3SN6N

Crystal structure of the beta2 adrenergic receptor-gs protein complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
128
structure length
128
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYKMNWVRQAPGKGLEWVSDISQSGASISYTGSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCARCPAPFTRDCFDVTSTTYAYRGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords Guanine nucleotide-binding protein G(s) subunit alpha isofor
publication title Crystal structure of the beta2 adrenergic receptor-Gs protein complex
pubmed doi rcsb
source organism Bos taurus
total genus 27
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2011-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sn6N00
1XGTB 2A74A 4UTAH 2VMFA 4ZAKC 4V2BA 3NPSB 4UMGA 43C9A 2YSSA 3SKMB 3L7EB 3U7WH 4MNGB 4D9RE 4YXHH 4PJ7F 4XC3H 3D87B 1LK3H 1FSKB 3UTTE 1EV2E 3O2WL 4OB5L 4KK8D 3FONA 3QEUA 3QQ9D 4IOSD 1ZVHA 2G5RA 3O9WA 1TNNA 3PL6B 3NVQA 1KCUH 4BK5A 1S5HB 3GUTB 1MAKA 1WFNA 1XEDA 2ITDB 1T5WB 3O4LB 4LSTH 2CDGA 1SHMA 3ARBB 3VFRA 2YZ8A 2DQGL 3C5ZC 4YDLB 4JKMA 2ZOKA 3WNLA 1UJ3A 3DNKA 4NO5A 2ZJSL 3BJ91 3PQYB 1CFTB 1SY6H 4LLDA 2VQTA 5T3ZH 2JKXA 1MIML 2ADIA 5IGXL 4HUXB 1PGRB 1Z3GH 2XKNB 1ZHBA 2IGFL 2KKQA 1EZVY 1IQWH 4MVBD 5JUEH 4Q9RH 1P1ZA 2Q3ZA 2XA3A 5B8CA 3IDYB 4YWGL 3GGWA 5C0GB 2XY1A 3BXNB 2HJKA 4YFEA 2XTLA 2X89A 4ODWA 4QRUA 4HPOL 4I2XB 2DD8H 1ERNA 1I9EA 5GGTA 4BQ8A 2GJZB 1N5YL 1KSRA 2GJ6A 2X44D 3VG9B 1OARL 3KAAA 3CLEH 3L95B 4GMTH 2VL5A 3F12B 4XVUC 5DT1H 3SKJH 3L3DB 3PWJB 2A0LD 1AD9A 4TUKH 1S7WB 1ZMYA 4P2RB 2R1WA 5FF6A 4WEBL 5BXFB 2GJJA 4LLVA 4E0RB 1FIEA 5A2JH 1EMTL 4RNRB 4HCRH 1LP9F 4Y0GA 4A6YB 4KHTH 5CILH 2ESVA 5EN2A 2DTSA 4S1RL 5D70L 5ITBL 2E8YA 5E6ID 3FB5B 4K3EH 3RWEA 5IMLB 2CLVA 3O6ML 1NGQL 3ES6B 4UDTA 4ODSL 4BQ9A 3DWTA 5EU6D 2MCG1 3OV6A 4PRIE 3VXMA 2FJHA 5DD1L 3RTQD 4ZQKB 2ZCKH 1VADA 3L7FB 4A6YL 4IRJB 1DANU 2CSPA 3EYSH 4P46B 3RGVA 5D1XD 5C0JA 3KNBA 5DJZB 1J1XH 2FO1A 4MAYC 4U1NB 5DMKA 1J8KA 1JHLL 3MCKB 1DQTA 4EIGB 3SGDI 5LCVH 4WCYL 5DR5L 4JHWL 3MBEA 4WV1C 3EHBD 2Y07H 3LH2H 3DRTB 2ZUSA 3OPZL 5TDOA 3M8OH 4MA3A 2BMKA 2PW2B 3M17A 5J11B 4XVSH 2NXZB 1S9KC 1MCHA 3EGSB 3TZVC 2P8LB 4OFYD 4UTAL 1DL7H 4Z76A 2PNDA 1SEBB 5ESQA 5L2KE 1K9TA 5I16B 3KYKH 3I02A 4NQDD 3U7WL 4YXHL 4XC3L 2VAAB 4OF5A 3VXTB 2G2RA 4NKMB 2KQMA 2XNAA 1G7MA 1NGYA 5K59F 4WGWB 1FBIH 2GUOB 4MWFA 1YN6B 1KXQE 4P9HH 3IFLH 2BXZA 4BZYA 2DRUA 5KAQF 5EU3A 1JYWA 5HHMB 4OGYH 5CGYD 1PSKL 1KXVC 4ODBD 4ONHA 5D93B 1NJ9B 3NABL 4OQTH 1Z9OA 5DMJB 1IGTB 4PJDE 4JAMA 1UXSA 3BRFA 2FATH 4TVPD 4XBGA 3V0WH 5E5UB 2YRZA 3CVHH 1OOAA 3R06B 3KJ6L 3RDTC 1IQWL 5JUEL 4CAGA 1RUAL 3CJJA 4JFYA 1T20B 4I13B 3HS0A 1U8QB 4JM2D 3EZJB 2DD8L 4PJHA 1SJXA 3H7BB 2WBJD 3QCUL 4P5TD 1I9RH 2APFA 1U3HD 3JZ7A 2EO1A 3GB7A 3MO1A 5KW9H 4NNYA 4UNTA 1F2XK 5JLZB 5DT1L 1XH3B 3OGCA 4L9LA 3SKJL 4FFWC 4XWGH 4FQHB 2QSCH 3V0VA 3GBNH 2EH7L 5CP3A 2ZUVA 5CMAA 1EGJH 3UYRL 3CPLA 1QVOB 3HAEG 1NCUA 1QNZH 4JFFD 2WP3T 3T0ED 1KJVA 3SJVB 4ONFH 2RB8A 4HCRL 3TCLA 5TJWK 9CGTA 1KJ3L 3D3VB 5KSBE 1YEGH 3JV4B 4K8RL 3TNMB 2ZSVB 5ELIA 1JI2A 2H8PB 4X7SL 5LGHH 1AIFA 2O5XH 4BUGA 3OKKA 5JTWA 4BM7A 3VXSD 1W0YT 2JCCA 2UWEA 1DVFC 5JIHA 1AC0A 1ITBB 5K9JL 4HUNB 2V5TA 4ODTH 5D1XA 3E1F1 1J1XL 4O51B 1RIUL 4XP9H 2QQNL 5I1DB 1G0XA 1HH6A 5AZ2L 3MV9D 3T4AB 4B7LA 5ADPH 5H35B 4WFFE 4JRXA 5J12B 3QBTB 4L3AA 4C56E 4F7CB 4JDTL 3RBSA 3EYOA 4EKXA 4HMEA 2PCPB 5GJSH 4HIJA 1EEZA 5HI4C 1C16B 5D5ME 2C4FU 4S2SB 5C09A 3BDXA 4H0HB 4RAUA 5IROC 3U4AA 4QXGL 3GO1L 4RGNC 3UBXI 2PW1A 1FVDA 2E9JA 2WLYA 3CXDH 3OKLB 5I66B 1FNGA 3RWJA 4PGEB 2A83B 4M7ZB 1FBIL 1A3LH 4E5XA 1F11A 1FNAA 1SJEB 3G9VA 3F7YA 2W0PA 5HYSA 3BUYA 2XIDA 3NCJH 5TDNA 3TBSB 1H15A 3CVHB 1RPQA 4OGYL 4GG6E 2WWMD 4JGUA 4ZS7L 1KGCE 3BZFB 4XB8A 5IV2B 4Z7VB 2UVEA 2PO6A 3STZA 1HILA 4KQ3H 4WDIA 1OVZA 3B2UC 2P7TB 1I75A 3FZUC 3CVHL 3CFCH 3EDJA 4Z7NF 5FYKH 5AZEL 1I8LC 4L4TB 4M6NL 3LB6D 5FUCC 4X9HA 1P7QB 1Q0XL 4NZTH 2F9BT 5TE6H 5SWZD 4EEEA 4OCRH 2GK0A 4JM2A 4BH7B 1UM5L 4ODUA 5F9JA 3CDFA 4XWOD 4P5TA 4PP2A 1I9RL 1NC2B 1T4KA 4KDTA 3ABZA 2VXUL 1VFMA 4IMKC 1U3HA 5F88A 4CVUA 5KW9L 2VDOH 5EUOF 3VGGA 4ERSL 5C0BB 4NZJA 2P5ED 3PNWA 1Y0LB 2HVKA 4OZIE 3GBNL 5F96H 1HINL 1IFHL 4FQQA 5BO1L 2B20A 2WUBH 5DD5L 4QRRA 4JFFA 3MUY1 3ULSB 3HNSL 1YNKH 1T7WA 4IHOA 3H9SA 2AI0H 4XMLH 2Y6SD 4EDXB 2AEWA 1JZ5A 5LGHL 5IFHL 2O5XL 1XGQB 4YZFE 5D2LF 1S7SB 4TQEH 5F9DC 3VXSA 4R26H 1ZLWK 2VLMD 4U6VH 4L3EB 4F57H 1MCJA 1T1WA 1CD8A 3ZDZE 4ODTL 2GYSA 4LVNC 4WFED 2AV7B 1ZA6B 4D0DA 1I3UA 1UFUA 3H3KA 1TZHA 3HHRB 2O5YL 4XP9L 4OIIL 1CZ8L 1CFNA 1EIBA 3MV9A 4PREA 5ADPL 3QEGH 3PABA 5DO2C 3KVQA 2DIJA 3MGAA 4Q74A 3VE0B 1BZQK 1J0KA 2OI9C 2ED9A 5JOPD 3MLSH 1P4LA 3N9GH 4KKAD 4XZUA 4NKQB 1U8MB 4ZO8A 3GM8A 3FB6B 4PG2C 5GJSL 5ALCH 2MJWA 4OLEA 3BQUC 3CFBB 5A2KH 5M95B 4N90D 4RZCA 3NAAH 4DTGL 4DGVL 3UTSE 5IW1B 5MENB 3VI3F 2GCYA 1EA9C 4N0UA 5FAAA 3CDCA 3K2UH 3RA7H 5FM5M 2E7LA 2EYTB 1IC7H 4G42A 4TTDD 4I9WD 3KYMA 1A3LL 1A7QL 1RIHH 1CU4L 3HPJA 3ARDA 5JZ7C 3LMJL 3NCJL 4WNQB 5ANME 3PHQA 3PWUA 1CG9B 4PJ7A 1OP5H 1IMHC 3AS2A 3FTGA 1J11A 4U3HA 1UADC 2G60H 4G7VL 1B2WL 4NN7C 2UUDK 3QUYA 1YMMB 4KQ3L 4LARH 3HPLB 3ILQC 5JDSA 4MJIE 1R3HB 4AG4H 1B88A 5E08H 4KI5C 1FQ9C 3KPRA 5ENWA 5FYKL 4KTEL 3QNYA 5FGCB 4FTVD 1HCFX 2DQCH 1QSEE 4J4PD 3SDDC 5C0FB 5GGSA 1DFBH 1B9ZA 5JO5A 4HIEB 5SWZA 2OM5A 3GIVA 4PRPD 4YQXL 3ZHDA 2DJSA 4E41E 4OCRL 5F7FA 3DMMB 1IGML 4Z77B 2BNRB 2QKIA 2B7DT 4ZTPL 3V4PH 3WLBA 5BW7A 3PWPA 1HOCA 4ZPTB 1QG3A 5JW3H 5FIEA 5F7UA 3SCMD 1DUYA 2N1KA 5DZLA 4PLKC 1TFHA 4CN4A 1PZ5B 4OD2B 5IBUB 4AL8L 2P5EA 1J5OL 3O6FB 1EHLL 1GIGL 4ETQB 4MNHA 1ZT4B 2J4WH 5CS7A 2WUBL 3VDAA 1CGTA 3TBTA 5DUMH 5J0BA 4DGYL 1D5BA 1JCKA 2PTTB 2ZCHH 3V6BR 2CUIA 4I18C 2AI0L 1AFVL 3P0YL 1FNEA 2NYYD 3L5WA 3LN5A 3RGHA 1LE5A 1ZEAL 4AENA 4N9GB 2Z8WC 6FABH 3ZDXE 1YY9D 1LP9A 1FYTD 2AERT 4RQQB 1W8OA 2YMXH 3QZWA 4BFEA 3HC0A 2P5WD 5ETUB 3B5GA 3EO0A 2FGWH 2J8UB 3G6JB 3LN4B 4P2YA 1KB5A 3QEGL 3ROLA 5IJVA 1JV5B 3GJFK 3QIBA 3BPOC 2BSSB 3FN9A 2VLJB 1RFDL 4XNXH 2NY5H 1BX2B 2HFGH 2DF3A 3SGEI 1OSZA 3QRGH 3TFKD 4U2ZA 5BRZD 1A1OA 4MZ2A 4WFHD 3CFJA 3DX9A 2MQ0A 1FFRA 4DOHB 4ESKA 2GJ6E 1H8SA 3W0WD 1A6ZA 1S8DB 1QRNA 3P4NB 2FX8L 3TT1L 1JGEB 1ZE3C 1QLFA 3C6SB 1TVBB 1IC7L 2C5DC 4QF1A 5B21A 4GG8A 2B8OT 4XB7A 2R0WH 1NDMA 1RIHL 4KJYA 3D18A 2CDEA 3D85D 5ISZB 1HDMA 5TFSH 3IGAA 3GFUA 3ZYJA 2ESVE 3BH8B 4XNMA 2E7BA 3C08H 3RVTC 3WUZA 1S9WB 2H2PC 2W9EL 5E4IA 2XQBH 3DSNA 4DKAA 5I0ZA 5DMIL 3QISA 5I1LA 1WCQA 3VXME 4AG4L 3MRDB 5E08L 4PJBE 2ZCLH 1OQXA 4JPVL 4NGHH 4YDJB 4DUXA 4FTVA 5GQBA 3WJLA 2NPLX 2DQCL 5BQ7B 3PV7A 4KKCC 4J4PA 4FABH 2HFTA 1PW3A 5HPOA 4S1SL 4RCAA 4PRPA 2YD8A 1CLZL 2XZZA 4KAQH 1PKOA 3EYVA 1NUGA 1NCBH 1S78C 1KELL 4WI9A 1RSFA 4P3DB 3N1FC 5KS9E 1A02N 3OTTA 2FJFB 1RZIA 4U0RB 3X12B 5F21B 5F71A 4IJ3C 4U1LB 5D7LD 1JNHB 4GS7B 4RMVA 2DYPB 2DI8A 4ZOAA 4AT6A 3B6SA 2BVQA 2XKUA 1QSZA 1HQ4A 2Z31C 1CE6B 2VWEC 2JJTA 1Q1JH 2A9NL 3DX8A 3OKOA 2ZCHL 4R0LC 5M7QA 5L8JB 4M5YL 3I2CH 2VISA 3J8F7 3DTXB 3RVVD 1IKFL 2J5LB 3QNZB 3VD7A 5GGSY 5C9KA 3QNXB 3IS1X 5C08A 5IM7A 1C5CL 5DMGC 2QTEA 3PGFH 2BNUA 2ICES 6FABL 3I3BA 3S3PA 3QO0A 5E94A 1ZHKB 2YMXL 2B1AH 1H8OA 5B38B 2BC4A 5E8PB 3NFSL 2FGWL 1ED3B 3GNML 4OCSL 1CGXA 4ALAL 4GAFB 3O3DB 3EJZD 5ERWB 3C60D 3ZYOA 4OLUH 1U2HA 1C1EH 3OSKA 3TBVB 2E9WA 1WUNT 5JOFB 3ROOA 1X9QA 3QRGL 4PJHE 4MJ5B 5ESVB 3WEXB 3ZKNC 2AXFB 1BQSA 5AEAA 3CLFL 5EOTB 3W0WA 1XF1A 4Z18A 4YHYB 3FO9A 4UOW1 1A1NB 3U0PB 4AIOA 5AUMA 3VRIB 1A21A 4D8PB 1C5BH 5IMKB 2R0WL 3RJQB 3FOMB 3S97C 43CAA 2HJFA 3MLYH 3D85A 4R2GB 2EIEA 2A9MH 3KPTA 4XX1G 5TFSL 3IYLW 12E8H 1LO4H 2GAZA 3KXFB 4ZUWB 3PXHA 4AEEA 1K4CB 1IGJA 2DN7A 4I5BB 3TEUA 4I0PB 3Q3GB 5ACZA 3VFUB 1VGKB 4YEFA 4JVPA 5ID1B 2XQBL 4OM0L 1Z5LA 4ZOCA 3U0TA 3PP3H 4GSDL 1KTDB 2ATKA 4PJFB 3B9VA 4X6EB 3V7AG 4NDMB 2JCCE 1V7ML 1GGBH 3TA3B 2LU3A 3VDCA 1CI5A 1VGEL 1OTUD 4JG1L 3QI9C 1DEEB 5KVFH 2AS5M 1BBDL 1TLKA 2BCKA 1BQLL 2YUZA 4JRXE 1UB6A 4TNWK 1XCQB 5INDA 3BPNC 5D6DA 1H5BC 5IB1A 2I9TA 1DZBA 4WU7A 5E2WH 2X1XR 2Z8RA 3K8KA 1YNLH 3KPNB 4QRPB 2DWDB 2F8VA 5IHLB 2XTJB 2F5BL 1AXIB 1OAXH 2R56L 5HDQH 3NIFF 2W60B 4X6FB 4M93B 4LKCB 3BP4B 2IANE 2ICWB 5C09E 4KV5F 3UDWA 1C08A 2BX5A 4BUHA 1OM3H 2MFNA 3CCHA 1Q1JL 2BVOB 1ZS8A 4KRLB 3OAUH 1QZ1A 5EUOA 3RY6C 4JQVA 4LASH 3FQTA 2P24B 4UOJA 3U9UA 5LBSH 5KOMC 1G6RA 2E6JA 3GSXB 2OJEA 5HHQB 3QG6A 2GITA 2LVCA 4GRWF 3IFPA 3MC0A 1AI1L 3PGFL 1I9IL 4NJAH 3TN0C 2OL3A 3HZKB 4G80A 1A7NH 2CO7B 5HYSG 1I7RA 3TJEH 4OF3A 1G7HB 3D9AL 2D7NA 3V8CA 1O5DT 5D1ZD 5J3HC 1PVHA 3MROA 1YEDB 5DC9B 3W9DB 5HHPA 2QQKH 2Y72A 1JE6A 5CEYA 1G84A 5D2LA 3FT4A 4Y4KC 4WUUE 3LQAH 2KUTA 3F5WA 3C60A 4OLUL 1A3RH 3SDCC 5HGHA 3ARXA 3PP4H 3MNVA 1BJMA 3L5HA 5IMMB 1OAZL 3R8BB 3BZEB 2G5BA 5GS2D 4UUJB 3O81A 5DRXA 1GGTA 2EH8L 2Q6WA 4ODVH 1RULL 4Y4HB 3MR9A 1GGUA 3ULUD 3MGTA 5DJDA 4L29A 5HHOD 4YUEH 4WW1A 1OL0A 5EZIH 2H3NA 4X4YB 1QR1A 4KKBC 5CCKH 1IQDB 2OZ4A 3MRFB 1RIVL 3DETC 3C5SA 2PF6A 4YHNA 3P9LA 4LBEA 5JR1H 3Q5YA 3TJHC 4QRRE 1RQ5A 1JPTL 2A9ML 12E8L 1LO4L 4W4OA 3H9SE 3D48R 3HRZA 4FQXD 3HR5A 4NUGH 1PKQA 3C5ZD 4Y1AD 3HNTH 1TZIB 1JZ8A 5D2NC 3TF7C 5CD5C 2KZ1B 4XNUH 3L5XH 4KMTH 5DTFA 1HHIB 1NEZA 2FX9H 4XPTH 3QUXB 1A4KA 4TSCH 3VCLB 1AKJD 4UB0L 4JPWH 5D72H 1BZ9A 3R1GH 3QXVA 2ADGB 1N0XH 5KVFL 4PGZA 2AKRB 2DQJH 2H6PB 3VXUD 5DGQA 1LILA 1YNLL 2IPKA 4PJGF 1DBBL 3IDXL 1KN2L 1OAXL 4K7PX 5DJ0A 4MNQA 4NO2A 5F1IA 2AQ3A 1T7VA 4OFDA 3FB7B 4U05A 1C5DB 2GW5A 5CWSA 1OM3L 3TVMB 1IZKA 3G5XA 3BPLB 4OLWL 3WO4C 4N0UE 5HGDB 3O3BB 2FH8A 1OTSC 4X0KA 2XN9A 5LBSL 4TOYL 5F97E 4ZOEA 1D5ZB 1KPVB 5BVPH 1JZ4A 2IADB 3WJJC 5BZWA 1WC7B 4PJ7E 3NFNB 3D6GA 2VKWA 2BVUA 2ORBL 4NO3B 1R0AH 5EBWB 3U6RA 4IRSC 3O11A 1RJYA 5D1ZA 3V6ZA 4ZFZB 3WCYA 3FT2B 3QDJA 1JGVH 4MAYD 6CGTA 1QSFB 2R4SH 2R1XA 4LEXL 3KPRE 4LVHB 1CICD 1JPFB 2NY1C 4KK9C 1UENA 1WQVT 4R7NB 4OKVB 4WW2C 5DMYA 1WFUA 1A6VH 3QA3B 1EUTA 3PP4L 4MX7A 1WV7T 4OFVA 1LO0L 4P2OB 3MRLA 1FN4A 1D5XB 4MCZB 1KUMA 2H2SC 3HB3D 4PJIB 2UZYB 3PWPE 2P8MA 3H9YA 3IDIB 4NO0A 4ZAKA 4YUEL 1G7PB 2DBLH 3NGBC 4W6WB 5JPMA 3TO4C 3QHZH 5JORA 3VFMA 1RVFH 4HJGA 4MCYA 1PLGL 1NCCH 4OV6F 4OZGF 3B2VH 3HZMB 5GRUH 7FABH 3ARFD 4ZFOA 3V4VH 3C6LB 3QEQB 4JDVB 5ECJE 1I8KB 1ZVSA 1P6FA 5GHWH 3SGKA 4Y5VC 1B3JA 3IVKA 5JXAH 4KI5F 1W72H 1Q9OB 5MERB 4F58H 1FG9C 4WIQA 3C5ZA 3G08B 4LSQH 4G6ML 2NX5E 1XT5A 4HW6A 4MAUH 1NBVL 3IDJA 4XNUL 1F3JB 3GSRB 5D6CA 3B8SA 4MDIA 1NMBL 3MRRB 1LP9E 1QHPA 4TSCL 3MLZL 3EFFB 3QWRA 1AKJA 1BD2D 4JPWL 5D72L 1C12B 4HLJA 4YPGB 3QZWG 4Q7DA 3BKML 3GHEH 3LPFA 4U4BA 2QSQA 3VXUA 1H0DB 1MFDH 4RA0C 1NSNL 3E2HC 4X4XB 1KXTB 2BOCA 2IH1A 4LRNL 2VLRD 3ZKXB 3GJFA 4OUUB 1J05A 1TITA 1BHGA 4X9GA 4L4JA 4KROC 3DIFA 3HZVB 2YPLA 2VL4A 4UBDD 3ZKMD 3B9KC 2YBRB 4XXCC 4HPYL 5EU7E 5HVGB 3H42H 4F8QA 5T3XL 3HTLX 1EBPA 1DSFH 4YDKH 1S7QB 3RUGF 1QRNE 1U95A 3KWWA 3PWVA 4C83B 5J6GB 5CGMA 1M7IB 3NCEB 2W0KA 2MOVA 5BVPL 4HAFA 5E8DL 1UT9A 2VAJA 1RK1A 5DQDH 1A1MB 3EYFA 4M6OH 2WM0A 4NZUL 1I1FB 1R0AL 1CGWA 1FIGH 1FZKB 3IDMB 1WWAX 4WO4D 3X17A 5K59E 4YDVA 2IPTL 4HX1B 4XPBH 5C9JA 1NGXB 2FJGB 1J88A 2AJSL 4H8WC 4RX4D 1QPPA 5F7HA 3L6FA 1JGVL 4MAYA 1EERB 1SEQH 5EU5A 5I8CB 1CICA 1CLOL 4HFUH 1MCOH 2H1PH 1REIA 5KAQG 5I19L 3Q6FA 4KRMB 3MRKB 1VENA 1A6VL 3E3QC 3P77A 4NQCD 4PTTB 4DKEH 3ULVH 1I4FB 4FA8A 2AABH 1UXWB 3AXLA 2P47B 3GMQA 1U92B 1HXMA 5CEZH 1DQJA 3TZVA 3MPCA 5DD0H 4DQOL 4P3CH 4NQSA 4PJ5D 4OFIA 3DVIA 5DJXB 3UPRB 5CD3B 3QO1B 5J4MA 1RVFL 1W72B 4NQUA 1NUFA 3VWKD 5FOBB 4HJ0C 3SDAB 4LAJH 3VWJD 5HI5C 3ARFA 3V4VL 4WI8A 5KSAC 2O26U 5L9DH 5GHWL 4G5ZL 2C1PA 4LCIL 5D7JD 5ITFB 4H8WL 1W72L 1T1ZA 1AGBA 2YD9A 1AHWA 2PYEB 4XCYA 5E8NB 4F58L 1MI5E 3RWCB 4JGMA 1X7QA 1BWWA 3NH7L 4FQ2L 4V2CB 5C08E 2CKBH 1D6EA 1T1YB 4ONGH 3F58H 1LK2A 2R9HD 2YUVA 2IF7A 2AK4B 3PDOA 3RNKA 1IM3B 1MY7A 2CPCA 4EUPA 1BD2A 2CIKA 4NQEB 3RDTA 4R96B 1BQHB 4N8CL 1VFAB 3IRZA 1A7OH 5K9KB 1YN7A 2EDBA 4EDWH 5KSVA 2R69H 3F7VA 5J9PB 3ZTNH 3QIWC 3K46A 1MSPA 4H1LA 1FO0H 2DLTA 1A0QL 3QHTC 3RIAK 5FECB 5JHLH 2ED7A 2NXYB 5FCUL 1J8HA 3DYMA 4R90L 1OB1A 4MD5B 4XH2A 1U93B 4BSWB 3H42L 4DAGH 5ABDE 5J8OA 4XMKH 4K7FB 3I75A 4WWKC 4YDKL 4HS8H 1Q9LB 5HHNB 1ZK9A 1JTPA 3FQXB 5E5MB 5DRZB 4LNRB 1QQDA 2EKSB 2V5SA 1T5XB 1YY8B 5E00B 1VACA 5B39A 5D1QB 3O6LH 1F5WA 4M6OL 1ZVYA 1MFCH 3MRJA 3CC5A 2QV2A 2RQ8A 3B3IB 4JN1H 3MRIA 1FIGL 1AXSA 3ARGC 4WO4A 1DVFA 3K8LA 2X2YA 4XPBL 5IVXF 4G6FD 5F1NA 4ORGA 1F02I 4UAOC 2HKHH 4R3SA 3GJEA 4OJFH 1UZ6F 4HFUL 3V6FB 4UTBH 2EDNA 2H1PL 4JY6B 4OFKA 3DUSA 3P11H 4F7EA 3OXRA 5F1SA 3QFJE 3LKNB 3RNQB 1A6PA 1UM4H 3CZJA 5A2IH 1JF1A 2XRAH 3ULVL 1J9CT 4KJWD 1FAKT 2AABL 2ZUXA 2RFXA 3CFKB 4PLOB 3UAJD 1MJJB 4Z7NE 1XZ0A 3SE4C 3FO0H 1J0IA 4PJ5A 3P30H 5ILTH 4KQ4H 1DJSA 4ZD3H 4MS8D 4APQC 1YEHL 5EPMA 4AEIL 5DYOB 1MHCA 3H3BC 2QADC 4HGKC 4TPRH 3EOYG 2CKBB 2FEEI 3BWAB 3HG1A 4ACPA 5L9DL 2BK8A 1F97A 1Y18B 4YFDB 4P5MA 5HHVH 5GSVA 5JZ7D 5EUOE 2R2HB 4JVUA 1ND0A 3CFDA 4MQTB 4FQJL 2BY0A 5TDPA 2LTQC 2B5IB 3NIGF 3IB4A 3UTTB 5DK2B 5HYEA 4HWZA 4JQIL 3IJYA 1YYLH 4LPCA 2F54D 4XNQA 3QCVH 2CKBL 1UB5B 5IMOA 3C87A 4GBXB 3FRUA 2Y25A 1M71A 2R0LL 4EN3C 1JHTB 2EO9A 3AMKA 4U49A 4FQ1H 1EK3A 1ADQA 3BE1L 2BSRA 2ERJC 4HHAB 1WTGT 4UU9B 2BP3A 2NY6C 1I8LA 2J6EL 4NT6B 3TBWA 4M4PA 3DVNB 1YZZA 1FO0B 2GIYA 1A64A 3VD9A 4PG9B 5D2LE 1A7OL 2O93L 4JG0L 4PJCA 5EBMB 2PR4H 3IFOA 4Q6IB 4P9HC 3X11A 2R69L 2Z93A 3F6IA 3BP6B 1L7IH 2RJMA 3DV4A 4G6AC 4UV7H 3ECBA 5I9QB 5EZLB 4NYLB 2YPKA 3FO2B 3RZCD 2PUQT 1I3RB 4IMKA 5EC1B 1KN4L 1RZJC 2AW2A 2B1HH 3QUZB 2X7LA 3KPQA 1PQZB 4DAGL 2BSED 1TCRA 2DM3A 3QDMA 2KBGA 1BF2A 1CK0H 4ZO7A 4HS8L 1MAJA 5DUPH 4H26B 4NOFA 4ZXBB 4PJGA 1U58B 4RWYH 1T22B 3UTQB 5DJAB 4TRPH 2LABA 1YEEL 4Z7OF 1XF3A 4OZFH 2YKLH 3VI3E 3CDGB 3MMEA 3O6LL 4MA7L 3DV6B 4X98B 1UEYA 4RGOH 3MV7D 1MFCL 3Q6GH 3P73B 4JN1L 1PKQE 1D6VH 4XCCL 4RAVA 4ELKA 1DBJH 1T2QL 3LV3A 4OLZL 3ZMRA 3WIHA 3MRPA 4N8VB 5E9DD 5EA0L 1NEZG 4ZUSB 3U9PH 3P9WB 4QRTB 1I1AC 4I48A 1KYOJ 1Q72H 3S36X 1OAUH 3VRJB 1F6AA 4Q9BA 3P11L 2GTZB 2VLKB 1I8MB 2EXYC 2BNQE 2XRAL 3CH1A 3O0RH 2HMID 3HI1B 2EYRB 1CR9H 3RVXD 2EDLA 4J1UA 4PG2A 3HI6H 4X6BB 5F9OH 4QTHB 1W8NA 4HKXB 4RGMC 3LKQB 3QPQC 4MD0A 1I9JH 1JNLL 1R24A 1MEXH 3VJ6B 4ZD3L 3HZYA 5TE7H 5FHBL 4MNQE 5FKAA 5I8KH 4NSKB 1WZ1H 2GSGA 4M61A 1UWEH 3OZ9H 1Q9WB 5FK9A 4XCEB 1F45A 2Y5TA 1MREH 3LHPL 1ZLUH 5L2KB 4KZDL 3LS4H 4P59L 5T5NF 5HHVL 3RHWK 2B2XH 3WHXB 3I6LD 2XN9E 1BZ7B 4D0BA 3NOIA 3AB0C 2FWOA 4OZGA 3QCVL 3RP1A 5JNYB 4TSAH 1P84J 5CKAA 2H2PD 4U6YA 4Y16B 5EIIA 3BN3B 3IU3A 4JO1H 4G8IA 4JCMA 1KT2B 4HWBH 4L4VA 2MCPL 4PLNC 4ZUUA 4CMHB 3IAPA 2OTWB 4U1GC 1R3LA 1S3KH 2NMSA 4HUUB 2V7NB 1WGOA 1EZVX 3SDDA 3QDJE 4PJDB 5EUKA 5F89A 3ZO0A 3REVB 3UC0H 5E4EB 4DN3H 2PR4L 5I8EA 3LDBB 3CH8A 1KJMA 1X5IA 1YJDH 4I1NB 1KEGH 1KYOK 4YHZH 4K23H 2Q76A 2ZUUA 5L88H 2Q87A 4HF5L 1DDHB 3RWIA 4ZPVA 4IOIA 1UQSA 3EJJX 4L8SB 1ES0B 4TULH 1ORSB 2B1HL 3QQ3B 3DX7A 4QXTB 4WU5B 3GSVB 4Y2DB 5E8EB 1AQKH 3DI3B 4JLRB 1MCPL 3O6KL 1V8HA 4YHPB 1DR9A 1K6QH 2Z31D 5AYUL 3F7PC 5DUPL 4RWYL 4POYA 5JXEC 1RJZA 2I07A 1CTNA 4LSDA 4I18A 4HGWA 1GVIA 2QQLH 3MV8A 4TRPL 5FYLL 4C57C 4EXKA 1CGSH 1OF2B 4G6KL 1JZ6A 3RL1B 1KIPA 5F7EH 4RGOL 1YNTB 3Q6GL 1I85C 4GKSA 4G9DB 4JFPB 3GRWA 3VFVB 4Z7UB 1TZGH 4I77H 5SWQB 3D69A 3P0VH 4GLRH 4WW2F 1P84K 3O8XB 3X3FL 5KSBB 3KS0J 1HSBB 1CF8L 3E6HA 1DBML 1IT9L 3KPMB 5E9DA 3EIFA 3U0WH 1G0YR 2HLFD 3GBMH 1MIEH 3SBWA 3WFDH 4QXUL 5KSUA 2QEJA 1IL1B 3OX8B 1Q0YL 4X4ME 5BV7H 1KBGL 3T2OA 1CR9L 5L8KB 2AV1B 2UUDH 4JB9L 4EI5C 2BY1A 3HI6L 5F9OL 1KG0B 3B43A 3G6AB 2NY3D 4N0FA 3V5DA 1JWUA 4L8BB 5EZJA 2VSDA 2FL5B 1OGAA 4HBQA 4X9IA 5GGRA 3T2NH 3HE7D 3KYNA 4C56B 2A1WL 3NFPB 1I9JL 1Y6KR 2XKSA 3CFEB 1MEXL 4WHTA 5E2UH 2YPLE 5I8KL 2JIXD 2ATPB 3OZ9L 4H20H 2X1WL 4WFGE 1NBYB 4LF3B 1DCLA 5D5MB 4PGDB 1YUHB 1MREL 4XGZB 5KANG 3T09A 1OD9A 2EZ0D 2C3GA 3LKPB 5CZXD 4MD4A 5JW4N 4LLWB 1FZMB 1YQ2A 2NCMA 2W65A 4LSUL 2KPNA 4ZO9A 3TNNB 5GS1A 4MXWL 2EDOA 5H2BA 3MA7A 2RCSL 4P57A 3D5OF 1T21A 5EC2A 3JWOH 2DQUL 2EIDA 4QGTA 2C3WA 3S8WA 3FB8A 5HPMB 5INCB 2KQNA 4YBLC 5IFJA 1TDQA 1N6UA 5DDHB 1GGIH 1NUNB 1EVTC 4Y4FD 4HV8A 5C0NC 3LIZL 4DN3L 4OGAD 4LGRB 5HYQB 4YHZL 3V7MA 4K23L 2APXA 3IJHB 1NCAL 3MRGA 4POUB 2CK0L 5L88L 1IC4H 3BPCB 5F8RC 5HY9B 2AK1L 4TULL 1OAKH 3AREC 1A6WL 1T1XA 3VFWB 3V6OE 5JHDB 1AQKL 1P2CA 1AR1D 1V3KA 5E2VH 3DARA 4OKDA 2A38A 2Z31A 1SQ2N 2V9QA 3S3JA 4R0LA 1S7UB 4YNYA 1N8ZA 2JK5A 5CJXC 5C3TA 3KYAA 8FABA 4O4YL 4Y5XC 3DSFL 4LLAA 5AG9A 4OZIB 4U1JA 3KHOA 4GMSL 4M03A 4MJ6B 5IB5A 3PWLB 4XP1L 1SM3H 5TQ2H 3T08A 3TWCH 3TN0D 4HZLA 3QIUC 5HD8C 4PRNA 5KN5B 3T2PA 5KJRL 3ZZ1A 4EJ1C 1TZGL 1OHQA 1I7UB 1P9MC 3EO1B 3P0VL 1RHFA 3TESA 1ZTXH 1G7IB 5C0CD 4HK0A 4NPYB 2F8XC 5IIEB 1KIQA 1MJ7H 4KY1L 4J3VA 2JF1A 1ZLVK 1T0MA 4HIXH 2GKIA 4Y4KD 1MH5A 2CRMA 1MIEL 5D8JL 5KG9A 2F19H 3QJHB 4EUPG 5EOCL 5MHSD 2ZSWA 3W82A 3D3VE 4HWEH 3T2NL 1A6UH 1G9NC 2W9LA 3HE6C 3GDBA 1QA9A 2CMRH 2F5AH 3FQNA 1FG2B 1LWRA 4H1LG 4PY7A 2DTMH 1IAOA 2JIXA 3E0GA 1J8HE 3JXAA 1Y6NR 4H20L 3ARRA 5C0DA 5C92A 3V5KA 1AGFB 2XWBB 3MLWH 4WHCA 3NIFE 4QY8B 2VO5A 3QP3A 1HHHA 4KK5D 1V3LA 4KV5E 2P42B 5ICXB 2DI7A 2PXYC 4PGJA 3VA2C 2KZWA 2WMPA 5GS0D 5TQ0L 2X4TB 1EO8H 4JQXC 3NN8B 4YDIH 4FG6D 2B4CH 2WUCL 5B39G 5ANMB 1MVUB 2FECI 4XHQA 3TIEB 4Z0XB 4DCQB 4KKLC 4RA3A 1D9KC 4P3WA 4D9QD 4PLJC 3ZKSD 4Y4FA 3KHQA 3JWDC 4JZOB 2V17H 2GT9A 3KLAA 3QI9A 4MJIB 4D0CA 5D9SA 4NJ9L 1ZSDA 1PZUB 1YDPB 4AMKL 4HBCH 1H5BA 5JW4M 4ELMF 4CVXB 5F9WC 1JF6A 2GFBB 1G9EA 1QSEB 4XBPB 4HS3B 4E41B 3D39D 3ZLQC 5IWLA 3MACH 4LQ1A 4LGSB 2E7HA 4GKOA 1BOGB 1IZJA 3S4SB 1CFBA 4G8EB 1DTUA 5E1AA 4RGNE 3ISWA 3MA9L 4NP4H 4QOKD 2HN7B 4LVOC 4JN2B 1YYMH 2HG5A 3QDGD 3QJFA 5DUBB 4ZUTA 3U7AA 4F33B 4KRPD 1OTSD 2DBJA 3LZFH 1KEMH 2A74B 3HG1E 1EHAA 1G7LA 4LLQB 4EIZC 43C9B 3VFPA 2APWA 3O3AA 3ZL4L 3C5JA 5TQ2L 3TN0A 2IAMC 2HWZH 3FONB 4U1HA 3QEUB 5FA3A 3O9WB 2NY4C 4X6CF 2Z9TA 3S34L 5C0CA 1WZMA 4LHUA 1A2YB 3ZYZA 1RUML 1MJ7L 1R5VA 4DKFH 2AXJA 3UBXA 2F74A 2HFFA 4HIXL 4Y4KA 4A2MA 5LQBH 4G8GD 1INEH 2ZOKB 2Q3AA 1UJ3B 4NO5B 2VB5A 2JTDA 1ZA3B 3SDCA 4K07A 4JFOB 4LLDB 1JMZA 4QXWA 2ADIB 1RUKL 2K9UA 3BW9A 1H3VA 5MEPB 3GK8H 5J57B 2WINA 1ZHBB 5JW4R 3DPBA 4H0IA 2AP2A 1FFQA 1P1ZB 5B8CB 3NCBB 1XIWD 4JFDE 2GEEA 4PS4H 3LEXA 2CJUH 4M9OA 4QRUB 2R2BA 1T2XA 4JR9H 1SMAA 3QDME 1HKLH 3I50H 4WY7L 2ZWLT 5HVWA 4PJGE 2DDQH 4J23A 4YC2B 2GJ6B 3MLWL 3ALWA 4JFHE 4UT9H 4HJJH 1AD9B 5GGTL 5D96C 2NZ9C 2R1WB 5FF6B 4ODHH 5D2NA 1N64H 2B4CL 4LLVB 2GTWA 5HYJA 4RFOH 3HNVL 2BHZA 4H25A 2EKJA 2ESVB 5EN2B 4S1DC 1B0RA 1NFDF 3RWEB 5CP3H 2CLVB 3V5HA 1MF2L 1MCBA 4UDTB 4JY4A 2VXVH 2V17L 2QR0A 4HUKB 3HMWH 4M48H 3VXMB 1OQOA 1MRDH 2VUYA 1VADB 2MPAL 3QUMA 3NCYS 5LGKA 2YZ1A 3RGVB 5BVJA 3DBXA 3OHXA 1L9NA 1T3FB 2DIAA 3V52L 5IHUH 5C0JB 5DMKB 4NWTH 4PJ9B 3QQ9C 4XVTL 5J1SC 1OAYH 3NCCB 5I2IA 3MBEB 5C0AA 1G9MH 3D39A 5KVDL 3PL6D 5JPNA 2IBZY 2BSTA 3MACL 5I6XC 5F6HI 3U83A 1GZQA 3O4LD 5KS9B 5GPRA 3ARBD 4ZYKB 4NP4L 3LQZA 2BMKB 3M17B 5D7IA 4GAGH 5F3HA 3PQYD 1GJIA 5ESQB 1FH5L 4CDHA 3I02B 2CR3A 3RL2A 3G5ZA 2BNRE 3WJJA 4JFQB 1N0LA 4MVBC 2G2RB 2XNAB 4LK4A 4LCYB 3KPOA 1G7MB 4HGMA 3VGHA 1NDGB 2Y23A 4IRSA 4MWFB 1SYVA 3EBAA 2L7UA 4PV8B 2YPVL 3WIIH 3PHOB 3VG0H 4L4VE 2XYCA 1RMFH 5EU3B 3S88L 4KI5E 4MSWA 3RI5K 2NY2B 5DURD 2Y36L 5AYQA 4WW2A 3GHBL 3H9HA 5L6YH 1UXSB 4ZTOL 4XBGB 5SWSA 3J7HA 1Q9KA 3GK8L 4P2RD 1FLTX 2C1OA 4PIRF 2QHLA 5E6YA 1C8PA 5HGBA 3MX0A 1I3GH 3BEVB 4FFZH 5FKPA 4JFYB 1XIWA 1FGVL 1GL4B 2CGRL 4PS4L 3HS0B 3TO4A 5E6IC 5F6IB 1U3YA 5FYJU 4PJHB 3BDYH 3T65A 3I50L 4GUPA 5HI5D 2BOBA 2J8UE 3G6JE 3CAFA 2DDQL 3RTQC 3EFDH 3GB7B 4IRJD 2OK0H 1CXFA 4P46D 4NNYB 1ZWIA 3MV8E 4Y5VA 4UT9L 1DLHA 3OGCB 4L9LB 5D1XC 1AY1H 2VLJE 4LLUA 4Y2OA 3V0VB 5GGVH 3WIFB 3MCLH 5CMAB 4ODHL 2D0FA 2WQ8A 1FHGA 1N64L 3RUGE 3EHBC 1WWWX 1KJVB 3IDGA 1GOHA 4G7YH 3NPZB 1A14H 3AU1A 4P23B 1GZPA 4BZ1H 1EXUA 5M94B 2B0SH 2NXZD 4YK4B 1AIFB 2W9DL 4ZUVA 3THMH 3PG2A 4WUKH 1MRDL 3OKKB 1JRHL 4TSBH 2JCCB 2UWEB 3K4DA 2FX7L 1B0GA 4MNGA 5DD6B 4HUVA 3LEVH 2FEDD 4NWTL 2AJUH 1HH6B 1JIBA 1X5LA 3SE9H 4JRXB 1OGAE 5T3ZD 3B9KA 1QKZH 4XXCA 5IVOA 1T5WA 4U6HA 1NCDL 1YECH 2DAVA 2JELL 5HHMD 3EYOB 1D5IH 3VH8G 4M6AA 1CFQA 4GAGL 5LG1A 1NBZA 3WL9A 1QTYT 4BSVB 1CFTA 5C09B 1KTLB 4RAUB 3O4OC 5FA4B 4K71B 3ZE2F 2LU4A 1FVDB 4S11A 1ZGLB 2EIZA 1NL0L 3JTSA 3PF2A 3ESUF 2ZNWA 5L0QC 3BVNB 3RWJB 5C0GA 3BXNA 4E5XB 5CIPA 1F11B 4ZO6A 4OZ4A 2N56A 3VFNA 3WIIL 1FL3A 3BUYB 4I2XA 4JM2C 5TDNB 4PJAF 5CLWA 3K7UA 4S1QL 2CDFA 2WBJC 2EXWD 4P5TC 4Z95L 3PWNB 1Z9MA 1BIIA 1OP5K 4EQ2A 4KDTC 4N5UA 4W6XB 1MCWW 2PO6B 5L6YL 3STZB 1HILB 4WDIB 5GGUB 5EO9A 4UQ2B 3PWJA 3JV6A 5IG7A 4HUWA 4M8QA 3UX9B 4UOW0 4P2RA 4LOUD 2MKLC 5C2BH 1IGCH 5GZOD 1H3PL 4FFZL 4OCNC 3SJVD 3T0EC 3GMPA 3OG6B 3ZDYF 1R3IH 4XP6H 1OPGL 1T83C 4TVPL 3UJIH 3D3VD 3WLWD 1ULVA 2GK0B 3FB5A 2CLZB 5GGQH 3B9DA 4WEUD 4X5WA 3WFEH 4ODUB 2IQ9H 3BDYL 2QADD 5F9JB 4LHQB 4O2CB 4PP2B 3MZTA 2VWEE 5KSAA 3EFDL 1U3HB 3WFBH 5F88B 5CAYB 4JREB 4OCXH 3TYGH 4P46A 2HT2D 1NMAL 3TT3H 1AY1L 3H2WA 3PNWB 2HVKB 3I85A 1L6XA 5KBNC 1U8LA 5GGVL 1TVDA 4FQQB 5DC4B 2UZIL 2XQYK 5DVLA 4GLRI 4QRRB 1NLBH 4KJPD 5HYFA 5HVFB 4CU8A 3DRTA 1J86A 3S35X 2V2TA 2D7TH 1CL7L 1W2KT 3H9SB 1Q8MA 2V7HB 5C07D 4Q97A 4XPHH 1CWVA 4O2EA 3RPIB 2P8LA 5LWYH 4OGXH 35C8H 4WUKL 3THML 3GSNA 3D0LA 5KZCB 1RZFL 4FQLH 4UT6H 5DGRA 1LDPH 1T1WB 5IVXE 4G6AD 4X99A 3QIWA 1UACL 3LEVL 4YXLL 4NCC1 4D0DB 1TZHB 5EIQA 1ZANL 2NY0B 1IEHA 1CFNB 1UZ6E 3MV9B 3CU1A 4IMLA 1SY6A 1YN6A 1I7ZB 1T66C 1QKZL 1IKNC 3ZT7A 2I27N 3I6GA 4ELMA 4DEPC 1VFUA 4GAYA 1P4LB 4WWKA 4XZUB 2WWMC 2XA8L 1D5IL 3BGMA 1MFAH 4HEME 1K8DA 4K9EH 4PR5A 3SDXF 3UJTH 3FRPG 4X9FA 4NBZB 4K94H 1E28A 1QFHA 3LD8C 1OLLA 2BVTA 1M4KA 5IR1B 4MA1B 2GCYB 1A5FH 1ORQA 2MTPA 2E7CA 2I26N 4N0UB 4L4TD 5HVHC 1DN0A 3LB6C 1E6OL 1P7QD 5CBEA 4B50A 2VITA 4X8JB 1F4XH 1Y6MR 4G42B 2CR6A 4R4BA 1V3MA 3KYMB 3QSKB 5CKGA 4J3WA 2ICWJ 5CJOL 2WIMA 3ARDB 3MLXL 4OCWH 1FDLL 4KMLB 3PHQB 4YXKL 3PWUB 1MLCA 4PJ7B 3AS3A 2D7QA 1A4JA 1KENL 3FTGB 4XWOC 4JY5H 3NIGE 1NC2D 3B9EA 3QUYB 3UTPE 4URTB 4X7DC 5JDSB 5C0BD 3DXAD 5ID0A 5CSBA 4NBYB 4XCNA 3CUPA 3KPRB 3Q5OA 1XAUA 5ENWB 4Y5YB 5K9QI 2X4NA 3P4MA 1ZV5A 4U1MB 3SE4A 2HKFH 5GGSB 1AC6A 1HWHB 4V1DE 3WXWL 5JO5B 4KDWA 5SWZB 3GIVB 4D9LH 2I9LA 3UJIL 4M43L 2Y6SC 4APQA 2QKIB 3TNMA 3WLBB 2ZSVA 3PWPB 1HOCB 2P1YA 4P2QA 1G1YA 2OSLA 3WFBL 2D03L 5KANI 1DLFH 1BFVH 4OCXL 1DUYB 4L3ED 4R7DA 3TT3L 3KPSA 2P5EB 2YA2A 1JTTA 1P4IL 2ZUQB 4M5ZH 4J12A 4QCIA 4MNHB 3UTZA 2L0DA 2J8HA 3TBTB 3L1OH 2YXMA 3QXDA 4HT1L 5IB4A 4AYFA 1D5BB 1MAMH 4Z0BL 2D7TL 1FNEB 4F7CA 4LL9A 1EO7A 3VI4F 3C8HA 2X10A 2ZKHL 4R97C 4Z7OE 5C07A 3LN5B 3P9MB 4KKAC 3LVEA 5E2JA 1LE5B 2PCPA 4AENB 2VH5L 4XPHL 3CX2A 3DX6A 3NIDF 3SHSA 4OGXL 35C8L 1FV1A 2EDRA 3MGOA 4GW4B 5IHZA 3MLPA 4FQLL 5IB2A 1AJ7H 1LP9B 2IALA 3N06B 4RRPA 5MEND 3UBXG 2FYYA 3TC9A 3QZWB 3FN0H 1NFDA 3FFCA 3HC0B 3VXOA 5GSRB 3VXNA 1S9VA 3OJVC 2Q7YA 3EO0B 4OQTA 3UMTA 1KB5B 4TTDC 1L7TH 3QUKA 2VXSH 3ROLB 5IJVB 3ZSSA 3QIBB 4XBEL 1CIDA 4C4KO 1U3ZA 3JV0A 5SX5H 4FP8H 5FYKD 1AE6H 3BZFA 1MFAL 3ME0A 1OSZB 2ZNXA 4Z7VA 1KB5L 5E7BA 3UJTL 4AEHH 1K4DA 1YMMD 4F37K 1A1OB 1MCDA 1OCWL 1G7JA 3CFJB 4K94L 3DX9B 1MJUH 1XFPA 4ZG1A 5L7XH 1JNNL 2AEQH 1A6ZB 1QRNB 2C26A 1GPOH 4JKPH 4YBQD 3S35L 5I17A 1MWAA 1QLFB 4IRZH 4P5KB 4UILH 1F4XL 4QF1B 5BS0A 1A7PH 4GG8B 5SX4H 3AVEA 5D2NE 3D18B 2CDEB 1I8IB 3P4LA 3UPCA 4OCWL 4RMUA 2VDRH 5IK3A 1HDMB 4P4KB 5HYJE 3IGAB 5E2TH 4EZMA 5EZOH 1EGJA 4JY5L 1NC2A 1I1AA 4XNMB 1FFPB 3QRFM 3SCMC 2AGJL 3CGTA 5MI0B 1UGNA 3DXAA 3O6FD 3FHQA 4CDGC 4L5FH 2UV3A 4FTVB 4HKZA 4RMWA 2HKFL 4ZFGH 3WN5C 4Y7MA 3MV01 1PBYA 3W2DH 2YN3A 2NYYC 3N85L 2F53A 4PJXF 4D9LL 5C0AE 4JO3H 1GHFL 2NTSP 4EDXA 1XGQA 1S7SA 4WTZA 5FEBA 4AZ8A 5C0EA 1RZIB 3MJ9H 2E3VA 1YY9C 5EIVA 1ZKAA 5JQ6H 1WWCA 3F8UB 3QPXH 3VXRE 3WHE1 4Q9QH 4HLZH 1TPXC 4AT6B 2BVQB 1MCQA 1HQ4B 3GIZH 3L1OL 1LO5B 1O7SA 3MZGB 3DX8B 3OKOB 4LSRL 4N1EA 1MAML 3VE0A 3K80A 2E8ZA 2C3HA 2VISB 5CSGA 2DQTL 1II4E 3MOAH 4FHBD 4TUJA 3L3HB 3FB6A 5DVMA 5C08B 5IM7B 3MRHA 3C09B 3TFKC 4OUOA 2J3SA 4JO2L 3QO0B 4JFXA 4OZHF 5IW1A 1JGUL 5E94B 4PRHD 5MENA 2FO4B 3HAEA 2EDTA 5CZVH 1QBLL 2FB4H 1JPSL 2BC4B 3MLRH 4UV4L 1WT5A 5SWSE 2EYTA 2OL3H 3OGOE 3MRMA 2CIIA 3V2AR 2DJ4A 1MY5A 3ARED 2VXSL 3FCTB 4HS6A 5ISZD 5C0IA 2R0ZL 1AO7A 3M1BA 1AE6L 5JXEA 3BO8B 4NKOA 2CXGA 5H37H 4AEHL 4DK3A 5JW5A 1YMMA 2X4OB 4C58B 1L9MA 3MREA 3HPLA 4W81A 5DI8B 5T33L 1MJUL 3DUUA 3T0WA 5L7XL 1EPFA 1F4WL 1LMKA 1RZKC 3UYOD 1GPOL 4JKPL 1TJGH 3FO9B 5F7DA 5KVGL 2FR4A 2IG2L 1FRGL 1I85A 5AUMB 4FOMA 3QDAA 5CEXA 4FXGA 4PJ8B 4XI5D 43CAB 2HJFB 4MQSB 1M1SA 3D85B 4Z77A 1Q94A 1BVZA 2EDHA 5E2TL 2GAZB 1IGJB 4MLIA 5ACZB 2GI7A 3HMXH 4JFZL 1KIUA 3ALPA 1X5AA 5FCSH 2ATKB 3DO3A 4PJAA 2DYPD 2I5YH 1VA9A 2ITCA 3GKWL 3QAZC 3QXWA 4L5FL 4JFEE 3DRQB 3NA9H 1DQDH 5EFIA 2VDNH 5FV1L 3PJSA 4JQVC 3WFCL 4F15B 2YHGA 3RVVC 5DWUL 1ZT1A 2BCKB 4Z7WF 4JO3L 1UB6B 1RZKL 4S0SD 5INDB 5IB1B 2C3VB 2I9TB 4WU7B 1HCVA 5GIRA 3WD5H 4P2CG 3EDKA 1CYGA 4RFEA 1L0YA 1DUZA 1QEWB 5IQ9A 4QTIH 1JFQH 4QT5A 3MQIA 1P53A 3VGAC 5TPWH 1C08B 3BGAA 4PRAB 3BDBA 3CCHB 4CBPA 1NC4A 2HT4C 1ZS8B 2PKDA 1H3GA 4XPFH 3EJZC 5EUOB 5T1LA 1GC1H 2ED8A 3FQTB 3C60C 3U9UB 5FGRA 2EDEA 3BSZH 1LD9A 3MOAL 4LCWA 2OJEB 2MQCA 4JPKH 3MODH 3OBAA 2GITB 3IFPB 2EIBA 2OL3B 4G80B 3PV6A 2FLRT 1S7TA 3WE6A 3IJSA 5T1KA 4PRHA 5IHBA 1G6RL 4MGXA 4DK6A 5CZVL 4CVWA 2FB4L 5HHPB 1EVUA 3C6SA 3QCTL 3STLB 1TVBA 5CEYB 2OL3L 4Z8FL 5D2LB 2O61A 4OB5H 3AREA 3DI2B 4X5LA 1KCSL 3NCFB 2XZCL 3F5WB 3ARVA 4FXKA 4R2GD 5ISZA 1UCTA 1JWSA 3ZSTA 5HGHB 4W4OC 5IEKA 1QFUL 1XR8A 3KXFD 1OWRM 2LQRA 4LU5L 2G5BB 3SPVB 3KPPB 5DRXB 4I0PD 2DQGH 2Q6WB 2FD6H 4PB0H 1RY7B 4MB5A 3SE3A 2ZJSH 4Y5XA 5J13B 3MR9B 4KUCD 3MGTB 1CXEA 4L29B 1MIMH 2WP3O 5IGXH 2OTUA 4NN6B 2H3NB 2P44B 2SEBA 2OP4L 3DLQR 4KH2A 2HP4A 1J0YA 5LAXB 1QR1B 2FIRT 3QIUA 4QHKJ 3C5SB 3MUZ1 4YHNB 3P9LB 1OTUC 3BGFB 4LBEB 1P9MA 1OP3K 4YWGH 5IKCB 2WWKO 3AAZA 3HRZB 2UYLA 4LPVA 3UJJH 3HR5B 2OZ4L 1PKQB 3LPWA 5KVEL 4QRPD 4I3SL 2XTJD 4C4KT 1N5YH 4NM8L 2X9YA 4ZSOA 1JNHA 1OARH 5DTFB 1NEZB 1YC8A 3T2QA 5MP6L 2DYPA 4HIIA 2I5YL 4S10A 1A4KB 1UJTA 3B8YA 1E4XL 3RIFK 1H9VA 2VDNL 3CSYB 3HE6A 1BZ9B 5DEFA 3CMGA 5CBAA 1LHZA 4N0YH 5J06A 4I4WB 2RAMA 3O6MH 4ELME 1NGQH 2PYFB 2IPKB 4RAHA 5DFWH 1ZHKA 4U7SA 1VEPA 1QHOA 1JFQL 4MNQB 4NO2B 5BV7C 5D1ZC 5F1IB 3BYYA 5TPWL 1SVZA 1RK0A 1YEFH 2NR6D 5CWSB 2X9XA 2PXYA 4FMFA 1NCTA 3G5XB 2WLZA 4NRYA 4WCYH 5DR5H 4RBPK 4JQXA 3BUTA 4JHWH 3O3DA 4XPFL 2W0LA 2VQUA 5ERWA 1HWGB 1S9YA 2YC1B 4X0KB 2XN9B 5LXGH 2VDKL 4XNZB 1D9KA 5JOEA 1T03L 4JPKL 3OPZH 3SN6N 2E5EA 2AJZA 3GBLA 1IEAA 4Y4HD 5HSFA 3PGCA 4TUOA 5DJ8A 2QBWA 1BOYA 3A67H 4K3JL 5GXBB 3ULUC 3ZTJH 1FGNL 5J89A 4JZNA 1KPRB 3AC0A 3QG7H 3O11B 4X6CE 1RJYB 3V6ZB 3S37H 5IB3B 3QDJB 5ALBH 3NBNA 2R1XB 2RBLA 4D8PA 2OLDA 3O2VL 1RV6X 3JWOC 1JN6A 2YR3A 4I3GA 4FFYL 4KI1A 3SGKC 1ZLVH 4MX7B 4FQXC 3KXFA 2IFFL 4I8DA 5EWIL 1E6JL 3MRLB 1FN4B 4I5BA 1PSKH 3VFUA 2A77L 2FD6L 4PB0L 5HXMA 3QQNA 3NABH 2CD0A 1MCSA 5IW6A 4P2QE 5CHNA 2ARWA 4HH9A 1KTDA 4NO0B 3VGEA 2JJSA 4ZAKB 3QUXD 1LE9B 2X05A 2R15A 5F70A 1YPZF 5JORB 4WVRA 2IAMA 1BQUA 3KPSE 4HJGB 3VFMB 4X7FC 3VMOA 3KJ6H 4XPGL 3N1PC 1RUAH 2J2ZA 1U8KA 4L1DA 4ZFOB 1TTFA 4B5EA 3U1SL 1WF5A 2WANA 3VXPA 3IVKB 3UJJL 2XI9A 5I75C 3C5ZB 3KPNA 4QRPA 3QCUH 2VKXA 3MSPA 4ZFOL 5I1HL 1A8JH 3IDJB 3BP4A 5D6CB 4MDIB 4OLYL 1A7BA 4P48A 2EH7H 3TVMD 5A2FA 1WITA 2BVOA 3UYRH 1AKJB 3FFCE 4RRPG 4N0YL 7CGTA 1XCTA 5HHQA 5I71C 1KJ3H 2FGZA 1KLUA 1R5IA 3VXUB 4LSVH 4K8RH 2BOCB 1BBJA 2IH1B 2V9TA 3TH2T 4EUPH 1ZT7A 4X7SH 2FHBA 1VB9A 1J05B 4MMZC 3MRBA 4AH2A 4PJXA 3DIFB 2YPLB 3BAEH 4YPJA 5K9JH 5F6HJ 2VLKE 1YEDA 1YEFL 5B3NA 1QSFD 1RIUH 3JV5A 1EAJA 2QQNH 1BMGA 1CICC 4H1LH 4KTDH 5AZ2H 4KXZI 1U95B 3KWWB 1PEWA 3PWVB 4CL7A 2VRAA 5LXGL 4PV9A 4LAQL 5BS0E 3IFNH 4MB4A 1J1OL 1UM6L 1L6ZA 4JDTH 4P2OD 4TVSa 1NKRA 4Y19A 4JRYE 1RK1B 1XGYH 4IDLA 2OXGA 4FNLL 4G8FB 3ZE1E 4P49A 3EYFB 5E24E 3HB3C 4G9FD 1MCEA 3OKNA 3A67L 1KTKE 3RWFB 5GRVL 4EI6B 3SGJC 1NANH 1AXTH 3QG7L 1H3TA 4YDVB 4QXGH 5C9JB 4X4YA 3GO1H 2FLBT 3S37L 5ALBL 4MAYB 5EU5B 3GSUA 3GMRA 1MCCA 3ARFC 1X5KA 4OZHA 3C6LD 4WV1B 3QEQD 4DVRL 3DYPA 3BZ4A 2PTVA 3Q6FB 4J3OC 3IDNA 5BCAA 2VC2L 3P77B 4JHAL 2F53E 3GSOA 3VGBA 1AHWC 4FZEL 3AXLB 4ZS7H 3GMQB 4HDIB 1HXMB 1EJ6A 2H45A 4IEFB 1DQJB 5DLMH 1DBAL 3TZVB 5F7MC 5J7CC 1JPGA 1ROWA 4PTUB 1KLGA 3NZ8B 4NQSB 2X1PA 4U1SA 2WAHA 4MZ3A 1JP5A 4WTZG 4UQ3A 3L3GA 4XRCA 5AZEH 3KYOA 4M6NH 2JJVA 1Q0XH 1I1YA 4MXVE 4G6JH 1UYWL 5FUZL 1OSPH 4U3CA 2JJWA 5E1HB 2C1PB 4O02H 5FYLE 1UM5H 4O2FA 1T1ZB 1AGBB 4XCYB 5T3XD 3W9EA 2VXUH 4W70A 4JZJC 4XAKE 2V5YA 1D6EB 4MQ7A 4UBDC 3KJ4C 4ERSH 3ZKMC 3BRGC 1LK2B 3V4UL 1HEZA 3DGGA 1C5DA 4IIQC 4RFNC 1ETZA 1KNOB 3PDOB 3RNKB 2DMBA 2W1NA 3TVMA 1HINH 1IFHH 1HZHL 5BO1H 2R23A 1E4WL 1BD2B 1GAFH 1INQA 5DD5H 4EUPB 2CIKB 2WV3A 5HGDA 3RDTB 2FSEA 3O3BA 2VDML 1I1RA 3HNSH 3KG5A 4NN5C 5DQJA 5FO8A 4Z7UE 4Q6YA 1HQRA 3WNMA 3OAYH 3BKCH 5KSVB 1ADQH 5E6IA 3F7VB 4DZ8B 3BOVA 4LSVL 3K81A 4PBVC 1CVRA 1WC7A 2NW3A 5EU6A 1AO7E 5IFHH 4H1LB 1EFXB 2NQCA 3RTQA 2WWKT 1QFWM 4U7MA 2I24N 4WO4C 3BAEL 4HFWA 1T6VN 1P4BL 4U6XA 4Z7WA 1J8HB 5HYIA 1FL6A 2DQHH 2EECA 4XH2B 5AD0A 3KGRA 2O5YH 3I75B 4OIIH 5SX4I 1CZ8H 1R3JB 1BVKB 4KTDL 5FO7A 5DQ9A 3BIAX 1S7RA 2XWJB 4FMKA 1CCZA 1RD6A 2VE6A 4OKVA 4X7TA 4W4NA 5FYJE 3UYPA 3QA3A 3IFNL 1F4AA 1QQDB 4JJ5A 4P2OA 2NZIA 1XGYL 2MHAA 4MCZA 1VACB 2ZUTA 4LCCC 5D7KE 3ZE2E 1QBAA 1WAAF 4HULB 4G9FA 1H3UA 3MRJB 2EDWA 1RJLA 4M7LT 4OFYA 3MRIB 3HCVA 1AXSB 4DTGH 4DGVH 1TQBC 1AXTL 1DVFB 4ORGB 1KULA 1MHPL 4NQDA 4GRWB 4OF7A 3UZVB 3VWKC 4PJAE 1KB9J 3GJEB 2DL9A 3VWJC 1BJ8A 4QWWD 2X40A 3WO3B 2Z0BA 1N7ML 2DM4A 3C6LA 3QEQA 2YD1A 1A7QH 4YHMH 1CU4H 1MRCH 1T66D 4F7EB 3LMJH 5D7JC 3MFFB 1FE8H 4PPTA 1AH1A 2PYED 4YHIA 2RFXB 2IMMA 4G7VH 1B2WH 5DLML 1XZ0B 5TE4L 1R3KA 3SQOH 2ZG2A 2R9HC 3ZDYE 2EDXA 2AK4D 4RGNB 2X4RB 4UIKL 3EFFA 4KTEH 4NC1C 5EPMB 4NQED 1RI8A 1MHCB 3F62A 3LOWA 3WFZA 4YPGA 1J18A 4G6JL 1G9MC 3HG1B 1OSPL 3CMOH 4YQXH 4P5MB 1ZLUK 4O02L 3CSGA 1H0DA 4TNVK 4QRSA 1IGMH 5GSVB 1ND0B 3CFDB 3QXAA 5JHDE 3TV3L 5TDPB 4ZTPH 4U6TA 2X4QB 2EE3A 5DJ6A 3A6CL 1XMWA 2WBJA 4HWZB 4LCWE 3IJYB 1JJUA 1LEGB 1OD7A 4XNQB 4QKXB 3KLHD 5GRWA 5K93A 5IMOB 3MLUL 2GQHA 1U91A 5I15L 2YBRA 2BRRL 4AL8H 1J5OH 1EHLH 4HXBH 1QFWH 2BSRB 1GIGH 4YH6A 5LJYH 3Q1SL 1GAFL 1NAKH 4DGYH 3TBWB 2VUOA 4LFHD 3T0EA 1M7IA 2AXGA 1AFVH 1KB9K 5EOCJ 3P0YH 1NMCC 3EDDA 3RRQA 1T83A 3IFOB 3BKCL 4POZD 1ADQL 2Z93B 4YR6A 5D1QD 3DV4B 4WHYH 3ECBB 1ZEAH 3U2SA 4YIQA 2QSVA 3H0TA 5JA8B 1FZKA 4JFDB 3IDMA 1FVEB 1MFNA 3V79C 1NGXA 3VFTA 3ULVD 3KPQB 2DQHL 1TCRB 3QDMB 1G1CA 2R4RL 1BP3B 1HSAA 4PGCA 3OAZH 4WJ5A 4PJGB 5CEZD 1KC5H 4N0CD 4L8CA 3CVIH 3SDXE 2VQ1A 2Z92A 4GKNA 1VSCA 5E99L 2XWTA 1RFDH 1XF3B 4KJWC 3MMEB 3UAJC 2OTPA 4NQVA 4NRZB 2XQYG 5DSCA 1EDQA 4RAVB 5DJXA 2WIIA 1TXKA 1MCIA 4UDUB 4ZSOE 4LVNB 4MS8C 1NAMA 1CD0A 2FX8H 3TT1H 3MRPB 4JRWA 2NTFA 2XXMB 5I8OL 1N3NA 2HRPL 1PD6A 1F6AB 1IAII 4YHML 1MRCL 1IKNA 4OCLC 5ITFA 1FE8L 1MFBL 1MHEA 1PY4A 4GG6F 4M8VA 4D9RD 3CH1B 4GXUM 1WEJH 2OI9B 3WIHL 4OT1L 3UTTD 3ARZA 1RHHB 3I84A 1UVQB 3QT2A 4J1UB 1NGWB 5CP7B 4MDJA 3BQUB 2W9EH 4GBXD 1P69B 5DMIH 3SQOL 4OD1L 2FBOJ 1M05A 5EU4A 3ARUA 3IXTA 1R24B 2ARJA 5EH1A 2E6QA 3HZYB 1FAIL 5FKAB 4JPVH 4Y88A 2GSGB 4M61B 1BQHA 1RU9H 1HI6B 5FK9B 5B38G 1MUJA 2I60H 4S1SH 3CMOL 1CLZH 5C0RL 4HMDA 4E42A 1YPZA 1U8OA 4D0BB 3OL2A 1KELH 1WBYA 5ESAA 3RZCC 4NN7B 2FWOB 4OZGB 2HFEA 4U6YB 5DEGA 3QUZD 5EIIB 4WI7A 3B4NA 4YHKL 1A7RL 1M6OA 2BJML 4G8IB 3RY4A 1XGUA 3LKSB 4L4VB 1W0WA 4ZUUB 4DFHA 4HXBL 1QFWL 1G0DA 1CTOA 1NAKL 5HHNA 4XP4L 2A9NH 1TMCB 3SDDB 5EUKB 2RIKA 5F89B 2Q86A 4M5YH 3QEHB 5E7FA 4LNRA 1XF4A 4LCUA 5I8EB 1KJMB 1IKFH 4QHMA 3H7LA 5E00A 5D1QA 2JB6A 1UC6A 2Q76B 1C5CH 3FHAA 1NGZB 3RWIB 1IBGL 4M4RA 2JLLA 4IOIB 4IS6A 3DX7B 4YX2L 4CJ0A 1KIRB 5JIKA 3U79A 5B4MD 5IF0A 1FZOA 4LKXA 2BVPA 1AGCA 4ODXA 4NOBA 3O2DA 2DLIA 2NNAA 3NFSH 4N0RA 4OI9A 4PRID 5HGAA 1FP5A 2I07B 4YGAB 3GNMH 1KC5L 4JY6A 4NQTA 4OCSH 4ALAH 1F6LL 4I18B 2W91A 4HGWB 3SBWC 3CVIL 3ULUF 3RNQA 3TBYA 3MV8B 1T0NA 5EDXA 4FZ8L 2HMIC 3ILPA 3RVXC 4PB9L 4OM1L 1KIPB 1OTTD 2D9CA 4HMCA 3RUGB 1MQKL 3DURB 4GKSB 1XF5A 1UA6H 2E9BA 1PG7X 5J1AA 3PHSA 1TQCC 3RVUD 3CLFH 4O5LH 3LY6A 1BGXH 5E9DB 3BKJL 1N6QH 3GRWL 2HJLA 1Y18A 2EYSA 5L2KD 2IBZX 2WQRA 3BPOB 1WEJL 4L8DA 4X7CC 2VDLL 1D5MB 5GS1C 1BFSA 1FVCA 1UB5A 2AJVL 4N0FB 3B83A 1JWUB 4GBXA 4Y16D 1OGAB 4OM0H 1T89C 5GGRB 1IAKB 4NWUH 1QRKA 3KYNB 5D71H 2PTUA 4GSDH 1CFVH 2DQDH 3EOBA 3X14A 4WHTB 4PJXE 4OBRA 1V7MH 2ZG1A 4ETYA 1MRFL 5HBBA 1UZ8A 5T5FL 1FO0A 1RU9L 5HTSA 3T3MF 4PG9A 3S6CA 1VGEH 4JG1H 2I60L 4NNPL 4Q0XL 4H0GA 1BBDH 3U46A 2AQ2A 1BQLH 4MD4B 3AROA 3DGCR 2W65B 4F7TA 4I0KA 4Y19E 5H2BB 1WIOA 1JYXA 4K9EC 4LIQL 3MA7B 3SCMA 1FLRH 4ZDHB 4P57B 2F5BH 5EC2B 1KCRL 2R56H 4LP4A 4Y2DD 3FB8B 3FQRB 3BISA 1Z0NA 5IFJB 5I18H 2OQJB 3VXQA 2BDNL 3WN5A 2VERN 3C9NA 1VEMA 4HAGA 3R4DA 1HE7A 2GY5A 3A0OA 4BA8A 3DV6A 3D2UD 3MRGB 1F4YL 1IEBA 2R8SH 1AI1H 1I9IH 1RZ8A 1S9XA 3ZDXF 3OKMA 3OB0H 3IF1A 2BXYA 1FYTA 4IJ3B 1T1XB 1GGCH 2VDPH 3CNKA 3O8XD 3D9AH 5IFAL 4YEEA 2P5WA 1PAMA 4K3DL 2Z31B 4PRIA 1CT8A 2L4OA 4FQIH 4FFVD 3ZE0F 2HT4D 1F13A 2HLFC 4R0LB 4JJHA 4R4ND 3QFDA 1WBZA 2JB5L 2JK5B 2H32A 4BKLA 8FABB 2GTZA 1I8MA 3O3EB 1LGVA 4U1JB 3HI1A 2EYRA 4OAWA 4KKNA 1OAZH 4X6BA 2EH8H 5IB5B 3Q0HA 4RMRA 4WFFD 2NY3C 4HZLB 1RULH 1BJ1H 3SO3C 4X5XB 4PRNB 1UA6L 1URLA 4BFBD 3HE7C 5BRZA 4QRQB 4C56D 2DQEL 3JVGC 2BHYA 5GS3A 1FCCA 1RUPH 2XZQH 4OI7A 4O5LL 4BYHA 1WAAA 1KIQB 1HHJA 1BGXL 3FJTA 1IC1A 5HDOA 1LO2L 1T0MB 2FIKA 4XCEA 1RIVH 2XV6B 1N6QL 4XX1E 3VW3H 2EZ0C 5CZXC 5IVXB 1JPTH 2ZSWB 1KPUA 3G04A 2VIRA 1MLBA 4UT7H 4NWUL 3V7AE 5D71L 3U36B 4Z6AT 1V5JA 1QA9B 1DBKL 2YRLA 5EU6E 3FQNB 4PJBF 1CFVL 2DQDL 3L5JA 2NY7L 2UWEE 1KGCD 4PY7B 3AY4A 1L0XA 2A6KB 4IDJH 2JIXB 5IT2L 3MOBL 4HUUA 3GMMA 4Y4FC 3MTRA 4UB0H 3WDIA 4PJDA 3BIBX 3QHFH 1QYGL 5C0DB 5CJ8A 3V5KB 4OGAC 2A6IA 1PYWA 2H26A 1HHHB 1DDHA 3JTTA 3F7RA 2A73A 4EVNB 1DBBH 3IDXH 1FLRL 1NANI 3QQ3A 4OCYL 1MCRA 1KN2H 4A2LA 5D7LA 1A22B 4Y2DA 4K3GA 3IKCA 3NTCL 2KL6A 5JHDD 4D3CL 5IWLC 1AR1C 4OZFA 2AJ3A 3FT3B 2YD7A 1LQSR 4JHBA 5I18L 3P40A 4OLWH 4NQDE 2J8OA 5FXCH 2LFGA 2GT9B 2MKWA 3KLAB 3QI9B 4CN1A 5D9SB 2DL2A 4PYHA 1U8NA 4TOYH 3U30C 1SBSL 1ZSDB 1LEIA 3EYQD 2XPGA 3BPNB 1H5BB 3D2UA 1YNTA 1VFBA 2R8SL 3MRNB 4WI4A 4BQ6A 1WWBX 3TO2A 4V1DB 1SJHA 2BY3A 2ORBH 2VDPL 1GGCL 3GI9H 4HWUA 1DEDA 1CDUA 3O8XA 5KSBA 3AFLA 5ICZA 3KPMA 4TVPE 4FQIL 4LEXH 3OKEA 1LDSA 3L9RB 2Z91A 1U8HA 2HG5B 3QJFB 4ZUTB 1M7DA 4TNWF 5DK3A 2R2EB 1WVZA 3BIKA 4XC1H 1LO0H 1G7LB 4I0CC 1UKQA 5J56B 1K2DA 3OJDA 3O3AB 3VFPB 4GKZA 3SEPA 1RURH 3TN0B 5MEOA 4KJQD 1T04A 1AD0A 1R5WA 3QR2A 3IAQA 4X4ZA 1IGYA 3W11D 3SDYH 1RUPL 2XZQL 2IPUK 4CADA 5FA3B 3FOLA 2H9GA 5I76B 4HEPG 4AY0A 2ATPA 4LHUB 1R5VB 1MJ8L 4D2NA 3UBXB 1VEOA 1PLGH 2F74B 4Y4KB 4KPHH 3IDUA 3UTSD 1UKSA 3VW3L 5DJ2A 4JFFE 3MXVH 4HWBA 3T0EE 4X8XA 3SDCB 4U7KA 2EE9A 4HKBA 4KK5C 2Y9RT 4AJ0A 5I74C 4CVZA 1MNUH 2HAZA 4LHJB 2R39A 4RWHA 5I1CL 4G6MH 5GS0C 4UT7L 1WFTA 4FG6C 1NBVH 1IJ9A 1LEKA 4PJCF 4GG6A 3VXSE 4X6DF 1NMBH 2GSIA 4IDJL 3LEXB 2R2BB 1T7ZA 1A9EA 2COQA 3MLZH 2HT3D 2XT1B 4LMQI 3QHFL 2XFXA 4CMMB 3BKMH 4MJID 1MHHA 4HXAL 3MV9E 1EO5A 2M26A 3IJHA 1CD9B 2X4SA 1NSNH 1QSED 1HXYA 4F9PC 1RUQH 4LRNH 2DLHA 5DXWA 2OBGA 5IVZA 5D2NB 3IS0X 4E41D 1U8IA 3SKOB 2GTWB 5I1JH 4XAWL 1NLDL 5HYJB 5E8OB 1GSMA 4H25B 5IBLD 4OQ1A 4HPYH 3MV11 3T77A 1B0RB 1PY9A 2QSTA 5T3XH 5FO9A 2N7AA 3V5HB 3ET9F 4L3CA 1FL5A 4ZFFA 4KRPC 5ACLA 3RKDD 3QUMB 4GQPH 4XT1C 5E8DH 4RDQF 1U8JA 1X44A 3OHXB 5JMOC 4MJ6A 3K0WA 3VDBA 1UWXH 3X13A 5I1KH 4JM4L 5DFTA 4NZUH 2X4UA 4G43A 3GI9L 3O9WD 3EO1A 5C0AB 5I2IB 3VU2A 3QUML 1KJ2A 2IPTH 2AJSH 1GZQB 1I7TA 4HWNA 3LQZB 3WO4B 1CLOH 4I3RH 3UCRA 5F3HB 5I1AA 3VXRB 5I19H 1VKXB 1BQHG 4XC1L 2D31A 5SWZE 4K7PH 2Q8BL 4XHJD 1RURL 3ZKQD 3G5ZB 1YPZE 3SDYL 4DQOH 5DS8A 3KPOB 5HHOA 1XIWC 3DOSA 3WS3A 4IRSB 1SYVB 2X89D 4CW1A 3INUL 3L3OA 2P5EE 4PRBB 1OP3H 4KPHL 3UTSA 2P4AB 3T0VA 2NY1B 3SGEH 2GJ6D 3MXVL 4DW2L 4WW2B 1G6VK 5CIPH 3BT2L 2W07A 3G6DL 4G5ZH 2PETA 4LCIH 4FQXA 4LQFL 4H8WH 4P4RA 4LFHG 5DHVA 4R4FH 1MNUL 5SWSB 2F15A 4GRLC 5ICXA 4Y1AA 1Q9KB 2C1OB 4OIAA 2X4TA 1B0WA 3NH7H 3NN8A 4FQ2H 5EB9A 5HGBB 5FKPB 4Z0XA 4DCQA 3NGBB 2VLME 2ESVD 2IJ0C 3TO4B 4M1CD 3QH3A 4WFEE 1Z6JT 3MUGA 5GZND 3EYUH 3T65B 2DKSA 4N8CH 5FV2A 2BOBB 3VXMD 3PGDA 4B7IA 2ADFL 4BELD 2OJZL 2F58L 3NPSC 3RGVD 1ZWIB 4Y5VB 5E56A 4L9DA 3SKUD 1U36A 2DLGA 4DUWA 1RUQL 5JOPE 1T7YA 1FSKC 4PJ9D 5DHYA 3D25A 4LEOA 3TPUA 1QLEL 3T1FA 1A0QH 3I6KA 4HS3A 4E41A 3PL6C 5I1JL 4N90E 3IDGB 4N1HB 5FCUH 4JHZA 5GJTL 2V2WA 3OKDA 4R90H 1BOGA 5F7WC 3S4SA 3DECA 1EEUA 3AU1B 4RBPH 1GZPB 3ARBC 4YDLC 1EXUB 2M8XA 1J7VR 3OWEA 5EO0A 3NA4A 4RIRB 1QFOA 4I9WE 3G9AB 3WHE0 4LLQA 2AEPH 4JFEB 4GQ9L 3E2HB 1AGEA 1B0GB 3GSWA 4HUVB 3SOBL 5I1KL 1SVCP 3MLTA 3IDYC 1ACYH 3GSNH 3MYJA 1TVHA 4KROB 1GH7A 4W6YB 4JPIB 3B9KB 1A2YA 2JJUA 4U6HB 2NY2D 3ELAT 4GW1A 1CBVH 4I3RL 4FTVE 1CFQB 1NBZB 3WL9B 1ZA3A 3U82B 3VG9C 2X70A 4JFOA 4PRPE 4YO0A 5MEPA 4K7PL 4KUZL 3P3YA 3BYTA 2EIZB 5C6TH 5HI3C 3JTSB 3VFSA 4U1KB 4ENED 4GO6B 5TF0A 3A6BL 4J8RA 3K1KC 4GAJL 3SGJA 2DWEA 5CIPB 4OZ4B 3BFOA 3HN3A 3VFNB 1FL3B 1YEHH 3NZHL 5DFVD 4AEIH 5C7XL 4YFLI 3E6FA 3RJDA 2CDFB 2Z8VC 1BIIB 4JDZB 4OV5A 5DURB 4IRJC 4P46C 1FC2D 4TN9A 5EO9B 2ZUYA 4FQJH 4EQ3A 4F2MA 4R4FL 2OMNA 4KDVA 3JV6B 1HHKA 4HUWB 4M8QB 4G3YL 5IG7B 4JQIH 3TH3T 1MPAH 4ZODA 3BP7A 3IU4L 1EHNA 3C8KA 4F3FB 1A9BA 2YK1H 5GRZA 3GMPB 2R0LH 4YBHA 2ZPKL 3HR6A 1RZ7L 4GW5B 1FYTE 2N4IA 3LSOA 3BE1H 4P23D 3HUJF 4X5WB 3O45A 5J11C 3HLAB 2P5WE 2J6EH 5BZDA 2NXZC 3T04D 3N0PB 3EYUL 4S0TD 5I1IL 1N5AA 4PJBA 5KSAB 1QSVA 4N8VG 4JG0H 1X6NA 2IMNA 1JHKH 4DVBB 1T3FA 3V8OA 4LLYA 1U8LB 2VLRA 4FQCH 4PJ9A 2CUHA 2FEDC 4OD3L 1XF2B 4YGVA 1KN4H 2AQ1A 1K5NA 4JZJA 3UPAA 4JRXD 4M7LL 3IT8D 3TYFB 1UCBH 4WFHE 5BRZE 2V2TB 1BM3H 4NCC2 5KS9A 4IIQA 4DKDC 5DVKA 2Q1EA 4ZYKA 1JK8B 2C4XA 4PP1D 3W0WE 4J6RL 5D93C 3MNWB 4NRXA 4O2EB 1WAAE 3V6OC 3MJ7A 1JGDA 3Q2CA 4H5SA 2IAND 3FQWA 3GSNB 2YD3A 3D0LB 5C09D 1YEEH 3EJYD 2AEPL 4TTGA 1BLNA 4QGYA 3LKOA 2ICEA 5F1KC 2YUXA 4X99B 4MA7H 3QIWB 4JFQA 1LK3L 1E27A 4LCYA 4QNPF 4XCCH 1ACYL 3GSNL 3X3GH 1NDGA 4IMLB 3LQMA 3EZ8A 1KCUL 4R9HA 1EHXA 4DWHA 4PV8A 1T2QH 2D2OA 3PHOA 4RX4A 4OLZH 3I6GB 4ELMB 4LSTL 4RMTA 5EBLA 1LNUA 4GAYB 4WWKB 1XR9B 5DJYA 5EA0H 5SX5K 2EXWC 1CBVL 3BGMB 1RZJH 1K8DB 4PR5B 2PO6D 1VFOA 1SY6L 5T3ZL 1QLRB 1E28B 4NQCA 1KTRL 4AEFA 3RBGA 3L3KA 1Z3GL 4LCCA 4K8RC 4LOUC 4WUUD 4LPXA 1ORQB 3RIAF 3VFOA 2K7QA 5C6TL 5GZOC 4Q9RL 1DN0B 5CBEB 3BEVA 1U8PA 2VITB 3T4YA 3ARGB 4R4BB 3UO1H 1JNLH 5D7LE 2HLAB 3NCMA 3WLWC 4UAOB 2CH8A 5FHBH 3W5NA 1A6TB 3VWKA 1CD1A 1MLCB 1A4JB 3VWJA 1ONQA 1MWAH 1YEIH 3LS5H 4OZFG 2ICWI 3LHPH 4KZDH 1EX0A 3CLEL 4GMTL 4P59H 4X6CB 5HJ3A 5D7JA 2HT2C 3NACH 2NLJA 5ID0B 2HVJA 3EAKA 3MBXH 3WIFA 4TUKL 4XCNB 3CUPB 1JUFA 3S5LA 1MPAL 1HYSC 4X83A 4HKJA 3L3IA 3P0GB 2X4NB 1OWWA 4B0MM 3JUZA 2QJDA 4QRRD 2YK1L 3P4MB 4KJPC 3MJ6A 5J12C 2VABA 3H9SD 4KHTL 5CILL 4LSSH 3K4ZA 2MCPH 2IWGA 4P23A 2I9LB 4K3EL 4APQB 3DHMA 2QADB 3U48A 1SBBA 4P2QB 5EORH 5T1DH 2OSLB 2ZCKL 5KZCD 2VZTA 1F3DH 4YHOH 4X6DA 3EYSL 1JHKL 4R7DB 2XOTA 1DQLH 3OR7A 2EDFA 5CGTA 3KPSB 5DD6A 4LPUA 5DD3H 2LTQB 3IKKA 1P5UA 1WFOA 4FQCL 4QCIB 4JVWA 2NY0D 4HF5H 5LCVL 3UTZB 3S9DB 3QXDB 2Y07L 5IB4B 4M7ZC 3LH2L 4NHUA 4EN3B 1UCBL 1BM3L 2VLLB 4NCDA 3GSQA 4BH8A 1A6AB 3O6KH 1MCPH 2ERJB 3M8OL 3S96B 5C07B 2MWCA 5AYUH 1EEYA 2NY6B 4XVSL 4GOSA 3DX6B 5DK0A 3CZFA 2D4FA 2OS7A 4BSVA 3CFIC 4NKDA 2IANA 1FV1B 1DL7L 3LRSB 3MGOB 5IHZB 5FYLH 2R1YA 5T1MA 4G6KH 1KTLA 5IB2B 2IALB 4GFTB 5FA4A 2FYYB 3KYKL 3GKZA 3DJ9A 1NFDB 3FFCB 3VXOB 1ZGLA 3VXNB 1F3RB 5MEQB 1S9VB 2MNUA 1OP9A 2R0KH 2Q7YB 4F7MA 3PDDA 4HK3J 3BVNA 3X3GL 3JUYA 4GH7B 3QUKB 1DQQA 5JQHC 4P9HL 3ARDD 3IFLL 3X3FH 3HAEH 4HIHB 5IOPB 4MQXD 1CF8H 1DBMH 1IT9H 1LO3H 4NBXB 3PWNA 4OQTL 1RZJL 4KGJA 3QUYD 3UTOA 4QXUH 1K4DB 2G9HA 2BVYA 5GGUA 1G7JB 2YD6A 1Q0YH 2FATL 4UQ2A 3RX8A 1KBGH 3V0WL 3RVWD 3MJ8A 3R0NA 4LSPH 3KPRD 4JB9H 4WUUA 3KR3H 1AP2A 4JANA 5I17B 1MWAB 1YEJH 1JWMA 3RQ3A 2GK2A 3DVGB 5BS0B 2A1WH 3UO1L 4JRYB 2CLZA 5IK3B 4HH8A 3PWPD 2Z4QA 4O2CA 5CSZA 1MWAL 1I1AB 1YEIL 2C7UA 3LS5L 5FYJH 2DIBA 3LCYA 4PRDA 4PJEF 2ADJA 3NACL 3WFHB 3DXAB 4XWGL 1H3XA 2QSCL 5DJCA 4LSUH 3MBXL 1B6UA 4PFEA 4NQXA 4MXWH 1EGJL 3MRCA 2F54A 3ZT5A 2CLRA 1QNZL 2RCSH 4HKZB 2YS4A 4RGMB 4ONFL 2DQUH 4LSSL 1JGLH 2V7HA 2F53B 3S36H 1SYSA 1YEGL 2NX5D 3B9AA 1YMHA 2O5ZH 5A1AA 3RPIA 1QACA 4NNXB 3W39A 5EORL 5T1DL 5C0EB 2XACC 1HH9B 3HI5H 3LIZH 4YHOL 1P7KA 2AEIT 4JKKA 1DQLL 1U2CA 3BZDA 1NCAH 3RWHA 5DD3L 32C2A 2CK0H 2I25N 2YEZA 3RZCA 3AB0B 1WT5C 1N4XH 4PUBH 5D7IF 2AK1H 1A6WH 1I7ZA 5DRNA 3QIBD 3ULUE 2D0GA 3N1QC 4OLVH 5HHOE 4U1GB 1BECA 3UXFA 4TUJB 4QHNA 5AG8A 3MRHB 3RHWF 2EC9T 4O4YH 2R2CA 2F8OA 3DSFH 4JFXB 3HAEB 4GMSH 4Y8AA 5IR1A 1QRND 1CFSA 1WCBA 3CXDL 3MV7A 4XP1H 4YBQC 4ISVA 2R0KL 4Z78B 4X8JA 5KJRH 3MRMB 2CIIB 4Y1AE 1X5HA 1XGPB 5EO1A 3DO7A 4HS6B 3DMMC 1FFNA 3UP1A 4P4KD 4OGZA 3LAFA 5C0IB 3BWUC 3TLRA 1AO7B 1LO3L 2BZDA 4KY1H 3M1BB 4WI6A 4NKOB 1FCGA 1G7QA 5A16B 1LVEA 5D8JH 5JW5B 2VZOA 2DLEA 3MREB 5EOCH 3DUUB 4XMPH 3O6FC 4LSPL