRAL 1A6AB 2CK0L 3LOWA 4XH2B 1MRFH 3BKCL 3BDXA 3WSQL 5MENA 2ATPA 4NRYA 1UZ8B 1JRHI 1I7RB 4POZC 1L7IL 4S0SD 3ZYIA 3VH8B 5DMJB 4GG6A 4W4OA 3FO2B 4PRHD 4TVPD 5TQ2H 4LK4A 4QTIL 3SKJL 1MFCL 4LVHB 1ZKAA 1BJ8A 4DAGH 4DJMA 1G0YR 2V9QA 3LN5A 4JFFD 2BVQB 5LXGH 5HVWA 4PB9H 1ADQH 4LQFL 3ARGB 5IMMA 5E08L 4TULL 3QUXA 3BP4B 2BSRA 4FQJL 1XT5A 5CIPB 4UUJA 3TT3H 4OI9A 4M6MH 4FQHA 4G9FD 5D1QA 5TDPA 1RUML 5DK3A 3R8QA 5ID1A 1K85A 1HQ4B 3OPZL 5F9JA 3EO0B 1JNLL 4I4WA 4XHJC 4AQ1B 1ZGLP 4U1LA 5CGYD 3QPQD 2K1MA 1CIUA 3DNKA 4ZS6D 1MHEA 3RNQB 3JVGC 4HS3B 1XF1A 1G9EA 1NFIB 1BX2A 4Z7VE 3DX9B 3KJ4B 1CLZL 4K9EH 1JZ6A 4QXGH 4YHOL 3ABZA 4PFEA 3RNKA 5FCSH 3BDYH 4J3OC 4NQXA 2B20A 1CT8B 1UXSA 1IGTB 2IEPA 4ZPTA 3NA9H 1VADB 3V6OE 1KN2L 3LQZB 3QUKA 3IFLL 2AW2A 1DBAL 2ZSVA 1N0XL 3RKPA 1S7QB 4JQIL 2WANA 4QCIB 3MV7D 1RJZA 4BH8B 2QSTA 3PDDA 2I27N 3HI5L 4ZFGL 4JRXD 2HTKD 5IVXB 3LKRA 1FZKB 3GBML 2Q87A 1DLHA 3QHTC 4JZJA 4EOWL 4XX1E 1G7PB 4X7TA 5DRXB 2ED8A 5C07A 1F42A 3SGEH 9CGTA 4OZGE 4Z78A 4FHBD 4YZFE 4JG1L 5DMGD 2D7QA 3RWFA 4NFDA 1IQDA 2P5EB 5D7LE 4ONGH 4XMLH 3PWPE 3RDTC 3G5VB 3I6KB 5F93C 2FGWL 2OTWB 2X1PA 3LDBC 3V9FA 4OB5H 5JW5B 4YIQA 1HYRC 4L9LC 4K3EH 3EYVB 5CHNA 5DUMH 3EGSB 5H8DA 4RX4A 1HYSD 3CVHH 4P9HH 4HHAB 5E6ZA 1BOGB 4OFPA 3VW3H 4KTDH 5GZOC 4WO4A 4OFYD 2R0ZL 5KS9B 1BFVL 4NQSA 1ZLUK 5I17B 2XKNB 4F7TA 4S2SA 4HCRA 4QHUB 3MLPA 4Q7DA 5FYJU 4LHUB 3MRLB 3NIDE 5JTWA 4WEBL 2ICWI 4PJ7B 3RI5F 4YO0A 5D2NE 2R8SL 3SKMA 4PJAA 4YHPA 3VA2C 2HJLB 2Z31C 1LK3L 3HCVA 3MYZA 5F9OH 1KJ2A 4OCWL 5MEPA 3QDAA 3TYGL 2X05A 4P5TD 3STLB 2IBGA 2BY2A 3LS5L 1SY6H 3GIZL 4CL7A 2VLJE 5HYJE 1BBDH 1AGCB 4ZXBA 4KV5F 3OZ9H 4P3DA 3O9WC 4V2CB 1CWVA 2C3HA 2QSCL 3LKQA 1ZV5A 5DHXB 2OTUB 4NO5B 2ARJB 1B0GB 4I5BA 3WHXA 4AK1A 4LEXH 3FO9B 2HJFB 3DUSA 5B38A 1OAKH 1U42A 1F3DJ 4J6RH 1VENA 3MC0A 1IL1A 4HXBL 2X09A 4PJAE 2FATL 3DGCR 2Y36H 1VKXB 2DN7A 4WHTB 1I9JL 4R3SB 4JFZL 3K2UL 3I02B 4NQVB 2X4PA 1KEMH 5ALCH 3OAZK 5JA9A 1GH7A 4K8RD 4LVOB 3RX5A 4KRPC 1Q9LB 5BMFH 5DJXB 4L8BA 2H2SD 3CNKA 2OR9H 3S96B 1OAUL 4MJ6B 4W70A 3DUUA 3UYRL 1QBML 4P5MB 1O0VA 5D7IF 5HGDA 1DANT 4NQXB 2R2BB 4MDIA 3QI9D 3PV6A 1QYGH 2ZUTA 1X5HA 2EIZA 3MRPB 4RNRB 5L2JA 5IVNA 1ED3B 5CUSL 5HYFA 4RGOL 1AC6A 1OT2A 4G43B 4BKLA 4DEPB 4OZGA 3P4LA 4HH9A 1OP3H 3ZDZE 2QHLA 1TPXC 4FQ2H 3KLAB 4HUUA 2VLLB 4OZGF 4PJCA 2ZOLA 1R0AH 2VL4A 3JTSA 4X9GA 3MXWH 3IKKA 5E99H 4RDQF 4YC2B 2XPGB 5AYUH 2VC2L 3WN5B 4F7EA 4YGAB 4OGYL 1NAMH 5HY9A 3RVWD 2GFBA 2H2PD 5FYJL 2IAND 5K9QI 3NTCH 1IEAB 1V05A 1CDJA 3DX7B 4XGZA 1HK6A 3O3DB 5T5FH 1F6FB 4DKFH 4KKAD 5F44A 1QKZL 2DQCH 4X5WB 3VGBA 2EYRB 4XHJD 3KYKL 5KG9B 4GRLB 2JJVA 1E27B 2X1XR 4MQXC 1NGYB 1S7RB 3DTXA 1P1ZA 4L3CA 5SX5K 4K07A 4RWYH 3RRQA 3BAEH 3FO1B 3TP4A 1EJ6A 3V7AE 2H3NB 2OMNA 1DFBL 4MNGB 5D1ZD 5KSBB 4WWID 3C87A 5LGHH 2NYYD 1I8LC 5DK0A 4X4ME 1QFWI 4JDZB 4HJJL 4WW2A 2E27H 5AAMA 2DOCA 1UWXK 1S8DA 2UZYB 2HG5A 3CX5J 1A7OH 4YDVB 1S7SA 4LSQH 4I0PA 3DETC 5DUBA 3B9VA 3GSUA 2Z31D 1ZANL 3BEVB 5A43C 2X70B 4O2EB 4IIQA 3D18B 4HSQA 4GO6B 2ADJA 5GGVH 3VRJB 5EOTA 4X83A 3P40A 4JPIB 1KB5B 5DJDB 2ENYA 3UCRA 4WTXA 3G08A 4U3XA 4PJ8C 3HNTL 2ED7A 1EAPA 4P46C 5EZIL 4IRJC 4JFQA 5TH2A 1TQCB 4M3KB 1ORQB 5E7BA 2HKHL 3C5JA 3ULSA 5I2IA 1QLRA 4G8IB 4ZUTA 5FKAA 5FGSA 4Y5VA 4Y4KC 3TCXA 3UJTL 1XGUB 4RMVA 1UZ6E 1OGAD 3TNNB 3ZMRA 5I8CB 3FO0H 4KI1A 2DQHH 4KJYA 4ZXBD 1X6LA 4KRPD 1Z5LA 3FT3B 4JFEE 4M7ZC 5GPRA 3EDDA 1FZOA 1SHMA 1ZMYA 4LCIH 3WO4C 5KJRL 3C8HA 1NFDF 1C5DB 2Z93B 4YBQD 5ABDE 2F54B 4HUKB 3P9MB 3PHQB 5C0RL 4GBXA 5SX4H 4ONHA 1YMME 2FBJH 3IXAA 4XVSL 4UT6L 4JM4H 1B4JH 4R7NA 3QI9C 4JAMB 2JELL 3VXMA 4HPOL 2O93L 5CJQL 4R0LB 5GSRA 4NKOB 5MEOA 3O9WD 1JPFB 4LEOB 2D9QB 5SV4A 1DP0A 1ZXQA 2H6PB 3HC0A 1MRCL 5HYQB 4QHKJ 4M02A 5KANG 4LCWB 4HUNB 3MRNA 4NN5C 3IVKB 2YD4A 5JA8B 3A6CH 1I85C 1KPVA 1EHLH 1I1AD 5C0BD 1LE9B 5IM7B 2BXYA 1EEYB 5FYKU 1S5HB 3MMEA 4XVUC 5J9PB 1PG7X 3MRIA 1DVFB 3DSFH 1GYAA 2CKBH 3F6IA 3LSOB 1ZVHA 1XMWA 1S7SB 1VPOH 2CXKA 3HZVB 1GHFH 1NUDA 1EJOH 1WSST 1HINL 5IFAH 2W65B 3V4VL 3FQXB 1DEDA 3ZKMC 2K7PA 4LPYA 4JFYB 4NFBA 3MREB 4U4BA 2P4AB 4PRIB 3IAPA 5DHYB 2IH1A 1GGIL 1R3IH 4JFOB 5DD0H 3CSBA 1AGDA 1OARL 3DX9A 3QIWD 4O4YH 4PREB 1KCUH 2Y25A 2A6IB 4UTAL 2V9TA 3KS0H 4OLEA 1EAJA 4LLQA 5FO7A 5TJWK 4JO3H 1JGLH 4HS8L 3ILQC 2NW2B 5IOPB 5TGBB 5HVGB 5C08D 4OIBA 1CGTA 1FNGB 1T20A 1JRHH 4NUGL 1BAFH 3WL9A 1AXTH 4HULB 4X99B 1D5MA 4YWGH 4CMMA 3T3ME 4UUJB 1CFSB 1I1RA 5EUOB 4I77H 1F3DH 1I9IH 6FABH 3HUJB 4ZUVA 2DMCA 4ETQB 2AS5M 2OCFD 5B3NA 2HFTA 2NY7L 3FFCA 5F1SA 1VEMA 3FO1A 4KI5D 1UB6B 4OZ4A 3UBXI 2V17H 3WIFA 3EJZD 4X9BA 1U8PB 5IBUG 1A6ZB 3TWCH 3V5HB 1RZ8A 4YFDB 4YZFF 5F8RC 1BEYL 1A22B 1NCWH 4Y1AA 4HG4J 2J8UF 3TH4T 3BZEB 1JYWA 1PYWA 3TN0C 3OG6B 3FZUC 4C54A 2Y9RT 3RZCA 4KMTH 4P2OC 5K9JH 1NC4A 2HT3D 4K7PX 5D1ZC 3FHAA 3D1MC 4PJGF 5I6XB 2C7UA 1PGRB 2G2RA 1K6QL 2PTTB 1IGMH 3KYMA 5HHXL 2BZDA 4PJFA 1NEZA 5CIPH 5HDLA 1AGEB 2HT2D 3TVMD 3VU2A 1NKRA 1INDH 4ZSOA 1OLLA 5F3HB 1IGIH 1U36A 4X4YB 1OAZL 4I0CC 4UIMB 1UVQB 2W9DH 4GG6E 3SJVB 5CILH 2WWMC 3S4SG 4XCNB 2P5ED 3PNWB 3GIVA 4Z7NE 3QEQE 3CLFH 3ARXA 4BZ1L 4IRSB 1NDGA 2XFXA 3IJYA 5HHOE 2VKXA 3WEXA 5CLTA 4KQ4L 2XWTB 3SDAC 5BOPA 2VWEE 2DRUA 3F7QA 5SWSE 4NO5A 2P43B 5DEFB 4IRZH 4ENEC 3CPLA 5HGAB 1G6RA 3CSYB 1NC2D 1C5CH 1UADC 5DQ9A 1RPQA 1UH3A 3F58L 4A6YB 4EVNB 5JHDB 2M26A 3FOLA 3TVMB 4UQ2A 1JWUB 5JXEA 3CXHK 2R29H 4KRPB 5TQ0H 5B8CA 4PY7B 1OQOA 2OJZL 1UH4A 2VABB 3NPZB 1LD9A 2PF6A 3IDJB 3ZKSD 2FO1A 1O7SA 5CD5C 4YDIH 1J10A 2B0SL 4PJ7A 3O3EB 4Z7UF 1FGNL 4NIKB 5F88A 4LSUH 2QQKL 4KUCD 4PP1D 4Z7VA 2YS4A 3L5JA 2EDHA 4ZTPH 2O5YH 3OKLA 2Q86B 4X6DF 1XCQA 4NC0B 4LCWA 4FQCL 1UCBH 4Z7NF 4JDVA 4KVCL 2R23B 1E28A 2EIZB 3DO3A 3MRKB 4Y1AB 2WBKA 2LAGB 4NWUH 5D7IE 1J8HE 2IAMC 3FTGA 3GMNB 2DKSA 1MLBA 3CZFB 5IVZB 4Z0XA 3QO0B 1M1SA 4PRAA 1RIVH 4AH2B 1MNUL 2BY0A 3MODH 5KAQF 3SKMB 2XZZA 1TJGH 1I1AC 3I50H 4OCNC 2WINA 4PJIA 5HTSA 1N6VA 4TNWF 1GZQA 4PS4H 1CFVH 1NAMA 2IGFH 1JK8B 4JY4B 2EIEA 3WE6B 3QCTH 1HH6A 1DBKL 5F70A 3PWJA 5EOCJ 4P5KA 1KYOK 3DI2B 4BH7B 4L5FH 3HE7A 3K3QA 3O6ML 3WDIA 2B2XL 3CK0H 3PWLA 5KSBF 4C55A 1AKJB 5F7EL 1ACZA 2NY2C 1T04B 4TNVK 3QIBB 4QRPA 3TN0D 4I3RL 3IETA 5F72S 3SCMC 2MHAA 1MCPH 3DX6A 1OW0A 3RVVC 4NKIH 4LLMA 3RBGA 3BWAB 5JORA 4N0YH 3RPKA 4KU1A 2BCKA 2D31B 4KZEH 2D0FA 2HJLA 1H5BC 2JJWA 4L9LA 3MYJA 3MUZ1 1B9ZA 2ICEB 1FYTD 2R1WB 1REIA 4JQXC 3U7AA 2R4SH 3MV8B 5KSVA 4NO3A 4K8RH 4OZHE 4RA0C 4ELMA 5JDJA 2VLME 4FRWA 3WE6A 5I75B 3U4EA 1CD0A 2OK0H 4JHAH 5JDSA 3GSQA 4WUUE 5ENWB 3TESA 3T2NH 4GRLC 2H45A 1BQUA 3ARBD 1W0VA 5ISZE 3PWPD 2B5IB 3D39A 5HGAA 2BNUA 2DBLH 4Q9QL 4RIRB 2HMIC 1VSCA 4NKDB 3K46A 4PJBB 4LU5H 3ROOB 5D71H 3QAZC 1YY8B 3ES6A 5FF6A 2HT4D 4LVHC 4EI5B 1XGRB 4Z95H 2WQRA 5CD3A 4X6DA 3ISWA 4RBPK 1A6AA 3KDMA 4Q97A 3LEYL 1RUQH 3HI1A 2DICA 1AGFA 1WTGT 4KK9C 1V3KA 3VD9A 2X4NA 3F62A 3VXSD 2HFEA 5DJ2B 1T2JA 2YMXH 1DQQA 1JHKL 1QSEB 1NCDL 3RA7L 3DWTA 3FB8B 2EZ0C 1QEWA 4Q58C 2DLFL 4GW1A 4WHDA 5HHNB 2OR8A 4XNUL 3C2AH 1TCRA 5ICZA 3B5TA 3EJYD 1A4JB 1EO8L 2WWMD 2HRPL 2PNDA 2YSSA 4HH9B 4K9EL 2N1KA 2GSIA 3ZE2F 1K4DB 3MR9A 5DMIH 3RY5A 4K3JL 2OXGA 4EQ3A 1Z9MA 1SJEA 5FUCC 5ID0A 3GUTA 1S9WA 3C60A 4U6TA 4WGVB 4JREB 2P5WB 3QDJE 3HMWL 1P9MA 1RK0A 1MHEB 5I76B 5IVXA 1MWAL 1OGAB 1S7TB 4MJ5A 4J7RA 1NGZA 4AG4L 5DQDH 5GJSH 1JI1A 3O8XD 1WIPA 3OAUH 3NMEA 1AHWB 3IXTA 5FXCH 4NGHL 5EO0B 3U36A 3MLSH 5LCVH 3H3PL 1N8ZB 3ROLB 3L3GB 3VGDA 3O45B 4OGXH 5C0BE 4AENA 1JGVL 1FE8H 1T1XB 4P23B 4Y2DB 2HKFL 4J1UA 3RL2B 1YQVL 4PJGA 4GQPH 5ILTH 3NPSB 2YPLD 4ACPA 2H3NA 3WN5C 3QPXH 2RIKA 1X44A 1LO0H 2GSIB 3M45A 4PJCF 5D96B 5CAYB 5BVPL 4Q0XH 3KPLB 5GIRA 1T21A 1DBBL 4L3ED 5HHVL 3S5LB 3TFKD 1ZA6B 2EECA 3QFJE 4Y4FD 3TO4C 3VW3L 2DTML 3VD7A 2YD3A 4P9HC 1LEKA 1DL7H 4O51A 1FYTA 1NDMB 5MEPB 1HI6B 3D69A 5D7IA 3LN4B 3KWWA 1B6UA 1BFOB 4H0GA 2FDBP 1DDHA 5JDSB 4AZ8A 3S98A 3UJJH 1JWMA 3MXVL 4DAGL 3L5XL 4JY6B 1IQWL 1HKLH 4O58H 5HPMB 5I19H 4ODWA 1I3RB 2V7NA 5BZWB 3HAEB 2HJFA 3DUSB 3IFNH 3MTRA 2E6JA 5ANMA 2A2QT 2CRYA 5FYJE 4GRLD 1INEH 3OL2A 1HHJB 3QI9A 2A77L 3MOAL 4YHKH 1VKXA 3O2VH 3RFZC 4YJZL 4EDWL 1K5NB 2XZCH 4BK5A 5JMOC 3CXDL 3VXRD 4BQCA 3WXVH 5FV2A 4QGTA 1RU9H 2NXYB 1YMHA 3MQIA 4YBLC 1QBBA 5IWLC 4JR9L 3MZGB 1DLFL 4XNQA 2J8UE 4ZPVB 4ZAKD 5F7WC 4NHUB 3AAZB 3RVVD 3V2AR 1DBMH 4QRPE 3CDFA 1S9YB 1Q9OA 4NZDA 5C0CA 4XI5C 5JXEC 5ENWA 3SKUD 4HK3N 3G5XA 4DGYL 3BDYL 4NUJA 3WFEH 3ZE2E 4JN2A 2XWBB 4WW1B 1A1MA 2AKRA 4RDQG 4Z0BL 3UTPD 1AXIB 4CGTA 2Y7QB 4OD2A 3HMXH 1F2XK 3NA9L 1DE4A 1KTKE 5MEOB 3UYRH 2EDOA 5CINL 1DBAH 1C5BH 4G7YH 4P4KB 2XKNA 1OAYL 5DFTA 1A47A 5I2IB 3S4SA 1NC2A 5IEKA 3QPQC 2AXGB 1HSBA 2Q8AL 1XR9A 3L3HA 4LLUB 2WMPA 3IYLW 3DBXA 5D2LB 3UTQA 2BVOB 2DQEL 1D9KD 3L6FA 3BX7C 2MKLC 3B9DA 3MBXL 3HR5B 3G9VA 1UM4H 4H1LB 3PL6A 3H2WA 3P4NA 1UJ3A 5AZEH 3MBEC 4WW2C 4AQOA 2AK1L 3BEVA 2FHFA 3LRSA 3P9MA 1MCEA 1ROWA 4OB5L 5LAXA 4PJCE 1EK3A 4MQ7A 2XWBA 5B22A 1LDSA 4XZUB 3VCLA 4IS6B 1R5VB 4FZEH 5T1MB 2Y6SC 4G8GB 2J7LA 3S8WA 5F7LB 3KPMB 1EUTA 2HTKC 4FQPA 4F7CA 3H3BC 4NZRL 2CUIA 1MCWW 5GHWL 3FN9A 5DC0A 1SMAA 3GHBH 1U3ZA 4YHYC 4P5TC 4ALAH 4YE4H 2W0PA 1EV2E 2FX9H 4LIQE 2GITB 4PIRF 4OLZL 3BAEL 4NQED 3PP3H 1XF4B 4YR6B 4AEIH 4CAGA 2YC1A 5IG7A 2L7UA 2EC8A 4PTUA 1HHGA 3DXAD 4B41A 1RFDL 1SY6L 4HCRL 1EEUA 2OXHA 4N0RA 3KPRE 1IEBB 3MUHL 1A9BB 4M1GL 4FABH 2J12B 3RIFK 4M62H 2FJGB 2W91A 1VCAA 3HE6A 4H1LG 4DVBA 4POUB 3HAEA 5EOTB 3ULUL 2DM2A 4P9MH 5JIHA 4X4MA 2ENSA 3O8XC 1ZANH 1ADQL 3NCCB 1CGVA 3BVNA 4LQFH 2F53E 4WEMB 1CDBA 3MJ8A 8CGTA 3O3EA 4YBLB 2YZ8A 32C2A 5BJTA 5JIPA 4G3YH 3LN5B 3WJJA 1ZA6A 2M8XA 4FQJH 5E4EB 5KVMC 5ISZA 3NABL 4ERSH 4NZUL 4PD4K 5IJKA 1RIUH 3OJ2C 5I15L 4HJGA 1RZJH 3DUHA 3ARDB 1N5AB 4UILH 1J8HB 2R23A 1AGBA 1D5ZA 1NCAL 4MB5A 3VG0H 2EE9A 1LILA 1YDPB 1ZHKB 1N5YH 2X89D 5C70A 1IMHC 4XAKD 4ZAKC 2B8OT 3C6LA 5FYLH 3CSGA 2X70A 3WLBA 3LKOB 4HIIA 5F7DB 1XF5A 5BZWA 4DN4H 3EO9H 1T5XB 1A6VH 3HZYB 1YNLL 4JFHE 4Y16D 2E7MA 3VH8G 5GRVL 1MI5E 2VLKB 4O2FB 4M9PA 3O2DL 2AJZA 4B53A 1WBZA 4J3UA 2DQIL 4LSTL 4OLWH 4W6WB 4W6XB 3REWA 1DQMH 2NY1B 4OCSL 5T3XD 1FH5L 1NGPH 1ZAGA 3K81A 4LDOB 3T0VA 5J57B 2F5AL 3GKWH 4LVOC 5I8OL 4FG6D 2FBJL 1N0XH 3SE4C 2KDGA 1H3WM 4JM4L 5HDBE 2YXMA 1FFQA 3OKEB 4JY5L 5IG7B 1RQ5A 2IALA 1WUNT 4PD4J 2Z92B 5KZCD 1T0MA 1E4WH 1FPTL 3WJLC 5C0CD 3OX8A 1NC4B 5FYJH 2D4DA 1F3RB 1NLBH 3MA7A 3P11L 1J1XL 6CGTA 1ZHKA 4XNXL 2LV4A 4DOHB 3BUTA 1KLGA 1F6AA 3H0TA 1DSFL 4HT1L 3OBAA 3CFKB 4KPHL 3Q6FB 4JCLA 4K71B 3GRWH 3BPLB 1KCKA 4WCYL 3FT4B 4UI2A 2R1XA 5GGUA 5JQ6L 2VDPL 1RZFH 3JSSA 2X42A 1MLCB 3EOAA 4TQEL 4FA8A 3N1PC 2J8UA 3B83A 3V4VH 3EFFA 4HF5L 3DIFB 5I1GL 2VDMH 1ZTXL 1ZHLB 2GAZB 1KCLA 2J6EH 1GGIH 2BHUA 2FB4L 1D9KA 2OQJB 4FN0A 3NIGE 4U1SA 5IMOB 2IPUG 5IM7A 3S97C 5IF0B 2QSVA 4GAYA 5HDBF 3D3VE 5IB4B 3T0ED 1IVLA 4PJ8D 3SGEI 1X5KA 3BEWA 1IGFH 1CLOH 4OZFB 1J87A 2J5LC 5C0GA 1QLFB 3E8UL 4W4NA 4L8CA 3EYSH 3FFCB 3CLEH 5L8LB 5DTFA 1L9MA 5J89A 5KTEH 4P4RB 3NFNA 3Q3GA 4JFOA 4NZTL 1QSEE 3ZYZA 3S35X 2WIIA 5I30L 4PRIE 2VH5H 2JIXB 2YPLA 4HUVB 2UWEF 2G60H 3V79C 3GSNA 1I3GL 4E9LA 2F8XC 4K7PH 3QQ4A 4YDKL 4PGZA 1GXEA 4HFUH 3MRJB 5JPNA 1N6QH 3HPLA 4X80H 1LP9B 3NIGF 4POYA 1S5HA 3V6BR 4Z7UA 4PJBA 1G6VK 1HOCA 3JVGA 1GIGH 3BWAA 1FNEA 4NCDA 1VFBA 5JORB 2EEAA 3Q6GH 1JZ4A 4XX1G 4L4TD 4DWHA 2GUOA 2BP3A 3EFDH 3IF1A 4I9WD 2VDKL 5KVEL 2K9UA 1YC8A 4JZJB 4YXLH 1FNFA 3U1SH 1MCRA 4P99A 1JZ5A 4G5ZL 4Y1AE 3EDJA 1G7LB 4WUUD 1JGDB 1RD6A 4O2CB 1JN6B 4NPYB 3DMMB 1CI5A 3VI4E 5CUSH 4Y16B 4L4JA 1JMZA 3O11B 1TQBB 2G9HA 1MRCH 3T0AA 4D0DB 5ACZA 1TXKA 4N0CD 2BSED 1BQHA 3W9EB 4KQ3L 4HX1A 3JWDL 1CGWA 1EHLL 3R06A 2WV3A 2CRIA 1AR1C 3RVTC 5BW7A 2VC2H 1ZT4B 3I85A 3FQWA 3QISA 1J0YA 1LO4H 3EW3B 3BIAX 1XZ0A 3HFML 3ZHLA 1YEFH 3JTTB 3QQ9C 1YMHB 3WUWG 1UKSA 1N2RA 5IV2A 4TUKL 1U3HD 1FL6A 3HKFA 1TVHA 2BC4A 4UT9L 2W9EH 4AEHH 2CJUH 1A3LL 3Q48A 2PO6D 3L3GA 1JPTL 4JHWL 4M3JA 4AMKL 3KPOB 4HGKC 4Z7WA 3DOSA 2IALB 2VLMD 4R90H 4JY6A 3HZMA 5BRZE 2V7NB 3MV7E 1QHOA 3EZJB 1CDIA 5FUZL 1N3NA 3MLTB 5ECJE 1JRHL 5CJXC 5FK9B 3QO0A 1UM5H 3QULB 5GS0L 43CAA 2HAZA 2GJ6B 2NXYD 3PXHA 3LPFA 4Y0GA 5JHDA 3N85L 5DSCA 1LEIA 1BZQK 4UQ2B 4I77L 1IEHA 1OWWA 2H32B 3QG6A 4JPKL 5EWIL 2D4FA 3VFTA 2BHYA 1J9CT 5J6GB 5FA3B 1I8IB 3VWJD 3BP5B 4U0RB 3S5LG 1MNUH 1WBYA 3MLWH 1B2WH 4OFVA 3IJHB 4L29A 3RP1A 1A7NH 4IIQB 4UDUB 1HYSC 4Z7VB 4JKWA 4IRSA 2HT3C 1DN0A 1MCOH 4PRPB 4V1DB 3MRCA 2IPKB 1HWGB 4PG2A 1U3YA 5C0IB 1X5JA 1MAKA 1MQKH 4AEEA 3WFBL 3CFCH 5C0DB 4D8PB 4LPTA 4Q2ZB 2P42B 4MLIA 5A2KH 5DK2A 5E6IC 3RTQD 3QWOA 4JO4L 4AYFA 3RJDA 2PW2A 1MUJA 4J8RA 3MGOB 4EVNA 5IHLB 4NP4L 3GKZA 5C0FA 5DGRA 4YPGB 4HPYL 5E00B 3U9PH 4HJ0D 3TBWA 3BFOA 2P24B 1K2DB 5FECB 4DTGH 1XZ0B 1OP3K 1Q72L 4U1MB 1KBGL 3GBNH 3VFOB 1SJHA 2P49B 4K94H 2QBWA 3X13A 1JNHA 2KKQA 4JPVL 3W5MA 3QDHA 4DZBA 5C0RH 3E2HB 1UZ8A 1I4FA 2FEEI 3CFEA 1DQTA 3SE9H 3BKCH 3E1F1 2XOTA 3FJTA 3ARTA 3B9AA 4KRNA 4HWEH 1V7NH 3MLTA 4XPFH 3D39B 1V3LA 2VISA 2P5WE 3HAEH 4HS6B 3RVXC 5EOQH 3MNVA 1TCRB 2GJ6E 1Q9KB 5DVMA 4UBDD 2ZSWB 3LIZL 4ODBD 5KS9E 3KAAA 1TVBB 4HWNA 4XNYL 4Z7QE 3QIUC 1MJ7L 3B9KA 2ORBL 2A6IA 2E9BA 2NZ9D 1KOAA 1JPGB 3SGJC 3PQYE 4HLZG 1XGRA 3L3KB 5CJBA 3MYJB 1YEJL 5T1LB 3KPQA 1TTUA 3V6FB 3ZHKA 4HD9A 4I0KA 4Q6YA 5SWSD 5EOCL 4LOUD 5DD0L 3NAAH 2LVCA 3JWDC 1AD0A 1NCCH 3G6JA 1T4KB 1CDHA 4P59L 4PJ5A 3FAWA 4L8BB 1MCLA 5CJ5A 4P3DB 1UCBL 4HKXA 3PXJA 1VGEH 4TVPL 4YHOH 1E6JH 5E6IA 5T1MA 4JFEA 5IIEA 5AUMA 3WS3B 5IJKC 3W5NA 4P4KA 4RWHA 1G6RH 3VFVA 3X14A 2A1WL 4X6FB 1QA9A 3GMRB 3CH8A 1IAII 1MI5D 2VR4A 1FGVH 4LMQE 5KW9L 1T1WB 3NA4A 4YHIA 2BNRD 4NQDB 5FYLE 4KVNH 5K9OA 2OZ4A 5DRZB 4S1QL 3J7HA 3WBDA 1I9IL 6FABL 3GMMA 1M71A 2R69H 3B8SA 4N1CA 3GMPA 4PJ8A 4MCYB 3O81A 4IOIB 4I2XB 2ZG2A 3OR7B 4FS0A 1RI8A 3MA9H 4PRNB 4DVRH 2OR7A 2V17L 3LKSA 4OCLC 3IJSB 5DQDL 3VRJA