3ZE1E

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze1E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ze1E02
4IRJD 2CKNA 3I6LD 4L8CA 2FO1A 4L8SC 5IGXH 3FQUA 1V3JA 5I19L 3RKDC 2A9MH 3O41B 4DW2L 5F7HA 1A6WH 5I71C 4EUPG 1CVSC 4GS7B 1FNEB 3EW3B 3T0XA 1DBKH 5D7JB 1BIHA 5DGRA 3HAEG 3SBWA 4MVBD 4L3AA 3HG1D 1HINH 3BSZH 5IW6B 1SMOA 3ZKQD 1EEZB 3GKWH 5TGBB 5T1MA 1JWUA 4RISH 2NMSA 3RVUC 2DIBA 1MCKA 5ID0B 3MJ6A 4K8RL 3RU8L 2A6KA 2Q86A 2DD8H 5EA0L 4QY8B 3FAWA 3O2DL 4NCDA 1JPSH 2BRQA 3GIVB 3L5JA 1WGOA 4AL8H 2ZUQC 1NFDB 1JGDA 1FO0A 1EV2E 1VGEH 4Z7OF 4F58L 5KW9H 2JJSA 3EDJA 2NY5L 2X9XA 5CIPH 2NY6C 1HYRC 4OCYH 4ODHL 1D5XA 2VXUL 3QIWC 3BQUD 1LNUA 2X4RB 1HH9B 2ZOLB 3FQWA 4JFDA 3OKDA 1UENA 1OGAA 4POUB 3SCMA 1HQRB 2NQCA 2VTFA 1LD9B 4R7NA 5FF6B 5JHLL 4MJ5A 4N0CD 5C6WH 5JO5A 2YK1L 3HI6H 4Z77A 4JM2D 5ICZB 1F6AB 2FIKB 5D9SB 4X7SH 1NCCH 4LSTH 3EZJB 2BHUA 1TVBB 5SWSD 4JDVA 1KG0A 4R97B 1YQ2A 1FVCB 4ZMAT 5C0NC 2UWEB 4GJTB 1MWAH 3V0VB 3GB7B 1QFHA 1JZ3A 1EUTA 4KTEH 3C6LC 3U46A 3RA7L 4PRBA 5E6IB 1CDYA 4MS8D 4XNYH 4PGCB 2OL3A 2HMID 5T5FH 2F8OA 3PWUB 4YC2B 2YXFA 1NJ9B 3QDGA 4GKZB 5BMFH 5EO1A 5HVFB 3HE6D 5IB5B 4NC1C 3PL6A 4GXUN 3VXQB 4FMFA 2FX9L 1EXUB 4FP8H 3LKNB 5C0AD 3H9SB 4NQDE 4WWKC 5DZOA 4ZD3H 3ROOA 4NKQB 3RGHA 4QHKI 1WFNA 5GGTH 1YEEL 4JG0L 1SEBA 3AVEA 3D9AL 1T1WB 4LAQH 3WUWA 1ROWA 4YDLB 4MCYA 4PJAF 3EOTH 3ZDXE 4P2RD 5DJ6B 3JWDC 4GMSH 5DHYB 1G7QA 5FA4B 3RWHA 1OPGL 1IC7H 1NDMA 5ELIA 1QSEE 2GYSA 4HXBL 4IDJL 4OCWL 3QUZC 2GQHA 1ZTXL 1A6VH 3Q1SL 2NY7L 5FGCE 5EBGA 3GSNL 1G7PB 5FM8A 1A7BA 3MLZL 3VMPA 4OI9A 1QLEL 5I9QC 1A9BB 4J23A 3BPCA 4X83A 4G3YL 2B1HL 2H6PA 5SX5H 1KSRA 2OZ4L 1XR8B 1T3FB 3UTSE 4CW1B 2O93L 4MNQD 5A1AA 3KYKL 1NAKH 1S7VA 4H88H 1GCFA 1H5BA 4MCZA 4PJEE 1KNOB 4L4TD 5FK9A 5TJWK 5L8KB 3AY4A 4ODUB 3BPNB 3ARBC 5ADOH 4GKOA 1YEIL 3UZQA 1S9YA 3LHPH 5LWYL 2ORBH 4R90H 4Y5YB 1KEGH 5DHVB 3S4SG 3VI3F 1AGDB 2VXQL 4PJXA 4YE4L 5DMYA 1T1YB 1DANT 3RWJA 3THMH 3LKOB 1OSPL 4FFWD 3ROLA 1UCBH 3C5ZB 4G8EA 3D39E 4OF8A 1V7NH 1T66C 3OHXA 2Z4QB 1AGFA 2MMXA 5CD3A 1AI1L 1U8OB 3BQUA 2A9ML 1OVZA 5DEGB 5KG9A 2Q87A 2HA1A 1D9KB 1A6WL 5GGRA 5T1DH 1W72B 3CJJA 5HVGB 2W9LA 4RMWA 1M05B 1BJMA 4Z7VE 4PY7B 1ND0B 4JM2A 4DCQB 1HINL 3BSZL 2NX5E 4PB9H 5DDHA 3CFJA 5C8JA 1RHHA 3GKWL 5KSAD 4QF1B 4ODBD 4TNVK 2DQHH 4RISL 4P9ML 5SWSA 2VLJE 1BGXH 1UXWA 1NFDF 1M7XA 1U2HA 3CD4A 1XGUB 4G9FD 1IEAB 4IRSC 3T65A 1B9ZA 4L8BA 4M7KH 5DJ8A 1NGYA 2AAVA 2DD8L 3L7EA 2VDLH 3U0PA 2NYYD 4EUPA 5HJ3A 1RSFA 2C7UB 4AL8L 4KI5E 4BUHA 4JPIA 2F9BT 1WZMA 3IDJB 1YEJH 3LCYA 1VGEL 3F58L 3HAEA 3HE6A 4NQDB 5KW9L 3PWPE 2GKIA 1RI8A 4IRZH 1T20A 1ZVYA 3O2VL 3OG6B 5IB3B 4JCMA 4HH9B 1IEBB 4OCLC 4G8FB 4QHUA 2P7TA 4HLZG 2X5PA 4QHKJ 2KDGA 4K3GA 3WCYA 3GSUA 2YSSA 2FX8H 1ORQA 4GW4B 5DQDL 1UA6H 5B21A 1QSEB 5JOEA 4P2RA 2DQGL 4X7SL 2HKFH 1WCBA 4LSTL 4K8RC 4NQSB 4PJ5D 3VD7A 3WIIH 1MI5D 2VQUA 4NZUH 4DVRL 1KB5H 4HEPG 4PJDA 2AJZA 5HHXH 3UTSB 4Z7WA 1F3JB 2Y7QB 4KTEL 4XMLH 5T3ZH 3MLTB 1I1AB 2OMBA 3IDMB 2NY5C 3IRZA 1YMHA 5FV2A 4PJEB 1DZBA 3QR2A 4XNYL 2IAND 4CJ0A 3BESR 4MNQA 2A6JA 3IDGA 2EE3A 3NFSH 4DKEH 1PX3A 1IL1A 1J0ZA 4JKKA 1YY8B 4U7KA 3STZA 3GBMH 3T3MF 5GRUH 4FP8L 1AO7B 3A6OA 3T4AB 1DQMH 4GRLC 3JV0A 4JFYB 4ZD3L 3W2DL 3MYJB 5E4IA 5H8DA 3GBLA 3H2WA 4JQVC 5C6PB 5C6TL 4OCSH 4P5MB 3QXDA 5IHZB 3BISA 1AP2B 3RWEA 3LEYL 4LAQL 3D39B 2E8ZA 2XV6B 5KJRL 1EFQA 5DJYA 3ORJA 2YMXH 4NC2B 4NZTH 4HBQA 1FLTX 5GRVL 4B5EA 2DQDH 3DVNB 1HDMA 1QRND 2FSEB 4GMSL 5EU4B 5JR1H 1IC7L 4GFTB 5DI8A 5J1AB 1I3VA 1A6VL 2V7NA 5BRZB 4KK8C 1EO5A 2EYRA 4Z7VB 3CFKB 5EU6D 2DOCA 4DQOH 4M6NH 4BQ8A 5HPMB 5JA9A 4JFEA 1DUYB 3KYOB 1F11B 1RIVL 2VERN 1TETH 5D70H 1DBMH 5GSVB 3ARFB 1HHGB 4UILH 3HUJE 3PWLA 1NAKL 4H88L 5I73C 5KSAA 4P57B 4GKNB 4HFUH 2E6JA 3D6GA 1AD0B 5E7BA 4Y4FB 5CILL 3T0WA 2ZG1A 3U2SA 2GUOA 5C3LD 3UBXI 5CAYB 3DUHA 5ADOL 4PUBH 4YHIB 5MEOA 4X8JA 4AK1A 1KPVB 3UDWA 2ORBL 2X7LA 4R90L 4GG6A 5I1CH 5CBEA 2YPKA 5JHDB 1XIWD 5KVFH 3KPNB 1J1XL 3PWPB 5KVEH 4ESKA 5D6CA 2BK8A 4X5LA 2AABH 4NHCH 1YDPA 3GMQB 3L9RA 3ARPA 1RURH 1X5AA 1V7NL 2XA3A 5IMLA 3VFTA 5AD0A 3DTXB 3SGJA 3KS0J 1H15A 1T04B 3AS2A 3WFHB 1T2JA 4O2FB 3L5XH 4O58H 5D72H 3G6JA 4GG8B 1N6VA 5FO9B 1QTYT 2HVJA 5DJDB 2PYFB 3S4SA 3AS3A 3ZDZE 4HKBB 1BAFH 4UI2A 1HOCA 4PLKD 2DQHL 4U6VH 3WD5H 3STBA 1ZA6A 4G6MH 4P46D 3V95A 4WFHE 1MI5A 3PHQB 4ODXB 2D7MA 1A9EA 5FYKH 3L5WB 1ZS8B 4M7KL 1Q0XH 3D3VB 4MQSB 3ARQA 1VACB 2PCPA 3OGCB 4D9QD 1KJMA 2IANA 2JB5H 2AXJA 2F74B 3MRPA 3Q0HA 5EIQA 3O3EA 3LSOB 4JRYD 2IBZX 3CDGA 3F7YB 3UTTE 3QNXA 3W9DA 5GRWA 5J11C 3ZDXF 1CL7L 3EYQD 5MI0C 2LABA 4EEEA 1CFQA 5I66B 4F7PB 1FV1A 1T7YA 4XCCL 3RNQA 3BHBB 4JY5L 2I5YH 4RGMB 4WHTB 4KDTA 3O4LD 1R3HB 2DI9A 2B0SH 1RZGA 2DBLH 3QB7C 5DFVD 1A1MB 3QJHB 5AAMA 1CBVL 2FX8L 5JDJA 2I25N 3MZGB 3QO0B 1P6AB 2JE8A 4IMLA 2AXHA 1UA6L 1QRNA 1T2XA 4XMPH 3C8HA 1MCCA 1RAMA 4ZFFA 5CZVL 3X3GH 3E2HC 2NW3B 4MAYB 4JJ5A 3WIIL 3C60B 4NDMA 3BFOA 1RUAH 1U91B 1MIEH 4NZUL 4AZ8A 3ARWA 4RGNB 5EU6A 1KB5L 5INDB 2HJLB 5B38G 5JA8B 4LGPB 5HHXL 3H0TA 3HUJB 1EFXA 4M61B 5J4MA 3ETBF 3NGBC 5ADPH 5D1ZB 5J0BA 3L1OH 1HIMH 2GFBA 2ZOKB 4DKEL 3NFSL 2JB6A 2OS7A 4O51B 5EPMA 3GBML 4Y2DC 2QHRH 3GJFA 1YEKH 2Z9TA 4K3DH 3MR9B 4M1GL 4YDKH 1O7SA 3A0OA 3QAZB 3RWFA 1FNFA 1HYSD 5GRUL 1CI5A 1NMCC 4DK6A 2EH8H 5JOFB 4TSCL 5DD3L 1IVLA 2ICWI 1T1ZB 2HTLC 4OCSL 4HV8B 1OD7A 1XIWA 3QUYB 3TJHD 2APVA 3WEXB 3R1GL 4WW1A 4X5WB 3S37H 4NIKB 1GGYA 1LEKB 3OR6A 1U8KB 2DQDL 32C2A 2V2XB 4LHUG 1C16B 4KKLC 1TZIA 4Y8AA 1XCQB 3DIFB 4UTAH 5E00B 3IAQA 1EVTC 1U8QA 3ZHDA 4M6NL 4XNZC 5DEZA 5SWZE 3PGFH 5E2VH 1TETL 5D70L 3MCLH 4U1SA 4KXZI 3DMMC 4UILL 3FO2A 2F54B 3B5GA 1BQHG 4FXGB 3QEUA 1VKXB 1QFPA 4KI5F 3V0WH 2MPAH 4F57H 5HYJE 5BV7B 1U8MB 5J12B 4HFUL 1FE8L 4P46A 4R0LB 1NGWA 5GHWL 3KJ6H 4HPOH 4PUBL 3GSVB 1PAMA 2ADJB 1G7HA 3RGVB 2W0KA 2IFGA 4X7TB 5TE6L 3CAFA 1A1NA 4NO0D 3UTTB 3P9MA 4CVWA 1FNAA 2D3VA 1ZGLA 5KVEL 2NY6B 2G5RA 4JRYA 2AABL 4NHCL 3P9WB 4I3RL 1YPZB 4U3HA 1RURL 5IVXA 4E0RA 4PV9B 4KK5D 3Q5OA 1BBJB 2OR7A 1YEFL 3B9KB 4G7YL 2GY7B 3TZVB 3GSQA 1NCAL 2YUXA 9CGTA 2WSKA 3O4LA 3HC4H 3S5LG 4O58L 2A1WL 4M8QA 5D72L 5JZ7C 1I9JL 5E9DE 1CICD 4LOUC 2PXYC 1QFWM 1CFTB 1FYTA 1IAOB 1P6FA 4K3HA 3UTQA 3VXUE 1JUFB 4NO3A 1D6VH 4U6VL 4UT7H 3WD5L 5L8JB 4M00A 4IIQA 3MRMA 1C7TA 4LHUD 4XTRD 5D96C 3REWB 4YDVB 3C6LB 4JZJA 1G1CA 5DRXA 3VWKB 2ZNXA 5HGDB 3CDFA 2Z91A 3SGEH 3QP3A 3ZKMC 1G6VK 1FNSL 1JGLL 4QXWA 4RX4D 3UYPA 3BP7B 2JB5L 4DKFH 5CEZD 2A2QT 3I9GH 2OI9C 3CVHB 5FA3A 4ZAKB 1UXSB 1OLLA 3BZ4B 1S7QA 2NY1D 3ZLQC 2P49B 1WK0A 1GPOH 2J8UA 4TSBH 4JQXA 2I5YL 4RSVA 5F3BB 2BOBB 1UZ8A 2ICWJ 3C5SB 5T3XH 3I3BA 5GGVH 4XVJL 4F7EA 2B0SL 3SDAB 2DBLL 2EYSB 3L3HB 4U1LB 4C56A 3VI4F 1ODAA 3MLPA 3TBWA 1ED3B 1JTOA 3UBXG 3DRTA 2RQ8A 3OB0K 5FGBC 1NGZB 3VG9B 2O26U 1UJ3A 3X3GL 4ZFGH 2EE2A 4XWOC 3WFBH 2NZ9C 1ZT4B 5SWZB 1WFOA 3VXME 5CLWA 5ESVB 1MIEL 3M17A 1I7ZB 3QUMH 2FD6H 2B5IC 4XNXH 3PJSB 2OQJB 3DGCR 5E8OB 2V5TA 3IAGC 5IM7A 4FTVE 1ONQA 5ADPL 5HYJB 3SQBA 5D6DC 2W0PA 3L1OL 1HIML 4KAQL 4RIRB 1CDBA 4JHAH 5EIIA 3QI9B 4LRIC 2Z8SA 1BOGB 2QHRL 4YDKL 4K3DL 3RDTC 2A83B 3BYYA 1A6AB 3O6KH 4P5KA 4PR5A 1X4YA 3DURB 2AV7A 2EH8L 2OK0H 2F8VA 2EDOA 2BZDA 1FZKA 4U1NA 5IJKA 2HT3D 2R4RL 1G0XA 1J87A 1A22B 4QOKE 2BP3A 2NXYD 2W07A 3RVXD 4EI6B 4NRYA 1ORSB 3T0DA 3VMNA 1IM3A 5B38A 5DD6B 3O81A 4NO0A 3QO1A 4LASH 1AR1C 3S37L 3BOVA 4HS6A 1M4KA 5GS1B 2X4NA 4Q2ZA 3CSYB 5ESQB 2X44D 5MEND 3JWNC 3IETB 4GRWE 1Y0LB 1DLHB 2C5DC 3DPBA 2XFXB 4P49A 5I1KL 1ZAGA 3MV7B 4HIEA 1H8NA 3RY5A 3MJ8A 5DK2A 5D7JD 3LN5B 3KXFD 4ELMA 1ZT7A 2XZQL 4YAQA 3QWQB 1EAJA 1G7MA 3PGFL 5E2VL 3L3IA 1CICA 1F3DH 4ZUVA 3UMTA 4I0PC 3WNKA 1U93B 3BP5B 4OZHA 4I48A 3K1KC 3ZHLA 1U8NA 1AHWC 4KKBC 1TIUA 2CRMA 4G5ZL 2MPAL 3T1FA 1VFBA 2VUYA 1NEZG 3DV4A 5C0FB 3DUUB 4LHUA 3OV6A 3LKQB 3MLXH 5IQ9B 1YPZF 3WKNA 4HUVB 2PO6C 1KEMH 1CFVH 3I85A 4HFWA 2FECL 5GGQL 3D25A 5H35A 2HLAB 1KCKA 4TOYH 2WINA 3DVFA 5IKCB 5B39G 1B0RA 2NZIA 3P30H 1YNKH 2C4FT 2CQVA 4QXGH 5AUMA 4GBXA 1P5UA 1B6DA 1BQHA 1JGUH 2CKBB 1XF4A 2E7LC 2VDKL 4OZIF 1KC5H 2WZPD 1F4XL 2JJTA 4Q9CA 5EOTA 3CCHB 3O6FB 4LLDA 1BVLB 5BZWB 4XXDB 1N8ZB 5CBAB 3HC4L 2UVFA 3FAXA 2AXGA 4AG4H 1U8IB 3IJYB 3O9WB 2R2HB 5JMOC 4Z8FH 2CLZB 3GO1L 5C07A 3X12B 1R24A 4BSWA 1NC2B 2HFTA 1XGTB 3VXMB 5DEFA 4R4BA 1I8MB 3WLBB 1XF3B 2J7LA 4J3TA 1JN6B 2VDMH 4OAWA 3S3SA 1GC1L 4Y0GA 5E6ID 3HR6A 3TNNA 4PTUA 3TO4C 5IVZB 2DJUA 2PTVA 3WMSA 1N5YH 3BD4A 5HGHB 2EXYC 2QSTA 2BHZA 1FZOA 4KTDH 4NHUB 3WNMA 5BQ7B 5T1KA 3S5LA 1QBBA 4ZQKB 4NQCB 5ENWA 1PSKL 1FO0H 5HGGS 3HZKB 5E2WL 2V17H 2OBGA 3I9GL 4UUJA 4XH2B 1MREH 1OTSD 4YXLH 1B88A 3O6LH 4QOKB 1GYAA 4Z7QE 4TSBL 3QIBD 5SWQB 2FEDC 3V4UH 1KPUB 4NPYB 1HWGB 1HHHB 5GGVL 4RBPK 4U6HA 2FRGP 2IEPA 4YHNB 3OKKB 4XNMB 4GRWB 1BFOB 3REVB 3TVMC 1ULVA 5MENA 1LDPH 3WXWH 3T0EC 3ARYA 4IMKC 1TZHB 3W82A 1XCTA 3V2AR 3TCLA 4ZFGL 1M71A 1FNEA 5A2KH 4K9EH 2QADC 3KXFA 4NN6C 3QUML 4RCAA 2FD6L 4XNXL 5IW6A 1YY9D 1BX2A 3MA7B 3X11A 5B3NA 4HDIB 4P23A 5JUEH 3A6BH 5TGBA 4ODWB 1OAQH 2X4OA 1EGJA 1PY9A 4V2BA 4HG4K 3B6SB 3QCTL 1TNNA 3RI5K 4JHAL 5BJTB 4NC0B 1X5KA 5TQ0L 3U7AA 3T09A 3SGKA 3S97C 3O6KL 4JHWH 3UBXA 1J0YA 1H3TA 2B7DT 5DJZB 5ALBH 1NBZA 1RZKH 3GIVA 4OM1H 4UAOC 1A4JB 1BM3H 4I5BB 3VXNB 1F58H 5GS2D 4D0CB 2XOTA 2EDEA 1W0WB 2KKQA 2O5YH 4PJHE 2H45A 1GZQA 1J8HD 4LVNB 4S1QH 4FXKB 5J1TC 2G60L 1NGXB 4JDZB 1KJ2H 1ZV5A 4MD4B 5FOBB 1HH9A 1CGWA 1D9KD 3HA0A 2H8PA 5CGTA 3B5HA 3OJDA 3EYOB 4G6KL 4XBEH 1LD9A 4E42A 1J0HA 2XYCA 2DQUL 4NWTH 1MCEA 1X5IA 4DZBA 4LNRA 3QG6B 3RWGA 2DTMH 1F6AA 1UM6H 3HMXH 4PG9B 2R1YB 4U1JB 2EDJA 5M95B 3TFKD 2XT1B 2GJ6D 4P3DA 4WHDA 4G43B 4HS3B 1N6UA 1KELL 3GIZL 4GAJH 3P0YH 1RULL 2JCCA 1WEJH 25C8H 3IAPA 3RIAK 2YZ1A 1L0QA 4HKXB 3FQXB 5K33A 2ZWLT 3WIHL 2D03H 3ISWA 4QCIA 4X7EC 1CFVL 1FJ1A 5CD5D 4GKZA 4WW2B 5IB5A 2EDQA 1FAIH 3OPZH 5E2JA 4Z18A 3UPAA 1FZMB 4NZRH 2EEBA 1I1RA 3FTGA 1G7IB 4TOYL 2YA1A 5J11B 1CTNA 5FUZL 1KJVB 2R1WB 4DOHE 1U3HA 3P30L 1YNKL 2DQFA 5BS0D 1JGUL 3CH1A 3MV01 1X4XA 8FABB 3EYSH 1KC5L 5ISZB 3OB0H 4RNRB 5ICYB 3BI9X 6CGTA 3QIBA 1NEZA 3OZ9L 4GKSB 3IKKA 4WGWB 1UKTA 3MRGA 2XTJD 4RAUA 1ZLWK 1G9MH 5DJCB 2R23B 5DQJB 1FL5B 3MODH 5CJOL 2QTEA 1GIGL 4OGXH 1WC7A 3G04B 3O8XC 3CFDA 4ELKA 2GAZA 3MBEB 1WBYB 1JE6A 3QA3B 3KHOA 3QEGL 4NJ9H 1HHIA 2DLTA 3FB7B 2YC1B 2R2EB 1I3RA 3NIDE 1UM4H 4ZUSA 2W60B 5FYJE 2BY1A 5B39A 2XACC 3MJ9A 4LLQA 2RAMA 4NN7B 3GSRB 1CU4L 1KIPB 1T3FA 4KHXL 1YA5A 5CIPB 3U0TB 3CSGA 4ZFZB 2RHEA 5C0RH 2IPUK 3DSNA 3SJVA 1EJOL 4KTDL 2ICES 4EUPH 1WFTA 1QHOA 1I1FB 4Y2DB 1ITBB 1MIML 5ICXA 1AO7D 1G0DA 2V17L 3E8UH 2DLFH 4Q0XH 3G9VA 3RUGE 3LN4B 3WO4C 4P9HH 3FT4B 1A64A 1I4FB 2XKNB 1MJUH 3WN5C 2ICWA 4AEHL 1AGDA 1N2RB 4QRQA 2FH8A 4UNUA 2V2TA 5IMKA 2YOCA 3OBAA 1WTGT 2L7UA 4UQ2B 1SHMA 1BVKA 4X7FC 4Y5XA 1J8HA 5CINH 1MWAB 4PJGE 1GC1C 1LDPL 2NY0B 3WXWL 5DMKB 4AYFA 5DEGA 4P2OC 1LP9E 5BRZD 1W72A 5EBLB 5IT2H 5J1SC 1G9NH 1FFOB 3MRRB 2OTUB 5C7XH 3INUL 4H25A 1BWWA 4K9EL 4ZO8A 3I6GA 3MV9D 3HE7D 3I50H 3NA9H 1QFUH 4YDJA 3W9EA 1QVOB 4RMQA 2BVPB 4X4ZA 4MD5A 2W0FB 5JUEL 1W0VB 2GJ6A 3A6BL 1PKOA 3K0WA 4Y4FD 1RZ8B 5FDWA 5MEPB 4F33A 4H5SA 1SY6H 1UM5H 1JVKA 3KYNB 12E8H 4N0FA 4JGUA 2BFVH 3EO1B 5FKAA 4KI5D 3TN0C 5ALBL 5JHDD 1R3KB 1Q9OB 1RZKL 3BGMB 3SKMA 2C7UA 3ILQC 4QTHA 4X5XB 4OM1L 2W65A 1BM3L 3V5HB 4HLJA 1F58L 3G5XA 2AK4E 3X3FH 4YUEH 3RWCA 5HDQH 2X09A 4Y5VB 3V7AE 2XWJB 4K3JH 3ARDD 2A73A 5D1XB 4CNIB 1KJ2L 4WV1C 5BS0A 4NP4L 5H94B 3LDBB 4ORZC 5DK3A 3UTZB 5T3ZE 4NFDA 4HIJA 4C59B 5LG1A 4J4PD 3EO9H 2VAAA 3V5KB 2H9GA 3Q2CA 4KHTH 5M7QA 2DTML 1WBXB 4J6RH 5IEKB 3AB0C 1KACB 1B0GB 5DMIH 5LAXA 4BKLA 1MH5B 3DX7A 3C5JB 3DOSA 1C5CL 1K3ZA 1U8PA 2FWOB 4C58B 5FHBH 4NYLB 4WW2F 1RUKL 2NY2B 3JV5A 5F9JB 4ZXBB 4M93C 2Y7QA 1WEJL 1BOYA 2IF7A 2PETA 3D3VD 4KJWD 3IDMA 4ZS7L 2G75B 1IQWL 2IADB 2VQ1A 3WJJA 1UH3A 4AIZB 4LBEA 5HDBE 1S5HA 4GXUM 1NBYB 1WAAA 3CZFA 4KC3B 3RUGB 1KLFA 1FAIL 4PJ8B 3LQAH 4RBPH 4WU5A 4M7LT 4XRCA 1OGTB 3RPIA 2VL5A 1RMFH 2F5AH 3VFPB 3MO1B 3QDHA 1ZANH 4L4JA 1MHPH 1F5WA 4Z76B 3QPXH 2HRPH 1IKNC 1IGJB 3TBSB 3V5DB 4Y4KB 4XI5D 4LFHD 3EFFA 1OHQA 4G8IB 4H0IA 4UDUA 3WS6C 2V7HB 5K9JH 3CPLB 4ZUTA 1G9ML 4QRPE 3UJIH 4PJIF 3MODL 1LP9B 3P11L 3DYPA 5D1QC 4NJ9L 4MAYD 1MFDH 1JHTB 3C60D 2G5BA 3G9AB 4P3CH 4RGND 3D0VB 5SX4H 2YD5A 4LVOC 1A3RL 3K3QA 5DVMA 1DUYA 3WLWD 1U58A 1S7SA 2WBJC 4YBHA 4FG6C 3P4LA 3MV9A 3HE7A 1I9EA 5GSVA 3R8BB 5D1ZD 4Z9KB 2AEPH 4PJCA 2P8PA 4XB8A 3ULUE 2ED7A 1UQSB 2MKWA 3VFSB 3OR7B 4OIAA 2VLRE 2NXZB 4GKNA 3BP4A 1B4RA 1AD0A 1TVHA 1E28A 2EIBA 1KIQA 4NQVA 1QFWH 3EYUH 4UU9B 5IMMB 4Q0XL 2DLFL 5ACZA 4Z95L 4KKAC 4OV6F 4JY4B 4P9HL 2FJHA 1RU9L 3PDOA 4M1CC 3HI1B 4OFYD 1RJYA 1XT5A 4W6WB 1P4LA 5JHDA 2AK4B 3L6FA 3KPNA 1CD8A 1UT9A 3QEQD 5ECJE 3VXSB 3FKUS 3TF7C 5FM5M 1UWGH 3HCVA 5DS8A 3D2UB 1HI6B 3RKDD 5F88A 3ARDA 5F71A 2VITA 4D9RD 5CINL 3W39B 3FFDB 1MY5A 5D71H 3ZZ1A 2MCG1 4MDJA 3HNTH 4MX7B 1RZFH 4MA1C 2DM3A 4PRDA 1C1EH 4FFZH 3GSOB 1IARB 2XG5A 3MV8E 2FB4L 4GG8A 4ZO9A 5T33H 1E4KA 4I0CC 5C7XL 1P2CA 5FO9A 5F7UA 4PJFE 4J4PA 3I50L 4PRID 2ARJA 1K6QL 3NA9L 2F54D 3R0MA 1OF2A 3NAAL 5F6IC 2N1KA 1NBVH 3RVUD 1S8DB 5J6HA 3EJZD 2P5ED 1QR1A 4E9LA 1LO4L 4JPKH 2BMKA 5FM5O 1RJZB 5C70A 4N5ED 1SY6L 1UM5L 5EUKB 12E8L 4YFLI 3ARGB 4LSDA 3DI3B 3D3VA 1MJ8L 1FDLL 4X4XA 4D9LH 4PV8B 3UTTD 4QHNB 2CDFA 2D9QB 3F7RA 1OAZH 4J3UA 2NY6D 4QHLA 5I74C 1SM3H 2LFGA 4RFNC 1KTRL 4U0RB 3MNWB 4ZUWB 3WS3A 5HDQL 3AS0A 4APQB 4K3JL 3GSWA 3B9KD 1JPTL 4K9EC 3IFPA 2ZG2A 3TZVD 3BW9B 1IAKB 3Q5TA 2R2BA 3VWJB 1PKQE 4K7FA 1KPRB 3C9NB 4QRPB 4U1GC 1A1MA 2VISB 4PS4H 2XWBB 2ZSVB 4OD2A 2V5RA 2E7CA 1IGMH 2FCBA 3C09C 4J6RL 1WF5A 3GM8A 4QRRE 5DMIL 1S9VB 5K93A 4OBRA 5C0ND 4P4KC 5T1LD 5FHBL 1RZKC 5KVDH 3CH8A 3CK0L 3C6LD 2HJLA 3VWKD 2MSPA 2WWKT 1RVFH 3VGEA 3MUJA 1YEDA 1VA9A 5EUOF 2YUZA 5EDXA 3IF1B 4K7PL 2HJFB 3T2NH 3ESUF 1WZKA 2CSPA 2ZOKA 2AJXH 5HTSA 3NCYS 4FQXC 3W5NA 2DI7A 3BE1H 3O2WH 3MR9A 1XGYH 2A6IB 4WWKD 4I0KA 1CE6A 2F5AL 3QZWB 5I18H 5JOFA 1UZ6E 1MHPL 3BJLA 2ED8A 4WI9A 5HGAB 1U8JA 2E3VA 4EI5C 4W4OC 2FJFB 1LP9F 2YPLE 4OFYA 4X6CE 5F1SA 4AMKH 3SDAD 3GNMH 4XVUD 2K7QA 3O6ML 3QEQA 5KS9A 5DR5L 3N0PB 1HN1A 4JKLA 1D5MB 1QR4A 3QUZD 4ZNEA 1E4XH 4ZFOA 2BNQD 2YKLH 1U95A 3ZDYF 4UTBH 2Z92B 2YN5A 3MV8B 5E2TH 3EDDA 4LRNL 5FYJL 4K7PX 2ESVE 4U1HA 1A7RH 4YX2L 5TDPA 5D7IE 5IW1A 2XRAH 4PRIA 4F15B 1HKLL 2AEPL 2LU3A 1JJUA 4YNYB 3GDBA 2GK2A 3QI9D 4YO0B 3H42L 3ARBD 1MAKA 4R0LA 5IFJA 2P5EA 1HZHL 5E8PB 3BO8B 2D7NA 1DN0A 1QFWL 3EYUL 3ZKNC 1T80A 3DV6B 4OSUL 5DA4A 4JREB 4JB9H 1G9MC 4I9WE 4LPXA 1J5OH 3IGAA 4KK6C 2CPCA 3MUGB 4XPFH 4J8RA 3T2QA 3NN8B 1JNLL 3L3GB 1GRWA 3QUKB 1T66D 2A77L 1UWGL 2P5WA 1YPZA 4EDXB 2ID5A 1CR9L 3MRFA 4K55A 4TVPH 3RHWF 4DGYH 3QIWA 1FFPB 3FL7A 4PV9A 5IIEB 2GK0B 4V1DE 2AK1L 4QEGA 3MV7D 2YD3A 5D71L 4UIKL 3TZVA 3DNKA 2ZUSA 1LO0H 1OQXA 2EDDA 2I9LB 1NCUA 3HNTL 4X80H 4I4WA 1C1EL 4FFZL 4MD0A 5TE7H 1PG7X 4OLVH 2ZUXA 4OZIA 2IJ0C 4QRRB 4UNVA 4OLZH 2EDRA 4XBPA 3TM6A 5F89A 1KBGH 4OFKA 3FB5B 4LVEA 5HDBF 5EZJB 4P9HC 1NBVL 5IOPA 4NQXB 4OIIH 3UYOD 3EYVA 3OX8B 1L0YA 2VXTH 1F97A 5EBWA 3M1BB 5CP3A 1DJSA 1MY7A 5T1LA 2GJZA 4JPKL 3WFEH 5ILTL 1INQA 3C6LA 3MRIB 4K94H 1SYSB 4KGLA 5HGDA 4KQ4H 1JYXA 3QQ4B 3IDYC 2NW2B 5BZDB 4D9LL 5DYOB 3DSFH 1HWHB 5F96H 1TQBB 4XC1L 1IKFL 1S9XA 4UBDC 1KJ3H 1G6RH 4WWKA 2X70A 1UXSA 5F1NA 4JFPB 1IT9H 1I85C 1V05A 1UB5B 2YPLB 3P4MB 1RFDL 1P84J 4X6CB 2OJEA 3QQ3B 4L9LC 4X0KB 5F3BA 3BGFB 4YEEA 4HQQH 1GHFH 2KZWA 2EDYA 3SDAA 3K4ZA 3O9WD 2EYSA 2VXVH 4PS4L 2IC2A 4JFXB 1IGML 4MGXA 4K8RD 1MEXL 4X4YB 3EAKA 3HC0A 1NUGA 1XMWA 2DMBA 1T21A 2DWEA 2CGRL 3VXMD 3QUZA 1NGZA 2Z31B 3VGBA 3W0WE 1HHJA 5HHOE 2ESVB 1NLBH 2BNQA 2EDNA 1S78C 2GEEA 5D7IB 1JPGA 5HDOA 3UAJC 3CUPB 3FB8B 3VGDA 5I76A 5K9QI 5F6HI 4LEOB 3UPRB 4F80A 3N85H 1FVEB 3NH7H 3MLSH 3HZMA 1N59A 2X4PA 3G08B 3GSXB 2H2SC 4NQCD 2AJXL 1CGTA 1J10A 4OLYL 3ZE2F 2R4SH 4H1LH 4P5TB 3ARBA 5IMOB 3MRCB 1A6AA 1XAUA 1XGPA 2LTQC 5D2NE 5DD1L 5I18L 2X4SB 2R1XA 2J4WL 2AERT 2AW2A 1A47A 1U8LA 3EIFA 3JWOH 4ZOBA 4LPCA 2HG5A 4AMKL 3EZ8A 4PGZA 5DD6A 5KSBA 1WZLA 1ES0A 5GJSH 3FT2A 4OGYH 3STLA 4HXAH 3GMMA 1G0YR 4V1DB 1RJLA 2AJVH 2OJZL 5GGRY 1E4XL 4MA3A 2W38A 3PWNB 4KK8D 1CLYH 3I02B 3MJ7A 4OD3H 1SMAA 3V52H 3EKCA 2YKLL 2GITA 1WFUA 4IHOA 5E2TL 4CDGC 2DWDB 4CUCA 3V8OA 1U42A 2ERJC 2ITDB 1DBAH 3Q6GH 3QUXC 5FXCH 2XRAL 3VG0H 3OJ2C 3ULUL 3AXLA 3BP5A 1B2WH 1P7QA 1MFCH 5HI4C 3TYFA 1J1OH 1TJIH 4Q7DA 1G7JB 2EYTA 2IH3B 2ITCA 4EOWH 4PGJA 5KN5B 2H32B 1CQKA 4ZTOH 4IRSA 2BSSA 2XKUA 3P4OB 5BO1H 3JTSB 1XFPA 4HUVA 4QRSA 4YZFF 3QXTA 4JB9L 1HSAA 4NNPL 4EXPX 1JFQL 1PFCA 1QYGH 2FR4B 3NIGF 3BKJL 4OZFH 3BMWA 1HXMB 2X1OA 1OP5K 3C2SA 4F7TB 1MQKH 2M1KA 4WY7L 1DCLA 4KJPC 4AY0A 4KROB 5GIRA 4JLRB 3OKOB 3PHOA 4B0MM 5CUSL 4WUKH 4DGYL 2W9EL 5D7SH 4WV1B 4N9GA 4CU8A 3K4AA 5E70A 1LO0L 5BZWA 4X80L 2H3NB 3IXAA 4UOJA 3SO3C 2QJDA 4PREA 1U8IA 5TE7L 1MHEA 4KGJA 1AGBB 2KPNA 2Y07H 1QLFB 1ZVHA 3M8OH 2WUCH 4HX1A 4MQ7B 1KBGL 1WVZA 3KPOB 5HHOB 5E7FA 4N8VB 3NZ8A 1OAKH 3HZYA 1SJXA 4OIIL 3O2DA 1AGCB 2VXTL 4YIQA 4LDEB 1BD2D 2Q76B 1BJ1H 4FN0A 2EC9U 1X5GA 1UZ6F 4K94L 5T5NG 5CZXC 3MRQA 4LSSL 4TNVF 5F7LB 3LS4H 4HJJH 4KQ4L 4JFDE 1OGAE 5K9KA 5HGHA 4AM0A 1A0QH 5F6HJ 4R9HA 4CVZB 3BP6A 3DSFL 3FOLB 1FAKT 1INDL 3KNBB 5D2NB 5IUSA 5D7KE 1MPAH 3BGAA 2CLVA 5ISZD 4PRHD 3ZYJA 3AREB 4JQVA 4G8GA 2EDFA 4JVPA 4O9HH 4PRAA 3VFWB 5FGRA 5SWQA 1CZ8H 1DE4B 4XGZB 1KPUA 3JV6A 4HBCH 1GHFL 1T2QL 3BH8A 2QR0B 3W81A 1B90A 4Z5RB 3OJMB 3MOQA 1BFOA 3REVA 5C0BB 4OF0A 3KPQA 1VEOA 4OIBA 3NCEB 2VNCA 1RQ5A 3IXTB 3PG2A 5EU3B 3VGGA 2HP4A 5JIKA 4S2SB 1X5LA 3BWAB 3WO3B 4KKCD 2VR9A 3N85L 3QG7H 3NH7L 3MLSL 3QEHB 3GHBH 3UJTL 1XR9B 4IDLA 4Y2DD 1J0KA 3QXAA 5GZNC 4L8CB 1B0WA 4LEXH 4XAKD 4U4BA 4NWUH 3FQUB 2R4SL 3I6LE 5FO7A 4I2XA 4G80A 4YHOL 2HTLD 1TMCB 4AENA 3MRJA 2BNRD 3W5MA 3VXNA 2VR4A 3JWOL 4D8PA 5AYQA 3CLEL 2J8OA 3L5IA 3S35X 1W0WA 3C6SA 2K3TA 5GJSL 4NO5A 4OGYL 3GSNA 4FXKA 5T1MB 3HG1E 1JWUB 3SOBL 1GOHA 3RTQC 4HXAL 3DBXB 4JDZA 5E2UL 1KYOK 2AJVL 3U30C 1YUHA 2OZ4A 3EYOA 1CLYL 4PP1C 3V52L 4M7LL 2A6KB 1NGQL 2Q86B 4UV4L 3ET9F 3QNZA 2FIRT 3DMMD 4PG9A 1CLZL 1DBAL 4NJAH 3T8XA 2R1YA 3Q6GL 1JGDB 1FO0B 5HVWA 4PJXE 5IG7A 3UC0L 5LXGH 5IROC 4JRWA 1OAYH 1B2WL 4HKZA 1UKQA 2GT9A 1TJIL 1YMMB 4MQXD 1BD2A 4TSAH 1RK1A 3FQWB 4JFDB 1OGAB 3KPSD 4ZTOL 4GQPH 4R7NB 4MJ5B 3QT2A 5J13B 5GRJH 1EZVY 1BIIA 3LMJH 4Z77B 4DWHA 3S6CA 3DJ9A 1QYGL 3L7FB 3WFCL 2Y25A 1DQTA 1MQKL 4XP1H 2ZNWA 3UYRH 4UIMA 1J0IA 1Q38A 1KJVA 2WIMA 4JDVB 1KG0B 4FFYL 1C5DA 5I6XC 1YQVH 3FT3A 5D7SL 5ISZA 4PRHA 3E0GA 5SWSE 3T77A 2MOVA 3JTTB 5K9QG 3WDHA 4DFHA 2F53B 4PLNC 4PRBB 3ULUC 4N1EA 4ZO7A 5HHMD 3A6CH 4F37K 4U1GB 1AXTH 2OL3B 4HJ0C 4LOUD 1BEYH 5DJCA 3QDGB 2X42A 3DECA 3G04A 5EO1B 2VOTA 1ZEAH 1CYGA 3CXHK 3ULSB 3PL6B 4RFEA 3M8OL 4JY6B 1DDHA 2R0WH 1QPPA 4XWGL 5D4QA 2R2EA 3PWJA 5DXWA 2DF3A 3ROOB 4ZOCA 5C0AE 4PJIA 3KPPA 3IDXH 1S3KH 2D0HA 3GSRA 4UT9H 4GAFB 4MLSA 3WUWB 3LS4L 1HXYA 1LQSR 3O0RL 3KGRA 4MCYB 3BDBA 1A0QL 4FZEL 5IP4A 1N64H 1NCDH 3WXVL 1I1FA 4Y2DA 1G7QB 3RWHB 1NDMB 1OARH 5IFHL 2IAMC 3IVKA 4QNPE 1MFAH 3QULB 4P2RE 4KY1L 1CIUA 1GGIH 2Q8BL 1MPAL 4HHAA 3BT2H 1MAML 1NAMH 1TLKA 3GMPA 5FYLH 1D5ZA 1N2RA 3KPMA 4DAGL 1CGXA 4HUXA 2PR4L 3BPCB 1CZ8L 2BNRA 2H6PB 3DROA 4PJDE 4KK9C 4UQ2A 4HBCL 4Z7WE 5AWNH 5IB1A 3ME0A 3PE9A 1Y18A 5CJXC 2XQYK 4MCZB 1AIFB 5IWLA 3O3AA 4MNQE 5FK9B 3U36A 3DI2B 4FQCH 5FYJU 1TTGA 1UFUA 4XWOD 4K94C 3SGEI 1GGBH 3PABA 1S9YB 2LE9A 1OTTC 3QCVL 1AD9B 3TT3H 1JZ7A 1PJ9A 4WENB 4U05A 1QSZA 2UUDH 1QVOA 3DMMA 1EK3A 2BVPA 1BF8A 3ARVA 3RWJB 3QG7L 2NXZD 2VDRH 5FDYA 3GHBL 1AJ7H 4G8EB 3V0AC 5AEAA 2BY3A 4LEXL 3RDTD 1OP5H 5GGTA 3OHXB 4YEFA 4NWUL 1AGFB 4L9DA 3BQUB 1SJHB 4BZ1H 1FVDA 1UCTA 2DQJH 5GGRB 4OKDA 3KPSA 1J9CT 1P7KA 2F15A 1F02I 3VXSD 1EVUA 4JFEE 5HI3C 1AR1D 4JM2B 3RAJH 5E94A 2OCFD 2VN7A 5DDHB 2P48B 3CFJB 2VN4A 1ZOXA 4R2GC 5C8JB 1RHHB 1X4ZA 1S7RA 2R15A 5SWSB 4OM0L 5A2LH 1CG9A 1UXWB 5T3ZD 4KZEH 4PIRF 3FFCD 1YNLL 4EQ2A 4D94A 4X99A 3T65B 5JIIA 5DJ8B 1NGYB 3RVVC 3L7EB 1I7TA 3U0PB 4G9FE 4EUPB 2J88H 4R4FH 5HJ3B 3I2CH 4GG6E 2PXYA 4I0PD 4X4MA 3RVWC 4JPIB 1B0GA 4NJAL 3CDYA 3HAEB 3HE6B 2BJMH 2EKJA 4KKBD 1WWBX 4B7IA 1YEGH 2BY2A 1T20B 1I8LC 3JWOC 4UDTB 3BPOB 3ARGD 4QHUB 1TJHL 2P7TB 3S9DB 1MF2H 2PO6D 1Q8MA 2IADA 3VA2C 3GSUB 1AE6H 5GRJL 2YSSB 3GMRB 1BQLH 3LMJL 2X05A 4Z0BH 4LSUL 5CGYC 3G6JE 2XZAH 4P2RB 2CUMA 3MBXL 2WUBH 1WCBB 2ZCHL 4XP1L 1TZGH 4XMKL 5EUOA 4JKWA 1VFAB 4X6BA 4J3VA 4XCNA 3NCCB 2YRPA 3VWJD 4PJDB 2AJZB 4OF3A 3R8QA 3MGOB 3CZJA 1MI5E 2HTKC 2SEBB 4Z7WB 2V7HA 2VDOL 4G9DB 3T4YA 3TA3C 3CPLA 1WLHA 3TESA 5MEQA 4F3FA 1AXTL 4MNQB 3T04D 2A6JB 1E6OL 1MCPL 2ARWA 1IL1B 3STZB 2IANE 4OCMC 3ZHKA 1IC4L 1ZEAL 1AC6A 5TDNA 5FGBA 1U2CA 2E27H 2WM0A 2R0WL 5GXBB 1IEHA 2COQA 4NOFA 5I2IA 1R3JA 4IJ3B 1INEH 5A3IC 4N8CH 4YK4B 1J86A 3CFEA 3TO4D 3IDXL 1S3KL 3P40A 3ZYOA 3RWEB 4UT9L 4ZS6C 4LKCB 4ZG1A 2C1OA 5CLTA 5D6DA 4PJBA 4R96B 1NCDL 4W70A 4LRIA 5L9DL 1CDGA 4TUKH 4GW5A 3SY0B 3RDTA 4BFBD 1T5XA 1OARL 2BC4A 4UU9A 5DI8B 4ACPA 1QRNE 5JW5A 1MFAL 1Q1JL 3TH3T 3VU2A 2V7NB 4M1DL 1U0QA 2EYRB 5GISH 2QQKL 4JFEB 2WWMD 3CMOL 2GI7A 2OSLA 1RY7B 3RL2A 5EU6E 1VPOH 3UZVB 1PYWA 2RBLA 2E5EA 4U3CA 1TJGL 2AKRA 3PWLB 2XWTB 5AWNL 3TVMD 3DX9A 1HI6A 1MCSA 1JYNA 3T0ED 5KSAB 1KB5A 4AIXA 3DUSB 4FQCL 5FYKD 5KANI 2QEJA 3K74B 2GUOB 5TDOB 3FFCA 1VESA 1GGBL 2GW5A 1C08A 2DYPD 2Y23A 4X8JB 2P24B 2VDPH 2X7LB 1M6OA 1JHLH 4GG6B 5CBEB 5I17A 1A02N 4I0PA 3IDIA 4ETQA 4NBYB 2BHYA 1VDGA 2EZ0D 1YDPB 2XN9D 3BZDA 1AJ7L 3IU3A 4NNYA 2NY4C 4KV5F 5IMLB 3VFTB 5AD0B 1RJZA 4JM2F 4MAUH 1FP5A 2XY2A 2R69H 1MLBA 4POZC 1H15B 1T7WA 1CDHA 4BZ1L 3ARGA 2GY5A 2PO6A 5FM4A 1CDUA 3E6HA 5DUPH 5IEHA 3BXNB 2PW1A 3SDXB 4FQ1H 1FIGH 2F8XC 5GGSY 4YBQC 2AGJL 3LQZA 2VZSA 3F7VB 1J88A 2HVJB 5BW7C 4HS8L 3S4SB 1GZPA 3RZWA 3BKYH 3GI9H 2ZUYA 1HOCB 5KTEL 2GSIA 1OTUC 3MREB 3FO1B 5IB4A 2E7LA 3M07A 4X7DC 2WLZA 3NPSB 3U7WH 3BW9A 4KZEL 5C0CD 1F4YH 1A9EB 3VWJA 2YBRA 4HWNA 1KCSH 1RUQL 5I75C 1GVIA 3DVGA 3P2TA 5EOQH 3JBG7 1EHXA 1F3DJ 2PCPB 4JO1H 2ZCKH 4WI6A 4JE4B 2J88L 4R4FL 4AEIH 3VJ6A 3MRPB 3OKLA 5KSVA 2ZUVA 4Q9BA 2FLBT 3SHSA 3O3EB 2D0GA 4D9QE 3CDGB 3W9DB 3QNXB 2BJML 1TPXB 1NCBH 3QQ9C 4Y16B 1LK3H 4D0DA 1CFQB 1YEGL 4JRYE 5I15H 1HKFA 5IBLC 1MELA 5IVXE 3RNQB 3LEXA 1LK2A 4XPAH 3IDNA 2E9WA 2VMFA 2IGFL 4XPBH 3TO4A 4FFVC 5ITFB 1N3NB 3O4LE 4X9FA 4KKNA 4IMLB 4PJDF 1DL7H 1QRNB 2XZAL 5EWIH 3MXWL 3TNMA 1K3IA 2WUBL 1A8JH 3QHZH 4ZFFB 4GSDH 2YPLD 2LV4A 4JJ5B 5D2LA 1FYTE 4NDMB 5EU6B 4M48L 3G5ZA 2P44B 4IOSD 2VZTA 2WLYA 4WEUD 1EFXB 4U33A 4LNVA 1A6ZA 4HEME 4YXHL 3O8XD 4PG2C 2GFBB 2JB6B 3TVMA 3T0EA 5EPMB 3GJFB 4FQHA 3GGWA 2X4QB 3KYMA 4IMKA 1H3GA 3N9GH 3GUTB 1A7OH 3VFNA 2FGZA 5IBUB 2B4CH 2CR6A 3KVQA 3KJ4B 4OGAC 5C0JA 1XZ0A 2DYPA 4P3WA 5TE4L 4BJLA 1MRFH 2BX5A 5I8KL 4N8CL 1DP0A 4S1SH 3E6FA 1AH1A 2J8UE 1M1SA 1XIWB 2B2XL 4FQIH 4WW1B 4EVNA 3VW3H 1RJCA 4NN5C 4PRPB 2H1PH 1KUMA 3OR6B 5J89A 3LOWA 1NUFA 2XN9A 32C2B 4FQQA 4TUKL 3MSPA 1TZIB 4HCRH 4H20H 1YN6A 5B8CC 1KCRL 1U8QB 3LS5L 3MUGA 3D18A 4WI8A 3C8KB 4YPGB 3NFPB 1I8KA 4U1SB 3T1WA 3FO2B 1N0LA 1DVFC 3LIZH 5HSFA 2JJSC 3FHAA 1TQCB 3QEUB 4F9LC 4GG6F 1WITA 2BSTA 1EPFA 3JWDH 3FN3A 3BZEA 3MGTA 5CCKH 5C0CA 1I3UA 2J2ZA 3AU1A 1ETZA 4JO4L 3SCMC 2VDPL 1MRCH 1G7HB 4XVSL 4TQEH 3QQNA 4K2UL 2ZZUT 4Q9QH 3U9PL 5IV2A 1QOKA 1A1NB 3IFNH 5BCAA 3P9MB 3HPJA 1ZGLB 5J9PA 4JRYB 4DGVH 4NQXA 2I9TA 3SDXF 1JPFA 3ZT7A 5DTFA 5IVXB 2DJSA 4E0RB 1KT2A 5GGUB 3MRIA 3E3QC 1SYSA 4MAUL 1Q0YH 2IQAB 5T3XD 2R69L 3GSQB 1T4KA 2KBGA 3MCG1 4RA3A 5C0EA 1QQDA 3BN9C 4PBVC 1FNGA 3ILQD 4Z7OE 3O4LB 1WWWX 3RP1A 2D7QA 3RZCC 5GS0H 3U7YH 4M8QB 3IU4H 4FQ1L 1FIGL 2MNUA 5DYOA 4EXKA 2UVEA 1V7MH 1EMTH 4ELME 2EDXA 3N50A 5DWUL 4A6YH 3U4EA 2DMCA 4KROD 1OB1A 5L7XH 3BKYL 1FYTB 3GI9L 3GM0A 3UTQB 4JFPA 1Q9LA 4NO3B 4NQEB 3S7GA 4OZHE 1U3ZA 4Z78A 3NBNA 3QPQD 3QQ3A 4IIQB 3MRMB 4YHYC 3U7WL 1HEZA 3TPKA 4FQLH 3BPLC 4M9PA 4JZJB 2P47B 5DRXB 2Z91B 3HNSH 5EOQL 3BEVA 1CDIA 2XXMB 2VR5A 5FKPA 2ZCKL 1ZK9A 4ZPTA 3O8XA 5I1EH 4IRJC 2VWEE 1AR2A 3OAUL 5C2UB 3RNKA 1LEGA 5CEZE 2HFGH 1MVUA 2O5XH 1NCBL 1S7QB 1LK3L 2P42B 4I3SH 5I15L 3QIUB 2H26A 3DX6A 3FB8A 4LLAA 2J8UB 4BFGA 4P2YA 1QBAA 3UPRA 4UZGA 4XPAL 1WIOA 1JZ8A 1UZ8B 5EIVA 3TP4A 5F7YC 4MVBC 4F7EB 3G08A 4BUGA 4UINH 4C56B 5HY9A 4OF6A 5KANG 4HWEH 1K4CA 3ULVH 2E8YA 5I19H 3TBWB 1IAIM 1DL7L 3P9LB 4JCLA 4LSRL 4X9IA 1Z2KA 4M7ZC 3DX8B 5C07E 4JFHD 5F7EH 3DRTB 1CLOL 4F7MB 1PEZA 1RZJL 1H3XA 1UJ3B 4GSDL 4WO4C 5CMAA 3SDDC 3J7HA 4CMHB 3WN5A 1JWSB 3KWWA 4I18B 4CVXA 5JW3L 2FH6A 3M17B 1U92B 3BRGC 3EGSA 4LPVA 1DEEA 1DUZB 2VIRA 5EB9A 5IM7B 3CDCA 1ONQB 5HVHC 1BFSA 3KYAA 5C0BD 4XZUA 5D1QD 4NM8L 1A4KB 5EIIB 1T7VA 4P2OA 5D93B 4TULL 3N9GL 2B8OT 3D85D 4FQ2L 4P5KB 3TPUA 2BVTA 4PR5B 1A7OL 2YRLA 1QSFA 2AV7B 4PJ9B 5EA0H 5E08H 2WBJD 4FG6D 3ZTNH 1FZKB 1G7LA 1M7DA 4U1NB 1T22A 4LF3B 4S1SL 4L1DA 3PHSA 5EU7E 4NRYB 1JV5A 2DRUA 1F8TH 1IM3B 2NY5H 2V2WA 4NKIL 4NO0B 4PTTA 4ENED 1G6RB 1FFNA 3QO1B 3VW3L 4HS6B 4XHJD 4ODHH 2WP3O 4Q2ZB 3SDCC 3HRZA 2VXUH 4JZNA 2IH3A 3KHQA 1CIDA 2BERA 2VLKB 4KKAD 1JMXA 1E4JA 3CU7A 3VI3E 5MENE 4M1CD 1EAPA 1ZHBA 3P4OA 5JHLH 4HIEB 3MJ8B 5DK2B 1I75A 3C2AH 1IM9D 3M45A 5CWSA 4JFFB 5ERWA 4ELMB 1S5IH 1ZT7B 4YAQB 4MS8C 1G7MB 2HMIC 4ODVL 3KXFE 3L3IB 3VD5A 1CICB 4HK3N 4N90D 2QQQA 2P43B 4F2MA 5SX4I 1EZVX 4MJID 4OZHB 4I48B 3MUHL 5JMRA 1U8NB 2C26A 2CXKA 4HH8A 3T1FB 3QUMA 4WV1A 3DV4B 4LHUB 4AEEA 4OI8A 5CCKL 15C8H 2EH7H 1NANH 5BVPL 5ESAB 3NCJH 4YQXL 1MRCL 3U4BL 4HFWB 1QFWI 2XKSA 3D25B 5H35B 4PB0H 5GGSB 5I1JH 3F12A 2GSGA 2WINB 1B0RB 4TUOA 5AUMB 3SE8H 1YMMD 4GBXB 2Q76A 1GOGA 2NY1B 1WTLA 3J8F7 3I75A 2BSRA 1WZ1L 3D9AH 4OJFH 5EOTB 5TH2A 4LLDB 1H8SA 4NBXB 2EIZA 4LP5A 3WNOA 5GS0L 4XBGA 2AXGB 2Z8VC 3X17A 1OPGH 5J06A 3V6FA 5C07B 1EMTL 1OOAA 4BSWB 4A6YL 3H8NA 4LCCC 4OCWH 1LE5A 1ZTXH 1VCAA 2VDNH 2CIKA 1OWRM 4ONFH 4R4BB 1I8IA 1JZ2A 1MFBH 1IKNA 3MLZH 1FZJA 3VFMA 1VFUA 2FHFA 4BK4A 3VFWA 2F53D 2DJ4A 5HGBB 2APTA 3TNNB 1L4IA 2JCCE 3KYKH 4PTUB 3HNSL 4EN3C 4CL7A 3QDGD 1UWEH 1FZOB 5L6YH 3RX8A 5T1KB 3S96A 5C0BA 3S5LB 3MLVH 5D1QA 5IBTH 5I1EL 5ENWB 5HHQA 4P4KD 2HFGL 5IK3A 5LWYH 4UUJB 3D85A 2W92A 2CIIA 1AXIB 4I3SL 2WBJA 3V6OC 1MCLA 3BWAA 1CLCA 1MSPA 4OZFB 5ABDE 1OSPH 3T3ME 2DICA 3QEHA 5I16B 5I8OH 4J3XA 4U6HB 1TTUA 4YWGH 4UINL 4Y4HB 2VL4A 1Q9WB 4HWEL 3RJDA 3ULVL 1AI1H 5C9JA 5MENB 4LQFH 5INCA 5F7EL 1C7SA 5JOPD 2VJXA 1V3MA 4ODSH 1XCTB 1QACA 3TCLB 1M71B 4EI5D 2R29L 5E9DA 3MRNA 5A43C 5MP6H 3LV3A 1HQ4A 1IM9A 3KXFB 3NMEA 5FUCE 1Q72L 4ZUUA 2Q7YA 2NYYC 4JGJA 5GSRA 1BX2B 3X11B 5E8NB 4P23B 3VXUA 1NMBL 4P9MH 3SE9H 3DBXA 1KF9B 4MJIA 2X4OB 3OXSA 1MCWM 2KH2B 3SJVE 4O02L 1R0AH 1IGTA 1QHPA 2ZKHL 1IMHC 2DIJA 4U1MA 3UBXB 4JFOB 2DKUA 4WDIA 1NBZB 5FAAA 5E08L 2VZOA 3MRDB 3ZTNL 1OW0A 2XZZA 1K8DA 3QDMB 1ZHKA 3F58H 1F8TL 2P1YA 1VSCA 1GZQB 4ELMF 3O2VH 5DMGD 1BVZA 1FC2D 1YMMA 1J8HE 3ZKND 4BQ6A 4B50A 2H8PB 4CN1A 4KRNA 3OJDB 2R0LH 4JPVH 3OL2A 3HS0A 4KK6D 4OZHF 4E42B 1RZIA 5IJVA 3C2AL 4KPHL 5DRWA 2EEAA 4DZBB 5DQDH 4LNRB 1S5IL 3RWGB 4X6EA 3L7FA 1T6VN 2DQGH 1FPTH 5E5UB 5MHSD 1A3QA 4DEPC 3D69A 4P3DB 2MFNA 4PLJC 3A67L 2B4CC 4HZLA 1REIA 4Y19D 3PGDA 4D2NA 4DVRH 2GJ6E 3PDDA 4XC3L 3JTTA 1YEHH 2I07A 4IOFC 3QFJB 1T6WA 2JCCB 2F53A 3P0VH 5DUMH 4QRTA 4ODTL 3AROA 15C8L 3K2UL 5L2KD 2EH7L 1JRHH 4HUNB 4YHPB 3NCJL 2EXWC 3TIEA 2OMNA 4QCIB 1FJ1B 4TUJA 4XCYA 3ULSA 3P4NB 4DVBA 1SJEA 4O2EA 5IQ7H 3LAFA 3UTPD 4JY6A 4PB0L 4XXCC 4WFGD 1D5BA 3FTGB 5I1JL 1L7IH 2FHBA 1FL3A 4JRXD 4P4KA 1KENH 1U3HB 2DQFB 3SE8L 3W2DH 1FIEA 3CH1B 5C6TH 4DTGL 5KAQG 4O2CA 3PP4L 4OJFL 3LEYH 5BS0E 3QIBB 1NEZB 5KJRH 5CP7A 3MRGB 3TBVA 4RAUB 5HXMA 2BCKA 5DQ9A 4FQXA 3LD8B 4PPTA 5GRYA 1KJ2A 1WIPA 4UBDD 5E8DL 1WC7B 1P4BH 2D2OA 2XTJE 3CFDB 3ZMRA 4ELKB 4LIQH 2GAZB 2KQMA 4ZO6A 5FFLA 3QULA 4KJQD 1HHIB 3TYGH 3OMZA 2VDNL 5TFSH 4ONFL 1I3RB 4YH6A 1MFBL 4X6DF 4ZUSB 3V6BR 5EC2A 4EI5A 1RIVH 4W4OA 5B39B 3HMXA 4WI3A 1S7TA 4LLQB 4H26B 3U83A 1T89C 5E4EC 1UWEL 1AIFA 1L7TH 3SJVB 5L6YL 2J5LB 3MLVL 5CILH 5IBTL 5ICXB 1WAAE 4U2ZA 4YBLC 1S78D 5CEZL 4K71B 1AO7E 2QSCH 1U36A 4WCYL 5GS0C 1AD9A 4M6AA 4LVHB 1ZVSA 2ICWB 4QRQB 2V2TB 1MCOH 4HC1H 5IMKB 1J1XH 1LDSA 4X7CC 2H2SD 3VXTB 4Y5XB 1BVKB 5I8OL 4YWGL 1L9MA 5DLMH 1J8HB 1TNMA 3LZFH 1CDJA 1JK8A 4JJHA 2I27N 1SJHA 1IQDA 4LQFL 4P46C 4M5YH 4ODSL 1HNFA 5AZEH 4JFED 5HYSB 4DKDC 4QT5A 5BRZE 5MP6L 4H25B 4R26L 3I6GB 3NCMA 1UJTA 2Y5TA 3VGAB 4YDJB 3W9EB 4DZ8A 3NIFF 3WSQL 1T0PB 3MV9E 4MD5B 3FMGL 5L88L 4DKAA 2V9QA 4PJCE 2GJ6B 1DTUA 1BPVA 4I3GA 2W0LA 4I1NB 3SE9L 5FDWB 4G7VH 4Y19A 1OAXH 4F33B 1R0AL 4H5SB 4N0FB 3AM8C 2WANA 5FKAB 2IH1A 5L2KA 3QWRD 3U1SL 3MRLA 3SKMB 1BMGA 3H3PH 2O5ZL 5EC1A 4QTHB 5DHVH 3ULVC 5DFVC 2W65B 4JAMB 5JHDE 3G5XB 1IGFH 3RWCB 5HI4D 1CL7H 3VRLF 3FQRA 1NAMB 4LSPH 4JRXA 2A73B 4HIXL 5L0QB 4XCCH 4UDTA 1I9RL 5CFHA 4JY5H 5BS0B 3HFMH 3WNNA 1BJ8A 3MA9H 3DGGA 2R0LL 4JPVL 4HIJB 3GMOB 3GMRA 1CBVH 2VAAB 2H9GB 2XTJB 2RCSL 2YZ8A 4R3SB 4OUOA 3SGDH 2JCCF 8CGTA 1FPTL 4KJPD 5IBUG 5LAXB 5CZVH 1H3PH 4BKLB 3DX7B 1VFAA 3WE6A 1U8PB 1I85A 4F7CA 4JHBA 1LO2L 5F1OB 1HYSC 4L9LA 3ZO0A 4BSVA 2R2CA 1YEHL 4JR9L 3MGOA 5GZOC 2SEBA 3P0VL 4QHMA 5DUML 1R5WA 4G9DA 4LLMA 1VFOA 5GS3A 5EN2A 2CMRH 3MNVA 2Y1VA 2NCMA 5HI5C 1JRHL 1EHNA 2VQ1B 4E5XA 3D3VE 4LBEB 2E6QA 1S5HB 4WHYH 1JF5A 4M1GH 1SY6A 2DDQL 3CZFB 5IQ7L 3ESVF 4WU5B 4XRCB 3B9EA 3RPIB 2VL5B 1Z9MA 2DQEH 4PD4K 4Y16D 2A74B 4DUVA 1L7IL 3MX0A 4TSCH 2OR9H 5DD3H 1KENL 3OKNB 3FQNA 4M4RA 5CZXD 2CH8A 4HWBH 4GT7A 3EFFB 4LKCA 4PJHA 3R1GH 4L1HA 4RQQA 4UDUB 5LGHH 4R8WL 4ALAH 2GTZA 4ZUTB 1R5VB 4R96A 2ATKA 1FN4A 3OTTA 3DETC 1WQVT 4YFDB 3SY0A 1P4BL 4LIQL 3IDUA 2G5BB 1XH3B 3TYGL 1IGYA 4LHJB 2YD9A 5TFSL 4HD9A 1IFHL 2Z93A 3ZTJH 3LKSA 5EG6C 4BFIB 3B8SA 1EFXD 3VI4E 1U58B 1S7SB 1KGCD 4RGNE 2QQNL 3MV9B 3HE7B 3WFDL 4PJCB 2P8PB 4UQ3B 2XWTA 3ZKXB 3SQOL 1S7WA 3OG4B 1L7TL 4Q6IC 4N5UA 2OR8A 3BP4B 1CDCA 1FE8H 3DUSA 1TVHB 1E28B 3Q5YA 2CLRA 1KIQB 3P0GB 3VDCA 4NQVB 5GHWH 5TDOA 1N26A 5ACZB 2P24A 4TRPL 2FJHB 5FHAL 3PDOB 2QSCL 1RJYB 4PRNA 1P4LB 5TE6H 4Q9RH 3L6FB 3DYOA 3QWRA 3V4VH 3QUXA 1L0XA 1MCOL 4HC1L 1TVDA 5DSCA 4ZDHB 2AJSH 4HWZA 2J8HA 4PRPD 4MMZC 5GZND 2X2YA 4BFEA 1K8IB 2WIIA 4I3RH 3HCVB 5DS8B 3QEQE 5AYUL 5HHVH 5KS9E 5DLML 3LZFL 5F88B 3ARDB 4G7YH 2VITB 1YEFH 3WL9A 2EO9A 4KRPC 4PYHA 4NRZA 4ZNEE 1E0OB 1NCAH 4D9RE 4M5YL 4MDJB 3QWOA 2R56H 5AZEL 4PRDB 2A1WH 3BXNA 1F4AA 3SDXA 1I9JH 2F19H 3KLHC 3TJEH 1P2CB 1T0MA 3K8KA 3F7VA 2VWEC 2ARJB 3TIDA 3LPWA 3VFRB 3BVNA 4LCWB 3RTQD 2AJ3A 1OF2B 3DWTA 3OAZK 4PRIE 2LQRA 2UV3A 2PNDA 2F54E 3FO1A 3MREA 2APBA 5J6HB 1WISA 1MHCA 4YGVA 1QR1B 4QWWD 5ANMA 4G7VL 4PP1D 5LGJA 2BMKB 1OAXL 1IAIH 1ERNA 2P5EE 2JJTC 3BZFA 3L3OB 3MC0A 1NH6A 3JXAA 5KOVC 1FNSH 1JGLH 4X4XB 5F9OH 1C12A 3JV4B 2GCYB 1FSKC 3H3PL 5FB8A 2CDFB 4LARH 5HYQA 2MKLC 5CJQH 4QHLB 5JORA 2QL1A 3GHEH 3D87B 1IGFL 2UZXB 3WS3B 3QFDA 4FNLL 4Y16A 3L5HA 2WV3A 4LSPL 3GSWB 1YPZE 2ZJSL 1DBBH 3IFPB 4U0QB 1D6EB 3JSSA 4QXUL 3HFML 1KTDA 2R2BB 5ITFA 1OL0A 4XVJH 3MA9L 4K7FB 1T03H 4U3XA 1W72L 2FYYA 1N3NA 4OD2B 4L3ED 1MUJA 4ONOA 3B43A 3EOAA 2FLRT 3ABZA 3AAZA 3OB8A 1OP3K 1FYTD 3BAEL 4OZIE 4OKVA 1H3PL 2APWA 4NQED 1O5DT 1CT8A 4WGVB 1WAAF 4KUZL 2WAHA 43C9A 4X98A 5E95B 1BQSA 1YJDH 3HR5B 4HJ0D 4CGTA 1YEDB 4MDIA 2CMRL 4GQ9L 5F9DC 4BM7A 1A1OA 1ZWIA 3TLRA 2NXYC 1PVHA 4KAQH 2R0ZL 2AEQH 2J3SA 3NABH 1T1XA 2X4QA 3S36X 1BJ1J 4GRMA 4NC1E 3O3DA 2A6DA 4MZ2A 3GUTA 3MROB 2AQ3A 2DQEL 1CE6B 4R7DA 3BKCH 3LEVL 4RWYH 2OR9L 1I7UA 3QIUD 4GS7C 3WDIA 2XTLA 1U8JB 2R4RH 1JI1A 5D7JC 1LGVA 2NNAA 4HWBL 1NDGB 3IKCA 3QRGH 5LGHL 5E24E 4C56D 3QEQB 4ALAL 4PRPA 5KS9B 2IBBA 4TVPD 4NFCA 4A2LA 4L8SB 2IAMD 2N4IA 4BH7A 4URTB 5DO2D 3B2UC 1GGUA 4LK4A 5BVJA 2Q3AA 2GHWB 4PJCF 5I1KH 3BIAX 5I71B 4PJ7F 4ZFOB 5F97E 2EC9T 1U95B 4H1LG 2XZQH 2ATPA 2BNQE 4U1HB 4KK9D 2I26N 3HKFA 1NLDL 5DF0A 5TDPB 2H41A 3C8KA 4YPGA 5IW1B 2GIYA 3NFPA 1JTTA 4PRIB 3R06A 2VO5A 3WIFA 1Q94A 5IF0A 3RTQA 2WNGA 3EJYD 4G5ZH 4YHZL 3VE0A 2C3GA 2ARJQ 4ETYA 2P5EB 4LPWA 5IFJB 1DN0B 4PJ9D 1MJJB 1OTTD 1NPUA 4TPRL 1OCWH 5E99L 4LCIL 5LGKA 1PW3A 3IGAB 2ZUQB 5GGQH 4LSQH 4Q9RL 3V4VL 4J8RB 2AJSL 5IROA 4Q58C 1T0NA 4S0SD 5KSBE 2P5WB 4Q97A 1A3LH 5HHVL 3MRFB 1AGEA 4MXWL 2VDKH 2VLKD 3QIWB 4RFOL 4UT6L 4QXTA 5GGUA 4R97C 1F4XH 1UWXK 3IJHA 2IQAA 3HZVA 4HAGA 4JFFD 2R56L 5E6IC 1U6AH 2DQIL 3MV7E 4I4WB 5HI3D 4MD0B 2F19L 1UADC 4YC2C 3GO1H 4NO2B 3TJEL 5C08D 4OZIB 4L3EA 3BIBX 1PLGL 4R2GD 4XBPB 5F89B 4DEPB 2HN7A 4M9OA 5ITBH 4LLVA 2IMMA 5IOPB 1SYVA 4NQEA 3EYVB 4OZFG 3U6RA 5EBWB 4JKPL 4JM4H 1OT1A 5T1LB 2V5YA 2GJZB 3UCRA 1GC1H 3ALPA 5BV7H 1INQB 3GI8H 1JWMA 1IAIL 4WTXA 4NZDA 2YN3A 3RVVD 4CKVX 3QDJB 2VLRA 4YDLC 4C4KO 5F9OL 3RVWD 3V6ZA 1BBDH 4OBSA 5I1IL 1PSKH 4LARL 5I1LA 5CJQL 5E2WH 1MCJA 3GHEL 5IHUH 4XVTL 1S9XB 4WWKB 4GBXD 3AFLA 2X70B 2W9DH 1K2DA 3SEPA 5F1NB 3UP1A 1AKJD 2QKIA 3QIUA 3MOBH 1DBBL 1X5YA 2OJEB 1R5IB 4WWID 3C08H 3L95A 2JK5A 1F45A 2UY7A 4NT6B 1IZJA 3MFFA 3U79A 1X44A 3OKEA 1T03L 2IG2H 1YY9C 2FX7H 3CC5A 4CADB 5C07D 1FRGH 1BF2A 3SKOA 2FBOJ 4HKJA 3P9LA 1RIHL 5IB2A 3HC0B 2IAMA 1T21B 2DWEB 3CMGA 3DX8A 4PGEB 3QUZB 5F21B 4F7MA 3BPNC 3MOAL 1T83C 1JWSA 1HHJB 4I18A 2BNQB 4MJ4A 2ZSWB 4PJFA 4Y5YC 5I9QB 1EEYA 2HTKD 1JPGB 5LQBH 4DN4H 2I60H 1U92A 2DKMA 3TA3D 4ZPVA 2DAVA 1FFRA 5I76B 3RWIA 1DUZA 5HYEA 1YJDL 2EIEA 2M8XA 3KPRD 3VMOA 3D5OF 3HZMB 1PX4A 2L4OA 1N59B 5CJXA 2X4PB 5T1KD 3C5ZC 3UJJL 3ARZA 2EKSB 3QCTH 1A4KA 4HGWA 2WQ8A 4RDQG 4WI2A 5A2FA 2AEQL 3NABL 3ARBB 5TQ0H 4NQCE 2OYPA 1D5IL 4KQ3L 2LAGB 5KS9F 1XGPB 2I24N 3ZSSA 2HFEB 4PJ9A 3U82B 5A3ID 3CVHH 3BKCL 5C0DA 1D9KC 4RWYL 2R1XB 4D0BA 5JIPA 1U8LB 4OZGF 4LGSB 5F9AC 4ZS6D 1QA9A 4LF3A 4N0UA 3LKPA 2HG5B 3QRGL 2RGSA 2Q1EA 5KSBB 4JFZL 1G6RA 5CHNA 5CEYA 4OLXL 5D7LB 3WDJA 5DUBA 1ES0B 3FT2B 3KPLA 4Y4HD 3S88H 1UH4A 2G60H 3STLB 2G2RA 3TFKC 3GMMB 4OLWL 2J6EL 1GH7A 1RJLB 2VLKA 1N7ML 1PKQA 4MA3B 4G6KH 5MERB 3D0LA 4TTDD 3MJ7B 2DQUH 2HAZA 4MXQC 2GITB 4IHOB 4JFFA 3PWVB 3GJEA 2X4UB 5CSZA 5GJTH 3HMWL 3VRIB 3ZL4H 4P23D 5C08A 2AP2A 4NUJA 5CD5C 3AXLB 3NCBB 1XGRA 5H2BB 1P7QB 4LDLB 4DN3H 1KELH 3TYFB 3GIZH 4ZNCD 1B6UA 4JN2A 2EYTB 1FL6B 2ITCB 1RULH 3RIFF 1F4HA 4IRSB 2BSSB 5ESAA 4I2XE 3WIHH 4QRSB 1OCWL 3QDMD 1HSAB 1O0VA 3N06B 5C86A 4U6TA 4H1LA 4LSQL 4RMTA 1QO3B 5E1HB 4LPUA 5GGSA 5FUZH 2NY4D 1A3LL 1PQZA 5GIRB 3PHOB 4P99A 1OP3H 1J18A 3F8UB 4POZD 1P84K 4C4KT 1AKJA 4N9GB 1ZSDB 3TGXA 2VLLA 3OZ9H 3GMNA 1LWRA 5DA0B 5DVLA 1I1AC 4NGHL 4YBQD 2IBZY 1U6AL 3IXAB 4OLUL 1EEUA 3BUYA 4X8XA 4PREB 4CAGA 2BNUA 5CJOH 4P59L 1GIGH 1MHEB 3H9HA 1C5BH 3QEGH 4Y1AD 1MVFA 4HX1B 2HYMA 1IBGL 4V2CB 1UGNA 1MHHA 5ITBL 3B2VH 1G1YA 3NZ8B 4BZ2L 1JF1A 3HZYB 3TBYA 3QFJD 4YIQB 1L6XA 4JM4L 4YLQT 2C1PA 5BV7L 5HGBA 5I0ZA 3FN9A 1CU4H 3GI8L 4KHXH 2VUOA 3TA3A 3MRQB 5BOZG 1BD2E 3T0AA 5L2JA 1MAJA 1K4DA 5K9KB 3KPRA 3BEWB 4WUUB 4AM0B 1EJOH 4X6DA 3GBNH 3NPZB 3BP6B 4LMQE 1BBDL 1MIMH 1P69B 3CXDL 4L29A 4NRXA 4NKDA 3IT8D 5IHUL 5HYSG 4G42A 1U3HD 1ITCA 3QSKB 3VFUB 5IBLD 4GRLB 2W9DL 1A2YA 2CLVB 2HT4C 4AEHH 2CKBH 5A2JH 4G8GB 4PRAB 2BVOA 3MOBL 3G6DH 1FBIH 4FFVD 3UTOA 4OZFA 2FNBA 4QTIL 3C08L 1FG2B 1QKZH 5ISZE 4PRHE 3JV6B 5I16A 3HB3D 3ARFC 3BH8B 2IG2L 3GMLA 2FX7L 4MJ2A 1FRGL 2XNAA 4Y4HA 3O45B 4MB5A 1Q9WA 3VXRA 5F7MC 1JI2A 1W0YT 1VEMA 3UEZA 3KPQB 4Y4FC 1DEDA 5K59E 5SX5K 1M7IA 2IBGA 3INUH 4XHQA 4LU5L 2PUQT 3RJQB 5LQBL 4KI5C 4DN4L 3ZKSD 1ADQH 2I60L 2VZUA 5F7WC 1JMZA 4PJIE 4AQOA 3T3PF 2RJMA 5E8NA 3F65A 5I73B 4ZSOA 5I1GL 4XNQA 3SJVD 3PGCA 3QXAB 2WK2A 4FS0A 4KTYA 4J7RA 4RA0C 4YR6A 4E41B 3MACL 5E8EA 5FO7B 5KSBF 1LE9A 4XAKE 2R39A 4I2XB 4G80B 3BMVA 4JFOA 2BSED 3CVHL 3MRDA 4AENB 3UROR 5HYIA 1E6JL 2D4FA 3K81A 3MRJB 3P77B 4N1HB 3QDMA 3VGFA 4D8PB 5I0DA 2FBJL 3VDAA 3Q6FA 1PDKA 2QSQA 5JPMA 3H6JA 3C6SB 2BNRE 1N5AA 2PW2B 4NO5B 5EOCH 3GSNB 3S88L 4YHKH 5KZCD 5CJ5A 4GRWH 4NP4H 5AG9A 2KZ1B 1KYOJ 1YN7A 1LO5A 1YUHB 2V9TA 1F4WL 1YJDC 3NCFB 5ID1A 3V7MA 4GO6B 5EBMB 3TH2T 4TNWF 2D7TH 3QNZB 4ORGA 1BHGA 2VQTA 5BW7A 5KOMC 3T8XB 5DJ0B 1DVFD 5GJTL 3ZL4L 1MFNA 5IG7B 4Y1AA 3BIKA 2DS4A 1C5CH 5JXAH 4HKZB 2GT9B 4MJ6B 4DN3L 3ULVF 3WNPA 1RUKH 3QFJA 1KN2H 1BD2B 1RK1B 4ZS7H 4RGMC 1T5WA 5HPOA 1IQWH 4YHPA 3PNWB 1CFNA 3KPSE 4RGOL 2D7PA 1BIIB 4J3OC 3P4NA 2IPTH 1Z3GH 2ZUWA 5FYLD 4UIMB 3KAAA 5MI0B 4MAYC 1F90H 4P48A 3C60C 1C5DB 4FZ8L 1EDQA 3FT3B 2UY6A 3T77B 4PRHB 4RGNC 3BN9D 1EH9A 5E5MA 3RZCD 4IEFB 5AZ2H 1YZZA 3EYFA 1JF6A 3ILPA 5D1ZC 3FONA 4XX1G 4BK5A 4PBWD 4YXKL 5HHME 3U9UA 1R3IL 3PF2A 1OT2A 3P11H 1C5BL 3CXHJ 4RFEB 1UC6A 4X4ME 2R8SH 5I1HL 3QAZC 1DDHB 3E2HB 3PWJB 3B2VL 3SO5A 1A3RH 1A7NL 3SE4C 3BX7C 1Q9KB 4LLWA 4NSKA 5EFIA 4PJIB 3KPPB 1TCRA 2PTTA 3VD3A 4TYUA 1EBPA 4H26A 3MMEA 3RHWK 3GFUA 3QUYC 3NGBB 1KTLA 1HXYB 1XF2A 2IWGA 4PG2A 3T0BA 2PYEB 1X5HA 3GBNL 1CXLA 1NSNL 4LLUA 3IVKB 1D7FA 4Z95H 1NMCB 4M43L 2FZ3B 5C2BL 1RU9H 4HHAB 1OD9A 5EUOE 3GMPB 2AJYL 1D5ZB 4FQPA 4GAGL 4WU7B 5C09D 3VFGL 2CKBL 1J11A 2H2PC 3KPMB 4HUXB 4OZ4A 5KSUA 3G6DL 1FBIL 5JDSA 3DROB 2BNRB 2AV1A 2BRRH 3BDXA 1QKZL 3VXTA 1UB6B 3SKNB 3DHJA 3HPLA 3ALWA 5IB1B 4Z7UA 1Y18B 4JKMA 3O3AB 1K9TA 3U36B 5BV7C 2JIXB 2LVEA 5J12C 3S98A 4WO4D 3SDDD 3EJZC 4IM8A 4R0LC 5B8CA 2E9IA 2XY1A 3MCKB 2CUHA 3PABB 5HYSA 4N5EC 1DQDH 4YDIH 4XNZB 2FB4H 1P53A 4H0HB 2Y6SC 1QLRB 1ADQL 1K6QH 3RGVC 4CN4A 5BXFA 3DMMB 5K9OA 3NAAH 1DVFA 1YNTA 4C83A 3H7BA 4F9LA 2Z35B 1NC4B 4F9PA 3ZDYE 1W8OA 5LVEA 2HT2C 1LO4H 4PJBE 1CK0H 1KV3A 1LHZA 3B9KC 1OM3L 4HULB 1FVDB 3TZVC 3AC0A 1MJ8H 1VHPA 3AS1A 3MLRH 1FDLH 3KPSB 1P1ZA 2YA2A 1P7KB 1TITA 4XP4L 3B9DA 1BQUA 4JAMA 1HCFX 1ZE3C 5LCVL 5E94B 3MNZB 3SDCD 3VXSE 3QNYA 4POYA 1NAMA 5EOCL 1S7RB 1JPTH 4YHKL 1CG9B 3OQ3B 2EDKA 2HLFC 3LRSB 3FO9A 4LCUB 4KH2A 3C8DA 3VWKC 4X99B 3RZCA 3GMOA 3FFCE 1AQDA 5HHMB 5JPNB 1I7TB 2D7TL 4M6OH 4R3SA 1SVCP 2PXYB 4LCWD 1BFTA 2JTDA 2CJUH 3MUY1 5LKNA 4YFLF 5JXAL 3UZEA 4ZAKC 4EKXA 3CK0H 2VDQH 1PD6A 5D96B 3BDYH 4ZYKA 1TFHA 1KN2L 4HUMB 3CU1A 1QUNA 1AFVH 1F42A 1E27A 3G5YA 3VCLA 4K7PH 1EO7A 1A6PA 1KB9K 3SDAC 4XVUC 3PV6A 4KWUA 5J6GA 4IRJA 1PZ5A 2OXHA 2OI9B 2IPTL 1Z3GL 2A74A 4WFED 5EUOB 3OKNA 3VG9C 4X6BB 3MQIA 1F00I 4XCNB 1F90L 3BUTA 2J12B 5C09A 3KR3H 2EC8A 4MB4A 1VB9A 5K59F 3O6MH 5CEXA 5AZ2L 2Y36H 3T4YB 3HG1A 5DR5H 1R5VA 5MEQB 4F3FB 4RAVA 1XF5A 2C3HA 43CAB 3MFGB 2ADGA 4DUXA 3QI9C 1NANI 5TDNB 1TENA 1WT5A 4MSWA 2R8SL 4WO4A 1XH3A 3SDDA 5JTWA 4LRNH 5A16A 5FYJH 5I2IB 1R3JB 2E9JA 3ARXA 3WHXA 4BFIA 3IB4A 4YX2H 2DQTH 3BN3B 2B5IB 4IS6A 1YC7A 2XQYG 1CD1A 3CFEB 4EN3D 3VFOA 1HKLH 4H0GA 4UQ3A 5DURD 2C1OB 4PJ7A 3VDBA 1DFBH 1PG7H 3BD5A 1AXSA 4S1RL 4HZAA 4HUUA 4PJBB 3H42H 5GS1C 2Q3ZA 1CE1H 1D3CA 1HZHH 4GW5B 5IGXL 4WEBH 3RDTB 4HF5H 1T5XB 1RUPH 2BC4B 1U8HA 5JW5B 4O00A 4OSUH 5T5NF 4XPHH 3ZE1F 2BXYA 5JNYA 2F58H 5D2LE 1DBKL 3O3BA 4PLOB 2OSLB 3RL2B 4NCC1 4ZDHA 1JNLH 2X4TA 2BRRL 3ZE2E 1PYWB 4N68A 3ECBA 1K8IA 2A77H 3NCYP 2AKRB 3SDCA 1CR9H 3DX9B 3RBSA 3L3DA 1A6TA 1KB5B 3BRDA 4W81A 4G6FD 2AK1H 5GGVY 4LCYA 4UIKH 1ZT1A 3RRQA 1HSBA 3T0EE 5DFTA 3FFCB 5FECB 2XICA 1C08B 5FYKE 2ZG3A 1DQDL 1M6OB 4YDIL 5FO8A 2ICCA 3S3JA 5I17B 1X9QA 3F62A 1CGVA 4AH2B 5EZOH 1JPSL 3GRWH 3VFRA 5I8CA 4I0PB 4LCWA 3IDIB 4ETQB 2A38A 3EO0A 4MNGA 1NFIA 2AQ1A 1AHWB 4P0DA 5C0AA 3IU3B 4NNYB 4OCYL 1J8KA 3PQYD 5ILTH 2XN9E 3E1F1 1CK0L 4JZOB 1MLBB 1HILA 2L7JA 3L3OA 4HK0A 3O11A 3O6FC 4FMKA 4LMQI 3MLRL 1RK0B 2PO6B 1HNGA 3E6HB 5IEHB 2NTFB 2PW1B 1Z0MA 3JV4A 2GCYA 3HI6L 2UWEF 3LQZB 3O9WC 4XC1H 1V8HA 5H37H 2APXA 1IKFH 3N1GC 4GW1B 1H3UA 2WMPA 1GZPB 1NCCL 2P5WD 1ZLWH 5A2IH 5FGCB 3QIWD 2GSIB 1JYWA 4NKOA 2N56A 5D5MA 5IB4B 3H3KA 1RFDH 4S10A 1XF1A 4YZFE 1I1CA 5KVMC 3AGVA 1D6EA 2VZVA 1MWAL 4OLEA 4JVUA 4P2QD 35C8H 2YBRB 3NIGE 3AMLA 3DVGB 5F9WC 5C0CE 4OQTH 2LAAA 3EBAA 5T5FL 4M6OL 1QP1A 1MEXH 5C0GA 3VJ6B 3OKLB 5BMFL 5KSVB 2CGRH 2YPVH 4LCCA 3VXOA 4L4TA 1H0DB 2CDGA 4PLJD 2C3VA 2CJUL 1ZLVK 4IOFD 1N6QH 3FRUA 4D0DB 1J12A 3QBTB 3IYLW 2A0LC 2E7HA 2VDQL 1Y6KR 3BDYL 1HH6B 5GGTL 1X3DA 3LEXB 1LEIA 1LK2B 3IDNB 3HR5A 3QDJD 4MNHA 3TO4B 2EXWD 1AFVL 4EN3A 4Y2OA 4OLYH 3EOTL 2LVCA 4R4NC 2NR6C 2YWYA 3IRPX 3TNMB 2K9UA 1I1YA 3MROA 5DD1H 1S9KC 2J4WH 2NTSP 5D2LB 3WFZA 3V6OA 2IPKB 1NDGA 4EJ1C 3G5ZB 4DFIA 2Q20A 3KR3L 2NX5B 1DN2A 2VLMD 4PGDB 5C0IB 2Y36L 3ZYIA 5DMJB 2CUIA 2EE6A 1A6ZB 2VLJB 4L8SA 5TQ2H 4OZGA 3L3JA 3TVMB 1MCDA 1IGCH 2OJZH 3T0EB 2FEEL 4FQHB 3GGWB 3MV11 4MB3A 1P9MC 3KYMB 5DD0H 2YD8A 1JRHI 3VFNB 4G9FA 4ERSH 4PJBF 5C0JB 3LHPL 1XZ0B 2DYPB 2JJUA 1KLGB 2BVUA 2QADB 4JDTH 4NN6B 1KEGL 1NUNB 2DQTL 4J3SA 4L5FH 5DZNA 3E6FB 3NZHH 3OKMA 3ULUH 1IZKA 1MCNA 4XCEA 4EVNB 4U1IB 3THML 1DFBL 1PG7L 1QEWA 2Y5EA 1UCBL 4OCRH 4LVNC 4L8DA 2XN9B 5FUOH 3OXRB 4FQQB 1CE1L 4WEBL