3IETA

Crystal structure of 237mab with antigen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
215
structure length
215
Chain Sequence
IQLTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAEDLGVYFCSQSTHVPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin light chain (IgG2a)
publication title Antibody recognition of a unique tumor-specific glycopeptide antigen.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ietA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ietA01
1XMWA 1BZ9B 1IAIM 4HXAH 4N8CL 4OLXL 5CP3A 4UT7H 3REWB 1FHGA 3G5ZB 1INQA 4XRCA 1ZHBA 4C56B 2I26N 3VRIB 3MFFA 5HHQB 4M5ZH 2IAMA 4HXAL 4PB9H 1U3HB 4HHAA 5F44A 4GFTB 4K7PL 4QTHB 4UT7L 3MREA 3L7FB 2R4SH 1ZEAH 4LFHD 4M5ZL 4FQ1H 1SMAA 2NY5C 4PG9A 4PB9L 5KSUA 3RVXD 3HCVA 4PGBB 1H3XA 4ONHA 1Y6NR 2AXGB 4LPXA 4QWWC 2R4SL 3DGCR 3OKLA 4FQ1L 4XVJH 5F88B 5ACMA 2I5YH 4YE4H 1CXLA 5HDBE 4PRHB 5IWLC 1J0YA 4XVJL 3N50A 5I1AB 2I5YL 3QRGL 4YE4L 3KYKH 1PD6A 1CDYA 4OFVA 4BH7B 1NDGB 3G9AB 4KJWD 3NAAL 3WNPA 1OM3H 5T3XE 3WFCH 1KLGA 1YUHB 1CCZA 3PGFH 4X8JA 1GHFH 4PJBB 1I3UA 2VZ3A 2MQ3A 2H6PB 4ZFOB 1OM3L 4U7MA 3WFCL 5C08B 3MA7B 3EYUL 4C83B 3PGFL 5I8OH 3TFKD 1GHFL 4ZPTA 1T5XB 1DTUA 1RIUH 4KDWA 4JO2H 3QDAA 5I8OL 3V79C 2NXYD 4LCUA 2FB4H 3TJEH 4D8PB 4JJ5B 1TFHA 5TE7H 1CIDA 4JO2L 4XC1H 5DC4B 4OF0A 3PDOA 1C5CH 3BEVB 4WHTA 3TJEL 5F8QC 3D6GA 1DQDL 4JRXD 1FNGB 3WSQH 3ZT7A 1C5CL 3BH8B 3MLZH 3AAZA 4L9LC 2BNRA 1AO7A 2FZ3B 3BGMB 2V17H 4HWUA 3WSQL 5KOMC 2YUWA 3D3VA 3DRTB 2EECA 3MLZL 4MNGA 3DI2B 1E6JH 2V17L 1U8QB 4X5XB 2BVEA 4G6JH 3MLPA 1IKNA 4S1DC 2EDJA 2R1WB 4KK8C 2APWA 1E6JL 4NFCA 1KPVA 2OL3H 3JVGA 1UWXK 4P3DA 1S7TB 4LPWA 3LSOA 2J8HA 2HFFB 4AEIH 2GSIB 2OL3L 1I8MB 2DF3A 3M8OH 4QRRD 4DUXA 1ETZA 5E2TL 4BUGA 3FAWA 4AEIL 5CD5D 3TF7C 2OTUA 2VXTH 1W8NA 4P49A 1K5NA 1JUFA 1PLGH 1RFDH 4LKCB 3PV6B 2VXTL 5IESH 3X3GH 1PLGL 1ZOXA 1RFDL 5D7LA 3PWPB 4Y8AA 5D2NB 4K8RC 1U8MB 5KSAB 5IESL 4K7PX 3X3GL 5CEZH 3VDBA 1V3JA 2V5YA 3MFGB 1XIWA 2R0ZL 3IVKA 1LHZA 4GW1A 4LHUG 5DUMH 4UOW1 1OAYH 3GUTA 3PG2A 2J4WH 4UT9H 4Y1AD 3GHBH 3RI5K 1YJDH 5CEZL 3BP4A 2G75B 2A6DA 1CDCA 3CUPB 4CVXB 1U8KB 1XGRA 4J3TA 3QO0B 2B0SH 1RJYA 2IPTH 2J4WL 3GHBL 4HT1H 4UT9L 3SKNA 1YJDL 4L8BA 4RISL 4MD4A 3KPNA 4P2QB 1T7XA 4KK9C 5IQ9A 2B0SL 2IPTL 4NSKB 5FYKD 4EOWH 3MOAH 2MHAB 2DI7A 2OL3B 3BHBA 1AR1C 1WFUA 4JN2B 1T0NB 1UJ3C 1DBBH 4Y16B 1FIEA 1V7MH 4WI8A 5AEAA 1T7WA 3A6CH 4EOWL 3MOAL 2W9LA 4AENB 2PTVA 3H3BC 5JMRA 1V7ML 5EO1A 5HPMA 3IDJA 3A6CL 3GSNA 1MAML 2Q76A 1HNGA 3MBEC 4JRXE 1R24B 2EYTA 4NUGL 2R2CA 4MNQD 5MHSD 1AGFB 1OGAD 1QOKA 3C6SA 3MO1B 4OCXH 3I75A 4PJDE 2BVUA 1G7QA 1HE7A 4M7LT 2GIYA 2W60B 2MKLC 3WDJA 4RMVA 4OCXL 4JCMA 1FJ1B 4RQQB 4ZUTA 1A6UH 4WO4B 3CFJA 5IHZB 1WZKA 1D9KB 1CG9B 1MY5A 2DQGH 1YEHL 3M45A 4Q74A 1A6UL 3RVWC 2VXUH 4R0LC 4QRRE 1YEEH 1IAKA 4PV9A 2DQGL 3EJYC 4KKLD 4IMLA 2F74A 5HGGS 3A6OA 4TUJB 2A6JB 2VXUL 4QTIH 4YC2B 2PYEA 3O2WH 1YEEL 1D5BB 2MKWA 4C54A 2IAMC 2EDLA 5IJVA 4N90D 4QTIL 4X6EB 2AK4B 3O2WL 4WHCA 1WV7T 5ENWB 3RPIB 4GQPH 4Y19D 1MCCA 2MCPL 1MRCH 4JRWA 4QRUB 4XC3H 1T6VN 4QT5B 3DMMD 1C08B 2Q1EA 1NANI 3QXTA 3P4LA 5C8JB 2YHGA 1MRCL 3R0NA 1IAMA 4XC3L 2BZDA 3B9KA 2FEDD 3LKPB 2BVTA 5ABDE 1HHIA 2VLKD 5DJYA 3EJZD 4NCDA 3U0TA 5BRZA 5KSVA 5FYLD 3VGAC 1JP5A 1AKJA 1BF8A 4JHWH 5TDPB 5SWZD 4KAQL 5DD1L 5FYKE 3L3GA 4X6CB 1LO3H 1QFWM 3VA6A 3ZDZF 1WC7B 1MCKA 4JHWL 4M7ZC 4CDHA 4N0UB 1LO3L 3ZDXF 5C0AD 4QHUA 4NM4H 5DDHB 5MP6H 1F8TH 3BZ4B 2YD2A 3TVMA 2LU3A 4DVBA 4M1DH 3RNKA 4UT6H 4OGYL 1FN4A 1HSAA 4LSRH 3K1KC 4NBXB 5MP6L 4MNQE 1F8TL 3OXRB 5AZ2L 1Q9KB 5MHSE 3ULUL 1E6OH 5KANI 1OGAE 4UT6L 2BSSA 2DM2A 4LP5A 4LSRL 1V3LA 1JWUA 1E6OL 5DQ9B 5E1AB 3IFOA 1QD0A 2YA1A 4U1LB 4PIRF 4LVOC 3DXAA 3VI4F 3C6LA 4BQ6A 3WYRA 2NY0C 2MTPA 4WW2B 3TV3H 3SDAA 3E6HA 4YIQB 1KLUB 4MMXC 3NN8B 5A2LH 2FGWH 1WBZA 4NNYB 1G7LA 3JV0A 3TV3L 3GGWA 4NKDA 4NDMA 3IDYC 4ZMAT 2DQJH 5EDXA 3STBA 2EXWD 2FGWL 2VH5L 5EPMB 1BLNA 1RZFH 4WW1B 3IU3B 3LS5H 3EGSB 1RJCA 4LKXB 5IKCA 2DQJL 4N90E 2O61B 1MCWW 5HD8D 3L3HA 4GW4B 5DQJB 5ICYB 2Q6WB 1B2WL 3ZSSA 1RZFL 3DETD 5E08H 3QYCA 3LS5L 5LGHL 4Y19E 1JGEA 2P7TB 1DANU 4R4ND 3RHWF 2BOBB 3EFFA 3ROOB 4FHBD 1F42A 5DFVD 3P4OA 5E08L 3VJ6A 1NUDA 3DARA 4KROD 4LCWD 4WCYH 1HHKB 2AV7A 4WFGD 3CK0L 4NZDA 2PXYD 2RFXA 4JKMA 3S36H 1IFHH 4LVNB 3BD3A 4N1EA 4OGAD 4WCYL 2W0FB 3ILQD 3EYQD 4L29B 3MRCA 3TCLB 1G7JB 4KJPC 5FYLE 1IFHL 3U30C 1XIWC 3EFDH 4NM8H 2I24N 3W11C 3N06B 1H15A 4I5BA 5HYSG 2DAVA 5GGVH 5FYJD 4X98B 3EFDL 4NM8L 4JFPB 4H0IA 4FQXB 3IKCA 3PJSA 5EH1A 1CDIA 4P2CG 3SN6N 1PEZA 1JYWA 3DHJA 3QI9B 1OGTA 5DK0A 4Y4KD 5C0AE 1OAUH 1LO4H 3VGFA 4IRJB 4HCRH 3S96A 3ZDXE 4YDVA 1RJZB 3VG0H 5IROC 2HRLA 2IBGA 1OAUL 3RWJB 4PY8J 4XNQB 5CSZA 4FQQB 4HCRL 5HHXH 3E1F1 3VG0L 2W0LA 2Z0BA 1FYTE 2D7TL 5HY9B 32C2A 1YNLH 1ZGLP 4BSVB 3BIKA 5E5MA 3DX7A 1M7DB 1H8NA 1M7XA 5HHXL 4H8WH 4K23H 4LSSH 3WFBL 3TO4C 2OMBA 1YNLL 3B9VA 5D1QD 4H8WL 4K23L 2A83A 4LSSL 3BMWA 1FZOB 4M6NH 3LAFA 4Z7UE 4TNWF 4PRNB 1U91A 3QXAA 2AGJH 3GSUA 3VG9B 4NJAH 4M6NL 1JPFA 2N56A 5KN5A 2ERJB 2F8OA 5C08D 3CH1A 3P4MA 3TBVB 4HWEH 3HUJE 1I3RA 2CLZA 3IF1B 5DD0L 2NY2C 1TJHH 4LBEA 4NJAL 3VGBA 2VR5A 1VADB 5HBBA 2VQTA 2YOCA 4HWEL 5JORA 1AXSB 1E0OB 2VXQL 2O5ZH 1TJHL 5GHWH 2C26A 4WGWB 2WIIB 3RQ3A 1M4KA 5C07E 3FQRB 2UZXB 4JRXA 3SBWA 3WFEH 1I9JL 5GHWL 1ADQH 5EBLB 2XZQH 4UTBH 5DUBB 3TPUB 4YGVA 5HHNA 1GGCH 4YFDB 5T3ZH 3WFEL 4H0GA 4LCWE 1GC1C 4WFGE 5HXMA 1ADQL 4LK4A 3PWLA 5I6XB 4PJDA 5KAQF 3I3BA 4HJ0D 1IEAA 2XZQL 3J8F7 4UTBL 3VI3E 2V7NB 1GGCL 5T3ZL 2YPKA 4Q0XH 3WLWD 1KNOB 2X4SB 1MCLA 3UCRA 4U2ZA 4PJ9C 1NGZA 1EJOH 4CU8A 2JB6B 2BSED 4QRPB 4DKFH 3B9KC 3BDXA 3CFBB 5FYJE 1KIRA 1EJOL 1QBMH 2X4UA 4DKFL 4QRRA 4N8VA 3JWDC 3P30H 2EICA 3DV6B 2V9QA 2HLAB 1QBML 1M6OA 2GT9B 3FO9B 1LO5B 1ZLWK 2BC4B 1G6RA 4NWTH 1KELH 3RI5F 3P30L 4NBZB 2AJVH 1R5IA 3VDCA 5AG9A 1A7PH 3VFVA 2A6KB 4G3YH 5DHVA 4NWTL 1KELL 1I8KB 1RD6A 5D70H 1R0AL 4FQIH 3RIFF 3OHXA 4U49A 1A7PL 1K4CA 2V2WB 2IBZX 5JIKA 4G3YL 3MJGX 1CFQB 1P7KA 3F58H 5D70L 1QRNB 5IBLD 1PZUB 3NCEB 4FQIL 4FFZL 1OD7A 1W2KT 1LD9A 3SCMD 4CGTA 5CP7A 3OB0K 3G5YA 5FK9B 2IH3A 4PBVC 4CMHC 5H2BA 3U2SB 3F58L 3RX8A 4PJCE 3F5WA 4LLDB 2B8OT 2HVJA 4Y4HB 5F9WB 3H7BB 5HGHA 1A6TB 5J13C 2FH8A 2OTWA 4PY7B 4AQOA 4M61A 3CSBA 5KS9B 5C9JB 2YD9A 3DUHA 3C6LC 1GZPB 3FMGH 2HG5B 1IILE 5A16A 2GKIA 1UVQA 1H0DB 1YPZB 3SDAC 2HTKD 2W9DH 5GRXG 3FMGL 2JLLA 2WBJD 4GUPB 1CVSC 3CU1A 5CCKH 2GSGA 5D1XB 1ZSDB 1REIA 3KYMB 2W9DL 3S3JA 2XY2A 1AY1H 2EDFA 4UDTA 4X6DB 4L4VD 3GI9H 5KSBF 5CCKL 1T1XB 4MNQA 3TIDB 1AY1L 2X10A 1OGAA 3GI9L 5DR5L 3PABA 3UDWA 4QRTA 4KRLB 1NQBA 3QXDA 1E4WH 1JJUA 2WZPD 4P4KD 3ISWA 5AUMB 1BD2B 3HTLX 4IOIB 4M8VA 3ILPA 4R9HA 1E4WL 3K81A 5ANME 1I7UB 5IB1B 2YPLD 3GMNB 5DJDA 4YHOH 1ZT7B 1X5YA 2VTFA 1WBXB 1MVFA 2CUIA 4F58H 4LPVA 5TPWH 4C4KT 2VLRB 1HHGA 3ZKSD 4F9PA 4ZXBA 1FNFA 4NKIH 3LOWA 4F58L 5TPWL 1P7QD 5L88H 1JZ5A 4I48B 4ZQKB 4GMTH 5DRWB 3I50H 5F3HA 3S4SA 4MHHI 1F00I 3LY6A 3X11B 5I15H 3C8KA 43CAA 4NKIL 4HJGA 1DLHA 3HNSH 4ZO8A 3EOTH 5L88L 4LFHG 4GMTL 3TN0B 3EAKA 1BIHA 3RVXC 4JFYB 3I50L 4Y19A 1HQRA 5FOJA 5I15L 3E0GA 5KVGH 3HNSL 1BQHB 3EOTL 1YMHA 4U1HB 1V05A 4KGJA 2J5LC 1ZT4A 3DSFH 3IAQA 1MCFA 4LLUA 5KVGL 5EUOE 3DX6A 4B7IA 4YLQT 2BMKA 5D2LF 1DN2A 4ETQB 2Z31A 3WKNA 4OV5B 4H1LH 5JXAH 4H88H 2EDWA 5JXAL 5EO0B 1A7RL 1QBLH 4H88L 4KI5D 4NGHL 5ACZB 4QY8B 4YFLI 1H8SA 3FQUA 1MREL 1G7HA 3TFKC 1MAJA 4M6OH 1QBLL 5IMKB 5B4MD 3OL2A 5C0AA 1KB5A 3UAJD 4FQJH 4YHIB 4Z95H 4UINH 1WWWX 3TNNB 5A2IH 4L4VE 1HEZA 4M6OL 5DA4A 2NXYC 5MEQB 3MJ7A 4RZCA 5MENB 5IVZB 1EEZA 1I75A 2ZNWA 4NQCE 3TBSB 4Z7WF 5KSBE 2F58H 4FQJL 4Z95L 4UINL 5L6YH 2VDML 4MA3B 1BJ1J 2ADGA 1FYTA 3TBWB 3WE6B 1RUPH 1I1CA 3N1QC 4WTZA 4CMMB 4OZHB 2F58L 5DMJB 3SBWC 5L6YL 1KJMB 2DMCA 4NQUA 2G9HA 1RUPL 4OI8A 1KCSH 1U2HA 4DKEH 8CGTA 5C0CD 1A4KA 1RZ8B 4Z7UA 5SWQB 5EC2A 6FABL 4WJ5B 5I1KH 3GMPB 1KCSL 5A3ID 3VWJB 2YPLE 1OY3B 4DKEL 3OKEA 4LNRB 1YYLH 4WHYG 2X89D 3WFDH 4Q9BA 5I1KL 4H1LB 4MAYD 1RZGB 3HUJA 7FABH 1Z9SA 1YYLL 5EU4A 1WEJL 3HR6A 3WFDL 3DJ9A 7FABL 4N8VG 4WI6A 1C7SA 5C07A 2FJFB 2ZSVB 5CD5C 5IGXH 3OB8A 1UCTA 2C3GA 4HFUL 2Z35A 3GIVB 5JOFB 1DBKH 3DVGB 3VFUA 2LU4A 5IGXL 1I1YA 2D31A 4LCWA 3Q5OA 2X7LA 5HHMB 2PXYA 4GAYA 3FB7B 3SDXB 2VAAB 3QHZH 5I74B 1IARB 5F7LB 5D2LE 3RL1A 1JHTB 1MJUH 1X9QA 2OJEA 1S9KC 3A6BH 3QHZL 4NN5B 2YBRA 2KPNA 3G08B 5C6WH 1G9NH 4U1IA 4BFGA 1MJUL 4FFVC 4KI5E 4PREB 3A6BL 3VD9A 2F9BT 3STZB 1G9NL 3WO4B 5B39A 4UQ3B 5FO9A 4Y4KA 2HJFB 1JGVH 1HI6A 5FKAA 2F5BH 1JNNL 1EXUB 2EE9A 1OB1B 1QQDB 4YPGA 1SEBA 1JGVL 2F5BL 2IPUG 1T03H 2I9TB 5IV2A 4KH2A 5F7YC 2JJUA 4JM2A 1JCKA 4GKNB 5LJYH 1T03L 3EDFA 5TFSH 4Q6IA 2PO6D 1K8IB 4POZD 3O3AB 1J05A 5DI8B 4GG6F 4PJCA 3LB6D 1LK3H 1QEWA 5TFSL 5C0CE 5HPOA 3BXNA 5FECB 3UDWC 5KVEL 1PQZA 1MHEA 5J56B 2VDRH 1OWWA 1LK3L 4YXLH 3UJTH 4H25A 5B3JE 5L9DL 5D5MB 1N2RA 2IANB 2VDRL 5LAXA 3UJTL 4YXLL 5SWSD 3KDMA 2EIEA 3MUGA 1EPFA 5F1OB 5BW7A 3IU4H 3P73B 5I1CH 2CDFB 2FO4A 3EDEA 3MYJA 4Q7DA 1H3WM 1G7PA 1T2JA 3RIAF 4ZXBC 4OCLC 3IU4L 2J88H 5E8OB 3AGVA 1FFOA 3NZ8B 1QUNA 3RX7A 2BNQB 2J88L 2F8VA 1BVZA 1K85A 2F53D 4I18C 4GKZA 3G6JB 3L7EA 2VXSL 1I7ZB 3DMMC 1IQWH 3VFPA 1VFUA 2PW2A 5GRVK 1CWVA 4MQ7B 3T0ED 1UB5B 3L3IB 2VYRE 2YR3A 35C8H 1BZ7A 1IQWL 1NL0H 2FEDC 5ANMA 4PRPE 4K3EL 5GGSA 3BPCB 4NQDA 2Z31C 3LQAH 4LQFH 3EJZC 35C8L 3VGEA 4JO4H 3VWKD 2HFEB 4NRYB 5IG7A 3LQAL 4RA3A 1EAPB 1UA6H 1D6EA 2P5WD 5DJ6B 4JO4L 2YD4A 4OIAA 5FM5O 3X13B 2ZUWA 3QDMD 3F7VA 5DMKA 1R3KA 4JVPA 4GRMA 2GJ6B 1UA6L 4JHZA 4MJ4A 1CD1A 1DE4B 3MZTA 4C59B 4OZGF 2D0FA 2HMID 4KRPD 4WI7A 5K59F 4LLVB 5TH2B 5I1LB 1LGVA 3GFUA 3VE0B 3CFIC 5JO5A 3SCMA 1QSFD 5CBEB 3K8MA 1BVKA 4OLVH 4ONGH 5EUOA 4GOSA 5JPNB 5BCAA 2APBA 1VGKB 4PJGE 1ND0A 1LILA 4WTZG 4E41D 4Y4FD 3ZKQD 4OLVL 4ONGL 4KPHH 2X4NA 4LSUH 1MFDH 3QCTH 4M4PA 4D0BB 5D1ZA 5J0BA 3T65B 4KPHL 3UP1A 5SWSE 2HVKB 4LSUL 4AT6A 3CPLB 1MFDL 4PV8A 3QCTL 5DHXB 5JIPA 4KUCD 5HGBA 3HZVB 1J87A 4RGOH 3LKSB 1JPGB 2LVEA 3DRQB 3IXAB 4NZTH 4YDIL 2ZJSH 4ODVL 1ZWIA 1KJ2B 1MIEL 2KH2B 3O45B 4RGOL 4HEPG 4N9OB 2EXWC 4L4VA 5LQBH 4NZTL 4UILH 1S7VB 1Z0NA 3ESUF 4MA8H 5KSBA 4NQCA 4HF5H 4XGZB 4LIQL 4TNVK 2VSCA 2H32A 1WUNT 5LQBL 3OBAA 1P2CA 3DETC 3LPGA 5IM7B 4LCCA 4IS6A 4MA8L 4HF5L 2F53E 3OQ3B 4R4NC 4GRWH 4GBXA 5DFVC 4R4FH 4KROC 3T0EE 2PXYC 3NCJH 1I8IB 3MRLB 3QUKB 1JF5A 3MLSH 4OGAC 4R4FL 3ILQC 3EYQC 3UTSB 3V6FB 2BY2A 3NCJL 3PWJB 4F15B 1NAML 2BSRB 3D85D 3MLSL 3G5XB 1J8HD 5D9SA 4U1SB 1A5FH 3B8SA 3GB7A 3H0TB 3QUZB 4HFWB 4LF3B 1KJVB 4LDLB 4OLUH 4I4WB 2P5WE 1P7QA 3ZKXC 1HQ4A 3BH9B 1A5FL 3QDME 5EOTA 4IIQA 2CXGA 4WVRA 3BSZH 3WHE0 4Y7MA 5DJXA 5B39G 3S3SA 4HBQA 4Y4KC 4TVPD 2B1AH 5LG1A 4ESKA 1FC1A 1KXVC 3EYVA 5CEXB 4WV1A 3BSZL 3HE6A 1ZA6A 1QSFE 2EIDA 2NLJA 4JPIA 1U0QA 1X4XA 4J3OC 4U6XA 1FAIL 5E2UH 4JM2C 4E41E 4EIZC 2I9LA 3GMOB 5JQ6H 2WQ8A 2GTZA 5D2LA 1VFMA 4TUOB 4Q6IC 4Z7QE 5E2UL 1C5DA 5JQ6L 5D1QC 1T3FA 3L95A 1AHWA 2EDDA 3MACH 4NRXA 1C16A 1P4IH 5DSCB 1NAMB 4GKSA 3VMOA 1WQVT 3HI1B 3MACL 5IK3A 1CD9B 5DZNA 4WU5A 4JVUA 1P4IL 1RK1A 5GPRA 4G9DB 5BZWB 2NYYD 4IHOA 3FQTA 1X5AA 1TQBB 3RTQB 4PLKD 2X4TB 5DO2D 4BSWA 3UTZB 2FCBA 1U8OA 3G9VA 5BW7C 1Q0XH 2DQTH 4WRLA 3O9WD 5IMMA 4G43B 5MEND 5I18H 5ETUB 1PZ5B 3PDGA 4WFED 1Q0XL 2DQTL 3QCVH 5I18L 2FL5B 5JUEH 2GCYA 1CI5A 4TUKH 5L8JB 3T3MF 4YAQA 4LARL 1W0VA 5BS0E 3QCVL 4HJ0C 1S7RB 2BY3A 3H9SB 1XGUA 3I6GB 3RX5A 4QCIA 4DFHA 1JZ8A 5JUEL 2J8UF 2ATPB 2Z91B 5KAQG 5FFLA 4TUKL 3WLWC 3LPFA 2A74A 3NGBB 1ERNA 2X89A 3H9HA 2AJZB 1J8HE 1SYVB 4MAYA 5FUZH 2ZUVA 3QEHB 5I8CB 1F4XL 4NQED 5F9JA 3TC9A 2NZIA 1WISA 4EI5D 5TQ2H 5IW3A 4HKXA 2FIKA 3ARXA 3MRPA 4TVPE 1IVLA 4IDJH 3L3KB 5B22A 1NUGA 3M1BB 3GBLA 4F3FB 5TQ2L 1CS6A 1J9CT 1T21A 5EORH 1A1NB 3BKCH 4IDJL 3DO7B 1CT8B 1MUJA 1FZJA 2F19H 5EORL 4XHQA 4PRBB 3BKCL 4ETYA 2YC1A 3MOQA 1S9XA 1X5LA 3QWOA 2B4CC 3HZMB 3TBYB 1FVCB 1RUKL 1JGDB 1RMFH 2F19L 5IBLC 2EO1A 3FT4A 1T89A 4F37K 3SCMC 2LAGB 5DJAB 4YXKH 5L2JB 1QR4A 3OKMB 3MGTA 1ED3A 4Q58C 2CKBA 2ICWJ 1NGYA 2YD8A 1A2YB 4PRPA 2AQ1A 1SJEA 5IEHA 3SY0B 1ZLUK 3LN4B 4YXKL 4JFXA 4AEFA 2EH7H 5CGTA 1BVLB 3PWVB 5D1ZC 4G7VH 4TYUA 4CRPA 1KYOK 4YPJA 5FDYA 2EH7L 3BE1H 4YHPB 4OBSA 3OR6A 1QSZA 3PWNB 1DQJA 1MCQA 3ARWA 1N3NB 4G7VL 4S0TD 4IEFB 3ARGA 4X7TA 3BE1L 3GJFH 4EDXA 1Z9OA 1CLOH 2WBJC 4S1RH 3GSRB 1ZV5A 3VFMB 3V8CA 3RZWA 1JYVA 2WMPA 4LQ1A 2XWBB 4WFEE 1QLFB 1CLOL 4CU7A 4S1RL 5DF0A 2PO6A 3KS0J 4LNVA 1QRKA 4MSWB 3GBNH 4UZGA 4BFIA 5IB3B 5DYOA 3TO2B 5F7WC 4DGYH 1FO0A 3KHOA 1G0YR 3T3ME 4LCCC 3GBNL 2Q86A 3HMXA 3CVHH 3HC4H 3S5LB 5A2FA 4DGYL 2WLZA 3V7AE 1MLCA 4XCYA 1FGVH 4P4KC 4WI2A 1MVUA 1S9WB 4F7CA 5FKPA 3CVHL 3HC4L 3QNYB 3SJVD 4ZUUA 3RL2B 3SDCB 3GSWA 5SWSA 1W0YT 4FOMA 2CLRA 1FGVL 4R7NB 5E8NA 1LP9E 5D8JH 1HCFX 3MNZA 3TA3D 2IAND 4P3CH 2NTFA 3EO1A 4NQEE 1F5WA 4Y0GA 3AB0C 2P4AB 5GS0H 5D8JL 3FO1B 4YEEA 4P3CL 4CAGA 4ELME 4U33A 2VLLB 4NQVA 2ICES 4N0FA 3RWGB 5GS0L 4PRAB 1OSPH 2XY1A 4MB4A 4IOSD 4N9GB 2XKNB 1Q9WB 1W72B 1ZHNB 1KENH 5CHNA 5KVMC 4IIQC 3FB6A 3C08H 3RVUD 3JTSA 3AS0A 1OSPL 4D9LH 5MI0C 2VR9A 1FZKA 4JB9H 2XTJE 3GJFB 5E1HB 1XT5A 1NC2B 2F53A 1KENL 2BNQD 1I9EA 1T22B 3C08L 5J3HC 4EVNA 1QFUH 1ZHLA 4D9LL 4JB9L 3IJHB 3T0EA 3RWCA 1QFUL 4JM4L 2APFA 5FGBC 5DGQA 1S7UB 2XNAB 3VWKA 3B3IA 2AXJA 5BV7H 3L5XL 1MHCA 2P5WA 4MD5A 1NBZB 3CFDB 4KI5C 4XZUA 5EIQA 4NUJA 5JXEA 1BJMA 3QDMA 2R2BA 3O4LB 3PGDB 5BV7L 1OW0C 1EH9A 2OM5A 5J7CC 4G8FB 4JPVL 4O00A 1DCLA 3UAJC 4OZGA 4DZBA 1S5IL 1KBGH 4PGDB 3K8LA 5BZDA 2VMFA 1WFNA 4PR5B 5FXCH 3IFLL 2NY6D 3OTTA 1IGTB 1QSFA 4HAFA 2V2XA 1KBGL 1SY6H 3JSSA 4JANA 1RZIA 4M00A 2VUOA 4QRSB 2DQEH 3ARUA 1MH5B 3RU8H 1MFEH 1IAII 1KTDA 3VXRB 4E41A 3LKNB 4D9QD 3ARVA 5MERA 3MRRB 1SY6L 1F6LL 3MRMB 1FNAA 1U58B 2DQEL 3BKYH 3RU8L 1MFEL 2EE2A 1CLYH 3SJVE 3P4NA 5DJ0A 4PJ7E 1D7FA 3BKYL 4HUXA 1CLYL 3PL6B 4IRSD 1FFRA 5A3IC 1ORQA 3C5ZA 1H5BA 3VFOA 1X5GA 3QIWB 4MAYC 4RNRB 3SGJA 1Z6JT 4XPAH 1KG0A 3VFGH 3BGFC 1HHJB 2ENSA 3OKOA 3ARBD 4TSAH 4CW1B 1RU9L 1JTTA 2YXFA 3NACH 1RVFH 1QTYT 5T1KB 5IW6B 3DHMA 1MAKA 1MLBB 1WWBX 5GGSY 3VFGL 4ZUWB 2AS5M 3VCLB 4TSAL 4KY1H 2ICCA 3MCKB 4QHMA 3VMNA 5CILH 1RVFL 5FCUH 3BQUD 4F7TA 4XCNB 2PTTB 2E8YA 4GJTB 4KY1L 2YN5A 4WEMB 5CILL 3SQOH 4WI9A 3BYYA 4JAMB 3D25B 4IJ3B 5BS0A 2Z92B 4XHJD 3MJ9H 3IAPA 1K2DA 1VERA 4WUUD 1JZ3A 1TCRA 4HIJB 3SQOL 2GYSA 1IM3A 5AD0B 3DURA 4K2UL 1PKQE 1T89C 3VD5A 3MJ9L 1J8HA 2X70A 3OG4B 3SKJH 3D1MC 4ORGA 4WI4A 4PS4H 1H3PH 3THMH 1KLFA 1A6AB 1D5ZB 3MRJA 3I2CH 2XZAH 3SKJL 1AD9A 5DEFB 5IW1A 4PS4L 3THML 3I2CL 2XZAL 4W68A 5BMFH 2GY7B 3HRPA 1UFUA 3OPZL 3UBXI 4YDLB 1OAZH 4P9HC 3WL9B 1HXMB 4WNQA 5BMFL 1RZJC 2X4PB 3S35H 2DJ4A 5CZVH 5EZLB 1MCSA 1OAZL 3MV7D 4D9QE 1CGVA 3EYFB 5I71C 2GFBA 3BD4A 4DUWA 5T33H 3S35L 1NGPH 2PO6C 3V8OA 4POZC 1MCWM 2X09A 2EEDA 5CJOL 4YK4B 5CZVL 5HI5D 4G9FA 3LB6C 1I9RH 4OZIE 1JF1B 5J4MA 4HS3B 3BP7B 3D39B 2DWEA 4NWUH 3NFNB 5BJTA 4I0PA 4IRZH 4B53A 5EC1B 4GG8A 3TCXA 4NWUL 3QUMA 2O5XH 2BVOA 4G42A 4IRZL 3PWUA 4WWKD 3QEUB 3CZFB 2ERJC 4MQTB 4MCYA 1HK6A 1NFDE 3HS0B 1ORSA 4PJHE 2O5XL 3ROLB 3RTQD 3U79A 1JN6A 3G04B 3R0MA 4OZ4A 5E4EC 1A7QH 2MJWA 5IVXB 5IP4A 3TM6A 5JPMA 4EDWH 3V4PL 3LCYA 2IEPA 3MGAA 1A7QL 3K8KA 1R3IH 2H3NB 5GRJL 2RAMA 5FEBA 2JB5H 5DRZA 4EDWL 3BUYB 4JFED 2GJZA 3AS1A 3PNWB 1F90H 2P43B 3MJ8A 3DROB 1P6AB 3O4OC 4WUUE 1Q9OB 4FN0A 5DLMH 3LD8B 5H94A 2Y5TB 3EOYG 3H9SD 5I8EA 1F90L 4LLAA 5D6DA 1MIMH 4RX4D 3T0EC 5DLML 3T2OA 3WBDA 2H9GB 4DOHB 1INDL 3IDMA 1LP9A 3NIFE 2VERN 1T5WB 4XP4H 3WFHA 4YNYB 2XA8L 1MIML 3NIDF 1A9BA 4LEOB 1J5OL 4EI5A 4NKQB 2W65B 4QXUH 3VWKC 3AROA 2R15A 3GKWL 4ELMA 4MX7A 4QXUL 1VFBB 3QNXA 1EUUA 4NBYB 3QDGB 3ARTA 3BO8A 3HB3D 3F12A 5ITFB 3HRZA 4DCQA 1ACZA 2GTWB 3GMQB 1Z5LA 3Q6FA 2DYPB 1DANT 2P8PB 3L5WA 4FG6D 3GSXB 3LHPH 2HMIC 3AU1B 3MV7E 4PGEA 4KRPC 2FR4A 3PHQB 1B6UA 5DGRA 3LHPL 3NBNA 1A14L 3UPRA 3VXPB 4P23D 1G0XA 5EU6B 4LHJB 5B38B 1U3ZA 4JPKH 3VRLF 1QBAA 3LZFH 1BZQK 2P47B 4HGWB 3BW9A 4Y4FC 4JPKL 3OKKB 2YRZA 2NY5H 3KVQA 3ET9F 1ZHKA 1R5VB 1TZHA 2YUVA 4CJ1A 4U1KA 4L3CB 2JIXB 2NY5L 5HSFA 2CRYA 1JK8B 3BISA 1HSBB 1GZQA 2YMXH 1A1MB 2X4OB 2YD6A 5FUCE 1IAIH 1KCRH 1JWMA 1UZ8B 5I1DA 2G2RA 3P9MB 5FGCB 2YMXL 4ODTH 1DQTA 1HWGB 4XAKD 1IAIL 1KCRL 3DVNA 3BESR 4OI9A 1U9KA 3EIFA 1X5XA 1QHPA 1IM9D 2OI9C 4ODTL 5J1AA 1B9ZA 4HIXH 3VXTA 4K9EC 4Y5VB 3PQYD 2OCFD 3MV8B 4JFEE 3SDDD 5H35B 3SKMA 4XNMA 2N7AA 1UWXH 4HIXL 2DM4A 4JN1H 1QFWI 3PGCA 3SJVA 4ISVB 2A9MH 5I1JH 4PJ7A 4JLRB 4JN1L 1KUMA 3TGXA 5IEKA 2MPAL 4MCZB 4E9LA 4LRNH 4O2CB 1OT1A 1T1YB 2B20A 4KMQA 4RMSA 2A9ML 5ADOH 2YEZB 4MNHA 5I1JL 5AYQA 3Q3GA 1BIIA 4O2FB 3NIDE 4LRNL 5GRUH 5ADOL 1FLTX 1U8JB 3KXFA 4XMKH 3HC3H 2E7MA 4QOKE 3CZJA 1DR9A 1BP3B 4OIIH 3T77A 5GRUL 3EYOB 2JELL 1BJ1H 3EOAA 1HXYA 3PHOA 3FFCB 4XMKL 4HS6B 3HC3L 2XFXB 4R96A 3DBXB 5CEZD 4OIIL 1M05A 3HE7D 1XF4A 5LGJA 4JREC 5AWNL 4HKJA 1IAOA 3QJHB 2R4RH 2AK1H 2RIKA 2WLYA 3LEVH 3Q6GH 3KNBA 3C09C 3LN9A 2R4RL 2AK1L 4U7KA 1OP5K 3LEVL 3Q6GL 5DJCB 3QR2A 3JBG7 1PKQA 4I9WD 1P1ZB 1SJXA 4OUOA 5DWUH 3WLBB 3VH8A 2AV1B 4S0SD 3D0VB 4O2EB 5E03A 3FL7A 3IFPB 2DIBA 1QA9A 4JDZB 1XGPB 3T8XB 3OKDB 1X5JA 4I0PC 3FT2B 1YEJH 5KTEH 1G7MA 5I1EH 1TJIH 4LLWB 1RI8A 4MJ6B 2YD5A 3EZJB 5E0QA 4NC0B 1IC7H 1YEJL 4YHNA 3TBTB 5KTEL 3QT2A 5DD6A 5I1EL 3FTGA 5DO2C 12E8H 1QVOA 1TVHB 4K8RL 4PP2A 4XAKE 1MJJA 2HFTA 3U9PH 1IC7L 5I1IL 4L9LB 3HPJB 3V5KB 3ZDYE 3O9WC 1F11A 4P2QE 12E8L 4PJ8A 4X6CF 5CWSB 3PQYE 4HWBA 5H37G 4WI5A 3LV3A 4L8DB 2E7BA 4XXDA 3G5VA 3K2UH 3B6SA 5J9PA 2UYLA 5DA0B 4Z78B 1NUNB 5ADPH 5IHBA 1QSVA 2Y7QB 1S9YB 4AJ0A 2EIZB 3K2UL 1AQKH 4ZOAA 4DKAA 5GSRB 5I0DA 4IBLT 1S9VB 2OZ4A 1W0WB 3I02B 3MROB 4JO3H 4JO1H 4IRSA 4WEUD 2IADA 5K9KA 1AQKL 2FHCA 4Q9QH 4XBPA 3V7AG 1PG7H 2HA1A 1KYOJ 4G8GD 4JO3L 4JO1L 4MJ2A 1IQDB 1G84A 4Q9QL 3KG5A 3VXSB 1PG7L 1NFDA 4OD2B 4PJHA 3ARBA 2CH8A 2DTMH 4CNIA 3FFDB 1F3JB 4EI5C 3B5TA 1VCAA 4EI6B 4JFHD 5EN2A 5CEZE 2DTML 4I2XA 4HLZG 4JZNA 3BQUA 4WW2F 2ARWA 4XPHH 2QHRH 1RY7B 3CXDH 3KPOB 1I7RB 1CE1H 4NKMA 2VC2H 5IF0B 1G6VK 4XPHL 4LHUB 2QHRL 2Q8BH 5D6CA 3BDYH 1KPUA 1CE1L 2XTJC 4JKKA 1FNSL 3U36A 4TSBH 4RAUB 4TRPH 4TULH 1UCBH 1JTPA 3QG7H 1RPQA 4TSBL 5C0GB 2V5SA 4LP4A 1OAXH 3NPSC 1NCBH 4TULL 3HZKA 3QG7L 5T5FH 2C3VB 2E9JA 3MYZA 2CSPA 1T1WB 4HZAA 1X5ZA 3ULUF 4NN5C 4LSVH 1A4JA 1OAXL 1UJ3B 1NCBL 2IFFH 4GT7A 5F7DA 5T5FL 3IETB 1IGCH 3CX5J 3NCCB 3CDGB 1JGUH 2DTSA 5EWIH 3BP6B 2IFFL 2XI9A 1JVKA 5JHDB 3MLTB 4X6FB 3UTQA 3MBEB 1EMTH 1R5WA 1IGCL 3DECA 3B5HA 2P24B 4MAUL 4P2OD 1WZLA 1JGUL 4CU6A 3MSPA 1U93A 3O2DH 1XF5B 5HGDB 1EFXB 4JFOB 2KBGA 3QQ9D 4R97C 1XFPA 3MV7A 3G5ZA 3IJYA 1WSST 1K4DA 1WBYA 1DBJH 3VFSA 5HHQA 2ITDB 2LU7A 1U3HA 3O2DL 5AAWA 5F9OH 4QTHA 5HVGB 3HR5B 4OUUB 5ICZB 4OCYH 4F7PB 1DBJL 2DD8H 4A6YH 1RJLA 5DTFB 2WQRA 5D7JD 5F9OL 1P53A 5CIPB 1NFIB 1CDUA 1B6DA 2N7BA 4OCYL 2DD8L 3I3EA 1WIPA 2DWDA 4R0LB 4O58H 3D2UB 4G8GE 3I85A 3NVQA 4HX1A 4WWKA 3NPZB 1P7HL 4O58L 1INQB 3HAEH 1ZHBB 4R7DB 4XRCB 3TA3C 3KLHD 3MFFB 2DKSA 2IAMB 4W70A 4HHAB 5D7IE 1NDGA 4KJQD 1NCTA 2A0LD 4JFHE 1MCHA 1JZ7A 1PW3A 3HCVB 1QFWH 1QACA 2WUCH 2BHUA 4ONHB 1WZ1H 5J8OA 4OJFL 1KEGH 3FO0H 3OKLB 3QFJD 4OCWH 5T5NG 1T5XA 1PG7X 3RVUC 1QFWL 1MI5E 2VKWA 2WUCL 4X83A 1WZ1L 4I8DA 2PCPA 3FO0L 1KEGL 1SBSH 4ZAKD 3OJMB 1QLEH 2XOTA 2E9BA 2WINB 4BK4A 1SBSL 2BVPB 3KYNB 4NJ9H 1QLEL 2HWZH 4MDIA 4NOFA 4ACPA 1KLGB 2VZ1A 2P45B 5GZOD 1IT9H 4X8JB 1EUTA 1MCOH 2P8MA 2Z9TA 2HWZL 2R69H 5HYQA 1CXFA 4NHCH 3QIBD 4HLJA 4MD0B 1FL3B 1IT9L 3ARSA 4M7ZB 1AD0A 3UEZA 2FZ3A 4NZRH 4ZPTB 3GJEA 3VH8G 4D94A 5FHAH 1OLZA 4NHCL 2VDLH 4QOKA 2AEQH 4PJFE 4NZRL 3D9AH 3V6OE 5EZJA 2FX9H 4LCUB 4PRID 4O5LH 5I17B 4NZJA 3ARFA 2VDLL 3B5GA 4RMUA 2JJTC 1YA5A 1V7NH 3C9NA 3D9AL 3PDOB 4WHTB 3QDGD 4Z0XA 2FX9L 4O5LL 4Z8FH 4F9LA 1WGOA 4KQ3H 4UIMA 5HVWA 4XP5L 2NY6C 3AAZB 4P23A 2BNRB 5E5RB 4LVOB 4WY7H 5FO8B 4KQ3L 5EA0H 5I16A 2C3XA 1MCBA 3D3VB 1EDQA 4PJIE 2F5AH 2D0HA 4WY7L 4ERSH 4JY6B 4M4RA 4M6AA 4PPTA 4RGMC 2F5AL 4ERSL 5KZCD 1KPVB 3CH8A 4ZFGH 3IDYB 4P3DB 3LSOB 4X80H 4IRSC 3WXWH 5GGTH 3X14A 1QFHA 4ZFGL 2ZNXA 3ZT5A 3CFKA 1ETZB 5I30H 5BXFB 3WXWL 5IFJA 5GGTL 4AG4H 4HDIA 2OTUB 1FFPA 2KL6A 1CXIA 3W9EA 1K5NB 2NY4B 1JUFB 1KGCD 3ARBC 4ORZC 4CVXA 4ZSOE 5I30L 3DPBA 4M7KH 4AG4L 5KS9F 3QFJE 3TESA 3ETBF 4P2QA 1HWHB 3JWOH 5ICXA 4M7KL 4DVRH 3BQUC 1UXWA 3OJ2C 1YPZF 2D7MA 2OL3A 4WEBL 4G6FB 5GISH 3MV8D 1T0NA 4Y16A 5I9QC 3E3QE 3JWOL 5HYIA 1HHHA 5CJ5A 3KPLA 3U30B 4DVRL 1XIWB 1INEH 4GW1B 4AENA 2PYFA 1KTRL 4XWGH 5GISL 3GUTB 4X6DF 1HIMH 5HYSB 5JA8B 4XHJC 2PETA 1DVFD 3BP4B 2FLRT 2A6DB 2QADB 4XNYH 4FQ2H 2WUBH 1ZLWH 1DUYA 1XGRB 4XWGL 1HIML 5JNYB 3SKNB 1RJYB 3W9DA 1NCAH 4L8BB 4MD4B 1AGFA 3KPNB 4U6YA 4XNYL 2J6EH 2YS4A 4BFBD 4FQ2L 2WUBL 4PG2A 5IQ9B 5C0IA 4NO5A 1GOHA 1NCAL 2GEEA 5KVDH 2C4FU 3BHBB 5DJ2A 2Y06L 1N5AB 4PJ5E 4PRIE 2J6EL 4J6RH 4N5UA 1T0MA 4KV5F 4L3ED 5GGRA 1FJ1A 1TDQA 5KVDL 3HE7A 1GC1L 4M7LH 3U7YL 3OB0H 4J6RL 1LEKA 2NZ9C 2IMMA 5HPMB 3IDJB 4N5ED 2Q76B 5DRNA 1C12A 1SJVA 3ALPA 3RP1A 2EYTB 4M7LL 3SE3C 4JVWA 3RVTD 4KJYA 2O5YH 2N1KA 1AGCB 3RY6C 3C6SB 4W6YB 4F33A 1ES0A 3P0VL 3JWDH 3U7AA 3KPMA 3K2MC 5DRXA 3WJJA 3P77A 1BGXH 5C09B 5HI5C 1DBAH 2AK4A 1QSEB 3JWDL 4HZLB 4ZUTB 3NH7H 4PGZA 4QNPE 5AYUH 1YMMD 3CFJB 2C1OA 3RPIA 3RUGF 3KYAA 2NY2B 3V0WH 5FUOH 1EZVX 3F7PC 3PXHA 1BGXL 5F6HJ 4YBLC 1DBAL 3TZVD 5M7QA 5AYUL 1ITBB 3V0WL 3QEGH 5FUOL 1IAKB 1EHAA 3ZHLA 3LEYH 1CN4A 4IMLB 2F74B 4WWKC 4F8TA 1KPRB 3IS1X 3SGDH 3LKPA 3QEGL 1KGCE 4LPCA 1ZGLA 1OD9A 2CIKA 3B83A 3OAUH 3LEYL 5IJVB 1OWRM 5FUCC 4JGJA 3OAUL 5TDPA 2H1PH 5I2IA 4X6CA 1TVDA 1G7IA 2R2HA 5CJXA 1ZT1B 3K7UA 3MUHL 4E42A 3KLDA 3BRGC 3MLUH 4N8PA 4PJ9B 1KCUL 2H1PL 4YDKH 4N0UA 4XCCH 1PKOA 1H3VA 3BZDA 3MLUL 5DDHA 3B9KB 3S97C 3HKFA 3K1DA 1UQSA 4YDKL 4PJXE 4XCCL 1HHIB 1KJ3H 5DJYB 2ESVD 1OAQH 1FG9C 4UB0H 3U0TB 4G8GA 5KSVB 1Q9KA 4M03A 4DGIH 3SPVA 1AKJB 1KJ3L 4OZHF 4JHBA 1YZZA 1OAQL 4H20H 3BZEB 5DZOA 2FYYA 3L3GB 4K94H 5HDQL 4OF8A 4DGIL 2XWTB 3VXSD 5D7IA 4H20L 4L3EE 4KXZI 4RIRA 4K94L 4MJ5A 2V5TA 15C8H 1NAKL 2ZKHL 3KS0H 4DVBB 3RNKB 2WP3O 4U6HA 2Q8AL 1FN4B 1HSAB 3HB3C 15C8L 2WNGA 4XX1E 1MI5A 1IJ9A 4CMHB 4FG6C 2BSSB 1RUAH 4F9LC 4LHUD 1VACA 4NO3B 1X3DA 2V5MA 3IFOB 4RBPH 5J13B 2C1PA 3ECBA 2O61A 3VXUD 4NN7C 3DIFA 4P23C 2FNBA 1U8PA 4D9RD 1YMME 3C6LB 4LCIH 3NIGE 3CXHK 2R9HD 2P7TA 3RUGE 2BOBA 3SDAB 4LCIL 3E6HB 3FB5A 4U1GB 4LVEA 3KYOA 3QCUH 2HT4D 1WBZB 2CD0A 2APTA 1HHKA 1G7LB 5FYJU 4OFPA 3STLA 5I1HH 4NZUL 3INUH 1YEGH 2VLJD 4NKDB 4NDMB 4YWGL 1UH4A 3QCUL 4PJFA 4U1JA 4HJJH 3V6OA 1KCKA 2VQ1A 4P2OA 3KWWA 3GSQA 5I1HL 2AJ3A 4AEEA 1BLNB 2D7OA 5JHDD 3INUL 4MXWH 3MBED 5HI4D 3V4UH 3T4AA 5IKCB 4TSCH 4K3DL 3L3HB 4HJJL 4MJIE 2R29H 3BAEH 2FJGB 1A9EA 4MXWL 3V4UL 2D03H 3N1PC 4TSCL 1JGEB 2NNAB 4FQXA 4BZ1H 3EFFB 4XVTH 2R29L 1U92A 2QEJA 3P4OB 2EKSB 2XACC 5HHOD 2PNDA 3QI9A 2AI0H 2D03L 2AV7B 4L8SA 4BZ1L 2RFXB 5D7JA 3SDDC 4PJIA 4XVTL 1RJZA 4PJEE 4ZS6D 1QG3A 2ESVE 1L0YA 3QDJD 3HFMH 1UC6A 1NKRA 2NR6D 4APQD 2IALA 1H15B 4I5BB 5HY9A 1N5YH 4BSVA 2H41A 2VISA 1BFTA 3IKCB 3H6JA 1N5YL 4FS0A 5DK0B 4XPBH 4Z7NF 1FZOA 4PG2C 3S96B 1MCPH 1T80A 4DZ8A 5I66A 1VENA 4PRNA 3HG1D 3QFJA 3IDNA 5D5MF 2J5LB 3MRNB 4TTDD 5CSZB 1MCPL 3HE7C 4NN6B 1CFSA 5D93C 5GJTL 7CGTA 32C2B 3BIKB 1JV5A 2XKUA 5E5MB 3DX7B 1AXSA 4XP1H 3VXUE 1FL6A 4Z77A 3CLEH 3LRHA 3HNTH 2A83B 4XP1L 1HZHH 3CLEL 2DQFA 2Z8WC 5KG9A 1U91B 4HCRA 3QXAB 2R23A 3QIBA 3PF2A 3HNTL 1F6AB 4AM0A 1HKLH 3K74B 5EBWB 1CGXA 1HZHL 2VLJE 4GO6B 1I3RB 2CLZB 5BVJA 2WAHA 2V7NA 1HKLL 4NO2A 4PJ5A 3VRJA 4I3SL 4FNLH 3KJ6H 5GS1A 4JJHA 25C8L 5JORB 4PLOB 3AM8A 3JTTA 1FG2A 2C7UA 4L4TE 4FNLL 3KJ6L 4PBXA 4QRPA 1TNMA 5D7KD 5DEGA 4M43H 4DW2H 2ZUUA 4JRXB 3I3DA 3DTXA 2JCCE 3MNWA 1MFAH 2F15A 1FH5H 4M43L 5HHOE 5HHNB 4DW2L 3GIZL 3PWLB 1ZVYA 4PJDB 1IEAB 2OLDA 1AO7D 4POUB 1MFAL 1FH5L 5DFTA 4J3SA 5CJXC 1IRAY 2YPKB 3QDJE 5ESQA 3JZ7A 1NGZB 2YD1A 4I1NB 2DLFH 4I0CC 4HPYH 2WIMA 5DMGD 1FC2D 4NC1E 4TQEH 1L9NA 1KIRB 1C5BH 2DLFL 4HPYL 2X4UB 1BFOA 4QRRB 1ADQA 4N8VB 2RCSH 2ID5A 5F3BA 4XNZC 3VXMD 5TF1H 4EUPH 1G6RB 2RCSL 1J10A 4OKVB 3HG1E 1DEEA 1R5IB 3VFVB 2NY4D 3ZYZA 4QF1A 3DUSA 3ZE0E 4HK0A 3PDDA 1J1OH 3UROR 1EHNA 3OHXB 1K4CB 2IFGA 3LEXB 2SEBA 5D7LD 3OR7B 3NCMA 5MEOB 4MA7H 1P7KB 3AY4C 1J1OL 1BFSA 5CD3A 2P5ED 1LD9B 3EZ8A 4G6FD 5CP7B 3G5YB 2IH3B 4MA7L 5H2BB 1E27A 3KPQA 3F5WB 2FHFA 3W11D 4G6MH 4PJXA 2UUDK 2VE6A 2HVJB 5EBMA 5HDLA 4KXZH 4F57H 1MCJA 1T1XA 2OTWB 4PTUA 5C86A 2QADD 4G6ML 4M61B 2NQCA 2KKQA 4F57L 5A16B 5F70A 3RKPA 1J18A 3ULVD 3ZLQC 1UVQB 1M7IA 1NMCC 4Z7VE 3UO1H 2AABH 2D9QB 1OP3K 4W4NA 1LQSR 5ECJE 2IQ9H 5D7KE 5F7KC 1ZANL 2AXFA 1Z9MA 5DMIH 3ME0A 4UDTB 1RK0A 2AABL 5IB1A 3MGOA 3V6OC 4P2OC 2FWOA 2IQ9L 1WBXA 2I25N 4EN3D 4MNQB 5DMIL 1FCCA 1JIBA 1WLHA 1OGAB 4WTXA 4JEGB 3QQ9C 5T1MA 1AO7E 1A0QL 5C6TH 1FORH 3VXNB 3LS4H 4YX2H 3QXDB 4MNGE 4GRLD 1AFVH 4XMPH 5C6TL 2XRAH 5FYLL 1YMMA 1FORL 3LS4L 4JFYA 1DDHA 4YX2L 1ZLSH 3MXVL 4Z7OF 5D7JC 1AFVL 3RUGA 4XMPL 3TZVA 2XRAL 1J8KA 2NY2D 1CBVH 5DJDB 3FN0H 4LAJH 4S1QH 1ZLSL 1QPPA 2PUQT 1U36A 3RWIA 3DV4B 5TDNA 1CBVL 3FN0L 2G5BA 2MQ0A 3VXME 4ZXBB 1KB5L 1A6ZA 3KLHC 4OV5A 4PGJA 5E2WH 5F3HB 2PYED 1IGJA 3EJJX 3C8KB 43CAB 2MSPA 4P99A 4HJGB 1DLHB 2YA0A 4KJQC 4WIQA 3DWTA 4MJIA 2A0LC 2W9EH 4OLYH 3OGCA 1G0DA 4J7RA 1EGJH 2E3VA 3RWEB 4Y19B 1HQRB 4ZOCA 5D7LE 4QY8A 1JZ6A 2XQYG 4X7SH 1G1CA 2W9EL 4OLYL 1YMHB 4GAGH 1EGJL 4LAQH 2P5EE 3QO1A 1ZT4B 4POYA 4X7SL 4LLUB 2QHLA 3RWDB 3DX6B 4ZAKC 5GGRY 2WP3T 4GAGL 4LAQL 4PJEA 3TNNA 2BMKB 2GAZA 1PX3A 5MEQA 2ESVA 3O11A 5I76A 2Z31B 4KFZC 3E3QC 3ZTNL 2GK2A 2V2TA 2VXVH 4HH9A 5BRZD 5GZOC 2WANA 3HI6H 4HUVA 1KJMA 2VXVL 4QEGA 3QIBC 3MPCA 4H5SA 4ODXB 3FQUB 3OAZK 3U4BH 2IH1A 3HI6L 3QXUA 3P9WB 5C0AB 1KB5B 1RZ8A 1N64H 3QISA 3W82A 1OTUC 3U4BL 1HEZB 3R1GH 1YNKH 3UTSE 5GS1C 3FRUA 1N6UA 3MJ7B 3AM8C 3TVMD 4WFFD 4H1LA 1RZGA 3R1GL 1YNKL 2ADGB 1FYTB 5FF6A 4M6ML 4Y5XA 5IOPA 3C5SA 5DFWH 2G9HB 3VXUA 5A2JH 1I1AD 1JRHH 4MB3A 2FJFA 1NSNH 1A4KB 2GK0A 4Z7UB 1EO7A 3DXAD 5D7SH 1AIFA 1JRHL 4ZS7H 3DVGA 1EV2E 1NSNL 3OKEB 3P2TA 4M8QA 3AS2A 5D7SL 5F1KC 3LQZA 3HUJB 4ZS7L 2EE6A 5EULV 1CDHA 4GQ9H 5EU4B 2BHYA 3L1OH 5EOCL 2PYEE 1JHTA 4GQ9L 4LCYA 4L4TA 2FJHB 4GRWE 2AEIT 3T1WA 4YBHA 5IFHH 1LK2A 1TTFA 2DN7A 5EO9B 5IIEA 2Z35B 2JCCA 4PREA 1ZLVH 1U8IA 3V9FA 5IFHL 2FH6A 1KSRA 1JHLH 2AXHA 4FTVD 4FQLH 3VFUB 5HHOA 2EDTA 3DSNA 1FGNH 4ODSL 1I1YB 4KROB 4LCWB 3GSVB 5TF0A 2X7LB 1BOGB 2PXYB 4JKLA 2C4XA 3N1FC 1S78D 1JHLL 1UB6A 1WWCA 4GAYB 3F7YA 1FGNL 5C0EB 2W0KA 5HYJD 4Y5VC 2DLIA 3VFTA 2AJXH 1OB1A 3QDJA 1F2XK 3MV9E 3RL1B 2I9TA 4BH8B 4APQA 3WIHH 1HNFA 2OJEB 1CIUA 2AJXL 5BRZE 5IB2A 1CFNB 1CE6A 2YBRB 5LWYL 1DVFC 4U1IB 3SKOA 3ZKXB 3T3PF 3WIHL 1T20B 4K7PH 4NQXA 3D18A 2RHEA 4Q2ZA 2ICEA 5B39B 2FECI 3M17A 2C9AA 4Y4KB 5JDSA 5K9OA 1HI6B 5FKAB 1QLRA 2Z4QB 5E8EA 3HG1A 3W39B 1Z0MA 3B2VH 1FQ9C 1GIGH 4YPGB 3NCYS 1U8HA 4WFFE 4OQTH 4X99A 5IV2B 4FQHA 4PGCA 2VAJA 3B2VL 1GIGL 4IOFD 3QRGH 4JM2B 1F58H 4ZYKB 2J8OA 4N5EC 1NDMA 4OQTL 4M1CD 3NAAH 3RNQA 4Q6IB 4F8QA 4BQCA 4HXBH 4JR9L 4XX1G 1ZLUH 1J05B 1F58L 1PGRB 3RVTC 4OGXH 1OQOA 3MCLH 5D1QB 2IGFH 4CVUA 4PJCB 5FO7A 1QEWB 5K9JH 2E7CA 3BXNB 2PKDA 3DXAE 4HXBL 1R3HB 1JNLH 3EYUH 4OGXL 3MCLL 1PQZB 1MHEB 2IGFL 1YEDA 4HMCA 5K9JL 4H25B 1KOAA 1HH6A 4XVSH 1JNLL 2QSCH 1N2RB 4WUKH 5KANG 3CSYA 5LAXB 3KDMB 3MUGB 4PB0H 3TZVC 4XVSL 1KN4H 2QSCL 4Z7VA 4WUKL 2M1KA 5INDA 2VUYA 3UC0H 5C0DA 3VXOA 4QYOA 2B4CH 4PB0L 1KN4L 3MYJB 2FBJH 1DQDH 3GKZA 4OM1H 1G7PB 3UC0L 2Z93A 1QP1A 3N0PB 1ZA3A 4S1SH 5F1SA 4HEME 4JRYD 4ALAH 2RR3A 2B4CL 1CD8A 1FFOB 1FIGH 2FBJL 4FTVE 4OM1L 2A6IA 2H8PA 43C9A 4MZ3A 4S1SL 1WTGT 4ALAL 2VWEC 2ZUQC 4UOJA 3BPOB 1FIGL 4PJAE 5IR1A 4GKZB 5HYJE 3L7EB 1MSPA 3LH2H 4AYFA 3MLWL 4BELD 3U9UB 3CXHJ 1DE4A 2PW2B 5E00A 1WVZA 3LH2L 4HKBA 4NP4H 1P4LB 1FAKT 5GS0D 1BZ7B 3QXVA 3V5DA 2DQIH 5ANMB 4RDQG 3QULA 2A73A 5GGSB 5TH2A 4P5MA 4NP4L 5CBEA 5E2TH 4OZFG 4ZUVA 2M2DA 3FCTB 3CDFA 1B0RA 2DQIL 1VESA 1EIBA 5GGVY 4GS7C 5JPNA 5IG7B 4E0RA 3WHE1 1VGKA 3VXMA 5T1LA 5F6HI 5HGAA 4DK6A 4HGKC 2ARJQ 3F62A 2R8SH 2H45A 4URTB 2BCKB 3JUZA 1R3KB 5DMKB 4GRMB 1UH3A 1GGYA 1CD1B 3BRDA 1WFOA 4AL8L 2R8SL 1TZIA 2HVKA 5CBAA 4O9HH 1P5UA 4RMTA 2R0ZH 5JO5B 1AXIB 2P5EA 3SCMB 1JPGA 3IXAA 5IBUG 3R8BB 4O9HL 5EUOB 3WD5H 5GS2H 1ND0B 4Y5XC 3VGDA 1WITA 3WD5L 4RISH 4FFVD 2X4NB 2NY3D 2PW1A 4Z5RA 2WWKO 5D1ZB 2IC2A 1U95A 2FBOJ 5IM7A 2BFVL 1KB9K 1I3VA 1L0QA 2R9HC 3QB7C 4AT6B 4PV8B 4P5KA 5HGBB 1EHLL 2YRPA 2HT4C 3FN9A 2WBJB 3O3UN 1WCBA 3D0LA 1ZWIB 2A1WH 1MAMH 4NHUA 1CD0A 1YN6A 4L4VB 4NUGH 1SMOA 4JRYE 4PLJD 3VDAA 3UTSA 3X12A 3HZYA 4EN3A 5KSBB 4NQCB 2A1WL 2ARJB 5HI4C 4ZUSA 4OCMC 2H32B 4U1SA 5TE6H 5HYFA 4DUVA 1P2CB 3QUZA 3H0TA 1F13A 4FXGB 4P46D 2VR4A 4IS6B 4LCCB 2JK5A 1CLCA 1FLRH 2BJML 5TE6L 4N0YH 5EZIL 3K4ZA 1NGXA 4GRLA 4P4KB 1RZKH 2VDKH 1FLRL 4ZDHA 1UEYA 2GW5A 4N0YL 4KDTA 3QXWA 1YEHH 3K80A 1RZKL 4ZPVA 4K55A 4ZS6C 1XEDA 2VDKL 2YPLB 1MFBH 3AB0B 4HAGA 2NR6C 5D9SB 4APQC 3UTTE 3GB7B 1MFBL 4D0CA 4LSQH 3SEPA 4FQCH 3VXQB 4NC1C 1I1RA 2X41A 1P7QB 1HQ4B 4D0DA 4PLNC 5C2UB 4ZXBD 4M7JH 5EOTB 4LSQL 4IIQB 4RWHA 4FQCL 1GGIH 3HC0B 5MI0B 5CS7A 2MCPH 3L5IA 3MNVA 4M7JL 3MR9B 3EYVB 1GGIL 1TQCC 5DSCA 1NAMA 1ZA6B 1P6FA 3GBMH 3C2AL 4TTDC 2NLJB 1FFNA 5GQBA 2QLVB 4U6XB 2CUMA 4CBPA 3GBML 3B9DA 3QQ4A 1JFQH 2I9LB 1X4ZA 3MCG1 4C4KO 2ED8A 3T0AA 1AI1L 5D2LB 1G9NC 3MV9A 4MA1C 2KQNA 2K3TA 2HT2D 1JFQL 1QKZH 1C5DB 2Z31D 4KAQH 1BBJA 5DD1H 5IVXF 1T3FB 3TYFA 3TH2T 3L95B 5ETUA 2FECL 4NRXB 3QHFH 3T1FB 3HNVH 3QIUA 4OFYA 1QKZL 4XCFH 3L3OA 3GMMA 4RSVA 4GKSB 4JHAH 3QG6A 5J1SC 4ZFZA 5IK3B 3QHFL 2DLEA 3ZYOA 3HNVL 4WU5B 4XCFL 1RK1B 4IHOB 5E2JA 2R0WH 3I6GA 3FQTB 4JHAL 1NBQA 4OGYH 3WEXA 4BSWB 5BQ7A 4N0CD 3IXTA 5AZ2H 1H8OA 3ULUH 1U8OB 2R0WL 3GMLA 4XNXH 5EFIB 5IMMB 1ACYL 1X6NA 2G60H 5I8CA 4XNXL 2EDKA 3ZKMD 1FYTD 1MWAH 1KN2H 3ZE2F 2QQLL 1I1AA 2GCYB 4EXKA 2G60L 3ULSA 1I7TB 4YAQB 1F4AA 1W0VB 5C0CB 1MWAL 3L3KA 2IMNA 1XGUB 1KN2L 3AMKA 1HOCA 1A1NA 2CKBL 2J2ZA 4UI2A 4JFZH 1VEMA 2A74B 2WBKA 3H9HB 1N6QH 4MAYB 4PRBA 5DMGC 1S7XB 4JFZL 1LE5A 1IKNC 2VH5H 4U0RC 2FO1A 3CVIH 3BGFB 3BDBA 2R0LH 2OTPA 4P9HH 3RJDA 1N6QL 3JVGC 3U1SH 2DIJA 1UENA 1B2WH 3CDYA 1H9VA 3CVIL 2R0LL 2EC9U 4P9HL 5LGHH 1D5MA 1II4E 3U1SL 3MRPB 3LN5A 2CLVA 4G6KH 1FL5A 1T21B 5C07D 2L0DA 4FTVA 2NY4C 3LMJH 4G6KL 3CK0H 3QZWA 4PRDA 1MUJB 1FZJB 2CK2A 2YC1B 4PJAA 1S9XB 1FO0L 3LMJL 5HYJA 4M02A 3QWOB 5EZOH 1IL1A 3JV4A 3PWNA 4JFFD 3EO9H 3FT4B 5GJSH 4AIZA 4MHHG 1OCWL 5DJZA 5C71A 5EZOL 1MWAB 4MXVF 3MGTB 3EO9L 1ED3B 2CKBB 2XG4A 5GJSL 1NGYB 4PRPB 1SJEB 3O3EA 1XF3A 5IEHB 3ZE1F 3BEWA 4JFXB 1VKXA 3OX8A 1WTLA 2QADC 2EDHA 4XWOD 4O4YH 3ZDZE 1LDPH 4P48A 5ITBH 3QAZC 2CDGB 1E4KA 4LMQI 4NFDA 3ULVC 1UGNA 3OR6B 3V2AR 1D5XA 1DQJB 4O4YL 4AK1A 3BWUC 5EU5A 4RFEB 5CSGA 1LDPL 3MC0A 3QUYD 5ITBL 4X7TB 2DM3A 3ARGB 4EDXB 2D7TH 1N8ZA 2V9RA 1MJ7H 4JQXA 1EBPA 5IVOA 5I71B 3WFBH 3CFCH 3F6LA 2PO6B 4JM2D 3CMGA 4EN3C 1MJ7L 4BFIB 3FO1A 5DYOB 4XBGA 3CSPA 3ZE2E 1FO0B 1N6VA 3CFCL 4PJGB 2Q86B 3RWGA 1L0XA 3EW3B 3HN3A 4N9GA 3VI4E 1MLCB 4GRLC 4XCYB 1ZE3C 4EKXA 1MVUB 4F7CB 5DD0H 2CK0H 4ZUUB 3GJFA 4M62H 2MQCA 3GSWB 5SWSB 5CGYD 4LGRB 3MNZB 4PYHA 2R1XA 2VXQH 2NTFB 3EO1B 2CK0L 2VZSA 3HLAA 3RDTD 4M62L 3MZGB 4M93C 3E8UH 4BUHA 5E4EB 4Q9CA 2CO6B 3UTOA 2GHWB 1I9JH 5B3NA 4EZMA 4NQVB 1QNZL 4N0FB 4JRYA 3E8UL 4FFWD 5CMAA 3MUY1 3CVHA 3QNZA 5CHNB 1C7TA 3FB6B 3C60D 5J6HA 3JTSB 5EIIA 1FZKB 2KUTA 2F53B 3ABZA 1NBZA 3O4OB 3ARDD 1MELA 4PFEA 3L6FA 4JFFE 3PGDA 3O4LA 1ZHLB 5J06A 4G8FA 3P40A 5JIHA 3T0EB 1WF5A 3RWCB 2IBBA 5TGBB 3BIBX 1JMXA 5CEYA 4RCAA 5E7FA 3VWKB 5GSVA 4NQDD 3UTTA 3MRHA 4QRSA 2AAVA 4WGVB 4LDEB 1MHCB 2P5WB 4NPYA 4NUJB 1G9EA 3HMWH 1EX0A 4XNUH 1YY9D 2WWKT 3QDMB 2R2BB 3NMEA 1R0AH 5C70A 3HMWL 4XNUL 2MNUA 4NO0A 4K9EL 1BF2A 4DZBB 1EHXA 2YRLA 4KRPB 4NNPL 5BZDB 4FFZH 4AQ1B 1YY8A 1QSFB 4GW5A 3TVMC 4NCC2 1S7SB 2V2XB 3QIWA 4JANB 1RZIB 3DVIA 2EDEA 3LKRA 1KTDB 4NT6A 4E41B 3F6IA 2FIRT 4S11A 4LPUA 4Y4FB 1VFAA 3IJSB 5MERB 5ELIA 4ZUWA 1I1AC 5DJ0B 4Y89A 5D1ZD 3DX9A 4HUXB 4CKVX 1ORQB 3WDIA 1H5BB 3CMOL 3VFOB 1AQDA 4JG0H 2ITCA 4F2MA 1Q0YH 2C4FT 4U1GC 4X4YA 2GITA 1SY6A 1KG0B 3L3JA 1XR9B 1M71A 3OKOB 4JG0L 4C57C 5E7BA 2X1PA 1GCFA 1Q0YL 4P5TD 2E9IA 5JA9A 1XH3A 2OI9B 5DR5H 4GMSH 4JPWH 4NQCD 2VKXA 5INCB 4P46A 5SX5K 3RZCD 4F7TB 1UM6L 4MWFA 5JIIA 4BA8A 4GMSL 1A6AA 4JPWL 2UVEA 3QFDA 4JZOA 3QZWG 5FB8B 1ITCA 4GBXD 4YDJA 3WIFB 4CADA 5BS0B 3BWAA 2COQA 2CMRH 1S78C 5DXWA 1K2DB 2IPKA 1TCRB 3OGOE 1IM3B 3DURB 2CMRL 3D85B 2ZG1A 3WL9A 1HXMA 2X5PA 1A1OA 1J8HB 4NQDE 4FABH 1OLLA 3QWQB 1HDMA 2X70B 2XWJA 4H26A 3QUML 4JCLA 4ZOBA 3DVFA 4ORGB 4FABL 2O93L 4M9OA 3AS3A 2X4RA 3V5HA 2EDXA 1AD9B 1U8NA 4YZFF 4ZNEE 5IW1B 4BFEA 1IMHC 2B5IC 4JREB 1E4KC 4P2RD 4Y2OA 4UQ2A 3WHXB 3ZT6A 4Q9RL 1K9TA 3MJ9A 2ATKA 1XCQB 3NA4A 5EC1A 4U1NA 4ELKB 2HJLB 4P9MH 3DYPA 5J3HD 3HE6D 4HWZA 4WNQB 3C09B 4YGAB 4G80A 4IOFC 1S3KL 4P9ML 3LQMA 2EEAA 2ZCKH 4NN6C 4M1CC 4O51B 3OKYA 5DZLA 1FVDB 3G04A 3EUUA 2ZCKL 1FVEA 1A7RH 4NQTA 1N4XH 4I0KA 3CFEA 4NGHH 3MTRA 3E6FA 2GQHA 3QPXH 4CJ0A 4DQOH 2FSEA 1MREH 2DWEB 1RURL 1TPXC 4FRWA 4I0PB 5F72S 5BJTB 5JDJA 5HYEA 1N4XL 3QEQD 5CKGA 3QPXL 3R06A 5ISZE 1UG9A 4DQOL 4JQIL 3LIZH 1A6WH 3QUMB 5IMLA 2BVOB 3PWUB 4OQ1A 2AQ3A 4MCYB 3IAGC 1Q9OA 1CXHA 1ORSB 2NX5D 3LIZL 1IZJA 1WICA 3TJHD 8FABA 4BSJA 1A6WL 3WO3B 4OFDA 1LO2H 2VDMH 2WM0A 1JN6B 3O9WB 4OZ4B 2H9GA 5IB4A 1LO2L 5E8DH 4YNYA 1KC5L 4LGPB 5IUSA 4HK3J 4DEPC 5JPMB 4LEOA 5K9QI 3S88H 2W07A 3MA9H 1Y18A 2W65A 5E8DL 4P57A 6FABH 3S88L 1UKSA 3D69A 3QSKB 3AMLA 4ONFH 1K8DA 2GJZB 4F80A 3MA9L 3MJ8B 1VFBA 1YDPA 5H94B 3ES6B 5I8EB 4ONFL 3KPSD 3VD4A 1JYXA 4R3SA 4B5EA 3O8XA 4HBCH 2DYPA 5DHYA 1KIQA 1WEJH 3CX2A 3FOMA 5GS0C 1LP9B 3FQXA 3I9GH 3WFHB 3UZEA 4LPTA 1CXKA 3PHQA 3L3DA 3FN3A 4HBCL 4NQEB 5AZEH 4FXKA 4YHYC 5BO1L 4EI5B 1FPTL 1MQKH 3I9GL 1IEHA 5EIVA 4HFUH 2EH8H 4ELMB 5AZEL 3WS3A 4P2RE 1MQKL 4MX7B 1J12A 2EH8L 3BO8B 3BPLC 1MCEA 3F12B 3FRPA 4RMRA 1J0ZA 3BZFA 4QRQA 3WDHA 2XG5A 4KKAD 1Z5LB 2XTJB 3Q6FB 2UVFA 1JK8A 1OTTD 3U0WH 4PGEB 4JFFA 2FR4B 1DQMH 5A2KH 1YN7B 5IJKA 1A1MA 2X4OA 3UX9B 3UPRB 2OSLA 1X5HA 3U0WL 2QR0A 3NPSB 1DQML 5EUKA 3P9MA 5E94A 4BZ2H 3BW9B 5ALCH 5BV7C 4FMKA 1YQVH 3QEQE 4PRPD 1G1YA 2JJWA 2DBLH 2NY3C 4BZ2L 1MFCH 2QQQA 2AP2A 3N9GH 5ALCL 1TZHB 1JNNH 4X0KB 1YQVL 2XN9E 4U1KB 2NW2A 5EBGA 5GIRB 2DBLL 4YBQC 1MFCL 1KTLA 2NX5E 3N9GL 2NY1D 2J3SA 5CAYB 4OKDA 1HYSD 4HMEA 1AGDB 3QUYA 1VPOH 1GZQB 4FFYH 1DQQA 4UMGA 4QLRA 4ISVA 4KKBD 4JLRA 4FXLA 3OJDA 1TETL 1JWMB 2P8LA 4R97B 3ARGD 5I1DB 3BFOA 4FFYL 1VPOL 3DUUA 1KT2A 4Z7WE 4OF7A 3B43A 4PLJC 3BUTA 4HG4K 3DVNB 4K3JH 1GH7A 5J1AB 3FO2A 5GGUA 3VXTB 4UNVA 5KVEH 1PY4A 1EVTC 4P46C 4QHLA 4K3JL 3GM0A 3Q2CA 1CICD 3SKMB 4IDLA 2BHZA 3SE8H 5F97E 1OAKH 3EYOA 2HN7A 4KMTH 5L9DH 1U6AH 2M8XA 1W8OA 1BWWA 2Q3AA 3KPRD 4HS6A 3KPSE 3LPWA 2UWEF 3SJVB 2XFXA 4LGSB 2WBWB 3SE8L 4PJ7B 4UNUA 1OAKL 4HUWA 5IEKB 4KMTL 1U6AL 3NCFB 3TA3B 1FBIH 1WK0A 3RDTA 4MNHB 3Q3GB 1BIIB 4AH2A 4S2SB 2I60H 3BPNC 3V0AC 1FBIL 3T08A 5C1MB 4QKXB 4YR6B 1IC5L 2IPUK 3CSGA 2I60L 4NQSA 3T77B 5ESAA 4F9PC 3C5JA 5J11C 1KFAH 2E5EA 3WS6A 2JF1A 1HXYB 3C60A 3EOAB 3PHOB 4R4BA 4JFDD 3D0VA 1V8HA 4R96B 1WIOA 2E7HA 4XH2A 3S4SG 3V6ZA 5DQDH 2QSQA 2VXSH 1XF4B 4GLRI 1KFAL 3ARDA 5CKAA 5LGJB 4KK5D 2EDNA 4HKJB 1IAOB 2BY0A 4KTEH 1Y0LB 3FT2A 5DMYA 1UXSA 4G7YH 5DQDL 1FV1B 5CSBA 3KNBB 2EXYD 1FNHA 4KTEL 3VFWA 4K3EH 4G7YL 5E6ID 2OZ4L 3U6RB 1TVHA 1PKQB 5C0BD 1JWSA 4L8CA 2HT2C 1NCNA 3VH8B 5CZKA 1MOEA 2G5RA 3U46B 1KJ2H 3OMZA 3EKCA 1QA9B 3S7GA 4M48L 3SOBH 2CGRH 4B50A 1KJ2L 1G7MB 5JXED 4JZJA 1PEWA 4ZNEA 3SOBL 2CGRL 3DX8A 4XPFL 4YHNB 5DD6B 1D5IH 3FTGB 4PP2B 4N0CC 2NY6B 2VL5B 1FSKC 1MJJB 1XCTA 1TITA 4XB7A 1TTUA 1D5IL 4A2LA 4PJ8B 5L2KE 3LV3B 4XXDB 4OAWA 3G5VB 5T1DL 3SKUD 1IGYA 3VD7A 4GG6E 3ZKMC 3B6SB 2NXZD 2UYLB 3UBXA 5FOBB 3BJLA 1G9MH 1F3JA 5E4IA 2X05A 3KPRE 4U6TA 4RGMB 2EYRA 1IEBA 4ZO9A 4OZIB 2UWEE 5GGQH 1G9ML 2CO7B 4IRSB 2EE3A 4LU5H 5HDBF 5IT2H 5GGQL 5ISZA 2F8XC 4YDIH 2UY7A 4ODVH 3C5ZD 4MDJA 4LSTH 4LU5L 5L8KB 1GVIA 1MIEH 3W0WD 2ADJB 2XQBL 5IT2L 1NFDB 3DGGA 3LRSA 4PJHB 1NMBH 3ARBB 4LSTL 4P5TA 4UDUA 4LIQH 3L9RA 2XYCA 5L7XL 1NC4A 4ZOEA 5MEPB 4JFDE 3CC5A 3U0PB 1NMBL 1SBBA 5EN2B 3U4EA 1LE9A 3RZCA 4JZNB 3BQUB 1BQSA 2F54E 4F7MB 3W81A 5KVFL 4OGZA 5I9QB 4NKMB 3FJTA 1S7QA 1ZMYA 4OF6A 1WFTA 1CDBA 3FRPG 5D6CB 3CLFL 4RGNE 2MFNA 1VGEH 3U36B 4HKZA 1I3GH 4HMDA 3K3QA 4WUUB 3ELAT 5H8DA 5BS0D 1NAMH 3S9DB 3BP5A 3CCHB 4RFNB 5ID0A 4PUBL 1UT9A 2ADIA 1VGEL 5C0BE 1I3GL 5IJKC 2QQKH 2AERT 4RMWA 5LBSL 4JFOA 5ESVA 2FX7H 4FZ8H 3HZKB 1AC0A 3QA3A 4X9GA 2QQKL 3WKMH 4Z76A 2ITDA 1A4JB 4OBRA 2FX7L 4FZ8L 5F1NA 3OJVC 4NRZA 4HIEA 4XWOC 1CTOA 5EU3A 3WKML 3MMEA 4OLWH 1MHHA 4UV4H 1FNEA 4P2RA 5TJWK 2QKIB 5ERWA 3LKQA 3UTQB 1R5WB 2BNUA 2EEBA 4OZGE 3QUYC 2VQUA 4OLWL 4RAVA 4UV4L 1CQKA 1FAIH 5FA3A 1U93B 5K59E 1XZ0A 2CDEB 1QR1B 1VEPA 4KRMB 3MV7B 4WDIA 3IJYB 4R7DA 3RHWK 4UUJA 1K4DB 1WBYB 3VFSB 1HN1A 3P9LA 1CFBA 4K7FB 3G6AB 4KZEH 2FDBP 4Y5YA 2I27N 4LPYA 1RJLB 2NW3B 1L7IH 1X6LA 4K3GA 4G9FD 4KZEL 1JL8A 4YBLB 2VOTA 3W5MA 3PP3H 4J1UA 3QEQA 1ZEAL 2DWDB 1L7IL 2OP4H 4I0PD 5GRWA 2Q7NA 2XN9A 3W0WE 1FCGA 4HX1B 4WWKB 1LMKA 3PIQB 1I4FA 2L4OA 5CGYC 3O2DA 3H9ZA 4WU7A 2NX5A 4MVBD 1XF2A 2OP4L 4XXCA 3V6BR 3RDTC 2WINA 1OQXA 3AXLA 3MJ6A 4OCSH 2BVPA 3KYNA 2ZSWA 3ZO0A 4U6VH 3KGRA 3KYKL 3I6KA 2UV3A 2KZ1B 4EBQH 5F6IB 4OCSL 4Z7WA 4A6YA 5LCVH 4HUUA 2RB8A 4U6VL 5ILTH 4FFWC 4CVZA 5LKNA 4MD0A 4V1DD 1FL3A 4EBQL 4LARH 3WS6C 3LKOB 3C60C 4PY8I 1OP9A 5LCVL 4K07A 1DL7H 3T4YA 5ILTL 4JFEB 4X9IA 2PCPB 4NYLA 3D5OF 3F7RA 2K7PA 3ARDC 3T09A 4Y88A 4GH7B 3BPOC 2BXYA 4RRPA 1DL7L 5I17A 1RIUL 3RGVD 3HAEA 4M5YH 3GHEH 3KPSA 4ZODA 1VDGA 4MDIB 4EEEA 2FB4L 5E9DD 5TE7L 5F1IB 4XC1L 4M5YL 3GHEL 4TNWK 1F4XH 1T4KA 2CXKA 2P8MB 4Y2DA 5HYQB 1WZMA 3CGTA 1IZKA 5FO8A 1AD0B 2BK8A 4KTYA 4PJDF 4GLRH 3B4NA 3GJEB 3MRBA 2GUOA 5FA4A 1JI1A 4QOKB 4JY6A 5EZJB 1YY9C 3ARFB 1RSFA 1U2CA 4JZJC 3C9NB 4YO0A 4Z0XB 5F89B 4G8EA 1RUKH 4G6JL 2XTJD 4UIMB 1ZXQA 4J12A 1DFBH 4NN7B 4P23B 3KJ4C 3PHSA 1T04A 3JV6B 5BXFA 2E7LA 5I16B 4U1MA 1ULVA 2MOVA 1CQYA 4DK3A 3M8OL 4G9FE 1DFBL 3DYOA 1TVBA 1YEFH 1MCRA 3UBXG 1F3DJ 1F2QA 3U83A 1YEFL 2ZOKA 4RWYH 3SGKA 1RIVH 4U4BA 1RV6X 1LNUA 3ZTJH 3X14B 3FZUD 3VMPA 1W72H 3OG6B 3U4AA 4RWYL 2QQNH 1RIVL 3CFKB 1JZ2A 1L7TH 5IFJB 3MRIA 5HYSA 4HDIB 1W72L 2ZUTA 5F96H 1FFPB 3N1MC 4ODUA 2QQNL 3W9EB 4OM0H 5IBTH 5K33A 1L7TL 5DUML 1KXQE 1OAYL 4P5TC 5JNYA 4V1DE 2D9CA 1IM9B 5F96L 3PUCA 3RIFK 4OM0L 5IBTL 5L2KA 3PQYB 5B8CA 3H9YA 3SDDB 1LEIA 1RQ5A 5ICXB 1CICA 2VN4A 4HT1L 3RZCC 5JLZB 1UXWB 3QJFA 4GG6A 5DC0A 1NBVH 5DJ8A 5IROA 1EK3A 1N5AA 1QO3B 4PTTB 3KPRA 1HHHB 3BRFA 5GGTA 3KPLB 2VITA 4YFEA 1NBVL 2J8UE 4GBXC 2PYFB 3H3KA 3FQNA 1WAAF 2UWEA 5E9DE 1DBBL 3BJ91 1SQ2N 1YC8A 1XF1A 1Z3GH 4XP9H 2I07B 4R8WH 1DUYB 3TO4A 1TLKA 2LFGA 1Z3GL 2VIRA 1H3UA 4XP9L 3W9DB 3WNKA 1MCDA 1AGCA 2BDNH 4U6YB 4R8WL 2P42B 4GAFB 1A7NH 1GOGA 5JOPD 4KTDH 5C0IB 4NO5B 5ALBH 4XBEH 5DJ2B 1BBDH 5DK2A 1Q94A 2BDNL 3KXFD 1A7NL 3RGHA 4I3RH 5C09A 3QQ3A 1T0MB 5GGRB 4JFDA 4KTDL 1QSEA 4HZLA 4LLMA 4XCEA 4XBEL 5ALBL 1BBDL 2ZUXA 3HE7B 3RWFA 4L9DA 5D93B 2EYSA 1DUZA 4I3RL 1LEKB 2F54A 5D96C 5DUPH 5DRNB 1C12B 3ARED 2CPCA 4WV1C 1XGQA 2UUDH 3HE6C 2OXHA 5DUPL 1RUMH 4KJYB 4JM4H 2CIIB 5E6IA 1KPRA 4F33B 2J6EA 1ES0B 3O6FD 1RUML 3KPMB 3MRKB 5DRXB 5C0BA 4MQXD 1MPAH 3P77B 4Y5YC 3KPPA 3L5XH 5IB5A 5IMOA 1X7QA 1EVUA 2XICA 3J7HA 1BAFH 3QUXD 2C1OB 3G6DH 1OP3H 1MPAL 1ZT1A 3WMSA 1AHWC 3FT3A 2QL1A 4RAHA 1BAFL 4LVHC 4ODBD 4PJ9A 5BVPH 4JPVH 3G6DL 3WCYA 3PXJA 2ZOLB 1CXEA 2HJKA 1S5IH 4Y1AE 2PTUA 3OSKA 5BVPL 3KLAA 3IFLH 1ZGLB 3TJHC 2CIKB 4XXCC 2X1XR 4CN1A 2PR4H 2V7HA 1GRWA 3BZEA 5I2IB 1EFQA 2PR4L 1G7IB 1UZ6F 2R2HB 2XPGA 4PJ8D 4E42B 2XWTA 4Z18A 4LDOB 2APVA 3MRFA 1BREA 4QXTA 2YUXA 1RHHA 1DEDA 5TDOA 5I73C 2YWZA 5JW5A 1X5KA 4TNVF 1CFTA 4HIIA 1WAAE 3U48A 1UQSB 1BX2A 4RRPG 2LTQC 4NM4L 5SV3A 3HAEG 3NFSH 4G8GB 4M1DL 3W0WA 4ZFFA 4XNZB 1R3JA 3SPVB 1DSFH 5JOPE 4H0HB 1RU9H 3NFSL 2FYYB 1CVRA 4NO3A 1DLFH 3KXFE 2AJUH 4Y2DC 2X44D 5D7IB 2MMXA 1DSFL 4RIRB 2FD6H 4Z7UF 1DLFL 2AJUL 1S5HA 4R26H 4MJ5B 4HG4J 2ICWA 1DBMH 4YHLH 4KQ4H 4LOUD 2RGSA 2FD6L 4UU9A 5CLTA 1XGYH 4U6HB 4R26L 2ZG3A 2AKRA 3V95A 1DBML 4YHLL 3HUJF 2DLGA 1MI5B 4KQ4L 4KKAC 4BJLA 4S10A 2DMKA 1XGYL 4LSDA 1OTTC 4P59H 1VACB 4K2UH 4HUKB 2QJDA 1DN0A 2C1PB 3ECBB 4QHNA 3DIFB 4P59L 3FONA 1U8PB 4B0MM 2E7LC 3OAZH 1BQUA 3W5NA 4X5WB 2FJGA 1N0LA 2FRGP 1NMCB 2NNAA 4FA8A 3MRGB 3QP3A 2EKSA 3FB5B 4HK3N 3KYOB 5J12C 2IF7A 1NJ9A 3VI3F 3STLB 4QHKJ 3OPZH 3SGKC 3ZKND 1ZVSA 2E6PA 5HHPA 4PJFB 4U1JB 2NY1C 2VQ1B 2VLKE 4P2OB 4HIHA 3KWWB 2Z8SA 3GSQB 4J8RA 2AJ3B 2NZ9D 1O7SA 5F9AC 1HYSC 2XIDA 3S36L 1AJ7H 1EERB 3IRPX 1KULA 3T4AB 4B7LA 4KKBC 2LAAA 3ARGC 3OXSA 5SWZE 4AZ8A 1RZ7H 1AE6H 4X6BB 1AJ7L 2D4DA 1A9EB 5CJOH 4E5XA 1I1FA 1UZ6E 3UMTA 4C56D 1U92B 1RZ7L 1AE6L 5GGVL 4LLQA 1U3HD 2X4QA 4KDVA 4L8SB 4YHMH 4L3AA 1KIUA 5B8CC 5D7JB 1YNTB 4PJIB 1AP2A 2R56H 3HPLB 1CICC 4U05A 2DIAA 3IDIA 4YHML 1LO4L 3MRNA 3EBAA 2R56L 3RBGA 4JM2F 2IALB