1NINA

Plastocyanin from anabaena variabilis, nmr, 20 structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of reduced plastocyanin from the blue-green alga Anabaena variabilis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ninA00
4F7KA 2IWEA 3FU7A 4DP2X 2BWIA 1OCOB 2EIJB 1L9RA 2BW5A 4E9WA 4KNUA 1QHQA 2GIMA 3X1EA 1CYXA 1V55B 2XYBA 3FSAA 4BWWA 3FS9A 4A66A 3T71A 2EINB 4A2DA 4BWUA 1HAWA 1X9RA 2AZAA 2W8CA 2AZUA 1PZBA 4YSTA 1BQRA 4E9YA 2W88A 1GSKA 1OE2A 4KO7A 1KCBA 4PCYA 5I6LA 1EZLA 1QNIA 3EH4B 2B08A 2IDFA 3NJLA 2H3XC 2PCYA 1KBWA 1OF0A 1ET7A 3SBPA 5I26A 3MX0B 3FSZA 4UANA 4YSSA 2FQDA 1SF3A 3IE9A 2GB2A 1BXVA 4W1TA 7PCYA 3QQXA 4G7QB 3UACA 3X1GA 4FAAB 4G7RB 4PAZA 2I7OA 3GXUB 4NB7A 4HALA 3NJMA 1OV8A 5I5MA 4YSCA 4A2EA 1PAZA 4Q89A 1N70A 1PZCA 1ZIAA 2PCFA 2XV3A 3JT2A 1AACA 5TK2A 3T6XA 5AFAA 3MBWB 2BZCA 2YAMA 3AG1B 1BAWA 1PY0A 3TBBA 1SNRA 2LLNA 5I6NA 3AZUA 2I85A 1JXDA 1KCWA 2FQGA 4YVNA 3FQ1A 1J5DA 1BXUA 1JVLA 4RH4A 2XXFA 3FSWA 5D4JA 2XXGA 2IH9A 1NZRA 2R7EA 2BZ7A 5A7EA 1OCCB 4DP8X 5B1AB 5B1JC 1PNCA 4YSAA 2ZXWB 1GR7A 2BHFA 2XLLA 4JHVA 2WO3B 4WTQA 1M9WA 5EHFA 1WS7A 1ASOA 1KDIA 3NJIA 3WIAA 2YXWA 1ZDQA 2BP0B 5I28A 3BQVA 4G71B 1PLCA 1ET8A 1TKWA 2VSKB 3FPXA 4DPCX 5B1KA 1AZCA 4HCIA 3FPYA 2AFNA 2NRDA 2PPFA 1R1CA 3AW5A 3NSYA 4QLWA 4F2EA 3QJRB 4HHGA 4KO5A 5F7BA 4N8UA 5D4IA 1JZIA 3OMNB 4A2HA 1TEGA 3FU8A 2UXTA 3DKHA 3SQRA 1JXFA 3WG7B 3H4FA 2QPDB 1AR1B 2FTAA 1IBZA 1CYWA 4QKTA 1N68A 3GYRA 3EF4A 2FT7A 2XX1A 2VM3A 2DWSA 1W6LA 4E9TA 2YAHA 2YAOA 2N0MA 2B3IA 3QJQB 3X1BA 3OM3B 1ET5A 4YSPA 3CG8A 2E86A 4HCFA 4GP4B 3S3DB 2J57A 3H4HA 5LDUA 3S3CB 5I6OA 2VM4A 4L0PB 2A3TA 4AX3A 1AS7A 1BXAA 2FT6A 4HZ1A 2PPDA 1TEFA 3QPKA 4BXVA 1HAUA 3T6WA 1IC0A 3ABGA 5PAZA 1BEXA 1A4BA 4E9RA 5B3SB 1SJMA 2FJSA 2XX0A 3PAUA 3ERXA 1JZFA 4Q8BA 1HFUA 2GHZA 2DV6A 3AY2A 2EIMB 4AI7A 1XB3A 1ASPA 1AZRA 2XU9A 5PCYA 1AIZA 1L9SA 5AKRA 2DYSB 1BYPA 2YAEA 3S8FB 1PLAA 4E9SA 3NSCA 4F2FA 2BWDA 3ZX1A 2AVFA 4W9ZA 4A67A 1DZ0A 5FC9A 4N4YB 1AZUA 2I7SA 1QLEB 4DPAX 1WA2X 3DIVA 2HX7A 3FT0A 5F7AA 1FA4A 1JERA 1NPJA 5ANHA 2XVBA 2QT6A 1E67A 2IWFA 2VW7A 3HB3B 4GP5B 4ENZA 1VLXA 4YSRA 4AKPA 5B7EA 1NWPA 1GS6X 2VW4A 3T6ZA 1PF3A 3FQYA 3ABLB 1RCYA 3IN2A 4DPBX 6PCYA 1AANA 1ASQA 1IUZA 3NJHA 3QJTB 2PP8A 2GC7C 2YAPA 3N55A 1E65A 1SDDB 1OE3A 1ILSA 3WI9A 3NJGA 3C75A 2HRHA 2GBAA 1RZQA 3TASA 3S8GB 2P80A 1CC3A 2TSBA 3X1FA 4G7SB 2QDVA 1AQ8A 1J5CA 5I6KA 2BP8B 2JXMA 2CBPA 1J9TA 2HRGA 1AS8A 1M56B 1PLBA 1AAJA 1OOWA 2PPEA 4HIPA 3UGEA 1BQKA 1L9OA 2XV0A 1JZJA 1NIFA 1F56A 4DP5X 4BXSV 3U25A 3ABMB 1GY2A 1KGYE 3H56A 3ZBMA 3DTUB 3NSFA 2PLTA 2IDUA 4M4RB 4HCGA 4YSQA 3CVBA 1GS8A 2P80D 1NIBA 1NIEA 3CVDA 2IDSA 4BK5C 2UXGA 4TXVB 3OMAB 4KOBA 1FWXA 1ZV2A 3IBOA 3ABKB 5B7MA 5E9NA 1E5ZA 1OCRB 2VN3A 2Y1AA 3EHBB 1AS6A 1GY1A 1ILUA 1PMYA 2CJ3A 2OV0A 4A2FA 4E9XA 3WKPA 2YAQA 3OMIB 3FU9A 1WA1X 4MFHA 3QJUB 3AG4B 1OE1A 3X1NA 1ID2A 2UXVA 1JZHA 2YARA 3CDZA 3EH5B 4AZUA 3PAZA 3FSVA 3QJSB 3CZUB 1SHWA 3T9WA 3TA4D 3V9EA 2HXAA 2FNWA 1ZPUA 2H5UA 1DYZA 2HX9A 1TU2A 2UX6A 3IN0A 4BDVA 4DP1X 4NERA 1NWOA 1KYAA 3WKQA 1WS8A 4BWTA 2XWZA 3NJJA 3OD3A 4GXFA 2ZOOA 3PLYA 5I5IA 4BDVB 2OCCB 4GYBA 4M3HA 2J56A 2GI0A 3PXLA 1E5YA 1ADWA 2X87A 1EHKB 2BW4A 1ZDSA 3NP3A 1ZIBA 2PPAA 1OCZB 2PP9A 1SFHA 1NIDA 1PZAA 3BVDB 3D12B 1J9QA 3PCYA 2YXVA 1A4CA 5TK4A 2Y69B 2IWKA 3S3BB 1JZGA 3CVCA 4YL4A 1A3ZA 1GW0A 2OJ1A 1XB6A 2IH8A 3NJFA 1MDAA 4DP0X 3JTBA 1NINA 2CUAA 1V10A 2GSMB 2XUWA 3AG3B 4HAKA 4E9QA 2ZONA 4UAHA 3UAAA 4ZK8A 1J9SA 1AOZA 1JOIA 2ZWNA 1UATA 4JHUA 5AZUA 4HHWA 1RZPA 1RKRA 1CUOA 2EIKB 4DP7X 3V9CA 1MZZA 1WAEA 1JXGA 4GY4A 3SBRA 3GDCA 2H47C 3FU7B 3UABA 1KV7A 2AANA 4DP6X 4KNSA 5B7FA 1AZBA 3NT0A 4YSDA 2CCWA 2MTAA 4DP4X 1CURA 2UXFA 3PPSA 4WKXA 2YAFA 1URIA 4KNTA 4P5SA 1MG3C 3FYEB 4DP9X 2QPEB 3NSDA 4CSPA 3QJVB 1L9QA 3RYMA 1I53A 2X88A 3FQ2A 2YQBA 4KO6A 3CDZB 3ZIYA 2DWTA 3FYIB 9PCYA 2IDTA 1SFDA 4AKOA 4CSZA 5I5JA 4YSOA 2VW6A 4G70B 3UADA 1WA0X 2FT8A 2HZHA 5I6PA 3NJKA 1NICA 1XB8A 4A2GA 1X9UA 2TSAA 1SDDA 1NDTA 1B3IA 4X4KA 2XV2A 7PAZA 2EILB 1AG6A 2CALA 2Q5BA 1MG2C 3T6VA 2FQFA 1L9TA 2DYRB 3TU6A 5D4HA 2J5WA 2BP8A 3WNJA 3AG2B 1A4AA 3N2JA 1W6WA 1A65A 2HX8A 2WSDA 1NIAA 4KO9A 1IKOP 1BQ5A 2R7EB 4UF7C 3PAVA 2PP7A 2PPCA 2CAKA 2UX7A 1KDJA 1FFTB 2IDQA 1GS7A 4K9JA 5I6MA 3OQRA 3HEIB 2J55A 1JVOA 2JKWA 3L45A 1T5KA 3UAEA 3ASNB 3EH3B 4AKQA 1IBYA 3KW8A 1YLBB 1AG0A 2GC4C 1GYCA 1E30A 2FWLB 2VMJA 4NAJA 4A68A 2RACA 3IEAA 4YSUA 2IAAC 4P5RA 4EF3A 2Q9OA 4G72B 2HLEB 4YSEA 2JFCA 1JZEA 3TBCA 8PAZA 1L9PA 1SHXA 2VSMB 4YVUA 5B1JA 2MRYA 1J9RA 4E9VA 3WNIA 1M57B 2BP0A 4GP8B 5IY5B 1ETJA 1XMEB 3SBQA 1V54B 3ASOB 2QDWA 4FA7B 1W8EA 1A8ZA 1NPNA 1PCSA 3X2QB 1AZNA 3NP4A 2FQEA 2BO0A 3G5WA 1KBVA 3NYKA 1SF5A 4KOCA 1PNDA 3ZDWA 3NJNA 1NTDA 2WO2B 6PAZA 5B1BB 1MZYA 4JKNA 3KW7A 2DY2A 1BYOA
chains in the Genus database with same CATH superfamily
3GRWA 4NWUL 1J8KA 3HG4A 5L7XL 4G6MH 4UTAA 4ENED 3RL2A 3SE3A 4RRPA 1I1FA 3ECVA 5BRZE 1DR9A 3ATFA 12E8H 4ZNEA 1LEKA 1E8WA 3TBYB 3G5VA 2WXHA 2MHAA 4Z7UF 2VLRE 1DL7H 2XYBA 4HUXA 2LAAA 3F84A 3FS9A 1MCOH 1RMFL 1EVUA 2EINB 5IVXF 4JM2A 5H4YA 1RERA 2JLPA 4MMZC 5J5EA 3FUKA 1L3WA 3V6OC 2IFFH 1M6OB 3VO0A 3S37L 2JIXA 3V2AR 3VXRA 2HKAA 2W65A 1T0NB 1CD9B 1NGYB 1KT2A 4FQXD 2VXSL 2VR5A 1AR1D 1NDGA 3U1SH 5HGBA 2YRBA 3PHQA 4F33B 4Z7VA 4HIXL 1I8LA 1WZMA 3H7BA 2BNQB 2OMZA 4GAJH 3I3EA 4TUOB 1J18A 3SDDB 1NCGA 4YBQD 5EBMB 4A2EA 3VD0A 4IRZH 2CPUA 4PJIB 2OK0L 4IRJD 4M5ZH 1HE8A 5CJXA 3RPIB 1SVZA 1J1OH 2BZCA 2WZ0A 2H3NA 1IAOB 1KSRA 1NDGB 1BFSA 5HGBB 1IAIH 2NNCA 3EJTA 1UWYA 4F5CA 2LLNA 4BH7A 4YL9A 3FQ1A 3ZVVA 4PJ8D 4AEEA 2H3NB 4UTBH 4XNZC 5I66B 5J6HA 2UYLB 4NT6A 4AV5A 2IO5A 2MKLC 4KRNA 3V7MA 5E6ID 3CIQA 4XP1L 5B1AB 1DSYA 4EJ1C 2IBZX 1UWXH 1C12B 2OMUA 2X12A 4WV1B 4XBPB 1IQWH 2P28B 2CE6A 3P2BA 2FSEA 3M88A 3MTXA 1NLBH 2YOAA 2FBJL 2DLFH 3TBWA 4JGJA 2YPLB 4PW4A 4DSYA 2UY6A 5IB3B 1UASA 4WI5A 3MJ7B 1TVDA 3D7PA 3OSKA 2JIXB 1TQBB 5FHBL 4O9HL 3JVFC 1R1CA 4Q6IC 3JQOB 3IDGB 4GH7B 2XNAB 4YHMH 3ULVE 4JFFA 4F1ZA 4H8WL 1TLKA 5DRWA 2K70A 2F6AA 3SOBH 2QPUA 1N6QL 3CTTA 4RFOH 5ITFA 2QPDB 4W9GC 1AR1B 4NAMA 2P44B 1IBZA 4DAGL 4FX5A 3RAJL 4ZPTA 3WMQA 1A6UH 4LGPB 2D2CC 3TCTA 5SX5H 1AR1C 5DK3A 5HHOA 1ADQH 4E9TA 5C0CE 2XKNB 4U3XA 3QZBA 1FE8L 3P3RA 4ATTA 2APXA 1PS3A 2XETA 4U0RC 2N7AA 2IPKB 2ATPA 4OCSH 5ESAA 3MV8E 4OLUH 2HKHL 3S3DB 2J57A 4TSBL 4B5EA 2R69L 2DTMH 1JP5A 5JW4M 4X6CB 4AX3A 1USZA 2YOCA 4AOFA 4BGDA 4CVUA 5AW4B 5GJSH 2FL5B 4PLJD 2HWZH 4HC1A 2AQ3A 2O26U 2DQJL 4PTTA 1LK2A 3GMRA 1IJNA 2C9RA 4AEHH 3H54A 1S7XA 3RWIA 3KM1A 1NMBL 4XE0A 5E8DL 4KGJA 3PAUA 3MLSL 4IDJH 1R3JA 3C5JA 4AY0A 1JV2A 3GRBA 4WKZB 5ISZD 1J5HA 1EXGA 3TIEB 4D9QE 5HHNB 4L3EB 5DVLA 1XB3A 4NKOA 3KXFB 3GBEA 4K23H 5C6TH 3QORC 3UJJL 4Y1SA 7CGTA 5DHMC 4EI5B 2X1WL 1KUMA 5HHQB 4AGOA 3HG5A 1DN0B 3F7YA 1LE9B 4A6YH 1LTXA 3E1F1 3MI6A 3W82A 3OAZK 4DPAX 1WA2X 3QARA 3AITA 1YQ2A 1NGZA 3ECBB 5EG6C 1CDBA 3CU7A 1GGBL 5BV7B 1J1PH 2RHEA 3GIVB 4GINA 4ZS6C 3TO2B 3PHSA 4FZ8L 5CKGA 3CV5A 3DIFA 2NY1D 1SYSB 2WXPA 1M9SA 1XO8A 2Z4TA 5GGVL 4B7IA 3MNZB 1S7UB 2ZXEB 2JJTA 3TFBA 3MOAL 43C9B 4Q9CA 4HHAB 1YJDH 4NWUH 3CLFL 3HLAB 4X6FA 2OKMA 5BVPH 5FKPB 4OQ1A 3A23A 3WFZA 3QJTB 3AS0A 4DGIH 1MCHA 5DD6A 5DGQA 1FBIL 4KKCD 5H35B 1SJVA 2YD5A 5E6IA 3ARGA 4HS8L 3UP1A 1SDDB 2DKMA 4JY6A 1PLGL 1CFQB 4G8IB 1S2EA 2BVPA 3MRQB 3Q5TA 1KIPB 1TZGH 5EF3A 2Y1ZA 3GLAA 2QDVA 4K9EC 2AEOA 4JJOA 5BZDA 1BREA 1QG3A 3HB3C 5DJ2A 5JW4Q 1EEYA 4WQOA 2CBPA 3Q5OA 5FDWA 4HBCL 4Q7DA 1PFCA 2LTQC 2Z31D 4HPOL 4LE8A 1OOWA 2XIDA 1YRKA 4YX2H 3N43B 5EFIA 4OZIE 1EMTL 1INEH 4HIEB 1B90A 4WSKA 4WUUA 1HXMB 3BHBB 4E41D 5B38G 5GGTA 1MFNA 4XP6H 4RETB 5IFJB 2EO7A 2H41A 3HG1B 1UURA 4UBDD 1LDPH 3OX8B 5T1MB 3CVBA 4Z95L 2VLKB 3WD5H 3WNNA 2IDSA 3KYAA 3H2WA 4GEJA 3SDYH 4P9HL 5I0YA 1QHOA 5L4MA 4C83A 4N5EC 3FQRA 4QRRA 2DEWX 3IMSA 3OAYH 4FE9A 1O7DE 4JFTA 5TH2B 5E4OA 5EA0L 1THAA 2I25N 2WTRB 3RY6C 3ZT5A 5KBLA 4I18A 1UM5H 1A7RH 4NO3A 5DJCB 4TMPA 4NN7C 4B9PA 2ZF8A 5JDJA 1XGUB 1IC7L 1YDPA 4HG4K 3V0WL 1GTFA 3UJIH 4AJWA 3RY6A 5C2BL 4WWKA 3EH5B 3I74A 2BDNL 4Y2DD 5DT1L 2YD4A 3I6GB 3DV4B 3LN9A 5K9KB 4X5RA 3BGAA 4NN6B 3EOAA 1ZPUA 4XP9H 2X4SA 3L7FA 4ATWA 2YD0A 5E2VH 3X3GL 4HGKC 2VO5A 3RG1C 4PM1A 4P06A 3QUML 4OIBA 3S88H 3BPCB 4PRNB 5J13B 1AXIB 3OAUH 2DPKA 4XO4A 1ZT4B 3BUBA 5F7KC 3PGDB 5KYXB 2DH2A 4JX0A 3OV6A 1EHKB 5IB4B 3NP3A 4JO3L 2PPAA 4EUPB 2EVHA 3PV7A 5IT2H 1NFDE 3GSRB 1KJ2A 2A5UA 2J6WA 4GSXA 2UYLA 4NT6B 2AF2A 2DIAA 1I8LC 3PG2A 4QYAA 3S3BB 1JV2B 3N3EA 4YXKH 1FZOA 3QFJA 4WFED 1A3ZA 1FFOB 5BPPA 3ZRSA 1MI5D 3SDAB 1CI5A 3EYFA 4AXWA 1QLRB 3GSNH 3NEEA 4TL4A 3GSUA 4V1DA 3NQIA 3TXAA 4ES8A 5B38A 3NGBB 5EBWB 5TF1H 1QEWB 4WNSA 4ETQB 4H88L 2JELL 4JM2C 2X4TA 4XNYH 5C0FB 4HJ0D 3E2HB 3KPSA 3L5WB 3T8MA 4WFGD 3GEFA 5L0QC 4DP6X 2AANA 3Q0HA 5J12C 1OARH 1SBBA 3HLKA 4AYID 2OLDA 1U3HB 2WV3A 1FAIL 3OJDA 3L3DA 4GS7C 3QZWA 3AT0A 4G7YL 4G2AA 2P8MB 1IX2A 5E9DE 1JD7A 2VM9A 5IOPA 5TDNB 4XWOC 2QMJA 4ZTPH 3UYOD 2Y5TA 4LSRL 3TS8A 1OAQL 4LLMA 3W0WA 2CNYA 3TJEH 4DUVA 1G9NC 1G7QA 3MBEC 2ZAGA 1NCAH 4YO0A 4OZHA 4MQSB 5IW3A 2IBBA 3BZFB 4XOEA 4TRPL 1HILB 2NY6D 5GISL 1ZLSL 4QJ5B 4GKSB 4R7DA 3UADA 1Y7VA 2FT8A 5H8DA 1QFOA 2I07A 1RZFL 1UJ3B 2BMKA 4LDLB 5D1QD 4N6RB 4BFGA 2UY6B 4JZJC 1VZGA 4BH8B 2Q5BA 3GNMH 1RZ8B 3VFVA 2FDBP 4OSUL 1GMEA 2YIHA 3P2TA 4UIKH 1CGWA 5EU4B 3AREA 3TU6A 5EULV 3GHPA 4LSVL 3CCHA 3ZDXF 3MRIB 1NCTA 1INQA 2FIKA 2PP7A 3T65B 1A1NB 3PWNB 4XTRC 3P4OA 4PYHA 3PRZA 4IOIA 1NUFA 4PJ7F 3MN8A 1XGYL 1TTCA 3GGWA 4Q4IA 3NAAH 3MNDA 2JELH 4DO4A 1RPUA 3P4MA 2GABA 1N19A 3CNKA 4OVUA 3UZVA 2LABA 4EZMA 1G6RH 4WFHD 4Y9CA 3T3PB 2Z4QA 4KVCH 1Z7JA 4LBAA 3P4OB 1LNUB 4JBSA 2ROXA 5D5ME 2HYMA 4GKOA 2ZUSA 2OMZB 4XPAH 4S1DC 3D85D 3F6JA 4AM0A 4EF3A 2J21A 3BAEL 2J88H 3KPTA 2AQPA 2R4RH 1OM3L 4G6JH 2GT9B 2CM6A 2XC8A 2Q76B 5GGRA 1DSWA 4PD4K 3TT1H 1MIEH 1Q0YH 1IE5A 4JO3H 4MLIA 1MJ7H 4KH9A 4NFDA 4ZD3L 4P48A 1SOXA 4J28A 2A77L 3WMPA 4P2RA 1CFNA 5SWSD 2ENSA 3ARBB 3P0GB 5IK3B 1WZAA 2HSIA 4PSRA 2YUWA 4NC1E 2PYED 4LIQH 2QADB 3SDXB 5L8KB 4N0UE 1DHKA 4Z3HA 1FYTE 2R1YB 5J56B 1GYAA 1L6XA 3V7AG 3G5ZB 4ZDHB 5JIPA 3SE4C 1KCRH 1U2CA 3P30L 2R2EA 4LP8A 2WO2B 3UTOA 5A40E 3SJVE 5IWLC 5IHWA 4WEMB 2EXSA 4Y2NA 5H37G 3NIFE 4L4VB 2G2RB 3GMMA 3NUKA 4F7KA 4MB1A 1HKLH 3O9WC 1WWCA 1RULH 2G5RA 2CCVA 2WD0A 2FYYB 2VDQB 1L9RA 4E9WA 2DWDB 1QHQA 4FQJH 4NEHB 4KITB 4L1LA 3IFLH 4XZUB 1KTDB 3FSAA 4NKIH 3X3FH 2VDKH 3MV9A 1Z5YD 4QXTB 1UFGA 2EVFA 3IMTA 1AHWA 2W8CA 3K2IA 3TNMB 1R3LA 2IQAB 2OMNA 3OKDB 3SDCD 4R83A 2HT3C 4AYFA 3BAEH 3H9HA 5DMYA 4GG6E 4XO9A 4NQXB 2DQIH 2H3XC 4X4XA 2Y5QA 1FL6B 2EDKA 2X4UB 2YD9A 3D85A 2D0HA 3K71B 1IVTA 1JGVH 4PREA 3VB9A 4ZQKB 1X6NA 3HN3A 4MZIA 4YHPB 1V05A 4ANUA 2O6DA 4XRCA 2WANA 2XTSA 4YXHH 4U6XB 3VD9A 2X5PA 3MLVL 1OAYH 2CO6B 1UEMA 4FQPA 3N41F 1G9NH 4LLMB 5F7LB 4H8PA 3TH3T 2NY0D 3W0WB 1N67A 2J8OA 4P4RA 3VCLB 4N25A 4LU5L 3VFRA 5DCCA 3KLLA 3PP3K 2A9NL 5I6NA 3LPWA 4OKVB 1MW1A 4XO3A 5C0AA 4Z78B 5L9DL 3OPZH 5C0BD 3K5RA 1G94A 4U3CA 1DTUA 3RGVC 2J4WL 1UQSB 2H2SD 3DSNA 3LKNB 5T1KB 2KT6A 4G5ZL 5IEHA 2V5RA 5BOZG 4KDTA 3FFCA 2F53B 3WL9A 4AQZA 1WISA 2XZAL 3QGVA 3TN0D 3JTTB 5J6GA 3VFSA 2Q7NA 3D07A 2BOCA 2PKDA 4OFDA 2YXWA 3AREC 4IBVA 2OXHA 1EJOL 1YYLH 2BP0B 5FYLE 3UPRA 2X4NA 3LKRB 1L7IH 3V5DA 4LLWA 1J1XL 1CCZA 1TNMA 2QQKL 4MMYB 1RP8A 5HJ3A 5CCHE 1JZ5A 3ARDA 2NRDA 3BKJH 3JT0A 1B2WH 1LGVA 1CD1B 2A6DA 2HLAA 4LHUB 5F7BA 5IVNA 4X9BA 1IAKB 3DPBA 5ICZA 1MFAH 5IFAH 3F12A 3SQBB 1Q9OB 4G3YH 4AZ8B 3H53A 1AO7E 1IAKA 4FNTA 1MNUL 3SZ6A 3V4LA 4PRAA 4LCUA 4QTFA 3L13A 3EYSL 4G6KH 4HQQL 4XC3H 4BFEA 5KVFL 4B9KC 1O5DT 4PJGF 5FW7A 1AZZC 5AUMB 3LKOB 3N44B 4NKDA 3JWNH 1LE5B 3V4VB 4URKA 4PJXE 1UB5A 3MBWA 2D9QB 2RMNA 1M7IB 2JIXD 4RFNC 2B1AH 3KHQA 3X1BA 1NAKL 4AZ8A 4M7KL 2YKKA 5IBLD 1MAJA 4Z0BL 4AQAA 1T83A 43C9A 4I48A 4GP4B 1SN2A 2IAMD 3KGSA 4GKZB 5DEGA 1JHTA 1GYUA 3FTGB 3OKLA 2VAAB 5KUMA 3T0DA 4TSBH 5HI4C 2EDXA 2WXKA 3ECWA 4XCYA 3ESPA 3VXUB 3ZZLA 1D9KB 2E5EA 3H9SE 3N42B 3X13B 4BRVA 4BXVA 4WY7L 1RZJL 5DD0H 1SJXA 3DO7B 4JKPH 4FP8L 5D93B 1IILE 3KH4A 2OTUA 2FJSA 1KPUB 2WOBA 5DZJA 4LMQI 3DX2A 3AU0A 1JZFA 1N2RB 1IB5A 2HH0L 3GSXA 1HFUA 1OZTG 2V5YA 4H8WC 3AY2A 5T1DL 5T3XL 4AI7A 1XF5A 3U0PA 2AJUL 4RDQF 4ODTH 4MAYC 3UDWA 2GW5A 4N90D 4QCIA 2J6EH 2VXTL 1HT6A 4XP9L 4GKSA 4R7DB 1X5GA 5IZ7A 4XVSL 5DT1H 1Q1JH 5FHBH 4UAOC 5LCVL 1E6JH 3T5WA 5JQ6L 1IKNA 5AG9A 3AACA 3GT6A 4X7SH 1AKJD 2A6IA 3EJSA 1BF5A 5CD3B 2EC8A 4R0LB 4K3DH 2PR4H 1AXSA 1QFUL 3FQYA 3DMMA 2KDGA 4M6OL 4KK6D 1RCYA 3I9AA 3SYPA 5C08E 1ASQA 1IUZA 1BZ8A 2C1PA 2NXZC 3F3HA 4NSKA 4QIRA 5EA0H 3ULUD 1FFOA 1NOAA 3L8QA 3BVXA 1IQDB 4FG6C 3VM7A 4X98A 3MODH 4O2FB 2GBAA 3X1FA 1U8HB 3MAWA 3N06B 4FQXB 2BY3A 4PBDA 5D70H 1DLFH 1QEWA 3RVWD 5LWYL 5AKSA 4XP6L 1J9TA 1U93B 4UNTA 3RX5A 4JRYA 3ARDC 1VADB 4XOBA 1K3ZA 2CU9A 1EMTH 1BZ9A 3AJ7A 3ZSTA 2DMGA 4YBLC 2WQAA 4FKKA 1KGYE 5ICYB 1YYCA 2DBLL 3PDDA 1GC1C 2IIJA 1FNEA 3CBJB 4M6AA 4N85A 4L8CA 2G0LA 2XBTA 5FO7A 2P80D 5AD0A 1TZGL 2XYCA 2B4CC 2ICES 4F7PA 4LCCA 1IM9A 1KBGH 2ZWSA 1PG7H 2OL3B 3OXSB 3PGFH 1PLGH 5IREA 4H8HA 5G55A 4QXGH 4G43A 1C1EL 3MXVL 5J0BA 1IM9B 3H1ZA 2CGZA 1RJZA 5B7MA 5ELIA 5FM5O 4Y7OC 2XOTA 3V6BR 2CIKB 2ESVA 3B7YA 5GRYA 3WYRA 5GJTL 5IB2A 1JUFA 3CXFA 3MPCA 4P23D 4Q0XL 1ILUA 3MLWH 5AW7B 2OV0A 2QHRL 3Q3GA 3D4GA 4DW2L 3UBXA 3Q5YA 4R8WL 5MEPA 2YEQA 2YARA 1T04A 4F9PA 1V3MA 3PAZA 1H8NA 4ZO9A 2WLMA 3S35L 1I4FA 5IVOA 3EDJA 3PDOB 1INQB 2FIKB 3BMVA 2V17H 2FATH 4DGVH 3V4PA 5A43C 5IVZB 3VFPB 4Y1AD 1ZAGA 4M8UA 3C8KA 2X3BA 3X17A 3BWUC 3BO8A 4KKPA 2NTSP 4HC1L 4Y2OA 1K4CB 1KN2L 4H40A 3C6EA 3INOA 3UZEA 3U82B 4GRLC 4M3HA 2J56A 4NQQA 2JK5B 1FH5H 1G1OA 4N8PA 2VR6A 4AJ0A 4CVZA 3QS3A 3RGBA 2Y7LA 4JUTA 4AQ8C 3ZDZF 4BGLA 4J23A 4AC2A 1NCOA 1IC4H 1UD2A 3EGDB 5DUJA 4X0KA 2YJQA 4PP2B 1G7LB 5IJCC 4FXKC 3DGCR 1ZLUH 3VACA 5HI3D 1MJ8H 1MHPL 1V3JA 2M83A 4TTDC 2XHNA 3VFVB 4LEXH 5CKAA 5HDLA 3NJFA 5C0CB 3RZCA 25C8H 3MV8D 3JTTA 3RNKA 2APSA 4YMPA 4HEME 4FNLL 1OAUL 4K71C 4WIQA 1E28A 4M6OH 4QPEA 3ZRCC 3UROR 4AH2A 1VJSA 2ZX6A 4WO4B 3I75B 5IEHB 1ND0A 3KNBB 4HUCA 3M6DA 1JDAA 2J1XA 4L8BB 4UB0H 3CDYA 1AJ7H 3CFCH 1DBMH 1A1OA 3FU7B 4O4YL 4O2CA 3ARGB 3F85A 2A73A 1S5IL 4LCWD 3V0AC 3PGCB 3UTTD 5I1DA 1A7PL 5EBLA 4GG6A 4WKXA 2HFFA 4Q74A 1T3FB 3QR0A 4H8WH 4KKCC 4N0RA 1L7TL 3HBQA 1Q72H 4I5BA 4QTIH 2C1PB 4BE5A 2W95A 2IXQB 5F8RC 3RYMA 1T1ZB 1X4YA 5HHNA 4LKCA 1EHLL 2FECL 1XH0A 4F8OA 3K72A 1II4E 3UAJC 5G2NA 3HMWL 3CDZB 1M7IA 3V0EA 2DWTA 4XCEB 1QUNB 4JFSA 1JNNL 5T5FL 3V0JA 5L2KE 4TPRH 2AI0L 4WWKC 3F7YB 3HI5H 4BZ2H 3FHQA 2EDLA 4YGVB 3LZPA 3B2PA 3IS1X 1B3IA 4JHBA 5AYQA 1S3KL 3RVTD 3NEXA 4NCC1 4LPTA 3FCUB 1JRHH 3IGAA 4QXUH 3T3MF 2ODIA 3AG2B 5AYTA 3LNFA 1W6WA 2DIJA 3HW7A 2EH8L 3RURA 2ZCLH 5D6CA 1T03H 1GGTA 2A4EA 4M7KH 3LKPB 4UQDA 1A3LL 5AVYB 4BEIA 4ZG1A 4PTUB 3QQ3A 1KDJA 1EZUA 1FFTB 1YO4A 2MSPA 3I2CL 2QTVA 3O8XD 1S7QA 2QGEA 3DURB 4PJ5A 1UUNA 4K9JA 4YDZA 3GK8L 1UYWL 3S4SA 4K0OA 5BOPA 4QRSB 4W9JC 3V4PB 3L1OL 5JOPD 3MRHB 2IPUG 4IGBB 3MV7E 2FHCA 3D2UA 3IDNA 5ALCH 4XN7A 3OG4B 3MLTA 2NZ9C 2RACA 4LQ1A 1MLBB 4PJ7A 4I5BB 3VGAB 3GRWL 4TKWA 1KYUA 1U3YA 3AS3A 2IFFL 2EABA 1U8NB 3BKJL 4M5TA 3QCTH 3F04A 1W0YT 2IH1B 3BVVA 4L3AA 3WS3A 2NR6C 3F7RA 4XB8A 2G60H 4ZUTB 1U8IB 5DF0A 3FUDA 5FA3B 3MC0A 4C55A 3DUSA 3LMJH 5EPMA 4FCHA 1R0AL 4XH2A 2UY7A 5B3JE 3DOSA 1HHHB 3UFIA 2A74B 4K5PA 2WZPD 2BZDA 3OKOA 4JO1H 3VG9B 5A16B 2LV4A 1OW0A 5DJ0B 3UG4A 3U36A 4QGTA 2BO0A 2XN9A 3G5WA 4P5TC 4QXWA 2Q8AH 1HNYA 1A22B 1AGBA 3A22A 4R26L 3TEWA 4GG8B 4JQIH 2EUVA 3T2QA 5A2BA 5GS2H 1ZGLB 4HW6A 1P4LA 1ZT1A 2O4EA 2XN9E 1TTUA 4X6BB 1UCTA 4QO1B 3V4UL 1LHZA 1QRNE 1ADQA 3MRNA 1P5VA 4JKNA 3N5AA 4Y16A 3RVVC 3ROLB 5KTEL 4POZC 4F8TA 2IWEA 1YMMA 4MAYD 1TJGL 3AMKA 3IAPA 4Z76A 2PCFB 3Q1SL 5B4MC 3VYNA 4FOMA 5C97A 4NHUB 2AJSH 3VE0B 1J8SA 4JNXA 4XMPL 5AVQB 2ZP9A 1P2CB 3GD1C 3VQMA 1U30A 4G1EA 4PGBA 3D05A 3T6QC 3SPHA 1DE4A 1OGAE 3GMQA 4U1IB 2OZ4L 4MA3B 4TNWF 2W88A 3QNXB 2WIMA 5TJWK 4LLWB 5HJ3B 2AC0A 3MRJA 1EZLA 1PSKL 4PBVC 3EH4B 4WZ9A 1E4JA 1OGAB 2B08A 3MOBH 4NUJA 4OCYH 4PMEA 2X4QA 1NJ9B 2GEEA 1NBYA 2WKLA 3MUHL 3P9MB 4A2LA 3B2VH 2HJFB 4W1TA 4KI5C 2NX5D 3LAFA 4HK0B 3UEQA 43CAA 4FAAB 1AIFA 2Y36L 4QHMA 3X3FL 2I7OA 4MZ3A 3KJ6H 3F7LA 5KVEH 3IGFA 4A1RA 2Y06H 4ZX3A 1C16A 2I26N 1QRNB 3EOTL 4G8GB 2MWCA 2IG2H 5E1AA 3IU4L 5C8JA 1SVBA 1YNKL 3GSQB 2FCBA 2X89D 4QCIB 3AZUA 4FYSA 3K1DA 4PW3A 3ZYOA 3F83A 4NENA 2AKRA 1K85A 1BQLL 3NIFB 4L4VE 5T8IA 2XXGA 5J1AB 2R7EA 3KYNB 1OCCB 1HJCA 3O45B 1CTOA 3CXHJ 1WDAA 3LY6A 3VI3A 4AVHA 4Z7OF 3VI3E 4XN2A 5CILH 1Z5HA 1JF1A 1MH5B 2DD8H 3VG0L 5GGQL 3A67L 2EDNA 3KJ4C 3LNIA 2XLLA 3SY6A 4ORZC 5KS9E 4WTQA 4GT0A 5FYKU 4B9CA 2K3HA 3DO7A 1E6OH 4N87A 2HTKD 3HAEH 3SDXE 3K6SA 3BZ4B 4G71B 1OT2A 2ALAA 1P4UA 1CICC 4I4WA 4PY8J 1BGXH 4F8NA 1AOHA 1QFWM 2ADGA 2YEZA 4KZCA 3QDJB 3Q1EA 1QYGL 1CICB 1QR4A 1SDYA 2NCEA 2HVJB 4U3SB 3LS4L 3QFJD 3V4VL 3SE8H 1OB1A 2MKWA 3OMNB 3WXWL 1W72A 2CO7B 3UPCA 1ACYH 1I4FB 3SDXF 5CD5D 1LO4H 4FMKA 4TVPD 1G0DA 3BP5A 4MMZA 1K8DB 1MJJB 3UH8A 4DERA 4R2GD 2FUQA 4Y4FB 1MCWW 4H1LA 4BFIB 3EF4A 3O6FD 1LP9F 4YDVB 2QVFB 3FCSA 2JKSA 4GG8A 3CFKA 4NYLA 3L1FA 4QRPA 4Z7QE 1FGNH 3NAAL 4OZ4A 5JXEA 4C56D 1SN5A 2BIMA 3LSOA 1YHPA 5EUOA 3WTXA 1F4HA 4ONHA 1LXMA 3DYOA 1XV8A 1MY5A 4NCDA 2JKLA 5JW4N 2EJ1A 1GOFA 3QH3B 4K8RD 5BZZA 3QQDA 3F7QA 1HCZA 1A9EB 3IB4A 4NUPA 2ZX8A 3TONA 2XTJB 4FTDA 1ZSHA 4Z7QF 2HKFL 2OMVB 2Q2EB 3IVKA 1W72L 1BEXA 3QXDA 4P2OA 1V27A 3F7PC 1D5XB 3DVGB 4OLWL 4KJWD 3U46B 3GMQB 3DV4A 1BOYA 5KVEL 3QEGH 4LLDB 2E7LC 4GQPH 3BUIA 4NQED 3HIZA 1KCLA 2ENQA 3QJFB 4GKNA 1PYWA 1U93A 4XVUC 5IG7B 2WXNA 4JR9H 5PCYA 4MDJB 1NBYB 3KE0A 4F2MA 2IGTA 4U3SA 3IJ8A 2EYSB 1KTLB 1NCDL 4N9GB 4O2EB 3ZRFC 4F27A 1UTDA 3N41B 4ZAKC 4PR5B 1NC2A 4UINH 5DLML 4AEIH 1P84K 1YY9D 4Y16C 4BK5A 2XG4B 5IKCB 4HUWA 4ONFL 5DEGB 2O6FA 3P0VH 4PJFB 1FZOB 1S7WA 2VR3A 2OSLB 5EU5A 2IMNA 3VD7A 5DVMA 3QE5A 2Z9TA 4U33A 1XR9B 4JM2F 2QELA 4PBWD 4XNYL 4Z3TA 4JZOA 3BVNB 4F93B 5JXAL 1BF8A 5IFJA 1BFVL 5A2CA 4NRZA 5C0JA 1WAAE 4HUVA 2J8UB 6PCYA 3KLKA 2ZJSL 4TULL 3KYMB 3KMDA 1JYWA 2O1AA 1C5DB 2VLLA 4TLTA 1EZVX 4AMKL 2BS9A 2K1MA 5LUMA 3HUJB 1ILSA 5I2IB 3CQQA 1JCVA 1CLZH 2K9FB 2WLKA 3K6OA 4OLYH 2F68X 3WL9B 5EOTB 1KCUH 3GS7A 5DJXA 4DZ8B 4JO1L 4Q9QH 4KQ0A 4CMHB 1FORH 1U8MA 4XTRD 4FI8A 1HIML 1DZBA 1KIPA 4N2OA 1P4BL 5TE7L 4PJIF 1J8HD 2AP2A 4DHLA 1CL7I 4NZJA 3KYNA 3RZCD 3QULA 1A02N 1CXKA 2DI9A 4GXUM 1KF9B 4HUMB 2EIBA 5TDNA 5SWZD 3TNNB 1EQWA 4NN5C 4JM4H 4BUHA 2CMRL 1IGYB 1S7QB 3DURA 4YDIL 4JY5L 4KKBC 2WJ7A 2ODHA 3O6FB 5E8PB 3H3PL 2FX9L 4R5TA 3NSFA 2OA9A 1F90H 1S7RA 1MJJA 4GW4A 3Q05A 2W9LA 3JV4B 1WUZA 1P53A 2ZXBA 2EYRB 4PV9B 1BFOA 4ZX5A 2ED9A 1FFPB 3NA4A 6FABL 1UWGH 4EDXA 4HU8A 1UH2A 4Z7WA 1Z9MA 3CZEA 2ZKHH 3C5JB 2AJZB 5FUCC 3US9A 3FW6A 1JFQH 5E1QA 5TQ2L 2XA3A 5C2BH 4P57A 1TYJA 5I1GL 1RJYA 5C0CA 1F4YH 1XF1A 1FLRL 4AIZB 5JHLA 3W2DL 1DVTA 1KIQA 2WNWA 5E2JA 4CNIB 4A2MA 4NO0D 3AM8C 5DEFB 5HJBA 4EKXA 3TEUA 1YMMD 4JS7A 4MA3A 4MAYA 3WFBH 2DW5A 1OE1A 4B9YA 2UXVA 1EEZA 2EH8H 5FGBC 4D7BA 3GSVA 3I50L 4XN1A 1FVCA 3EYVA 5D4QA 4DO5A 4YFEA 2GJRA 4KK8D 5K59E 2OMTB 1JNJA 5CHNB 1O7DC 4QXUL 1G6RA 2IAMA 4YS4A 5J11B 1PEWA 2G75A 1Y1DA 2DOCA 1AGCA 2HX9A 4PJCF 5DHYA 5E5UB 2CDFA 1Z0MA 4UM8B 3L95A 1NWOA 2Q0ZX 2CHDA 3IDUA 4XNXH 3PWPB 5DFTA 3WD5L 3WJJC 5HDQL 1CDIA 4OCNC 2R1XA 4RZCA 3ZOAA 1VESA 1TITA 2IEPA 1X5KA 4J8QA 4QO1A 4TPRL 3B2DC 3FL7A 1U58B 4CVXA 3L3OA 1WV7T 3MVSA 1ZDSA 4DCQA 3D69A 4NP9A 1AQKL 2JKNA 1EX0A 1SVCP 1UCBL 5DK2B 4GW4B 1EXUA 5FOBA 4AMWA 3BX7C 4PGJA 4HPYL 2BY1A 4JMXA 2X4PB 5FUZH 4LGRB 4Z7NE 3L3OB 2B16A 1B0GB 1V5JA 4FXKB 2BY2A 3QORB 2CIKA 2C1OA 5CEZD 3WS3B 3GC3A 4PJAE 1UZ6E 4PLJC 3H2PA 4I18B 3ZTDC 5F1OB 3H42L 4N8VB 4WUUB 3BZFA 3VA6A 4JFHE 1YG9A 5TPWL 3ARTA 1RKRA 2NSMA 1URLA 4F92B 1RSYA 1BBJB 1XH2A 4UZUA 5DC0A 5CLYA 1OF2B 3ETSA 3GKZA 1KB9J 2HCZX 3OKMA 3B34A 3O0RL 1FV1A 4JFQA 1DBAL 2B15A 3GDCA 4FFWC 3UABA 3UG5A 3NT0A 3ZKXB 5DJYA 4HX1A 3ISWA 4QHUB 4WW2A 2VSDA 1DQIA 4PB9H 2Y6TE 1IC4L 3IYLW 3TO4C 3JZYA 4H13C 4FABH 3C6SB 3MRCA 4KMQA 4FC3E 2HT4D 2F0CA 3GI8L 3OVUB 2ICEA 3BKYH 3TNMA 1JPGA 2F7PA 1J05B 1IFRA 1FL3B 4Q56A 4WHYH 4XXWC 3P77A 2LU5A 5DRNB 4UT9L 4L5FH 4LAQH 3AU1B 3SKMA 3STZA 5JOFB 2X05A 1DVFC 4HOMA 4YSOA 1K5NA 3NK4A 3MGOB 1QLEL 4HC1H 3EJYD 3GHBL 4MQ7A 3BPNC 3NJKA 4ZMQA 2JVUA 5HDBF 1A25A 3N1FC 1GJIA 1QO3B 2DQJH 4OZHF 1MWOA 4QAMB 1BPVA 2FATL 1MNNA 4TLKA 4JRYE 5EC2B 4EQ3A 2BP8A 4H5SA 2JNZA 2QFPA 5D7IB 4GUPA 4XC1H 1RHHB 2VXQA 4PJ8A 4UOQA 2DTML 5JMOC 5KN5A 3LIZH 4KO9A 2R1WB 2WYIA 4UF7C 2ZZUT 3QQNA 4DW2H 4IQHA 1YA5A 2V9QA 3QEHA 3CX5K 4ZUUB 5K9OB 1J0HA 3UC0L 1PIGA 2X70B 2GJZB 5E1AB 5C8JB 1LO0L 3QEHB 2EC9T 1PX3A 3QNZA 3MCLL 3PGCA 1W8OA 1KENH 2Y3NA 5EU6D 3K2KA 3ZE1F 4F24A 4OF3A 4DK5A 1L6ZA 1YLBB 4OH2A 5E1GA 2Y6SD 2YEVB 4OT1L 3BE1H 3GBMH 1RIHH 2IPTL 4GBXA 3LB6C 2IAAC 3RL2B 3VYPA 4XHJC 2X6BA 2X9YA 3TZVA 4MJID 1TZIB 4HPYH 4QOKE 2NY1C 2JB6B 1IKNC 1I1AD 4JG0H 2OSLA 3EXLA 3HHMA 3V4PL 4NO0A 3I9IA 5D2NE 4NUJB 2HLEB 5F6HJ 4AGMA 2W0FA 3TBCA 4GFXA 4L4TA 5DC4B 3S37X 1T5WA 3ARWA 1B4LA 5BOJA 5KSBB 4M3KB 3VQ1C 5KVGE 2N4IA 2QSVA 4WV1C 1AHWB 1SHSA 3CJJA 5CEZE 3V5HB 3VSQA 5HYSG 3CHOA 5F1IB 5CZVL 2F18A 2V7HB 3QIUA 3CPLA 1JBJA 1E4XL 2J6EA 3PHQB 1UHVA 1AZNA 3HFMH 1WCBA 3RTQA 1RZ7L 4NZDA 4WENB 4Y4KC 4ZUVB 2DQHH 2V7HA 3QIUB 3PIQB 4KUCD 4P23C 4PJHB 3WUZA 2CRYA 1XF2B 4XN4A 2RQ8A 3U4AA 2X28A 2O6PA 3MRRA 3IMWA 5KJRH 3JWDC 4IRZA 2ZOKB 4ECNA 1A6TB 4UDTB 3VH8G 3WFBL 5ERWA 3RIFK 4H44C 1O5PA 4YFLF 3BP7A 4YPJA 1SBSL 3W2DH 3KPLB 4PS4H 1JD9A 2N7SA 3IJEB 4M02A 1CYXA 3NCJL 2NLJA 3LQMA 4XMVA 4BWWA 1HN1A 2JKRM 3AVEA 2A4CA 1P7HL 1FCGA 1NC4D 1XL4A 2AMUA 2WO4A 2ZTBA 5CINH 5HGAB 3P1VA 1HNFA 1JWSA 3G6JB 5FUOH 1U33A 3QUYB 5H2BB 2J6EL 2VXTH 5F3BB 4XXWA 3CFEB 4FRWA 4M8RA 5FGCE 3SKNA 4XPGL 3UG3A 3GZKA 2OMVA 4OFKA 2NDFA 1F90L 2Y5EA 3BAKA 5IROC 1PZDA 2WIIA 4ODTL 4AENB 4DT2A 4L1BA 2AJUH 1TTBA 3QO1B 5FK9B 3HHSA 3PUCA 1UXSB 5ACZA 1XGRA 2VQTA 4XNQB 5KOMC 4N6QA 1D9KC 5DXWA 4ELMF 1CE1H 5J3HD 2HUEA 3P69A 1MW0A 2FWSA 3VDBA 1X4XA 3U4BH 1S78C 3VFWA 2FO4A 3ILEA 4FI7A 5F3HA 5L7XH 4DGUA 4KXCA 3FCSB 2VXVH 5LBSL 2QKSA 4J6IA 2DWEB 3VFOA 3UYPB 3P54A 4MXWL 4CN6A 2RH0A 3O4LD 5AWNH 1XF2A 2W38A 1TSHA 1KBBA 1IGFH 1NGXB 4MQ7B 4WFGE 3OXRA 4N2DA 4MD5A 2ED7A 2YKLL 5FB8B 1EZVY 4M48L 1H15A 1G7MB 4MXQC 3VU2A 1MQ8A 1U58A 4R4FL 3PL6A 4XODA 2UZXB 3B2UC 3FULA 4XPHL 4CVXB 3CXDH 4AQ1C 4GW5A 1WS7A 5AYUH 1AMYA 2E9BA 2BSED 1S9VA 2NW3A 2CM5A 3LRHA 4JG1L 3NCMA 1I7RB 4YFLI 1GGCL 3P0VL 2VABA 1X9QA 2B4CH 5EUOE 1R3LB 1QA9B 1MNUH 4ELMB 1RY7B 1JFHA 2PTTA 3SEPA 1MFAL 1MCLA 3K72B 3SYAA 4E36A 5EEWA 3VUAA 5C08B 4RBPH 4N8VA 3FMGH 2VL5B 2PN5A 3BUPA 1AIFB 4XVJH 3HE6B 4MDIB 3DXAE 3U9WA 2AQSA 2HT4C 4ZUTA 4NQVA 4PRPA 3ULUC 2MPAL 1YYLL 3BH8B 2ZX5A 4I0PC 4PRIA 2OW6A 4P4RB 5KYNA 3GSQA 2DICA 2V33A 4UT6L 3JUYA 2D3VA 4XAKE 3CHSA 2H6PB 5HHVH 3VGGA 4D9LH 1MREH 1VKXA 5E9DB 3Q8AA 2HKFH 1BVNP 2CA4A 2P8PA 3L1GA 4X7TA 3O6LH 4NBYB 4CU8A 1X6LA 5MENA 1FHGA 2NY3C 5F7MC 1FO0H 4DZ8A 5FKAB 3GIVA 3B2MA 4N8CL 1UXWA 2HFGL 4PREB 4YHOH 1MHCA 3BAIA 4AQAB 5KBKA 3L4CA 1JPGB 3QUZA 4LSDA 1SY6A 4B53A 2A99A 2NQDA 4ENEC 4M56A 1E9QA 4K55A 5IF0B 4ZMWA 2BVYA 4QRRD 1BEYH 3MCKB 5CGBA 4LNRB 4HUUA 1MXDA 1K5NB 4JRXE 4MNGA 1PD0A 4PVBA 4F7TA 5SX4I 4IMLA 4JHWL 3DMMB 4LSUH 5LGJA 1MEXL 4HUNB 3S36L 4M1DL 4G1EB 1GZQA 4P59H 4L0ZA 4IMLB 1AKJB 4OJCA 5IMLA 3MBED 1JPST 2X09A 2WZPA 4EUPA 4F3FA 1CT8B 1JV5A 3GBDA 1E8XA 2R29L 2PO6D 2UZYB 2ZXDA 2X4OA 1OD7A 1SPDA 1JN6B 1DZ0A 1IKFL 1N7ML 3HKZA 4MNGB 4NM4H 4QT5A 5FC9A 5GS1C 2GUOB 4J2XA 4AQEB 1QOKA 3V8OA 3QYNA 1JGDA 4LBEB 4EZJA 3T1WA 1T1WB 4JFZH 1J8HA 2Z0UA 5ANHA 3SDDA 4ZX4A 4CN1A 5ENWB 2ARJB 1UA3A 2WMPA 4XBGB 4NQEE 2H6PA 1ZVNA 3UTSD 2VDQH 2LT9A 4YHZL 3A21A 5SX4H 5EO1B 1JTOA 2BFGA 1S9XB 4P23B 4XO8A 4MD4A 5B8CA 1OT1A 1S4IA 1J8HB 2GC7C 2VLMD 4S1RH 3FTUA 1IGCH 4X9FA 4NWTH 2XKUA 3QWRD 3IGKA 3ZHDA 5DJCA 2HT3D 2E7HA 3L3KA 4L8BA 1PPIA 1ROWA 5C0DA 4HWBL 3EG9B 1C12A 2OMUB 4I0PB 1T89C 1QSVA 2CRZA 3B9KD 2Q10A 2YPVA 4L2LA 3V6FA 4OD3L 5I1EH 2APVA 5C07D 1FVEA 1SXSA 2IQ9H 2YGVA 1SXZA 3L9YA 4WK4B 2WUCL 1GZQB 5I0DA 3RWJA 1NCNA 2XV0A 2H6OA 3RUGE 1JZJA 1BQHB 2EACA 5FO8A 1WWBX 1MJ7L 3HNSL 5IJKA 3HZYA 3FH5A 4HJGA 5HYQA 3TT1L 2XWBB 4XMLL 1E4HA 1S7XB 1X44A 4JDZB 3QRBA 4EN3B 4EDWH 1G0XA 3L5IA 2CKBL 4BQ9A 4U0QB 3RQ3A 1S9VB 2NW3B 1XHHA 4GAGH 2VDRB 4N20A 3W11D 2VN7A 4LF3B 4WI7A 1DBBL 3UMTA 1DDTA 3B5HA 1NAML 3HMXH 4PJBE 4TXVB 4PRPD 3O9WD 5JHMA 2FX8H 5DHVA 5ECGA 2H32B 3W0WE 3V55A 2OCJA 4RFEB 5IQ9A 5E9DA 4YE4L 4QD2E 2AJSL 5HHMD 4H25A 2A9AA 4JHZA 3U6RA 3VMOA 2NZ1A 2ILLA 2W0FB 1JMXA 4LRNH 3K4ZA 3HZMA 4HMEA 3UZQB 3QJUB 5JXEC 1ONQB 1MFDL 4HYTB 3OG6B 4JPIB 3S4SG 2F8OA 4KPHL 1IBGH 2NSQA 3C5ZD 3V5HA 1IGTB 2BM3A 3PNWA 3TESA 4U1GC 3UBXB 4YHYC 4UIMB 3O2WL 2VDMB 3PWPE 1ACZA 1DYZA 3JWNG 1BBDH 1UXSA 3A4EA 2UX6A 3JWOL 3BPOC 3QFGA 4P2OB 1OPOA 2FGWH 1KYAA 4CGTA 2XIIA 4OZGB 1KGWA 1CXLA 3D06A 5AOJA 1RVFH 4AIEA 1KFGA 1KULA 3RX8A 4H20L 2B20A 3DWTA 3F58H 2FH8A 3QFJE 2NOYA 5KYYA 4FZEH 1E5YA 4P4KB 4ZSOB 2J20A 3CMOL 1E9PA 1JWUB 2RIKA 4J2QA 4U1MA 5TE4H 3S36X 1OAQH 1PZAA 1CWVA 2A9CA 1XIWA 2Y69B 3FU3A 1JZGA 4GSDH 1KYFA 2B0SH 4MA8L 3SDAC 2OFQA 3FU6A 3LEVL 3IDIA 1AGFA 5E5RB 4TN9A 2CGRL 4NIKB 4NRXA 2DQCL 3FTXA 2N59A 3QIBA 1ZK5A 3OAWA 1VADA 1BOGA 2YJLA 4PP1D 2WWKO 3FCGA 3JTBA 4Y4KB 3T3ME 4AT6A 4B9JA 4A7TA 4L48A 4W93A 4ZFOL 4N2AA 3A6BH 5GGUA 1J10A 3MMEB 4UAHA 5J9PB 1MRFL 1BJ8A 1CYGA 2QR0A 2F1BA 1CE6A 4KUZH 1EDYA 2VDOH 4X6EA 2ORBL 2L04A 4ODUB 4K71B 3ZL4L 1OAKH 5FGBA 2Z7YA 2DWDA 1KZYA 1MFEL 2ID5A 1AGDB 1KXQA 1N3NB 1U91A 3IFPA 3PL6D 1YMMB 1B0RA 4Z8FH 2CCWA 1ZWIA 3ULSB 4DP4X 4M8QA 3STLA 1DLHA 1TQWA 5BQ7B 5DQDH 2R56H 3EGXA 4JFFE 4PJEA 4ADJA 4MMXB 5CWSB 1MG3C 2A83B 1FNGA 1RK1B 4DP9X 1HH9B 3RVUC 5FDWB 4IRJA 4JN2A 4ABWA 1NCBH 3MUUA 5AOMA 3RI5K 2AK4B 1TZIA 3FQ2A 4LSTH 1FZMB 3FU5A 4G9FA 3ZIYA 4E41A 2XQBH 2MJWA 2AK4A 3DGGB 3QPXH 4AGPA 5HGHB 4M6NL 4M1CC 1XL6A 4IU2B 2HZHA 4Q97A 4U6YA 4JJ5B 5J11C 4X4KA 1BMGA 2VDLH 2VKXA 5H2BA 3WHE1 1VFAB 1L7TH 1YEDA 2V8MA 1QWNA 4YJZL 2FQFA 3US1A 4UYPA 2WQXA 4L0YA 3R18A 4F7MB 4OFVA 4WTXA 3F64A 4CILA 2AJXH 1VEOA 2Y6SC 2DYPA 4NGHL 4X5XB 1QTPA 2R2CA 3LKNA 5FWRA 4DKEL 1H5BA 4MAZA 3V0WH 1O0VA 2YR3A 4PP1C 3V52H 2CAKA 3WELA 3POCA 2HN7A 3QCVL 1ZGLM 3O6KL 5IJKC 1AGEA 3OQRA 3B8YA 1DANU 3B9AA 4U7SA 1DSFL 1JHLH 1U8LB 2LLGA 1R6VA 1ZLVH 5CF3A 3G6DL 1U8JA 3EH1A 3O6ML 5DQ9A 1DJZA 2HP4A 1E30A 2G9HB 1F0LA 3ARUA 1MVYA 2OULB 3F8UB 4F20A 1H0DB 4GRMB 1OPGH 1JHLL 3KR3L 4LEOB 2ADIB 1E4WH 2Y72A 4JFDD 5T3ZD 4E9LA 1Y07A 5ANMA 1LDPL 4X9IA 5DRNA 4Z7AA 5IMMA 3V5KB 1CFQA 2O6CA 1O9ZA 4P4KA 4GRWE 4JDTH 5JZ7D 3V52L 2XZCL 2VLRA 3U0WL 4YVUA 4NQCD 1E40A 4LLYB 1FNLA 4JZJA 4NDMB 2YZ8A 4OAWA 5I18L 2O61B 2YC1B 4UQ9A 2VYRE 1XSKA 1S8DA 3LN5B 1QACA 2QDWA 3NCCB 5E4EC 1ERNA 2YSSB 3G9AB 4OLZL 5MHSE 2QQLH 5E00A 3KPOA 4NNYB 5EOCH 3UL4A 4NXSA 4IBSA 4PWKA 4OZHB 1MQKH 1NM9A 4XNZB 2FJHB 2IXQA 3TPKA 3L4YA 3OMZA 1IC1A 1PD1A 1SMAA 5KN5B 1AE6H 3LS5L 3TN0B 5C0NC 4M4RA 1KIQB 1PNDA 3SZKC 3ET9F 1FBIH 4B50A 1BJ1H 2JTDA 5FCUH 4LSTL 5T1KD 4FJ6A 3DO4A 3WY2A 5HHXH 4CDHA 2LFEA 3DX6B 3QDGA 4P46D 1WTGT 2Q2LA 4S1QL 2BW5A 4FQHA 4XVTL 1M2VB 4FJZA 3DX6A 3QDGB 5LBVA 4QAWA 4G6AD 2WLIA 2A6JB 3MXVH 4XNUH 4W9KC 5HHOD 3FFCD 5JNYB 5L4JA 2NY0B 5BO1L 1P7KA 1CDGA 1GSKA 1OE2A 4MSWA 4PVLA 2R83A 3FN0H 5EN2A 2ZOTA 4PTUA 3T1FA 4N3TA 3VXOA 4MJ2A 4RGOH 5I75C 1BLNB 1XGPB 1XZWA 2COQA 2GB2A 4OCWL 3CLWA 4TOYL 1CTNA 3RKPA 1M1XB 3IETB 3U7YL 3PWUB 4WSGA 3VRIA 3KYKH 2ZUXA 3GJFK 2L0DA 4UTCA 5B8CC 1OV8A 5ESQB 2A74A 3NCBB 2XV3A 2XWCA 2YA2A 4KMTL 2ZIDA 3HNTH 1QI3A 2CRIA 4JO5A 5IV2B 2B0SL 4MA8H 1W0WA 3O3AB 1PY0A 3BSZL 4K94H 3DSFL 2YMXL 4FNSA 1JXDA 2Y07H 3V0DA 4RAUA 4BD4A 2X9ZA 4AIOA 5LDSA 4JZOB 5TE6L 2IH1A 2H3KA 4J8RB 5EBGA 3WJLC 2MCG1 5A7EA 3BUTA 3ZR6A 4MJIB 1YNLH 3UTZB 3ZGIA 4OLUL 3TCLA 1FV1B 4JFQB 5GGTH 4RMTA 1X5ZA 2IFGA 3MREB 5CCKL 5ADOL 4OB5L 2X44D 3RBGA 2EXTA 4D3CL 2WMPB 1HHHA 4K3DL 1BP3B 2V2WB 1FZJA 3S96A 2XQYK 4KTEH 1JXKA 1KYOJ 3PAYA 3F6LA 3OZ9H 4L8SC 4LXFA 4WU7A 1T7XA 4KK5C 1YAIA 4M4PA 4UBDC 2VDPB 1A6UL 3G5XB 1PLCA 1YYML 5HI3C 4MMXC 1ZTXE 2V2XB 3ZE2F 5EH1A 5SWSB 5KSBE 3ZE2B 1LEIB 1BZQK 3U9PH 3EBAA 4DWHA 3TA3C 2AGJH 3C6LD 1B4TA 5C7ZA 4F3FB 4DQOL 2NCMA 4A2HA 4QRPD 4XNMB 3FU8A 3V0GA 2KBGA 3LHPH 3HC0A 4PGDA 4G8EA 4S1SH 2Y7NA 4HD9A 1R5IB 3MJ9A 2WBJB 3DRTA 1JGDB 1T7WA 1B4JL 1BIHA 2BVUA 1IEAA 4LBEA 1XMWA 4HAGA 3MR9A 5LG1A 4KJQD 5KSBF 4AYMC 2X2YA 1FG2A 1SUJA 4XMTA 2Q7YA 1VFUA 2EIZB 2YAOA 5L2JA 3BLKA 3BC9A 3HPJA 3RFZA 1HHKB 4XWGL 3C60D 1ZLWH 3FT4B 4P57B 3TM6A 2Z31B 1JWMB 3GMPA 4X4MA 5CO1A 2E86A 4GAYB 4RISL 4XMZA 2O93L 1IGIH 1EUUA 4B7LA 1HH9A 2VM4A 4TQHA 1ZHNA 1BZDA 2A9BA 2XG4A 1BXAA 4PJGE 3DVNB 4GI9A 4Y5YC 2PPDA 2BVPB 4W70A 4FFVC 4NRXB 3HI6L 5I82A 2AERT 2Z35A 3L17A 5KVFE 5HI5C 2B2XH 3A4AA 4LRIC 4OD3H 1MHEB 3UIYA 4HOZA 1SQMA 1TTRA 2AXGB 4ZUSB 5J6SA 4C56A 1PZUB 1M1SA 4X6DF 4LOEA 1A7BA 4X6DB 3L1EA 4G6KL 4GXVH 1F11A 5DC9B 1IV8A 4RGMC 4GW1A 2PYEA 4G3YL 3EJZC 1IBFA 2JB5H 2VT0A 3QWRA 4K7FA 3SKOB 1UENA 4KQ4L 5FFOA 1EZSA 1ZVYA 3U9UA 4F7MA 5IFAL 1BD2D 4KAQH 2AVFA 1KCSL 1U2YA 1KPRA 4LARH 1VGKA 2QQNL 1KJ2L 4F1SA 4N2KA 2WC7A 3NFSH 1I31A 3RILA 4X6DE 2Y9RT 4R90L 3WNMA 3FT0A 4YHYB 5CR1A 1FA4A 1IIIA 3CZLA 5A6IA 3QULB 4JRXD 1Z0NA 2YQ2A 4TUJB 5L0QB 2P42B 5F93C 3QUYD 3BN3B 1E5UI 1CGTA 3CAFA 3HC4H 4XCFH 3VXSE 1OY3B 3PWJB 1WRFA 2XZAH 1MI5E 2OCFD 1E9OA 2RFXB 1QRKA 1CFTB 4XBMA 1CFSB 1TO5A 4P2RB 1GZHA 4YBHA 3UJTH 3MRKB 2R8SL 3DNKA 4K9EH 4GKLA 3ILPB 4DZBB 1E65A 5KG9B 3BGMB 4JJ5A 1QI5A 3GMOB 4N2HA 3THML 4IIZA 1BW8A 1T22B 2XVLA 3C9NA 5HGGS 2MOGA 5K59F 3V6ZA 1RZQA 4H8QA 1HWWA 2QADC 1HOCB 3ARSA 1S9YB 4JHWH 4CU6A 4PRBA 2JXMA 1KTCA 1RK0A 4H7VA 4KJPD 5F7NC 5TDPA 2MNJB 3GLEA 1BX2A 4J8RA 1HSBA 4P46C 3REWB 3FQNB 2JQZA 2GJ6E 4KVNL 4N0UA 3PP4L 4DKFH 3Q2WA 3BW9A 4ZBJA 3H56A 2O5ZH 4LVOB 3STLB 1BOGB 4AT6B 6TAAA 4RSVA 3MV7D 2DZEA 4PGDB 2R8SH 5LG6A 1IM3A 1I7UA 5GRVK 4PJ9A 3U83A 3RZCC 2WNXA 3BWAA 5CLXA 1KPVB 2YWZA 5JIDA 1THCA 3HS0C 3P11H 3JBG7 5SWSA 4Z7NF 5C70A 3KPMA 1P7QB 4LNVA 1I8KB 2ZWLT 1JPEA 4IJ3C 5AAPA 4PJAF 1M71A 2E27L 5I9QB 1RXLA 1V7NH 3ZUNC 1DVUA 3NZHL 1FDLH 2RJMA 3MDJA 1IL1A 5L8LB 3HC0B 3TA3A 5FS5A 2YAQA 4NN7B 2YPLD 1KCSH 3AQDA 1PDKA 3AABA 4U05A 4UTBA 4JGMA 3WGUB 3EYQD 1I1AA 1OGPA 4KQ4H 3BSGA 2Y1VA 4OUUB 2ZCKH 4HCRL 1LQBC 5T3ZL 5DMIL 3SGKA 5C3LD 2HT2D 4FXLA 1PQZA 4I13B 4M62H 3TBYA 1D7FA 1PCXA 2HXAA 4IIQB 1D9KD 2P7TA 5CEZH 3TGXA 5DMKA 2BXZA 5D6DC 3FUIA 2EAEA 3C8DA 3WEXB 1PZSA 3UBGA 4BWTA 1WS8A 4F9LA 2XWZA 3GIZL 1A0QH 4N0YL 1JYNA 2B2XL 2AK1L 3D6GA 3QI9B 5F6IB 1IQDA 1A66A 1YNTA 4M48H 5TH2A 1Q9KB 2XXMB 4NNXA 4MB5A 2A77H 2DL2A 2ENPA 2YUXA 1QW9A 1ADWA 2R0LH 4P2QB 3L4ZA 1D2OA 4J1UB 1T0MA 3WFHB 3WSQH 2P5EB 5G5DB 5IFHL 5JPMC 1BZEA 4HJ1A 4NC1C 1IGIL 3LQAH 1A6WL 4KI5D 3WV0A 4B5ZA 1FPTH 4IIQC 2CDGA 2GSIA 4FFZH 4BFOA 1MF2H 5DC2A 2N56A 3HI1A 2X4RA 3DXAA 4U1KA 4ZXBD 2NY2D 2VB5A 2OJ1A 3GJFA 4MX7B 4OZHE 2IH8A 4JFPB 5K1NA 1LM8V 2VLRB 2E4FA 1M05A 2VDMH 4P5TB 3UTPE 1E5BA 2GSMB 1IAIM 3WTWA 2PWEA 4NBZB 4WF7A 1DVQA 3HG2A 3SSGA 4WI3A 4EI0A 4ADGA 4GT7A 2AV1A 1UATA 2NQ3A 2XZQH 3DUUB 1CUOA 4R0LA 3PJLA 2GY7B 5JDSA 3T2PA 4JFEB 3NGBC 5EB9A 3DJ9A 3IXTA 1CB4A 4JHAL 4LO9A 1ES0A 2X0VA 3RHWF 1BBJA 4I1NB 3BVTA 4MDRA 4B9ZA 4GPVA 1AZBA 3KPSE 3LD8C 2JJTC 3O4LA 1KIUB 2NR6A 1AQHA 2UXFA 3LNDA 2F53D 4KHXH 4UMGA 1L3NA 4P5SA 4PWEA 3L9BA 5JORA 1L5GA 2KQMA 3MRJB 3GNML 5EOQL 1TVBA 2IAMC 1NBQA 1NFIA 3QJVB 3P3SA 2WYTA 1QFWL 3AQXA 3KPRD 2FUTA 3VD4A 4RVBA 5MEQA 2B5IC 1VGEL 1TVBB 3MNVB 1ZS2A 3VI4F 5D2LA 1OANA 2NYYD 2MTPA 4KRPD 1GC1L 1OWWA 1NEUA 1KB5L 2YD2A 5GHWL 1CLVA 1NLDL 3ALXA 3TJHD 5TE6H 3VSUA 3IJHA 3S2AA 2JWYA 3G5XA 2EILB 2FJUB 1AG6A 5CSZB 2CLVB 4RX4D 5CN3A 3LNEA 4G7YH 4MYPA 2WTRA 1LP9B 4HIEA 5DD1H 2FBRA 3DECA 2AVGA 5ID1B 1FAIH 2OQJB 1R24A 1OAXH 3NJVA 3B5GA 2CR6A 5EO9A 1CO1A 1LO5B 2HX8A 1NIAA 3C12A 3CVHL 1NAMA 3IRPX 1IKOP 2VN4A 3KWXA 2VDPL 3OKOB 3D39E 4OGZA 5CGYD 4PGEB 4LMQE 4MMXA 5CWSA 3R4RA 4D0DA 3RWFB 4RWYL 5FYLL 2AJYL 2YPVH 3J8F7 2XWDA 4IRSC 5TF1L 3RIAK 4GIAA 4W9CC 2WSPA 3UAEA 1TFPA 1YC8A 4M8VA 3PL6B 5D7EA 3BE1L 2VJ8A 2GC4C 5CM1A 3T65A 4FL4C 5IQLA 3WKYA 2NY3D 1AY1H 5KANI 2UZIH 4HK3J 1KWKA 4M93C 1ECZA 1JNHA 2ATPB 5IVXE 1FVEB 3G5YB 3UAJA 4PV1C 1RJCA 3NABH 4CKVX 3C5ZC 5E8NA 2VQ4A 3FO9B 1LD9B 5EN3A 5MEQB 3P4MB 3H9YA 4KX7A 4FD0A 4JFVA 3NH7L 2DAVA 3TWCH 5CEYA 2BP5M 4X0NA 4QYOA 4AV0A 3TBWB 1T3FA 4MZ2A 5DMKB 3LIZL 1VFBA 2XXCB 3CX2A 1QBBA 3BXNA 4TNFA 2GI7A 3PWVB 2C34A 4HIHB 4AYEC 5I1JL 4Z5RA 1PCSA 2XNAA 3OB0H 3IRCA 5D1ZI 5IHBA 5JQHC 3D8MA 4JVWA 4OZIA 4MA7L 1FNAA 4WUKH 4BELD 4HSAC 2DQDL 1TETH 4JG5A 1QSFA 1W9XA 3LPGA 3AWGA 3MNWB 4KKNA 1CFNB 1XEUA 2VJXA 4P3CL 4G83A 4CKQA 1MVFA 1KPRB 1NUDA 3MKGA 5I18H 1A9EA 1LK3L 5KZCD 4QRBA 3VXUD 1BIIA 4MNHA 2CK2A 4Y5YB 2BWIA 3HS9A 4MX7A 5GGRB 3HUJF 2EIJB 4OD2B 4M6ML 5AW2B 1DQDH 4KNUA 3K6NA 4QXTA 2I5YH 2CBOA 5B39A 4AQ8A 3X1EA 1A1MB 2ADJB 2AQRA 5KANG 4WHYG 1IM3B 4A66A 4MCNA 3QIUC 1H0DA 1PY4A 2FK9A 3MSPA 4G8FA 2J72A 3EGXB 3FT2A 4IBLT 4HFUH 3B7TA 5G4NA 4TM9A 3IWVA 5AALA 3SDYL 1NBVH 2QFRA 1BD2E 2OJZH 2ZPKL 2B1HL 3NJLA 5FM5M 1TENA 5H35A 5DUPL 4YSSA 4IMKA 4LAJH 1JZ4A 3G04B 3TFKC 3NIDE 3QNYA 1BXVA 3J27A 2UVEA 5HJGA 1BM3H 3VFPA 2E6PA 3GBNL 3VW3H 2DLEA 3X1GA 1Q9LB 5I1IH 2Z31A 1OW0C 2WSKA 2VDRL 5E2TH 4NGHH 1DCEA 3KCPA 4M5YH 5AB0A 3LZFH 4YSCA 2PWDA 4JFFD 1BAFL 1NBZA 2NZIA 2X6AA 3QJZA 3WIFB 4AUYA 5ES4B 5J57B 1ZIAA 3NESA 3BWUF 1R34A 2ADFL 1D7CA 3BJLA 4OUUA 4WGWB 5TK2A 1CQKA 3JWDL 3LKQA 4EIZC 3DTXA 3L3HA 3HC3H 4QRQA 4POYA 4ZI8A 4W9LC 4XMXA 3ZKND 5CFHA 2FQGA 4X4ME 4PGCB 5IB3A 1M6UA 2DMBA 4OF5A 4DN4H 3CE1A 2C4XA 4M5YL 3VXRD 1QNZH 2K4WA 1GPOL 1G7LA 1H5BB 3U1QA 3T8VA 4JM2D 3SKJL 3KWTA 2VIRB 1DEEB 1DQJB 4ZO6A 2ZG2A 2XJKA 5DJXB 3MOAH 4JQXC 3WIHA 1M9WA 4MVBC 3BAJA 3L3KB 4NC2B 2FHBA 4Z3IA 2CKNA 4PJCB 5DR5L 4FZ8H 4F7EB 4NO3B 2ITDB 3NN8A 4MJIE 4ODWB 1MRCH 3GSNA 3TURA 3MXWH 5HGAA 3FPYA 3BKCL 3I50H 2GT9A 2W1NA 3QFDB 1CZ8L 4I77H 1T2JA 3MREA 4KY1H 4N0CC 4EMZA 3G04A 3SE4A 5D7IF 2CBMA 3H7BB 3VX0A 3GSOB 1PYWB 1OKEA 3H4FA 4K5MA 2IADB 2IANA 1KTRL 4M43H 4MJ6B 4ZOAA 2VLJD 4DIXA 5K9JL 4QKTA 5D71L 3IPEA 3WKNA 2NYZA 4P3CH 1FYTB 1C5CH 2O72A 4GRWH 3TBSA 1I1AC 2ZKHL 3QI9A 4Z0XA 2DWSA 5E8DH 1NMBH 2NY0C 2NQCA 5CZXC 3L48A 3D08A 4GKZA 2VISB 4GBXD 2BK8A 2R29A 3U36B 4NQDD 4Y2DC 3OM3B 2FD6L 3CVHB 3DX8B 5HD8D 1CXEA 5ACMA 5I1JH 4RX4A 4HWZA 3SE9L 1EEZB 4MS8D 3S3CB 3GSRA 4B27A 2NDGA 3CMOH 4H0HB 2AXFB 2R0KL 3KPQB 1LE5A 2Z1PA 4QRRB 1I9EA 1TKWB 3BRGC 2OTWA 1T22A 1NFAA 3TWCL 3VFTB 2X6MA 4QHPA 1DUYB 1ZRUA 4NZFA 1M71B 3N40F 2G4EA 2YQGA 3C6LB 3RZWA 5C0GB 1X5IA 1QR1B 1EEYB 1UWEL 5F71A 4P5KA 4J3SA 2JTYA 2ZCZA 5AAWC 4NZTL 4K8RL 2QMKA 2GTQA 2NY7L 2FWUA 2YAEA 3FUNA 3LOWA 5FW6A 2KLSA 2VE6B 3D39B 3QC6X 2LE9A 4MAUH 4YXLH 2AJYH 2YPVL 1QZNA 4IBUA 1FO0A 2LOEA 4NQDE 4U1GB 1D5ZB 3W9DB 1YPZB 3HE6D 1N64H 4PV8A 5IUCA 3BEWB 3VXUA 1LP9E 3K8LA 2VRQA 4NKOB 4YHIA 3M8OH 1TQVA 3BPOB 1HH6A 2LU7A 2ZG3A 4GW1B 3I84A 2UVFA 4BRJA 1T66C 1CGSH 4QR7A 2CO7A 4YFDB 2VLKA 4NZ8A 5I1LB 1KGUA 3KG5A 1H3WM 4PI2A 5DZNA 5F6IC 5B7EA 2VW4A 2QLVB 3EFDL 4G7VL 4B41A 2ZCHL 2FGZA 4X98B 3WEOA 1JPTL 4TQIA 4EZKA 1NGYA 1S78D 1RJYB 3ULVD 1SLVA 5EF2A 3O6FC 4X80H 2DH3A 3QAZC 4BQ8A 4PPTA 2X41A 4HX1B 3VRLE 3DOIA 4H1LG 4Y1AB 3S8GB 1CC3A 3IBEA 1J12A 2XDHA 5F9JB 4KXBA 1VEPA 5ID1A 1KB5B 5DTFA 1J1OL 2FECI 1TZOA 1FSKB 5C0AD 1I1YB 5A2KH 3C2AH 5C2UB 1QFHA 3U7WH 3WGVB 1NAMB 1KTJA 1KNOB 4PCKA 1CFBA 1DBKL 3K8MA 4CC1A 2PPEA 1F13A 5F8QC 5LAXA 1CD1A 4FXGA 4MCYA 3MRMA 4PTTB 5HHOB 3GJFB 5IIEB 3DRQB 4K3JH 1CN4A 3QUZB 1TTFA 1F3JA 1QPKA 5CP7A 4OVVA 2WWMD 1ZS8A 3BSHA 1PKQB 3DX4A 1UADC 4N90E 1QSFB 3EBIA 4HCGA 4QHLA 1U8KB 4GMTL 1H3PL 1HX0A 1OGTA 2GFBA 1NIEA 5E0FA 3N1MC 3WOVA 2LFGA 3WY3A 2J43A 5D7HA 4CUCA 4LDEB 3WFEL 2A9DA 5D7IA 5L6YL 1IFHL 2W0PA 2ARJA 1PW3A 1F3JB 2MMXA 4DUWA 1UA6L 3CSFA 5E9NA 4KWUA 2BIPA 3P9MA 5HI5D 4OQTH 1B4RA 1XAUA 2KDYA 12E8L 3VQ2C 2D03L 4WW2C 1ZHBB 3LZOA 1NGZB 3OKNA 4NI6A 4I9WE 3AADB 3KPQA 4H25B 4IGBD 2ITCB 1MF2L 4NM4L 4Y5VB 4YEEA 3V6OE 4UZSA 4XCYB 4ZT1A 3UBFA 1G7IA 3GJFH 4PYGA 3ATBA 4JFFB 1CK0H 1KEML 2R4SH 3OJMB 4LLUB 4JPSA 3ZR5A 1MPAH 1RQ5A 2VR4A 1VZIA 3QHFH 4E5XG 4ZMPA 5TGBB 1IC5H 2RQEA 2VZOA 5ENWA 5DJ2B 2PUQT 4JPVL 5BRPA 1E6OL 1TU2A 4LLVB 5DWUL 4NI3A 3FH7A 3WKQA 1C5DA 3GEWB 1HEZA 4YLCA 1QBML 3OKDA 3ATEA 3GBLA 1RPQA 3QHZH 5IHUL 1FJ1B 2L3BA 1JNLL 5CEZL 1XGZA 1U91B 3PXLA 1T2QH 3PDOA 3QUHA 3MJ9H 1AO7D 3GUTA 5DRXA 1XF4B 3MACL 1AI1H 1HXYA 2YHGA 2Z4QB 3H55A 4PJCE 4YUEH 4PJ9B 3EOYG 1LO5A 4G42B 4MGXA 2YXVA 4XZUA 5IB1B 2NT0A 3L16A 5DD5H 1UVQB 3NA9H 4AUUA 1MREL 3EDEA 1KXQE 4ZTOH 5DJ8B 4DK6A 1H9VA 5FYLD 2B7DT 5H94A 3WFDH 4L37A 3AT9A 3VFNA 4KKZA 1Z66A 2F1EA 3MRIA 1FP5A 3RTQC 4DP7X 4ODBD 1A7NL 3E3QC 1EO7A 1QBAA 2IWGA 3KBPA 3U30B 1R9FA 3ZDXB 5JW3L 1QASA 3SDXA 1WITA 3ESNA 3RB7A 1VFAA 1YEDB 3RZCB 2BSTB 1F2QA 3H2QA 1LO2H 2NNRA 2K6WA 3HE6C 4AYBA 1CVSC 3NACL 3QXWA 4ZUUA 5K9OA 1ETZB 1I85C 3M1BA 2MQ3A 4Y7MA 5IJDC 4CC0A 3W56A 4CSPA 4MCYB 3QHZL 2C3VA 5IHUH 4Z9KB 3C8HA 2CZNA 2IMMA 2F8XC 2JJSA 2WNKA 2ZKXA 5E5MB 2LU4A 4XCEA 1I53A 3KXFA 2VZUA 1G6RB 2IAMB 2YQBA 1OCWL 3C60C 3WHE0 5HSFA 3R0MA 2DTSA 2WGXA 5A6MA 3FCTA 1IC5L 5F9JA 4H26A 2SEBB 5F9OH 4K2UL 3BW9B 2JV6A 4BYHA 1IGFL 3U4EB 1ORQA 5DZ9A 4DTGH 1SXAA 4KJWC 1S7TA 4M5SA 3SYOA 4A55A 4U7MA 4WI8A 3KLHC 4MXWH 1FH2A 4L3CB 4TNVF 3WIIH 4NO0B 2XQYA 4JRYB 2VXQH 5ICUA 4UZGA 1YNTF 2CJSA 7FABH 1L9TA 2DYRB 4PJDF 1UWFA 3O8XC 1A7OL 4NAQA 4QLRA 2EZ0D 3S6CA 1R0AH 3CFJA 2C9UA 2CBTA 4N9GA 1A7QH 4I87A 4LCCC 1EFXD 3N2JA 1A65A 2WSDA 4Y4KD 4JB9H 2PW2B 1O6TA 5J9PA 5A7BA 1SEBA 2ITFA 1Z9SB 4L9LA 4JFOB 4MCMA 4MJ5B 4WU5B 3DJRA 3QCTL 3T0EE 3ROLA 3HFFA 3L3GB 3EKCA 3IPBA 4IBYA 5E7BA 2ZP8A 4FJYA 3QB7C 4PJDE 3GRWH 4ZAKB 5BJTA 2EKSA 2IPUK 3SJVD 1NGWB 3VXQA 2IOIA 1G1KA 2JB5L 3HE7D 4F58L 1IBYA 1RUML 3L4WA 5B39B 1B88A 4LK4A 3LRSA 3ROOB 3D09A 5CJQH 1EAOA 3ZTNL 1CFVH 1OF2A 1YC7A 2JCCA 4QF1B 3IMBA 1JE6A 1P0SE 3NCWA 5ICXA 1KXHA 2Y5TB 4JPWH 4YWGL 5CZXD 2XTJD 4BV1A 3RUGA 3IJEA 2YA0A 4AG4H 4BKSC 3LH8A 2V2XA 2XV6B 1MFVA 2ZOUA 3N44F 2BRQA 5AVSB 4DK3A 2VSCA 2MRYA 2J25A 4OM0H 4KI5F 2DQUH 4GP8B 1N8ZB 4OFYA 4Y9EA 2DBJA 5FIEA 3S9DB 4M8QB 2B1OA 3RL1A 2WXQA 4DEPB 2EDYA 1YEKH 1JRHL 1EHAA 5HDBE 4NNPL 3GMLA 2OYKA 3P77B 2HG5A 2M8XA 1SM3H 3VTMA 2I9TB 4OI9A 1CLOH 5LGYA 4NRYB 4ZYKB 3VFNB 5CZVH 4JFYA 4XVOA 3T2NL 3VI4A 5K9QI 1CG9B 4BZ2L 3B4NA 3NYKA 1XCTA 3BT2H 4K7PL 5KVDL 5HYIA 4K2UH 3GXFA 5F9OL 3L6FB 4IJ3B 5AZEH 1B4JH 1YN6A 2PW1A 4YHLL 4XXDA 5K93A 2J8HA 2KZKA 1GMIA 4HT1H 4PJFF 2EE3A 2WKOF 3L6FA 2HN7B 3O3EA 4R3SA 3HPLA 4ZXBB 3QDJD 1AHWC 1JGLH 1FFQA 5SWSE 4JRYD 5DS8B 3VI4B 5G4MA 4LVNB 2GIMA 3Q6GL 5DMGD 4D8OA 4L8SA 5LGJB 4UOW1 4KRMB 4BWUA 4ZFZA 5FF6B 2AZAA 4QHUA 2HRPL 3QUXA 4WW2B 2NY5C 2X4NB 3LKRA 3EDKA 4WLCA 4L4VD 3EBGA 4HS3B 1RUAL 3KBFA 1O9VA 1F45A 3QNZB 4BSJA 2BOCB 4F8LA 1I8IB 2PCYA 1AGBB 3QAQA 3HC2A 1NCCH 3R8QA 3T4AB 1IARB 2NY2B 3D9AH 4P5MB 4UYQA 2Q3AA 1JHKL 2FLRT 3US0A 2BSSA 1D5RA 1C16B 2VNCA 1BPLB 2AJVL 3KPSB 5T1KA 3SKUD 1DJIA 5IGXL 3RVUD 1ZK9A 2K4AA 4HZAA 1CF1A 4Q89A 4CMMA 1OD9A 3POHA 1I3RA 4XOCA 4OBSA 1LEIA 4FLHA 4NYLB 2B59B 2Q3ZA 4RMVA 5J1TC 3ZKMD 2ERJC 3VSTA 2BNQE 1U95A 4UT7L 3JVGC 5ESVB 4ELME 2P5WA 4XE5B 2HTKC 5LB1A 2GCYB 2EDOA 3MJ9L 4I48B 1UM6H 2BZ7A 4W9HC 2QVMA 4ALAH 1JZDC 4MNQB 3KWVA 2FE0A 4KZEL 1RK7A 1KY6A 4EI5C 4YSAA 3QXVA 4N0CD 5DHEA 3U7YH 4TOYH 1NGPL 4UV7H 2W07B 5C0IA 1S7SA 4RGOL 4W4NA 5E4IA 3GXTA 4KZDL 2JMRA 4NZRH 4KKBD 4YHKL 5DRXB 3ZTJG 4V1DB 1HINH 1DUYA 4NOFA 3CGTA 4GSUA 2ADGB 5E8OA 1HHJB 5F6HI 1K2DB 4F37F 5I28A 3D0AA 2CD0A 4KK9C 2P3YA 2CRMA 3LKPA 3QUXB 2VSKB 5CUSH 3MXWL 3EO0A 2YUVA 1I3GH 5BRZB 4IBTA 5EFIB 5IBTH 3IMRA 4XBEL 2DQGH 3WLWC 4CVZB 2UXTA 1JXFA 2YK1L 4LF3A 5FCSH 5KVGH 3DBXA 1ZMYA 5F7DA 3RWIB 4DOHE 4OV5B 4KHTL 1QI4A 4GSRA 1GZPA 1UKTA 2KC0A 1ZXKA 3BO8B 3ARGC 3OR7A 1T83C 2Q6WA 3T3PE 1T1XB 4JJHA 1CG9A 2BSTA 1P4LB 1ZT1B 2B3IA 4NLHA 4HF5H 3OGOE 2X4SB 1N6UA 1OZUA 2NY4C 3UZEC 1ET5A 1MVUB 3JWDH 4NHCH 3QBTB 5EOCL 4HUKB 5LDUA 3E6HB 2P5WB 1RZGB 5JYMA 3OLEA 5K5YA 1U8CB 1MVUA 1YECH 5HPOA 4HZ1A 4WI6A 3LDBB 4J3OF 5I1IL 3T6WA 3ZHKA 5EZOL 1A4BA 1KFAL 3U79A 5I16A 2X2IA 5JZ7C 1ZA3A 5FF6A 1UGKA 5JPNC 2XX0A 5ILTH 4GLRI 4HKXA 3FN3A 4YHPA 5DLLA 1U8CA 2KPWA 3FTGA 4Y5YA 1MIML 5EO0B 5I71B 1AZRA 5DQJB 1H6EA 1G4MA 3UTZA 2XIBA 3DPBB 2D3NA 4DJMA 4ERSL 2Q8BL 5CLWA 2KPNA 2YGQA 3UZVB 1FZKB 5IHZB 2DM3A 4PJAA 4FXTA 3ZX1A 4J6RH 2ZCHH 3SIKA 3BGFB 3LV3A 4LPCA 5ETUA 5JHDD 3O6KH 1VF5C 3QCVH 4MAYB 4CN4A 1RHFA 4ZJ9A 2Y23A 1P9MA 4ZFZB 3ZHFA 4N2FA 4ZX6A 1FLRH 3QWNA 3VA2C 1SLXA 1CL7L 1J0YA 4HWZB 1NPJA 1V7ML 3ZE1B 2YRZA 2H2SC 4YNYB 3NPSC