1NINA

Plastocyanin from anabaena variabilis, nmr, 20 structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Solution structure of reduced plastocyanin from the blue-green alga Anabaena variabilis.
pubmed doi rcsb
molecule tags Electron transport
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ninA00
4YSEA 1L9RA 1JZHA 2IH8A 2BP8B 3FSAA 2AANA 2HLEB 4HCFA 1SHXA 2PPAA 2PP9A 3CVDA 1ILSA 3FQYA 3NJIA 1WAEA 2UXGA 2WO3B 4E9WA 5B7MA 2BP0A 2DYRB 2PP7A 4E9YA 3S3CB 4N4YB 1JXFA 3NJHA 4DP1X 4M3HA 2J57A 5D4HA 4E9QA 1SF3A 1FWXA 2XU9A 1OE1A 1PY0A 4E9VA 4F2EA 2UXTA 3SBQA 1URIA 3AG1B 2YAMA 3FQ1A 1GS8A 2CJ3A 3ASNB 2FWLB 4BWUA 4HHWA 3FYEB 3H4FA 5F7BA 1XB8A 3NJKA 3S8GB 1JXDA 2XV2A 3QJRB 3S3BB 1KV7A 1BYOA 2H47C 4KNUA 2P80A 1PLAA 1QHQA 2GI0A 3OM3B 4A67A 4BXSV 2CALA 4BK5C 2JFCA 1N68A 3NSYA 3TBBA 1NINA 1ZDSA 3QJQB 1ZV2A 1BAWA 4QKTA 5AFAA 1HAUA 2A3TA 2GB2A 4A66A 3GYRA 1KGYE 1J9QA 2BZCA 4YSRA 4YVNA 1BXVA 3NP3A 1PZCA 2XXFA 3AG3B 3PLYA 1V54B 3TU6A 1OCCB 1AQ8A 1J9RA 1E67A 2FTAA 4NB7A 1ADWA 4MFHA 3MBWB 2QPDB 3V9EA 4DP7X 1AIZA 1BQ5A 4W1TA 1F56A 2FQDA 4BWWA 3T6ZA 2H5UA 3GDCA 3T71A 2B08A 1UATA 5D4IA 1GR7A 3GXUB 2YAHA 8PAZA 1SDDA 4NERA 1RKRA 2JKWA 4DP9X 1GY2A 2QPEB 3CVBA 2YAPA 2XX1A 2PPEA 3EHBB 4A2HA 1V55B 4TXVB 1A65A 1NIEA 5AKRA 1SNRA 5FC9A 1QLEB 1AZRA 3IE9A 2XYBA 2VM3A 3NJLA 3NSDA 3TA4D 4YSQA 2Q9OA 3OQRA 1JXGA 3ABMB 3X1EA 4BDVA 3FU7A 2OCCB 2R7EA 2JXMA 1GYCA 2OV0A 3EF4A 4WTQA 4WKXA 3UAEA 4A68A 2XV0A 2I7SA 3NSFA 4HAKA 3X1NA 1JZJA 4GY4A 4HCGA 3WKPA 1BXAA 4QLWA 2QDVA 5B1BB 1VLXA 2BW4A 1EHKB 2X87A 3ABKB 2DV6A 2P80D 1SFHA 4G7SB 3FS9A 3X1FA 2NRDA 1HFUA 1A3ZA 2GC4C 2ZOOA 1MG2C 2IDSA 1PZAA 4G7RB 1PCSA 4DP2X 5B1JA 1KDJA 3OD3A 1BEXA 3FU9A 1PZBA 2LLNA 3DKHA 3PCYA 4DPBX 1AZNA 4HIPA 1GY1A 1L9OA 1WA0X 1NICA 2HX7A 1IUZA 1J9TA 1L9SA 9PCYA 2BP8A 3KW8A 1FFTB 2FT7A 5D4JA 2VSKB 3SQRA 3QJUB 2J5WA 1SJMA 3ASOB 4DP0X 3FSVA 2PPDA 3TASA 4A2GA 2BHFA 2BW5A 5PCYA 1TEFA 5TK2A 2EILB 3UGEA 1OCOB 2I85A 2IDUA 3EH4B 1PF3A 1V10A 4GYBA 3DIVA 1NWPA 3ERXA 5B1JC 4DP6X 2HX8A 2VW4A 2XX0A 4UANA 1N70A 3AZUA 3H4HA 5ANHA 1DYZA 4G71B 4L0PB 3RYMA 2IDTA 3OMAB 2XVBA 3QQXA 4YSSA 1T5KA 2CAKA 2PP8A 1E30A 2PLTA 1BYPA 3FPYA 4E9TA 1MG3C 4FAAB 2ZONA 4YSUA 1E5YA 4A2FA 1BQKA 4KNTA 4FA7B 2YAEA 3N55A 2BO0A 4KOBA 5I26A 3IN0A 1AZCA 1OE3A 1ASPA 4HZ1A 3CZUB 3CVCA 3PAZA 3NSCA 1NPNA 2VN3A 1MZZA 2TSBA 2AZUA 4YVUA 1WA2X 3X1BA 3FPXA 1E5ZA 1W8EA 2HX9A 3ABLB 2UX7A 1ETJA 1EZLA 1JOIA 2DYSB 4UAHA 5I6PA 4DP8X 1OE2A 1XMEB 1MZYA 2FQGA 2PCFA 3SBRA 1NZRA 3NP4A 5IY5B 1ASQA 4BWTA 2B3IA 2AFNA 1A4CA 1JZGA 3NJFA 1OF0A 1QNIA 2J56A 2HXAA 4GP5B 1M56B 1M9WA 2X88A 3H56A 2AVFA 1A4BA 2EINB 4KO6A 1I53A 1TEGA 3NJJA 4YSCA 3AW5A 3PXLA 5AZUA 1AS7A 2VW6A 2PPFA 4HCIA 3T6XA 4DPCX 2OJ1A 1TU2A 3CDZB 1GW0A 2DY2A 2UXFA 4GP8B 3WG7B 2FT8A 3HEIB 4RH4A 3L45A 3FQ2A 2YXWA 4DPAX 1AG0A 3TBCA 1PLCA 5B7EA 3PAUA 2EIMB 1IBZA 3DTUB 2UX6A 1JERA 1WA1X 3PPSA 4F2FA 5I6LA 2EIKB 2N0MA 3QJTB 2GHZA 5I6OA 2MRYA 1PNCA 1RZQA 4Q8BA 3CG8A 3ABGA 3G5WA 4DP5X 5B1KA 2DWSA 1IBYA 1A4AA 4PCYA 3ZIYA 2YXVA 3AY2A 4NAJA 3V9CA 2XV3A 2ZXWB 1PNDA 3ZDWA 4KNSA 1OCZB 3FU8A 3BQVA 4YSOA 1KCBA 2Y69B 4W9ZA 2QT6A 2J55A 3QJVB 3T6WA 5I6KA 1J5DA 1L9QA 3NJNA 1TKWA 4A2DA 1AOZA 1JZFA 2PCYA 1JVLA 2IWFA 1ID2A 2QDWA 5B3SB 1BXUA 3NJMA 1WS8A 3WI9A 4AI7A 2YAQA 2GSMB 4AKPA 3WNIA 2BWDA 4DP4X 3MX0B 1SF5A 3T9WA 3KW7A 1ZIAA 3WKQA 1ET5A 5TK4A 3S3DB 1W6WA 2FNWA 2W8CA 1CYWA 4CSPA 5I28A 3HB3B 4JHUA 1NIBA 2IAAC 2UXVA 5LDUA 1NWOA 4P5RA 3X1GA 1XB6A 3S8FB 2BP0B 1DZ0A 1X9UA 1PLBA 2FQFA 1M57B 4X4KA 2CUAA 3UACA 1J5CA 1JZIA 1NTDA 2VMJA 4JHVA 1MDAA 1AZBA 5I5IA 3PAVA 5B1AB 2IDQA 1X9RA 3OMIB 3WIAA 2GIMA 1AR1B 3JT2A 4YSAA 1NPJA 2TSAA 5I5MA 2MTAA 1AS8A 5E9NA 1SFDA 1AS6A 1NDTA 5A7EA 3UADA 4KO5A 2IDFA 2WSDA 4AKQA 3NYKA 1GS7A 2GC7C 4YSPA 3SBPA 1FA4A 2BZ7A 1ET7A 2ZWNA 1W6LA 3IEAA 1CUOA 1XB3A 4BXVA 1AZUA 1OCRB 3N2JA 5EHFA 2BWIA 5F7AA 4N8UA 2XLLA 5I6NA 2VSMB 1JVOA 1ZDQA 2CBPA 3D12B 4ZK8A 4G7QB 4UF7C 1NIFA 4Q89A 3ZX1A 1BQRA 1L9PA 1GSKA 6PAZA 3T6VA 3UAAA 4ENZA 3FYIB 1ZPUA 4P5SA 1L9TA 2FT6A 2Q5BA 3NT0A 3QPKA 4HALA 3BVDB 1CURA 2H3XC 2XXGA 2Y1AA 1RZPA 1SHWA 3OMNB 1J9SA 3FSWA 5B7FA 2AZAA 1PMYA 2IWEA 1KBVA 2W88A 1AANA 4GP4B 4CSZA 1OV8A 2IWKA 3CDZA 2IH9A 3NJGA 1SDDB 7PCYA 1KDIA 3X2QB 4EF3A 3FT0A 7PAZA 4YSTA 1AAJA 3QJSB 4HHGA 4K9JA 3IBOA 1A8ZA 5I5JA 3UABA 1ZIBA 4E9SA 1JZEA 5PAZA 2EIJB 1YLBB 1KBWA 1KYAA 6PCYA 1CYXA 1HAWA 2HRHA 1B3IA 2FQEA 2XWZA 1RCYA 4AX3A 1GS6X 2DWTA 3U25A 1AACA 2RACA 3EH5B 2FJSA 3FU7B 4BDVB 2R7EB 1AG6A 1PAZA 2HRGA 3ZBMA 4AZUA 4YSDA 3AG4B 1R1CA 4YL4A 1IC0A 4E9RA 3EH3B 1WS7A 2XUWA 4JKNA 5I6MA 4KO9A 4KO7A 2WO2B 4G70B 1ASOA 2VM4A 2YARA 4G72B 2CCWA 4AKOA 4E9XA 3C75A 4A2EA 1CC3A 2GBAA 2YQBA 1NIDA 2YAFA 1ET8A 4PAZA 2YAOA 2PPCA 1OOWA 2E86A 3AG2B 4GXFA 4KOCA 3WNJA 1ILUA 2I7OA 2VW7A 1KCWA 1E65A 1NIAA 3IN2A 3JTBA 4M4RB 1IKOP 3FSZA 4F7KA 2HZHA
chains in the Genus database with same CATH superfamily
1A7PH 5I5RA 3MRFB 5GS0D 2UZYA 5I17A 3MA9H 2PYEE 4PJBA 4UV7L 5F9JA 3V4PH 4HUXB 1IM3D 4EOWH 2KUTA 4JJ5B 4PD4K 5ILTH 3VB9A 3FQRA 3T3MF 2NW3A 1T6WA 2A99A 4KK9D 3RFZB 2R2BB 2ZICA 1ILSA 2EIZA 2V3EA 4U05A 1CGYA 3MBED 4HOWA 2YLKA 3KXFD 3BD4A 1MCCA 4P2OA 1LO5B 4HUUB 4HF5L 3TTYA 4ZS6C 1DUYA 1H3VA 4ZNCD 3Q6GL 3MO1B 1RJLA 3ZDYE 1XH3B 2EVHA 2PXYB 3S2CA 1K3ZA 1GKEA 2F1EA 1KN4H 2R4RH 4NUGH 4DGIL 1I1AD 4RFNB 4XNXL 1GS8A 2V7HA 3VGBA 3IDYB 3CMOH 1IC7H 3NIDF 4LQFH 4QXTA 4AW4A 5C6WH 2X4TA 4BQCA 1E9PA 3KJ6L 1I9IH 3ZE2F 3MI6A 3QIWD 4L1DA 2X4OB 3N44B 1DQJB 1XL4A 3ZDZB 3QJRB 2F1BA 4JRFA 5FYJE 3SDAC 4LASH 3TV8A 5I1IH 3QRBA 2AQRA 4FXKB 5JIHA 2DDQH 3W56A 3UGUA 1AHKA 4Q6YA 2F5AL 3BN3B 4ZQKA 5DGRA 3QBTB 2G0KA 3PQYB 1CK0H 1AGDA 2H9GB 1NINA 3EOTL 3MNMA 4KV5F 4OR1A 3QJQB 4WI7A 3AU0A 4OCXL 4XN8A 4A66A 4JAMB 4X8GA 4N2CA 1HOCB 3BPOB 3WJLC 2XWJB 1AGCA 1MCHA 3MC0A 4KKCD 3WTVA 3P0GB 1MHHB 5DEFB 3V0IA 1MCOH 2FTAA 2YPLE 5IMMB 3LS5H 2LFEA 3RVTC 2ICEC 4F7EA 2AKRB 3NJVA 1AR1C 4HEMA 4OZFA 1MNUH 1Z32X 2C9VA 3NZHH 3ZRCC 4O2EA 2DQGL 3HC0B 4JFEB 4MNGA 4OCNC 5ID0A 1RV6X 2WTPA 3U2IA 4LSDA 3SDCB 3FF7A 2MTPA 4LEOB 3UTSE 4P59L 2EUWA 4J4PC 2IEPA 3QNZA 5D4IA 2XCMC 3MRBA 4IKKA 4XO9A 4M1CC 1QHOA 3IYLW 1X5HA 2ZTBA 5IESL 5IJDC 5F7UA 1R4XA 4M56A 1WGOA 4E2OA 2GBTA 3CVBA 5E4IA 1EXUB 3UMNA 5J89A 1PIGA 5FGRA 3GLZA 4ISVB 4Q0XH 2W0PA 1VA9A 4S1SH 4ZW7A 2CIIA 1RZGA 3GJFB 1YEIH 1NLDL 4G6FD 3MXWL 1L9MA 4PJ8A 3CVIH 1WK0A 1AZRA 4GNKB 4HKXB 5E08L 1DBAH 1DFBL 3NCJH 4XR8C 1G7MA 2Y5TA 2ZT9C 3PFUA 4K0OA 4M1DL 1K8DB 4LU5H 2CNYA 4X50A 4M93C 4A7QA 2HFGH 2E7BA 4O00A 3KLLA 3RURA 3L5WB 4D2NA 5L7XL 4PJHB 2Z31D 2I27N 4QCIA 4OV5B 3MJ9L 3GBML 3BUYA 2GFBA 4U33A 3OX8B 3LHAA 4XMPL 4UV7H 1KB9J 5B1BB 4FTVA 1G7LB 1YJDL 4A63A 3X1FA 4Y5VA 3L1OL 3NEOA 4JQVC 4LKXB 3SY6A 4JDTL 2EUZA 3IFOB 4L1BA 3BP5A 1PCSA 5D2LE 4DP2X 3D0VA 1UJTA 3OD3A 4C4BA 2E8YA 1KYFA 2HVJB 2QKIB 2BDNL 1AZNA 4HF5H 2O61B 5IQ7L 5BZWA 4R90L 3F6LA 1KYOJ 2J1XA 1F0LA 2DMCA 3NH7L 3Q6GH 4YDLC 1YY8A 5F44A 4Z7OF 1E9OB 2BP8A 4Y5YB 4ZXBD 4DGIH 3BUDA 1JD7A 4QD2E 4OF6A 1ZS2A 1BXXA 2C4XA 4J6IA 4XNXH 1U0QA 2RFXB 2R51A 3DX9B 2UZIL 5D7LA 1YCSA 4FQXD 2DH2A 1RAMA 2VLME 3KJ6H 2XQYG 4HIHB 4FNSA 4U6YB 2WXFA 2Z8RA 3MYJB 1KXVA 3JTTB 2W38A 4U6VL 1MH5A 2FEDD 3TEWA 3TVMC 2IADB 2F5AH 4KJYA 3V4PA 3DUUB 1PF3A 2F7QA 2VN7A 2WYTA 3MMEB 1IMHC 3EOTH 4U1GB 4I1PA 4MA8L 1ZANH 2QFRA 3HZKA 4JL2A 2J2ZB 4AL8C 4OCXH 4KXZH 1S5HA 3KPRB 4LEBA 3KE0A 5SX4H 2EVIA 3O2DL 4HQQL 4MJJA 3D08A 5DYOB 2CAKA 4XPGL 5DVOA 4H8WL 5F6HI 3K72B 5D1ZD 3NPZB 3T2QA 1KWGA 2VITB 5L2KB 5HHNA 4GQPH 3ARED 4OAWB 1XZ0B 3FB7B 1UVQB 3V0AC 3LVTA 2R4SL 2ESVD 2DQGH 5FYLD 3ARFB 3QA3B 1I8MB 3T65A 3PWLB 2J71A 5A2AA 5JIQA 4WGKA 3JVGC 3TO4B 4N2DA 4P59H 3ATEA 2VN3A 3W11C 4HIEB 4DTGL 2L04A 3N5AA 5DUBB 3H3PL 3QUHA 1KUMA 2UX7A 5IESH 4G82A 2WVSA 3TJHC 3K1DA 5I6PA 4FERA 2LW3A 3HUJA 1YQVL 4FFVD 4RAVA 5DWPA 1GHFL 2WUCH 2F0CA 3GMNA 3DJTA 3S3PA 1HSAB 3M1BA 4HMCA 3BIKA 1MI5E 4NJ9L 4OTXL 4MAYA 1NLDH 1P4LA 4X5PA 4HKZA 2FCBA 3MXWH 5E00B 5GJSL 1HWGB 2ZJSL 2K6ZA 4QRSA 2E27L 1E8XA 2BP5M 5SWZB 1DFBH 3B2VL 5CSBA 4FQXB 3IAPA 3NEEA 4M1DH 3VFNA 3BD5A 1A1MA 1G7PA 2VW6A 1I85C 4NQCD 4W9HC 3S37L 1GJIA 1JGDB 1CXLA 5HD8D 1WUNT 4Z7IA 3BT0A 2FT8A 4QEGA 3L95B 3DSNB 5E2UL 4L29B 3MJ9H 4R2GC 1YNTB 3GBMH 4XMPH 3PU7A 3H54A 4N2IA 2OPCA 5B7EA 1HIML 1YJDH 4P57B 4GJTB 2HTLD 3L1OH 3C87A 4JEGB 4OY9A 2FR4A 2C1PB 5FKAA 1BFOA 2VSCA 3ULSA 2UY7A 1SMAA 3O0RL 4PRDB 5I1JL 2BDNH 4J8RA 2B39A 2ZPKH 3P4LA 1P5VB 2R1WB 5IQ7H 2F53E 4R90H 3NSXA 3NH7H 4E41B 2C9QA 5D2LF 5B1KA 4ORGB 2CLVA 3O3EA 2EE6A 1Y18B 2QLVB 4I18A 2X1OA 5AW4B 2HJKB 4WEEA 5C9KA 1BF5A 1XFPA 5I9QB 3R0MA 3DRTB 1PNDA 2VDLL 1YUHA 2UZIH 4YAQA 1OCZB 4UDUA 2Y69B 2K6WA 2O5XL 4WJG3 4U6XB 2GUOA 4G83A 4ZPTB 1H3UA 4OI9A 2DYPA 4XNQB 4U6VH 2LVEA 4JFWA 5AOJA 2H2PC 2IWFA 4AYBA 2XN9A 1DE4A 3CH1B 4LCWD 1MCKA 1WS8A 4MA8H 3FQUA 3RTQD 2I5YL 3O6ML 2YAQA 3NA4A 3UYPA 3WNIA 2NCMA 1G7IA 2X4QA 3MV8D 3PGDA 4HJ1A 4RAHA 5JO5B 4CW1B 3K6SA 4UQ9A 3B3IA 1GCFA 4HQQH 1OGSA 5FO8A 5IHLB 4XPGH 5C0AB 4JY6B 5INDB 2GPZA 4H8WH 1VB9A 1P84K 1CB4A 5LDUA 4J3WA 2EECA 4ZAKA 3RZCC 1PGRB 3F7RA 3C5SA 1XIWC 1O9WA 5AW6B 5IB5A 3DVGA 1Z7JA 4QRPD 2R4SH 4P9HC 2J43A 2CDEA 4DEPC 1IGJA 5I1EL 3QO1B 5E24E 5LNGA 4XCFL 4O2FA 3BP6A 2HT3C 4GUPB 4R4FL 3ULUE 4PGZA 2IDQA 1ITCA 4DTGH 2BFGA 1FF5A 3H3PH 4YSAA 1WRFA 4XP1L 2NUTB 2EXYC 4ZSOE 5MHSD 1KIQB 1F8TL 1ZTXL 1ICTA 3RWJB 3ZE1E 1GHFH 3UBXA 4WHTA 2VC2L 1DFXA 1RIVL 4OTXH 5I8EB 4NJ9H 4WK0B 3VG0L 5C09D 4DUXA 5GJSH 4U1LA 2R83A 4QO1B 4GKLA 5GZND 1VJSA 2ZJSH 2A83B 2I9LB 2LGNA 4FRWA 1UURA 1DVSA 3WXWL 3B2VH 3UAJA 2YGQA 2XWTB 2WJ5A 1M6OB 5F3BA 3U36B 3CQFA 2ZYIA 1UOVA 1MRCL 4NN6B 4ZK8A 3S37H 5EOCJ 3LQZB 5DA4A 1HK6A 1BQRA 1HWHB 3M45A 1TZGL 3TH4T 1ZE3H 2KS0A 2VR6A 5E2UH 5F9AC 5TE7L 3UAAA 3RVXD 4Z7WA 1ZPUA 1QSEA 4N25A 4BFIA 5B22A 3FU5A 3MV8B 2Q5BA 5E2TL 1HIMH 5D7JB 3H9HB 3ARBB 3S35L 4WEMB 4G59C 3B1TA 4U1KA 2G2RA 2YOCA 4HA1A 3W0WB 3O0RH 3EYQD 5I1JH 4EI5A 1EZVX 1YVLA 3CDZA 3ML8A 4ANWA 3O4LB 4FNTA 2VQ1A 5IQLA 1PZDA 3BUQA 4DUVA 4BH8A 1IBBA 2A9DA 2NXZD 2WN2A 1ANUA 4LQ1A 4BFOA 3S4SG 3BEWA 3ZHKA 3BWAA 3VH8G 3INOA 1MELA 2EIJB 4KMQA 1YLBB 2VDLH 1CYXA 4QRRE 4YZWA 3O8XA 1HAWA 5DJXB 2FQEA 2YN5A 4MCYB 3JZ7A 2F74B 1LO4L 2O5XH 4ZQTA 3EBIA 3VGFA 2V2TB 4N0FA 3QQDA 5FW6A 1I4FA 4LGRB 4XO5A 1I8AA 4P4KD 1QUNA 3MJ9A 1AG6A 1RMFL 3ARGB 4IBQA 1UXSA 2R2EA 1RULL 2I5YH 3O6MH 3ZYOA 5J06A 4FLOA 2OSLA 4KO7A 3SE3A 3U82B 1ASOA 3WNMA 1QRNE 3LB6D 5CEZL 3IJ7A 2ARJA 2EC9U 4OCRL 2IQAB 5AVRB 2W9EL 1G87A 5I24A 4I5BA 5GSVA 5KYWB 2X2UA 2K8QA 4FQPA 3CSFA 3SJVE 5E23A 3QEGL 4JREB 1G9NL 4XMUA 2IALA 4ETYA 5IVXA 1HT6A 2MNJB 1N6VA 4MYPA 4M4RB 2BP3A 4EIGB 1HXMB 3OHMB 4MCZB 3GZKA 4LT7A 3QRLA 5I1EH 4XCFH 1S9WB 3MX0A 3VD3A 3MFFA 4AT6A 3B56A 3FSAA 4AQZA 1KLFB 2OTUB 2VDNL 4PFEA 4R4FH 1KGCD 5BO0D 1XR9A 1U4EA 1MFUA 1RZ8A 3GSNL 3A22A 4R7VA 5TDOA 1MAJA 2HVBA 4XP1H 1A1OA 3ZO0A 1F8TH 2YSSB 3F00A 3R8BB 5D1XA 1IFGA 4NGHL 3V0FA 3MN8A 2VC2H 3DYMA 1RIVH 2VR4A 2DQFA 2N0KA 1OTTC 3VG0H 2H3NB 2ZNXA 4BQ8A 1X9QA 1OE1A 5C07A 3U2SA 3O2DA 5T5NF 3ALPA 3ZE1F 3WXWH 2BC4A 3LRMA 4KROD 3L08A 3FFCB 3KGSA 1IBFA 4G9DA 2DWXA 1VESA 2AMUA 1XB8A 1XF3A 2AEIT 2UUDH 5DRWA 2JCCB 4FFYL 1MRCH 1GKOA 2A74A 4OLUL 2DEYX 3TFKC 1JXDA 4ZMWA 2ZG2A 3F01A 3F2LA 2X09A 1KV7A 2H47C 3GSQA 4KNUA 4YBQC 3VXRD 3KPNA 3MA7B 5TE7H 5F88B 2XTJC 2YD5A 2P3YA 4A67A 1YNLL 1A2YB 4W68A 2IWGA 5E2TH 4IGBB 4WO0A 1NUGA 2PWFA 1ZV2A 3EJUA 1CFQB 4MQ7A 4PJ6A 2A6IA 3S35H 5AFAA 2E0PA 1L0YA 4WI6A 1BZ7A 3LMJL 1U8JA 1BOGB 2BZCA 3DHMA 4O5LL 4YSRA 4YDJA 2GJ6D 4C56D 2XXFA 4BZ1L 5HGHA 3ZKND 2XFXA 4FMFA 1J9RA 1E67A 1G1CA 4LPCA 4PREA 2C9RA 5IROA 4MFHA 1EJ8A 3HKFA 2QPDB 3OV6A 4WAFA 4AC2A 1UOLA 1FE8L 3RX9A 1BQ5A 4H4NA 5KANG 4BWWA 2QELA 4FQJL 3JWNH 3QUZC 4CC4A 1GAFL 1UATA 2CGZA 1U8NA 1LO4H 5CP7A 4B9ZA 3G7TA 3L2MA 4QHLA 5F0LB 2YA1A 4OFYD 4RDBA 2V7NB 4Y5XC 2JKWA 2FZ3B 2QVKA 5B4MC 3FB8A 2OMUB 1RMFH 2AJYL 2PW2B 1RULH 4RX4A 3KWWB 3TYFB 3MUJA 2OR9L 5DF0A 5LDSA 2FGZA 4ELKA 2V5RA 3KPPB 5CEZH 3I85A 1WAAA 4JPKL 1A3QA 3HCVB 3TCLB 4L5FL 5EF2A 3AM8C 3C8KB 4KK5C 4KJQC 4OCRH 4FI8A 4JK0D 5HI3D 3BVTA 2W9EH 2C3VA 3NJLA 2E7DA 4WI9A 4YHYB 1RPKA 3SDXF 1ZLVK 1YYML 4BCZA 3V5HA 3QEGH 1G9NH 1WWCA 4GG6B 1VFAB 2VLRE 3CSYB 1NGXA 2ZKYA 3BZ4A 2VL4A 4P23C 3WO4B 1EFXB 3FONB 1R3JB 1VCAA 4M48L 4WUKL 4HULB 5E2VL 4HU8A 4LIQL 3HS8A 2WQWA 4MJ6B 4TV3A 1F4XL 4BBWA 1T2QL 1U3YA 3F12A 3FOMB 2VDNH 2BIPA 4J3OC 3PHSA 2GAZB 4WFED 5KYUA 3ZUNC 4U1NA 3FULA 5IG7A 5KVFE 5T1LD 4XNZB 3LVEA 5AAWC 3I84A 1A3ZA 1N8ZA 2IBZY 4DZBA 3EYOB 3HAEB 4I2XA 5I18L 2CO7A 4NGHH 4GXUM 3G5YA 1NICA 3Q5OA 4GO9A 2GTQA 3TBSB 4XXWA 1HCZA 3U4EB 4DGYL 1QFHA 4CC0A 3HLKA 3BOVA 2WQVA 1ETB1 4HAFA 4PWIA 3ULVL 1IO4C 5FOJA 2WINB 2G3MA 2G4GA 5ANME 4FFYH 4OLUH 3TASA 4AQ1C 4MWFA 3VWKB 1TETL 4HS6B 5F89A 3NQIA 3WEXA 2I85A 3SYCA 4UIMB 3KM2A 1YNLH 2VWEE 4HK0A 3H42L 3UIZA 1DVZA 3OGCA 3L5JA 4AIZA 2FJHB 3RWFA 3MHZA 4XO8A 4F1ZA 3LMJH 4AMXA 3HVNA 4O5LH 4PJGB 1RZJL 3CFJB 4UUJB 3EOBB 3VI3B 5I6XC 4XCNA 3TEXA 4X5XA 4BZ1H 4E5XG 1TPXC 2WLKA 2LLGA 4MD4A 3KNBA 5JNYA 2ZWLT 2QEJA 3AADB 5ESVB 5E5MB 3H2WA 1OY3B 1RI8A 4W4OC 4WWKC 4QHKJ 2EDKA 4NRXA 1HYRC 4NQXB 1NC4A 1D5BB 3BCFA 1ZT7B 4FQJH 4JG1L 4TN9A 1GAFH 4N2GA 1PBYA 3VXME 3PV7A 3QS2A 2A9NL 5CZXD 2EDBA 4ZFZA 4RAUA 5CAYB 3QWQB 1KTKE 3BCDA 2AJYH 3FUFA 2W0FB 1FNGB 4JBSA 5IQNA 4D0DA 1NCUA 1UB6B 3JUYA 2OR9H 2AQPA 5CM1A 2MQ3A 3N1PC 2LU7A 5SWSB 5G4MA 4JPKH 1FZOB 4BWTA 4L5FH 1CCZA 1JZGA 4J3OH 5FGCE 5CJOL 4APQD 4JPSA 4I0PB 3R8QA 3LV3A 1Z0MA 2XT1B 3MZGB 5ALBH 2DPKA 5C0RL 3R7QA 4Z77B 4GOSA 3WLWC 2O5NA 1YYMH 4CADB 4OI7A 2PYED 1R5WA 4XPBH 3AB0C 1UXMA 4JFXB 2ZCKL 1L0PA 1WV7T 3MZTA 3O2VL 2CBOA 2VLKA 1U8KB 1YPZA 4WUKH 5E2VH 3WIIL 2F8XC 4LIQH 5IKCB 2RHEA 3VDCA 1F4XH 2YXWA 3PJLA 1KGIA 5C0GB 4MB4A 5FYKD 4E36A 3FU6A 1GGIL 3VJ6B 4G8GE 3MLXL 3DMMA 2VJ0A 5DUPL 4FZEL 2B15A 4PY8J 5I2IB 5I18H 3IDIA 1A6AA 3QUYC 4GBXC 2MRYA 2P48B 1XCQA 1PYWB 2AXGA 1RZIA 1OVZA 1AH1A 5T5FA 2ENYA 3S34H 2ZSWB 4X9IA 1FYTA 4WNQA 4IOSA 3QDJA 2PYFA 4F33A 1SXBA 4ETQA 4DGYH 2WCPA 4JO5A 4UM8B 4M00A 2VDKL 3G6JA 4WI0A 1S46A 3SPIA 5FYJD 2V9RA 2MOQA 4NC2B 5AW2B 2Q87A 3G5XB 4OH2A 1E9QB 2LOEA 2EEXA 1AMXA 1K2DB 3EHBC 2J55A 4BFKA 5IK3A 4XBPB 1CWVA 4K7FA 3FBQA 2WMPB 1TETH 4UT6A 1A7BA 1S7VB 1F58L 4ZFOL 4AQAA 3ZGHA 1SUJA 1A6TA 4FL4C 2PCYA 4K73A 5EU7C 3IU3B 5I73B 3H42H 3VNZA 4GS7B 1TVHA 5HVHC 2BVQB 3DWTA 1K5WA 3G6AA 4PRID 4WWPA 2FJUB 1RURL 3GSNA 1JD9A 5DQJB 2Z4QA 3LQAL 3QIUA 1NBCA 1SF5A 1RZJH 3VQ2C 2XVLA 2YUWA 3MJ8A 3WNNA 4PLNC 3UTSD 2FEEL 3R06A 1GZHC 5DMGD 1DZ0A 3ZK0A 5D5MF 5I16A 1PLBA 3VFMB 4P0DA 1P6FA 2J1WA 2DBLL 4MNQE 3DX8B 3QORC 4Y88A 4PJAF 4JG1H 3F3HA 4Z7NF 1NTDA 4Y19A 4FFYA 1LK3L 4Y4HB 5E1AA 3L16A 2A9NH 3DLQR 3L3KA 2V2XB 2BIIA 5EC1B 2WCSA 4P2QE 4WO4D 3UIYA 2H26A 4OQTL 1T2XA 3DGCR 5JMRA 2VNCA 4H8PA 5D2NA 5K9JL 4TL4A 3A6BL 2BVYA 4UAOB 5I5MA 1Y6KR 5E9NA 4PWJA 1HL5A 4MXWL 1D7BA 2IDFA 3GMLB 1JPGB 3MRGA 4OJAA 1A7NL 1B0GA 4M7LL 3VM5A 2IO5A 2OXGB 3VXSD 3VD4A 2CM5A 2EEDA 3V0VB 4IRJC 5AOIA 3F64A 3EGXB 2ADFL 2DM7A 4N5EC 3FO1B 3PNWB 5C0EB 1OAYL 5C0RH 5JW4R 1SOXA 5IOKA 1T1ZA 4DOHB 4BZ1A 3N2JA 4QYAA 4NQSB 2NY6D 3REWA 3N04A 1AOHA 1I31A 4AMWA 1LE9A 3BZEB 3C6LC 4S0SD 2ZCKH 1ACYL 3O2VH 1HEZB 3CIAA 1OB0A 1Q0XL 3ZE0E 1QWUA 1J12A 3WIIH 3MUUA 4RZCA 5HYJA 5J7CC 5FECB 4P5SA 2OI9B 2VB5A 5HI4C 3IWUA 3SPJA 2YPLB 1DANU 3MRMA 3DC0A 1GGIH 2YKKA 2DJ4A 1AHWB 3KBEA 1LD9B 3MLXH 1EUTA 3IKKA 1R34A 4XN5A 4PRHA 5DO2D 3BVNA 4FZEH 5I0WA 3FSWA 1UJ3C 3OVUB 3PJSA 4A7VA 1JV2A 5AVVB 2DM3A 4B5EA 4XN1A 2F5BL 1CFBA 5C0DB 3RWHA 3W39B 4F2MA 5IREA 1NGYA 3QIBC 1H6UA 2EKJA 2VLMD 3BGMA 2XKNA 3OKMB 4K9JA 5A3IC 3JV5A 3EFFA 1T1XB 3WGUB 4IKLA 2ENQA 2VDKH 1E4KA 3P9LB 5FGBA 4M5YL 5EN2A 2GJZA 3VFSA 5GS0C 1ZLUH 3RDTA 1UASA 4ZYKA 3N43F 1CL7I 2J5LB 4YXHL 2X0WA 3ARPA 3US9A 4HJGA 4MKMA 4KK9C 3MCG1 4KTEL 2Z91B 4HJIA 1F58H 3WE1A 1Q1PA 3EH5B 2EQDA 4F8PA 3II2A 3E6HB 2HFFA 3MBEC 2JXMB 4RLDA 5TH2B 2ZF9A 3IJHA 1VFBA 4NO3B 1YG9A 4GW5A 4UMSA 2Q86B 2OTPA 3V4VA 2CGYA 2XUWA 3MCLL 4TQ8A 1RURH 2ZYSA 3DXAA 3LEVL 4WW2F 3KPOB 2YARA 3DVFA 2NSQA 3CVHB 2OJEA 1BGXH 3LQAH 4U2YA 3PHAA 2XWEA 2Z8WC 4W70A 2G60L 2OX5B 4K23L 3NN8B 1I1AC 4X6CA 5DHYA 3K74B 3WEOA 3WKNA 2C7UA 1QHPA 4PAZA 2GSGA 1AGBA 3RUGA 4KOCA 4OIIL 2RD0A 1HHIB 3QEUA 3HE7A 4L4TE 4JO4L 2A0LD 3QIWC 4QRAA 5DRXA 5BMFL 1IGTB 4CNIB 3LH8A 3I6KB 4NO0A 1OTUD 1UXLA 3LDBB 4YGVA 1XGUB 5D9SB 4H0IA 3FRPB 5DJDA 3ZKQD 5JQIB 5ID1B 3CZFA 4NKQB 5CP3A 1PG7L 3FH8A 4WU5B 2VSDA 1LK3H 1SHSA 2EO7A 2ZOTA 2MEJB 2Q1EA 1UWYA 2ADGA 1MI5D 5BZDB 3H9SA 4JRYB 3ZRFC 1WBZA 1N5AB 1J0KA 3FQYA 4OQTH 5K9JH 1BWWA 1JWSA 2OXHB 2WZ0A 3A6BH 3TCTA 1NC2D 2ZWKA 4GFTB 1E2ZA 4MXWH 2ARJQ 4KKCC 5BRZB 4FQCL 3AITA 1A7NH 4M7LH 5INCB 5GZOD 4RIRB 1HQRA 1FWXA 1OP5H 1ZHLB 1TJIL 3BAWA 2ADFH 3CFKB 4LO9A 2HMIC 3ZTJH 1OAYH 2B8OT 5HP5A 4GSUA 4UQBA 1TF4A 4HP5A 4U7KA 4ALAL 4Q9QL 3U0PB 1U8MB 2N3JA 1ACYH 1RPQA 2IQ9L 3SODB 1Q0XH 4G7VL 3EDJA 2UWEA 1XSOA 2Z92A 4OGAD 2M1KA 3HOGA 1G7JB 5L4FA 1KXQA 1V7ML 3RWCB 1BG1A 3WHE0 4EZLA 2F53D 5GS0H 3EG9A 3BDBA 4FI6A 3ORJA 3CDGA 5E99L 3IPBA 2CBMA 5B39B 1J9QA 1RLWA 1OZUA 4ALAC 4P48A 1D9KB 3SZ6A 2E3VA 1YSOA 4PRPE 2F5BH 2VLJE 3TU6A 3GI8L 1BD2A 1C5DB 3L54A 4U1HA 4J28A 4NUJA 1BVZA 4NNXA 4WRLA 4PP2A 4M5YH 5HGBB 3UOAB 5E7FA 5H2BA 5J9PA 1F3DH 3L13A 3U7AA 3GJFH 4IBTA 2BS71 4Y7OC 2VN4A 4WDIB 5EC2A 4YXHH 5KS9E 1WPCA 3O45A 4KTEH 5B8CA 2YAHA 2OKMA 3MRDB 3T0XA 1P7KB 4UQ2A 1CD9B 3RGBA 3TZVD 4PGEB 4PJDB 3O3BA 3IJYB 4IIQB 4CBPA 3Q2LA 3CFBA 3MCLH 2OYKA 1WCQA 3LEVH 4LHUB 2QVTA 4V1DE 4ZODA 2QV2A 4MX7B 3QXDA 1BA9A 1H5BA 4ZXBC 3L3IA 3HMWL 1X7QB 2G60H 4K23H 4MJ2A 4ONHA 4M61A 1AD0A 2P8PB 4QJ3B 2C5DC 4M9PA 4WTWA 2Z1PA 2Q10A 3CZSA 4NC1E 3ESMA 4XVJL 4L4VD 4OIIH 3VXTB 4BDVA 1A9BA 2E5EA 2R59A 4JO4H 1X5JA 1WZAA 2IPUK 3ULUD 3MJWA 4FG2A 4NPJA 5BMFH 4UU9A 2XV0A 3EADA 1HHKB 3N42B 1O9ZA 1QQDB 3FUHA 2FEDC 3R1GL 1KACB 4MD0A 5GGSA 1PG7H 4PJ7F 2H1XA 1OCWL 2G3XA 2X87A 3RWEA 5JIMA 5FYJU 1SFHA 3WUZA 3T1WA 4ZFOA 3RWIB 2OMVB 5EZIL 4DO5A 3D39A 1K6QL 5IHHA 4H44C 5DZNA 1QLFB 4XI5D 1S7TA 3MLSL 5D1ZC 1KF9B 4Y2LA 5C0CA 4Q7DA 4FQCH 3QXUA 3U7WL 2NT1A 4X83A 3V4UL 3AREC 1IUZA 1JGEB 4QLRA 3MRFA 2V5MA 4LLQB 1FFTB 3D51A 5DRZA 3SYQA 1TJIH 3VWJB 1A6WL 4HUXA 3WO3B 4JJ5A 2VABB 1WP6A 5J11C 4XVSL 5IQ9B 3RFZA 2R2BA 4ALAH 1P4UA 3K1KC 4Q9QH 1I8LA 5F1OB 1MOEA 3L9BA 1LHZA 2IQ9H 4RCAA 1JPSL 4G7VH 1K72A 1LO5A 1W80A 3B9KB 4HUUA 4LEXL 3KYKL 3MO1A 5IJVB 4FFVC 1XH3A 2PXYA 1KPUB 2RIKA 1V7MH 1EEQA 4WHYG 3PYCA 1A7OL 5HGGS 5B1JC 1YNKL 4GUQA 4HLEA 2VW4A 3FQWB 4OQTA 5E99H 1NCCL 4APXB 3OR6B 4R4ND 1HE8A 2YFOA 3B6SB 4ZX3A 4MMXB 2X4OA 1DQJA 5MI0B 5T5NG 3K0YA 1X5AA 5IB4B 3GI8H 3FN3A 2KZWA 4FXKA 4RA3A 2BO0A 4ZSOB 5HD8C 2IBZX 4FX5A 3PQYA 5E1IA 1AZCA 2H9GA 4F5CE 3L4WA 1M53A 2VZSA 3KLHD 3Q2CA 5DJAB 2PABA 2BMKB 4JAMA 2PF6A 4Y4FD 5ELIA 4CC1A 3RL1B 1HOCA 2AZUA 2HTLC 2XWJA 3FPXA 5BUGA 3LPGA 2EABA 2NY0D 1PJWA 1FDLL 3MOAL 1EZLA 4DH2A 1MHHA 4IQHA 5DEFA 4E68A 5LN8A 5IMMA 1CDYA 1TCRB 4JZNB 1AO7B 2AKRA 4IRSB 5DO8A 2CH8A 2WYZA 3MAWA 4Z7QF 3SJVD 3NP4A 4UTAL 4JFEA 3HC0A 4NHCL 2PUQT 3SDCA 5KSVB 3VRLE 4LEOA 3OLGA 1J8RA 3HMWH 5GISH 4BQBA 2WP3T 1BQLL 3H56A 4F9PC 1WD8A 4LLVB 1BZOA 5BO1L 3KGUA 4XVJH 5FW7A 3O41B 3UMTA 3FTUA 4HKJB 2BNRE 1TO4A 3QDHA 3SPHA 1EXUA 3TTSA 4ISVA 4M3JA 4TTDD 2WXQA 3DX0A 3R1GH 4EN3D 3GJFA 3FQ2A 4NP4L 4LVOB 4LPWA 3S0PA 4XO4A 3RTQC 5JHDE 1OCWH 4HKXA 3RVWD 3VACA 1X5YA 3BQUD 2QHLA 2UX6A 1DQVA 1WBXB 5DVPA 3SO3B 3P9WB 4JPVL 1K8DA 4L8BB 5E5UB 5EZIH 1MW2A 2K6YA 4YJZL 1ULVA 3CQPA 4QRRB 4F9LA 4XXDB 4OCMC 2OSYA 3K2MC 2V8LA 4JGJA 4MRBA 3U7WH 3L5WA 2JQAA 4PJHA 3V4UH 3HR5B 2RQEA 5HYFA 4NWTL 5GRZA 1JYWA 4OV5A 4FULA 5TDNB 4AE1A 1A6WH 3OX8A 4JMXA 3FC8A 4UQEA 3HE6B 1G7LA 3DBSA 2KI6A 2P24B 4MVBC 3ZDWA 4XVSH 1GRWA 3HS0B 4LKXA 4OSUL 4WI5A 3IFOA 5A2KH 1GTFA 1QRNB 4R4BB 3GLDA 2HVJA 3OAWA 1RJCA 1JPSH 2QKIA 2R0ZL 2EYSB 3ARSA 3G9VA 3LOWA 4JHWL 4TSCH 2O61A 4LEXH 2CRIA 3KYKH 4QMEA 5L0QB 4HGKC 2YD8A 1JZFA 3AS0A 3BWUC 4GEIA 1XGPB 1E9OA 1QFPA 2G75B 4Y5YA 3HVDA 3RL2B 2WLHA 1A7OH 1RFDL 5EUOB 2GSMB 1MW1A 3BKML 3ZMEA 2BWDA 2RFXA 4GIOA 5GZNC 5C0BE 2AHIA 1JZ3A 3C5ZD 1NCCH 3DX9A 1ZXKA 4AUUA 4GPVA 2DMKA 2ENJA 5TK4A 2WLLB 4HIHA 4U6YA 1PL3A 2X6BA 4CSPA 3MYJA 4L48A 3UBXI 3MUY1 3JTTA 4QOKB 5FV1L 1D5IL 1XB6A 1SMDA 4B96A 1U92B 1CDCA 2IADA 4QHMB 3U46B 3DUUA 5SX4I 3MMEA 2FQFA 2H0EA 2IOMA 3ZKXC 3LYRA 1CXEA 5TF1L 2LT9A 2J2ZA 3RVXC 1XD0A 3ML9A 2E6PA 3KPRA 4HH9B 1IGFL 1LO2L 1Y07A 2PO6B 1A9VA 5DYOA 3O4OC 3K72A 5K93A 4IU3B 3C2AL 3JT2A 1FDLH 2JJUA 3MOAH 3PREA 5JPMB 2VITA 5L2KA 1PZ2A 3EYQC 3KLSA 4OAWA 1OSYA 2FUTA 1XZ0A 3FB7A 1SFDA 1AS6A 1NDTA 1M42A 1UVQA 4OVUA 3BYYA 5EMYA 4UTAH 3ARFA 3QA3A 5A7BA 1I8MA 1MCEA 2NXZC 3PWLA 4NHCH 5GJTL 3H55A 3TO4A 4YNYB 3Q06A 4RGNE 2CU9A 1BQLH 2J72A 3R4DA 4HIEA 5BO1H 1UXWB 3OHXC 5DUBA 3NQKA 2AQQA 4J3UA 2Q8BL 4K2UL 1RUAL 4QHNB 3EH1A 2VUOA 2VQ4A 3RGVD 5ENWB 1FLRL 2BOBB 2YA2A 4P4KC 1HSAA 3T6VA 2ALWA 4K7PL 5E00A 3P3RA 1NDGB 3NCFB 5DEGB 3IDUA 4HEME 4BRJA 3N0AA 3LPWA 5SWZA 5IEKB 3MREB 5FUZL 4FQXA 1S7RB 3LB6C 2OP4L 4Z23A 4KHTL 4JPVH 1J9SA 1T1WB 4ABQA 1GC1L 4NSKB 5KSAC 4H8VA 2QPSA 2FB4H 4R96B 5BUPA 3EJRA 1JGDA 3ZO9A 1TVDA 2CNZA 4PJXB 4M29A 3T0DA 3N06B 3L95A 3DSNA 5TE4L 4CVZB 4HHGA 4IW4C 4L1LA 4L29A 1SLUA 4NWTH 1RLBA 1YNTA 4DWHA 1KMGA 4QWWD 3UC0L 4ZG1A 3ZGIA 3GMQB 2QVIA 4P57A 4XCCL 1NH6A 5JW3L 3KHOA 4OSUH 1B2YA 2C1PA 4B9PA 2K45A 5ICYB 2VDRB 1GC1C 2I69A 1AMYA 4PRDA 2JJVA 2R0ZH 1KCVL 1LEKB 4FQ2H 1TT6A 4JHWH 1P5VA 2R1WA 4JZOB 1N59B 3U1SL 4G6KL 4C47A 4E41A 3HBQA 3OXSB 4ORGA 1R1CA 4KTDL 2G9KA 2EUXA 1E3FA 1Y18A 1DLFL 2VLRB 3GTNA 4Q74A 3VFGL 1RFDH 2HJKA 2Y2TA 4WK4B 5GGTL 3BKMH 4B9GA 3DRTA 3GXMA 1TTAA 4ANKA 1FNSL 4KVPA 1TDQA 4KROC 1H3TA 1QEWB 4J7RA 1ZY9A 4U6XA 2QHRL 4LL9A 4ZPTA 1E5UI 1SYVB 1XD1A 5A6IA 4XNQA 4PJBF 5MEOB 2CO3A 1D5IH 1X5IA 5AYUL 3VXMD 1N0XL 1V3JA 4OLXH 2DBJA 2E6JA 4H88L 4LNRB 1USQA 3CSPA 1T0MB 3CH1A 3TEZA 1AP2B 4YSEA 5TF1H 4CW1A 2X2JA 5JO5A 2IXQB 5DRNB 1LO2H 1TO5A 5HHOE 1S3KH 3Q48A 5C0AA 4JY6A 5INDA 4X7SH 3C2AH 3M86A 5GGRY 2P1YA 2ERJC 1WAEA 4FLHA 1UUSA 4AUYA 4KTGA 2HUHA 2DYRB 3IDXL 3WSQL 3LXAA 4AV0A 3NJHA 4YPJA 3MDJA 4M3HA 3ZKNC 1TMCB 4K94L 5GJTH 3QO1A 3TN0D 3LKRB 3TP4A 4BKLB 4GUPA 3GM8A 3LNIA 2XIBA 5AALA 3VFUB 3TJEL 4JO1L 2KZ1B 2NUTA 2Q8BH 3NJKA 3QDGB 1KIQA 1MFDL 1RUAH 4K2UH 5A2JH 5HJDA 4HIQA 4G8GD 3RWJA 3VGAB 1WIPA 3FHEA 3G08B 4K7PH 5I8EA 4QO1A 4K94C 4AC4A 2DL2A 4PW3A 2A83A 3HIZA 3MUZ1 2CK0L 2I9LA 2EIEA 4M5ZL 5IHBA 4XP9L 2MOVA 4UOW1 5FUZH 3AY4A 2WKOF 2OP4H 3E3QC 5DWUL 5CD5D 2E74C 4KHTH 2GB2A 4PB9L 3HC2A 1GC1H 2XWTA 4QY8B 1M6OA 1UZ8B 2KMWA 5HI3C 1E3ZA 3L3OC 3T4AB 1FRGL 1HDMB 4ZTPH 3U36A 1MXDA 4XHJC 2H0JA 3LQZA 1TZOA 1ZA6B 2WAHA 4UTAA 4PIRF 1EZUA 3E2HC 5TE4H 2IOIA 3HUJE 5G4OA 3E1F1 1KCUL 4XX1G 2C7FA 3UC0H 3MV8A 1H8LA 5D7JA 4XZ4A 4AXWB 3H9HA 5HHQB 3ARBA 5JW3H 4F58L 1F56A 3L4CA 2DICA 2QQNL 3W0WA 2DLFL 1Z1WA 4QRQB 4HK3N 1V27A 4OJYA 3E38A 1UA7A 1KCVH 3S97C 3O4LA 2JKNA 4G6KH 1OAUL 4ODWB 3W82A 3EO9L 1J5HA 3S5ZA 5LGJB 1XZWA 4KTDH 5E5RB 2BZDA 3EW3B 4N26A 4JKKA 1DLFH 4YDVB 3VFGH 3WU1A 4EXKA 5SX5K 3PIQB 5GGTH 1UM5L 1WFOA 3GI9L 5C3TA 3O3AB 1SOKA 2FD6L 1QLEB 4MCYA 1FNSH 5DJXA 1L6ZA 2F74A 1A4KB 2KBGA 3HI5L 2VM3A 2V2TA 1N10A 1T5WB 2QHRH 1C5CL 2D7MA 2VZ1A 1BVNP 3PUCA 5BZZA 2FHCA 2WD0A 4XO3A 1F1DA 1W15A 1N0XH 2F08A 1MEXH 1MKFA 3ARGA 3C60D 5AYUH 1MCBA 3T2PA 2APXA 4H88H 4A68A 2VXSL 4Y16B 3WELA 4Z76B 4WWNA 2L4OA 2IQAA 1U2CA 2H0FA 2Y7QB 4R0LC 1BMZA 4G7SB 4UB0L 3D85D 5KYWA 2FX7L 1QATA 1T7ZA 3LPPA 4G7RB 1Z9MA 4HIJB 3VM7A 1KDJA 1YDPB 1I1CA 2EIBA 5HHVL 3LRSB 5F8RC 5MENB 3L8QA 4M4RA 1O6VA 1H3XA 2L7EA 3TA3D 1HXMA 1WA0X 4MCZA 1P2CB 2J8UF 2X1QA 4K94H 1S9WA 3EJCA 1THCA 1P4IL 2XN9E 3FUDA 4L9LB 4LDLB 1KLFA 2OTUA 2OYPA 1KB9K 2B20A 4IOIB 3TJEH 2P26A 4DP0X 4JO1H 2MQ0A 2YSSA 5CZXC 5ICUA 4B41A 4YC2B 5IBUB 4U3HA 1SXNA 3DDFA 1PKOA 2H3NA 4HBCH 1JTTA 4HAGA 1CF8L 1RZKL 2OS7A 4M5ZH 1KYOK 2IF7A 2CK0H 3MV7B 3VMOA 4XP9H 4AQOA 4HOMA 5GGQL 4YHKL 5MEPB 3FFCA 5DWUH 2XOTA 3WMPA 4APQC 3TURA 1VAHA 4G71B 4MNQB 5HDQL 3OMAB 4YSSA 1FRGH 1T5KA 2JCCA 1MNNA 1FUNA 1W8NA 1H6TA 2WBXA 4JGNA 2GCYB 3F7LA 5D6CB 3U9UB 3MA7A 1EXHA 4P2QB 5F88A 4AJWA 1KCUH 3CIQA 4FC3E 1A2YA 2R29H 4IGBA 3OF6D 1RU9L 3DPDA 4ODVL 1M7UA 4F58H 2DWEB 3OZKA 4Z1PA 1CFQA 1PZ5B 4ATWA 3HUJF 5CJXA 1DJSA 5G5DB 2AJUL 4KTYA 3WIHL 5CZKA 1WZ1L 2QQNH 2DLFH 2WLIB 1BOGA 2DMBA 2TSBA 4RRPM 5C2BL 2XWXA 1I3RB 3KAAA 3X1BA 4DKFL 3WTTA 1OAUH 4AVHA 3T5WA 5CIPH 5ADOL 3OG6B 4NKDB 1MAML 1NBQA 5DQDL 1OE2A 1XMEB 5DMJB 4H20L 3UZEC 3F7PC 1CDUA 1Z9SB 1FIEA 1UM5H 4GSRA 4X0KB 4ZMPA 3ZE0B 3GI9H 3L3HB 1BAFL 4Z7WE 1QSEE 2JQMA 2FD6H 1YEDB 1QNIA 2V5TA 2EE0A 1N3NB 4CDGC 3AGVA 3HI5H 1SRDA 4NKOB 1C5CH 5LWYL 4KRLB 2V7NA 3RLSA 3T6QC 2FZ3A 1DR9A 2ZSVB 1NBYB 2OMUA 4DGVL 2PW2A 2AQ2A 3S4SB 2VXSH 3R4RA 3KWWA 5GRVK 3VO0A 4D0CB 3VH8B 1U30A 3TYFA 3DJZA 3VQLA 3L45A 2H41A 2WWKT 3KPPA 4KRPB 3V0JA 5FFOA 3HCVA 3UTPD 2GJJA 1T80A 3TCLA 4XOAA 3C8KA 3NRPA 5KEZA 1C1EL 5CU5A 3L81A 1L6PA 4UB0H 1R3LB 2FX7H 4JKLA 1SDAB 3MFGB 2X0UA 3VX0A 4GG6A 1VFAA 3CSYA 2SODB 5HHVH 3INUL 3UO1L 4Y2DB 1U3ZA 2BXZA 5FAAA 1EFXA 2E59A 3FONA 1R3JA 5GGTA 4BUQA 5AG9A 3SBWA 4MJ6A 5DMGC 2X5PA 1P4IH 3IS1X 1E2VA 1Z9OA 4YO0B 5DLML 3FOMA 3U83A 3AY2A 1X5ZA 2GAZA 4KBPA 3BRGC 2V17L 1C9SA 5L4IA 5JZ7D 3EYOA 3CVHL 3HAEA 4KKPA 5K9QI 2BCMA 3FO9B 1TJMA 1NFDB 4RVBA 1MFNA 2VDQB 3KH4A 3L9EA 4YE4L 1XF2B 4N2AA 4HUWB 4WO4C 4LCCC 5IFJB 1LMKA 3CFIC 4LK4A 5L6YL 3TBSA 4WSJA 3HRZB 1CF8H 1RZKH 5EDXA 4HUVB 4PRPD 2EXSA 4L4TB 3U4EA 1ADQA 2VLJD 1P0SE 5GGQH 4YHKH 1ZT4B 2WINA 4L8CB 4NZUL 2IAMB 3B83A 5FF6B 5HDQH 2VE6B 3S3DB 1OAQL 3TWCL 2FNWA 5C0ND 4HZLB 3N6YA 1SVZA 1NEPA 1SXCA 2NY6C 3VWKA 4JG5A 4HS6A 3JWDC 3X1GA 3QO0B 4UIMA 4GLRH 3S5LG 1X9UA 1Z0NA 5T1MB 3O9WB 4PCSA 1YEFL 1M57B 1RU9H 2WAQA 3K8MA 4ODVH 3ZRSA 3EBAA 3Q8BA 2FJHA 5C07E 2AJUH 1JK8B 2XZZA 4W9FC 3WIHH 1WZ1H 1B4RA 3A5VA 4HJJL 5JA9A 5C2BH 4PJGA 1FBIL 3CFJA 2Q7YB 4UUJA 3EOBA 1SJXA 1E27B 4L0ZA 3VI3A 3WIAA 5DO2C 3B2DC 1KFAL 2NY5L 4DKFH 5T33L 4L3ED 4BGLA 3MRRB 5ADOH 3T0EB 1J8SA 1MAMH 1RPUA 1A14L 1UD4A 5DQDH 4XBEL 5ESVA 4H20H 4RQQB 5E5MA 1PKQB 1Z66A 4PG2A 1HEJC 1EO8L 4JE0A 2IGTA 1GS7A 2GC7C 1M7XA 4N24A 4NQXA 1D5BA 4ZMYA 1BAFH 5TDPB 3T0BA 1ZT7A 1UG9A 5LN4A 1TXKA 1YEWA 3QE5A 4X7DC 3K2UL 4XN9A 5IT2L 4WTZA 1MCSA 2OFQA 1OCRB 5LWYH 4PWFA 4E42B 4Z7WF 4JLRB 2NYYD 4J1UB 3LEYL 4DGVH 4X4MA 1BBJB 3OKEB 5TF0A 2W0FA 1FNGA 1ZDQA 2CBPA 3D12B 2AS5M 4N8CL 4G7QB 3QEQB 1UB6A 4X8XA 4UZGA 3DX3A 4KI5E 4KGLA 5FO2A 4QDGA 5SWSA 2IVFC 2H7WA 2QGCA 3FYIB 2BOCB 5JIDA 1FZOA 3BE1H 5D7IB 4Z3TA 2D03L 4I0PA 1UKQA 4TLUA 1C1EH 4PJEE 5IHWA 2Q7NA 1QACA 1SBSH 2P52A 4Z77A 4CADA 4YFDB 4AK1A 1FFQA 1T89A 1IEHA 1W0YT 4JFXA 2ZQKA 3QARA 3INUH 3UO1H 1OV8A 1U8KA 2JIXD 3HW7A 2R0KL 1A0QL 2ZKHL 5IKCA 1SN0A 2A0LC 5C0GA 3U7YL 4ELDA 2HSIA 5DLMH 1AXIB 1OTUC 1UWEL 3IDGB 2MCG1 1DQLL 5F6IC 3UABA 4E9SA 3VD5A 1GOHA 3VJ6A 2V17H 1ORSB 3GPEA 1JDDA 1WAAE 4JG0H 3B2UD 1JNHB 3CVHH 2AABL 5I2IA 1CGXA 2PTTB 4V1DB 3ISYA 4YE4H 1QO3B 2B9BA 5T1DL 2GUYA 3VU1A 1PYWA 2DQUL 4CVUA 1UCTA 5L6YH 5JOEA 5HI5D 2QFPA 3Q8AA 1QASA 3CLFL 2ZSWA 5IB3B 1BM7A 1LGVA 5I66B 4LSRL 4X9GA 4CRPA 4UM8A 1MHEB 2EKSB 2VJXA 5GZOC 2QSCL 3C2SA 4LOEA 1CLCA 1OKEA 3G5XA 5J4MA 3JTSB 1E9QA 3HI6L 4BSJA 4NZUH 3HLAB 4UV4L 4NUMA 5IVXF 3AWFA 4JN2B 4KDTC 4UM9B 1K2DA 1OAQH 1WG3A 4KKBD 3TWCH 2NY3D 4XBPA 4MJIE 2YAOA 1NGWB 1OOWA 2WMPA 3K91A 4A7UA 1S7VA 2HJFB 2G9HB 3ZW3A 1N0LB 3IU3A 3MCYA 1FPTL 2CA4A 1YEFH 2BVQA 2F19L 3AAZB 4OGAC 3HBPA 1YA5A 5DQJA 1ZHKB 5C08B 4HJJH 4U1MB 1FBIH 5CKGA 5CXPA 4XVUD 5F0JB 4JCWA 5HDLA 4DVBB 4LRIA 3Q6FB 5E6UB 2YLHA 1KFAH 2NY5H 2A4ZA 3NJIA 5JUEL 4PW9A 2YUVA 4Y9FA 1A14H 1Z3RA 4XBEH 3LSOB 3SE8L 1NCNA 3VFMA 1KYDA 1JXFA 3V8CA 5CGMA 4GXUN 3LHPL 5E6ID 2DRUA 2BNRD 5J0BA 1SF3A 4UZUA 3DX8A 2EH7L 1PY0A 4E9VA 5EIIG 4Y4KD 1IX2A 3K2UH 5IT2H 4IBLT 4Y4HA 2WKGA 2CJ3A 4R5TA 4L9DA 1L3NA 2V2XA 4E5XB 5EC1A 2AGJL 4AZ8B 2OAAA 3V2AR 4L2LA 1ZTXE 5D93B 1SVCP 3G9AB 5JHDD 4KQ0A 1E0OB 4N8CH 3F84A 5F7WC 3FUJA 1B4TA 1GSMA 3GMLA 1G9ML 1JPGA 3ULUL 1QHQA 4BQ9A 4HW6A 4WZ9A 3TZVC 2OXGA 3WIHA 4AQ8A 3V0VA 1SPDA 2R39A 2D03H 2P42B 3EGXA 5E9DE 3FO1A 3PNWA 5C0EA 2D2OA 4KI5F 5T3ZL 3H9YA 4NQSA 1XSJA 15C8L 3QNFA 3CMGA 5GS1C 3BZEA 4U2ZA 1E4XL 2VH5L 4CGTA 3BZ5A 1QPPA 2Z34A 1HEZA 3AG3B 4BSVB 1O7DE 3CPUA 5FWRA 2R0KH 2ZKHH 1Q1JL 3ARXA 5DJYB 3U7YH 5FECA 1UWEH 2G30A 3L17A 1DQLH 2B2XL 3MBWB 2YPLA 3OB8A 4PN6A 4UDTB 2D3JA 1OWRM 1AHWA 1AIZA 1FIGL 1LD9A 5IQOA 4JFUA 3M8OL 3ESVF 3VFPB 1N64L 1BFSA 2AABH 4Q14A 4OFQA 2WKLA 3PY9A 1YEEL 5T1DH 1EX0A 1FFOB 2DQUH 4KZEL 5C0DA 3W39A 4FZ8L 2Y1YA 3B7TA 5CBEB 3KPSE 4JDEB 4LPVA 4XI5C 4YBHA 1TU2B 3OKMA 4LSRH 2BNRB 2VLKE 1P9MC 1T1XA 4Y1AE 4YDKL 1YPZE 3QNXB 2FGWL 2O6PA 2QSCH 3P9LA 2VR8A 3JWNE 3HI6H 1NIEA 2Y5EA 4LLUB 4P2OD 2CRMA 2GK0B 2WQSA 1JG9A 2JKLA 1O5PA 3N1MC 2CHZA 4WI2A 4Z7UB 3ETSA 5EEVA 4AUJA 1JRHL 2WNKA 1HNYA 3W5MA 5ITFB 3TA4D 3RX8A 2Z91A 3EBGA 3E6HA 5E1HB 5G55A 5CLXA 5FCSH 2JXMA 5TH2A 4LOVA 4NO3A 2Q86A 1FPTH 3NZUA 4HCGA 4AEIL 2F19H 2COQA 3B4NA 5CEZE 3KPOA 1WC7B 3QDJE 4EN2A 3I6SA 3F7KA 5C2UB 2OX5A 1VLXA 3NN8A 5FM5O 2FEEI 3UO8B 3WAKA 5I1AB 8CGTA 3P4OB 2NRDA 5C6TL 4R4NC 4X6DE 4RGND 5JUEH 1HHIA 1OSEA 4XWGL 3MLRL 4DNLA 4Y9CA 3SE8H 1TCMA 4DPBX 1IGTA 4CNIA 3LIUA 3I6KA 5KJRL 3LHPH 1XGUA 3BEVB 1IJ9A 5D9SA 3RGHA 3ABZA 4NQUA 3P54A 3FRPA 2CO6B 5ID1A 2EH7H 4ZMLA 2ZWSA 1WSST 4WU5A 2J5WA 1SJMA 5BZDA 3RBGA 3KLHC 4JRYA 5D1QB 2AGJH 4JFDB 1TENA 1FNFA 4Y4FC 1EPFA 4GIAA 1N5AA 5C0BB 2P5EE 2OXHA 1J1PL 2ZE0A 1G43A 1RIUL 3QRGL 3B9VA 5I0VA 2NY0C 5PCYA 5BRZA 1G9MH 3ULUH 3CV5A 5INCA 1OCOB 2VKWA 3QUXB 2A7BA 4RIRA 4A7TA 1ACXA 1ITBB 1ZHLA 3Q1SL 3MRLB 3CFKA 4YXKL 2AMGA 2H0PA 2MPAL 4XNUL 2IPKB 4P06A 1PY9A 3AFLA 5T3ZH 2XZAL 3VD9A 15C8H 1QZNA 4OD3L 1DYZA 1MCQA 4Y19E 5FR3A 1KEGL 1CDGA 3QHZL 1E4XH 2VH5H 5FGSA 1U8MA 3N41B 3U0PA 4PJ8D 1CE1L 2HKHL 5D2NE 4PQXA 1Q1JH 2IANB 3RIAK 4L23A 1OD7A 1G7JA 3CZEA 4BUHA 1HVXA 2B2XH 5I26A 4FJ6A 4TTDC 3RWCA 1G94A 4MA1C 4BZYA 3CPLB 4EN3C 1A9EB 3P0VL 1VRSA 1QSVA 3M88A 3M8OH 1N64H 3UTQB 3ARDB 1Y6NR 5DS8B 1KT2B 3QI9B 5B39A 1YEEH 4N20A 4FFZL 3RVWC 1JAEA 3UTTB 3BQUC 3HG4A 1D9KA 5HJGA 3T0AA 5JPNC 2HX9A 4F7TB 4KZEH 3BGFB 4FZ8H 4O9HL 2X4PB 3BLBA 1C5DA 4H1LG 2NCEA 4XPHH 2WBJB 4ZMZA 1O75A 1DJXA 4YDKH 2FGWH 3BWZA 5HYJE 4EDXB 5HGBA 4OZFG 2O26U 1W16A 2APFA 3PWNB 4PLKD 2PWEA 3MLTB 4PI2A 5EWIH 1OOAA 3OG4B 2CLZB 4WDIA 3OMZA 4FYRA 35C8L 4UOZA 1JRHH 3OKDB 1I53A 4PRHE 3P77B 3MRDA 1NOLA 1P7KA 2FNBA 2WXKA 4N2NA 2DM2A 5FLUA 1IC4L 1HCVA 1II4E 2L7QA 2DY2A 4PGEA 1KG0B 4GP8B 3IJYA 4IIQA 4P9ML 4PJDA 5AQ0A 4AEIH 4F2ME 5D7LD 4X7EC 4AGLA 1SN5A 4LHUA 4LLAA 2AXFB 5E2WL 3K6NA 4L5FE 4MX7A 1U2YA 1X7QA 3BVVA 2NY2B 2P8PA 3L4YA 4XNYL 1B4JL 2GYSA 4X9BA 3C5ZC 2V2WB 5C6TH 5IW1B 3VXTA 3MXVL 4XWGH 5DYFA 2N0MA 4HDIB 2VDRL 3MLRH 2GHZA 2LE9A 3G6JF 2DJUA 2XV6B 5KJRH 1HHKA 3V0DA 1QQDA 5EORL 2G4EA 3G5WA 4KK8D 2Z35B 4UTBL 3OPUA 4LOUD 2E7LA 3RJOA 4A04A 2O6DA 3DXAE 3T1FB 3L3JB 3T4YB 4KITB 1P4BL 4K8RD 3ENEA 2GABA 2OMVA 3RWIA 2E47A 3L4UA 2LTQB 1KCBA 1J1PH 3HMXL 1OZTG 4TUOB 1RIUH 3QRGH 1QLFA 4TVPL 1MLBB 4X42A 3RUGE 5AVQB 4D7BA 1NANH 3VFVB 1JGEA 5KVFL 4LLQA 4K9EC 2E56A 3Q1SH 3VWJA 4FA6A 3ULVE 4YXKH 1Z5YD 2MPAH 32C2B 3CHXA 1J87A 4K3JL 2VABA 4LVNB 4XNUH 2K4AA 2WWOA 2XZAH 5IQ9A 1UD8A 3M17B 1RUPL 4OD3H 3O0LA 3VYOA 1KEGH 3U0WL 3CN1A 4HIIB 1CYWA 3H9SE 5HHOB 3B9KA 3FQTB 1CE1H 4I48B 2HKHH 5LBSL 4M8QA 4OGXL 3EJQA 5IJVA 3S8FB 3OTTA 3P4NB 3RGVC 1KPUA 2X9XA 3SQOL 2AW2A 3L9RB 4HBQA 5K9OB 3P0VH 4NQDB 4ZO8A 3FQWA 1QLRB 4APXA 2OMWB 1K9TA 3OR6A 1MF2L 1U41A 4FFZH 5HDBE 4C58B 5I5IA 3B6SA 2IV9A 5DJ0B 4MMXA 3TT1L 4J2QA 2AEOA 4U49A 1BDYA 3EO0B 2NY1D 2OCJA 1K4CB 3D07A 5D6DC 5IB4A 1OGTB 1AS8A 4ZSOA 5IW3A 2UWEE 4ZNEA 4ZMQA 1USZA 3VMPA 4YPGB 3VGGA 5DJAA 4QWWC 1KXQE 2BMKA 2DLIA 1I8KB 3RL1A 4PGDB 3GINA 4XAKE 3OR7B 3N50A 4K3DL 2VWEC 4ZUVB 3EF7A 3GRWA 5F7AA 4CN1A 4O2CB 1IAKB 1AQMA 1IC4H 4QAMB 1TCRA 4JZNA 2BSEA 3F8UB 4NNPL 1AO7A 4IRSA 4HIXL 4P9MH 6PAZA 4PCTA 5E2WH 1BD2E 3MRCB 5JXED 5KSVA 4PJCF 4PMFA 2Y22A 3U0TB 2NZ9C 5IB2B 2DYPD 2CPCA 2Y7LA 1B4JH 4CMHB 2Y1AA 4LLVA 4UYQA 3K6FA 1T7WA 1GYVA 5J12C 5EEWA 3EXJA 1WT5C 3O41A 3MXVH 3OAYK 4J3OF 5JHMA 2XN9D 1E6JL 4HKJA 1K4DB 2MHAB 5E70A 2FRGP 2IH9A 4EF3A 4WU7B 5EORH 2EDQA 2ED6A 4H26B 4UTBH 2UYLB 2Z4TA 5I5JA 1PCXA 4MZRA 2C8NA 1FYHB 2NZIA 4ZAKD 2Y25A 4G7YL 1WBXA 3WS6C 1B3IA 4L8BA 1UM6H 4N6QA 3HMXH 2LU3A 4OCLC 1QLEL 4MS8D 4QRRA 3FH7A 4TVPH 4OGYL 4XXDA 1JPTL 2NY1B 4OFPA 1AACA 3FU7B 1W0WB 2DH3A 1W8OA 3HR5A 4X6CF 5KVFH 2EDFA 2CJTA 5KYNA 5TDNA 3NIFE 2WLNA 3RUGF 2I25N 3HE6A 1M71A 2CJUL 2WXHA 4K3JH 3CZJA 2P24A 4P04A 4HEPA 3LD8C 3HS0A 4WF7A 1IQWL 4AKOA 1RUPH 1WFUA 4XCYB 3TN0C 1OQXA 2ZP0T 1QRNA 3WUWG 4AIXA 3U0WH 3FCSB 1BW8A 4R4BA 2XQBL 1KENL 3AG2B 2EYSA 2X4UB 5E9AA 5LBSH 2LQRA 3D39E 4OGXH 5ITBH 4R7DB 3BKJL 3SPVB 1XGPA 2G75A 5C0CE 3UAJD 1KTDB 5CGBA 2ZCZA 3FSZA 4U1JB 4N2FA 3RL2A 1TZIB 5EUOA 4WK2B 5HGDB 3AT0A 3OC8A 1MF2H 3ILPB 2WLLA 4YH6A 3ZZSA 3O6FB 5CD5C 2VN6A 3TT1H 5AD0B 2PPAA 3F85A 1QSED 2DQMA 3Q1EA 4M3KB 4QOKA 2UXGA 1E7UA 1GPOL 2Q3ZA 1U92A 4QHMA 5ISZE 3U46A 1G1OA 3DARA 4DP1X 2QSQA 3SZKC 4GH7B 1UH2A 5F96L 2WB7A 2Y1ZA 4HOXA 2XZQL 5DHVB 3QJFB 4EI5D 4HH9A 3KR3L 2PO6A 2UWEF 3AG1B 4WW2C 4L2YA 5GRUL 4TQEL 2VUYA 4O02B 3VFRB 4K3DH 1TVBB 4IU3A 3KS0H 5JPMA 3L5IA 3KL0A 4MCNA 1HN1A 1TOXA 3B9DA 4PVMA 4NNPH 5BRPA 3BZDA 3SDDB 4HIXH 4W81A 3O8XD 2XWBB 3ZDZE 1CICB 4K3HA 4URKA 2ED9A 5AAPA 2CPUA 2IFGA 4YNYA 4FFZA 2CALA 3ZPDA 2GTWB 1QFWI 4XXCA 5HGAB 2ZAIA 4FA8A 1UXWA 1DQIA 1NKRA 5JYMA 2W92A 1BF8A 1E6JH 1NCOA 3V6BR 2DI7A 4BFJA 3P11L 4QHNA 1IAMA 4Z6AT 2P4AB 5ENWA 4ADIA 5K1NA 2OMZB 3JV6B 2BOBA 2WUBL 3C60C 3ARVA 5DHDA 2V4LA 4IM8A 1OPOA 1ADWA 1NDGA 3GBNL 5DEGA 4I7ZC 4TPRL 3VNYA 3RA7L 4KZ0A 4CN6A 4JFEE 5B38G 3MREA 3QSKB 4U0RB 5I1HH 2JJWA 5IEKA 1S7RA 4G7YH 1T1WA 3LPFA 2LHAA 4RWHA 4DO6A 3U30C 2Z8SA 4NSKA 1QLEH 1A64A 1BF2A 4OGYH 4ORZC 3UL4A 1JPTH 4R96A 4W9GC 3D05A 1E4WL 3WE6B 1RZFL 4FFTA 5I76B 1QWHA 3EBHA 4PJXA 2ZYHA 4KUZL 4OLYL 4CVZA 3CE1A 1WDAA 4A2HA 3TA3C 1AYRA 3GMQA 2CJUH 5GGVL 8FABB 4TXVB 1IQWH 5D1XD 1SNRA 5ICYA 5E95B 4UINL 5AW7B 1JZ2A 2XQBH 1KENH 1LEKA 4A2MA 1ZRUA 5C07D 3VA2C 2VTFA 1N59A 4JZOA 1G5AA 3QYCA 3BKJH 4ZS7L 3OXSA 3OAUL 3KG5A 3SDXB 4KKZA 2D4DA 3BAYA 2VLRA 1EBPA 4PJHE 3C09C 3LNGA 2XG4B 2Y23A 3DA0A 3RJDA 1T83C 2QDVA 3HMXA 4PRAB 3H0TB 1J1XL 2D2CC 1LLAA 1UEMA 2EVFA 1QEWA 3LX9A 1ZLVH 4YEEA 3WY4A 2Z93B 1P7QB 1SYVA 5MEOA 1GPOH 3ECBB 3HNTL 1PZBA 2FJFB 3PCYA 4S11A 5DZVA 3TC9A 4LNRA 4DFHA 1P1VA 1T0MA 1ROCA 3F7VB 1XTLA 5F96H 2JNZA 2XZQH 5LLIC 1PW3A 1KTLB 1Q90A 2IXQA 5DRNA 3SKJL 3KR3H 5C7XL 3M6DA 3J27A 1U3HB 3QJUB 2XQYA 4KI5D 4TQEH 5GRUH 1L4IA 4OZIE 3BSZL 4R9HA 4PIBA 5LBSA 5IROD 2H6OA 5DZPA 2O72A 2BOLA 3NK3A 4A2GA 1CIDA 2P44B 3COOA 3QZOA 4E0RB 5GRJL 4S2SB 2OZ4L 4ZTOL 5E8PB 1DQML 3ELQA 2EJ1A 2KZBA 4ODUB 2WYHA 3EH4B 3BPLC 1A4JB 4GRLB 4JHZA 1PG7W 3LKRA 4LCYB 4BKLA 3ZDZF 3GT6A 2ITCB 4RMRA 2NQ3A 5IEHB 3N1QC 2M83A 3IPFA 1CFSB 3VFUA 4RX4D 3DX2A 3KPRE 2VZTA 3QDGA 3WHXB 3P11H 2VLLB 5ADPL 5C70A 5JIPA 4M5SA 5AZEL 2NY7L 1C7SA 2K7QA 1BX2B 3KH3A 5L2KE 2WUBH 5LCVL 3G08A 4NBXB 3WTXA 2OTWB 3T3PB 3GBNH 2APSA 4QXWA 3K6OA 4U4IA 4TPRH 4GRWB 1OLZA 2AVGA 4KKQA 4P99A 3RA7H 4PWEA 3NSJA 1T03L 3CK0L 3RKPA 4ATTA 3IMUA 3CVCA 3NSCA 1MHPL 1TNNA 1DO5A 1NPNA 4QY8A 1UZ8A 3T4AA 4KVNL 2I9TB 1HDMA 3ATBA 1E4WH 1IEAB 1RZFH 2DLHA 5GPRA 1ZA6A 3FHQA 2X12A 4LSQH 4Y2OB 1SVBA 4FYSA 4KUZH 4OLYH 3TBVB 4NCC2 5E94B 3K71B 1OTSD 1BECA 3MLWL 3DHJA 3QDMB 4ZUWB 5GGVH 4AXWA 5HHQA 4FG6D 2Y0SA 2O30A 2NY4B 1IKNA 3BAKA 4UINH 1OAXL 3CXDH 2ZXDA 3I9GL 4QRQA 2EINB 1C16B 4D8PB 3NJJA 5JZ7C 3TPKA 4PJEB 2KQNA 4ODWA 2VMCA 4ZS7H 3FCGA 5LGJA 2X42A 3OAUH 4DPCX 4AIOA 3SCMB 1VACB 1NDMB 4RMWA 4YDVA 4QHUB 3PIQA 1O7SA 4ANUA 3PL6B 2LU4A 4A55A 4MBRA 3O3AA 3TBCA 2AJZB 3D4YA 1EJ6A 4OJCA 1J1XH 3UEQA 1A4KA 2ALAA 3KVPA 4P3DB 4PJHF 1T5WA 4R97C 5CCJA 3DURB 4XE0A 5C0NC 4L1HA 5DUML 2UV3A 4J3VA 2BCKB 3A24A 3GK8L 4Y16A 5BZXA 3SPGA 4S1DD 4Z76A 3BAJA 2AV1B 3VXOB 4E41E 4QR7A 3HS9A 2OM5A 4HFWB 3LH9A 3QZLA 3B3BA 2X89A 1G0DA 1ODAA 4O51B 5C7XH 1P53A 4HUMB 2Y7QA 3RPIB 2ILLA 3BSZH 5AB0A 2O6FA 2PTVA 3THML 2WC7A 3PWUB 3ZUCA 3OLDA 1Y1DA 2ROYA 4HIJA 3F7YB 4B5ZA 1RUML 1YDPA 2B59B 1LK2B 2J25A 3QJVB 4G1EB 4RRPA 1NC4D 3LRSA 3RY4A 5MENA 4YBLB 3W81A 3F05A 2OZ4H 3OWEA 4MJIB 2C9SA 1AC6A 4ZTOH 4BFEA 1AOZA 1R5IB 1DQMH 4N8PA 1P2CA 2ICWJ 1EIBA 4NC1C 4MYWB 4L9LA 4BFGA 3LN4B 2X9WA 2NXYD 4FHKA 4K5PA 1J0ZA 2Z1KA 4IOIA 1EBAA 1VADB 3FCTB 3F65A 2LFGA 1MIML 1W6WA 4RESB 3VW3L 5ADPH 3PV6B 5AZEH 3AROA 5I15L 3HB3B 2NYYC 2IAAC 5EEUA 3WYRA 2FDBP 5LCVH 3GXIA 1KV3A 4LSPL 1IVTA 2YC1B 3K81A 1L3WA 4H8HA 3MV7A 2FX8L 2F8IA 4X4KA 3DNKA 2CUAA 3QG7L 2Q7AA 2WXGA 3TXAA 5DEJA 1T03H 5MEPA 3CK0H 4N0UB 3KPSD 2B5IC 3CHRA 1JK9B 5D5MB 3V7AG 1MHPH 3BVWA 2VLKD 5AKTA 3FT1A 3UCRA 4MNQA 5FDYA 2JK5B 4KVNH 4QKXB 3S35X 4DAGH 4PWHA 5DTFB 4PJAB 2R2CA 2YEVB 4Z7NB 1XT5A 2GCYA 1HHGB 2O6CA 5D6CA 5HBBA 4EI6B 3CUPB 1N8OE 4K5LA 4PBWD 3U9UA 1K8IB 4P2QA 1V8HA 4WHDA 3WJJA 5MP6L 3DMMD 2WQUA 4GKZA 5A7EA 3RJQB 3AQXA 1CGWA 3MLWH 3MLUL 2YRPA 3ZIMA 5CJ5A 2DWEA 1QR1B 1PZ5A 3LZQA 1NCWL 5G5DA 5F7NC 3D33A 2WLIA 3I9GH 5DI8B 1I3RA 5CEZD 1E5AA 4KHXL 2K4WA 1FYTD 3CXHJ 2WY3B 4IOSD 5E9DB 3QDJD 5L4JA 2G3ZA 1U2HA 5LG1A 5KSBE 5H4YA 2NNAB 5C1MB 5T1KB 2HPOA 3NFSL 1Q94B 3SGJA 2VSMB 2CA3A 1CU4L 4NKDA 1MCFA 4JHAL 4UF7C 1NIFA 4JZJC 4HJTA 1Z9SA 5HI5C 2HN7B 4X0KA 1R0AL 5GRWA 3L3HA 3MLYL 4XAWL 4JQXC 2H6PB 4IRZA 4XN2A 1YEDA 1N3NA 3N85L 5EPMB 5EIVA 2XXGA 4U6HB 2Q0ZX 4NKOA 5HVFB 1RUQH 1SHWA 4J6RH 5FUOL 4XBGB 2MQGA 1EEYB 3W0WE 1G6VK 3DDGA 3F04A 2NY3C 3NZSA 1MCLA 2ZSVA 4KKBC 1NBYA 4LDEB 1AANA 5DUMH 4H13C 5IJKC 4B0MM 1OM3L 3S4SA 3GK8H 1CFVL 4HISA 4D0CA 3QIUD 3O4LE 3VH8A 3PP3H 2NQDA 2RB8A 2P5ED 2FWUA 3ZSSA 2APVA 5DZJA 1WHOA 2Z64C 3TWYA 3IRPX 2GTZB 4PJIE 4AM0B 4YHNB 2DLGA 3KPSB 4N90E 2C1OB 4G6ML 4Y1AB 3U4BL 1KBWA 3ZVVA 1R3LA 1U58B 1J86A 1EEZB 2HRHA 2GKIA 1U3JA 4AX3A 1RUMH 3ARTA 3KMDA 4Y2DA 4AVKA 2ZXGA 1KY6A 2FJSA 1GZPB 4Y19D 3S96B 1HINL 4JW3A 4PM1A 3ZYIA 4N28A 4YO0A 4YGAB 4E9RA 4NFCA 4JN1L 5E6IC 1KJMB 2CKNA 5A2BA 3LKNB 1AGEB 5ACZB 1T0OA 4JRXB 5I8KL 3BH8B 1JXJA 1OANA 4Y4KC 1QI3A 3B37A 4A2EA 1MIMH 3FO9A 4MKTA 4CUCA 2YQBA 1NFDA 5I15H 2BFVL 1XF2A 2EUVA 4HUWA 1IEBB 1YEHL 2P46B 1C7TA 3LRLA 5IFJA 5GSRB 3KDMB 1TTGA 4LSPH 1E65A 1KFGA 5I1DB 1KNOB 1NIAA 4UQCA 3HRZA 4X6DB 3V55A 2NNRA 4HUVA 2FX8H 2KH2B 4G9FB 2BVUA 4HHAB 4L4TA 2PMZA 2XBTA 3CBJB 4EO5A 3QG7H 1IZKA 4N9GB 5FDWB 3U2JA 1JZHA 4KJPD 1XH1A 1ZT4A 1CL7L 4L8CA 4OUUB 1SBBA 1G7QB 2Z0BA 2IAMA 5FF6A 2VE6A 4C4KT 5HYJD 1OLLA 5F9WC 4HZLA 3OKKB 4NZJA 5AOMA 4QTHB 2VYRE 4BK5A 4EPSA 1TIUA 3L4TA 2WK2A 1CFNB 2WO3B 3QO0A 5MP6H 3OKNB 2P5EB 1N4XL 5T1MA 4PRHD 2CCLA 3O9WA 3MLUH 4KMLB 2W65B 1NCWH 2N01B 1JK8A 3S88L 3TESA 2XDHA 4KFMA 5H35B 2Q7YA 3FAWA 2QBWA 4KHXH 1E27A 2FECL 3FFCE 1RJZB 3WY3A 3IMBA 2JKXA 2VR5A 5LCVA 4LRNL 3O3UN 3MRRA 5LJYH 1CU4H 2IJ0C 2NT0A 2QPFA 3T0EA 2JCCE 3QFJE 4JHAH 4RQQA 5D55A 1PKQA 3RDTD 2ZP9A 3LZPA 1N2RB 4J12A 3ROLB 4KRNA 2AJXL 2P80A 2R9HD 1R0AH 4BHUI 2W0LA 4XAWH 5TDPA 3MROB 4X5WB 1WZLA 1FORL 5EOTB 5BV7C 3N85H 1JZ5A 1PD1A 1MHCB 2BIOA 4P2OC 2Y2WA 3K5SA 5FUOH 4E42A 4JLRA 4PPTA 5H37H 2NX5B 4J1UA 1KGYE 1QSFB 4NN5B 1BBJA 3OKEA 3DXAD 1PZCA 1CFVH 3RHWF 3QEQA 3VGDA 3PLYA 1EAQA 1H19A 2R69L 3RKDD 2ATPB 1AQ8A 1AHMA 5D71L 2BOCA 5D7IA 5DMYA 1EFQA 5TQ2L 1LP9F 4DP7X 4L37B 1IC5L 3BYTA 3U4BH 1CG9B 3VVWA 4NO0D 2B08A 2KLRA 3ULVD 3Q8FA 5I30H 4I88A 2E8ZA 2XTSA 3EIFA 5IW6B 2BHZA 5E8NB 4RGNC 3VRJB 4NS0A 4NZ8A 3MV9B 4P2CG 1BVNT 5GS2D 1HINH 3FTXA 1J5OL 3X3GL 3H9SD 1GXEA 2PPEA 3IDGA 2FX9L 4JFZL 4JN1H 5LAPA 1MRFL 4J3OG 5J5EA 2PW1B 5I8CB 1G5GA 4IHBA 1ORSA 5I8KH 1OT4A 3RX5A 5EN3A 1BPLB 1JNHA 1ZAGA 2PTTA 4V1DA 3D18B 1JZ7A 3NSDA 2B77A 5M95B 1QO3A 2FH6A 2BFVH 2BK8A 3IGUA 4OB5L 1YEHH 4HS3B 3TO2B 2B0SL 3EYSH 2MWCA 3MRKB 4GG6E 5IB3A 4G80B 5I66A 4DFIA 4UT9L 5I19L 4HAKA 4NO5B 2EEFA 1MHEA 2EKSA 3A3YB 3RRQA 3FAXA 4F80A 5BJTB 3JTSA 1CL7H 3QH3B 1QUPA 2QMKA 5HJBA 3HLAA 4JN2A 4UM9A 1QFOA 1DSFL 3H2QA 43C9B 4G8IB 4IBZA 2LABA 4LCUB 4F37F 5FHAL 1U33A 4XMVA 5KVGL 1NGWA 3P0YL 4PJ7B 4OU3A 2HJFA 1MG2C 3HG1B 2G9HA 2ZCHH 3KZ8A 1N0LA 4XAKD 1HYSD 3DKHA 3C6EA 1N4XH 2LU5A 3G5VB 4LSSH 4PJ8C 1L6XA 3AAZA 1WTLA 3KEHA 3TM6A 3KJ4B 9PCYA 3PWPE 5E4EC 3GZOA 1SY6L 3ZY7A 3S88H 1ZHKA 5C08A 1A3RL 4U1MA 4DVBA 5DEZA 4FLRA 3Q6FA 2B4CL 1BD2D 4LRNH 5HXMA 2HYMA 4UTCA 5E6YA 2A9ML 4OGQC 3QQNA 3S5LB 4PJ5B 3LSOA 2D4FA 3TIEB 4XE5B 3SGKA 1B9KA 2Q2EB 4ABUA 4YOKA 4WV1B 2AJXH 2OMXB 4DQOL 3C8DA 1Q9WB 4OZHE 1DEEB 4Y5VC 4N2LA 1FVCB 1FORH 1XHHA 2EO9A 3QW9A 4XOBA 2OR8A 4WVRA 4LLDB 4N87A 4YLQT 4PLKC 2B4CC 1HKFA 4E5XA 4AZ8A 1N70A 3TBTB 2BS8A 2HLFD 3RYMA 1HXKA 4WFFD 2WN3A 5JOPD 1PAMA 3VI3E 2PP8A 1E30A <