3IETA

Crystal structure of 237mab with antigen
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
215
structure length
215
Chain Sequence
IQLTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAEDLGVYFCSQSTHVPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin light chain (IgG2a)
publication title Antibody recognition of a unique tumor-specific glycopeptide antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ietA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ietA01
4OCSL 2CRZA 4XC3H 1PVHA 2YXFA 3SPVB 4LLAA 3HC0B 5LBSH 2J8OA 1WT5C 3QWQB 2ZP0T 3TYGL 2W92A 1QNZL 5KVDL 1WBYA 3HAEB 3O6ML 4TNVF 1PZ5B 3HS0A 3RUGA 5GRZA 3ULSB 5LJYH 3KS0H 3HZKB 1RIUH 2BVEA 4M6NL 3LB6D 1UYWH 4HV8B 4IJ3B 1NAKL 4U6TA 2GSGA 1LEIB 3VXTA 3MRMA 4WENB 1KLUB 1PKQA 2B5IB 2XY2A 4KU1A 4LRIC 4JFQA 3G5ZB 1D6VL 2W0KA 1OD7A 2R4SH 3KJ6L 2DM2A 4XP9L 3F7VB 4NJ9L 4ZYKB 5DSCB 4ONHB 1A0QL 4HC1L 1TNMA 2K1MA 5GGRB 4IRSC 5E2JA 3GBNH 5IV2B 4X7SH 5DMGC 4ZOCA 2IBGA 3BESR 4XNXH 1MCRA 3EFFB 4GS7B 3QZWG 5DD6A 3SBWC 4KPHH 4XWGL 3ARBB 3QHZL 5FOJA 2VQ1A 3TNMB 4P5TA 1IT9H 4KTYA 1QKZL 4KUZL 5I71B 5E8NB 1O0VA 3DUSB 1C5CH 2DMKA 3QUYB 1FFOA 3QNYB 4HS6A 5HYQB 3JV4A 4PV9B 4I5BA 1I1AA 1AI1L 2XKNB 3BN3B 1H3VA 4ZPVB 1LNUB 3BDYL 3H42H 5DD1H 3MRRA 3NPSC 3T4AB 4XP5H 5I8EB 3KNBA 3EOAA 1IGML 4GG6B 1YUHA 3GMQB 3IXAB 1T3FA 1AGFB 5DUPH 5CBAA 4PGDB 2X9XA 4X6CB 1F42A 1SYSB 3MODL 3WNLA 4WW2C 5EPMA 2IG2L 4RMTA 3N1QC 1JHTA 3TT1H 2BJMH 3BKJH 2F5AH 5IQ7L 4FQIH 4NWTH 4AQ1B 3VFNB 3OKKA 3P9LB 5HHOB 4F58H 2FX8L 2IH3A 3P2TA 1VKXB 3RNQA 1KCUL 5GJTL 5B22A 2FGWL 3WDHA 1R5IB 4FQCH 4MHHG 1RZJC 1JZ4A 4H0GA 5DR5L 5DJAA 1S9YB 5IHUL 4PJ9B 4JFED 2R1WB 1QFWI 5J12C 4ZTPH 3D85B 3HZYA 4GXUN 4LNVA 4P59H 2VDRL 3S8WA 4DN3L 4K7FA 1BFSA 1CZ8H 2VKXA 4U1HB 1KXVC 2QQKH 1KYOK 5LWYL 1T80A 4YE4H 4G8FA 3V95A 5KVGH 1U93A 4EOWH 3W0WD 4QGYA 3S7GA 1HYSD 3U7WL 2BX5A 2PTTA 5DVMA 2LTQC 1BM3H 2XQBH 3R4DA 2YOCA 5FCUL 4PJFB 4M6OH 4NQVB 4HUNB 1IEHA 3AROA 5DEFB 5A1AA 2Z93B 4QRSA 4HIXL 1MPAL 3IB4A 4MXVF 3WIFB 2DYPB 4JO2H 1HWHB 4S1SL 1N2RB 1PLGH 2IADA 2JF1A 4X6CE 4CBPA 4K23L 5BJTA 4JFOA 2OS7A 4WCYH 1NH6A 5CUSL 2HJLB 1YDPB 4HAFA 4DKEH 1HHJB 4HIJB 3WIIH 15C8L 4OLXH 3U30C 3PV6A 5F9WC 3FMGH 1ZEAH 4JZJA 3O3EA 1K85A 2H9GB 4K94L 3GRWA 4J4PD 2VLKD 5HHOE 3VDBA 2VXVH 3FB6B 3GHBL 4KRMB 3MGOA 3RP1A 3HR5B 5MENB 4K71C 1LO5B 1F4WH 1FZKB 4Q6YA 5HHXH 3M1BA 4LU5H 4RZCB 3ZL4L 3U36B 5DRXB 5E6YA 2Z8VC 1EJOL 3IS0X 5JW3H 5FK9A 2WZPD 4P5TC 1FC1A 3V5KB 3ZYJA 3LPGA 3IVKB 3EHBD 1I3RB 3PXJA 4HH9B 4S10A 3O45B 3L7FA 1GGTA 3O0RL 3PWNB 4N0FB 2EKSA 4XAWL 1FNGB 5JZ7C 4EUPH 3HI1A 2DQUH 4PYGA 1ITBB 5FM5M 5ID1A 1FAIL 1I1AC 4YXHL 4OZFA 5CLWA 1JFQL 4I77H 4PGCA 4Q9RL 1KBGH 4GAJH 4NDMA 1INQA 4L4TB 4IRZH 2VUYA 4R4BA 5CBEB 4NKQB 2MKWA 2MMXA 1KPVA 4NN7C 4PJFE 1B6DA 3I02A 5ALCL 1IGYB 1DN2A 2E5EA 3TV3L 4IBLT 1GZQB 4GH7B 4K3DH 2Y36H 4H8WL 2DN7A 4MA3A 5TE6L 1NGYB 2ICCA 5FF6B 4YDKL 3TZVA 3IDGB 5GSRB 2VXTH 1H5BB 1V7NL 4KRPC 3QDMB 2D9CA 4I3RL 4H25A 3SDDA 4L29B 2YA0A 3SKUD 1ZHKB 2IFFL 1QRNB 1T6VN 1SYVB 4C58B 4QO1A 3WDIA 1S9WB 1LP9F 4FS0A 1KN4L 2H6PA 3ZT5A 4I18C 4OLYH 2OTPA 3VXPA 5MENE 5E8EA 4Q7DA 5F7DA 4S2SA 1Q72L 4ONGL 5L2JB 4YC2C 3E6FB 3ABZA 4OT1H 5IFJB 1HINL 5IB5A 4FQ2L 4ZUTB 4H20L 4NT6B 2X4SA 3LQMA 3MJ9A 2AXFA 5T3XH 4EUPB 4I0PA 4DVBB 2Q1EA 4FTVB 4I0PD 2DF3A 3TO2B 2CRIA 4OFVA 4N5UA 4RAHA 1ORQA 1EBPA 4K7PX 4Y88A 5HI4D 3DUUB 1BOGA 5B3JE 4W4OA 3QA3B 5DFVD 3L9RA 4U3HA 2ICES 1Z9MA 3D39B 3OKMB 5D7SL 3RKPA 5ADPL 1ZA3B 5D6DA 4LSUH 3V5DB 3CMOL 4L4TE 4Y4HC 2J3SA 3WLWD 1E4XL 1R5VB 1IAOA 5ITBH 1RUMH 4OKVB 3QXUA 1T7YA 3BUTA 4IRJC 1XZ0B 3F8UB 2FGZA 1AIFA 3QAZB 2NXZD 5H35B 1P9MA 1SJVA 5D6CA 3SPVA 5IBLD 2Y07L 2VLJB 6FABL 3HC0A 3QDME 1JTTA 3P9WB 3H3PH 4TNWF 1GC1H 4D9LH 3INUL 2EC9U 1OAZH 3HAEA 4E42B 4NPYB 1QRNE 3ULSA 4JPIB 4DN4H 2BY1A 3HZKA 3U7AA 3JWNC 4HV8A 4X80H 5I1IL 4YXKL 1KELH 5E1AB 1S5IL 1LEIA 3ULUL 4UQ2B 5BMFL 4HWBH 1VEMA 2YS4A 4HJ0C 3TVMD 1KLUA 2P8MB 5MHSD 2BRQA 3KPOB 3TN0B 1BZ9A 5J0BA 3G5ZA 5I18H 4RMUA 5DD3H 1X4YA 4P9HL 3SCMC 2NQCA 2PXYC 5DSCA 2AXJA 4POZC 3NACH 3KLSA 3WYRA 1OAYH 2QSQA 3DGGB 1UH3A 1H3UA 3QFJB 5GS0D 1PYWB 4I1NB 5GGRA 3H9ZA 4FTVE 5DLMH 5EO1B 3U1SL 1EK3A 4OLZL 2AK4B 4TSCL 3TBWA 3EFFA 5ACMA 4GJTB 3ARBA 4F7MB 2GJZB 3D39E 2XA8H 1JV5B 3TNMA 3QUXB 4R97B 3VFTB 4HXAL 5E8NA 5HDLA 4JO4L 1BIIA 4L3EE 4NZRH 3QUYA 2E7MA 3KG5A 4G7VH 4PR5B 3IU3A 1MCSA 5INCB 4EQ2A 3VXNB 1MCWM 1ORSB 4PV9A 2NY6C 3TZVC 2AQ1A 4B7IA 2XKNA 1A47A 3K4AA 4HCRH 4ZPVA 1LNUA 1S9XB 4O4YH 3T4AA 1WFTA 2VLJE 3SDDC 3T77A 2ZG1A 2FBOJ 1V7MH 2R4RH 3ZDYE 1TJGL 4RISH 1U8HB 1XIWB 2J4WH 3DJ9A 4CJ0A 3GMQA 3VD9A 1MREL 3IXAA 4F15B 1AGFA 4XH2B 3NTCH 2VR4A 4R26L 4X6CA 2WLYA 1SYSA 1FC2D 2NY2D 2NY3C 4KZEL 1XGYL 5IBUB 1Q9WB 3QQ4B 3F6IA 4HZLB 1MFAL 5C2BH 1HQRB 1RZFL 5CINL 2HT4D 3WUWG 2CMRH 3VFNA 4IDLA 5FUZH 5FUOH 3P9LA 3HR6A 1KULA 5J3HC 5F7YC 4AEHH 5T3XE 5KJRL 1ZOXA 3NZHL 3QFJE 1VKXA 3P40A 4MNHB 4R8WL 4JQVC 3T65B 4O51A 1M71A 1V5JA 4W4OC 2AK4E 2FHFA 5TQ0L 1S9YA 1KLFA 2R1WA 1RUQH 1MJ7L 4K3EL 2OM5A 3BP4B 4XPFL 5C0BD 3HTLX 4XPGH 3FQTB 3X14B 2ZOKB 4OZIF 1RK1B 1OTTC 1CDBA 4QRPD 1GOFA 4XMLH 4Q9CA 4U1HA 3RX7A 4G9FD 5D7IA 1GZPB 4RAVB 4X4YA 3FAWA 3QG6B 3OAYK 4XRCB 5CLTA 3RWFB 2DQHL 1RQ5A 1PBYA 1AO7B 3V6BR 3B5HA 4D0DB 1DE4B 4PJFA 3LKRA 4NQVA 1CU4H 4YHMH 5DEFA 2Z93A 3HN3A 1N59B 4R90L 2RGSA 2RQ8A 3T0EB 4UILH 4JKKA 4NGHH 3WIFA 2DYPA 1EEYB 3MLSL 3IFNH 1N2RA 1BFOB 4CKVX 4PTTB 4IJ3C 4L4VD 2VRAA 3EJYD 1YECL 4K9EL 2HJLA 1YDPA 1DN0B 4LGRB 4TVPH 1HHJA 2B5IC 3KXFB 4HIJA 2AV7B 3MRGB 1KG0B 1EMTH 5DZLA 2XZAL 4MQ7A 4BZ1L 1UKSA 3U82B 1SJHA 5CP3H 2MCPL 2H9GA 1HQ4A 3QIUC 3NCEB 4MNGB 3FB6A 3DYMA 3Q6FB 4NKIL 5E08H 5MENA 2HG5B 5EU6B 1LO5A 1I7TB 4KRLB 1FZKA 1YJDC 5KSAD 5JW4R 5D72L 4K7PH 4RZCA 1IL1A 4XZUB 5DRXA 5FEBA 4M7ZB 4GS7C 3ARBC 4M62H 4P9MH 5CWSB 4BQ6A 4NM4H 3IVKA 4YQXL 5I71C 1I3RA 3DROA 4HH9A 3O45A 1T0MB 5FO9A 4PJ7A 5GRWA 1RY7B 4QHUB 1NBVL 3MXWL 1FNGA 1OGAD 3QUYC 3DMMD 1E28B 3KYMB 4Q2ZB 3GSOB 2Z35B 1U91A 1JWUB 1AO7E 4L4TA 2Z8RA 2WIIB 5CBEA 1N5AB 4Z7VB 4LPVA 2I27N 2OTUA 3I84A 1IGYA 5F7FA 3SKJH 1GZQA 3FT3A 4HGWB 2EIZA 1EZVY 5EU4A 4G5ZL 3T0EE 1NGYA 2JCCF 4ISVA 5FF6A 2X09A 5DA0B 1NGWB 1VGKB 1OLLA 2WP3T 5GSRA 1H5BA 5HVFB 3QDMA 4DTGL 1HK6A 4L29A 5J6HA 2XN9B 1QRNA 1SYVA 4UTAL 3BE1L 2PUQT 3NZ8B 3C08L 4MNGE 2J12B 1ZS8B 1IAIL 3TJHD 5CSGA 5EU6E 2X4TB 1DQMH 1KF9B 4UI2A 4WTZG 2AGJL 4YHZL 1JRHL 5KS9F 3CFKA 5L2JA 4PJ9C 5IFJA 3JUZA 3JTTA 2ADIB 3RGVA 2WANA 5CJQL 4ZUTA 4NT6A 3RGVD 4DAGH 4R96A 4EUPA 2GKIA 1I1YB 3MO1B 4OCYH 3TO2A 3BVNA 5CHNB 3LOWA 2DQFB 3GMOB 4QGTA 3D39A 3V5DA 1GGBH 5HHMB 4PP1C 4JG0H 2XA3A 1TLKA 4Z7VE 3SKNB 1F58L 1R5VA 3DO3A 4KI5C 4L3EA 4JG1H 3F58H 3PIQA 4L3ED 4PLJC 1XZ0A 2APVA 1QSZA 2ZSWB 2ZPKH 1JGEB 1KTKE 3C6LB 3UTTB 5H35A 3ILPB 4TVPE 1G7MA 2VLJA 1F6AB 3NA9L 5DUBB 1H8SA 1NDMA 3WJLA 5F7HA 3H9HB 4NPYA 1OP9A 2XN9E 2ZCKH 4ZPTB 5I76B 2PO6B 1OQOA 5D7KD 4CN6A 3QCTH 4HK0A 1DQLH 4S1DC 1RIVH 4UT6L 4PRDB 5E1AA 5IWLA 4M00A 1CYGA 2GHWB 4UQ2A 3S36L 2P8MA 5CGYD 3QZWB 3KPOA 1T89C 2CUMA 5HYEA 5EOTB 4YXLL 3QFDA 2APWA 3JWDC 1IGTA 4NO5A 2DKUA 3WFBH 2QQLL 5F7LB 1KPUB 1KCSH 1MH5A 3VXRB 4BQCA 5T3XD 3QFJA 1PYWA 5E2WL 1NUFA 4XP4H 2ZG3A 5EOQL 2WUCH 5EO1A 4LASH 2H32A 3IAQA 3OZ9L 2EDQA 4EI6B 4OIAA 3WCYA 4F7MA 3IXTB 5BV7H 2GJZA 4P2QB 3TFKD 3PNWB 1JV5A 3QUXA 4QRTB 3BEVB 3VFTA 2VLRD 4OSUL 5FGBA 1JHLL 2VDPH 2EEBA 4PR5A 4UMGA 3VXNA 3E3QC 1ORSA 3D2UA 4JE4B 4UTBL 4QXGL 4PJAB 3VJ6B 3D2UD 9CGTA 3UTTE 1H5BC 4AY0A 1I4FB 1RZ7H 1D5XB 4KDTA 1RFDL 1IVLA 2IQAB 2A77H 5K59F 4HIEB 4WFGE 4P4KB 3U9PL 1YYMH 1QO3B 1U8HA 1XIWA 4IOIB 4X7TB 5MP6L 3H9SA 1NLBH 2GT9A 3H9SD 4XH2A 3WD5H 3RUGF 3B9DA 1T5WB 4HWBA 1QBMH 3GNMH 2YRPA 1Q9WA 3QQ4A 1KGCE 4HZLA 1LGVA 1HQRA 2NXYB 3C2AL 4JKPH 3I3EA 2CUIA 1HHGB 2YA2A 5EA0H 4G6JL 4JKWA 3CFIC 3BPNB 4XBPA 1KJVB 2IH1B 3WEXA 1J1PH 3T65A 3D48R 4DZ8A 1QR1A 1NKRA 2BCKB 5F88B 1LEKB 5IROA 3UO1H 5BV7B 1HN1A 5I1KH 1O7SA 3UJTH 3RWHB 3BP4A 4P2QE 2OMBA 5ILTL 3FQTA 1OW0C 1Q9OB 4UNUA 4G6ML 4NN5B 3CX2A 1S5HB 2J7LA 4K3HA 2Z9TA 4RAVA 3QG6A 4J3TA 4DFIA 3W82A 4XRCA 1DDHB 3RWFA 1UQSA 4HCRA 2C1PB 43C9B 4PY8I 3QAZC 4FXGB 4HD9A 4XPAH 1AO7A 3T1FA 2ADFH 3SY0B 4D0DA 1RUAL 1AO7D 3F7RA 2QSCH 4HIHB 3Q6GL 4NQEB 4LVEA 4EBQL 1LEGB 1N59A 3T0EA 4NOFA 4MQXC 1S7RB 3OKOA 3WJJA 3SKMB 4CUCA 1EEYA 4XBGA 1V8HA 2B1HH 1BFOA 2VN4A 1OWRM 4PTTA 4KH2A 4JQXC 5BW7A 3PGCB 4OCXH 1FYHB 1ZHBA 2AV7A 3EGSA 3FN0H 3HI6H 3QI9B 1KG0A 3TN0C 5DJXB 5I15H 2RR3A 4KXZI 2N1KA 1IC7H 3CLEL 3R8QA 4BKLB 3RVUC 1BBJB 4MNGA 3QCUL 1OTSC 5C0AB 3HMWH 2QQNL 2WINB 1KYOJ 3VGBA 2FDBP 4XZUA 2ZG2A 3OAUL 1G9NL 4KQ4H 2I5YL 1A4JA 5CWSA 1YEGH 3TT3L 2OJEB 2VH5H 1L7TL 3GMPB 3QUXC 1JYXA 4OCRL 4R97C 4JO3L 3GBMH 5FGBC 4MMXC 2W59A 4R4NC 1WEJL 1UACL 4Y89A 1KC5L 4M6ML 5D70L 1GGYA 5DT1L 2D03H 5TDOB 4J2XA 4N1HB 2DLEA 1YQVH 4KDVA 5F7NC 3QJFB 2FO1A 3KYMA 3GSOA 3K0WA 2Z35A 1JWUA 3KYAA 4MVBD 4CU7A 1GCFA 3K81A 4U3CA 4Z7VA 1T7ZA 3DETC 3OHXB 1XIWC 4NQEE 4AYFA 4MAUL 1HXMA 4HGWA 2XXCB 1U6AH 3RIAK 5HYSG 2OLDA 1JTPA 3K3QA 2E9JA 1VGKA 3GO1H 1A7PH 4JDTH 3MOAL 1GHFH 1TNNA 4Y4FA 4UOJA 4RFEB 1YNLL 4Y4FD 1RZKC 2OL3H 1XEDA 5CP3A 2P5WA 1OPGL 2FHBA 2XN9A 3ZTNL 2AQ2A 2P5WD 5ERWB 2VTFA 1WZLA 3P30L 4LQFL 3NZ8A 5IB1A 1NBZB 1ZS8A 4XI5C 2AXGB 4KFZC 1FORL 4YFLI 2X4TA 5BRZB 1NAML 3PDDA 4HGKC 3W11D 1RUKH 3QSKB 1SEQH 4FN0A 4PJIB 5FKPB 3ARDB 3UTSE 2ADIA 2RCSL 5KAQF 2K7PA 3GM8A 3ZZ1A 3SGEI 1TZHB 4FNLL 2Q8BH 3AXLB 2GY7B 3UZQA 1N7ML 1F90H 1I1YA 5IMKA 4L8DB 4RGNB 2X44D 1YEKH 5GGTA 2DQFA 2YPLD 1TVHB 3GMOA 1N4XL 2C1OB 4YH6A 3UZVB 5F3BB 4CVZA 1JNNL 3DWTA 3HI5L 5DRZB 3T0EC 3L3IB 1DTUA 1RAMA 3ARXA 1JGEA 3V7MA 4RMRA 1IAII 3LD8B 1IGCL 5BO1L 1PZUB 1D6EB 4TULL 1F6AA 1JRHI 4OZHF 2XZCL 5DUBA 1SBBA 1TPXC 3B2VL 3MA9H 2WW8A 4ZPTA 4L3AA 4ORZC 5I76A 3U4BH 3X3GH 2PO6A 4Y1AB 2NY1D 1YEEL 4PRDA 3BAEH 5AZ2H 4Z8FL 2DKSA 4M7LH 3MTRA 3RVVD 1YEHH 2IGFH 4M7ZC 5BRZE 1UXSB 3QZWA 5DUML 3PP3K 5EOTA 3H8NA 4IMKA 3UDWA 2R1XA 1ADQH 4DGYL 4PJIE 2Q3AA 3BUYB 1KPUA 1HIML 5I74B 3IRZA 5IBTL 4F37K 1T66D 4F9PC 5GHWH 4RGNE 4Y2DD 4XPBL 4MMZC 4EI6A 1IILE 5FFLA 4XXCA 4WTXA 2GUOB 3IXTA 3DRTA 2VR5A 4P2QA 5EOCJ 5H94B 3PNWA 4NKOB 4QRTA 5JHLL 3BEVA 5DMIL 3OJDA 4PJXB 3SQOH 1U8KB 5IVXB 2A6KB 2A6JB 2MOVA 4XMPH 4JFXB 5SV4A 2OTWB 3GSQB 3VJ6A 3K2UL 3NCCB 1J12A 2DLFL 2N56A 3N1GC 1K3IA 4NBXB 4HXBH 1MWAH 5CGTA 3U4AA 2IQAA 3NFNB 4MDIB 4K8RD 5FYLL 3WUWB 4HIEA 2BY0A 2W9EH 5EU3B 3SE8L 3UPRB 5HI3D 1QO3A 2B4CC 4X7TA 3PHOB 3TWCH 4YHIB 1RHHB 4F7PB 1I7ZA 2WAHA 4Y1AE 1LE5B 4QRRB 4X9HA 5F97E 1INEH 1T5WA 3ZHDA 2C3WA 3MXVL 1VERA 3PL6D 1PX4A 2HTKC 1HSAB 1HHGA 1XGPA 3MCKB 5TE4L 4PJGB 4PP2B 1CFTA 3LCYA 3RVXC 3BYTA 1MFCH 4P0DA 1XGUA 3HRPA 1OCWL 4NRYA 3P0YH 1F8TL 4XGZB 4ODHH 1KJVA 2IH1A 4X7CC 3FHQA 3VRLF 5FA4B 2BSTB 4A2LA 3IDMB 2BCKA 3H0TB 5F88A 1LEKA 5CCKH 4NBYB 2Z4QB 3EO9H 3MJ7B 3CVHB 4NQCB 3TJEL 4ERSH 3EJZD 1HXYA 3ZKNC 3RWHA 3RTQB 4PTUA 3T0WA 3MNWB 5E00A 1GGCL 1Q9OA 1DQJB 4GO6B 1S5HA 5I1DA 1OSPH 4PJXE 1CXKA 2YRLA 3MV7D 4ODSH 5E94A 3SE9L 8CGTA 5LXGL 3PGFL 4ZFZA 5IVXE 3MCLH 3MPCA 4LIQH 2C1PA 4ZXBB 3C6LC 43C9A 2EYRB 4FG6D 4FXGA 3OKLB 4N90D 1EEZB 2BERA 1U8IB 1CXIA 3NCJL 2AEIT 4HIHA 2ENSA 4NQEA 2WUBH 3QULB 4GLRI 4N0YL 4NQED 1LEGA 3SN6N 1T03H 4PB0H 2PO6C 1S7RA 4LAQH 3MOBH 3SKMA 1W0VB 1NCDL 4LHUB 5KSVB 4EXPX 2XYCA 4PJ5D 4QRRE 1S7UA 3KWWA 1IAMA 2V2XB 4RGMB 3MLVL 5K9KA 3QI9A 2DI7A 2FBJL 1YMMB 4TPRH 1IM9D 1BJ8A 5DJXA 3QI9D 4IMKC 3UDWC 1P4BL 3MA7B 2X4OB 4PJGE 4BKLA 2MQ3A 5GGQH 1Z9OA 5IW6B 3HZMB 1BBJA 1CF8L 3NIGE 4J12A 1XR8B 5E70A 5L6YL 1QFWH 2I9LB 2WINA 3VE0B 1MEXL 3S6CA 3ESVF 4OD3L 2QR0A 1BP3B 1ONQA 5DZNA 1VA9A 2X89D 2YD4A 4NQCE 5CZVH 2HVKB 4QHKJ 4WU5B 3RU8H 3GMPA 3NIDF 3UTSA 2DM3A 3SE4A 3UTSD 5E56A 4G3YH 4MX7B 1KFAL 2V17L 4XP1L 2I24N 4E9LA 1MRCH 3B9EA 5CEZH 4LQ1A 1CICD 5TDOA 4DEPB 3RDTD 5EG6C 3BZFA 3QJFA 1VFMA 5D7IF 5JW4Q 3S5LG 3THML 2XTJB 5T1DH 2BNUB 3OHXA 3CDCA 1QBLL 1CQYA 4JHZA 1DLFH 4P4KC 3AREB 3QDJB 3MV8E 1QVOB 1XCQA 4ZUUB 4OLVL 3CSYB 4BFBD 2AEQL 2C4FU 3ZYOA 3PE9A 5JPNB 4QYOB 2MFNA 4RFEA 5M7QA 1U92B 1NGQL 3NAAH 2NXYC 3ZKQD 5JIIA 1YMME 4H88H 5GS2H 1MI5E 4L1DA 2AXHA 3C5ZD 5ERWA 5HGDB 4Q9BA 5TQ2H 4Z0XB 2CSPA 1NC4B 1XMWA 2H26B 2DMCA 3BPNC 5I1GL 1NBZA 2ZUVA 1MJUL 4WVRA 4LGPB 1CI5A 5BV7C 3MJ6A 5DJZB 5DD0H 2YD1A 3WFDL 4PRIE 2GTWB 2XACC 4M48H 4PJIA 3ARDA 2XPGB 5JXEA 4NN5C 1B0GB 1TZHA 2B7DT 1RPQA 3AXLA 5GS3A 3T1WA 4CN1A 2Z92A 1U8LB 4L8DA 4LSTL 4O5LH 4LIQE 4RAUB 4PJ7F 1TVHA 3A6BH 3OGCB 2C1OA 1J86A 2LAAA 2CUHA 3HE7B 4J8RB 5JTWA 5B3JF 2I60H 2XTJE 1G0DA 4M43L 4DQOH 4NSKB 1HH9B 4BSJA 4AMKH 3UP1A 2UZYB 1CE1H 4XBEL 4I3SH 2Z31B 3MNVB 3QDJE 5B3NA 2VNCA 5DRZA 5C9JA 3L3IA 1WK0A 1A7NL 4E5XA 4WGVB 1IC5L 1F11B 4YZFE 3C09B 4J3XA 1NFDB 4QWWC 1K8IA 3NA4A 1FZJB 5T5FL 3ROLB 1GGUA 2OL3A 1GAFH 4JY5L 1D6EA 3QI9C 1VEOA 2IPUK 4KHXL 3SHSA 2QADD 1U8JB 3UYRL 5B4MD 3BKMH 1OL0A 4XNYH 4Y1AA 4JRXD 1ZLWK 4YHNB 1GIGH 5JUEH 5T5NF 1OM3L 3BD4A 2BZDA 4AH2B 2AW2A 3AC0A 4LDLB 2VC2H 1UXSA 3BGMB 4MWFB 2OZ4L 4G6KH 4KWUA 3LN9A 2VL5A 5E99H 4DKFH 3AS3A 3HE6D 3BUYA 3G6DH 4PRHD 1TJHH 5IM7A 2NY5H 3GKWH 4FQLL 5TFSH 4LEXH 2M26A 4LLUB 4I4WB 3MLUL 5EZIH 5CEZE 3O6LL 3K1DA 3KYOB 1Q38A 4K2UL 3WSQL 1BJ1H 5AEAA 4WI8A 5K33A 3I50L 2GUOA 1RI8A 5H94A 5I1JH 3GIVB 3LPWA 5C0CD 4NKDB 2GAZB 5KSBB 2DQJL 4PJXA 1P7QB 3FT2A 1A1MA 1LD9B 1MCNA 1T5XB 1U8KA 5IVXA 2A6JA 3RL1B 4JFXA 1DL7L 5C0RH 1WVZA 2OTWA 5EWIL 1Q0YH 2OP4H 1P6AB 1WWWX 3EYOB 4QEGA 3RWEA 1M7IB 3QEGH 4JY6B 3QBTB 1EHNA 1G0XA 1KJ2L 2L7JA 3NFNA 1BJMA 4MDIA 1VACB 2FEDC 5EU3A 4AEEA 3UPRA 5HGAB 2FECL 3PHOA 4HLJA 2PETA 3OR7B 3UTOA 3CK0L 3HPLA 4D0CB 4F7PA 3LQAL 3ZDYF 5DHXB 4EDWH 4QRRA 4JAMB 5E4EB 4OLWL 3SDYH 1EHLL 5D8JL 4G6AD 1HSAA 5GRYA 1ADQA 1LE9B 2VDMH 3MCKA 4PJGA 3ARDC 1UCBH 5JXEC 4MA7H 4UINL 3LS4L 3QUZB 1KXQE 4XGZA 4RGNC 4OCSH 1MIEL 2BSTA 3H0TA 3L5XL 3PF2A 3HUJB 3ZT6A 2Z4QA 3MLTA 3MJ7A 3TYGH 4QF1B 4U05A 5D1XA 1QNZH 5KVDH 3GI8L 4NQCA 3O6MH 1T7WA 4YIQB 1VEPA 5D1XD 4JHWL 1TCRB 3EDEA 4FQXD 4GMSL 3NBNA 4JFDB 4OV6F 4M6NH 4DK6A 5KSBE 2IALB 2ATPB 1NAKH 1S7XA 3VFRB 4MD5A 1S7QB 3DURB 1I3GL 3CD4A 3EKCA 3JWDL 4ZXBA 3LD8C 1MWAA 2EYRA 4RWYL 4ZXBD 3OKLA 1D5ZA 1D6VH 3HLAB 3KJ6H 1LO0L 4XP9H 1Y0LB 4NJ9H 5GZNC 1A0QH 4HC1H 3S35L 5CD5C 3MV8A 1X5KA 3QULA 1F97A 3MV8D 3MNZB 2WLZA 2BNQB 3UBXI 1MFEL 1VCAA 2ZOLB 1W0VA 4H26B 4LHUA 5KSVA 1SVCP 1HEZB 4OLUL 4LHUD 5IIEB 1TJIL 4XWGH 5CAYB 3QHZH 3VI4E 2D7OA 4OQTA 4CMMB 1QKZH 3RWIA 4KUZH 1YMMA 3MBEB 4D9QD 1YMMD 1MI5A 1MJ8L 4FFVD 4O2CB 1MI5D 4ZSOB 1XGTB 1C5DA 5I74C 1XR8A 5L2KB 2K3TA 2R56L 3QDHA 4FFYL 2M1KA 1AI1H 2QL1A 1S9KC 4JRWA 3VE0A 3BDYH 2ZKHL 4YPJA 1NBYB 4PRIA 4F7CB 2E6QA 1U9KA 1IGMH 4PRID 4BSVA 5L9DL 1EDQA 1XR9B 2VB5A 2B39A 4JFDE 4MX7A 5EUOB 1BWWA 3MODH 2FL5B 4KKBC 1T1YB 3I2CL 3HFML 3ZHLA 4GRLB 2IG2H 2OI9B 5HYSB 2DQCL 3CFCL 5IQ7H 3A67L 3K1KC 4PGEA 5GISL 3BQUB 4M5ZL 5D5MB 2XTJD 3RWGB 4PUBL 2BNUA 2FSEB 2FX8H 2JIXB 3QDJA 4MGXA 1KCUH 5GJTH 4ZUUA 3O11B 2FGWH 2CIIB 1EFXD 4KAQH 3CSYA 2BNQE 3VD3A 3ULVD 5DR5H 1HSBB 3MRKB 5I8OL 5F9JA 3CZFA 4CVXB 5IHUH 5JPNA 4WTZA 4AEIL 3W9EA 2VDRH 3GJEB 1U92A 4DN3H 5B8CB 3FB5B 1CVRA 1IGIL 1R3JB 1ZT4B 5HHQB 1XH3B 5HGDA 4ZSOE 5LWYH 1NC4A 2H26A 2YUWA 3C6SB 4I0CC 1QFWM 5L2KE 5CILL 4ODUB 4KJPD 2W07A 2HFFB 3BP6B 3TBTA 3U7WH 5LGHL 4MXQD 3GZKA 4XHQA 3NMEA 5FCUH 2HMIC 3ME0A 1TQBB 3JSSA 2GTWA 3RTQC 3PJSB 1T4KB 1MPAH 4HIXH 4WDIB 1B0GA 2B0SL 5IUSA 4K23H 5EUOE 3I75B 5E8OB 1U8LA 3IETB 4YK4B 5CUSH 5CEZD 1QSFE 1NC2D 4ODTH 3B6SA 3U0TA 5C6WH 15C8H 1T21B 2HT3C 4Q6IB 2X4RB 3OGCA 1U8NB 3HE7A 1Z9LA 4P46B 5FYKU 3KLHC 4K94H 1A7RL 2EDFA 5D5ME 1HH9A 2QHRL 4TRPL 3GHBH 1J1XL 1XGRA 3BPOB 3MNVA 1KV3A 1FVEA 4UQ3B 4Z7VF 3UEZA 3ZL4H 1EJOH 5ACLA 3ROLA 3KHQA 4P2OB 5DJ6B 3KHOA 5JW5B 4DGVL 4PJBF 1P7KB 1A1OB 3TO4B 3O0RH 1BVZA 1U8JA 2O61B 5GS2D 4XAWH 4OCLC 2CDFB 1BD2E 5EZJB 1IC4L 3SDAB 3GB7B 4YHNA 4X6BB 3WBDA 1FAIH 4YXHH 4ZS6C 1JFQH 3C5SB 3U6RB 4Q9RH 2DQDL 4AH2A 3BGMA 3IDNA 1J8HB 4MWFA 5ALCH 3UCRA 4G8EA 3GI9L 4JDZB 3TV3H 4RFNB 1U8MB 4Z7UF 4FQHA 4H8WH 5AUMB 3MLYL 1OSZB 5TE6H 1UT9A 5TDPB 1ZKAA 4YDKH 2DD8L 1W72L 3ZYZA 2W1NA 4I4WA 3GMRA 1V7NH 1RZKL 4C83A 3KYOA 4XP6L 4I3RH 3QXVA 4KK9C 5ESQA 2IFFH 1HHKB 2XTJC 1MUJB 3GIVA 1K4DB 1X5IA 3OTTA 4QNPE 5TGBB 3Q3GB 2GAZA 5KSBA 1MCJA 4U1JB 2QKIB 1KN4H 2C3VB 2JJUA 2VAJA 5IGXL 1BVLA 3AREC 1P7QA 5D4QA 1LD9A 3ILQD 2R9HD 1P7QD 3VRJB 4J3WA 3RL1A 2AJVL 4OAWB 4U1SB 1B0RA 4ONGH 1AGCA 3EYOA 3LKQB 1RV6X 1RJYB 2VLLB 5DRNB 2ITDA 2NMSA 1M7IA 2E9BA 1QHPA 2PW2A 4JY6A 1HINH 1G6VK 4FQ2H 1OQXA 4H20H 1BREA 1VACA 3GEWB 1NKOA 2LU4A 3UYPA 1EZVX 3V0AC 3OR7A 4D0CA 5A16B 1H8NA 3HKFA 4JAMA 2W9DL 3W2DL 3QO0B 4MXQC 4ZOBA 5D7SH 1FFNA 5ADPH 5F93C 1LDPL 4HMDA 3CMOH 4Z7WB 3AUVA 5EB9A 5D7LE 5HVHB 1J8HE 1E4XH 1NEUA 4FQJL 3AAZA 1H3WM 4PS4L 1BQLL 3IDXL 1C16A 2VZUA 1KCRL 3TA3B 4UBDC 2Y07H 5ESVB 5C0FB 2PKDA 1WBZB 4OM1H 5B39G 1JPTL 4QF1A 1YN6B 3INUH 4MJ2A 3HE7C 4YIQA 1TCRA 4LLQB 1PG7W 3CSBA 3VXSB 1MOEA 4JFDA 2VLMD 4JFDD 2A73B 5I1IH 3F7QA 1NFKA 2IALA 2Z31C 4BFGA 4D3CL 2VR9A 3K4DA 1S5IH 2E9WA 3ULUH 5F71A 5BMFH 4PG9B 3C09C 3UJJL 2HTLD 5ISZD 5GPRA 4NUGL 5B38G 2E9IA 3HLAA 1XF3B 4J3OC 4P9HH 1Y0LA 4RQQB 3ESUF 3O8XB 4L9LB 2ESVE 3BRDA 3HMXL 2YMXL 1F3RB 3MNZA 3O6FD 4NRZB 3U1SH 3S3JA 4OLZH 3DO7A 4TSCH 4KTDL 1HEZA 4OBRA 4P2CG 1JHKL 1BEYL 1MHEB 4MNQB 1U42A 4ZMAT 4CMMA 4Z7WE 1N0LA 4HXAH 1MAML 1FDLL 3BHBB 3NABL 4JO4H 2FEEL 1AXTL 3BIBX 4EN3B 2NY0B 5D1ZB 3UC0L 4FMKA 4UV7H 2HLFD 1JZ3A 3BKYL 1XGTA 3QT2A 4AJ0A 1JZ8A 1KCKA 5M94B 5L2KA 2AJSL 4ZTOL 1G7JB 3RI5K 1E6OL 1D3CA 1QEWB 2E7LA 2NW3B 3VFVA 1R6VA 1QSED 1ZT1A 2B4CL 5DJDB 3S5LB 1TJGH 2X1PA 5JIPA 1AHWB 1MREH 3HNSL 5DGRA 1XR9A 3VXSE 2FLBT 4LK4A 4R26H 2FL5A 2MPAL 4WU7B 1T1YA 2EECA 4KZEH 1QSFA 2HT2C 1XGYH 4KKAD 2VDNL 3B5GA 5HYSA 1QSFD 5AAMA 5T1MB 3MRNB 2B1AL 1MFAH 3KVQA 1RZFH 3JXAA 5CINH 1JYWA 4Z77B 5ESAB 3NOIA 4HPOL 4OF7A 3BQUA 4GW1B 4HC1A 5D5MA 4D9RE 3RWGA 2FSEA 1ACYL 1AP2B 3QNXA 5KJRH 3NZHH 4TTDD 4R8WH 3E2HB 3ZKMC 4JM4L 3S36X 2A74B 5TQ0H 1YC7A 5E4EC 4CVXA 1RMFL 4KXZH 1MJ7H 1VB9A 4UB0L 4K3EH 4XPFH 5JMRA 4EI5B 3GJEA 4MNQE 2P24B 4OFDA 4OF5A 5B8CA 1I75A 5FECB 3WL9B 4XTRD 1I7RB 1BD2A 1XH3A 1J1OL 1S78D 3CZJA 1BD2D 5EU7E 4CJ1A 4QRQB 1R5WA 3C6SA 3QUZC 4MB3A 2DQHH 3D25B 5C86A 3ARGB 5DI8B 4ODUA 2HFFA 3BP6A 2FNBA 3DI3B 4APQD 4L8CB 3WKMH 4Z7OF 2ZCHL 4PLKD 3SKOB 4X83A 5CJ5A 3TCXA 2UWEF 4ORGB 2VXQL 1MJJB 4W81A 3TEUA 5IMOB 4R90H 1T4KA 1ZAGA 4WDIA 3MLSH 3H9YA 1A9EB 4UIMB 3KDMB 3I75A 1JIBA 3ULUE 1YECH 1NCAL 4K9EH 1CD8A 3P9MB 1PG7L 3PWJA 4X5XA 1EERB 1T21A 4Q6IA 5JNYB 2XZAH 1KN2L 2X4RA 4BZ1H 1NFIB 1U8NA 2MCPH 4P46A 2WWKO 4J3VA 4X6EB 4ZFFB 5DVKA 3IJYB 4NKIH 1VADB 4O58L 4E41D 4UQ3A 5I17B 5D72H 1HILB 2BDNL 3VMOA 4I9WE 5ENWA 1I8LA 2O5YL 3S9DB 12E8L 3V6FA 2CD0A 4P2OA 1NLDL 2BSRA 5JW5A 4IOSD 4NKMB 1P7KA 1A1OA 4YQXH 3X11B 1KIQA 3MBEC 3TO4A 4P4RB 5KSUB 1CFVL 1NBVH 2O61A 3MXWH 1J0KA 5F8RC 2CDFA 2GJ6B 3SDAA 3DYOA 3UPAA 3SDAD 4X6BA 5L7XL 3VXMA 4NO2A 3VXMD 1PX3A 4G6FD 3C5SA 3U6RA 3GGWB 1JN6B 2Y23A 2Y1VA 4JZNB 1OTUC 1PDKA 1O7VA 5D7LA 1VENA 1J8HA 3KLDA 4HEPG 3SGEH 5D7LD 3M8OL 2W91A 3OXRB 4KV5E 1U8MA 5AUMA 1OSZA 4G5ZH 5DJ0B 2LABA 5TDPA 2SEBB 1FJ1B 3G6AB 3S3PA 4GRLC 2VO5A 2OI9C 1AKJB 4DTGH 4WFEE 5JORB 1KIPB 2FB4L 1W0YT 4HMEA 3ARZA 1HHKA 4Z18A 1MUJA 2WWKT 3BWUC 3S88L 3BQUC 4WI7A 4GG8B 4UTAH 5TGBA 4OTXL 5E8DL 3C08H 2QKIA 1HHIB 4U1JA 1IGFL 5D71L 1RVFL 2EDHA 1IAIH 2G2RA 2AJXL 1FNLA 1PKOA 1WWAX 5HSFA 3RY4A 2DIAA 2AGJH 3BIKB 3VH8G 4YHZH 4C57C 5ETUB 1JRHH 4X6DB 2YD2A 4U1SA 4GBXD 2FHCA 1RJYA 2VLLA 1EVTC 1X5JA 1FL5B 3OX8A 4Q0XL 2NY4C 3FZUC 2Q8AL 5JA9A 5B8CC 5CJQH 4M7JL 2ESVA 2BOBA 2EXYC 3TCLB 1SY6L 2ESVD 4NNPL 1A6PA 1BLNB 4FMFA 1A6UL 2PYED 4CMHB 4IDJL 4ZD3L 4GQ9L 4X0KB 5E9DB 4U4BA 2UY7A 1Q94B 4Z7WA 4X5WB 3DRQB 2ILLA 1TQBC 2XZQL 3DX8B 2ZZUT 1F58H 5BOZG 1HDMB 5F89B 1AR1C 2QBWA 1V3MA 5DURB 4ZODA 2P45B 5IR1B 4JFYA 4BSWB 3QIWB 4FFWD 1OAUL 1A4KB 1QQDB 5E03A 4ZQKB 4UNVA 3BPLB 4YK4C 1CGSL 3TA3A 3CVIH 3TBYB 3OR6B 5ESVA 5C0FA 5I1LB 3NA9H 2FYYB 1WBZA 4Q6IC 1P2CB 2OBGA 3T04D 1YN6A 4P46C 1L6XA 5A2FA 4LLQA 4OFPA 3VXSA 2V9RA 4NZDA 2IANB 3VXSD 5HI5D 5K93A 1ACZA 4JHBA 4UT6H 3BPOC 3VD5A 4I0KA 4JZOA 1NCBL 5BS0B 3S36H 5H37G 5C0ND 4NUJB 4PG9A 1I8LC 5DD5L 1JF5A 3ZDXE 4YXLH 1CIUA 3GJFA 1A22B 4P2OC 1XF3A 2EYTB 2QQLH 1EUTA 2R15A 3HZVB 3MYZA 3O8XA 2V7HB 3P77B 4RQQA 3TO4C 3V4PL 4L9LA 4ELMB 3FO2B 4Y7MA 5E2WH 1IEBB 5FOBB 3K80A 3DV4A 5EOQH 3GIZL 4NRZA 2VAAA 2HWZL 3VXQB 1FO0L 3OZ9H 1Z5LB 4RBPK 3BD3A 2AERT 3EJJX 3WO4B 2EDKA 1BAFL 2ZUXA 4HFWA 4XXDB 5E9DE 4MNQA 4DZBB 1T83A 4IMLB 4MNQD 2PTUA 4LCCB 5C0EA 4KVCL 5K9QI 4D94A 4OSUH 2FWOB 2HJFB 3LRGA 3BHBA 4RFNC 1JHLH 3ET9F 4MCYB 4PFEA 3UAJD 1BQHG 5D1ZA 1M7DA 2Y72A 2DBJA 4LSSL 4QXGH 4UTBH 4V1DD 4YPGB 4N8VG 1QEWA 3RJDA 3VW3L 1RFDH 2NW3A 2RAMA 1N8ZB 3U9PH 4TQEL 4YGVA 5MP6H 1AHWA 4P3CL 3E6HB 5I19L 2IANE 2H45A 4FHBD 1J9CT 4UDUB 4WU7A 3BEWB 2DWDB 4NHUB 4OIIL 3FO0L 3LKNA 5BS0E 5T1MA 3ETBF 2FATL 5E6IB 4AIZB 5KN5A 3C2AH 4UUJB 1DQDL 4DFHA 2D4DA 5DK0B 4GLRH 4Z77A 5ESAA 4NO0D 4GW1A 3L1OL 5C3TA 2HKHH 1TXKA 4G6JH 5IOPA 3RWCA 3G5XB 1AP2A 4GKNB 1MAJA 3DNKA 3U9UB 1IBGL 5EBMB 4V2CB 4ELME 1E4KA 3JUYA 2D0GA 5J9PB 2A74A 4I9WD 4GKZB 2P8PA 2IPKB 1A21A 4N0CD 3KPSD 4OFKA 4OD2B 4KMLB 5ILTH 2P24A 3P0GB 5IT2L 5HVHC 5DJ2B 5KOVC 5FECA 4G6MH 4H8WC 2FX9L 1A64A 1I7RA 2O5XL 5TE7L 3T2NL 5TF0A 4QRQA 1HCVA 3D25A 1RZGB 1GVIA 2HKFL 3ARGA 5D2NB 5DI8A 2GI7A 3TA3C 1IQDB 1GOGA 3ZTJG 5E2UL 3EO1B 5L8KB 3IAPA 2DDQL 4L8CA 4ZOAA 4P57B 3CDFA 3Q6GH 4EBQH 1G7PB 1MJJA 5EZLB 5IMOA 1U3HD 2PCPB 5F21B 1A9EA 4UIMA 5I9QB 3KDMA 3CGTA 3LH2H 2X1WL 5SWZB 3WE6B 3P9MA 1FBIL 5BZDB 3AY4A 4WFED 1NCUA 4OM0L 1HI6B 4AL8L 1TQCB 4G43B 4QHMB 1HH6B 1NFIA 3FN3A 4M93B 3CLEH 3NGBB 3WFCL 4DUXA 4LSVL 3O8XC 4X6EA 4LRNH 4ZFFA 3QCUH 3IAGC 2FZ3A 1VADA 5EO9A 2QQNH 1V3JA 4WI9A 5I17A 1HILA 1NMBL 1FNFA 3OAUH 1G9NH 2I5YH 3BT2L 3ULVF 3TT3H 1T83C 1L7TH 4YZFF 4OCRH 4JO3H 4ODBD 2NR6C 2D7MA 4PRAB 4NKMA 2RFXB 3T2OA 3MJ9L 4P4RA 4YGAB 5KSUA 4Y8AA 4EN3C 2NY0C 4LOUC 5D1ZC 1WEJH 4IS6B 1UACH 1J0JA 5EU7C 1KC5H 4M6MH 5D70H 5DT1H 3WIHL 3RVWD 3KPRE 5D2NE 4LPUA 3AS2A 1JN6A 2HLAB 4JZNA 2WBJD 2N4IA 3STLA 4NP4L 2O26U 5DYOB 3OXRA 4XVJL 1AHWC 4YDJA 4OGAD 5E5RB 1UKTA 5DJ0A 5HYJB 3ULUC 1FJ1A 1DBML 1WITA 3G6AA 3OMZA 5SWZE 3MOAH 1MCKA 2H3NA 1AKJA 1YNLH 4LSPL 1D5MB 5IJKA 3IFOB 1KIPA 1EFQA 2YZ8A 2IAMB 4TYUA 5KANI 1D9KB 1OPGH 2V5MA 3ZTNH 4P9HC 3OAZK 4Z9KB 1TITA 3O3BB 2BRRL 2F9BT 4GG8A 3CXDL 3P30H 4LQFH 3W9DB 1HHIA 3MLWL 4OBSA 3MZGB 3L3JB 4J6RL 1FORH 4PREB 4M5YL 1S7VB 3TBSB 3VG0L 4KGLA 2UUDK 1P53A 3ARUA 3BIKA 4JHAL 4NJAL 4U33A 1NAMH 3CVHL 3LIZL 3FO1B 4JANB 4F9LA 4EI5C 5IHLB 1FL5A 1I7UB 4XAKD 4PRPB 2DTML 2YWZA 2RCSH 4XVUD 5GJSL 5GS0L 2HJKB 2AEWA 3O9WD 4FNLH 1X4ZA 2NZ9C 3KYNB 4NWUL 5E7BA 4XPTL 1BLNA 5FYJD 2X4QA 1AXIB 5EH1A 1A14L 1DBKL 3ARGC 4X0KA 1N4XH 5A2IH 1XT5A 3TIEB 4GRMB 4HQQL 5E9DA 3SDXB 1UWGL 1Q94A 1SBSL 1UCTA 5E9DD 3V7AG 1Y18A 5B39B 4IOFD 1U3YA 4X5WA 3V6OE 3DRQA 3DX8A 3LEVL 5HHNB 3EYVA 4WW1B 3HI5H 4YHOL 4NM8L 4BSWA 3QIWA 5J12B 1QQDA 3M07A 5EBWB 4ZQKA 5BO1H 3QRGL 3AY4C 5IVOA 2KH2B 4UT9L 4TULH 5I1LA 3U48A 2FYYA 2XZCH 1P2CA 3RHWF 4P23C 3B2VH 3D1MC 1J88A 4EVNA 4HUVB 1NCWL 3A6CL 2IANA 1TTFA 3CFDA 2I07A 1IAIM 1MIML 1YEEH 3KPNB 4Z8FH 4P48A 3CPLB 3B83A 4JGUA 1NAMB 5BS0A 2VZ1A 3BI9X 3FT4B 5F9AC 5KSBF 2DICA 2AJUL 4LCWB 5JHDD 4HEME 3ZT7A 1OT2A 5DUMH 1FL6B 3I6LD 4ONOA 3AMLA 5GGSY 4LKXA 2EYTA 4DGYH 1FPTL 2XFXB 4BFEA 4P5MB 1F02I 3HZVA 1QA9B 3P77A 2V7HA 1HIMH 1MCLA 3Q48A 4HS3B 2V5SA 4JFHE 4ELMA 3FO2A 1NCNA 5KVFL 5IBTH 5FOBA 1JGDB 4YFDB 3VXQA 4BJLA 4MAYD 4XPBH 1HOCB 4MSWA 2F53B 2YPVL 3AS1A 3B2UD 4HGMA 3OQ3B 3H3KA 5E0QA 1V05A 3SDXE 3VFWB 4PRNB 1FVCB 4IMLA 1U8PB 5JHLH 1XCTB 5CSBA 4LCCA 2FWOA 5DMIH 4MCYA 3MLZL 5DC0A 5MERB 1I1CA 4KRNA 4Z6AT 5FIEA 1J10A 3K2UH 1CTNA 2DLFH 5I8CB 3LRHA 3MC0A 1A9BB 5DJ8B 2NY7L 2H2SC 2A2QT 5FYLH 2Q7YB 1OVZA 4QOKD 5K9OB 3SE8H 1N8ZA 1KLGB 2RJMA 3S34L 4HF5L 3E6HA 4WJ5B 1LVEA 3NPZB 4UDUA 3B9KB 1FCGA 2DWDA 4NHUA 3KPMB 3BKJL 3L3DB 2F54E 1JPGB 3PWLB 3MXVH 1RUPL 4LCWE 4MJID 2GTZB 2BHYA 3S3SA 5JOPE 1JNJA 4UUJA 4W68A 4F9LC 5DK0A 3GK8L 4NZTL 4F58L 5TE4H 1Q0XL 3P4NA 4PJEF 1JWSB 3G5XA 3U9UA 1OCWH 2JELL 1F8TH 4P2RB 5EBMA 2E8ZA 3MQIA 4I48A 5CJOL 4R9HA 4U6VL 2Y7QB 3IRPX 4CMHC 5EORL 1RSFA 4Y5XA 4NC2B 5ID0A 1Q9LA 2IPKA 4JFZL 2WBKA 5KVMC 2XKUA 2W60B 3TJEH 4R3SB 1JUFA 2F53E 1OAXL 3O6KL 4OD2A 5GZOC 1BX2B 4ETQB 5DJ2A 3F65A 1GGCH 3VWKC 4GKSB 4U7MA 3IJSB 3QXTA 3SE9H 5LXGH 3PGFH 1QBAA 4YC2B 3QIWC 1IKFL 2ED9A 1FV1B 2MQ0A 3KPRA 3OJVC 4ODWB 3KPRD 5BCAA 3BPLC 5D2NA 5HD8C 1W2KT 2P49B 2X4UB 3EO1A 5IB2B 2FRGP 1EHXA 3NCJH 1F4XL 2PF6A 4P57A 3EDFA 4YHPB 4N0YH 5EZLA 3MUY1 4LLMA 4JM2B 4KK8C 3BN9C 1I8IB 1NCDH 4UIKL 1A6ZB 1A6WL 5SWZA 4R0LB 4B0MM 3WIIL 3WE6A 3QNZB 3BW9B 1NUNB 4OLXL 4U6HA 5BZDA 1G7QB 2JJSA 3MLVH 2FBJH 1PFCA 5FYKD 3EYSL 4XWOD 1ZLVH 3QEQD 4QHMA 1HH6A 4IRJB 1P4BH 1IRAY 3KPLB 1CF8H 2J6EL 5E4IA 4LAJH 4Q58C 1KENL 4WWKB 5L6YH 3KPPB 2UYLB 2GITB 4P2RE 1WF5A 4OV5B 5D5MF 1MEXH 2WNGA 4GW5B 4OD3H 3TYFB 3WO4C 3UTPE 1E4JA 2ZCLL 2CO6B 3FQUB 2APFA 3BZ4B 1OP3K 1LQSR 2DJUA 1AR2A 4LCCC 4PRAA 1BWMA 1ZWIA 5JMOC 1KFAH 2V17H 4FXKB 4XP1H 4IS6A 4RNRB 4LRIA 1XF2B 3FFCA 1J7VR 4DGIL 4BUHA 4YJZL 3FFCD 3THMH 1IM3B 1KJMB 3PQYB 5F7MC 3V6OA 5FYLE 1NMCB 3FAXA 3O2VL 4KKCC 4K3DL 1QBLH 1M1SA 4IRSD 5FGSA 2RBLA 3MOQA 4OLVH 5DMGD 3CDYA 3ALWA 1KCLA 5SV3A 4JN1L 4X9BA 2AEQH 3HB3C 4NZUL 2VZSA 4Z0BL 2KBGA 5KW9L 4WUUD 3CFJB 3V8CA 3VH8B 4OUUA 1WCBA 3UYOD 3DIFB 1D5MA 5E6IC 5H37H 3CDGB 1NGQH 3IFOA 2IAMA 2DI8A 1MY7A 1D9KA 3RY5A 2VDOL 5FA3B 3S35X 4LLDB 4IIQB 3U83A 3O3BA 5KG9B 1K2DB 4POUB 4KROB 3W9DA 5I1GH 5H2BB 3L3JA 2CR6A 3HA0A 2ORBH 4PREA 4F7EB 5TPWL 4QNPF 1MJUH 4CN4A 3MRDA 3EDKA 2VQUA 1CGWA 3F62A 4ACPA 3QUML 2VABB 3GHEL 5A3IC 3FO1A 4JANA 3WFDH 5HYFA 5D1QC 4L8SB 2IJ0C 4XX1G 4WW2A 2NY3B 4GSDL 3I9GL 5E8PB 3MUGA 2XKSA 4N9GB 4LSTH 3IGAB 3VGGA 1F6LL 2BOCB 4J3UA 4TUJB 3DXAB 4LHJB 5D2NC 3RQ3A 1KT2A 3TIEA 3SDXA 1UENA 3QDGB 1T22B 3PQYE 4M43H 1WIOA 5IP4A 4EZMA 5HHNA 1U8OA 3IDIB 4GW4A 4WW1A 1OB1B 4XBEH 3U4EA 5FXCH 1A7NH 1I9JL 2NX5B 2R23A 3FQRB 4QXWA 1IC5H 3REVA 3UPCA 5J1TC 5I9QC 3G9AB 5EBWA 2NW2B 4BA8A 5JOEA 4XVSL 5T5FH 2WMPA 5DMKB 4JY5H 5CZXC 4QY8B 4KHXH 1TQCC 4FXLA 3ARFB 3UYRH 4M93C 2EIDA 1NEZG 3NGBC 1BOYA 3O81A 3KPNA 1TVBB 2CKNA 1OM3H 3LN5B 3CPLA 3PP3H 4LPYA 1NAMA 2F54A 2NZIA 4HUWA 3FT4A 4Q9QL 1QFOA 4LCWA 2F54D 2Z0BA 3AVEA 1GRWA 3T3MF 2OZ4H 3FONB 4KJQC 1FL6A 1QLFB 1MSPA 4UV4H 1K4CB 4PJCE 4KGJA 1JJUA 2XFXA 1WBXA 1QA9A 1MQKL 4HS3A 3RIFF 4FQLH 4RSVA 5DLML 3MLUH 3O6LH 4NC1E 5C09A 1FE8L 3ZE2F 4K2UH 3WSQH 1KTLB 1P84K 5C09D 1HOCA 1WIUA 2EDNA 4ZO6A 3DXAE 2EC9T 3QIUB 4N8VB 2F53A 3I50H 5DK2B 1D5IL 2VL4A 3V6OC 1XF4A 3VFWA 1FVCA 3FRPG 1AGBB 1H3PL 1XCTA 3QDGE 3BDBA 2OXHA 5I30L 4WO4B 5DWUL 1EAPB 4NYLB 3VFUB 1UFUA 2FJHB 5AYQA 4G9DA 32C2B 4Z7WF 2NX5E 1DL7H 3WNPA 5EWIH 2AJZB 5CKAA 5I8CA 4P5TD 5A43C 1A9BA 5DJ8A 3GSRA 2FCBA 5TH2B 1KJ2H 2IAMC 1FNEB 4PY7A 1D9KC 4N0UE 3IS1X 1CFNB 1U95B 5JZ7D 1VESA 4FZ8L 1KLGA 1I1AD 1G0YR 3CK0H 4WJ5A 3LQAH 1WFUA 5KANG 3VFPB 1JYVA 5AG8A 3B9KA 4F7TB 3KPMA 5AG9A 1DCLA 4CW1B 3L3DA 1G9NC 4OLWH 1FCCA 1JBJA 2AEPL 2GTZA 1EHLH 4M6AA 1CFSA 1ZA6B 4NFCA 5D8JH 4YR6A 1PQZB 4HKJB 2F8XC 5DMYA 5F6HI 5BVJB 2AKRA 1E4WL 3SJVB 4UINH 3LS4H 4P2RA 1MQ8A 1X5XA 2EDDA 4KRPD 4OQ1A 2UV3A 4TUOB 4P2RD 1FNSL 5F6HJ 5CJXA 1MIEH 2FLRT 3L5XH 2X10A 2GCYB 3D0VB 1HZHL 3UTPD 1FGVL 2W60A 3DVFA 3GI8H 4JHWH 3GSXB 2VZTA 1BX2A 3AU1B 4I18A 4ETQA 3C8KB 3RJQB 1UZ6F 4XMKL 2H2PC 1C12B 5F7KC 3ZLQC 3IJSA 3T2PA 3QPQC 5KBNC 3U2SB 4GAGL 1KB5L 4M7LT 1FV1A 4ODWA 3W39B 3NIFF 5HHPB 4Z76A 1I3GH 3JWDH 3BDXA 4L8BB 4C59B 4RWYH 4NFBA 4DOHB 2YD3A 1KJ2B 2X4UA 1LO0H 5IB2A 3UTZB 3DX6B 1QPXA 3S35H 2CK0L 4U1KB 1YY8B 2D31B 4JM2A 2R0WL 1SQ2N 3CAFA 1MFEH 4HKXB 4AZ8A 1I8IA 3DV6B 1IJ9A 2UVFA 1G7HA 4OLUH 1TJIH 4Y4HA 1X3DA 4R0LA 2XRAL 4MD4B 4Y4HD 1BGXL 3QNZA 3BW9A 3DUHA 4C56A 1PJ9A 4GG6E 4YHYB 4C56D 4HX1B 4RDQF 5JR1L 4IRJA 3UBXA 1MJ8H 2JB6B 4IRJD 3KPLA 4Z95L 3BPCB 1S3KL 5I16A 2P1YA 5E08L 2DQIL 3SJVE 1FYTB 1ZLSL 2R56H 4FFYH 1A3RL 3KPPA 2GITA 1VFAB 5K9JL 5F9DC 4GW5A 3TYFA 4ZAKB 3TBVB 1RULL 2ZKHH 1QG3A 4K3GA 3FQUA 1ZVHA 3BZ4A 5L9DH 5T1LA 3EYFB 2V2WA 5T1LD 5FKAB 4OGYL 1FVDB 2CXKA 3BH9B 3I2CH 4C54A 5C6TL 4HJ0D 2ICEB 1MVUB 3SOBL 1XF2A 4TOYL 2DQCH 3IKCB 3CFCH 1AE6L 5GGTL 3A67H 3SCMA 2PXYA 3L3KB 2WWMC 3SCMD 2W9LA 1IM3A 2PXYD 2YD9A 5GISH 4DOHE 4M5ZH 4POZD 2BNRB 4PD4K 1WUNT 4PUBH 1K9TA 2Y6SC 3VFSB 5I2IB 4Y16B 1CGVA 2YUVA 2GIYA 4KV5F 4PJHF 2XOTA 3B9KC 4J3SA 5I8OH 1NCCL 2EDLA 5IJVB 2OSLB 3CFJA 3VH8A 4AEIH 2R2BA 2YC1B 5LCVL 1JPFA 1CGTA 3CDGA 4KI5E 3VXOA 1G84A 5DF0A 1IGIH 5LAXB 4LLDA 5D9SB 4IIQA 5KG9A 1KIUA 4JREB 2NY6D 3TZVD 3KJ4B 4G8GB 2VERN 5H2BA 1FYTE 1I9RL 4HLZG 2M8XA 5CILH 1U58B 1WFOA 8FABB 5CJXC 3G08B 1CDHA 1IEAB 3SDDD 5LGHH 4OFYA 2CRYA 4U0RB 2MHAB 4OFYD 4S1QL 2VABA 1ZMYA 4PJCA 1F00I 1T0NB 3L3GA 4L8SA 1U3JA 1FNHA 4XNMB 3FQXA 3QO1B 1NSNL 2C7UB 4OI7A 2CIKB 2B0SH 2NY3D 3QRFM 2DM4A 3IGAA 1JNLL 2BOCA 4TUJA 3DXAA 3MLXL 4N68A 3D3VB 3CSPA 1JI1A 4ZO9A 5C1MB 5J3HD 3QDGA 1T22A 1A7RH 2X42A 2OCFD 4JQVA 2BNRE 2QHRH 3G04B 4TRPH 3IDIA 1J1XH 2ZWLT 1UZ8B 4BH8B 5C08B 4JM2C 2NX5A 3FQRA 4LP4A 5JW4M 3QG7L 1ZHLB 4JPKL 2IFGA 4KKNA 3CH8A 1CLOH 4OF0A 4R0LC 4RX4A 5DMKA 5IVZB 4K8RL 1YNKL 4RX4D 1OTTD 4N0UA 4WRLA 4QY8A 1ZLWH 1J11A 5ICXB 4JFFB 1BJ1J 4HKZA 4QXUL 1UXWB 4Y4KB 3E3QE 5CEYA 4IHOB 1IC4H 4OZGF 3L5WB 3MRLB 4WWKC 5KAQG 5ANMB 5D7JB 1CK0L 3QISA 3GMLB 3LN5A 4Y2OA 5ECJE 3HC3L 1Z0NA 2DQDH 4WFHE 5EZOL 4GAFB 1PZ5A 3BMWA 3BRFA 1QLFA 3GI9H 1K4CA 3OXSB 4CADB 2MJWA 3V52L 3ZDXF 1WGOA 3MLYH 2ADJB 4CNIB 4XP4L 3MRJB 3EZJB 3BRGC 2DD8H 3B43A 3QQ3B 4XHJC 4NQSB 1W72H 3P4OB 1R3HB 1SMAA 1DVFC 1RZKH 4MB4A 4XP6H 3GSWB 4HG4K 3F7VA 3HRZB 3QIUA 4ZYKA 2CH8A 4ONHA 3D3VE 3QIUD 2APTA 5DK2A 4BQ9A 3FN9A 1AGBA 1NMCC 3QHFL 1JK8B 4WO4A 4P3DB 5IV2A 5IGXH 2V5RA 3VFUA 5FDYA 2FJHA 1B6UA 32C2A 3QUKB 5C08E 2AJVH 3ARBD 1PG7X 1UH4A 2AJZA 3IKKA 3DUSA 5D93B 3T0AA 5TH2A 2VUOA 2R69L 1F3JB 1FNEA 1IAKB 2LQRA 3QNYA 3QUYD 2DMBA 5HYQA 4IIQC 1U2HA 3FFDB 5AZEH 3D18B 1G1CA 4KROC 4W6WB 4RMWA 3VFPA 1QBML 5ANME 2W9DH 4F7TA 3W2DH 4NZJA 1UWEL 1LDPH 2GSIB 5I8EA 4CAGA 3OKYA 4CW1A 1G9EA 2OZ4A 4GG6A 3ALXA 1A3QA 4OKDA 4PGDA 1PQZA 4HKJA 5EA0L 3HCVB 4L8SC 1QD0A 3MLRL 1NANH 4FQJH 3MX0A 3KPQB 3SJVA 1TZGL 2ZSVB 4PS4H 3L3HB 1W72B 1BQLH 3IDXH 3SJVD 25C8L 1J1PL 4P5KB 4NC1C 4DUWA 1G6RL 1KCRH 4HIIB 1KEGL 4Y19B 1B4JL 3D0VA 2GCYA 4ELMF 5HHOA 1YY9C 1JPTH 4JRYB 2CK2A 5HHOD 3Q1SL 2DLGA 3TLRA 2KQMA 1N6VA 3GSXA 2DI9A 3AU1A 1F4HA 3C8KA 1X44A 1R24B 1R5IA 1C12A 4WHYG 3E8UL 2J5LC 5J89A 5MEQB 1G1YA 4M4PA 3WUZA 4PJ9A 3U2SA 4JY4B 4X99B 3D85A 4PJ9D 3W39A 4LSRL 4JJHA 3UJJH 3V4VL 5HHPA 3D85D 1P1ZB 4NUGH 3OJMB 4L8BA 3HAEG 2O5ZL 1KJ2A 1RU9L 1B9ZA 4FABL 1B4RA 5D2LB 3WS6A 2AV1B 3RZCB 3ARFC 3HMXH 4U1KA 2HYMA 2YMXH 2Z91B 4WEBL 4KMQA 1JE6A 2D31A 2AI0L 4KTDH 4GXUM 4OGXL 1JHKH 3WHXB 4KKLD 5EC1B 1BEYH 4MD4A 4PP1D 1QUNA 4POYA 3PABB 2YEZB 5DFWH 3VDCA 4KI5D 4OD1L 1MAMH 1FDLH 4HX1A 3RBGA 3NABH 1AXTH 3GMMB 4PLJD 3MV11 4HWEL 2DYPD 1WFNA 3UC0H 2FIRT 3BKYH 5BOPA 4KK5C 5HVGB 2WP3O 1FYTA 3HG1B 2AJSH 4ZTOH 5HDBF 3LHPL 3MLPA 2Y06L 4UDTB 1E6OH 1VFAA 1TPXB 4Q97A 3J7HA 4Y19E 3U0WL 1KOAA 2B4CH 1T1ZB 3N85L 4W4NA 3A0OA 4JRYE 3OL2A 3HR5A 4NO3B 3HNSH 3FRUB 4LDOB 4S1DD 4WO4C 5MEND 2VE6B 5FKAA 5DDHB 3GSVB 3U36A 3O4OB 2MPAH 5ACZB 3V4UL 5IFHL 5GRJL 1T89A 4RA0C 2VDNH 4M1CC 5DVOA 2H1PL 3PWUB 3IKCA 3DVIA 2B1AH 4ZUVB 1JGVL 3V5KA 5DFTA 1HYRC 3WNMA 4HPOH 3PWNA 4N0FA 3QP3A 2BNRA 4DUVA 5D2LE 3JV6B 2BNRD 5E5UB 1A6VH 1ACYH 2B2XH 3VFSA 4B41A 1NQBA 4NCC2 5J56B 4JM4H 1X5AA 3L5HA 5I2IA 4Y16A 3B5TA 4HAGA 2KUTA 5EUKB 3VWJB 1IC1A 1Q9KB 5I1EL 4L4TD 2OSLA 4UB0H 2C4XA 5HHVL 1ES0B 4WHCA 3PWVB 5D9SA 1J1OH 1UM6L 3IDGA 5C07B 1DBAL 3RRQA 2E27L 2ITCB 4Y5VB 3HG1E 3KXFE 3QDMD 4MA8L 3B8SA 3RWJB 3G08A 1ZSDB 1IEAA 1ZHKA 1DLHB 2WK2A 1QRND 2A6IB 1CFQB 2EO9A 3JBG7 2ZCHH 1S9WA 3ARTA 1I8KB 2HFTA 4H1LG 2VXQH 5E5MB 5HGBB 4XNMA 2A1WL 3FKUS 2D7NA 2Q76B 1AD0B 3QO1A 5ITFB 2C7UA 1K3ZA 2CIKA 1AXSB 1NCAH 3MZTA 2XWTB 3E6FA 3JZ7A 1PG7H 5C7XL 1KEML 1KN2H 3D3VA 4Z7NE 3WMSA 4DVBA 4KDWA 3WS6C 4FTVA 5JXAL 5KS9B 3G04A 4FTVD 2ICWI 5F3HB 5L88L 2YKLL 1UVQB 3DUUA 3ZKXB 4O58H 2RB8A 3D9AL 1UZ8A 3QA3A 3LQAC 3N1MC 4Z78B 3K2MC 3BP5B 3OKMA 2BDNH 1ZA3A 1ZHLA 1QACA 3D39D 2ICWJ 4KKLC 4RRPA 4QKXB 1UG9A 2O5YH 3HPJB 12E8H 1OW0A 1NLDH 5IVZA 4OKVA 4YHYC 3OWEA 2UZIL 1YNTB 1CFVH 5BXFB 4YX2L 2BVPB 5KZCB 1UXWA 4Y4KA 4R2GB 3N0PB 4HFUH 3L5WA 3SEPA 5I66B 5L7XH 5ANMA 5MEOB 5DC4B 2HRPL 5L0QB 2VLJD 1JGLL 1WZ1L 2E3VA 1UEMA 1Q1JL 4PB9L 3P3YA 4E42A 4LGSB 4ZAKC 2X1QA 4JPIA 3MFGB 2YA1A 3VD7A 1YEDB 3M8OH 2CLRB 3OXSA 3QDAA 4CADA 1FLRL 4MQXD 5J6GB 1CCZA 1HHHB 4JQXA 4CNIA 2K7QA 4HUXB 1JPST 4NQSA 4MS8C 4OF6A 3TN0A 1R3HA 4WW2F 3TN0D 3GSWA 2FB4H 2QTEA 1X5YA 2AS5M 4EEEA 1FFPB 3DGGA 1E4XI 3RVUD 3S88H 5AWNL 1EIBA 1CWVA 3QFJD 1OTSD 1OF2B 2VITB 4OTXH 3UMTA 5IW3A 5KS9E 4P3DA 1IGFH 2AK4A 1RJCA 5D71H 1RVFH 3SDXF 2AK4D 2AJXH 3LS5L 3QUKA 4PJ8B 4Y16C 2OX5A 3LPFA 1KB9K 5HHME 1I85C 5T5NG 3QUXD 1UA6L 1CTOA 5FGCB 5IMLB 4Q0XH 2Q8AH 2EZ0C 1F3JA 4BFIB 3C9NB 3QB7C 4M7JH 4R4ND 5INCA 3TWCL 1SY6H 1YEJL 1DUYB 4NNPH 1CE6B 3D18A 4JREC 3C5JB 4GXVL 3KJ4C 1H9VA 1A6UH 1S9XA 4U6XB 2ZNWA 4IDJH 2G9HB 4ZD3H 4GQ9H 4RCAA 2ARWA 1T7VA 2GSIA 3DETD 4NCDA 4OQTL 2DL9A 4U0RC 1XIWD 2XZQH 1P84J 3BJ91 2YRZA 3HCVA 5DJCB 1A02N 3N1FC 5HPMB 2QLVB 1OAUH 5J7CC 2ZSVA 3L3HA 4LCUB 4P5KA 4HW6A 4HIIA 5SX5H 4X4XB 3FB8B 1XFPA 4Y19A 4FZEL 3H7LA 4JRYA 3VXRE 2WV3A 4MNHA 4XI5D 4O9HL 1DQTA 3MJ8B 4M1DL 3ZE0F 1CXFA 3I6KB 3MFFB 1NCBH 4JY4A 3BYYA 5DD5H 3X14A 2ZOKA 3X13B 1RK1A 3VD4A 1A6AB 5D2LA 4XNQB 4A6YL 3QPXL 2AV1A 1GZPA 3V4PH 3RZCA 2BXYA 1M7XA 4Y4KC 3G6JB 3GIZH 1WZKA 2JB5L 4PJAE 4TSBL 3ULVL 5T3ZL 2HWZH 1FO0H 5D7JC 5I1AB 1DE4A 3WHXA 1BAFH 1O5DT 4YDVB 1K8DB 5EC1A 5BQ7B 4PY8J 3PABA 4PYHA 4RA3A 1CDYA 2YEZA 4KVCH 2FX7L 3T0ED 4AIXA 3GMMA 3CX5K 4HS6B 2XIDA 4F8QA 2EDTA 5K59E 1DN0A 3HG1A 4BZ2L 3BIAX 4EXKA 4LSSH 1VFOA 3KXFA 3MRGA 3HG1D 3KXFD 2N7BA 5CP7B 5F7EL 1M05B 5EDXA 4JCLA 5GRVL 3KNBB 3DSNA 3EOAB 4CVWA 1YUHB 5CZVL 1ZLVK 4TQEH 2ZJSL 1J05B 2G5RA 3RKDC 3Q6FA 4NO3A 2HG5A 3FRUA 5EU6A 1I7TA 4P3CH 1CLYL 3RNKB 5EU6D 5I19H 5DDHA 4KK6C 1YMHB 3GSVA 3S97C 3T4YB 1QFUL 5ACZA 4WTWA 2DOCA 4OIIH 3FO0H 5J11B 1FNAA 3PWUA 2FATH 5SWSB 1X5HA 1DQDH 4YNYB 3OKKB 1T0MA 1BHGA 5D93C 3SO3B 5HPOA 4QHUA 3L1OH 3HMXA 1RIHL 3JV6A 4F9PA 1ZV5A 3N9GL 3WO3B 1IBGH 5CKGA 2XQYG 1NGXB 1E28A 1FO0B 2VXUL 5IBUG 3SGKA 3G6JE 4Q2ZA 4JFEB 1BQUA 4EJ1C 5DJAB 5EUKA 3VWJA 2WIIA 1Q9KA 1N5AA 1KTDB 1WAAE 4K7FB 4DVRL 4OZ4B 4UZGA 3LY6A 5IT2H 1UM5L 2FX9H 1ES0A 3PWVA 5GGVL 1G9MC 2O5XH 4M3JA 1NGWA 3RVTC 5TE7H 3T2NH 3W0WB 3IDUA 4TVPD 3Q5OA 2ITCA 4Y5VA 35C8L 1QP1A 2HKFH 3QH3B 3RWJA 3IFPB 1ZSDA 5E2UH 1DLHA 3EOBB 4ENEC 3MJGX 1CL7L 2XN9D 2DDQH 2A6IA 3Q5YA 2MNUA 1I8KA 4KVNL 2Y4SA 3WFZA 5HTSA 5E5MA 5HGBA 4KZDL 1LO4L 5C0AE 2Q76A 2HFGL 1AD0A 5ITFA 2VDKL 4PD4J 4JFOB 5J8OA 4KY1L 7FABL 1BIHA 5EN2B 1VGEL 5IFAL 1AXSA 3OKDB 3IDJB 1FBIH 2HTKD 4JZJB 4OM0H 4AL8H 1P4LB 1S8DB 5SWSE 4ZFGL 1JZ6A 2VLKB 1LO3L 5GGVY 3RVXD 3WFCH 4LVHC 3MO1A 4LSVH 5KS9A 1DANU 2EIBA 1Z6JT 1MELA 4WHTB 5CHNA 3RZCC 3BO8B 4JVPA 2WSKA 1UVQA 3MRBB 4GRWF 1LHZA 5E2VL 4FP8L 2UY6A 4TNVK 2DQTL 4JFEE 4H0IA 5CMAB 3ZKND 5FK9B 3HPJA 5HHMD 3BT2H 3SKNA 4KJWC 5GS1B 4JFPB 3I3BA 2R29L 3MJ9H 1GPOL 3HI1B 2BVPA 1MFDL 1X5LA 2ZSWA 5IKCB 3C6LA 3UTTA 4JKLA 3WIHH 3ILPA 3TC9A 3W0WE 3C6LD 3UTTD 5I66A 1JWMB 4NDMB 5CD3B 3RPKA 4MJ6B 4WFGD 3H9HA 2Q86B 1KPVB 2QHLA 4FRWA 1EGJL 3R06B 5DEZA 1YEDA 4NP4H 4XVJH 5J6GA 2PO6D 4MA3B 4XT1C 4OZHB 1HHHA 4X98B 3ZSSA 4PJCF 4HUXA 3O4OC 1DBMH 3D87B 1AH1A 1KGCD 3C8DA 4QHNB 1TETL 4LSPH 5C3LD 3ALPA 1FFPA 3VXRA 2VLKE 4AM0B 1RJZB 5FAAA 3VXRD 2BRRH 2I9TB 2KZWA 3CXDH 1OF2A 2VITA 3RX5A 5C92A 2VZVA 3O2DL 3MLWH 3VGFA 3TGXA 1FIGL 5DQ9B 5F7DB 4J6RH 1RD6A 4M5YH 3SGKC 2V9QA 4HBCL 1H3TA 3VG0H 5F9OL 4JHAH 4S1RL 3VWJC 3CVHH 3LIZH 4P2QD 3DECA 4DW2L 5TJWK 1U41A 3V79C 5IMLA 2DTMH 1PY4A 2IPTL 4MJ5B 5GS0H 4BFIA 4I0PB 1K6QL 2A0LC 4U0QB 5SWQB 4YWGL 4NWUH 1DUYA 1ORQB 4PJAA 4XPTH 3ARSA 3C5JA 1ZLUH 2C9AA 1WC7B 2P46B 1R0AL 3L9RB 1I4FA 1D5XA 4Y5VC 1A14H 1DBKH 4U6XA 1I3UA 2G9HA 4HQQH 5E2TL 1UWGH 1SBSH 4P4KA 4IOIA 5FB8B 4P4KD 1IAOB 1S7WB 1W8OA 3LEVH 4BELD 4HG4J 1DBBL 3WFEL 2NYYC 5DJCA 1MHPL 4YHOH 2NXZB 1AFVL 4OZHE 3H3BC 5DO2C 1AIFB 5IEKB 4LCUA 1JMXA 1MCBA 4YO0B 5D6CB 4X4XA 3QRGH 1J87A 3KPTA 2NXYD 3FB8A 4UT9H 4UOW0 4PBVC 2R2EB 1L4IA 3ZSTA 4WFFE 1NCWH 2D7TL 2E6JA 3A6CH 2VSCA 1YA5A 3MJ8A 1MIMH 3ZKXC 3TVMB 4ELKB 1MLCB 3BD5A 3I6KA 2XT1B 3MFFA 1S7TB 2AJUH 1ZANL 2F19L 1BZ9B 1WICA 5CGMA 3X13A 5CSZB 3V9FA 2BVQB 4TN9A 5T33L 1A6AA 1FPTH 4XNQA 2DJ4A 1SY6A 4N5EC 1MHCB 4RBPH 1DDHA 5KVFH 4R2GC 3G6JA 1KPRB 1X5FA 5HDQL 3TBWB 1ZVSB 1CD1B 1D7FA 2OR8A 3SY0A 5I1AA 5L0QC 4YDVA 3ARWA 1K8DA 1FSKB 2YPVH 1WAAA 1TZIB 5BQ7A 3G5YB 1J0YA 2YN3A 5GGSB 2NLJB 1BIIB 4RGOL 5ALBL 4H1LH 3MLZH 2ERJB 3TPUB 3IU3B 3MBXL 4GG6F 3EYQC 3AFLA 4QWWD 1AGDB 3R1GH 3PGCA 4F37F 4X6CF 3QQ9C 1C1EL 4JKMA 3OBAA 4JPWL 5CP7A 2NY7H 3T77B 1M05A 2IBZY 2EXWC 1Z3GL 3DARA 2A9NL 1NGPL 3PGDB 1T20B 1J05A 4L4JA 5C0AA 3S34H 2EDWA 2NY2B 5C0AD 4HF5H 2MQCA 3RNKA 1F4YL 1CXLA 4HPYH 1T04B 1YMHA 3NN8B 3T4YA 1QR4A 1HCFX 1B2WL 4LSQL 4PJ8C 3EOYG 5MHSE 4BH7B 2OJEA 1RUPH 5SWSA 4DKAA 3T0VA 4YNYA 5SWSD 3FQWB 3GK8H 3WLBB 4NZTH 4YBQC 3VRLE 3W5NA 1Q0XH 1M4KA 4B50A 1NPUA 3CNKA 2JELH 3MGAA 1MRFL 4O51B 1M71B 1NGXA 4KAQL 5CJOH 1FO0A 1C5BL 1IMHC 4U6VH 2HH0L 1JPSL 4JFEA 2E6PA 3MR9B 2CKBL 5EORH 3D6GA 1FRGL 4JFZH 5C0BB 3KYKL 1KTDA 1UWXK 3O6KH 5J13C 1OAXH 3D5OF 3DLQR 2VMFA 4QRPB 4OZ4A 5BVPL 4PGBB 4H1LB 4G9FB 4PJFF 1A2YB 3VMNA 3R0NA 5D7IB 4X4YB 3LEYL 4KI5F 1I9IL 1EJ6A 3W0WA 1IKFH 1IFHL 5DRWB 3QCVL 1JZ5A 3DVGB 2EICA 1J0HA 3QH3A 3TH2T 4CVUA 2KKQA 3IFPA 3MROB 2F74B 2A9ML 5KTEL 3EOBA 3LKRB 2FEDD 2YR3A 4QCIB 1F4XH 2DLIA 3K8LA 2DM7A 3LB6C 2AXGA 4L4VB 2AJYL 4UIKH 5BRZA 1A6WH 5BRZD 5EN2A 4ODTL 3OKDA 4LCIL 5IK3B 3IDJA 2HFEB 4MQ7B 5FKPA 1P4LA 1S8DA 3EYSH 1SJHB 4J4PA 5GRXG 2VLKA 3ARDD 3CC5B 1HQ4B 5JXED 1JF6A 5AAWA 1YPZB 4HT1L 2J6EH 3LMJL 4WHTA 3BO8A 2H8PB 3NCMA 5KSAB 1KENH 4RGND 4WY7L 3MRBA 4TNWK 1IL1B 1X5GA 3K8KA 4X9FA 3NIDE 1A8JH 5F3BA 2ZCLH 5CMAA 3FB7B 5DQJB 5C0BE 5EC2B 2IEPA 5GS1A 3DROB 4JFPA 1SJEB 5FO9B 4QRPE 1CL7I 4RMQA 2IQ9L 4PJ7B 1OGAB 1CR9L 4G9FE 3DMMB 4HJGB 5D7IE 5IKCA 2D7PA 1JWMA 4DGIH 1U91B 5CD3A 4F33B 1FZOB 4FQPA 1QZ1A 4MJ6A 1L0YA 1AD9B 1AC0A 2Q86A 5GZND 2OTUB 5CD5D 3O2VH 2I26N 3R06A 3FT3B 4UOW1 4U6YB 2EIZB 5EU4B 4KQ3L 4URTB 4Y1AD 4ISVB 4OZHA 3OKEB 4JN1H 4L4VE 4X98A 4NZUH 2X5PA 1FAKT 4Z0BH 4BYHA 5KW9H 4QHNA 2DS4A 3OAZH 3HNVL 1ZTXL 5J11C 5J6HB 1DQQB 3ORJA 5CFHA 2VDOH 3SO3C 4WFFD 4AM0A 1RJZA 4LHQB 4MA1B 2I9TA 1T1WB 4HK3N 1KCVL 1N64L 3DVNB 4WUKL 2UUDH 1YPZE 2EIEA 1JZ7A 1N5YL 5DQ9A 5TPWH 3JTSB 5CJ8A 4PJDB 3CFKB 1K5NB 3DSFL 3VDAA 2EE6A 4NKOA 3QUMH 3GHEH 3JWOC 3JTTB 3EAKA 3L5IA 1MCIA 5DS8B 4XNUL 3RGVB 4P49A 1Y6KR 2YBRB 4MJ5A 4YUEL 3AB0B 4GSDH 2E7HA 4R96B 2A6KA 3I9GH 1OGAE 4KKBD 4PJ7E 1BFVL 1VHPA 1WJ3A 5SWQA 3BVNB 3WIHA 3GSQA 1NFDE 3PP4L 2H32H 1WC7A 1HYSC 5IEHB 1T7XA 3WUWA 5FB8A 1L6ZA 3CU1A 1S7WA 4YHIA 4L3EB 4AG4L 3R8BB 1RHHA 3PIQB 1BFTA 4MDJB 2D3VA 1LE5A 1FG2B 1YYLL 3OB8A 2R0LL 5BZWB 1I9JH 5E6ZA 4QRRD 4TUKL 5IEKA 4UNTA 1YN7B 1UEYA 3O2WL 4XVSH 4YO0A 1G7MB 4QXTB 3VI3E 2GW5A 3GSUB 4OM1L 5HDOA 4JZJC 4PP2A 3T08A 2R2EA 1NDMB 4YHLL 1OAQL 4J4PC 3U7YL 1REIA 1KB9J 4J1UB 4OF3A 2HA1A 1FGNL 4HK0B 5FA4A 1L0QA 4HJJL 3IDMA 4LCYB 3TVMA 4ELKA 1MLCA 3GMNB 4X8XA 4UU9B 3H6JA 2HMID 1HNFA 3CVHA 1S7TA 2DBLL 3QUMB 4PJDE 4Q9QH 4NQCD 3RTQA 3QFDB 2J2ZA 1IGTB 3RTQD 3LQZB 4N1EA 4NO5B 3EHBC 5CSZA 3MNWA 1DQJA 2BVQA 4MD0B 5JDSB 1SMOA 5GS1C 4CGTA 1MH5B 3WNKA 1MHCA 1WISA 1MQKH 2H32B 1KPRA 1INDL 1ZVSA 1CD1A 2HT3D 1FE8H 1EEZA 4HHAB 1U8IA 1RK0B 3KLHD 1TZIA 2VLRB 1D5IH 3FO9B 3G5YA 2QV2A 1H3PH 5I30H 5DWUH 5GGSA 2NLJA 4XC1L 4UV7L 3E0GA 3TPUA 3D2UB 3L6FB 1ZT7B 1AGDA 3D69B 2V2XA 4X9GA 2W38A 1SHMA 5I6XB 3MA7A 2X4OA 1GGIL 5IW6A 3HZMA 1J18A 3H9SB 4FZ8H 3PGDA 1T20A 1F5WA 2Q6WB 2GT9B 3EOTL 3UZEA 5D7KE 2P7TB 5F96L 2I9LA 4ZS6D 1T04A 3NN8A 3HUJE 3HC4L 4U3XA 4YHKL 2MTPA 2EO1A 2HVKA 4WU5A 4BH7A 2AEPH 2HRLA 3FQWA 3WLBA 5FHAL 3MGTB 2XG4A 5DXWA 1CDCA 1E4WH 4I0PC 4XBPB 5HI4C 3WEXB 2DB8A 1KJ3L 4DZ8B 4B53A 3Q5TA 5DFVC 1QR1B 3CX5J 5D2LF 2DQEL 1FNSH 2LAGB 4U31A 4KK9D 4RMSA 2EDXA 3MR9A 1HZHH 5D6DC 2RIKA 5C0BA 1FGVH 1UB5B 1EAJA 3BH8B 1SEBB 3WLWC 3PV7A 1WQVT 1OLZA 2VLRE 3AREA 4QRPA 1QVOA 3ARED 4PGBA 3QDJD 4H1LA 3VXUB 1LWRA 1GL4B 4XMKH 4G9FA 4M8VA 1A2YA 2AABL 3JVGA 4OIBA 2EE3A 3CH1B 2VIRB 3ZE1E 1UH2A 1TDQA 4QYOA 1UQSB 4GAGH 2NXZC 1KB5H 4PGZA 5DRWA 4JLRB 5IBLC 1P9MC 1N6QL 3DVGA 2NY4B 3T1FB 1N0XL 2BHZA 3MROA 2F74A 1EPFA 2BVYA 3WKML 4LVNB 4QCIA 1TENA 1ZK9A 3LKPB 4Z0XA 2CK0H 3H9SE 1NC4D 2DTSA 3OKOB 1FZMB 2R0WH 4CDHA 3OB0H 4L4VA 4XBGB 2ARJQ 2ENYA 3TVMC 3IFLL 1BQSA