3OR7A

On the structural basis of modal gating behavior in k+channels - e71i
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title On the structural basis of modal gating behavior in K(+) channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3or7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3or7A02
4QRTA 4Z8FH 4MJ5A 2G2RB 4IMKC 4JO3H 1CF8H 2F19H 2IAMD 1Q8MA 3MV8A 3VCLA 3UTZB 4GUPB 2HT3D 5DK2B 3MXVL 3ROLA 2Q3AA 2AK4D 1U8HB 5BXFA 1JZ5A 5H37G 1R0AH 4X4ME 1WICA 4PJ9C 4RNRB 2GT9A 1TXKA 2COQA 4AQ1B 5INDB 1DQJA 1J0IA 1JRHL 2XV6B 3L3HB 3FT3A 3O3UN 3JV4A 2A0LC 3CDGB 4OZHF 1I9JH 4NWUL 2X9WA 2UWEB 3GO1H 5DS8B 1VA9A 2Q87A 1JF5A 4W81A 2R0WH 2NCMA 4FFWD 5KSVA 3U36A 4YHYB 1DBJL 3LKQA 4X6EA 3SDCB 5IQ9B 1HNGA 3QB7C 4XMLL 4U31A 4G8GD 4XWOC 5E1HB 3KXFA 3MXVH 4PJCA 4FQJL 1KB9J 4I18B 4B53A 3BEVB 5CJXA 1A7OL 2N7AA 1WBXA 3FKUS 3GBNL 4Y7MA 5A3IC 4TQEL 1JRHH 5TDPA 4JANA 4NWUH 4Y8AA 2X4TA 1BFVL 3CFEB 3T65A 4PG9B 1CDGA 3VFOA 4DKEL 1MY5A 3KPPB 4Y5YA 2MNUA 5F7DB 1LHZA 5KW9L 2DM7A 3UEZA 5LGJB 1QSVA 1UWXH 3MTRA 1NC2D 1FFOA 4KUCF 4XMLH 2XTJE 1HHIA 2EDNA 3ESVF 5TJWK 2YC1A 1R3IL 4JFQA 1CE1L 4FQJH 4HWNA 1OAUL 4MQSB 1A7OH 4OCRH 1X5HA 3E3QC 4YGAB 5DHVA 2VH5L 4QO1A 5EBMB 4TQEH 3KYNA 3TZVB 1UGNA 2VAAA 4WY7L 5C0NC 1BFVH 4L8BA 1SJEA 4XI5C 1D5ZA 4MWFB 4PJBE 4YXLL 2AV7A 4DKEH 1RJZB 4P3DA 1QLRB 1ZTXL 1WITA 2F5BL 5IB2A 5KW9H 2FBOJ 4NFDA 3ZYZA 5MI0C 1XGPA 3T0EB 3QCTL 2YPLA 1KG0A 3SGEH 4JDZB 2OTUA 3VFWA 1MFNA 3HA0A 4WWKD 1CE1H 1RJYB 4TYUA 1OAUH 3VXMA 4QNPE 4YGVB 2FO1A 5DURD 2YPKA 5I2IA 1GRWA 1VGEL 2VH5H 3UO1L 3FOMB 1OTUD 5DTFB 1KPVB 2NX5E 3V4PL 1AQDA 5A2JH 3N1QC 4NZJA 1BPVA 4WY7H 2H9GB 2XZAL 4JR9L 4JFYB 4YXLH 1I85C 2VAJA 5GGRY 5E94A 1EEZB 1ZTXH 1T3FA 5ENWA 2F5BH 1AC6A 3BZDA 4QKXB 1KJ2L 2XA8L 4JM2F 2CSPA 4UTBL 1W0VB 2GUOA 1VPOL 4EN3A 1QSFA 5EPMA 3QCTH 1UM6L 2XFXA 4ZO7A 4LKCB 1Z0MA 3BUTA 1A1NA 1VGEH 2A0LD 3UO1H 2O61A 3QJFB 1B9ZA 3V4PH 1XGQA 4YNYA 5K9QI 5T5FH 4JR9H 4NPYB 4JG1L 4TUOA 2NR6C 2VC2L 1JCKA 2DKMA 5I1CL 3U9PL 3R4DA 1AP2B 3V0WL 1YEHL 1KJ2H 2XA8H 4IDLA 4UTBH 3K80A 2J8UF 4XWOD 3T8XB 4I2XB 1VPOH 4G9FA 3QH3B 3CAFA 3QQ4B 3O8XA 4FZEL 4CDGC 3BD4A 3CC5B 5F8RC 3IU3A 1UM6H 5D8JL 3A6BL 4JO1L 4MJ6A 4X4XB 3OXRA 4BK4A 4QHNA 1HEZA 2XXMB 1A3RL 5IMKA 3OAYH 1BM3L 5FUCC 4QF1A 3OXSA 3RTQC 4KTDL 1P84J 3NIFE 4KMLB 4JG1H 2VC2H 4BK5A 2APTA 2PTTA 3VGDA 5I1CH 1MCBA 3U9PH 5C09D 4LF3A 5DI8A 4OF8A 3V0WH 1YEHH 3GB7A 4HWBA 5KS9E 3OKOA 4JGUA 1LVEA 3EUUA 3HE7D 5FO7B 4P2QA 1A9BA 5AG8A 4FZEH 1J87A 1AE6L 1ES0B 1S78C 3GI8L 1U36A 3A6BH 4JO1H 4M43L 4N8PA 5D8JH 5GGRA 2CLZB 3X11B 4OAWB 1A3RH 5L7XL 2CK2A 4PRPA 1BM3H 1ZK9A 4XI5D 1INQA 5GS2D 1JJUA 4MNGE 3TNMA 3KPTA 5ACMA 4KTDH 2HJFA 4GRWH 3VGBA 5C3LD 4M48H 2HKHL 5D9SA 1JV5A 2PYFA 3CSYB 4M61B 1XCTA 2DWEA 5FA4A 4AL8L 3Q48A 3SKJH 2FWOB 5HDOA 4NBYB 3D25A 1LD9B 4TTGA 3GI8H 1AE6H 1KTLA 4M43H 2OTPA 1KJMA 3FT2B 4JQVA 2Y6SD 4MNHA 2EEBA 5L7XH 3DMMB 4E0RA 3HRPA 1UJ3B 2V2XA 1UH4A 2WSKA 1OPGL 2R29L 1U95A 3QXTA 5FYJL 2HKHH 5B8CA 3TBVA 5GS1C 1R5VB 1LEKB 4QRUA 4K9EL 4AL8H 3HZKB 4JCMA 1EO5A 2BSSB 5GGQL 1JMZA 5B21A 3CK0L 3MJGX 4I1NB 3KYOB 2EDEA 3MRIB 4KI1A 2YWZA 3IJYB 3RGVB 4HZLA 2VISB 3GSOA 4KK8C 5KG9A 3PWPB 1PX4A 1QP1A 1J05B 3QIBD 2RFXB 4JZOA 4HKBB 3HC0B 4PRIE 3TBWB 1TJIL 4J23A 3VFPB 2MTPA 4KJPD 4G43B 1KNOB 2H26A 5A16A 3QDJB 1OPGH 5IB4A 1DE4A 2R29H 3QXDA 3AS3A 5FYJH 3IXTB 3OJVC 3GM0A 4QRQB 5DD0L 3D0VB 4IJ3B 4H1LB 4K9EH 3SDXE 5EU4A 1OCWL 1T5WB 3KPLB 5GGQH 1XF4A 3CK0H 3MGOA 2E9BA 4L3EA 1KV3A 1NFIA 1KIPA 5T3ZE 5CEXA 3V7AE 3FFCD 5L2KA 5HHPB 3RDTC 3MMEA 2ZSWB 5GPRA 4M8QB 2ESVE 3QXUA 4MYWB 1FN4A 4NKQB 5FO8B 5INCA 4KHTL 3RTQD 1TJIH 1K6QH 1UZ6E 3TLRA 4IEFB 3BP4B 1LO5B 5SWSB 3RL1B 4NM8H 3B9KC 3FO2B 4U4BA 5TE4L 3VG9B 5BRZA 2YUVA 5DMJB 1EGJA 5DD0H 2H3NA 4S1SL 4NO5A 3TBSB 3RWIA 1OCWH 2AXFB 2E6JA 2XQBL 3O45B 4PJ8A 1Y0LA 4JCLA 2E7BA 4AIZB 1S78D 5FGSA 1FZOB 3OGCA 2H2SD 1JPGA 2P43B 1E6JL 1XEDA 3BN9C 1KACB 1LQSR 3MRHA 2NY1C 4G6AC 4KHTH 4N0CD 4OF7A 5AWNL 1IAOB 3JWDC 4PJFF 3W9EA 1P6FA 2VOTA 1QFHA 2C9AA 5TE4H 3I9GL 4XXCA 4LSVH 1HHKB 1RZKL 1A1MA 3CSGA 4S1SH 1FLTX 1Z3GL 2VWEC 1CFBA 3EJJX 4AM0B 5C08D 3WNOA 2XQBH 4PGEA 1ZVHA 3TN0B 4CDHA 4JM2C 4ZO8A 5CSGA 1R3KB 3SCMC 1E6JH 4D2NA 1AHWC 2AV1A 1QSEA 3A6OA 5L0QB 5E4EB 2E8ZA 3VGAC 3X12B 2D31A 3WEXA 2GK0B 3M07A 4D9QD 5AWNH 3RRQA 2CLVB 4UU9B 1NEZA 4YBLC 5IVZA 1F97A 3W11D 5IM7A 2D0HA 4R96B 4M5YL 2Q7YA 4XNZB 4RGOL 3QI9A 4QGYA 3TP4A 2W0FB 2DRUA 5F7MC 2VDQL 3I9GH 1PG7L 1CTNA 1WCBB 1RZKH 5EOQL 1TTFA 1Z3GH 2JIXD 5FM5M 4E5XA 4GT7A 3RKPA 1S9YA 1D5XB 4K3EL 3NCBB 4JY5L 4KK8D 5C0JB 2R0LH 1F3DH 4PJDB 4WI9A 5IBLD 4L8DB 4AIXA 1P2CA 4BFEA 4LFHD 5MENB 2GJ6A 3LV3B 4TUKL 3OSKA 5L88H 1NJ9A 3WN5A 4OZFB 3CFIC 5D70L 3QIUC 4Z77B 2ICWI 1S3KL 3WO4C 3P9MB 4X7CC 2ZUSA 3K3QA 4Y5XA 1CDBA 2R2EA 4JFXA 1D9KD 1U93A 2P5EB 2Y5TB 1DQQA 3U83A 4RGOH 5DRWB 4A6YB 2FDBP 5GGSB 1QBLL 2OP4L 2AXGB 1PG7H 2VDQH 1P9MA 5EOQH 5ESQB 3GHEL 4OCNC 1ZLUK 4K3EH 4NQCE 1TIUA 3L3GB 1P5VA 1EFXB 5F1NA 3U0TA 5H35B 1QFWI 3RDTD 5T1KA 4EJ1C 4H5SB 1EPFA 3BISA 4LASL 4NQUA 1RUAL 3FB6B 3G6JB 3O3EB 1NLBL 4TUKH 3DNKA 4UNVA 3S9DB 1HIML 2BNRB 2YD8A 1D6EA 3CFBA 3VMOA 5D70H 1S3KH 4AMKL 3B9KD 4HJGB 3BO8B 5DJ8A 3SY0A 4U1GC 3MJ7B 4WTZA 3GSRA 3MV9E 1QBLH 1LILA 4AYFA 2OP4H 4P2RE 4GBXC 1WAAA 3CZFB 5DGQA 1UWGL 2E6PA 1I8IB 2HFEA 3GHEH 4WO4A 2P49B 4YZFE 3QO0A 1RMFL 5J6HA 5IIEB 2VSCA 4LASH 3FHQA 5ILTL 1RUAH 3HPLB 4FHBD 3NPSB 3ZKSD 1CD8A 1GVIA 1MCPH 4G6AD 4TVPE 1NLBH 3PQYE 4L3CB 1YEFL 3P4OA 4HJ0C 1HIMH 3QNYA 1FG2A 5FGCE 5GIRB 4R7NA 5HGBB 3P4NB 4HC1A 2H32B 4AMKH 5EIVA 1C16B 5CJ8A 3VFVA 3HUJE 1EEYB 5DJAA 1K4DB 3H9SE 4JKWA 4LCWB 2ITDB 1RZFL 4YBQD 3C60D 4CRPA 3OF6A 5C0CA 1UWGH 3V52L 2DI7A 5HI5C 3C09C 4JM2D 2FNBA 3SCMD 3JUYA 3GJFA 1RMFH 1NCWL 5ILTH 2ZOLB 1X5GA 2G75A 1YEFH 3AREC 5E8OA 5HHOD 5CD5C 3BWAA 4Y16B 5D5MB 1QLFA 3X13A 1C5CL 3KPOB 1I7RA 5HYEA 3N0PB 3SDAC 3FQRA 3M17A 1L9NA 3ARGB 1GZPA 1RZFH 2QHLA 4G3YL 1NKOA 4LPUA 3B5HA 3CXDL 2WP3O 3U4EB 3V52H 5DDHA 3V9FA 3HZYA 3QFDB 3GZKA 1FNLA 2NLJB 1T0MB 5AD0B 1X5JA 4GRLC 2CDFB 1N2RA 1NCWH 2ITCA 2M1KA 4PRDA 4YHNA 5EORL 3MZTA 1J1OL 4KY1L 5IB1A 2YUZA 3P73A 5FOJA 2XPGA 1FL5A 2RB8A 3FQWA 1HH9A 3CCHB 4Y1AA 3T3ME 2DKUA 1SYVB 4IRSC 5KAQG 3MBEA 5HYSG 3HNTL 4HKJA 4HK0A 4CADA 4OLYL 3TA3B 4MXWL 3G9VA 2ZUQC 3MLSL 3IDMB 5DMKA 3HNSL 3S4SG 1DUYB 4G3YH 4PB9L 4OCMC 3O3DA 2ADIB 3CXDH 1P4LA 1VHPA 3KGRA 3BD5A 4FP8L 2XWBB 2JJSA 3ZE1F 2DJUA 1IGJB 4JAMB 3CPLB 3IF1A 3K4DA 5EORH 5LWYL 1J1OH 4KY1H 5EC1A 3SDDD 4DKDC 3H7BA 3T08A 3EYOB 1HQ4B 4WFEE 3NGBB 4CJ1A 3CFKB 4ZXBA 3HNTH 1EAJA 1F3JB 3T0DA 1N3NB 4OLYH 4MXWH 4GBXD 3NFPB 3QO1A 1WQVT 3MLSH 1CQYA 3HNSH 1TZHB 2C3HA 4PB9H 4GKNB 4J8RB 1SY6L 3GM8A 3OWEA 3V6OC 1S7RB 4EQ2A 4R8WL 3V6ZB 1XFPA 4FP8H 1QRNB 1IM9B 4FQHA 2WBWB 2VR4A 4X6DF 2J4WL 1K5NB 4NKMA 4KGJA 5DO2C 1M1SA 4HJ0D 4HT1L 3RQ3A 4OCXL 4L4TA 4OI9A 1RZ8B 2XTJB 4RMUA 4X6BB 1CDYA 3F7PC 1BQUA 1KN4L 4NKOA 4Q6IC 5HYJB 3SE3C 3VE0B 4LU5L 3V7MA 3VDAA 1ZT4A 3UPRB 2J6EA 2R8SL 3AFLA 2AERT 3L3DA 5HI5D 1JF6A 4Y4KB 3AVEA 1SY6H 4DZ8B 3L7FB 2CIIA 1MI5A 4LP4A 4R8WH 1DANU 3O11B 2AJ3B 1N0XL 1X5LA 4XVJL 2J4WH 4NQDE 3VXTB 3QEQD 2FYYA 4HT1H 4OCXH 4OFKA 5JA8B 4YX2L 5J0BA 1NKRA 4KJYB 3RWDB 3QQ9D 1KN4H 1BOGB 3KPRA 2E27L 1HSBA 4LU5H 2EDTA 4ZUTB 4QTHB 2JJVA 4D0DB 2R8SH 3VDCA 2NX5B 4KKBC 2H6PA 1F42A 4XNYL 2EDYA 5BS0E 5FF6A 3CVHL 1S7VA 4ZNCD 4OZIA 3OKEB 4LSQL 4N1CA 2R1YA 1NGPL 3QG7L 1N0XH 4XVJH 1HQRB 3V5DB 1P69B 4HMCA 1CDCA 3LN4B 2Z8RA 3E3QE 1NGZA 3MRNA 3VW3L 3KLHD 2PXYC 2UUDH 4YX2H 4WW1B 5LJYH 1L4IA 3NCYP 3RWHB 3IKCB 3NFNB 1EFQA 3IETA 1WZ1L 3O3BA 3O3AB 1JPST 3H6JA 1ZLWH 4ZUUA 2KQMA 2YRPA 4HKXB 1H3VA 1MJJB 4XNYH 3QNZB 3WE6B 2NY6C 5IROA 3CVHH 4DCQA 4LSQH 5E7FA 4PTTB 2X4UA 1S9WA 4WHYH 4N5UA 3QG7H 1SJXA 3VXQA 2DIJA 4PGDA 1XF2A 2I9LA 3FQUA 4FQCL 4XBEL 3BJ91 3VW3H 5CSBA 2DLHA 4WU7B 3DO7B 1K4CA 3P2TA 2BP3A 3H0TB 1RUQL 4RA3A 1WZ1H 1OTTC 1DQLL 2FO4B 1NPUA 5C2BL 2ZUUA 3DI3B 4CNIA 5D7LA 2FJFB 3VH8G 5HHQA 5HBBA 3DTXB 4EUPB 1FGVL 3ROOA 3W81A 3S5LG 1S9VB 1NFDA 5MEPB 2DI9A 3ZSSA 1U3YA 3L7EB 3RNQA 1CS6A 4L29A 1CLYL 3I6GB 3O9WC 3RWFA 1MRFL 3I75B 2J7LA 3PGDA 5KS9B 4R2GB 2CLRB 4B5EA 4FQCH 4XBEH 2NY0C 3LD8B 3O2VL 4HFUL 5H94A 5B39G 3T1FB 5CJQL 1DCLA 1RUQH 3S3JA 1G6RA 3ZE2E 1DQLH 5FFLA 4R4BB 3C8KA 1JPTL 1A7QL 5C2BH 5ESVB 4KRPD 4X7SL 2MSPA 2Z35B 2VXSL 2GSGA 1OY3B 1PW3A 2EDRA 1N6UA 1FGVH 4MNGB 4KFZC 3BT2L 5E9DA 5EU7C 4NN7B 3PHQB 3LN5A 5DRXA 3U1SL 5IVXB 4OKVA 2BMKB 1HH6B 5KZCD 1YEGL 4KJQC 3WFEL 1NBYB 4Z7WE 1CLYH 1LK2B 1MRFH 1RK1B 3O4LB 4HS8H 5I74B 2JK5B 3O2VH 5FUCE 4HFUH 1NCCL 4LCCC 2I9TB 3BIKB 1GL4B 3HKFA 4JJHA 5IW1A 3O4OB 3SKUD 1UXSA 3DV6B 4ZUSB 1A8JH 3KYMB 3PV6A 1JPTH 4M03A 4PJIE 1A7QH 2ICWA 4XRCB 2BXZA 5E00B 5E2JA 4CVWA 3ARFC 4X7SH 4N8CL 2VXSH 4HFWA 4RAVA 1FVEB 5DK0B 4F8TA 3BT2H 2C1PA 3AXLB 5IMMA 3U1SH 2WIMA 3ME0A 2EYTA 1K8DB 3MR9B 3S7GA 1YEGH 1BP3B 1EV2E 3WFEH 4RIRB 3D0LA 4HF5H 4Q9QL 5FGRA 1RD6A 1NCCH 3WFZA 4Q2ZB 3QFJA 4TVPL 1S5HB 4WU5B 1V3KA 1IKNC 2NY6D 4RBPH 1P7QB 4LVOB 4N8CH 3FN3A 2QKIA 2Q8AL 3GSWA 1B0RA 1TZIB 4PLKC 4OFYD 4OGAD 3RIAF 3SDXB 5KVFL 3VJ6B 4JRYE 3GSNA 2JJUA 1JUFA 3QULA 4Q9QH 1X7QA 3QIWA 4M7LT 4HS3B 1OTTD 1AH1A 5E6ID 1JYXA 4K2UL 1FE8L 3MO1B 3MGTB 5DJDA 4U0RC 3ILQC 1FNGB 1MCFA 3B8SA 3K8MA 2ESVB 4ODXA 3V5HA 5L8JB 5MERA 5F3HA 4TVPH 3ZTJG 5GHWL 4OV6F 5EA0L 4JB9L 2Q8AH 4O02L 1TCMA 2P5WE 5IEHA 2XKNB 5GGVY 1NCNA 4WW2F 4NHCL 5J6GA 5D7JC 3RJQB 1FNAA 2Y72A 5KVFH 4ZTPL 4W6XB 2X09A 3MFFA 2WQRA 3WFBL 2VL4A 3W0WD 1N64L 3D39E 1KULA 4K2UH 1FE8H 5HHME 3RZWA 1I4FB 3MRMA 4NQSB 3EYFA 2HG5B 3DX7B 2QSCL 4RRPG 1TJGL 5ID0B 3IJSB 4HIXL 5AZEL 1DQML 5EZLA 5GHWH 5KAQF 4Z7UE 5EA0H 5JOPE 4JB9H 4O02H 4PJCF 4GG6F 4P4KC 3EHBD 4NHCH 1NEZG 1MLBA 1UG9A 3BMWA 4YPGB 4N0RA 3BKCH 5IV2A 5FM8A 4NZUL 3V6FB 4ZTPH 4ZUWB 5KJRH 1NEUA 1I3RA 3WFBH 1N64H 3MGAA 3IVKA 4IRJB 4HXAL 4S1DC 3WKML 4QXTA 3ARFD 5HPMB 5A40E 4KTYA 3BPLB 2QSCH 1TJGH 1CICA 4HIXH 5AZEH 1DQMH 3CMOL 2GAZB 2PO6A 5EOTB 4KV5F 1BJ8A 1CGYA 2Z31C 5CLTA 3GSXB 5IF0B 3VFGL 3A67L 1FFRA 1EXUB 4NZUH 2ADGB 4P4RA 4PRAB 1BQHG 1OTSC 4L9LA 1QNZL 3REWA 1ZLVH 4RGMC 2R9HC 3C5SB 2BNQE 4I4WB 5ANME 4EI5B 2C7UB 1F11A 5EB9A 4HXAH 3WKMH 1P1ZA 2LU7A 3FB8B 3SE4A 4M7JH 5C86A 1WFOA 5FO9A 1GJIA 2C3VA 1QSZA 3CMOH 5KANG 2AJXL 3C5JA 4PJEA 1T03L 4PLKD 4D0BB 3F5WB 1YPZA 4LLMA 3QUYB 1JWMA 3HHRB 2H41A 4KUZL 3K4AA 4UQ2B 2R1WB 3OGOE 1IE5A 3ARWA 3NCEB 5ECJE 4QLRA 3VFGH 3MREB 3A67H 4WTZG 1JMXA 1T0NB 2MHAB 1WK0A 4Y19D 4NQCB 3IFOA 4GKZB 1QNZH 1I1AC 2LV4A 3UXFA 4NQTA 3WHXB 4KDWA 5T1LA 2FH8A 3W9DB 2UZIL 5F1SA 1S7UB 3WNLA 3G04A 3A6CL 5GS0C 3O6FB 5HHNB 3GEWB 5A43C 1H8SA 5FECA 1J88A 3SEPA 2P1YA 4CVZB 3WJLC 5D93B 4BSVB 4LK4A 2AJXH 3QDGB 1T03H 4ZAKC 5D2LF 1NUFA 3LRHA 2CIKB 3LSOA 1LEIA 4KUZH 4NYLA 2J8UE 3MV9B 2N4IA 2F74B 4P2RB 2GFBA 4NO3A 4K7FA 2W92A 1JRHI 2VTFA 1HDMA 1RURL 3MRGB 4NIKB 3TVMD 3VFUB 2G60L 2OL3A 1UJTA 1OAYL 3UBXI 1U58A 2YBRB 4G6FB 2UZIH 3U6RB 3ULVF 2MOVA 1JHKH 2IPKA 3PQYB 5C0FA 1FV1A 3L5IA 3A6CH 1KB5B 2MJWA 3GMRA 5FGCB 3C6SA 3T0AA 3QISA 2QQKL 4OFPA 3VFMB 4OD2B 4ZNEE 2LFGA 1YDPB 1FL3B 1KCSL 3S37L 2DF3A 4P46B 2GHWB 3HUJB 1UKQA 4ZFOB 4M1DL 3H9SB 3PWVB 5JDSB 1OLLA 4WEUD 1F2XK 5I1LB 1FZKA 4K23L 1WC7B 1A02N 1S7SA 3PWNB 1RURH 2F53E 4LPTA 3TCLB 3RHWF 3GMOA 3EIFA 1S7QB 2G60H 5D1QB 4I5BA 1OAYH 3I50L 1T89A 1LDSA 2Q20A 3HMXH 5TGBB 2X4OA 2X1WL 4GAFB 2QQKH 5ADPL 5FYKD 2ZSVB 5CIPB 3ARBA 1F45A 1KC5L 1KCSH 3S37H 1LE9B 3SGEI 4ODWA 4UDUB 5D1XA 1GXEA 4ELKA 1YEDA 4M1DH 5GS2H 5C0GA 4KU1A 1AGBA 1ORQB 2UZYB 2J1KA 2FRGP 5DMGC 1CGSL 4YDJA 1VGKB 5J11B 2R9HD 1VERA 1E4JA 1BD2E 2EZ0C 1N5AB 4H88L 3RZCD 3O41B 5IFJA 3SE8L 5GGTA 3WUWB 4PRHA 2VLLB 4MXQC 4WGVB 4E9LA 3RY6C 3I50H 4V1DD 5IHUL 4QHUA 1ZHNB 4XPGL 3U7YL 2IANE 2OM5A 3VXRA 1FNFA 1LMKA 5FUOL 5ADPH 1BQSA 5DT1L 3STZB 3B6SB 1BAFL 3TO4D 1WWWX 5TE7L 1MREL 5IVOA 1KC5H 3ES6B 2KDGA 4UIMA 3AS0A 3FB7A 1HILB 3QDME 4ORGB 3BMVA 4ODVL 2FJGA 5IK3A 3QEQE 4WW2C 1OAQL 4H0GA 1CGSH 5E2VL 1BIHA 4H88H 5FDWA 4YEEA 3SE8H 1KXQE 4LHQB 1YMHA 6FABL 1QBML 3V4VL 3GUTA 3UDWC 4JFFD 4MA7L 5GS0D 1RU9L 4LVNC 5IHUH 5I1AB 3RWGB 3ARUA 4AT6B 5ADOL 4XPGH 3U7YH 4ONHA 3BYTA 4LHUB 3LKNB 5FUOH 4JFDE 3QR2A 3DGCR 4CMHB 4I3SL 5DT1H 1BAFH 1TVHB 1MREH 1VACB 1AKJB 5TE7H 3GJEB 2PR4L 3QQ3A 3EAKA 2DN7A 5GJSL 4QRPA 4UNUA 3RWEA 2UVFA 1AXSA 4ODVH 1DUZA 3CXHK 5DUBB 3MLUL 1JYNA 4U1LA 2RHEA 1TZGL 1OAQH 5E2VH 3T1WA 3B3IA 3I2CL 2AJUL 4BKLB 4PV9A 1Q9KB 2YPVL 1AD0A 3NTCL 4ZDHA 6FABH 1QBMH 5C0AA 5DMYA 3V4VH 4PJ9B 4JFHD 4MA7H 2CUMA 1X6NA 2VXUL 3F7VB 4BFIB 1RU9H 2ENYA 5IWLA 5ADOH 5EOCL 1IKFL 1NUDA 3UTSA 5FK9A 2ORBH 4XCNA 2QADC 1S5IL 1T7WA 4I3SH 3AB0B 4AENB 3S88L 2PR4H 2C3WA 5GJSH 3SKNB 2G2RA 4AJ0A 3DLQR 1D5IL 3NCYS 5CEZD 3QYCA 3MLUH 2BHUA 3KLSA 3UTZA 3ZKMD 1TZGH 5DK2A 4P3WA 4F9PC 1A6ZA 4MVBC 2BXYA 3I2CH 2AJUH 5JMOC 2YPVH 1G6VK 2P46B 3NTCH 3SE9L 3FTGB 4Z7NF 4NQDB 4RNRA 3EOAB 2D9CA 2VXUH 5INDA 3B9VA 3L3HA 5DVOA 4YDKL 3WDIA 5EOCH 2DKSA 4FFVC 3CDGA 1IKFH 4PRBB 2UWEA 2ARJQ 5DS8A 3GI9L 3V6OE 2AJSL 2LE9A 4J3TA 2BRRL 1VFBB 1KSRA 1D7FA 3S88H 3HLAB 4XPTH 4BQ8A 1CXLA 3SDCA 4KJWC 1NSNL 5IQ9A 1D5IH 1E4XL 1GOHA 2EZ0D 5EZOL 5BS0B 4K94C 3DV4B 3CDFA 2EECA 2FGZA 4ZOEA 4DOHE 4MXQD 4IM8A 4I18A 1J0HA 3D69B 3T2NL 3BH8B 2VZOA 3BEVA 3SE9H 2VQUA 4NCDA 1SBBA 1XGUB 2A73B 3MLYL 1AO7D 4X7EC 4YDKH 3T2OA 4OZ4A 3CFEA 4PJ7E 3MV8D 4PG9A 3GI9H 4R97B 2BRRH 3KPPA 5SWQB 1BLNA 4U1HB 5LGJA 4RA0C 3ZHDA 1NSNH 5CUSL 5B3JE 4PRNB 1T7YA 1VFAB 5EZOH 4DFIA 1L0XA 4DW2L 4KK9D 3L5XL 1JVKA 5IB3B 3VXUE 1F4WL 2FLBT 3SGJA 3T2NH 5FGBA 1YJDC 4HPYL 4KXZI 2XN9E 4WV1B 3HPJB 3MLYH 3B8YA 5EBMA 4Y0GA 3TZVA 5CBEA 1U8PB 4JZNB 3ULVC 2C26A 3DX9A 3QEHA 4MWFA 2ZCLL 4HX1A 1RJZA 3HB3C 4NQXB 1WSST 1KYOK 3KXFD 1QLRA 4NC2B 9CGTA 2C4FU 5KSAC 5C0IB 5CUSH 5F3BB 3PXHA 4OT1L 25C8L 4FZ8L 4DW2H 1F5WA 5EOCJ 4JDZA 3L5XH 3OX8B 4FQ1L 1RJYA 1F4WH 3K74B 4YGVA 2KBGA 2AEQL 4HPYH 5DSCB 5D96C 4OJFL 4U1JB 3E6HB 3FOMA 4WI3A 5DTFA 1QR1B 4HQQL 4QRRD 1KPVA 2DBLL 3HRZB 5TFSL 5DR5L 2H9GA 5L9DL 3FT3B 2APBA 3JWDL 4JFYA 2ZCLH 3HZVA 4U2ZA 4APQC 4EXKA 5BW7A 2V7NB 1MCNA 2EDOA 1EEZA 2PW1B 5JO5B 5KSVB 4LPYA 1W0VA 4DEPC 1SBSL 3U36B 4OT1H 2APXA 1BF2A 3MC0A 25C8H 4FZ8H 4N90D 5I73B 4FS0A 1XZ0B 4FQ1H 4LGPB 1AQKL 1VEOA 2AEQH 1GSMA 4LKCA 4OJFH 4Z7WB 2FCBA 3QJFA 4HQQH 5TFSH 2XNAB 4PV8B 5EO0B 3U7WL 5DR5H 5L9DH 2P8LB 3JWDH 5DRNB 4NPYA 2EE3A 1X5YA 5IG7B 1NMCB 3N1MC 3NACL 1IVLA 2YPLD 4KJWD 4LGRB 2ZUVA 5H2BA 1S7TB 4ALAL 1AP2A 2E8YA 1UB5B 2UY7A 3FOLA 3T8XA 3L6FB 1SBSH 2BCKA 4I2XA 3T4AB 3QQ4A 3MV7E 3O0RL 3PHOB 5D6CB 3CC5A 2B1HL 3DVFA 5GSVB 2VLJD 4R26L 4WI2A 1FPTL 3IB4A 2A83A 4GXVL 4X4XA 3ZE0F 3S37X 2NXYB 3BZFA 2V2TB 3FRPG 4I13B 2YD2A 4NFCA 1IAIL 5DHVB 5B8CC 3U7WH 4HZAA 4EZMA 1YNLL 3BZEA 4HPOL 2ED7A 1RIHL 4K3GA 1QSFD 5EU7E 3NACH 4OLUL 4YLQT 4ALAH 3D85B 1RHFA 1CQKA 2BK8A 3WDJA 5JW4Q 2EC9U 3O0RH 5I1EL 2D4FA 2H45A 1IGFL 4NKIL 2B1HH 4D9RD 4R26H 1ES0A 1KG0B 1FPTH 4GFTB 2CLZA 3VFWB 4GXVH 3X11A 3VXMB 4OAWA 4JRYB 2Z9TA 2YPKB 3ULVD 5KN5B 1IAIH 1CWVA 4BH8B 3RU8L 2WANA 1P4IL 1U8KB 3HB3D 1YNLH 1RPQA 1IBGL 4HPOH 3QUMB 4POUB 5TQ2L 1RIHH 4NRXB 4G9FD 1WCQA 1YNTB 2DS4A 5T5NF 3CSYA 4M61A 2NY4C 1BF8A 3A0OA 4OLUH 5GS1B 3SJVE 4NO0B 4M7KL 3BAEL 3RVUC 3ZE1E 4OSUL 2P5WB 5D72L 5J4MA 2PCPB 5DD5L 4EN3B 5LCVL 5I1EH 1LD9A 1IGFH 4NKIH 3LAFA 5C71A 5DQJB 3VI3F 2JCCF 1IZKA 3FT2A 3INUL 2XFXB 3DMMA 1OP3H 5JQHC 3IAQA 1UJ3A 1RK0B 4UV7L 3RU8H 3HAEH 1P4IH 1OT2A 3D39B 4YH6A 1IBGH 1XGQB 2HLFD 5TQ2H 1Y6KR 5HHMB 4F7EA 4HKZB 4P2QD 1R5VA 1LEKA 4BSJA 4ERSL 4PJ8C 2ERJC 3HZKA 2BSSA 2ZCKL 4Z7UB 1P7KB 1EK3A 2WM0A 4HLZH 5E56A 2XWTB 3EOTL 3KYOA 1Q1JL 4X6DE 3BAEH 3MRIA 4OSUH 4UAOC 5D72H 2VDML 5DD5H 1C7TA 3IJYA 4UNTA 5LCVH 3RGVA 4Y19E 2VISA 4PRPD 4NDMB 3PWPA 1K85A 5GZOC 1J05A 3ZHLA 2W38A 4MQTB 3INUH 4U1IB 2RFXA 4HKBA 3HC0A 4LRIC 3S3SA 3TBWA 4GRWF 3WS3B 4F7CB 4KTEL 1GC1C 3VFPA 4UV7H 1KNOA 4XVUD 3WSQL 3QDJA 2K7PA 5F1OB 3OXSB 5D1ZB 5EIIB 3IXTA 1T5XB 4QRQA 5E5RB 3D0VA 4OQTL 4ERSH 4F3FB 1T5WA 2R0ZL 3KPLA 3QRFM 4Z7VF 2ZCKH 4Y2DC 1MRDH 1KFAL 2ATPB 3NCMA 1MJUL 4LF3B 4MNQE 1O7SA 3EOTH 1Q1JH 4HBQA 3OKOB 1QHPA 1F4YL 2VDMH 1ZA3B 4I0PC 2ZSWA 1I8MB 3KLDA 4M8QA 4MB4A 3PABB 4IMLB 5FO8A 3OKNB 2NY1B 4KDTC 2YD4A 4KTEH 1R3LB 1LO5A 3BP4A 4HIEB 2BNQB 2XRAL 5ANMB 1F6AB 3WSQH 3FO2A 5MHSE 3AC0A 5F7KC 1IM3B 1J7VR 2HJFB 1WIOA 5D9SB 2PYFB 3K1DA 3TBSA 2DWEB 2R0ZH 2AXFA 3KS0H 3O45A 4OQ1A 1YA5A 1KFAH 2ARWA 1C5BL 3FZUD 4JFOB 1MJUH 4NJAL 5IMOA 4E41E 4AIZA 4M5ZL 5B38G 1F4YH 1GGUA 2IQAB 3WN5C 5GGSY 4L9DA 3VA6A 2RCSL 1L7IL 3TT3L 1DZBA 1AHWB 5TH2B 2J2ZA 4QRSB 3VGAB 1IAOA 4MNHB 4WFHE 4YBLB 4OZIF 3BKJL 4YDLC 2XRAH 1NL0L 2X40A 2NY4D 4BM7A 1TQBB 2AP2A 2FIKB 1MCEA 5FYKE 1B88A 4L3ED 1FFPB 1HHKA 3NFSL 1IGTB 5F96L 3QWOB 3KPNA 5L2KD 3RVUD 5J1TC 2HTKD 2L7JA 3ARDC 4NJAH 1C5BH 1GGTA 3TN0A 4M5ZH 3AROA 1A4KA 1R3KA 2I60L 5BO1L 2EEDA 3LPGA 2RCSH 1L7IH 2Z91B 3FRUB 3TT3H 3DXAE 3ZKQD 3X12A 5BRZD 2GK0A 4BQCA 2CLVA 3QIUB 5HD8D 4R96A 3BKJH 1SMAA 5GRVK 1OM3H 1NL0H 2G9HB 2PKDA 2NNAB 4MCZB 4NNPL 2W0FA 1V5JA 4PJ8D 2E6QA 4H26B 4JREB 4WO4C 1WCBA 5F96H 5H37H 1FGNL 2AK1L 1T22B 5IUSA 1NBZB 1TETL 3BPNC 5ALBL 1UA6L 3MCLL 1U3ZA 5C0JA 1FBIL 1X5KA 3EBAA 3MGOB 4NUGL 4P5MB 4TOYL 4PJDA 5GZOD 1LNUB 1U3HC 4FQXA 5B22A 2I60H 5MENA 1QO3A 3LV3A 5CEXB 3H9HB 5BO1H 4OZFA 3MNWB 4Z77A 3BUYB 3HAEB 2F53B 3Q5OA 1FN4B 3ETBF 1I7ZB 4L4VA 3P9MA 1EZVX 3KS0J 3WD5L 4NNPH 1OGTB 5DRWA 4A6YA 2M2DA 5GGSA 2VLRA 2X70B 4BUHA 1J0YA 1FGNH 3EJYD 3V8CA 2AK1H 1QSED 1TETH 4LCYB 5ALBH 1UA6H 1ZSDB 3L3GA 3MCLH 1T1ZB 1EFXA 5H35A 1FBIH 1OAXL 4NUGH 3M1BB 4TOYH 3WFHB 4F7MB 4U6VL 2NZIA 3FB6A 3G6JA 3O3EA 2BNRA 3QI9D 5IW6A 1BD2B 5IHZB 4NNXB 1A5FL 4HJGA 3BO8A 3OR6B 2EDHA 2DTML 3FONB 3WLWC 2XICA 3QUKB 3MJ7A 3WD5H 4YHML 1H3UA 5CILL 3VWJC 2DD8L 1F13A 2YD7A 3DETD 1XCQB 3WFDL 3CZFA 2IANB 3MA9L 1I8IA 3IKKA 3X3FH 3QZWB 2GJ6D 3VFNB 4HH9B 5T3XE 4MZ3A 3LKPB 3WJJA 2E5EA 4ODTL 4N1EA 3KDMB 3QNXB 3G9AB 2VZSA 1BWWA 4PGEB 5IJKC 5IIEA 1OAXH 3QDMB 4X8XA 3VRJB 1LO4L 4JKKA 3X17A 2X4PB 4U6VH 2BERA 1M6OA 4QCIB 4X8JB 1LDPL 4L3CA 5HHXL 3AREB 5GIRA 1XF3B 3P4NA 2H32A 2P8MB 1A5FH 1CLCA 2VZTA 1H15B 2D31B 4FXKB 1ZWIB 2DICA 2DTMH 2LTQC 3WYRA 1C16A 2Y25A 3K8LA 3KLAB 3SDAB 4YHMH 1EEYA 4XC1L 5CILH 1K4DA 2DD8H 4BJLA 4LCWA 3CFCL 2ITDA 5T1KD 5DFTA 3WFDH 3ARDD 4HXBL 4QHKJ 1XGRB 4JFDB 4NGHL 2Z92A 3TCXA 4ODTH 4NHUA 1NAML 4RFNC 2YD5A 4C56A 3DSNA 4YFLI 2R2HA 1LO4H 2ZOLA 4GRLB 4UINL 3OL2A 2R15A 1LDPH 4GG8B 3FO9B 4ZXBC 4Y16A 5HHXH 5D5MA 2WINB 3ZO0A 3MRQB 4U7SA 4Y88A 4IRSB 1TQCC 3KPOA 5JNYA 4WO4D 3C5ZC 1BFTA 4Y5XB 1N59B 4XC1H 2ZUQB 3N9GL 1DQQB 1ITCA 3ARGA 3CFCH 4HXBH 5IKCA 5I0ZA 4NGHH 3U4EA 1UKTA 1UM4L 3QFDA 4HMDA 2AJYL 3HNVL 3TT1L 2NLJA 1T0MA 3AM8A 5AD0A 3RI5K 1NAMH 3EYUL 5F9JB 5F1NB 1EUTA 2C3GA 3U0TB 4XWGH 5KBNC 4UINH 4H25B 2VYRE 2ZWLT 4H8WL 3CCHA 3U2SB 4J4PC 5HYFA 1SYVA 3OF6D 4X4MA 5C0CD 1MCIA 3BGMB 2FATL 3TA3A 4LHJB 2OZ4L 3H9YA 3NN8B 2R2BB 3IDYB 5CD3B 4S1QH 3IDXL 3IDMA 1NCAL 3N9GH 2HAZA 4NWTL 4CN1A 1DUYA 4MDJB 1CD1B 4X9FA 4PD4K 4GG6E 1FIEA 1UWEL 1J0ZA 4UQ3B 1UM4H 5HPOA 1MCLA 4W4OC 2AJYH 3HNVH 4WI8A 3TT1H 3KJ4C 2XWBA 4BSWB 3EYUH 1IGJA 5DMIL 3CPLA 2EYSB 3E2HC 4LGSB 1MCKA 4LIQL 4Y2OA 1WEJH 3EYOA 1HQ4A 4H8WH 4DOHB 4QRRE 1A9EB 3CFKA 3BP7B 4Q6IB 3PDDA 2FB4L 1F3JA 3K81A 1MCHA 1N3NA 2FATH 1ITBB 5A2KH 2OZ4H 1MWAL 2VXVL 3NFPA 4HULB 1F00I 3PDGA 3VFVB 3IDXH 1NCAH 1GOFA 4K9EC 2L4OA 2VB5A 4NWTH 4UBDD 5DJAB 4GKNA 4J8RA 1EVUA 2V9TA 5E5MA 1UWEH 2CKBH 1S7RA 4PJ7B 2X41A 3V6ZA 4KV5E 4Y4HC 4UOW0 2E7MA 1IM9A 1JPFB 4FQIL 1K5NA 2VKWA 5DMIH 4KZEL 1VFOA 2VZ1A 3LN9A 3MBED 4F37K 4LIQH 1RZ8A 1DDHB 4X6BA 5IEKB 2UV3A 2G75B 3VXUB 2CXGA 3RIFF 2F54D 3HR5B 1JN6B 3VE0A 5J13B 2FB4H 3T04D 1XGTB 2XN9B 5MP6L 1JNHB 1MWAH 2VXVH 3UPRA 5BOPA 3DOSA 5BQ7B 3FQRB 4HWUA 4Y4KA 4DZ8A 3FQNB 3L7FA 3M8OL 4Y5VC 4CBPA 4PJBA 5ID1B 2I27N 3O11A 2AJ3A 5HGAB 3HZYB 4FQIH 3VXTA 4KZEH 5K9KB 2WZPD 4WTXA 2VLJE 4ZXBD 3HZMB 4X83A 1BZQK 1N2RB 3KPQB 1EHAA 2PXYB 3BESR 1KGCD 2IQ9L 4KJYA 4PJEF 4RGNC 3RWDA 1BOGA 1PVHA 2XPGB 1YPZF 2QV2A 4ZUTA 5MP6H 1KCVH 4QTHA 3VFSB 4D0DA 3MA7B 2NX5A 3NCJL 3OKLB 5DMKB 4L4TD 5D2LE 3M8OH 3OKEA 5CZXD 4DUWA 1Q94B 1XR8B 3CFJB 2BSTB 5GSRB 1HQRA 1ONQB 3P11L 3V5DA 4JQIL 2WWMC 1F2QA 2VDRL 3LN4A 2X42A 1NBQA 1EERB 2IPTL 4WW1A 1EUUA 3RWHA 3IKCA 4HIJA 5EC1B 3NFNA 2IQ9H 3MOBL 2QSTA 3WIFA 3PGCB 4OCYH 2DQIL 3O3AA 1I3GL 1B2WL 3ZLQC 1MI5D 1UCTA 3D18B 4HKXA 1RZKC 3GMPB 4PLNC 5CP3A 1MJJA 3NCJH 3QNZA 3WE6A 2OTWB 5L6YL 4WI7A 3CUPB 4F9LA 4PTTA 2EDJA 3QJHB 1QHOA 2VLKE 3G5ZB 4HSQA 3P11H 5FYKL 4JQIH 3QPQC 2CH8A 2VDRH 3KPRD 3TPKA 1AC0A 3O9WB 4Z78A 3E0GA 2IPTH 4NRZB 4WU7A 3DO7A 5EU5B 4HH8A 4K3HA 3MV7B 2NY0B 4X5WB 2V7HB 2CXKA 3H0TA 3OTTA 3MOBH 5C3TA 3Q6FB 4NSKB 2FO4A 2DQIH 1I3GH 1B2WH 1U0QA 3PL6A 2IADB 1QFWM 2FJFA 1KEML 2B8OT 5D7KD 4XNUL 3ALXA 4D8PB 2C4FT 4PJHF 4RSVA 3BDXA 2VNCA 4EUPA 1BREA 3GSQB 5L6YH 1S9VA 4U6YB 1OQOA 5MEPA 4JPWL 1OF2A 4EIGB 3L7EA 4MHHI 5FYKH 3P0YL 5I1IL 1HWGB 2RGSA 3I6GA 3I75A 3NVQA 4CL7A 3O2DA 5KS9A 2CLRA 1R5WB 5JUEH 2J12B 4HDIB 3TH2T 4HG4K 4BUGA 3T1FA 1BGXL 4R4FL 3IDIB 1U8NB 4LCCB 2VDPL 3PF2A 4R4BA 2PUQT 3GSVB 5ESVA 1KEMH 2Z35A 4XNUH 4P59L 4BZ2L 1DVFB 5GS0L 2CKBB 4M6ML 3CZJA 4UI2A 1RZGB 4MNGA 1KTDA 4J1UB 3PHQA 1HYSC 1S7VB 2JELL 1HH6A 4C4KO 3OKYA 3P0YH 5I1IH 1NBYA 3SJVB 3GMNB 1LK2A 1RK1A 2OR9L 3VXSE 3MROB 5E95B 2YUWA 1NDMB 4NZRL 4RGND 5JW5B 5D7LD 2JK5A 3MRNB 3BIKA 1BGXH 4R4FH 3CIQA 1CXKA 3DV6A 2FL5B 4ZUSA 1KPRB 2VDPH 3KYMA 5FYLD 4XRCA 5E00A 4YHOL 3WCYA 1DTUA 1I1FA 1SY6A 4P59H 4BZ2H 4ZUUB 5GS0H 1FVEA 5DK0A 4EDXB 1G7QB 3AXLA 4P23C 1ND0B 2WWMD 2ZOKB 3NOIA 4AEHL 1K8DA 2VDLL 3MR9A 2JELH 4I3RL 5HVHC 1V7ML 4M02A 2JE8A 4RIRA 2OR9H 3RWJB 1DL7L 4NZRH 4PJ5E 4H1LG 4X6DB 5C2UB 5CEZL 1JTTA 4GLRH 4Y19B 2QSQA 1C8PA 2R0KL 3B2UD 1F4HA 1ODAA 1HCVA 3BPCB 1RQ5A 1S5HA 3S35X 3ZDXE 3I6LE 4PRIA 4WU5A 4YHOH 4DN3L 4PLOB 3HE6C 1P7QA 3PWLB 2K1MA 4YBHA 3MCKB 2D3VA 1IL1B 1WJ3A 2EC9T 3EDEA 3QPQD 1TZIA 5HTSA 2VDLH 2CGRH 2CPCA 5D7JB 5HYQB 4I3RH 3SDXA 1V7MH 3VJ6A 2VO5A 1SJHB 4URTB 3F7YB 1PKOA 4L29B 4MNQB 3RWFB 1DL7H 3Q6GL 5EBGA 4WCYL 3N1GC 5CEZH 3TJHC 4JQXA 4DWHA 3MO1A 3MGTA 1FNGA 2R0KH 2AJZB 4ZQKB 2ESVA 1URLA 3SBWC 5K33A 3O6KL 3BPOC 4DN3H 5JHDE 4LDLB 1SJVA 1GYAA 4Q74A 4O9HH 4RFEB 1RSFA 1FC1A 1RI8A 2XKNA 2KQNA 3L1OL 4FQQB 3CX5K 4P4KB 4PY7B 4KAQL 4PUBL 4L9LC 3MJ6A 5F6IC 3MOQA 4HGMA 3VDBA 4J3VA 4PP2B 2JB5L 4PJAE 4E41B 2UWEF 3Q6GH 5F1IB 4WCYH 1W72B 1OD7A 1VEPA 5I18H 5CHNB 1I4FA 4NQSA 1CFSB 2D9QB 2HG5A 3DX7A 3QUXA 5ID0A 3IJSA 3O6KH 2YEZA 5ITFB 1FZJB 5I66A 5I1HL 4XCCL 4ONGL 5LKNA 3QIWD 3L1OH 2D2OA 1KLGB 2C1PB 3S8WA 3JVGC 4YPGA 1FYHB 4KAQH 4MJIE 4PUBH 1LP9F 4XAWL 1UVQB 2Z31B 2FIRT 3V6FA 1YYML 4ZUWA 2W9DL 1RULL 4FFZL 1U8MB 1U9KA 2JB5H 3BXNB 2KPNA 3DECA 1FVCB 1EHXA 3ZZ1A 4L8SC 4IRJA 1QQDB 3HG1E 4WJ5B 2WAHA 2HT4D 3ARXA 1DN2A 5HPMA 2NY3C 4GW4A 3S36X 3DXAB 5BVJB 1MFDL 1OARL 2WMPA 1KLUB 3QFJB 1E4KC 4MS8D 2GAZA 3MNZA 5I1HH 4XCCH 2ADFL 2NXZB 4ONGH 5EOTA 5FUZL 3GSWB 3KWWB 1KJ3L 4PG2A 4N0YL 4OTXL 2UZXB 5IF0A 4XAWH 1EXUA 1DLFL 1QUNA 2ADGA 4PRAA 1YYMH 2W9DH 4LNRB 5CJ5A 4K7PL 1RULH 2X89A 4FFZH 4I9WD 2R23B 3C5SA 1I1AB 1X7QB 4EI5A 3WNPA 2C7UA 3MQIA 4LVHB 5J06A 4XCYB 3OKDB 4DKAA 5EU6E 1MFDH 1OARH 1UH2A 4ODXB 4LSTL 4WFFE 1MH5B 4D0BA 4I8DA 3F5WA 5CBAB 2ADFH 3O6LL 4ZAKB 5FUZH 2WBJA 4UQ2A 5BZDB 2R1WA 1KJ3H 4UOW1 4JO4L 4N0YH 4OTXH 3MREA 4GW1B 5J6GB 4LFHG 1DLFH 1N7ML 2MHAA 1T0NA 2BOBB 2CO7B 3QHZL 3TV3L 4NQCA 3TJHD 4K7PH 4X5LA 3WHXA 5ALCL 3PP4L 4FXGB 3W9DA 4U1KB 4X9GA 4U7KA 1S7UA 3HI1B 1Z2KA 2QLVB 5DZLA 5B3NA 2X4SB 3O6FA 3ZDYF 3WIHA 3EDKA 4CVZA 4P2OA 3MXWL 4LSTH 4BSVA 2VUOA 4ELME 4RFOL 4WUUE 3WS6A 5KSBF 3KPMA 1IZJA 3IDJB 2CIKA 4IOIB 3O6LH 2ILLA 1H8OA 3MV9A 1G7IB 3FO1B 4HWEH 1WISA 2F74A 4P2RA 4JO4H 3TM6A 3EGSB 4JGJA 5C8JB 2A74B 1N7MH 5E6YA 3PV7A 3QHZH 3MRGA 4YC2C 4QHLB 3TV3H 3VFUA 4YJZL 3ZE0E 3G5YB 3G6DL 3GBML 1HINL 1UM5L 2YBRA 4OM1L 1HHHB 5ALCH 3PP4H 1WV7T 1YJDL 3PQYA 5HDQL 1W8OA 2HJLB 1KB5A 4U1NB 5E8NB 1LO0L 4F58L 3VFMA 4OD2A 3MXWH 5ABDE 5HYIA 1YDPA 1FL3A 4ZS7L 4P46A 3ULVL 1AD9B 4RFOH 3HUJA 4ZFOA 1EJ6A 1SM3L 5ACLA 1WZKA 3H9SA 5JDSA 1UH3A 2PO6B 5T1LD 5I1LA 3PWNA 5GRUL 1H3WM 5JQ6L 3TCLA 3WXWL 4GSDL 1JE6A 1TDQA 1IRAY 3G6DH 3GBMH 1HINH 1S7QA 1UM5H 3MNVB 2NY3D 3EOYG 4J12A 5D1QA 3REWB 4OM1H 4LDOB 1YJDH 1K3ZA 3QAZC 5TGBA 5HDQH 1RY7B 3RBGA 3MSPA 4F58H 3TJEL 2ZSVA 5FHAL 5CIPA 1X4YA 3FL7A 4ZS7H 1R3JB 3ULVH 1LE9A 2V2WB 4UDUA 1SM3H 4O5LL 1K8IB 1ORQA 4HWBL 3SHSA 1IC4L 3JWOL 1VGKA 1TVBB 2XZQL 4N9GB 1XIWC 1DBBL 1NC2A 5F7WC 1N5AA 5GRUH 3O41A 3WXWH 4GSDH 3WUWA 2JCCE 2VLLA 4PYGA 1MJ8H 4U3HA 3RUGF 5BV7B 3SDYL 2F54E 1PX3A 1ZHNA 4LLYB 1MOEA 5C0DB 3DSFL 3STZA 3TJEH 5FHAH 3ES6A 3MLWL 1HILA 4ORGA 5HYSB 3BSZL 4O5LH 4HWBH 1OW0A 2PYEE 2AW2A 1INEL 1S9KC 1LEIB 4XP5L 3CMGA 1IC4H 1AGEB 3JWOH 2XZQH 2YK1L 1DBBH 3S4SB 3WLBB 5JXEA 2W1NA 4KMQA 1MCDA 5SWZE 4PJGE 4GRWE 1FRGL 3SDYH 2D03L 5I1AA 3RWGA 4AT6A 3ARRA 2L0DA 3EZ8A 5DF0A 5D1XD 2VL5B 4LHUA 5C0FB 3LKNA 1PKQE 3DSFH 1ZA6B 4XH2B 4DVRL 2QADB 1R3HB 1AKJA 4AEFA 5HY9B 3MLWH 3GJEA 3UX9B 4PP1C 4ZFZB 2DMBA 4Z7VE 3BSZH 5ELIA 4KK6C 4IMKA 4PRHD 5DUBA 1INEH 4XP5H 3QEGL 3EW3B 4M4PA 2YRLA 4PIRF 3LKOA 2YK1H 3BGFC 4BKLA 5F7UA 1Q9KA 2BY0A 1CL7I 5DD3L 3VXRD 1A6UH 5LGHL 2B4CC 3V5KB 4PJ9A 4GQ9L 3F7VA 1FRGH 4BFIA 5H8DA 2D03H 4HHAB 4KI5F 2F15A 1BBJB 1G0DA 2IFFL 4FTVE 3ZKND 5D7IE 5IQ7L 4N0UE 4DVRH 4AENA 1EVTC 1WBYB 5J12C 4KMTL 2FSEB 3ARBB 2V17L 3SKNA 2WQ8A 1RV6X 4NQEE 2X5PA 3AMKA 3QEGH 4XZUB 3SGJC 1N8ZB 3B4NA 1Z9MA 1IAII 1PEWA 5DD3H 3FTGA 5CGMA 5LGHH 4NQDA 4AH2B 1G7PB 5FYJE 1X44A 4QRPD 4PRBA 1FC2D 3ALPA 4LPVA 2IFFH 3T4YB 3CSBA 3SQBA 5IQ7H 1VFBA 2AJVL 1EGJL 4H0IA 3HLAA 3PP3K 4KMTH 4NO2B 2CQVA 3T0EC 2V17H 4WDIB 4X5XB 1ZAGA 1IGML 2EH7H 2FEDC 5GRXG 5BS0A 4NNYB 5I17B 4Z5RB 5C7XL 5D2LB 5EU3A 2A77L 1BIIB 4R0LC 4DQOL 5SX5H 4JRXE 2ARJA 3BH8A 3UTSD 4NZDA 1XGUA 4ZG1A 2A73A 3HMXA 3VI4F 3T09A 3LS5L 3DPBA 3SO5A 2HKFL 2KL6A 4F33B 3CDCA 1GC1L 1F8TL 2AJVH 2WUCH 1EGJH 5SWQA 4U1HA 3GIZH 1QPXA 4Z7OE 5KSAB 3V0VB 1IGMH 3LVEA 1VFAA 4Q7DA 3JZ7A 5C7XH 4U1LB 1B4RA 2A77H 2IJ0C 5IB3A 3ZTJH 4DQOH 1GPOH 4EUPG 2VLKB 4KQ3L 4JHWL 5L8LB 4OF0A 3HPJA 5D96B 1EEUA 4OF6A 5C0AB 3LS5H 4WWKC 1MAKA 1U8PA 2HKFH 3P30L 3MRKB 4JZNA 5D2NE 3SDCD 1GC1H 4PP1D 4PJDF 1F8TH 3UTOA 4APQB 4K7PX 5GZND 4KK6D 1ADQA 4HIHB 3NZHL 5DEGB 2B2XL 5C0IA 5K59F 5F88B 1WLHA 5F3BA 1GGIL 1MHEB 3MV01 5JORB 2Y5EA 5EDXA 3VH8B 4FABL 3OX8A 4P2CG 4MQ7B 3LRGA 3MRJB 3S5LB 4PYHA 1A6ZB 4KQ3H 4QHMB 4JHWH 5DSCA 4BQBA 1NQBA 1YUHB 4U1JA 3E6HA 5K93A 1QR1A 3HRZA 3P30H 5CEYB 1NAKL 3ARPA 3LHPL 1CVSC 5B39B 1OWRM 2V7NA 4XAKD 2PW1A 3NZHH 2B2XH 3K7UA 5JO5A 2OJEB 4GJTB 1U8JB 5JIPA 1GGIH 1I8KB 2EDKA 2R4RL 4ZFFB 3MLXL 3LKRB 4FABH 1XZ0A 1JK8A 2FJHB 5FM5O 4Z7WA 1CE6B 4U6XB 3F12B 3VXSB 3IDUA 3ZYJA 1YEJL 3TGXA 4R90L 3WDHA 4MAYB 2XNAA 4PV8A 5EO0A 1MLCB 3VGEA 5F9WB 3ARVA 2P8LA 4NN5B 4XBGB 3MRLB 3EFDL 4O58L 1NAKH 5DRNA 3OAUL 3T0ED 4OZ4B 5IG7A 4QOKE 3LHPH 4PJIA 2B5IB 4RAHA 3QUZB 1S7TA 2FEDD 1A7PL 1UB5A 3GHBL 1BLNB 1CG9A 3BKML 4NQVB 3L6FA 1XMWA 5GGUA 1DBJH 3CGTA 4ZD3L 3T4AA 2R4RH 1JWSB 2P7TB 3PHOA 5D6CA 5GSVA 4MLIA 3MYJB 3N50A 1FH5L 4M3KB 3HE7C 5DZOA 1WT5C 1HOCB 1CGWA 3H7LA 4KPHL 5E2WL 2V2TA 4HC1L 1YEJH 5BMFL 2EO9A 3GBNH 4PJ5B 5J7CC 4U6TA 4R90H 5CBEB 1K3IA 1FYTE 3OAZK 4O58H 3EFDH 5CZKA 1EIBA 2FBJL 3OAUH 5I6XB 1XF5B 2A2QT 3DX9B 3QEHB 1SVCP 4HX1B 3OAZH 2EE2A 3D85A 1A7PH 3GHBH 4QXGL 1FLRL 1YEIL 2VXTL 1ZV5A 4QHKI 3BKMH 1PAMA 5D5MF 4ZD3H 2IBGA 1T4KB 3B5TA 2XACC 2A6IB 2YA2A 3LDBB 1EZVY 1FH5H 1R3IH 2J5LB 32C2A 5E2WH 4KPHH 4QGTA 2X4RB 4OCSL 4ZPTB 4JRYA 1S8DB 5KN5A 4HC1H 3CJJA 4BH8A 1U8KA 3SOBL 3RNKB 2Y6SC 1YYLL 4IJ3C 3QUMA 1FO0B 1YMME 4KI5C 4KH2A 4NRXA 1YNTA 4JN1L 2FBJH 3NIDF 4LLUB 3HZVB 5I16B 5GS1A 3I6KA 3GJFK 5JHDB 2ERJB 4QXGH 1FLRH 1YEIH 2VXTH 4NO0A 1WIUA 1M7XA 2PTVA 2BVOB 2P5WA 1LWRA 3IDNB 2PCPA 5F21B 3IGAB 1QACA 2ID5A 5DQJA 2GY7B 3EOBA 1D5BA 3D3VE 4OCSH 2UYLB 3H9ZA 3L5WB 4PJAB 1RK0A 3SOBH 3FMGL 3D39A 3QIBC 2VDOL 1YYLH 5CKGA 4WEBL 5HVFB 2PN5A 3U7AA 4JKLA 3L3IB 3R0MA 4KJPC 4HKZA 4LQ1A 2XZAH 4XB8A 4Z7UA 5H2BB 1P7KA 2XWTA 4Y2DB 2BSRB 3FOLB 5IR1B 5DEZA 4PJXF 3I3DA 2BCKB 3VFTB 1JGLL 4NDMA 4MJIB 2XWJB 4I0PB 4U1IA 5D6DC 4FMFA 4JG0L 4UIKL 2A83B 3WS3A 4F7CA 4LKXA 3BZFB 5KOMC 3MV11 4HS6A 3FMGH 2VDOH 3HG1B 5D1ZA 4WEBH 1H5BC 4OGZA 5EIIA 3BZEB 1T5XA 2BNUB 3CLFL 4P57B 4U1MB 4F3FA 3TN0C 5JW3L 2K9UA 2ATPA 5F7LB 4LSRL 4OLWL 1JGDB 3DMMD 5HDBE 1ZA3A 4KVNL 4PGCA 5E4EC 1JGLH 1JHTB 1BZ9A 2RJMA 3ABZA 1I8MA 3I02B 1KELL 3ARYA 3PABA 5EULV 4IMLA 3UTPE 4JG0H 2H2SC 4UIKH 3OKNA 2VLME 1HCFX 1OAKL 4XNZC 4IS6A 1CI5A 1MIEL 1R3LA 3D2UB 4HIEA 4WHTB 4N9OB 2BNQA 5ANMA 4F7TB 1BQHB 1F6AA 1J12A 2ZUXA 4YDLB 3UBXB 4FNLL 4N0CC 3OG6B 3RWCB 3RX7A 1IM3A 5DRZB 5J1AB 3CLFH 4X9IA 1ZE3C 5EU6B 3RGVD 3RL2B 2EEAA 1HXMB 5ISZE 2ATKB 5E7BA 5JW3H 3VD4A 2IH1B 4G8EB 3PWPD 2Z93B 1PY9A 4JFOA 1BX2B 1L9MA 4KK5D 5A1AA 1Q72L 2IFGA 4O4YL 1U42A 4LSRH 4OLWH 2DQFB 2IQAA 4G6KL 4KVNH 1R24B 5DUPL 3SCMA 3QDJD 1AHWA 1KELH 3LY6A 2YOCA 5TH2A 3OPZL 3QCUL 1M71B 4QRSA 5IMLB 1IGYA 1OAKH 5CINL 1MIEH 4KI5D 3RKDD 4YDVB 4JPIB 2FIKA 4FNLH 5C07E 4F15C 3DYMA 1NGXB 1FFPA 1IGTA 1PG7W 3W11C 3BH9B 4XBPB 2DJ4A 3QWOA 1CIUA 1U92A 4F7EB 1MEXL 3MRBA 3TYFB 3GIVB 4CU6A 1KJVA 4XC3L 3BPNB 2DYPB 1Q72H 3UTTE 4ELMB 2ICEB 3T2PA 4O4YH 2APFA 1KIUA 4S0TD 4WUUB 1PYWB 2J8UA 5SWSD 1U3HB 4TUJB 5DUPH 3F6LA 2Z91A 3FRUA 3B2VL 1HE7A 5GQBA 3OPZH 1A22B 1JZ6A 3QCUH 5IBLC 43CAB 3TIDB 1B6UA 2O5YL 3QIUA 5CINH 1JHLL 2FECL 2G9HA 2E7CA 2NNAA 3GBLA 4MCZA 1NDGB 2W9LA 4U6HA 4PJHE 4H26A 3RPIB 3VXOA 4Z0XA 3VG0L 1D9KC 3WJJC 3ZYIA 4RAUB 1MEXH 1P6AB 1T22A 1NBZA 4ZNEA 1Z9OA 4XC3H 2YSSB 1QFPA 4P5MA 1LNUA 3RFZC 3BIBX 3H9HA 3B2VH 4PREB 2HRPL 3MNWA 3BUYA 3HAEA 2F53A 2O5YH 1I7ZA 1JHLH 2OLDA 1X5FA 4EKXA 1PBYA 1X4XA 3DWTA 3NIFF 1OGTA 1DFBL 3TN0D 3VWJB 1WFNA 2X70A 3VG0H 3BVNB 5KS9F 1KJ2B 5FYLL 1UT9A 1XT5A 1GHFL 4LCYA 1ZSDA 3MJ8B 3VXPB 2DLEA 1T1ZA 2V9QA 4IIQC 3ZDZF 3M1BA 5IMOB 4X6CE 3WFHA 3KPSE 4F7MA 1FSKC 4S11A 5LBSL 2QHRL 4W68A 1OGAE 1MHHB 2HRPH 5I75B 1BD2A 5IHZA 4NNXA 4AEEA 3G5XB 3OR6A 3FONA 2UY6A 2YN3A 3UROR 2JCCB 3QUKA 5IVXF 1A6VL 1DP0A 1S7XB 4AIOA 2D7OA 1DFBH 3MLTB 5LXGL 1XCQA 3SKMB 2IANA 2OYPA 4HWZA 5MEND 3QZWA 3VFNA 1GHFH 1QA9A 3KPNB 2EKSB 3GRWA 4HH9A 5J56B 3LKPA 8FABB 4YBQC 3C60C 3KDMA 3QNXA 2WWKT 3TO2B 3QDMA 3VRJA 1JL8A 5C92A 2X4PA 2OXHA 4QCIA 4X8JA 2PYEB 1WIPA 3ILPB 5LBSH 2P5ED 1A4KB 2QHRH 3DYOA 4CMMB 1PJ9A 1A7NL 3QEQA 4JDVB 3AREA 3VRIB 3V2AR 1XF3A 3U48A 3TA3C 2P8MA 2ZNWA 4MA1C 1H15A 4FXKA 4P9HC 1ZWIA 5F89B 2P42B 4MDIA 5SWZB 1Z9LA 1X5XA 3KLAA 4PJGB 3FQTB 1A6VH 2BVQB 4GRWB 3C5ZB 5DJCB 3SDAA 3VWKC 1FNEB 1EFXD 1RVFL 5T33L 1U8LA 5LXGH 4NBZB 4QWWC 3FHAA 3U4AA 5IW3A 1XGRA 1PKQB 4JFDA 3RPKA 3PJSB 2XZCL 5I71C 2BNRD 1EAPB 1KBGL 1ZT1B 4TTDD 1NGWB 5DFVD 2K3TA 3G5VB 4GRLA 4Z7VB 3MRDB 1I3UA 1QPPA 3F58L 3OB0K 4GG8A 4FQXB 1WZLA 1A7NH 4WWID 3FO9A 1QO3B 1FNSL 2WINA 4FN0A 5DJZB 1NGYB 3MRQA 3FO0L 1DBAL 4G7VL 1J8HE 4IRSA 2VIRB 4DK3A 4L4VB 1QR4A 1N59A 1KN2L 5T33H 1JPSL 4M5YH 1RVFH 4O2EB 4JO2L 1OLZA 2VLRB 3Q1SL 1NCUA 4FTVB 5D7IB 2XZCH 2P44B 4N0UB 4TSBL 1KBGH 2YR3A 3P9WB 1M7IA 3KJ4B 5F9JA 2XTJC 4JY5H 2NW3B 2DQGL 4H25A 3IS1X 3GSNL 2YKLL 4NQEB 3DI2B 1ZLUH 3F58H 3WHE0 5I1KL 1UZ6F 4D0CB 1FNSH 4LCWD 3GSUB 3U2SA 4AEIL 3HC3L 2W91A 5DLML 1KCLA 1DBAH 2A38A 5IW6B 4G7VH 4HGWB 4JHBA 3BGMA 3SDDC 5JOEA 5JZ7C 3CU7A 3NN8A 2R2BA 5CD3A 5KTEL 1KN2H 1JPSH 5ICXA 3UZEA 1JZ2A 4MDJA 1CD1A 4JO2H 3Q1SH 3GDBA 5C9JB 4UQ3A 3V6OA 3L5HA 4OLZL 4X4ZA 2D7TL 4TSBH 2NTSP 5DUML 1LP9E 4Y16D 1A2YB 4BSWA 4Y4HB 1QBAA 1CD9B 5IFAL 5A2FA 2EYSA 1RZ7L 4AK1A 1ZHLB 2DQGH 3GSNH 2YKLH 3LH2L 1ZEAL 5FKAB 1V05A 2AK4E 2MPAL 1M6OB 3KAAA 5I1KH 1JGVL 2WK2A 3ARGD 4BQ9A 4AEIH 5DLMH 1A9EA 4JRXB 3BP7A 4Q6IA 3J8F7 3SE3A 4O2CB 3WFCL 5KTEH 2GTZB 2EDWA 1T1YB 1PDKA 3ZL4L 2BC4B 1F3DJ 3DX6B 1D6VL 4PJ7A 2GSIB 4X7TB 2HRLA 4Y5VB 4JZJC 4EVNB 4OLZH 5TPWL 2D7TH 3RI5F 5DUMH 1JPFA 2Z92B 4GLRI 1LO2L 5IFAH 4G8GE 3ULUF 4NHUB 1RZ7H 4HW6A 4C56B 3LH2H 2R2HB 3TA3D 1ZEAH 2MPAH 5GXBB 1DDHA 2N56A 2EICA 5I8KL 5IEKA 1JGVH 3VXUA 3PIQB 1CFTB 3HR5A 3VWKD 1JN6A 4DGVL 2DQJL 1XGTA 2XN9A 1JNHA 4QWWD 3WFCH 1UENA 5JNYB 3T0EE 3QQ9C 3ZL4H 5C70A 2AEIT 5BQ7A 4BA8A 5D2NB 3QHTC 5LAXB 3FQNA 1D6VH 3K8KA 5ID1A 5IKCB 1DEDA 4ONFL 5TPWH 5HGAA 1Q9LB 1HHJB 1ZGLA 4OFVA 5ACZB 1LO2H 5K9KA 4JGMA 3LQZB 3HZMA 2H2PD 3LKSB 1A1OB 1H3TA 3R0NA 4M93C 3KPQA 3NCFB 1WWAX 5J1SC 2PXYA 5GS3A 3RBSA 1FP5A 1AFVL 1PSKL 1JGUL 1IEBB 3IRPX 5GGVL 5FDYA 5HVGB 3KLHC 4DGVH 1C5CH 2DQJH 3ZDYE 4M8VA 1A64A 3VFSA 4GS7C 1A6WL 1QRND 3MA7A 1IM9D 4Q97A 4L4JA 2XOTA 1F4XL 5KSBE 3OKLA 1IAMA 2CUIA 1Q94A 4P5TB 2XTJD 1XR8A 3CFJA 4ONFH 2BSTA 4R2GC 5GSRA 1ONQA 2K7QA 4OZGE 2XG5A 3RA7L 1CXIA 3D1MC 5HYJD 5L8KB 4NFBA 2HJKB 5FEBA 1X4ZA 4YK4B 3N06B 5JZ7D 1AFVH 1PSKH 1JGUH 1FHGA 4OUUB 2CKNA 5I1GL 4Y4KD 3PGCA 1T7ZA 3JV5A 5HGGS 2W65A 1AR1D 3NPZB 3D18A 3GMPA 2AVGA 1A6WH 1TPXC 3RAJL 4WENB 1FCGA 4M00A 4DKFL 1F4XH 3KVQA 2OTWA 5A2LH 3CUPA 1CT8B 3QJHA 3LQAL 4QOKB 5E5MB 3F8UB 3G5ZA 5DVLA 3RA7H 3F62A 3QA3B 5JDJA 3O9WA 2FEEL 3O4OC 4NRZA 4WUKL 5EU5A 3L95A 4EIZC 3MV7A 4X5WA 2QR0B 5LWYH 2OL3L 2V7HA 2NX5D 4YFDB 3LB6C 5I1GH 1WGOA 1A7BA 3HUJF 3Q6FA 1O0VA 4NSKA 5JIKA 2IADA 2YA0A 4D8PA 3THML 1G9NL 2GKIA 3RAJH 3U30B 3JUZA 3GSQA 4FG6D 4DKFH 1FYTB 2ZNXA 4KRPC 4ZOCA 4U6YA 3ULSB 1BWMA 2WP3T 3LQAH 3QPXL 4WTWA 2HVJA 3KYKL 4PJBB 3MRFB 4TRPL 2YMXL 2ADJB 2EXWD 3MUGB 2DQTL 1R5WA 4WUKH 4NCC2 4NM4L 5SX4I 4HDIA 1B0GB 1BEYL 2OL3H 4XNMB 3RUGE 5HXMA 3IDIA 4WI5A 1U8NA 4LCCA 3MRPB 1T7VA 3SN6N 4S1RL 1L0QA 4LVOC 1G7HB 3GSVA 4ODSL 4ETQA 4FQ2L 2GQHA 3LRSB 3UYRL 1DVFA 5DHYB 1G9NH 2CKBA 3P9LB 3DVNB 1RZGA 4OCLC 1J9CT 4J1UA 1KF9B 4TVSa 1YMMB 4CU7A 2J3SA 2EH8L 4ODHL 5GJTL 4HD9A 4N5EC 4P23B 5C09E 5F1KC 3KYKH 3AS2A 4TRPH 2YMXH 5HVHB 3SJVA 3GMNA 5FV1L 1RAMA 3MROA 1NDMA 2DQTH 5JW5A 1T66D 4NM4H 4RMVA 3T3MF 2VUYA 3GKZA 1BEYH 2GYSA 1BBDL 1L0YA 4XPAL 1S9XB 2FL5A 4HIJB 1KPRA 4S1RH 5EUOE 3L9RB 4ETYA 1TJHL 3WIFB 2E27H 2P4AB 4ODSH 3D3VB 4OV5A 3ET9F 4GXUM 2YS4A 3UYRH 2IBBA 3TBYB 1IKNA 1QEWB 1QVOB 1QYGL 3HE6B 1BECA 2DB8A 4EDXA 3QWQB 1G7QA 4R2GD 4HK3J 1ND0A 3U46B 5C0RL 2ZOKA 2EH8H 4ODHH 5GJTH 5HDLA 1KXTB 2LAGB 1NGPH 3RWJA 4X6DA 1U91B 3IJHB 4OGAC 4HAGA 3C6LB 4UMGA 4Z78B 1AY1L 1BBDH 4Y19A 1PG7X 4XPAH 4KI5E 4YR6B 1DBML 3BPCA 4KROB 4X98B 3S34L 2D4DA 2DOCA 1TJHH 5E6IC 2D7NA 4GH7B 4ODBD 3PL6B 3PWLA 3B9DA 5TDNB 1QYGH 3MCKA 1MCCA 4NJ9L 1IL1A 1KIQB 4O2FB 1OQXA 2VZ3A 3O4LD 5C0RH 3RVTC 2ZUYA 3ARQA 5D7JA 4UV4L 5HYQA 1A4JB 1OF2B 4RDQG 5F6IB 5K9OB 1SJHA 2XI9A 4I48B 5AUMA 5SWSE 1ZT7B 3F7YA 4MNQA 4DN4L 1YECL 2VZVA 2G5RA 3LB6D 3ULUC 4MQXC 1AY1H 3STLB 3E8UL 1RHHB 1EHLL 3QWRA 1MVUB 3CFDB 2AJZA 4ZQKA 1DBMH 4POZC 3S34H 2F8XC 1YQ2A 1FCCA 4JFED 4CJ0A 5ICYB 5EFIB 5KSUB 4KVCL 4RFEA 4XCEB 4NJ9H 3SKOA 5HGDA 2I26N 4IBLT 4FQQA 1KTDB 3RP1A 4P4KA 4PY7A 2GIYA 1YQVL 2HA1A 1P53A 4UV4H 3BQUC 5ISZB 3V8OA 4K07A 4YIQB 1I7UA 4PP2A 1SEQL 3EHBC 5ETUA 2QBWA 1KEGL 1DEEB 4OIBA 2X4NA 3FFCE 4E41A 4DN4H 1YECH 4A2MA 4F57L 2CDGB 4H8WC 5F1IA 1I8LA 1W72A 1IT9L 5JLZB 1P7QD 3VI4E 3E8UH 3C8HA 4M7ZB 3QDHA 4L8SB 5CHNA 5CJQH 1EHLH 5B38B 1CFSA 1JYVA 3O2WL 2Y7QB 4BQ6A 5ITFA 1FZJA 1BJ1H 3QUYC 3SO3B 3AY4C 4KVCH 4N5ED 1I1FB 1WBZB 1OT1A 3UPAA 3BFOA 4J3WA 1KIRB 5C07B 5F72S 1KLGA 4V2BA 2BJML 4UT9L 1YQVH 4NN6C 5T3ZD 1QLEL 1UVQA 2Z31A 4YWGL 1X9QA 5DJ6B 1KEGH 2ESVD 3WHE1 1YNKL 1U8MA 3BXNA 3UTTB 1CTOA 2O5XL 4Q9RL 1FVCA 1IT9H 4Y4FB 1QQDA 4WJ5A 3EO1B 2X1QA 2Q8BL 2B4CL 1EH9A 3RVWD 3UTQB 4MXVE 5C0BD 3DXAA 2N7BA 5BVJA 3O2WH 1KLUA 3DGGB 1VENA 5EWIL 5F7HA 1JNLL 1T04B 4PRIB 4MJ2A 2SEBB 4F7PB 4X99B 1UCBL 3E1F1 4JFZL 5K59E 3KWWA 3PUCA 2BJMH 5C08E 2CR6A 5IHBA 4QY8B 1QLEH 3P3YA 4YWGH 1TLKA 2WLYA 2D7MA 4LNRA 3QEUB 2E7LA 4S2SB 2P5EE 1YNKH 4JVWA 2R23A 2I07B 2ED9A 1I1AA 2O5XH 4Q9RH 4OBSA 2V5YA 4FXLA 2DIBA 5I19L 1VKXB 1CLZL 1W0YT 4XCYA 3OKDA 4D9QE 2Q8BH 2B4CH 2Q86A 1HHGB 1Y6MR 4P46C 5EWIH 4OZHE 1JNLH 3P4LA 3WJLA 1C08B 1MH5A 3RVTD 5FYJU 2HFTA 4PGJA 5CBAA 3CVHB 4ZAKA 1UCBH 4JFZH 5BZDA 1A47A 2XY2A 4Z7QF 4IRJD 4GW1A 2P24B 2BOBA 1MQKL 3ULUD 3OJ2C 5F7NC 4MQXD 4W4NA 4ZOBA 1ETZB 4YC2B 1DN0B 1U8IB 1BJ1J 4RMQA 3WKNA 5JPNB 3V4UL 3QZWG 3REVB 4ENEC 4FXGA 4N0FB 4POZD 4X6CB 3KPSB 3OKMB 4U1KA 5I19H 3TFKD 12E8L 1CLZH 3HI1A 5E1AA 5B4MC 3TVMC 4Q0XL 1OGAB 2CRYA 2X4SA 3GK8L 4G8IA 5EBWA 3ZT6A 4EQ3A 4HUXB 3QUXB 4YHIB 4UILL 2YEZB 3IYLW 5I66B 4WHCA 3ZKXC 3IDJA 4ZUVB 3WL9B 4IOIA 1I9RL 2X89D 3BQUD 1G7IA 3FO1A 4EI5D 1I7TB 3EGSA 3FN0L 5C8JA 2A74A 1V3LA 5CGYC 2E9IA 1MQKH 4EEEA 2E9WA 4QHLA 1R6VA 4DAGL 3G5YA 1HXYB 1KB9K 1VEMA 4I0CC 3V4UH 4H0HB 5I8CB 1HHHA 4WGWB 4KKAD 1VCAA 12E8H 5FOBB 4PGBB 1BVKB 1P7HL 3DIFB 4Q0XH 3QUYD 2HJLA 2Y23A 2A6JB 4U1NA 3QAZB 3GK8H 5E8NA 4GW4B 2BVEA 4Z8FL 1CBVL 2P47B 4UILH 3R06B 1AD9A 1MCRA 3MNZB 4PBWD 1I9RH 4OD1L 1MVFA 4E42B 1FORL 2OQJB 5JXEC 2CRIA 3VFRA 3FN0H 2B0SL 1LK3L 4U3CA 5F93C 5EZJB 1A6AB 4KC3B 1G7MB 1DR9A 1XIWB 3O6FD 4NT6B 4DAGH 5FO7A 3MNVA 3RY6A 5I1JL 3QDGD 3RZCC 4J2XA 4CMHC 1HZHL 2W60B 4K7PY 3MV9D 3T77B 2ZPKL 4P2RD 1BOYA 1J8HB 2VWEE 1CBVH 1CLOL 3QT2A 1R3JA 4TULL 2V2WA 1FFNB 1JZ4A 4OD1H 1K8IA 5I1DB 3TO4C 1FORH 1NC4B 4G6FD 2WBJB 2B0SH 1LK3H 3KHQA 1TVBA 4N9GA 5DQDL 4TVPD 4WW2A 1P4BL 3PQYD 4JN2B 3DRTB 1EBAA 3L5JA 3UJJL 2DTSA 1T83C 5HHOE 2AXJA 3UDWA 5I1JH 2HYMA 4P46D 4LLYA 4LSSL 5C0DA 4UDTB 5E0QA 1HZHH 2NY2B 2DQUL 3AB0C 3H9SD 1ZS8B 2ZPKH 1N6QL 1QD0A 2NTFB 3JV0A 4CN6A 4P2OB 1INDL 1CLOH 4TULH 2RR3A 3F7QA 5HYSA 3DBXB 3KPMB 5D1QD 4PJXE 2IALB 1AGEA 5DQDH 4GG6A 4ZO6A 1CCZA 1P4BH 3S4SA 2DQEL 4OCRL 3WLBA 3BGFB 4ENED 1LP9B 3UJJH 2IAMB 3FCTB 4NZTL 3QXAB 4ZYKB 5B4MD 5KVMC 4X4YB 3EFFB 3TIEB 1VDGA 2AK4B 4GMSL 4LSSH 2VL5A 5E8PB 4Z7UF 2DQUH 1UWXK 2MKLC 4RMWA 1QRNE 1ZA6A 4XH2A 2X6MA 4QRRA 1N6QH 2NQCA 1R3HA 2FHBA 5HY9A 1INDH 4ZFZA 5J12B 2GCYB 5KANI 1ERNA 4R6UA 5CGYD 4RX4A 2NW2A 1J0KA 1GIGL 5HYJE 4MD4B 1UB6B 1KCRL 4F9PA 2DQEH 1ORSB 3BIAX 4NZTH 4UUJA 3V5KA 3ZKMC 2IH3B 4G8GB 4GQPH 5K9QG 4HHAA 5IGXL 1X3DA 4QYOB 5IFHL 4MX7B 4GMSH 4R97C 4R9HA 4GKSB 1BBJA 5E8DL 5T5NG 4G6JL 4RWHA 1P84K 1WBYA 5FB8B 3NIGF 2FSEA 1BVLB 5JXED 1ZANL 1FDLL 3KG5A 3BYYA 4LLDB 5EIQA 4S10A 4XZUA 1AGCB 1N8ZA 1GIGH 1REIA 4OF3A 1ZHKB 4WV1C 2V5MA 1KCRH 1U3JA 1VFUA 4R0LB 4LHUD 4K23H 2D7QA 1NC2B 4RDQF 4WFED 1EBPA 4N8VB 5IBUB 5LQBL 4AH2A 1G7PA 1N26A 2VLJA 4JY4B 4UB0L 3BGAA 1K9TA 1AKJD 1ZHBB 5IGXH 2YXFA 5IFHH 3F7RA 2IBZX 5T5FL 1CR9L 1CDJA 5E8DH 3VXNB 2PF6A 4G6JH 3T4YA 1WF5A 3UJIL 4D94A 4H1LH 1Y6NR 4NO2A 4WDIA 1JZ3A 4X5XA 5C0EB 1NFKA 1ZANH 3DUUB 1FDLH 3HR6A 2UVEA 4PJ9D 5KSBB 4NNYA 1E0OB 5I17A 4Z5RA 3TESA 5D2LA 1BIIA 3IAGC 5J9PB 4OZGB 1V3JA 4KK9C 4LL9A 5LQBH 4KWUA 4UB0H 3X14B 1IARB 3S97C 4D3CL 4WWKB 1ULVA 4IOFC 1CR9H 4F33A 5DURB 2V6HA 2OCFD 3G08B 1BFOB 1NGQL 3UJIH 2CK0L 2AQ3A 5I73C 5KSAA 1ZMYA 3V0VA 2M26A 4NQDD 1CDHA 1FJ1B 5C6WH 1OD9A 1N0LA 3OAYK 5A3ID 5F44A 3BX7C 5FA3A 2VLKA 5CJXC 3LKOB 3WNKA 4XXDB 1TTUA 4OFDA 4KQ4L 2X44D 4TSAL 4HCRL 1UADC 4D3CH 3DO3A 4M9PA 1NMCC 4M3JA 3MRKA 4M48L 2YUXA 5E08L 4JFPB 4W6WB 1IEAB 4Y5YC 5BS0D 3SKJL 1NGQH 4APQA 3W2DL 2CK0H 4HIHA 5DEGA 2BVPB 4M62L 2X1OA 4M4RA 5F88A 3VGFA 2DM4A 5HGHB 1JF1B 4HEPG 1MHEA 2VQ1B 4JEGB 4DFHA 5JORA 3T2QA 3VH8A 4K55A 2KH2B 3ZDZE 4ZMAT 5TDOB 4PTUB 1JGEB 4S0SD 2NXYC 4MQ7A 1VADB 4NC1C 3MRJA 3S5LA 1FQ9C 4QHMA 2HN7B 3EO0B 4KQ4H 5C0ND 2OSLB 1YUHA 4TSAH 4HCRH 1D3CA 3VD7A 2W0PA 3MJ9A 4XP4L 5AAMA 4PJFE 3QG6B 2O26U 5IVXE 5CEYA 3RUGB 5E08H 4A6YL 1YZZA 2H8PB 5B39A 1T1WB 2WIIA 5DVKA 3W2DH 1S5IH 3UZVB 3O4LE 4M62H 4U05A 2OJEA 2P45B 1U8JA 1JNNL 5JW4M 1I8KA 4ZFFA 3B5GA 3LKRA 2VE6A 4FA8A 4LBEB 2FJHA 5C09B 5EU3B 3HCVB 2QQNL 2AS5M 4OZFH 2ARJB 3HE7B 1CE6A 4OLEA 4U6XA 2FR4A 1FIGL 3F12A 5HJ3B 3VXSA 3QCVL 2HLAB 4MAYA 1WTLA 4RCAA 1MLCA 1UXWB 4XP4H 5KVEL 1MCQA 2A9ML 5CWSB 4JFEE 4XBGA 3KHOA 3MRLA 2E9JA 5DXWA 2ZZUT 4A6YH 5EUOB 4PR5B 2AJSH 3MRCB 3QUZA 1AIFB 2WWKO 4IOSD 3CXHJ 4J3SA 4EN3C 4NQVA 2JTDA 1JNNH 2QQQA 1JWSA 2P7TA 1E4XH 5MI0B 4P99A 1YEEL 5GRYA 5I30L 3MYJA 2QQNH 1MF2L 1K6QL 1HOCA 4XVSL 1PD6A 2ZG1A 4IOFD 1FIGH 2NR6D 3QCVH 4NM8L 4PJ5A 4KXZH 4MB5A 5KVEH 3EYVB 2A9MH 2AI0L 2LVEA 1X6LA 1XF5A 2AKRB 5F6HJ 4XX1G 3RVXC 1CFNB 5D4QA 5DJ2B 4LQFL 2A6DB 1IILE 3T3PF 2ZKHL 3O8XC 2OI9C 1RZJC 1T4KA 5IT2L 1Z5LB 2RQ8A 5CCKL 2A6IA 1YEEH 5I30H 2FECI 4K3JL 1KCUL 3G6AB 1MF2H 4XVSH 2X4RA 4ZPTA 1NANH 1RUPL 1S8DA 3MYZA 2H32H 1YEKL 3OKKB 5D1ZC 3Q3GB 5C0BE 5DC0A 3RNKA 3H3KA 3MRRB 4LSVL 4OB5L 2AI0H 1FO0A 3QIBB 2VDKL 4LLUA 5I16A 4NOFA 1MQ8A 5JHDA 2HLFC 4FOMA 4LQFH 3SGKA 2Y4SA 2YXMA 3JWOC 2BVOA 2NXYD 2ZKHH 3T0VA 3IDNA 4P48A 5IT2H 2EYRB 3IGAA 5JOFA 2PETA 5CCKH 1B0WA 4K3JH 1JK8B 1KCUH 5TF1L 1E28B 5C1MB 2UYLA 1RUPH 4LRIA 3L5WA 1G9MC 3OV6A 4PJAA 3FFCB 5JR1L 1YEKH 3BP5B 5DC4B 3FQXB 1WAAF 3D85D 1GCFA 2DBLH 3BRFA 4OB5H 4P9HL