1NINA

Plastocyanin from anabaena variabilis, nmr, 20 structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PLASTOCYANIN
publication title Solution structure of reduced plastocyanin from the blue-green alga Anabaena variabilis.
pubmed doi rcsb
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ninA00
4E9YA 1MG3C 4P5SA 2X87A 2XXFA 3NJHA 4KNSA 1SFHA 4G71B 4CSZA 4BXVA 2IDSA 2JKWA 3JTBA 1ZIBA 4A2DA 3FU9A 1NIFA 4HHGA 1ILUA 1JZHA 4DP7X 1IC0A 3FU8A 1ASQA 2YAMA 4WTQA 2YAOA 3MBWB 4YSSA 2J55A 1NIAA 3UAEA 4K9JA 2VM4A 5I28A 4GXFA 1NIBA 2IWKA 3WNIA 3PAUA 3AW5A 1XB8A 1ASPA 1ASOA 4CSPA 1CYWA 2X88A 2TSAA 2DY2A 1HFUA 3TBCA 4HAKA 2FNWA 2XLLA 2H47C 2QT6A 1L9QA 1NTDA 2GHZA 3T6WA 3CZUB 3SBPA 3S8FB 2Q9OA 2CJ3A 4E9VA 3ERXA 5I6OA 1BQKA 3EHBB 1ZDSA 4BWWA 3DKHA 5F7BA 4AI7A 4KOCA 3OQRA 1TEFA 3QQXA 1MDAA 4JHVA 3V9CA 3NJJA 5B1JC 1KGYE 1JOIA 4MFHA 1DZ0A 1UATA 2EIJB 1OE2A 1ZDQA 2HLEB 1PMYA 3AG3B 2J5WA 1JVLA 4DPBX 1ET8A 4DP4X 2JFCA 1E67A 1FWXA 1AAJA 2IDTA 2B08A 3NJKA 4HIPA 5B1BB 3FQYA 1I53A 1MZYA 4HZ1A 3WKPA 2HZHA 2UX7A 2AZAA 5F7AA 3FPYA 1J9RA 4DP5X 1W6WA 1JXFA 4YSCA 2DYRB 2GI0A 4E9SA 2HRHA 2YXVA 3EH3B 1AIZA 3C75A 3QJQB 1J9QA 1CUOA 2VMJA 3N55A 1A4BA 3CVBA 1EZLA 3GYRA 4HCIA 1MZZA 1X9RA 1ID2A 2PPFA 1GS8A 2PPCA 1SF5A 3FT0A 1SJMA 1PNCA 1RCYA 4DP9X 2YQBA 2XV2A 5B7MA 5PAZA 1OCOB 1OE1A 1AACA 2VM3A 4G72B 5B7EA 3SBRA 2BW5A 3S3CB 1E5YA 2PCFA 1ILSA 1ET7A 3AZUA 1KV7A 1AZUA 1OV8A 1AQ8A 3ZBMA 3FSWA 1N70A 1TEGA 1WS8A 3IN0A 4YSOA 1AG6A 1WAEA 3S3BB 2GC7C 5I5JA 3UADA 4GP8B 1CYXA 3T6VA 2OJ1A 3CVCA 5B1AB 3AY2A 3TU6A 3G5WA 1L9OA 1KCWA 4E9RA 2BW4A 4KO7A 2LLNA 1A3ZA 1XMEB 2FTAA 3IBOA 2BZCA 1B3IA 2BHFA 3NJFA 2UX6A 2WO2B 3FQ2A 5D4JA 1MG2C 2YAQA 3KW7A 4BXSV 2R7EA 3UACA 5ANHA 3NT0A 1OCZB 2IDFA 1ZIAA 3JT2A 3WNJA 4A2GA 2GC4C 1DYZA 1KDJA 4UANA 4KNUA 2HXAA 2J57A 3PCYA 2TSBA 1E65A 4YSQA 1JZGA 1XB3A 2VW6A 2IAAC 4KO9A 4KNTA 3UGEA 3WI9A 3X2QB 5D4HA 5I6LA 3WG7B 1AOZA 1QNIA 1GS6X 1A4AA 2QDVA 4DP6X 4UF7C 1BXAA 2I7SA 1ET5A 5D4IA 1KBVA 5FC9A 1J5DA 1V10A 3QJSB 3T6XA 1L9SA 3DIVA 1BQRA 2BO0A 9PCYA 2IWEA 2BP0A 1AG0A 4GP4B 3IE9A 4GYBA 2R7EB 3HEIB 4BK5C 1AR1B 3S8GB 4FAAB 2YAEA 1PAZA 1KBWA 3QJRB 2XXGA 2FQFA 2RACA 1BXVA 2PPAA 3FPXA 4NERA 2VSKB 4ENZA 4PAZA 1RZPA 1PCSA 1JZEA 3ABLB 2QDWA 3QJUB 7PCYA 4A2EA 2H3XC 1FA4A 3PAZA 3V9EA 5E9NA 1SF3A 4F7KA 1NPJA 3QJTB 1BYOA 2BP0B 4G70B 2ZWNA 4AX3A 4EF3A 3OMIB 3NP4A 1J5CA 2UXGA 1JERA 2BWDA 2GSMB 3T9WA 3NJGA 3UABA 2UXVA 3T71A 3BQVA 2YAHA 1ADWA 2W8CA 4BWUA 2BZ7A 3U25A 4A68A 1NPNA 1PF3A 4E9WA 2EILB 4YSTA 4M3HA 4DP0X 1QLEB 2GIMA 3NSYA 4BDVA 2XVBA 1GR7A 2YARA 4G7QB 1URIA 4KO6A 3WIAA 7PAZA 2DWTA 4NAJA 3NSDA 4YL4A 5B7FA 5I5MA 3SQRA 2HX7A 3D12B 3ABKB 3NJIA 2CALA 1KYAA 1GSKA 4E9QA 3QPKA 1IBZA 3X1GA 2FQGA 2N0MA 3ZDWA 4A2FA 2NRDA 2ZXWB 1JVOA 4DPAX 1V54B 2Q5BA 2XWZA 2HX8A 1SHXA 4E9TA 5I6NA 3OD3A 5I26A 4DPCX 1CURA 4QKTA 2EINB 1PLCA 1M57B 1GS7A 4AKQA 1HAWA 2GBAA 3H4FA 3PLYA 3FQ1A 4A2HA 1F56A 6PAZA 5B3SB 3IN2A 1SHWA 2ZONA 3NJMA 4BDVB 2P80D 4Q8BA 2CUAA 1IUZA 4AKOA 5AFAA 3QJVB 2JXMA 3NSCA 2IWFA 5PCYA 3ZIYA 2XX0A 2XX1A 3FSZA 2YXWA 2XV0A 1R1CA 1L9RA 1WA1X 1WA2X 1PY0A 1GY2A 4A67A 3NP3A 2FT8A 2AVFA 4M4RB 3EH4B 4F2EA 2FWLB 4YSRA 5AZUA 1M56B 3ABGA 1OOWA 5AKRA 3HB3B 4G7RB 3WKQA 2I7OA 3NSFA 3OM3B 4YSUA 4DP8X 1NZRA 4HCGA 4HHWA 1NWPA 1PLAA 5EHFA 2A3TA 2FJSA 2HRGA 4UAHA 1SDDA 3TA4D 2Y69B 1BAWA 1AZNA 1W8EA 4AZUA 3CVDA 3L45A 1RKRA 2PCYA 4YVNA 4TXVB 3FSVA 1BQ5A 1YLBB 5I6KA 2CAKA 2XUWA 3H56A 2FT6A 2VW7A 3X1BA 1KCBA 2AFNA 2BP8A 1OE3A 4HCFA 2J56A 1J9TA 1WS7A 2UXTA 4ZK8A 4F2FA 1E5ZA 2DWSA 3TBBA 5B1JA 4PCYA 1V55B 2FQEA 3ASOB 3CDZA 2ZOOA 5A7EA 1BYPA 1AS7A 2WSDA 1TKWA 2PPEA 2DYSB 3BVDB 3PPSA 4W1TA 5I6MA 1NWOA 1NIEA 4N4YB 1NINA 2XU9A 1JZJA 2CBPA 1A4CA 3FS9A 3FSAA 4YSDA 2WO3B 3NJLA 3S3DB 3PXLA 2I85A 3OMAB 4YSPA 1SDDB 2BWIA 1A65A 2PP8A 3KW8A 1GW0A 1GY1A 2IH8A 2FT7A 3DTUB 2YAFA 1AZRA 5LDUA 4JHUA 3AG4B 1KDIA 1QHQA 2AANA 1AS6A 1OCCB 1JZFA 3RYMA 2DV6A 2BP8B 4Q89A 4GP5B 3NJNA 3ZX1A 1VLXA 3T6ZA 4YSAA 2IDQA 4G7SB 1NIDA 1FFTB 3UAAA 2AZUA 2PLTA 1PLBA 4GY4A 2IDUA 2OCCB 4RH4A 1ZPUA 3FYEB 4AKPA 4QLWA 3CDZB 3ABMB 1BXUA 2E86A 1IBYA 3FU7A 2QPEB 1AZCA 5I5IA 1XB6A 2MRYA 4NB7A 2XV3A 2MTAA 3AG2B 4KO5A 4A66A 1AZBA 2Y1AA 2OV0A 1N68A 1NDTA 1M9WA 1ZV2A 3FYIB 4HALA 2PP7A 1WA0X 4W9ZA 4X4KA 5B1KA 3TASA 2EIKB 1AS8A 3SBQA 3GXUB 2HX9A 4DP1X 1EHKB 3X1EA 2B3IA 5TK2A 1A8ZA 2PPDA 1NICA 2IH9A 8PAZA 1PZBA 1AANA 4WKXA 4DP2X 2H5UA 2W88A 1HAUA 2GB2A 5TK4A 1GYCA 1RZQA 1E30A 2VSMB 1IKOP 1PNDA 2EIMB 5IY5B 4L0PB 2VN3A 3OMNB 2P80A 1BEXA 3FU7B 3CG8A 4BWTA 2PP9A 4P5RA 1ETJA 1JXGA 3EH5B 3NYKA 6PCYA 1L9PA 3PAVA 2XYBA 4E9XA 2VW4A 3X1FA 3IEAA 4FA7B 1OF0A 1PZAA 2QPDB 3ASNB 1OCRB 3GDCA 4N8UA 1SNRA 3EF4A 1CC3A 3X1NA 5I6PA 2UXFA 1TU2A 1JZIA 2FQDA 1W6LA 1X9UA 1T5KA 3AG1B 4YSEA 4KOBA 1L9TA 3MX0B 4YVUA 4JKNA 2CCWA 1J9SA 3H4HA 2YAPA 1SFDA 1PZCA 1JXDA 3N2JA
chains in the Genus database with same CATH superfamily
3V4VB 1W72L 1E3FA 3WUWB 1J88A 3CLWA 2X87A 1G7QB 2J12B 5JIQA 2EECA 2P8PB 3L8QA 3I9PA 2IDSA 4JFHE 2VLRB 4KTDL 2FLBT 3QUMH 3EBHA 3B2PA 1C7TA 2YLKA 3HC0A 2YQ2A 1QX1A 2EYSB 2AAAA 2PO6A 3CBKB 4XMKH 4G8IA 4G6ML 1JWMA 3ESPA 4A38A 1I7UA 3GLZA 4Z7WE 1URZA 1ZA6A 4JMNA 4OGAD 2FX9H 5KBDA 4YH6A 1ZT1B 2Q20A 5IB1A 1T4WA 3R06A 2Y0SA 5J6GB 3P3YA 5GSVB 1HE7A 1L0YA 1EXUA 5A1AA 3QPXL 5I1LA 4NN6B 4KVNH 5H4YA 2XNAA 4RMSA 3H9YA 3WN5A 2EDFA 2R2HA 3GM0A 4ELKB 1AI1H 5CMAB 4YDLC 2XLLA 4HFWB 3I50H 4BFGA 2IALB 4RBPK 4KJQD 4L3ED 1DL7L 1PG7X 1PD6A 1LE9B 3NZSA 3OZKA 2ZUSA 1ZLWK 3MV11 3BP6A 3MUY1 3QQXA 5HHOA 3RURA 1ETB1 3EGXA 4FMFA 1JPTL 3QGVA 2XPZA 4K3EH 4BH7A 2N1TE 3V5KA 4TUOA 4YAQB 3RWGB 2ZWKA 3UDWC 3VA2C 2H8PA 4YIQA 5C97A 5IEHA 1E3XA 3GZKA 2X0WA 5EPMA 2LAGB 4RX4D 2JFCA 3FBKA 1DE4B 1AAJA 1J8HD 2NNRA 2C3WA 1OARH 5FFGA 3WHE0 4QJ4B 4XN1A 3WFHB 5BRZE 1JZ8A 5H4ZA 4ATWA 3PJSB 1NBYB 4X0KB 4EJ1C 1DJYA 4P3DA 4I0PA 3MO1B 2AEQH 3CFCL 2VDLB 5DJYA 1I8UA 3ZHKA 1A6TB 3KPRD 4EUPB 2VMJA 5AOKA 5HYFA 4IU2A 1JAEA 1A9VA 1X9RA 1FL6A 2B1HH 2PPFA 1E4XH 3D09A 3MRCB 4PD4K 1TTUA 1RUQH 3ARFD 5F88A 1R6VA 4L8BB 3CJJA 4JM2B 4NZFA 4TNVF 4WUUD 5IMKA 2W0PA 2GSIB 3TVMB 4XMTA 1YNLL 1F90L 1AMYA 1T0MA 5B7EA 3ZN6A 1QKZH 1ETA1 3GZQA 3U7YL 3HMWH 2GBUA 4PV8B 1QFHA 4PJBF 3L6FB 5BVPH 2WIMA 4ICXA 4NQTA 5EU3B 3D85B 4ALAL 3DJ9A 3ZVVA 4BCYA 1BZ7A 5BRZB 2MHAA 3KPLA 1NMBH 2GC7C 1HXMB 1U8JA 1CICD 1CGUA 1DUZA 2NZ9C 1RIHH 2FUQA 3DX0A 5GIRB 1R3LB 4QRPB 2OR7A 1N26A 4YHYC 4LVOC 3KPOB 3AU1A 1HHGA 3FT2A 4B9ZA 3NAAL 1DDTA 2BSTB 2Y9RT 3HAEB 4NQXB 4ZPTB 2J4WL 5G5DA 3F7RA 2OL3H 1A7RH 1Z0NA 3RKDC 2WAQA 5EU5B 1FO0A 2F9BT 5JIIA 1T04A 2ZSWB 3PV7A 4FEMA 4M5SA 3UJIL 3ZDZB 4MKTA 1CN4A 2ZOTA 1JNNL 4N0RA 5FFLA 3ARRA 2WC7A 3ROLB 5IIEA 4FFYH 3DPBA 4O4YL 5HGAA 1U30A 1JZGA 4YSQA 4M7LT 1X44A 1U8LA 4X9IA 1RAMA 1KYOK 1KTDA 5ESVB 3Q6GH 1MJ7L 3LIZA 4URTB 4GRLB 4EZMA 2DQHL 2H1LM 3HN3A 4ZS7H 2R0ZL 4DP6X 3BDYL 4HSAC 3BE1L 2ZF8A 1N19A 1GAFL 1VPOL 3V10A 3R1GL 4AL8H 3KLLA 2EE3A 3DVFA 5DWUL 1L7TL 5GRUL 2Z8WC 3HE6C 4DHLA 3QIBA 3WFEL 4M29A 4NN7C 1ZOXA 4BQ9A 1WV7T 3O3EB 4P49A 4QHPA 4Y9CA 4YE4H 2FR4B 1OTTC 5EB9A 3TO4A 4TUJB 4AQ1B 1FYHB 4M7KL 1UZGA 5I9QC 1J18A 4OQ1A 5CD5D 5C8JB 4OD1H 5KBLA 1KEMH 4W9GC 1WFNA 3GSXA 4MJ4A 1D2PA 2ICWJ 2R69L 3LHAA 2K9FB 2VDRL 2IOIA 3RWDA 2FIKB 1FA4A 1KXQE 4HYTB 4W9KC 3QISA 3Q6FA 3QQ3B 3ZGIA 4EIZC 2R8SH 4U6YB 3V9EA 1JNLH 1UXWB 3QCVL 1XXDC 1XIWC 3TT1H 3AU0A 2EE0A 4A7UA 5GISH 2WUBH 4CGTA 3RVWD 4MJ5B 1HC1A 4BGLA 1KB5H 4ODWB 1EZVY 2ZWNA 3OMIB 5KEZA 1N6QL 2AJUH 3P4LA 4UTAA 1OO2A 4JUTA 5EF0A 3K6OA 3HHRB 5F7FA 1B0GA 4KBPA 2ZOWA 1N3NA 2F5AL 1H9VA 3HI1A 4Y2OB 4L0ZA 4MMZA 1PF3A 1TO5A 3AQDA 4IHOA 3VE0B 4DT2A 2AK4D 5A40E 4PLNC 1SJHA 2K3HA 1HZKA 2WBJA 4MJHA 1DVFB 1HH9A 1YUHA 1EDHA 4EQ3A 3ATBA 3FOLB 2VITA 1NGZB 1HL9A 2AXJA 4ZMLA 3P2DA 1KEGL 2GAZB 4JK0D 5DTFB 5I8OL 2YPVL 5I6XC 1TITA 1I8LA 1WDAA 4UQAA 1BFVH 3BO8B 4KHXL 5DFVD 3TZVC 3EGSB 1UJTA 4KRPD 3F58L 3PXHA 2CNYA 4GBXA 4LSVH 1YYLH 4NQCD 4DIXA 4CADB 4FFVC 2O6CA 2H2PD 4K5MA 2AI0L 4HKBB 5D1XA 4JO1H 2C8NA 1SHWA 2VDPH 5FWRA 5F6HJ 3ETTA 43C9B 4Q8BA 3W9EA 2RA1A 3QXUA 5AFAA 1P5VB 1W0WB 2DM7A 3FQUA 3L5JA 4JANA 4CMHC 2EDNA 4Q4IA 4O02B 5CINL 4E42A 2NR6D 3LHPL 4LCIL 2DQTL 4N0FB 2QZ5A 4DPRA 4AJ0A 2FUTA 3FRUA 2NY6B 3WIIH 1OT1A 5CCGE 4OLWH 1BEYL 1P53A 5CCKL 4IRZL 4MXQD 3M8OH 5AOZA 2YA0A 1YMMD 5FHAH 1PY0A 2F53E 4QXWA 4M4RB 1QLRB 1E43A 4F2EA 5KVGL 4PJBB 2XTJC 4XP4L 2DWEA 4QNPE 4Y16D 5I0XA 5KYYB 5HI3C 4IBYA 5F0LB 4CVXB 2NNFA 2ZKWA 3DHJA 4N22A 5AD0A 4FZEL 2RIKA 1NL0L 2Y7NA 1BX2A 3CXHJ 2X4QB 3B37A 2YN5A 3MNVB 4PJDA 4XZ4A 2CDGB 1M05B 2Y69B 1AZNA 4YDZA 2YD0A 3AT8A 4Z5RA 2ITEA 4GRWE 1DQIA 3OKOA 2GJ6A 4FLHA 2RGSA 4ZMAT 4X5QA 3PHQB 3PYCA 4E41E 5JW3L 2WNKA 5FO7A 1CBVH 4KJWC 2VW7A 3ARDD 5DI8B 1KTBA 2BP8A 1OE3A 3JVGA 5DT1L 2XKNB 2XWTA 3CCHB 4JPKL 1OAYH 3EGDB 4HK0B 4KROD 2YD6A 5JHDE 5EBMB 3QQDB 1ZLSH 3BGFC 4FNLH 1QD0A 3FUNA 2H32A 3O2DH 2NUPA 1A0QL 3DGCR 1FC1A 1K3ZA 2VIRA 3SDAC 5KSAC 1NFDA 2HKAA 4N0YL 2A74B 1G6RL 2E59A 1SMDA 5INCA 2XA3A 2ZICA 2D4FA 4IEFA 1NIEA 3M86A 3QUKA 1D7FA 1JZJA 2EVIA 4YSDA 5FXCH 4CSSA 3QUYA 2I85A 3ARGA 2F6AA 4JB9H 5HGDA 3K8LA 3SE9L 2WXJA 3KLSA 4V33A 3HVNA 5I0DA 4MHHI 2YQGA 4LOUC 1Q4NX 1MJUL 1XXFC 1J48A 1UWXH 3H9SE 2AJYH 3O0RH 4PJ8B 3LEYL 2W9EH 2DDQH 4U6XA 4ZTEA 4AUUA 1BQUA 1KLUB 1YZZA 2AGJL 2VERA 3CSPA 3IWUA 1MHHB 4IKKA 4JRYD 2E27H 3DX7B 3KYMB 2DV6A 4XCEA 2VRQA 1AHKA 2G5RA 4KJYA 3WAJA 1UKSA 2W0KA 2HJKB 5DJCA 1SDAB 1AYRA 1EXGA 3UAAA 4ZNEE 1SVZA 4U1NB 2XBDA 1HE8A 2VJ0A 1LTXA 4QOKA 2E86A 4KKNA 5CBAB 2YD4A 4L9LB 2V3EA 5J12B 4HJGA 3KM1A 3WFDL 1CFQB 3QR0A 4X8GA 2ICWB 1A7BA 1OP9A 1KFAH 3BVUA 4P5TD 4TSBH 1G7MB 2NY5H 3BUTA 2ZKXA 1R5VB 2Y1AA 3BDXA 2OFQA 4PB9L 5TQ0L 1N68A 3K2KA 3EUDA 1FI8C 2H2SD 2O5ZH 2KS0A 4PB0H 3CQPA 3H9SB 2GT9A 2X9ZA 4MWFA 5MP6H 1FE8H 4L5FL 4FQ2H 3VXRE 4KK8C 1RZFH 2VMFA 3QFDB 4PLOB 4EI5B 2WVVB 3ZKNC 1MW2A 3ZKXC 1IGIH 4XVSL 3V4VL 2IMNA 3K8KA 3PWJB 2GW5A 3MV9E 3PQYA 3D69A 3L16A 4UM8A 1PNDA 4XVOA 3FQWB 5CZRA 2O6FA 4KQ4H 1HH6A 5IVOA 5D1ZB 4ZUSB 4ZUVB 4DEPB 1HEHC 2MKWA 4XGZB 4HXBH 2VL5A 4M43H 4Z3JA 5JIHA 5I17A 4WCYH 2WLLB 3KPSD 2WWKT 3OPUA 4BM7A 3GDCA 4H40A 3EF4A 4JY5H 4J1UA 4OM0L 2P5EE 5IB3A 2BPBA 4G6FB 2HLFC 3R4RA 3THMH 3K4AA 1RUAL 2L7EA 4YVUA 2EIDA 5EN2B 1LO4L 4JL1A 4B5EA 2YK1H 4ABWA 3Q9QA 3HHSB 4RFEA 1DFBH 5DEFB 1CGYA 4LLMA 3P4NA 4HG4K 2X0VA 2HN7A 5EZIH 4WI2A 3UTSD 2B5IB 3DDFA 2X6VA 2HRPL 3A6BH 4I3GA 3UTOA 3FQNB 1EGJA 3P3UA 4TOYH 2EXYC 4NM8L 3ALXA 3DJRA 5EBWB 3OC8A 1XH1A 5BMFL 4OF6A 1RMFL 3QG7H 3ZOAA 4RMQA 4R90H 2BSED 3QEQB 3GJFA 3KVQA 2RH0A 1MFUA 5CLWA 4C83A 3WU1A 4JQIA 2ZXGA 4X7EC 4OKVB 3C6LA 3BSGA 1E40A 5FUOL 2X1XR 2HCZX 1P4BL 4JN2B 4JO3L 2K6YA 4A6YA 2ZCHL 3OZ9L 6CGTA 1KPUB 3VXME 4LESA 4DTGL 4TQEL 1HCZA 3QEGH 1PLGL 4M7ZC 3KWTA 4KMTL 3QS2A 5M95B 4FFWD 3SBPA 3O9WA 1JD9A 2ALAA 2VTFA 1ZDSA 1OD7A 2VDLL 3ATEA 5JW4M 1XQ4A 3HC0B 1IQDA 4GKZA 2YEVB 3OQRA 1MWAA 2PO6B 4FADA 3VA6A 3NFPA 5MEND 4G8IB 1JPFB 1JWMB 4JQXC 1I7UB 4XZUA 1RUKH 1W9XA 3UC0L 1ZA6B 4H0LC 4UILH 2CO7B 3NDZE 1TTBA 5F7NC 3KAAA 3R06B 2VUYA 3HHMA 5I1LB 1EXUB 1NLDH 4FL4B 1J5OH 2ZZUT 3VXMB 2OW7A 2F5BH 3F3HA 1F2QA 3WN5B 4ELDA 2R2HB 2VDNB 2QMJA 3QFGA 5D9SA 4LNRA 4ZD3H 1I53A 1LILA 4G6AD 4PH8A 5F7AA 5KYUA 5KUMA 2A9BA 3RZCC 4HOMA 3ZRSA 3BT2H 2A1WL 1JJUA 4W9IC 5HY9A 4EVNA 2ZWLT 1J9QA 1XF3A 5DFWH 3BP6B 2L7QA 5HHOB 1KNOA 3EGXB 1KJ2B 4PJGE 1GS8A 4BH7B 4KMLB 3B2VL 4DZ8A 4TUOB 4WFED 3QG6B 3UJTH 1O7VA 3LKSA 3NA4A 3D8MA 2H8PB 4YIQB 5B7MA 5IEHB 4FI6A 4X4ME 5C0RH 3L1OH 3E7JA 3SBRA 3SOBL 4NN5C 3BAIA 5EPMB 5DSCA 4GQZA 4N28A 1ILSA 3BPOC 5I1GH 1B2WH 4KKQA 1N70A 4C4KO 3U30C 4LP4A 5E99L 3VD2A 4QD2E 4HUMB 3SGDI 3UADA 3F7QA 3D1MC 5E5LA 2Z34A 4P3DB 4I0PB 1ZLVH 1F5WA 3BESR 1U3HD 1MIML 4HFUH 5JNYA 5DJYB 1TZIA 1QP1A 1UOLA 3F62A 4N5UA 5HI4D 1UACL 3OGCA 4IU2B 5CD3A 1FL6B 3RGVD 1DR9A 1XMEB 2FTAA 2YUZA 3TV3H 4NP4L 4YDVA 5F88B 4C8XA 1N8ZA 1KUMA 4OGZA 2NQCA 2UX6A 2WO2B 4J8RA 3SSGA 4ZJ9A 1Q90A 1J1XH 3PABA 2OR8A 2BY0A 4PRIE 3WMPA 5EO1A 1CDCA 1CWVA 1T0MB 3QIUC 3IFNL 3W0WD 4FKHA 5H37H 3TPKA 1JWUA 1PGRB 3T0WA 4TSAL 3R8BB 4O9HL 3O45B 4LEXH 1BFOA 3U0WL 1HKLL 2J57A 4OCRH 4KXBA 1BZ7B 4AUJA 2Q87A 3KPLB 2DD8L 2G9KA 3UIYA 4GMTH 1U8JB 3MSPA 1AP2A 4JHAH 4DN3L 1ZCRA 1EMTL 3EKCA 4X4ZA 4PJDF 1QACA 5I6LA 2QQLL 1E28B 2YPLA 3EH2A 3AU1B 1HHGB 2WB1A 3FT2B 3Q5OA 4NJAL 2CGZA 5FM5O 3REVA 5DMYA 5L6YH 1NAKH 3PXJA 3FO0H 5G5DB 1BF5A 1GOGA 1YY9D 1FO0B 1BQRA 1CXHA 1K8DA 2PYFA 4GXVH 1AG0A 2B7DT 1F8TH 2XV6B 5B3JF 3ISWA 1H3PL 4PLKC 4RMTA 4HQQL 1NFDF 3ARSA 3C08H 5IIEB 4W9HC 3F7LA 3DPBB 3OXSB 4PJ6A 2VSKB 3KH3A 1O6SA 2X6MA 1Z5YD 5HGAB 4G8GA 1JUFA 2AJVL 3DUHA 3TEWA 1U8LB 1KTDB 4F92B 4TKWA 3QJUB 3D2UD 1AQMA 4I0KA 1J8SA 2J5LC 1EDQA 2E74C 3KCPA 4YK4C 4EN3C 3ZZ1A 3IAGC 1A1OA 4GW1A 4HHAB 2Q8BH 4XC3L 4XNUH 1T21A 4M5YL 3CLEL 4J3VA 4NYLA 1ZE3C 4JFFA 5EA0H 2XWJA 3QIBB 1S7WA 4GAFB 3VRJA 3CLFH 2C1PA 1L0QA 1RXLA 2V5TA 3QH3A 1PQZB 5FDWA 3ALPA 4GH7B 2NX5A 1A64A 3VVVA 2BZ7A 3LZQA 1VFUA 3RTQA 1H5BA 4N9OB 4WEEA 3GSXB 3M7FB 1QSVA 2G0KA 4AEIH 1S9WA 5F7KC 1GOFA 3RWDB 1PEZA 5CGMA 4YL4A 2PW2A 5HPMA 3Q6FB 1CXEA 1EBPA 5I5MA 2DS4A 4U3CA 3BEWA 4O02L 1HQ4A 1M3IA 2DM3A 2D31A 4DSYA 3BUIA 4K23H 3QPKA 5BZWA 4ECNA 3PDGA 5I66A 5GGTH 4FZ8L 1YNKL 5DZOA 1LP9A 1ECYA 4UQDA 5GXBB 3MBXH 3DXAE 1B0GB 3L4XA 3T0XA 2WKGA 3VD3A 5IOPA 1N3NB 2GBAA 1R3KA 3W9DB 1FZJA 3VXUA 3HI1B 1EX0A 5KZCD 4MMZB 5EWIH 4IHOB 3S37L 4WV1A 1HKFA 3Q1SL 2XXCB 3ZL1A 2AABH 4KK5C 4QCIA 3TA3C 3TH4T 4XCYA 5IB4A 3RUGA 2BIMA 1UWFA 2DH3A 4ZW3A 5DJ0A 3UTQB 4NZUH 1HH9B 1YUHB 4KKBD 5IJKA 2VITB 1ITCA 2DWYA 5D7JC 1JGLH 1FL5A 4J3OG 4YBHA 4H88L 2XV0A 4WHTB 1ACYL 5IROD 2MWCA 2VDMH 1PZ3A 4DVBA 1TDQA 2AERT 4PEEA 1CF1A 4NUGH 5SV4A 3CV5A 5EC2A 3Q06A 3RRQA 3TOPA 2NY0B 1E9PA 4XCFL 4GBXB 4QHKJ 1M56B 1S7RB 3ZTEA 3P2TA 3QI9D 4NN6C 1LWJA 4ZFOB 3I6LD 4ZAKA 3APFA 4LCUA 4J39A 5D1XB 4QXVA 3QULA 3EJPA 1RU9L 1UUNA 4KRNA 4PV9B 5F7EL 2ORBL 1U8HB 4CNIA 1VFAA 2VLJD 4AZUA 3W9EB 3D33A 1F1DA 1BJ1H 1IM9D 5CZXC 4J27A 5IQ7L 3S97C 3FQUB 2LABA 3E1ZA 3FSVA 2GUYA 3CU1A 1OKEA 4Q74A 4E42B 1UOKA 3PGCA 2Z7WA 2AFNA 3RFZA 2IADB 1TYJA 3NIFF 4F9PA 4M8RA 5E56A 2Q8AH 1A1MB 1J9TA 2X89A 3BPLB 4R83A 2FEEL 4TNGA 4OJFL 5ACZA 4M6MH 1V55B 4HMEA 3KYKL 4M7JL 3ASOB 3CDZA 3E0GA 1LQBC 2I5YH 4UV7L 1ID5I 4W9LC 2DWEB 3IMRA 5F7HA 1G1CA 1XO8A 3HG1A 5CJ8A 4JFEA 4QRRA 5AD0B 4OQTL 4GW5A 3RY6C 3HMXL 4XCCH 1PG7L 1BX2B 1T0NA 3PXLA 4WTWA 3SO5A 5EEYA 3OMAB 3MRBA 2CPCA 2DBJA 4PJDB 1KJMA 2YRLA 3X13A 3FUKA 3L54A 2GJ6B 4ICWA 5LXGL 4YHML 4BFFA 2B20A 1FHNA 3MRHA 3DHUA 1JZFA 2AXHA 4MZIA 5E00A 1WP6A 1MFAH 5FO7B 4ZNCD 1CR9L 2BP8B 1CGSL 9CGTA 2XWTB 1ADQH 2VISA 1H19A 4P07A 5FYJD 2PLTA 4G7VH 4JM2C 1IBHA 4QYOA 4QF1A 2H32B 2YD5A 2NUPB 3KEHA 4J23A 4J3WA 2VIRB 4PJ7A 4CW1A 2NLJA 1IBYA 2F18A 4FFZL 4IDJL 2QPEB 5INCB 1Q0YL 4IEFB 2ZAGA 3QUKB 2NUTB 4YOKA 1ZGLP 2O5XH 3BIAX 5B22A 3QUYB 1TQUA 3ARGB 3UTPD 5HGDB 4DK3A 3BJ91 2VZTA 1BIHA 3OAZH 5FYKH 3KPRE 2X0UA 3WO4B 3AAZA 1EEQA 5B1KA 1XSOA 2EIKB 2HX9A 4IOFC 3BH9A 5A3ID 4U6XB 1VEPA 2HVBA 4V1DD 3QDGA 4XCEB 2XWBA 3D3VD 4WUUE 3ZMNA 5DHMC 3GXFA 4KJYB 3K5SA 2CLRA 5E1AA 3FZUC 2MJWA 3RGHA 5GS3A 1VCAA 5DJCB 4F58L 5SWZD 1P9MA 2WQVA 1MXDA 1GCYA 3FO2A 4DGIH 4QOKB 1DQML 5EU7E 1V7MH 1BZDA 1OAXH 2ZYSA 5CBEB 4S1SL 4Q4EA 3W37A 5JW4Q 5ADPL 3MA9L 2R0LH 2L8AA 3UMNA 4AE1A 3X1FA 2Q76A 3OLGA 3OHXA 3MBWA 4KUZH 1IAMA 1U8QA 1IAIL 1X5ZA 5F1IA 3RP1A 4MWFB 2GT9B 3WIHH 1MW1A 3AG1B 3S34L 1W15A 4GRLC 4WWKD 2F8VA 4H0HB 2P26A 2CCWA 4DGYL 3I84A 4N2AA 3OKMB 4JFZL 4KK6D 3IFOA 1N10A 2A2QT 4CDHA 5AKVA 3C5ZA 3VTTA 1U91A 3K3QA 3GKZA 4WDIA 4E9YA 3GUTA 1KN4H 2XA8H 1YQVH 3DGDA 3PQYB 3D69B 4HIIA 4UM8B 4XMXA 3OJVC 1E4JA 2LU4A 3M45A 3HC3H 2Y72A 3BI9X 2WXQA 1BD2A 4Y8DC 1G1KA 3SPIA 5JIKA 4FP8L 3WFBH 2EABA 3BFWA 2VL5B 1WBZA 3KLHD 1IKNA 5A6LA 1BJ8A 4AQ1C 5IFAH 5I17B 3ARZA 5J6HB 1Q9OA 5DUPL 3KHOA 5AL0A 5FEBA 4J1UB 2ODIA 1UC6A 5IB3B 1UCTA 5JIPA 5IGXL 4E41B 4MJJA 4X6FA 2D7QA 4XI5D 2CK0H 4B3EA 3EYQC 4IBTA 3V7MA 5CS7A 5EORH 4RFEB 2VDNL 1JWSA 3MLSL 3P4NB 4MCZB 3MRGB 2HN7B 3CC5A 4LHUD 4PRDA 3IWVA 4HBCL 2C3HA 2JJTA 2OKMA 4D2NA 2BNQA 2SODB 1R24A 5AZEH 5CIPH 4E9VA 3VQ1C 4XRCA 3I9GH 5F93C 1FFRA 1YDPA 3C87A 4KOCA 2V5SA 5AW7B 4NFBA 4C83B 4PJ9C 7TAAA 1KJ2L 1UHVA 1S4IA 1TZGH 4Q2ZA 3C6LB 2IO5A 1T1WA 3SPGA 1N7ML 1VCBC 1G4MA 2VR6A 3ILEA 3WELA 2Y07H 4A6YB 3A67L 1PMYA 3U7WL 3PGFL 2Z64C 4YBQD 1U8MA 4BUHA 2R59A 1NCJA 3NIFB 3WL9A 5D7IE 1MQKL 1GJUA 5CP3A 1M53A 4ONFL 2YMXH 3ABZA 2GUOA 1JK8B 1TIUA 3O2WH 2I26N 1A6PA 3M7OA 1MCJA 3O9WB 3RAJH 2CO2A 3FF7A 4ZRGA 1PSKH 3CVIH 5BV7H 3A24A 5L2KD 3MQIA 4EPSA 4ZMPA 2IV8A 2Q2LA 1CGWA 2KZKA 4WI8A 3VU1A 3EO1A 2MOVA 1IQDB 4YHIA 5BUGA 4N2EA 1A4BA 1R3IH 2DJSA 3DVGA 1MELA 3NFPB 3QDMA 1XGYL 3EO9H 4XZUB 4PWFA 5CWSB 6FABH 5I8EA 3TBWA 1ZHKA 2FDBP 4ENED 4DF9A 4X9GA 4OTXL 2PWHA 3LB6D 4DP9X 4TNWK 4S1DC 2QBWA 1OE1A 4G72B 3OVUB 1LP9F 2BW5A 4JNXA 4JDEA 3CZJA 3SDDD 1BZ8A 1F86A 1FPTL 1OLZA 3N3EA 2ATPA 2IPKB 4JFXA 4NP9A 1LK3L 3UPRA 2KC0A 5F7DA 2K3TA 1BAGA 1CDYA 5D9SB 4LNRB 3CBJB 3PL6C 4OFVA 3AY4C 3VM5A 3RB5A 1D5IL 2P5WD 3U4BL 3ETBF 5KYUB 4NQCE 3ARBD 3MRRA 1CYXA 2LR4A 3ZT6A 4XMPL 4ZPVA 5HY9B 1PPIA 4EVNB 3RUGF 1XR8A 1T03H 4MXWH 1A9EB 2DIEA 2VN4A 1KNOB 4BZ2L 3B8SA 1IAIM 3AT9A 3ZR5A 2EZ0D 2DIBA 1FO0L 2PR9A 3LKSB 2A4EA 4Y9GA 3KW7A 5IB2A 4Q56A 3B34A 1CCZA 3WV0A 3SKUD 3NT0A 5E2TL 3H54A 3LH9A 3HN8A 3CSBA 1A14L 5AYUH 5C0EB 4F8OA 1CFVH 5DK2A 5FUZH 4AEEA 3QC6X 4J3OF 3DSNA 1YMME 2XPGA 4XVJL 4ZO7A 4JVPA 5CUSH 3HNTL 3I6GB 2V37A 5LCVA 5DK0A 2FX8H 4ORGA 3LIZL 1B88A 5JNYB 4R4BB 1GKEA 2HYMA 2DM4A 1C5CH 1QNIA 3IDJA 3RVXD 3OGCB 2AXGA 3T4AC 3V4UL 2I7SA 5CD3B 2A74C 2PXYD 3SJVA 4EBQH 1ET5A 5TDNA 3VXPB 2BH0A 4PGCB 5F3FA 3MHZA 4M3KB 5DZAA 1MJ7H 1N8ZB 3BD3A 5J56B 2YPKA 2AEPL 2Y25A 4J8RB 2BO0A 1CDJA 4PBDA 4R3SA 3PABB 3BE1H 2X9WA 3B7UX 5EO1B 1VEMA 2BNUB 5I5RA 1EGJH 3F05A 3EOBA 1JWUB 5GS0H 1A3RH 1UT9A 5JHLH 2EEDA 4WI6A 1KBWA 2GYSA 1ETZB 1GMEA 1BFOB 3GJFH 4ZW5A 3QQ9C 1BG1A 2NMSA 1QFWH 4PGDA 4J2QA 2APXA 1AP2B 3QJHA 4WFFE 4KWUA 1I85A 3MRIA 2XJLA 1E3ZA 1S6NA 3MZGB 2YPLB 2Y7SA 2H3XC 4G9DB 1AGCA 2IAMA 1UT1A 4PY8I 4L9LC 4M8UA 2BOBA 1VFMA 3KPTA 4OLEA 2V0AA 5GRVK 5J12C 4Y4HA 3REVB 3VXSD 4NNPH 3SE4A 1E9QA 1NLBL 3L4WA 2R69H 3SDYL 3DYOA 1XF4B 1SF3A 3OGOE 4XVUD 1QQDA 4I9XA 1EBAA 2BP3A 4FLRA 4B3VA 1FG9C 1IC7L 4JFWA 2MKLC 1BYOA 1D3CA 2PYFB 4G70B 2RALA 2WZPA 3RVVD 4KKCC 3S0PA 4JFFE 4BE5A 4WHDA 4Z0XA 2MOQA 3NP4A 4QRSB 1N6UA 4JRYE 4D0BA 3D34A 1CFSA 4UTAL 1I3UA 4LGRB 2ZKHH 4PJ7F 4NZDA 4JMXA 3T71A 4BIKA 5BZDA 4FKEA 5G55A 4BWUA 3MACH 1D9KA 1MWAH 1D7BA 4EI5C 1O6SB 2HPOA 4G8GB 1I1AA 1JUFB 1E5UI 4HUUA 4U1LB 1BYNA 1GRWA 3QEHA 2C4FT 2PWEA 3FXIC 4Q6KA 1QVOA 4G7QB 4PS4L 4GJTB 3WIAA 3MOAH 2DWTA 5F7WC 2CM5A 2QADB 2WXRA 4J12A 4M5ZL 1QRNA 2DMKA 4JFDD 5K9QI 5I30L 4D8PA 4HWUA 3TBSA 3SDCA 1AIFA 5D1ZC 1A1OB 2FQGA 3ZY7A 4FQCH 1T21B 1AO7D 5BOZG 3MKKA 5I24A 5E2UH 3FCSA 1S9VB 2F15A 2PW1A 2J8UE 3HFFA 4JFFB 4NYLB 2WZ0A 2XWJB 4U1IA 1S7WB 3AFLA 4ZO6A 3VRJB 3QEUA 5BNXD 2C1PB 4MD0A 1YAIA 2EC9T 3VI4E 5IG7A 3QH3B 1WZKA 5FDWB 3P3SA 4EOWH 1FZKA 5I8OH 3L9BA 2NX5B 4NRZB 1F3RB 1CGVA 2HT3C 3HB3D 3U9PL 1GS7A 2Y4SA 3B7TA 3K0WA 2OM5A 3OJDA 4CSTA 4ZFOL 3TF7C 1QYGH 3CFDA 4ZTPH 3RTQB 3MBED 4UMGA 5LQBL 1H5BB 5DD5L 1AVAA 5FFOA 4XX5A 3N06B 4M6NL 3EZ8A 1P5UA 1INDL 1YEFH 3MLTA 4IQHA 1S9WB 3ESMA 2B5IC 4GQ9H 1D5RA 2QHRH 1TCRA 4X42A 3RUGE 2ZUWA 3G5ZA 5GZOA 4OLVH 1RUMH 2DM2A 2PW2B 1OGTA 4Z9KB 5HPMB 2JNZA 2VE6A 4OGXL 3ZIYA 3UG4A 3BEWB 2XVGA 1HQ4B 2V6HA 2D31B 1IV8A 3QUGA 5KSBE 4M6AA 1JDDA 4U1SA 5BZWB 5AB9A 4AM0A 5I66B 4ZMNA 2J8UB 3OAZK 4XBPA 2A0LD 1LP9B 2HKHH 3LEXA 4FQXA 2Z31A 5C0BA 3D0VA 5CINH 4L4VA 3VB9A 2LVEA 3NZ8A 3RBGA 3H3KA 4HUXA 2FJFA 3MROA 5CCKH 3UTSE 1R3KB 3RIFF 1FZJB 3KPQA 2XFXA 2LFGA 4L8SA 1DQJA 1OAQL 3LKOA 2FECI 2HRGA 1CZ8H 4WV1B 4JUSA 1W8EA 4POZD 4QCIB 4MMXB 2XN9A 4XCYB 2DTSA 3RUGB 5IB4B 3S5LB 5DJ0B 5DEGA 4TQHA 1U8CA 4YVNA 4N0CD 4ACPA 1NL0H 3AGVA 2X2UA 3D07A 2OTPA 4L1TA 2ZOLA 3PP4H 1I31A 2AHIA 1DJHA 2PO6C 2H0JA 1WS7A 5LVEA 1CI3M 2QV4A 4DVBB 4ODUB 1X7SA 1CE1H 5B1JA 1I3GH 5EC2B 5DJ2A 2YIHA 1MCOL 1E9PB 4IOIA 5I15L 1UT2A 3RX8A 1KB9K 1BVZA 1SOKA 4I0CC 5DT1H 3PPSA 2Q7YA 4FL4C 3VWJA 4N4YB 1G9HA 4LCUB 1V05A 4RVBA 2WO3B 3ES6A 2FLRT 3NJLA 1F58H 3QULB 4MLIA 3GMMB 1HCFX 4CNIB 4X7SL 4H8PA 4Z7OE 1VFAB 4JRLA 4N0YH 5HGHA 3BQUB 3IMWA 4AG4L 1MCSA 1VENA 4GLRH 1TCMA 3NTCH 2K70A 2YAFA 3B2UD 1T5XA 5LDUA 3RLSA 2WD0A 4UNTA 1CDUA 1HHKA 2ATKA 3PGCB 4G9FD 3MODL 3RFZB 1UYWH 4RA3A 1FGVH 5FYLD 1MJUH 4FNUA 4YSAA 1SJVA 4UTBA 2A9ML 3S9DB 3QORD 3ZE1E 4L3AA 2FZ3B 5ACZB 3QCUL 2AGJH 3CDZB 2ADJA 2WWMD 1Z9OA 4HWEL 1BPVA 1OF2A 1VGEH 1GZQA 3P77A 1DBML 2CHWA 4R5VA 4XPTH 3HG1B 2MRYA 4GW5B 3V52L 3ZTNL 5IHBA 2VABA 3IDXL 4QRQA 1AZBA 1HU8A 4Z7OB 2E8YA 3T3MF 3U79A 4OZIE 1KJMB 4Z76A 4XCNB 3LS5L 4IS6A 2Y2WA 5I82A 3X13B 4NOBA 1BLNA 3SBQA 5I0WA 4K5OA 3H42H 3HCVA 3HS0A 4XBEL 5D4QA 4EAEA 4OY9A 1TTRA 2B3IA 3CXDL 3MRHB 3QDJD 5SV3A 1KCUL 2XTSA 3H2PA 8PAZA 3DMMA 4FHBD 4OLYL 4WFEE 1AANA 2PKDA 1KYOJ 3DJTA 4P23A 4R2GD 2Q86A 2HG5A 5AG9A 1GGIH 3MV7A 4QYOB 4QF1B 4PJ7B 4AENA 3HLAA 3L13A 4CW1B 2NLJB 4MA1B 4HIXL 2PP9A 1LMKA 3LPFA 4FQPA 5TE6H 4J3SA 2Y2YA 4ZTOH 3ZTJG 4OFYA 4WFGD 1EXHA 2ICEA 3ME0A 2EDDA 2FWOA 1KN2H 1KIUA 2Z93A 4GXUN 4DKTA 2JI3A 1K9TA 1T2QH 2FATL 2V17H 5E51A 1OCRB 4HLZG 2XJKA 3AAZB 3FUEA 5DMKB 2NY3C 1JZIA 3BH9B 1GHFL 3L3KA 1SMOA 3QDGB 4X0NA 3GMLB 2A77L 2DAVA 2F54A 3H4HA 1KTRL 2CLRB 5E1AB 2P49B 1JXDA 2DQCH 3P3RA 3N2JA 3BMWA 4N2DA 4QXUL 3ZZSA 4HCRA 2LOEA 1OQOA 4NKIL 2JQAA 5FM4A 3SCMC 3IU4H 3LQMA 3W0WE 3VFVA 3NJHA 3FO2B 4BFJA 3T3PF 3MLXH 1H6UA 3FB8A 4FMVA 1WK0A 3TCTA 2CDFB 2WPGA 1RZIB 2VQ1A 3CSYA 5ESQB 1R19A 4ANKA 4HAGA 5HDBF 3WKYA 3LEVL 1IC0A 1BDYA 2Q76B 2FBJL 2BHYA 2I07A 2YAOA 4KDVA 4FA8A 3MBWB 4JQIL 3UJJH 2IEPA 3IMUA 2P8LA 1U8QB 4OGYH 2B0SH 2E9GA 5EU6D 1BM3H 3UAEA 2YUVA 3RIKA 3UERA 1F41A 1RMFH 2XWXA 5F1IB 4BELD 3ORJA 2FEDD 4GXFA 3EAKA 5IBUG 4TTGA 2QLYA 4A6YL 2JIXD 1E2ZA 1HEZA 4NQDA 4BJLA 1R4XA 3AABA 5DZVA 5D55A 4EIUA 3V9FA 5FUOH 3IFOB 2YGOA 3O4OC 1KTLA 1SXBA 3C5ZB 1IEBA 1P4BH 3LS4L 4LPUA 1U91B 4WDIB 3VSTA 1VADA 1NAMA 2Z35A 2FJUB 3OZ9H 2BNQE 1ZANL 1VERA 1KXVA 5DUBB 1WIOA 1BD2B 3DJZA 1XFPA 1SEQL 5F7BA 3M1OA 4N5EC 1PLGH 4A39A 4H0IA 4UYQA 1WBZB 3MGTA 4UI2A 1NBZA 1Q9OB 1N64L 2FX7H 2R56H 2CJUL 2H0EA 2ZPKH 3AXIA 4H20L 4KJPD 4W68A 2HH0L 1M6OA 2OPCA 1KCLA 1MCCA 1JOIA 1OT2A 2R29A 1E4WL 1MY7A 4XMWA 3QUZB 2BVEA 2HLEB 8FABA 1R47A 4LCWA 4X6FB 4DP4X 4WGKA 3VWKA 4NHUA 4YJZL 2D7NA 1NC4D 3JV0A 2B08A 5B1BB 3G5YA 1JWSB 5FM5M 3WNLA 3CC5B 5BOJA 1FLRL 4I3SH 1HHJB 3O81A 2IGLA 2NNAA 2PYED 3OKDA 2BNQB 3B7YA 4B50A 4PSRA 5DR5L 1R24B 5B8CA 4YSCA 4XRCB 5EOTB 3HRZA 3IJSA 5ESAA 5J6SA 4M56A 3B9KA 1JZ6A 5FS5A 1YDPB 1GGBL 2ZUVA 4JKWA 1ZGLM 2B15A 4FGMA 1UD5A 2EH7L 3QDME 2DIJA 4Q2ZB 3ISYA 4IMKA 1T22A 1T1WB 4YDKH 4MMZC 1AH1A 2OP4L 1BIIA 4D9QE 2HUHA 4HD9A 4LQFH 3KL3A 1Z2KA 3L7FA 4NNXA 4CN4A 1U8MB 5IQ9A 2JKIS 3B2VH 3FCTA 2W0LA 4KKLD 4K5LA 3RVUD 3WL9B 2IDCA 4Z3IA 4KDTC 4PCKA 2GUOB 4P4RA 4PRHA 1WS8A 3IN0A 2D9CA 4Y9EA 2BWQA 3GD1C 3S3BB 4J4PC 1I8LC 2G4GA 3UZVA 4BHUA 3IPEA 2BNRE 1Q1PA 3CVHL 1MOEA 3GSNB 2APTA 3EO1B 4YHIB 1GZHA 1FZOA 4GBXC 4LVNB 2WWOA 4NWTL 2VR3A 3DVGB 1B4JH 5FGSA 3T3MB 3EXJA 2Y7QA 3QDMB 1E27A 4EZKA 3VXNA 3MCKA 3Q8AA 3NABH 3S3PA 5I8EB 2L7JA 3TBWB 3F2LA 5D1XC 1ZHKB 2FJHA 1HSAA 1TMQA 3NRPA 1OSZA 2VLKD 5TDOB 1QPXA 3N04A 3VNZA 4BA0A 5ADOH 1RK1B 3P4MA 4RESB 1YECL 1HNFA 2OBGA 5KVFH 4JDEB 1P4LA 5AAMA 2ZG3A 2Y7MA 4JFXB 2ATPB 5T3XD 1QMUA 4YXKL 3UPRB 5F7DB 2E7LA 5L4MA 2F08A 2NY4D 3V6OE 2YKKA 1ZEAH 2V2TA 3IFNH 4TRPH 3GGWA 3BPLC 2E75C 3MRRB 2BNRB 3VGFA 5I18H 1AXIB 4TSAH 4GS7B 1D6VL 4KXAA 4ZPVB 4X6DE 3I6LE 1NGXA 1XR8B 1HKLH 2A38A 5HDBE 1C9SA 4IRJA 3IFLL 1FRGH 4H7VA 5CLXA 5FYKU 3SEPA 3R7QA 3VH8G 3L9RA 2IAND 5D4IA 2X38A 4DN3H 2VLJE 2JCCE 2VSDA 1CF8L 2IPUG 2QQLH 1I8KA 3ULUH 9PCYA 3OPZH 4Z7VE 4MBRA 2QSVA 1JVKA 1XZ0A 3HEIB 4YLBA 3VH8A 2A6DA 2MPVA 2QSQA 1O9WA 4I18C 1UEMA 5IB2B 1WZ1L 2YAEA 4QDGA 4L3EA 5I76A 2H4EA 3BVTA 2ENSA 2EO7A 2XXGA 5DK2B 3VGEA 3DSNB 1BXVA 3L17A 4NERA 2H1PL 2XPGB 4J28A 4KHTL 4OGAC 4F57H 2PWFA 1BGXH 3T3PB 1OM3L 3ZK0A 1H3PH 2YRPA 4ONOA 4ORGB 5DK0B 5SWSD 3ZKQD 5I8CA 2L0DA 1KZQA 3G6DH 5HDBB 3UXFA 3IDJB 5E9DD 5GZNA 1IAOA 2VXTH 1OAUL 3SJVB 5TDNB 3QNYA 3P0VL 2X4OA 5EUKA 2EIZA 4QWWD 2K4WA 3I75B 4JCLA 1NGWA 4KJQC 3QUYC 4R3SB 3ARGC 1YYML 4AX3A 3GPSA 4F5CE 4PJHE 3WO4C 4Z7UE 5FGRA 3EOBB 4HS3B 4OJCA 2FVNA 4OFIA 3T8XA 2KH2B 2ITDA 2TRYA 1OAKH 4FKKA 4AGNA 5JOPD 1NBCA 3CN2A 4K7PH 1QSEA 4JPQA 4FA6A 4PGDB 3QJHB 4OFQA 3MRIB 2Q3ZA 4F9LC 4M7LL 3TN0B 1GR7A 3LPGA 4KO6A 3S36H 4MAUH 4APXA 1E9OA 3NVQA 4NAJA 2VAJA 5LB1A 1AGCB 2IAMB 2CGYA 2YD7A 3SD5A 4HG4J 2VR5A 4Y4HB 4D9RE 1H15A 3AMKA 4FYSA 1E9QB 3UTPE 4DUVA 5E8PA 1GSKA 4PJAE 1I7ZA 5DD6A 2BFVL 1QQDB 2PTTA 2MPAH 4N8PA 2WLZA 3VSUA 4DCQA 3WEOA 4JO8A 4Z0XB 2HT4C 2HG0A 4PHZA 4D0BB 4V1DE 1FC2D 3GHBH 3QFJD 5GRWA 1NCAL 4P3CL 3R8QA 3FCGA 2WXPA 1YEJL 5SWZE 1YNKH 1D9KB 1KPRB 3OKNA 3DSFH 1I1AB 4HUUB 3QUXA 1LYQA 3QEHB 4M1DL 2DIAA 1T2XA 2CG9X 1QVOB 4LEBA 3WLBA 4AV4A 2W59A 4M48H 4YS4A 2GK2A 2JLPA 5EU7C 2KDYA 1QRNB 4TVPD 1FBIL 5PCYA 5LUMA 5KTEL 2IF7A 5I19L 4D8PB 3TBSB 3MLVL 3S37H 3SDCB 2IXQA 1AIFB 3TEUA 2VNCA 3T0DA 1YAZA 4LQ1A 3A0OA 5TQ2H 4UU9A 1HHHB 2D7MA 2DKSA 2PW1B 1MAML 5HI5C 1JRHL 2YMTA 2Z91A 3QEUB 1U3JA 3L4UA 4MD0B 3JWDL 5IG7B 1NQBA 3EH4B 2E7MA 4ZW8A 4HWBA 1DLHB 2JJVA 4MJID 1UURA 3OJDB 4YZWA 4N8VG 4ERSL 2JKXA 4Z3HA 4L0YA 4N2BA 4Z0BL 4LPVA 1P5UB 3MLTB 1X6LA 3CHXA 4OZGA 2RFXA 1MFBH 4XO9A 5TE7H 2APFA 1TCRB 3TNNA 3BKYL 3G5ZB 4NO2A 1RKRA 2BCKA 1JYWA 1OGTB 4ANUA 4JZJA 2VE6B 2M83A 4N8VA 1YLBB 3ZLQC 1RU9H 5I6KA 1E5CA 1OSEA 1WLHA 2CAKA 2JTYA 2LU3A 3KM2A 4F2ME 5F6IC 3C2AL 4Y5YA 4AM0B 3I02B 3OAUL 1R5IB 2UXTA 4GRWH 4R7LA 4ANWA 3IAPA 4LSRL 1OVZA 4XBPB 5JLZA 3C6LC 3LEXB 4FQXB 4XNQA 1J0YA 2Z31B 5C0BB 5IVXE 3D0VB 3P11L 2VXQA 4L4VB 3NZ8B 1YY8A 2IOMA 3UP1A 4WWID 2J6EA 2VXUL 4HUXB 2FJFB 2YZ1A 3MROB 3BX7C 3NDYE 4NM4L 1QATA 3KPQB 1X5IA 2WQ8A 1XIWD 2XFXB 3FSAA 4L8SB 4OJFH 1DQJB 3LKOB 3KYKH 4M7JH 2X7LA 2XG4A 2LQRA 1A65A 1PX4A 1RZJL 2XN9B 3KBHE 4Q97A 4P5MA 1EAOA 2Q1EA 1DBKH 4RWYL 3MXWL 4CN6A 1JZ3A 3O9WC 2DTML 3UO8B 5DEGB 5C09D 1ECZA 1U8CB 3HMXH 2AANA 4NKMA 4KGJA 4OCNC 4RGOL 5E5RB 2F61A 1JYNA 3K91A 4WFHD 4GP5B 4WWOA 5A2FA 5IJDC 3T6ZA 2IH3A 3QE5A 5E2VL 1PZDA 4KVCL 2QSCH 3EF7A 2IDUA 4R26L 5LXGH 5DJ2B 3A23A 1G5GA 2EDHA 3LQAH 4IOIB 1JI2A 2AK4A 1ZTMA 2B3RA 3D39D 3PUCA 2EDTA 3QAZB 4XO8A 1W0VA 4M8VA 4UQBA 1NCDH 3ES6B 4XTRC 3SO3C 1ORQB 3P54A 1EEYA 4LVEA 3S35X 3NCCB 5TJWK 5K5YA 5L2KE 1XAKA 5HGHB 3TZVD 4QO1A 4OLUH 4I2XE 4DO4A 4OZFG 4G8FA 1T5XB 4WWPA 1VGKA 4MX7A 1P7QB 4AV0A 4R9HA 4AYFB 5BPPA 1NICA 2F1AA 2QQKL 3H7LA 1HHKB 5CJQL 4CAGA 4OSUH 3PFUA 5I1CL 2X6BA 5BS0D 4OZFA 3D0LA 1QPPA 3CFUA 4WQOA 2ADJB 1HCYA 2WNWA 3QRGH 3ET9F 1GZQB 3P77B 2A9NH 1KGUA 1CI5A 1BM7A 2AQSA 2BIOA 2N0KA 5A43C 2XYBA 3V4LA 2P5WE 4QRQB 4BFRA 5DFVC 4FA7B 2NR6A 3INUH 3QP3A 1SLUA 4Z76B 3ELQA 3BSHA 4S1SH 3EOAA 5C6PB 3SKJL 2C26A 4IS6B 2C9PA 2WY3B 2I69A 3MA9H 1TU2A 1BLNB 3DV6A 4PG9A 5G4MA 1T5KA 3HS0B 3MJWA 4FG2A 4KVPA 5E70A 3OL2A 1UM6L 4QRUA 3LKPA 3V4PH 1CLZL 4KKZA 3DMMB 3JVFC 2YAPA 5J8OA 3MFFA 3VG9B 4P23B 3PHOA 1BMWA 1N59A 2Q86B 2HG5B 1RK7A 2VZVA 3NIGF 2O93L 3MV7B 2XXFA 4LFHG 5ILTH 2K7QA 2ZWSA 3HLAB 2SEBA 3DOIA 2Z65C 1DLFH 1EA9C 4JFZH 2FHBA 1ZIBA 5LKNA 1U8KA 4KJWD 1RFDL 5IMOA 2ICEB 3ME0B 2FWOB 4PG2C 4TS6A 1KIUB 4MXQC 4PBXA 5SX5H 3ZQWA 5IHUL 3O3DA 2R51A 3EBAA 3DO3A 2EDWA 4K9JA 1Z9PA 4U7KA 2W60A 1CPUA 4MMYA 1IBBA 3SDAD 3B9VA 3VQLA 1XL6A 4FNRA 3VRIA 5TPWL 3CC1A 3EZJB 1NGPH 3HNVL 4I13B 4NQDE 2K7PA 4MB5A 1QSFA 3ZE2F 1A5FH 3ECWA 2F54B 1SXZA 5IT2L 3G6AA 4TSCL 4AQOA 4F8PA 3QC5X 5ALCL 3T6WA 3VFVB 2ZD0A 4LOUD 1RZ8A 1UWYA 3FB8B 4JVWA 3FBQA 2B4CH 3FFDA 3ARDC 2EE9A 2CXGA 1G43A 4HBCH 2I07B 2YXMA 4YXHH 3P9WB 1BW8A 2P8LB 2XZZA 5EEXA 5ICUA 4WTZA 4XMVA 1AR1B 2AF2A 2YD9A 1MNNA 3AWGA 4FI8A 4BSVA 2H7WA 2WUCH 4NUQA 3VXSE 4EDXA 3SGKC 1HEZB 1VSCA 4NQDB 1KJ2H 2HPTA 5LLIC 2EJ1A 1IBFA 1HK6A 5IFHL 2ZCLL 1KTLB 1IEBB 4P5TA 1VADB 3KZ8A 3P0YL 4TQPA 5IBUB 1NAMB 3D05A 3PGFH 2Z35B 4J3XA 1U6AL 5AKSA 3QWOA 2FD6L 2HRHA 3ARTA 3GSNL 4KK8D 4PHXA 1BSIA 3MGTB 4PUBH 4HCIA 1NBZB 2UZXA 3ZKND 3IS1X 3GM8A 2F58H 1M6OB 4G6JL 3RTQC 3TYGH 1ZHBA 3FT0A 2X4UA 3TX4A 1PJ9A 2DF3A 4TNFA 1NSNH 4JFDE 1ZVNA 3RX5A 5PAZA 2DQUL 8FABB 5IUCA 3HLKA 1E5YA 2QVIA 3CK0L 4Y5VC 2F8XC 3SYQA 3VWKB 5C86A 4K8RL 4KITB 1AO7E 1FSKB 2CGRH 1BMGA 3WAKA 1B90A 1MRFH 2GI7A 2FGWL 3QIWD 2ENPA 2VYRE 3FSWA 3G5YB 3LYRA 4HJ1A 2ADGA 1TEGA 1DSWA 4PRHE 3ZO0A 4S10A 1AG6A 2NNAB 2R1XA 3OKDB 5MERA 2QPSA 4ZXBA 1IKFL 3F7VB 5B8CB 1X3DA 3ZTDC 4ZMXA 3HRZB 1H6TA 3IJSB 5ESAB 1WT5C 2HLFD 4LASH 3B9KB 2ZUXA 1A7OH 3O6ML 1C16A 3JXAA 3UP6A 1IGMH 3AB0B 1DN0B 1T22B 3NJFA 3BWZA 4IRSA 1BIIB 1WBYB 4YFDB 4Z7QF 4WV1C 4ZOBA 4GI6A 2EXYD 5D2LE 3L7FB 4Y1AD 2VN6A 4BZ2H 4MMXC 4DFHA 5C6WH 1ZVHA 5KANI 3D9AL 1YYCA 2R0WL 1RZ7L 4MA8L 2XY1A 5IQ9B 4S1RH 1ZIAA 3V0WL 4KZCA 1WHPA 5IJKC 3HTLX 4PRNA 4PRHB 4P4RB 1JS4A 4AEHL 2AXWA 1FNEA 1PIGA 5DS1A 5BW7C 1ERNA 1KYFA 2QELA 4JN1H 3UZVB 5EF3A 5LCVL 3ARUA 4OZGF 3JWNG 4YX2L 5E8NA 3JWDC 4MCMA 4TNVK 1FZOB 2D03L 3MUHL 2PR4L 3LAFA 2WLIB 2Y7QB 4J3OC 3VFNA 4QTHA 1PW3A 3VXNB 3HNSL 3MCKB 2NY7L 2YFOA 4AVIA 2XQYG 2FJHB 1HSAB 1OSZB 5D2LB 1CFTA 2YQ3A 3BQUC 4OM1L 1Z9SB 2DKUA 2IQ9H 3LZNA 3P4MB 5BQDA 1P4LB 5F0MB 1U3ZA 2Z1KA 2XQYA 4LPYA 4DESA 3NIGB 4GEIA 3DX9A 4EDWH 2PPAA 1ZSDB 2BVQA 1RZPA 3RFZC 4QJ3B 1ZVSA 3MJ9L 5DYOA 4F9PC 2V2TB 1R3HA 3GGWB 5AVRB 3FHEA 3HG4A 2O6PA 1JZEA 3G6JE 1W16A 2UUDH 3KLAA 4MQXC 4I48A 3BH8A 1NGXB 3JWOH 4IRJB 2ZCZA 2Q3AA 3SZKC 3L9RB 3PAZA 2YOAA 4N2GA 4EIGB 3A47A 4HOZA 5C6TH 1I8KB 4FFWC 1RZGA 1JGDA 3CDGA 4FLQA 4AK1A 3CUPA 2GJZA 3FK3A 1GL4B 3FQTA 3VCLA 3RZCD 1XZ0B 3T2PA 2A6DB 3VH8B 5DDHB 1WWAX 1NLBH 1M3JA 3ZE2B 2WBWB 1TFPA 3SDYH 1QUPA 5I76B 5FYLE 3GJEA 4NZTH 4A1RA 4I3RL 2R0KL 3JYCA 1QSEE 4NRYA 3WXVL 1OAZL 3BKCL 3WJJA 2YXFA 1RH8A 4YSTA 4HZAA 1J5IA 4JKPL 3WNOA 4CBZA 3E9TA 5LBSA 3AMLA 4U6VL 1PY9A 2YSTA 4DKEL 4MA1C 2KQNA 3CGTA 3SQRA 3DHMA 1J1OL 3PWLA 1IAOB 4YUEH 3ABKB 3QNYB 4G80A 4ACTA 5D1QE 2X4OB 4F7MA 5EUKB 5CGTA 2EIZB 2ICES 2N0MA 5EBLA 4PS4H 5C2UB 5EBGA 1NGWB 4YO0A 5IM7A 2VT0A 4DPAX 4HT1H 4M5ZH 4LRIA 4N20A 4L4TA 5MHSE 4N9GB 1A7QL 4H1LA 1J0HA 1W8OA 2Q2EB 1X6NA 2K8QA 5I26A 3T8XB 3EH1A 2ITDB 2EINB 4UOQA 3GXMA 3D6GA 3DETC 3KCWA 3FQ1A 4NQSB 1QSEB 3CE1A 3OR6B 4LRNH 3O3BA 1UGNA 3DGGA 1GIGL 1P69B 4TVSa 2AJ3A 1UH4A 4X9HA 2OYMA 1P9MC 2P80D 4NLHA 3TTYA 4APXB 4JHWL 1E9OB 3QIUD 1KB3A 3U9PH 3ZT5A 3Q2CA 3BFQG 4G7YL 3CIAA 5LDSA 4LARH 5HJBA 5LQBH 5DD5H 1YEIL 1H15B 5D1QB 4DGVL 1IGJA 5E8PB 2XZAH 5DD6B 1INDH 1DQQB 4JFTA 1A4JA 3US9A 1YEHL 4XN2A 1MLCA 4WGVB 4E68A 3DVIA 4QRBA 4M9PA 4OGXH 5HI4C 3VFRA 3GMPA 3Q01A 4K2UH 2ZYRA 5AKRA 5D7LD 5EF1A 4DKFL 1YEWA 3ZZLA 4PYHA 3OKNB 5FCUL 5B38A 5CR1A 3QUXB 2A3TA 4IKIA 3DBXA 4XPFH 1MPAH 3IJHB 4OZGE 4OD3L 3WLBB 3BJLA 5GRJL 3T0EA 3TFKC 2X4RA 1LO3L 5E94A 4PRPD 4PM1A 2HLAB 4KMQA 2BP5M 4PLKD 3UCQA 1RURH 2IXQB 4R97B 5G4OA 4OIIH 4UU9B 1UXLA 2ADYA 5J5EA 4Z7QB 1IKNC 1VIWA 3N0PB 4P3WA 5K59E 3GBNL 2Z91B 1S7XA 1IBGL 3LCYA 3TXAA 1L9NA 3TH3T 2O5YH 3B2MA 3VJ6A 5A7EA 2F7OA 1MFCL 3QUZC 2DYSB 4NPKA 4FQLL 4U7MA 3VGBA 4QRAA 3U6XA 4EN3D 1WFOA 4FQJH 2MIZA 4W4NA 5I1DA 1LO0L 3FS9A 1HXYA 4IGBA 4X7TA 3GEWB 5ISZD 2DQIH 1A9BA 2AJZA 3P40A 4OZGB 1E90A 2ESVD 4LKCA 2RFXB 3TNNB 5J4MA 2OZ4L 3FNKA 4NO2B 5CU5A 2JELH 2BCKB 1FYTD 5CN1A 2XOTA 5DJ6B 2A6JA 4IJTA 4N8VB 4EIBA 3GBEA 1CBJA 4X7SH 3QZPA 4P05A 4Y5YB 4AG4H 5SX5K 1VLXA 2IFFL 5CN2A 5T5FL 4ESKA 3CXHK 4HWNA 2CKBH 5JLZB 1E6OH 4XNQB 4OV5A 5CFHA 4ISVA 1YY8B 4F93B 1XGUA 1L6ZA 1J8RA 4NUPA 2BJML 4HMDA 5JDJA 5L9DL 1XB6A 3GI9L 4HDIA 3TO2A 3OXRA 2FRGP 2OW6A 4B9JA 1A6WL 5ETUA 3KBPA 2X7LB 2HFEA 2XG4B 3BT0A 2MCPH 4FX5A 4NUJA 3OLEA 4HALA 1QRKA 3F65A 4W9ZA 4RDBA 1AS8A 4BD4A 5LN8A 2MH4A 1QHOA 1LEIA 2ARJA 4A2LA 3L4TA 5I1IH 4XN9A 3A4EA 4GRMA 1V8HA 2DLEA 2Q7AA 4Y4FA 4KK5D 3CXDH 1RZQA 4ZMTA 2HT2C 3O8XA 4KTEL 5E7BA 2VDQH 5F0PB 3I74A 2ADFL 2VLRD 5C0DA 6PCYA 4MXVE 4GT0A 4HPYL 3IMBA 3BN3B 1EQWA 1W0VB 1XD1A 4K8RC 4U3SA 4AGLA 5I75B 3FTUA 1S7QA 1M9SA 4NZRH 2RCSH 4N2FA 1EEYB 1K4DA 1GTFA 1CLCA 3KPMB 4QO1B 4EQ2A 3NA9L 1AGFA 5D8JH 5J57B 4G8FB 3CQFA 4FQHA 5GS1A 1GJWA 4HV8A 3FT3B 5C0CA 4GS7C 3O6LL 2WTOA 3NGBB 3KDMA 1T20A 5B3NA 4K0OA 3HJEA 3L5HA 3BLKA 4OLZL 4WW1A 4MA7L 2VLKE 5BVJA 4L18A 4RQQA 1GHFH 2OYKA 3W57A 3D0LB 3KR3H 1IU1A 5MEQA 3GHEL 2BMKA 1DQDH 4KUCD 5CZXD 1MH5A 2CMRL 2A77H 2WVUA 3FFCE 3IJYA 2JSFA 4JFHD 5LBVA 3PNRB 1AR1C 2O72A 3LPOA 3APNA 2W0FA 4CA4A 1NIFA 1ILUA 2EE2A 5IROC 5HVHB 1EHLL 2ZOUA 4GO8A 3C9NA 3WXWH 5AKTA 2VM4A 1KJ3H 3GI8L 1NIBA 3DV6B 5F97E 1FFOB 4NJ9H 4PG9B 3SIKA 3LN9A 3MI6A 3LEVH 2IANE 3QI9C 3ELAT 3JTSA 5F9WB 3FMGL 4A55A 1TJGL 4QRUB 4AMXA 5JXEA 1GPOH 2CE6A 4CSPA 1UB6A 3OKEA 2J7LA 2C1OA 1F18A 2OSYA 2X88A 3AREB 3FKUS 3BP5A 3GTVA 4R4FL 2VR8A 3ULVD 4WK2B 1SJXA 4DWHA 5C70A 1N59B 1IBDA 4KPHH 1RPUA 1U8IB 3P3TA 1NAML 3W2DL 2SEBB 2Q9OA 5I6OA 1E6JH 3FFCB 1JF1A 1A66A 2AQ2A 3B6SA 3DKHA 5L4JA 4G8AC 2HVKA 1U8KB 2CCLA 2VDKB 3FB7A 5IMOB 1BV8A 3MOBL 1ZANH 3HUJE 4HPOH 3T0AA 3BEVA 3O3DB 4H26A 4X4YA 4LMQI 2IGFH 3QHFL 1WD9A 3PWPA 4JM2D 4QHUA 4F15B 3C6EA 4MMYB 1QNZL 3T08A 2R29L 5E9DE 1I85C 3JBG7 3TVMD 3TN0C 1NFIB 2M26A 2R15A 2YC1A 3VRIB 2IMMA 1K6QL 4JKMA 3NCFB 5EOQH 3INOA 4N2KA 1PTZA 1QSFB 2IAMC 1KCSL 5DZLA 1MUJA 5BO1L 3G6AB 4POYA 3WMQA 3SE4C 2IG2L 4HIHA 1E4WH 4ODHL 4HISA 1KT2B 3D85D 4OT1H 1AXSA 3NFSL 2N7BA 2UX7A 3P73A 5BRZD 5TD4A 1RZ8B 3WKPA 3FPYA 4DP5X 1ZS8A 2R27A 2DYRB 1U3YA 1YJDL 3A4AA 4IOFD 4JE4B 4MD4A 4XNYL 4E9SA 5JOPE 1DJSA 3ILDA 2BFGA 4QRPD 2F19L 3FUJA 2QKIA 3TBTB 1TQCB 1K8IA 3CX5J 2APVA 5T3ZD 1VJSA 1ACCA 3FZUD 2IWGA 5DZPA 5HHMB 5INDB 1D9KC 1GGUA 1BG9A 1S3KL 2J25A 5TE4H 3VD7A 1GGBH 1ML0A 5DD3L 4BSVB 1J9CT 1HOEA 4CVUA 2XYCA 4EDXB 2EH7H 1XSJA 2CIIA 2X4NA 2EEFA 3PV6A 4KTGA 5EULV 4C4BA 5IW1A 5DS2A 1J5HA 1AZUA 4P2OA 3SDCC 3VNYA 2P43B 2BIQA 4YSOA 4V2CB 2F1EA 3MFGB 4JGNA 2Z3FA 4K9EL 2O30A 3QWOB 5A2AA 4MTMA 1AQHA 5AYQA 3T6VA 2OJ1A 3W11D 3PU7A 4GRLD 3VMPA 1E4HA 4ZFGL 1UD6A 3KL0A 4EXPX 2UZXB 3IBOA 4KAQH 4XPBL 3T1FA 1GH7A 1WTLA 3CDYA 4Y5XC 3CVHH 4OCXH 5HHPA 2E4FA 2EADA 2YKLL 1DUYA 3E9UA 3QUMA 4NIYE 4TVPE 3RU8H 2CBMA 2OLDA 4BSJA 2X70A 3Q8CA 1UG9A 2ZG1A 1LL1A 3T2QA 2ZP8A 1MREL 4UANA 4PJXE 2ADGB 5JQ6H 4O5LL 5MERB 2R1XB 1H8OA 4ZXBB 3FAXA 4MJIE 4WWKC 2Z31C 2WINA 4NPYA 4YXKH 5KOMC 4IBVA 3K8MA 3O4LA 1C16B 4Z23A 2N01B 3EYQD 1K3IA 3RNKA 4L8DA 4R0LA 2FEEI 2YA1A 5AB0A 2CIKA 4IRSB 3T6XA 4L8SC 4TLTA 3DIVA 5FOJA 3C60A 3BC9A 3JWNE 4LHUA 1O5PA 4HH9A 1M7DA 1IVLA 3V7AE 4O2CA 2ICWI 2J3SA 2NSQA 1TXKA 2E7HA 3N41F 2DWDB 3PJLA 1RSFA 2DYPA 3KL5A 3QJRB 2EYTA 1FGNL 4PRNB 2VRKA 4PJXB 5EZOH 2OXHA 1X5KA 3IKCA 2WJ7A 1FNEB 4OZHE 2GBVA 1JDAA 4L05A 3F64A 2QTVA 5EMYA 2IC2A 1PCSA 4FQ1L 4UT7L 3TPUA 5E8NB 2D7TH 2XBZA 2FGZA 1DVFD 1IC4H 4KHTH 2DQJH 4UT6H 1HIML 3VFNB 5C0AE 1OM3H 4QTHB 1DFXA 3V8OA 1CLVA 1WAAE 1B9KA 2DI9A 3QAZC 1WFIA 2G2RA 4NIKB 1F4XH 3L7EA 5C09E 5CZKA 1VEOA 4DQOH 1CFTB 1HL4A 2G3NA 5IV2A 3B4NA 15C8L 5E95B 4RGNB 5D1ZI 1KIPA 1NGQH 4WFHE 5D70L 3UABA 1WC7A 4PGZA 1D5ZA 1YN6A 1DSFH 1IE4A 3DX9B 3QO0A 4LLWA 1H3XA 4OZHB 2LTQB 3UYRL 4JFPB 1N2RA 1ZVSB 1FAIL 1R3HB 4LF3B 1G0DA 2X3BA 5CN3A 1QLEB 1MFDH 2ZXDA 3D39E 2VZOA 4S1DD 4AV5A 3KLAB 4BQCA 1AFVL 4I48B 4UQIM 4EZLA 4MZRA 1D2OA 1TSHA 3LPWA 5ACMA 3D12B 1QR4A 2O4EA 4Q0XH 5C0AB 4X9YA 2WCGA 3AM8C 2VDOH 3PRZA 1RZGB 3MNDA 1JGDB 25C8L 3BGAA 2YMOA 3CDGB 4YHNA 3CUPB 4ZG1A 2JB5L 2NY6D 1KGXA 2GJZB 3CMOH 3VCLB 3FQTB 4KZEL 4FCHA 3HI6H 2WGXA 5KJ7E 1HZHL 4LAQH 5F6HI 2K6ZA 2OL3A 1N5AA 3GJEB 1JHKL 1SOQA 5BS0E 5IWLA 1QI4A 4M6OL 4NRYB 1IAII 4FNTA 3CZFA 3SGEH 5T1LA 3VG9C 3LB6C 4P23C 3OWEA 1NCAH 2ZTBA 4Z3EA 5LNEA 1JGVH 3H2WA 3SDDC 1IFHL 4RAUA 1A6VH 4OF3A 3PWLB 4G80B 4F7MB 3E8UH 4M1DH 5FX3A 4OGQC 5EBLB 4AYGA 3ILPA 1HINL 4GB9A 1IGCL 2ICEC 2X6UA 4YO0B 5IM7B 4HPHA 3ARBC 1QI3A 5CFAA 4L4TB 1PKQA 1FBIH 4X8XA 4YZFF 3TWCL 5KTEH 1NCWL 5AW6B 3RI5K 5AW2B 3RX7A 4HWBL 4YSRA 1V3MA 1K4CB 3GLAA 2WXIA 3LNFA 5D93B 2CK2A 4EKJA 4G7RB 2AV1B 5GGQH 4N3TA 5T1JA 1FVDA 2DEYX 1JRHH 1D5XA 2G75B 2AQ3A 3LVEA 3BZEA 3UTTA 1QW9A 3O3BB 4XC1L 4P59L 3DGGB 4ETYA 3JWDH 1RJLA 5FO9A 2AJ3B 1DZBA 3D52A 3HN5A 1J0ZA 3CZEA 4BK5A 1BECA 2B77A 5CM1A 1HDMA 1U21A 3SKNA 4P57A 1KBBA 3ZR6A 2R2EA 4MYWB 1JZ5A 4KXDA 4ONGL 2OTWA 4JHBA 4PJ8D 1E4KA 1FFNA 1MRCH 2VB5A 4E41D 5DJZA 4UOZA 2EP6A 1A4JB 3QQ9D 2JF1A 4H0GA 2IBGA 1MCLA 4U49A 4XE0A 2FBRA 2FYYA 3WNMA 1MLCB 4AC2A 2X6CA 1LXMA 2WWNA 1L7IL 3TBBA 1KIQA 2WW8A 2VXQL 5B4MD 3GMPB 4N68A 1U8PA 2LU7A 3MV8A 3RVXC 3VQMA 5HYEA 2FIRT 3BVDB 3B5TA 4G1EA 3OAUH 3BOVA 1KCRH 4MZ3A 5CLYA 2OMYA 1KB5A 3REWA 2HWZL 5HYSG 3SOTA 2O5NA 3BAEL 3G5XB 3DBXB 4UIKH 2BWIA 4XPHH 3T0EB 3EJQA 1RZKH 3DX1A 4YFLI 4RNRA 5JPMA 5DO8A 2OCJA 5ANMA 5E94B 3H9SD 3S5ZA 1KXVC 2DQDL 3GSOA 1XCXA 2YGQA 5HYSA 1QA9A 4W93A 1X5FA 1F6LL 2WXHA 3RYMA 4XVTL 4NUMA 5K1VA 4Q89A 4AM0Q 1YNTF 4EI5D 1XGZA 2WKLA 3VFTA 1I4FA 3H8NA 4UQCA 1S7XB 2XXMB 3GLEA 1CS6A 3TWYA 3N41B 1UA6L 3O41A 3BPNB 4JG0L 4HEPG 2F8IA 4BV1A 5DCCA 2UWEE 1AKJA 5JUEH 5D1ZD 3VWKC 5I1DB 4IGBB 2XV3A 4CVZA 1A9BB 5ITFA 2AJZB 2OV0A 1CDGA 1MEXL 3KYOA 4LKCB 4HEPA 2V7HA 5BCAA 3DIFA 4AQEA 1VZIA 4BKLA 3RIAK 1TETH 4KX9A 4X4KA 3GXUB 4FFTA 5D2NE 5B8CC 1CU4L 1YJDC 2A6JB 2J21A 3IDYB 2J72A 1EHKB 3NCJH 4G6FD 2HT3D 4HF5L 2AAVA 4UB0H 4AIOA 1KGIA 3GPEA 4ZX3A 3DRQA 3AB0C 5DMJB 1M7XA 3DTDA 5I0VA 4JPWH 4OV5B 4AMWA 4WJ5A 2NW3A 4KY1L 4ISVB 2EIMB 3RPKA 1DQVA 1XGUB 2WLNA 2IPTH 3F6LA 1Y6NR 5CJQH 3WE6A 4ZFFA 3TO2B 2AMUA 4FQIL 2FO8A 4UM9A 5F96L 2E46A 3NIDF 2GKIA 5AOJA 3QEQD 4Y2DC 4ZX4A 4HUCA 5ETUB 1T3FA 2BS9A 3F5WA 3K0YA 4ZMQA 2HFEB 1OF0A 5TF1L 4L8CB 4EI6A 4NUJB 3BVXA 5I6PA 4K9EC 5J1SC 4H1LH 3B5HA 2EDQA 3HB3C 3KXFA 4IIQC 4E36A 4MSWA 2UZYB 1IC5H 4WUKL 1E8XA 1IGTB 2ARJB 3MBEC 3TEYA 1LEIB 2NT1A 3BWSA 4KI5E 5FDYA 2OJEA 3VM7A 1JGUH 4GRMB 1QW8A 2ZAHA 4Y1AE 1U8OA 1N0XH 4JREB 4Y4FB 1XH0A 1UM6H 4LIQH 3O8XB 4P9HH 4DUWA 4ZOEA 4HC1H 3ETSA 4M9OA 1ZLWH 4M1CD 2AQ1A 3FU5A 1GYUA 1ORSA 5C0DB 1JG9A 1R17A 5E1GA 5EO9A 4D9LL 2VDKL 1JZHA 4U3SB 3ZT7A 5DHVA 1S7QB 2PO6D 1XCWA 4FEIA 2E7LC 2V9TA 3LN5A 2NCEA 1A21A 1K4DB 1QABA 1ZA3A 4XAWH 1BQLH 4Z3TA 3BRFA 1A6AA 5I1AA 4FQHB 5GS1B 1WH0A 4HV8B 1ZMYA 5C0CB 2NYKA 3FF8A 1U95A 2BIHA 3FRPG 5HHVH 3TF4A 1R0AL 1ASPA 1MFNA 3KDMB 3X3FH 5I1JL 3HI5H 3VXMD 4IRJC 1NBVL 2OMNA 2B59A 4WW1B 5LGHH 3T65A 4RQQB 2FWSA 4DETA 4CL7A 2D9QB 3C5XA 4O2EA 1L9QA 3LJ3A 5I1HL 2G60L 5CEZL 4WU7A 4GSDL 2BMKB 1MCPL 4ZMVA 1MH5B 3IJYB 3BYYA 3EHBB 1HWWA 4HXAH 2W0FB 1F02I 1JE6A 5ALBH 4X6EA 2W92A 5JZ7C 5JW5A 3ZJAA 5CJOL 3QAQA 5HHOD 2Y5TA 4UYPA 3C9NB 4X4XA 1LJMA 3BHBA 2VMDA 2WXNA 4AQ8C 4G43A 5L8JB 3PWPE 1H8SA 4WZ9A 1WRFA 4GIPD 4JS7A 2F1BA 2MNUA 3ARXA 3JTSB 3RNQA 3V0IA 4P4KA 4DPBX 5KBNC 3LZLA 1UB6B 5AG8A 5A2LH 2C1OB 3AWFA 3WGVB 5GZNC 4YGVB 3N1PC 1O6TA 3BP5B 5EN3A 4PU2A 5DFTA 1TQSA 2JH2A 1MAJA 1TVHA 4HD5A 1XTMA 5C1MB 1L6PA 2Z8RA 3LXBA 4RSYA 1JF1B 4I0PD 1ED3A 3ML8A 4JGJA 3B6SB 2BZDA 4P04A 1FUNA 5C07E 5DK3A 2A73A 5F9DC 2HVKB 1SQ2N 1IVTA 1S5IH 3FB7B 4M5TA 3QDJA 1OGPA 3BEVB 3SYAA 1QBMH 2PPCA 1RD6A 2FD6H 1TVBA 4X4YB 3MXVL 5L88H 4Q9BA 3RFRA 2WWMC 3PWPB 4QHUB 4CVWA 3NH7L 1KENH 2PETA 5JR1L 3U48A 4P2RA 4BFKA 1ODAA 1F6FB 3MRJA 3D87B 1Y1UA 1YNTB 3N85H 2PCFA 1DBJL 3SQBA 2W91A 1UUSA 5D1QC 1AY1H 3LZRA 4HIHB 1OW0A 5TH2A 3JV4A 2WNGA 1Q0XH 3P73B 2VR7A 2W9LA 3MRKA 4MRBA 4QR7A 2JKNA 3MA7A 1WCQA 4MD4B 2ZNXA 2Z8VC 3CH1A 5C07B 2EEBA 3QWRA 3AY2A 1VB9A 3BIKA 4S0TD 4IBQA 1KCWA 2QKIB 5KBMA 1GOHA 1K8IB 3EJZC 4LSQH 4S1QL 3D2TA 2GTQA 1KLFA 2V5MA 2K8MA 5CHNA 1RULH 2P47B 1X5HA 4JM4L 3V0HA 2DLHA 3J8F7 3K2UL 2FJGB 4XMLL 4TVPL 4H2AA 3KNBA 2X42A 1Z9NA 4RGMB 2YS4A 5DHEA 2CIIB 2X4NB 3PV6B 5AQ0A 1KCVL 5IW1B 4F33A 4A2GA 4P2OB 4R97C 5HYJA 3H3PH 5LG1A 4U1GB 2IAAC 3D9AH 1RZ7H 4MA8H 5KVGE 3UGEA 5D7LE 2WTRA 3V0WH 2EUVA 3MPCA 3MN8A 4QXGH 4GAGL 5DLML 5EV7A 3GRWL 3VFMA 3NIDB 2YBGA 3O4LE 3LN4A 2VLMD 5CCJA 1BXAA 5I71B 3U6XS 4I77H 3HBPA 3SE6A 5FC9A 2VC2H 3ZDXE 1OZTG 1U93A 5AZ2L 1IILE 2EO9A 5HHPB 3UBXI 1C12A 1MQ8A 3QJOA 1DUYB 2EICA 3QUMB 2R4SL 4JDTL 2X70B 3QIBD 2V8LA 4FAAB 1MRDL 1A4KA 2NY7H 1WUNT 3GTTA 4N0UE 5E1QA 2OX5A 3IGFA 4G5ZL 4N1EA 2O6DA 1Q72H 4JQVC 4OIBA 3ECBA 4OM1H 3IE4A 3T1WA 3UCRA 1JK9A 2OMVB 1QLEL 3CFNA 1QEWB 2VWEE 4NPYB 2WINB 3QZWA 3FTZA 3IFPA 3O4LB 3FAWA 4NEHB 2V7NA 3FN3A 2LAAA 1TNNA 5ISZE 3MJ9H 1NH6A 4L8DB 3RNKB 4R0LB 4NENA 5D6CB 4FNSA 5C71A 1DANT 2ESVE 2GCYA 4Z18A 4ADGA 2ZX6A 4X6CA 2CIKB 4X7DC 1NC2A 4IOSA 5ENWA 1FYTE 4NKDA 3C60B 4X9BA 3TH2T 1XGTB 1BHGA 1M7DB 4HH9B 2GPZA 3HZMA 4JO4L 1Q9LA 4O2CB 2Y6TE 2HVJA 2P24A 4N0UB 1IX2A 4DQAA 2DYPB 5TDPA 2EYTB 3K46A 3WIFA 2D0HA 1ZT4A 2HAZA 3DYMA 2EH8L 3QNZB 3L3DA 3LZFL 5EUOE