3P0GB

Structure of a nanobody-stabilized active state of the beta2 adrenoceptor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAASGSIFSINTMGWYRQAPGKQRELVAAIHSGGSTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDYGAVLYEYDYWGQGTQVTVSSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, hydrolase
molecule keywords Beta-2 adrenergic receptor, Lysozyme
publication title Structure of a nanobody-stabilized active state of the b2 adrenoceptor
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2010-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p0gB00
4MNQB 5DJ6A 3ARWA 3O4OC 5IOPB 5ICZA 1OTTC 2VIRB 2CXKA 1Z3GL 2XKUA 1V3LA 3HB3D 1H3UA 3O3AA 4JM4L 5EO0A 4J6RH 1GL4B 4HX1A 1IGCH 1JYWA 4FS0A 1KCUL 3DOSA 4WU5A 4PJDE 2A1WL 4K94L 4FFYH 4PRPD 3IDNA 1QRNE 4ODHL 3VD3A 4LQ1A 5GGTH 1S9WB 1NFDB 2A83A 5E2JA 1MWAA 5EOQL 3CFEA 2H32B 2EYSA 3PG2A 4U3XA 1K5NA 3Q5YA 5DRWB 3JXAA 5I1KL 3DX9A 4GAGH 4X5XA 5CZKA 1AO7A 1YMHB 2H3NB 3SDAB 5BJTA 4B53A 2YD5A 3MZTA 2NY6D 4GBXD 5IFAL 3BJLA 2W65A 2VZ1A 5B38A 3QUZA 2VAJA 5FYJL 3S35L 4QRRD 5TE6H 3QPQD 5HTSA 5JXED 4K3DH 1WWWX 1GJIA 3R8QA 5EWIL 4D3CL 5GGVH 3DVFA 1KIQA 4L4VD 3V4VL 1T5XA 2VTFA 3ZO0A 1IT9H 5CJOH 1MFAH 1GGCL 1MLBB 4UI2A 2B20A 2A9MH 4OLYH 5H35A 1NJ9B 4R97B 3ZHKA 4QOKB 1ONQA 5K9KA 4FQQB 1KC5H 4NJAH 1IBGH 3TVMA 4LLQB 4X6DF 4GG8B 4G43A 8FABB 5ITBH 1CG9B 2XNAA 3REWA 3MRCB 5I75C 5IF0A 5F9JA 5IK3B 2GJ6B 3OKNA 1GGTA 2YR3A 4LOUC 4YHPA 3LQAH 5J9PB 3WLBB 4Z7WF 4E41E 2E9WA 2D31B 4NN7C 5HD8D 1PEZA 1HXYB 4JY6B 1QTYT 4PLOB 1N26A 5D4QA 5LAXA 3CC5A 5D1QC 1OWRM 2GITA 4EN3B 3K4ZA 3EGSA 2GYSA 2VZSA 4WFHE 1CXEA 1CDHA 4ERSL 5HY9B 3I9GL 3X14B 1KIRA 1ZEAH 2OTUB 1EVTC 5E7BA 2DYPB 1IGYB 4NUGL 5DRXA 4D0BA 4L9LA 1UH3A 4JANA 1T0NB 5GHWH 3G6JB 5L2JA 4MNHA 4HV8B 2OZ4H 1FFOB 3HG1A 4G8EB 5FHAL 1FQ9C 4HC1L 4AMKL 1RK1A 4DKEL 1B6UA 5I66B 1NCDH 3ARGB 3DROA 4RFOL 3U82B 2FWOA 1BFVL 2ZCLL 4R8WH 2YXFA 6FABL 4M61A 3SKOA 1QSEE 4PUBH 4YHLH 2ITDB 3OJMB 5TE7H 3FQUB 1L7IL 4IRSA 5DQDL 4G8IB 2PNDA 3QZWB 4HKJB 4K94C 4AH2A 5I15L 4NSKB 4V1DB 1I1CA 3DXAE 1ORSA 2DTMH 2RR3A 4XVTL 3TJHC 3JWDL 3M17A 3W39B 1MRDL 3EJZC 1U92B 3IDMA 2CKBL 3ELAT 5GGRY 4XCNB 3FOLB 5E2WH 5A16B 1S78C 3FFCE 3TT1L 2QSVA 3UTSA 5DMYA 3KPLA 5DRNB 4G6ML 1BJ1H 3TBTB 3ULUE 4O2EA 1YJDH 3MRHB 3KPNB 4PGZA 3ARXA 1RIHH 3KJ6H 4U31A 1U2CA 3TH4T 2XZCH 2ICWB 4R4BB 2R2EA 3OKEB 1S7SA 2V5YA 1QLRA 4PRHE 2AJVL 5J6GA 4X6FB 5LWYL 4H25A 1NC4D 5HGAB 5D6CA 3MCLL 1DUYA 1XCTA 4OJFL 4FQ2H 1RZJL 4C55A 4NNPL 1J11A 2AEWA 2ZZUT 4LVHB 2H32H 5CUSL 3LCYA 5E6ZA 4ZUVB 1MNUH 4PJXB 2ATKB 3SGKA 3RRQA 4FTVE 1S5HB 1AO7D 5KAQG 1LILA 5A40E 4QTHB 1LP9B 2OSLA 1H0DA 4ZO9A 2ITCB 1ZA6A 2E3VA 2UWEB 2IC2A 3QUZD 3WXWL 1YYLH 3G5VA 1BZ9A 4M48H 5L88L 1PKOA 5CAYB 3I85A 4R7DA 2AJSH 1HCVA 1JK8B 1TPXC 3L6FB 3DV6A 5HDBE 4WGVB 4UIMB 4X7CC 3WNKA 2F19L 3FHAA 3EO1A 5JA9A 1ZKAA 4KK5D 4UUJB 1ZHKB 5K9JH 2I60H 2DKUA 4E0RB 5A2IH 4WW1A 5AZEH 3G6AB 1GIGH 4JM2C 1RI8A 3NABH 5DEZA 2DQTH 2XA3A 3MLUH 4Y5XB 3QEGH 1SJEA 3D69A 2DLFH 2K7PA 3O11A 2F5BL 4JFYB 5GGVY 1S9VB 1IQDA 4UT7L 5HGHB 2Y06H 2R69L 4YWGH 3QI9B 1FNEA 2FHCA 3QWOB 5D7KD 2O61B 4KK9C 4F80A 1ZGLM 2FATL 5E94B 5I8OL 2RCSL 2NY3B 3VFTA 3KPRA 1MRFH 1PZUB 4ZSOE 1KG0B 3BHBA 2ADIA 5GRWA 2CIKA 3L3KB 3OPZH 2NLJA 1XR9A 3QULA 4HJJH 3QWRA 4PR5A 4K23H 3VFPB 1IM3B 3JWDC 4YEEA 3NFPA 4XC1H 2DQUH 2BCKA 4YO0A 2FH6A 3LKOA 3SDXF 3UBXB 5J13B 2HWZL 1FVDA 5I1DB 3BP4B 3U2SB 1H3PL 1G7MA 3D0VB 4AQOA 3MV11 1RUKL 3L7EA 4JFFD 1DBML 1ZXQA 2BXYA 2QV2A 5CSBA 3MJ7B 4NUJA 4QWWC 1NGZA 2AJ3A 1G6RH 3CH8A 4FRWA 1TCMA 2Z93B 3GKWH 1BFTA 4YGVB 3PL6B 1KB5A 4P23D 5CEZE 4MNGE 1RZJC 5DR5L 3C5JB 3DARA 2VDQH 4RRPA 2OL3L 4LRIC 4C58B 3MZGB 4MDIB 1S7RB 2DBJA 2I27N 4U2ZA 1S7WB 5DJAB 2VLRE 1ODAA 1DQTA 5B22A 3UTSD 1OTTD 3SOBL 4KWUA 5EOCL 4U1GC 1HSBA 5C71A 4JJHA 3TWCL 5B8CC 4OGAC 5E5UB 4HK3J 4XVSL 4HUKB 3V95A 4FXGB 2A6DB 3BKMH 2R29H 1G6VK 5T33L 3P30L 2NX5A 4HKBA 1NC2A 4RAHA 4P2RB 5KN5A 4HIHA 2MHAA 4I3RH 3IU3B 1REIA 2P5EE 3O3BB 1YMME 5CFHA 1RJYB 5EIVA 3K46A 2UZYB 3IF1A 2FLBT 1II4E 3ET9F 1T89C 1XEDA 3REVB 3IFPB 4JG0L 4Q9CA 2OXHA 5EZOL 4WW2B 4LLDB 1ZLWH 1FLRH 2VLMD 3WIHH 5D1XB 3SBWC 2CGRL 2FX7H 1JWMA 1CF8H 2GHWB 5FAAA 4QRRE 3ALWA 4AEEA 2A77H 1Q0YL 2BVEA 1N4XH 1X6NA 3DIFA 4R6UA 3B2VH 2UV3A 3DBXB 1EHLL 3H9HB 3QAZC 4NO2B 2X10A 3G08B 4GRLD 4XMPL 3IJHB 2PTTB 4MHHI 3H0TA 2P5WB 3GRWA 5E5RB 1F4YH 5C8JB 2BSRB 3FOMA 3MOAL 3ARBC 2NY4D 3BPLB 5JOFB 3VJ6B 3QIWA 3MRNB 2R9HC 3GBNL 4RFEB 5D2NB 1Q1JH 3LKPB 2XWTA 5BO1H 4U7KA 2X40A 1BGXH 4HF5L 2DMKA 4YXHH 3MLVH 3SGDH 4K3GA 4JHAL 4JREC 4N0CD 2R0ZH 2EC9T 2CMRL 3BOVA 3HPJB 1UM5H 5LQBH 1MCLA 3IDGA 4NCDA 3RVVD 4Z7QE 4Y4KD 4L3EB 3WS3A 2BVUA 5ALBL 3MLTB 4F3FA 5J4MA 4DZBA 1M6OB 1QPXA 2NXZB 3PIQB 4KAQH 3EO0A 1MCDA 3VW3L 5KJRL 4HIXH 4WI5A 1H3TA 4WDIB 4KI1A 3MR9B 3KPRD 5IW3A 2HA1A 5JUEH 1UA6L 4NWTH 1I3RB 2X4SB 2BDNL 2GKIA 2R1XA 4M5ZH 4R26H 5BVJB 2XTJC 5E95B 5T3XH 1PG7X 5DMGC 1AP2B 1TVBB 3QWRD 4ZTOL 5EZJA 5INDA 5JIKA 2VLLB 3U1SH 2WINB 1J05B 3EYFA 3HE7B 3LN4A 1OW0C 3VGFA 2VLKD 4HH8A 4K7PL 4UOW0 2KQNA 3WLWC 1MSPA 1EPFA 3CVHB 4LVEA 4X83A 5HYSA 4HWBL 4UNUA 5D7SH 3QFJE 4P4KD 2O5YL 3RVXD 1G7JA 3NIDF 3RPIB 3UJJL 2ZCKL 3RTQC 3BPCA 4QF1B 1IL1A 5E8EA 4HS8H 4I48B 5F93C 3VXSB 1AE6L 2VLJD 4CMMA 3U7WL 3O3DB 3VXNA 5IHZB 2BHUA 3EJZD 3MRPB 5E9DB 3WFEH 1T2QH 2DWEA 4LSSH 3L3GB 1DUZA 4PGCB 1HHHA 3V4UH 4JO4H 3S5LG 2C3VB 1UZ8B 3PV7A 4YK4B 3UC0H 2IWGA 2X2YA 4N8CL 4NO0B 1OAYL 3HUJF 4NRYA 1L6XA 4PJBF 5CLWA 5B8CA 1RHHB 2IAMD 4WO4C 1WBYA 5GRVL 2IADB 3CFBA 4WGWB 1V7MH 4YDIL 1P69B 5TE4H 1A7PL 1D5ZA 4EDWL 2XACC 4JZNA 4JO3H 4JRXB 4F7PA 5E2UH 3OJDA 2NX5D 4HS6B 1NC2D 2Y1VA 1CXFA 3UJTH 4K07A 4NDMB 4N8VB 2FD6H 3ARQA 1WWBX 1T66D 4KI5E 2ILLA 4Q6IC 1T03H 4I3SL 4LSUH 2F53B 4XNQB 2B1AH 3FO0L 4AIXA 1AO7E 5K9OA 5GGRA 2H8PB 2J8UF 2ZNWA 3OR6B 2JB5H 4YC2C 3MJ9H 4D0CB 1MCKA 5DD1H 1OGAE 3MV7A 4PJ8A 2YBRB 4UBDC 4JFZH 3BI9X 1W72B 2AVGA 5D5MB 4GAJL 2CSPA 4G5ZL 3GSOB 5FDWA 1ORQB 4HEME 2EIZA 3FTGB 3ARZA 3A67H 3F5WA 3U6RA 5GGQL 5AAMA 3H6JA 1DBAL 2DB8A 4KY1L 1A7QL 2QSCH 5FV2A 4MCYA 1KTLA 4KZEH 3NIFE 4WHTA 1WFTA 4M1CD 4HK0B 1JUFB 2XKSA 4LCCC 4WCYL 2ZP0T 1Y0LA 3QIWD 1FFNA 5AAWA 2GSIA 3QDJB 2EDDA 3MRFB 3ME0A 1DN0A 1MFBL 1U95B 5EBLA 3O6KH 4ZOCA 3UTPD 1BEYH 2D7TL 2IH1B 3RHWK 5D72L 5L9DL 5FOBA 3FB8A 4JR9L 4GKZA 3O6LL 4OKVA 3RFZC 1G7IA 3MPCA 4DKAA 5GGTA 2R2BB 2ZG3A 3C2SA 3TO4B 3I75A 5F7DB 4ELKB 1YEEL 1QR1A 3S37X 1JN6A 3GNMH 4HLJA 1PQZB 2IFGA 5EU7E 4MA3B 3SGJC 4JRWA 2BFVL 1CTOA 2DLTA 1U8LB 3OAUH 5GS0L 1ZWIA 1OW0A 2VABA 4OUUA 2C3WA 2Z35B 2FH8A 3NIGE 1QQDB 1IEAA 4G8GB 1F2XK 3HG1E 5E4EC 2PYFB 3P2TA 4IRZH 2Y5TA 1GZPA 5J6HA 1RJLB 2XV6B 1AFVL 1MJUH 2DM4A 2VUYA 5ESVB 4Y1AB 3RWGB 5IMOB 5EOCJ 5HBBA 3CVHH 4NPYB 4ZXBD 5JTWA 5C0IB 3D18A 2EDEA 5EOTB 4LCIH 4U1IA 5IB3A 4KVCL 1NGWB 3VE0B 5DD5L 3VXPB 4OLWH 5GISL 3RIAF 3CD4A 2BMKA 2VN7A 1VPOL 1FZMB 4LPCA 4G6AD 4FZ8H 3B3IA 1OCWH 4ODXB 4PJ7A 4LVOB 3QCVL 4CVZB 4X4MA 2VXQL 3UTSE 3KNBB 4OLXL 3DNKA 2WIIA 3KPOA 3ARDB 3UCRA 1ZSDA 1FE8H 3RWDA 2WUBL 1RHFA 1JF5A 2XY2A 1BLNA 5IQ9A 2FYYB 4BFIB 4FOMA 4U1HA 4A6YL 1TZHB 2D2OA 5DFTA 3N85L 3UYRL 4AENA 4UV4H 2EDWA 3W9DB 1WC7B 3Q1SL 5FYKU 5D7IF 5DJCB 5KSVA 5HHNA 4KROD 5C0BB 5C0EA 3DYPA 3DSFL 2LV4A 5HHQB 1A4KA 1UM4H 5T1LA 5EZLB 5HI4D 1P7QB 1KYOK 4LU5L 4DN4H 3QRGL 4LMQE 2OZ4A 2VH5L 4P4RA 2AK4A 2WANA 5MERB 5CILL 1AH1A 4I2XB 3KPTA 1WZLA 2I9LB 3ZSSA 1EEQA 4Z8FL 1KCLA 3TJEL 1SY6H 3BUYA 4KJQD 4CNIA 4TVPH 4JDZB 4LLUA 3ARVA 5IWLC 1S7QA 1DQJA 3BSZH 3DUHA 3F7YB 5I1CH 3F7VA 4PJ8D 3WKNA 4XX1E 3GMMB 4MAYC 1W72H 3GUTA 3N0PB 5J1TC 2FO4B 5C9KA 4X7EC 4Z7OE 1CFSA 4ONFL 2BERA 4HW6A 4PRDA 1VADA 4TUOB 2YPLE 5IJVB 1GSMA 4H1LG 2MCG1 2C3HA 3NTCL 3MRGB 3BO8B 4LCCA 5GS1B 2OJEA 2W9EL 4W68A 3EZJB 3DO7B 5HYQB 2CLZB 3CFJB 4L8SC 3MLWH 5D9SA 5GS0C 1C5DA 2ZUWA 1GHFH 1H5BC 4NYLA 1P7HL 3C6LC 1KEMH 3T0WA 3O8XB 4MNQA 3MLRH 3BGFB 2JJTC 3UJIH 4OCXH 4PJCF 3X12B 1A47A 2VIRA 3QDGB 2QHLA 5FO9B 5EC1B 3ZE2F 4LSPL 4YHOL 1E6OL 1FL5B 4CU6A 1LO2L 4UMGA 5BOZG 3SGJA 3RGHA 5I6XB 1S9WA 1NFDA 4KRMB 3KYMB 1UWEL 2H32A 1Z3GH 5DRWA 1A6UL 4KXZH 4JM4H 3N06B 2HFGL 2VN4A 5DMGD 1YMHA 2H3NA 3SDAA 4ZFFB 1J0HA 2VISB 5KTEH 3W5MA 1KCUH 2HJKB 2A1WH 5IEKA 3BZEB 2WWMC 1NBZA 4EXPX 2DQIH 1XF4B 1K6QL 5D7LB 2DWDB 3SN6N 3RWEB 4MJ6B 4ZFGH 3WD5H 3RX5A 1UACL 4TRPH 5F70A 5I1KH 1MCQA 2YHGA 3LY6A 4HJ0C 1QSVA 4KPHL 4XVUD 2FIRT 1IJ9A 3MREB 3M8OH 1INEH 1MLBA 4FQXB 3WHXB 2A0LC 4QOKA 3K81A 3S35H 4FQQA 1IFHH 2V5TA 2Z31C 2MJWA 4Z0BH 1I8IB 3QUXC 5EORH 1D6VL 2J88L 3VA6A 3ZL4H 4LLQA 4D3CH 3D6GA 4GG8A 3V4VH 4HH9B 3O41B 4P2QE 8FABA 1B2WH 4DGIH 1CG9A 3MRCA 3UTQB 4JO1L 4D9LL 1CQKA 3RWHB 1GGCH 2XN9D 5IK3A 2GJ6A 1FNGB 3OHXB 3W5NA 4HHAA 1YEHL 4FN0A 2E7BA 3ROLB 4NQDB 3D0LB 4Y5XC 2AW2A 5J9PA 4LKCB 3WLBA 2D31A 4RDQG 5JW5B 1LO3L 3LZFH 5D8JH 5I17B 1MRCL 3V5KB 3C5ZD 5DQJB 1FORH 1UXWB 5ECJE 4EN3A 2R0KH 3M1BB 4OZFB 5HY9A 3X14A 1RUQL 2OTUA 4OCSL 3TT3L 4AEIL 4PJGB 2DYPA 1IGYA 2L4OA 1FCCA 1QBLL 1QSFB 4U2YA 4MXVE 5KG9B 3GIZL 5T1LD 4RAUB 1T0NA 4J3OC 5LXGL 3G6JA 4CADB 4RQQB 4HV8A 1FFOA 2BNUB 4LPYA 5IMLA 1B9ZA 4MWFB 4ERSH 3I9GH 1FC1A 1TQBC 1I7RA 1A0QL 5I66A 3R06A 1A7NL 4BYHA 1ZLWK 4NGHL 5EUOF 1ZT4A 1CE1H 1ITCA 4NUGH 4ZMAT 2GT9B 3IXAB 2QEJA 1CL7H 1X4ZA 3FQUA 4ZODA 4G8IA 4H20H 4NFBA 3QZWA 4HKJA 4HC1H 4X6DA 3V7AG 4NSKA 4DKEH 1NCBH 3ZKXB 2DS4A 1UH4A 6FABH 1EGJL 3I6KB 3C6LA 3W39A 5J12B 1HIML 1U92A 1IAKB 4XCNA 3FOLA 1CFTB 3QHFL 1CFQB 4LMQI 4KKNA 2JJTA 5A16A 4HWNA 1ZHNB 4LSQL 1L0YA 5C0GB 4J3UA 5I15H 4Z7WA 5L8KB 2JTDA 5DRNA 5KSUB 1UXSB 3FAWA 1FSKC 3TBTA 3RVTC 1Z9SA 3MRHA 3KPNA 4MNQD 5H37H 4XVTH 5FEBA 2BJML 2CDGA 4RX4A 3TGXA 2ICWA 2APVA 5GRYA 4R4BA 5C6TH 4X80H 5I1GL 1YEJL 3KJ4B 3TT1H 4YHYB 4YBHA 1DQLL 2XQYG 4FQLL 4X6FA 4U1JA 4GQ9H 5HGAA 1ZOXA 3RDTB 4JHBA 1JCKA 2Q86B 4XHJC 5DYOB 2XA8H 3MRKB 1XIWB 1F97A 4WEBL 5KANG 1BOYA 3DGCR 3QUML 4ZUVA 3RNKA 1KSRA 4QXGL 4PJXA 2ATKA 1JHLL 3KHOA 1S5HA 3VFMB 3SDAD 3ZTNL 1NAMB 2IFFH 2E7HA 3HZVB 4QTHA 1AQKH 1LP9A 5MEPB 2ITCA 4OJFH 1H15B 2UWEA 1Q9WB 1RZJH 4YBLB 3UPRB 4Y8DC 1PD6A 4NNPH 3N9GH 4DUVA 4BKLA 4MJ2A 5CUSH 1RJZA 1ADQA 1KGCD 3SE8L 1JK8A 3L6FA 4NZUL 2CKNA 5T1MB 1IEBB 4UIMA 4YDKH 3SJVB 2V7HB 2Z31A 2V9TA 3OB0H 2AEQL 1P84K 3HR6A 4N1HB 2H2SD 4PB9L 2VB5A 3D25B 2OR7A 3ZTJG 5L88H 4UUJA 4QOKD 1JRHH 4JY5L 5D2LB 5IFHL 1ZHKA 4O4YL 1NCWL 4WIQA 1XCQB 1KN4H 3G6AA 2H45A 1P6FA 1C7SA 4YX2L 4X4XB 1ZT7A 3BPLC 4Y5XA 4Y4HC 1QUNA 2IGFH 5D2NC 3P9LB 4JFQB 4BSVB 2UUDH 5KS9B 4JFYA 2GJ6D 3LEVL 5GSRB 3EYQD 4M6OL 1OL0A 1NGYB 1YDPB 5HGHA 4NHUB 3VWJB 3GGWA 4TPRL 4KRNA 3QWOA 2ZOKB 3UZQA 2O61A 1F4WH 1E0OB 5AG9A 5E94A 4H8WL 3PQYB 5J89A 4TSBL 2F5BH 3DECA 3QEUB 1YNTB 5B39B 1RY7B 1KG0A 4EN3D 1KENL 4OT1L 4UT7H 3GI9L 3L3KA 2R69H 4HFWA 4OZFH 5T3ZH 4NO5A 5DMJB 3VFPA 1IM3A 2DYPD 2FATH 5E03A 4YHZL 5I8OH 4YXLL 1DQDL 2RCSH 4U1LB 3UBXA 3MRDB 3LRSB 4KHXL 1JGEB 4KDTC 3MV7E 5I1DA 3GM0A 3U2SA 3ARGD 1IC7L 3WFDL 4GW1A 1VFBB 3IDIB 4L8BB 4M9OA 3MJ7A 3V8OA 3IFOA 5E6IB 2HWZH 1OTSC 2Z93A 3PJSA 2EEAA 3FB5A 3GMRB 4ONHB 4XNMB 4YGVA 3PL6A 2XICA 1H8OA 4V1DD 2QSQA 1H3PH 4MA8L 5K33A 1RUKH 5F72S 5DO2D 4MDIA 2EIDA 2EE3A 1S7WA 1XGQA 5JORA 4YK4C 3EDFA 1BQUA 4MQTB 1MF2H 2E9IA 1JHKL 2DD8H 1HE7A 2A74A 1NUDA 3RGVC 3MRJB 4KTYA 5ACZB 5TDPB 4FXGA 2A6DA 1GPOH 2EC8A 4KKBC 1SVZA 4RX4D 5C92A 1JYNA 3ZKND 4P2RA 1E28A 1SBSL 3WFCL 3N1GC 2XQBL 4EUPH 3IU3A 4XXDA 1NDMB 3O3BA 1NL0H 1ZAGA 3TV3L 1RJYA 4X7DC 3RUGE 3DVIA 4U6YB 4QHMA 3REVA 2XTJE 3IFPA 4PJ9B 5JHLL 5DVOA 2ENYA 4JY4B 3P30H 5M95B 4WW2A 5JOPE 2WWMD 3HAEG 3MJ9A 3U0WL 3HMWL 1AHWB 3D3VB 3NACL 2YZ8A 1T22A 3JV4B 3UAJD 5DF0A 3KGRA 2R56L 3TP4A 3NH7H 3B2UC 1NAMH 4HJ0D 4JG0H 2WM0A 1XGUB 1MCOH 5EZOH 1BMGA 4AEFA 3ZE1F 3DBXA 4H5SB 3H9HA 4NO2A 3G08A 1RPQA 4EKXA 3IJHA 2CO7B 1MAMH 1MCSA 2B1HH 3CCHB 3GIVB 4H8WC 2JJSC 5A2FA 4NZJA 5DRZB 3P0GB 1MOEA 2BSRA 1SEQL 3V0AC 4WNQB 4OZGB 5JOFA 3VJ6A 4RFEA 1KBGH 5D2NA 5F21B 3LKPA 1DSFL 1EHLH 4XMPH 4PJ7E 1IRAY 2ORBH 2DQJH 3MJGX 3VMPA 4X4ME 3HPJA 1AY1H 1JYXA 1UWGL 5E24E 4P2OB 4L3EA 4M7ZC 3OAYK 1VSCA 1WFNA 1MUJB 1QFWI 3FHQA 4HWEH 1B88A 1TETH 3MLTA 1A1OB 1PY9A 5CLTA 3QI9D 5BXFB 4EBQH 3PIQA 3MRRB 4JHAH 2OYPA 1INQB 2OXGA 4R90L 2XWJA 3QJHB 2HKHL 5J11C 3MCKB 1YEIL 4KFZC 2NY3D 4MVBC 3PXHA 4JZOB 1KB9K 4LPTA 1J1PL 4JFXB 2X4SA 5ALBH 1UVQB 5T3XD 5BVJA 4MB3A 2YD2A 5ADOH 1AP2A 1TVBA 4NNYB 1A6PA 1LO0L 4Y5YB 3TESA 2AK4E 3R4DA 4KDTA 5E2TL 2EH8L 2VLLA 1YPZF 2WINA 4JCMA 1J05A 1P7KB 4PJHF 5JW3H 1UA6H 1A7BA 3S98A 3CVHA 5DHVB 4OCLC 1QFOA 1CD8A 4ZTOH 1PJ9A 4JVWA 2CJUL 4Y19E 3RPIA 1DTUA 1JTTA 4QF1A 5C70A 4I48A 3VXSA 1K3IA 5ANMB 1AR2A 5F3BB 3HZMA 4G3YH 5FGBC 2VNCA 4K7PH 2DQEL 3MRPA 3KG5A 5E9DA 3L3GA 4J2XA 2DLHA 3PL6D 4HWBH 4PGCA 1EEZB 2C3VA 1UZ8A 5HGBA 3CMOL 4ONOA 3UJJH 3TCXA 4NO0A 4V2BA 4P2YA 4S1DC 4S0SD 2AXFB 3RGVA 2HLFC 3Q6FB 1RHHA 3MCG1 4CN6A 3RVTD 4OSUH 1BF2A 4MNQE 3FQWA 3P4MA 2A6IA 2IADA 5DJ2B 5HJ3A 4FG6C 5F8RC 3WMSA 3ARDC 1Z5LB 1T0MB 4N8CH 1OAYH 1CXHA 4JRXA 1P4IH 4R2GC 2R4SH 4RA0C 4OBRA 4HS6A 4E42B 4MD5B 4LPXA 4P2RD 2W0FB 3IDJB 3CFKB 4NDMA 4NQEE 4N8VA 1NFDE 1L0QA 4YDIH 1IGJB 4OZHB 5HVHB 3NCJH 2W9DH 4KTDL 1U6AL 4HK3N 4WI7A 5IG7B 5A43C 4DK3A 1CLYH 1SY6A 1CGYA 3LS5L 1YA5A 2EEBA 3MACH 2H8PA 4PGJA 1L9MA 3B9DA 4M3KB 5FIEA 3F7QA 3QIUB 5FYLL 4MMXC 3WNLA 4D0CA 1WJ3A 5D1XD 4MJIE 2YBRA 2WP3T 1RUML 3HR5B 3O2WL 4BH8B 3FO0H 1FIEA 2V2XB 3GSOA 1ORQA 4EI5B 1JGVH 3FTGA 4GOSA 4F15B 2FEDD 1X5YA 1VGEL 4QOKE 2P46B 1DJSA 4GSDL 4I3GA 2P5WD 2VQTA 3OKKB 2RGSA 4H26B 2HT3C 2ARJQ 4GAJH 3V4PH 4HK0A 3OKMA 5GS1C 4UAOC 4FABL 3QDJA 1HYSD 4WY7H 1U95A 3T65B 1NCUA 2GJ6E 1DBAH 4KY1H 3LB6C 4CKVX 1MJJA 5ITFB 4B7LA 3BGFC 3QISA 3CLFL 1FL6A 1ZHBB 3BQUC 3PGFL 2GK2A 4L3ED 4FFWC 4N9GB 3AS1A 2R2BA 3ETBF 2LVCA 4DQOL 2A9NL 3AMKA 4PG9B 3TO4A 1MREL 4APQB 1MFBH 4F37K 1A2YB 4M7KL 3NZHH 5F7DA 2NXZD 1JF1A 3D9AL 2D7TH 3VGAC 4ELKA 5ACLA 1PQZA 3PABB 5HHME 3OQ3B 4MA3A 2J8UA 1OARL 4I77H 2LU4A 4PTUB 4ETQB 5I1IH 1Q9LA 1RVFL 4JO2L 1RULL 1R3KB 4DFHA 2Z35A 1H8NA 1UH2A 2KQMA 5T1KA 4G8GA 3FJTA 4XPGH 3G5YB 4PJIB 3SE9L 1WQVT 5K59F 1FO0L 1FAKT 2PYFA 2Z8VC 1W0VB 2MQ0A 2BFVH 3HE7D 5DJ0B 1RJLA 1W8NA 4LDOB 3U46B 1GGYA 5KSBF 1A64A 2VO5A 5ESVA 5IMOA 3RWGA 4EDXB 4NPYA 1YY9C 4TQEL 3BDXA 2VXSL 5CGYC 5DHVH 5C0IA 1X5HA 3MV9B 2F9BT 3U7YL 5EOTA 3S88H 1V5JA 5I9QB 1NGWA 1CGXA 3BZ4B 4HPYH 4X6DE 3VRIB 3VXSD 3HI5L 2APBA 1VACB 3BT2H 2F5AL 2BX5A 4UTAH 1IAOB 4R3SB 2HJLB 2HTKD 5E9DD 5IT2H 3RIAK 1IC4L 4ODXA 4NBXB 1OSPH 1Q9KB 4CVZA 3MROB 4NO0D 3KNBA 5CD5D 4Z7WE 2X4QA 1R5VB 5DD5H 5HVWA 5GISH 2RBLA 3BAEH 1PG7L 3ARDA 4M7LH 4OLZL 4WFGD 1X5GA 4PG2C 3V5HB 3BUTA 4UQ3B 2FYYA 4BFIA 2N7AA 3OZ9H 2PO6C 4G7YL 3BE1L 2NY1B 1TZHA 1IVLA 1U8JB 4LNVA 1XF2B 4QCIB 3BW9B 4OFYA 4BQ8A 2K1MA 4ODTL 3W9DA 4JRXD 3OB8A 1EZVY 2BRRH 3LH2L 4RGOH 3H8NA 4YBQC 3FCTB 4LSRL 3GMOB 5DUPL 3NGBB 4U6XA 5C0BA 3BMVA 2IQAB 3L7FB 5HHOB 4PJ5B 5HHQA 3SQOH 2FGZA 1P7QA 3S34H 1P1ZB 3VH8A 4PLJC 2DQCL 2QQLH 1EFXB 1ZANH 3UYRH 4PJXE 2F53D 4RZCB 3WDHA 2VDRL 4I2XA 2I9LA 5KAQF 4XWGL 4KJWD 1KCRH 4TVPD 1U2HA 4X5LA 1UKSA 4JDZA 3T2OA 3DSFH 2UWEE 3F7YA 1KACB 1R5WB 1QBML 4LU5H 2VH5H 3NAAL 4ZYKB 2FHBA 4OZ4B 5CILH 4GH7B 4X6CB 3DSNA 4U6TA 3H2WA 5DVMA 5AUMB 3S36H 5CP3H 5BVPL 3EOAB 5JZ7D 2FB4H 4ODSL 3EDKA 3MRGA 3BO8A 5GS1A 1LVEA 3HLAA 5F1SA 4Z6AT 1M1SA 1QVOB 1I3VA 1QKZL 3PHSA 3QNYB 3DO7A 5HYQA 5MENB 2CLZA 3CFJA 1J88A 4QO1A 4PLNC 4IMKC 4ONFH 2V9RA 1N6QH 5F3HB 3LEYL 2FL5B 5EU3B 2DRUA 3KYKH 4ELMB 5DA4A 3QDJD 3GHEL 1UM6H 4UNVA 3X12A 1E4XL 4Y16B 25C8L 4TSCH 5SWZB 5FO9A 1ZS8B 1FP5A 2PTVA 5EC1A 1MLCB 3JTTB 1BFOB 2GCYB 4M7LT 2VOTA 1IAIL 3ZKMC 2DQHL 1A7OH 1FL5A 2F54B 3Q5TA 3QEHB 1JIBA 3R1GL 5AEAA 1WAAF 3TO4D 2R23B 1OT2A 4AL8H 4JKPH 2MPAL 4K8RC 4YHMH 2FGWH 1NCAH 5LBSH 4ZFFA 4YHOH 2VISA 3ULUF 1P5UA 3BZEA 1XIWC 2APFA 3PGCA 5D7LA 2DWDA 3RWEA 2QQNL 4FQIH 2NCMA 4G8GD 1A6UH 4WVRA 1K4CB 5DEGA 1G7PB 4YBLC 3LQZB 1Q94B 4L3AA 4L29B 3ARPA 3SO3B 3MREA 1K6QH 4Y1AD 1BOGA 1LK2A 4FQXA 3WHXA 4IHOB 4XNZB 3V7MA 1F4AA 1FV1B 4XPFL 2FBJL 1I8IA 3BJ91 3K2MC 5C2UB 4U1SB 1X7QA 2H1PL 3MA7B 3FQXA 3O41A 3VXMA 4X5WB 3S37L 3UTQA 4LPWA 3BGMB 3RWHA 1NSNH 1D9KC 5DFVD 1FNGA 3OHXA 4M6NL 4NQDA 3D0LA 2EDYA 2PO6A 1D6VH 1DBBL 2J88H 1AD0A 4LKCA 1CWVA 5JW5A 4U1NB 4Q74A 3MUY1 5IVNA 3O4LA 5I17A 3V5KA 5JQHC 5DQJA 1UXWA 3W11C 4P2RE 3MRMA 1KJ2B 4OFYD 3M1BA 5HVGB 4OZFA 5L6YL 1VFOA 4HSQA 4RMTA 3DVNA 4HIEB 1A22B 4JPIB 3F6IA 4PJGA 5CZVL 4GKOA 5C0BD 3VRJB 1WT5C 2G2RB 1EO7A 2DF3A 1LO3H 4LVNC 4M43L 5F7EH 5HDLA 2GQHA 2ADJA 4RAUA 3F12B 4TNWF 3SDXE 5KSAB 4NJ9L 1P7QD 4CADA 5DVKA 4RQQA 5DGRA 5CJXC 2BNUA 1U3HB 1FRGL 1GC1H 4MWFA 4RGNC 4U0RB 1ZGLP 1J7VR 4JFPB 2CK2A 3TT3H 4AEIH 1KULA 3IJSA 3LV3B 1TMCB 3WJLA 3GIZH 2GT9A 4BFGA 3UXFA 4EI6B 4FXLA 5IR1B 5CSGA 1N59A 3WN5C 5C0RL 2IALB 1A0QH 5DWUL 1EHNA 2ZSVB 2C3XA 3LSOB 4XI5D 4KKAD 4NGHH 4MXWL 4IMKA 1NUFA 5KOMC 2WLYA 5IB4B 1KXVC 3MBXL 1IAKA 4G9DA 1CFTA 4IRJB 1CFQA 4ZTPH 3KLAB 5D2NE 1ZHNA 3KYNB 5C0GA 3SKUD 2VZUA 3WFBL 4DWHA 5KVDL 5KSUA 1UXSA 4GG6F 5HYIA 3O3UN 3O8XD 3ES6B 1HIMH 1KJ3H 4FFWD 3FZUD 3QDGD 5D1ZB 4H0GA 1X5XA 3FT4A 4G9FB 2FJHB 5C0AE 3OG4B 3QB7C 4LF3B 3AU1A 5FUZL 4XCYB 3RDTA 2Q86A 3NFSH 1HHGA 2BJMH 1X5KA 5DYOA 1XIWA 3ZZ1A 3MUGB 3H9SA 5I1GH 5T5FL 3T0EB 1JGLH 3DMMC 1DQLH 4KTEL 5I18L 3DUSB 5EUOA 3IDYB 1JGUL 2Q8BL 5JA8B 3FONB 4XRCB 1NAMA 1CYGA 5MEPA 4WFED 1H15A 1MHHB 5D7LD 3UPRA 1IEHA 1AHWC 2EYRB 4W70A 1MCWM 3ARUA 4OZIF 5FDYA 3T1FB 2C1OB 2VRAA 3QUMH 5JW4Q 4LLVB 5BS0E 4QXGH 4JKKA 2KZ1B 5T1MA 4ENED 1IEBA 3SJVA 1T5WB 3ZTNH 1W0YT 1A3QA 3HC3L 3D25A 3TH2T 2Q1EA 4FQXD 4E5XA 2P48B 1CQYA 5IVXB 1OQOA 5D2LA 5E08H 2C4FT 4UT6L 4KUZL 3GDBA 3SE8H 5E9DE 1D9KA 4K71B 4QRSB 3S4SG 4OLUL 4OKDA 3GK8L 4X4XA 1J0YA 2XG5A 4OF5A 3GZKA 2Q8AH 3SE3C 3P9LA 4BSVA 5L8JB 5E0QA 5KS9A 3OSKA 2XZZA 5GSRA 4M9PA 3UBXI 3L1OL 2B0SL 2R15A 5C7XL 2B4CH 4NQDD 2Z92B 1NGYA 4I13B 4L4TB 4NHUA 1FH5H 1MY5A 4M7JL 5F88B 1I1AC 4GW4B 2VE6A 2ZOKA 5DK3A 1GXEA 3T8XB 1CK0H 4XCEB 3WNNA 2VWEC 2HKFL 5F9OL 3QEUA 1YNTA 4BH7B 1WT5A 4HIIB 5B39A 1BAFL 2O5XL 2IQ9L 1JZ7A 3CX2A 4M6OH 2WP3O 2ZUQC 3EHBC 4J3XA 3D5OF 3QQ9C 1KJ2H 3KYAA 2FJGB 5C3TA 1CIDA 5T3ZD 1OD9A 5CJXA 3QUKB 1IC5L 2BOBB 1SBBA 5JPNB 1FCGA 1QSFD 1NMCC 3K74B 4YLQT 4Z7QF 1QO3B 3IXTB 4TSBH 2D4DA 2F58H 5I8KL 5F7HA 1WV7T 3LRSA 4MJ4A 4FQPA 1JGEA 2X05A 3VXRB 4OT1H 3FN3A 2OJZH 3GI9H 4EEEA 5ISZB 2NZIA 4QHKI 1P9MC 4WENB 1VFBA 1OP3H 4I18B 3HE6B 3IDIA 4L8BA 4YXLH 1DQDH 1AGCB 3KLHD 5E6IA 3GMLB 1J1OL 1FAIL 1K8DB 4XP4H 3E8UL 2Z8RA 4ONHA 3HC0A 3LPWA 3S5LB 4KKCC 1MCPL 1CDJA 3L3IB 3WFDH 4IDLA 5FGRA 3O6FB 1J0KA 2JJVA 3B9VA 3FAXA 3JUZA 4L4VB 2GI7A 3TIEB 5DHXB 1GH7A 2OS7A 1X6LA 4G6KL 1YEKH 2C4XA 3CXHK 5CHNB 2FEEL 3T04D 1F4XH 2W0KA 2F8VA 1YQ2A 3WS6A 1ZK9A 1R3HB 2QKIB 2L7JA 5ACZA 1ZVHA 4XXCC 4MA8H 5TDPA 1QACA 1DANT 4FZEH 2NR6C 2YOCA 1KPVB 4HLZG 3E2HB 4MA7L 1NH6A 43CAA 1K2DB 3ORJA 1NDMA 4JGJA 5GRUL 4PBXA 4K8RD 1T1WB 1U8MB 2DIBA 4NCC2 4OIBA 4U6YA 4F8TA 4G80B 4UV7H 4XNUL 3RPKA 5KW9L 2R4RH 4PJ9A 3RDTD 2JF1A 1SJXA 2J8UE 4JY4A 2A73A 4WUKH 2XFXB 1XIWD 1CFNB 3WFCH 1AHWA 3D3VA 4JRYA 3JV4A 4FFVD 3TV3H 4CVUA 1G0YR 3QO1B 1N6VA 3PDOB 3TBVB 5T1DH 2BVYA 4MS8C 5JHLH 4ZAKB 2E7CA 3RWCB 1XGUA 5JHDD 1KELL 3HMWH 1RZGB 4H5SA 3IKCB 4IS6B 3PE9A 3SJVD 1T80A 1U9KA 3CCHA 3GIVA 4HUMB 2F15A 1TITA 2HMIC 5DRZA 4LKXB 5GS2H 5JQ6L 4J7RA 4WNQA 4OZGA 4ZUWB 1C7TA 4ODVL 5E8OB 5E99L 3SE3A 4CBPA 1XMWA 2OLDA 5D7JC 4QY8B 5JNYB 3K4DA 2NNAA 4F58L 3CXHJ 5C07B 5MEQB 5F6IB 3S8WA 2R1WB 1ZVYA 5DJ8A 4O2CA 2QADB 2JIXB 4P2OA 1T83C 1UJ3C 3TZVC 3NFNB 4X4ZA 1MUJA 2GJZB 4GQPH 1A1OA 1I8MB 3VWJD 5BXFA 4L5FL 4C56A 4F9PA 3BFOA 3MRRA 1INQA 5TQ0L 2VZOA 3RWFB 1RV6X 3QJHA 3MCKA 1JI1A 3CZFB 3PQYD 4I0PB 3MXVH 1UWGH 4JZOA 5C0BE 2X9YA 4JFXA 4G42B 1UVQA 3EOBB 4CVXA 1HHKB 1DCLA 4ZQKB 2HVKB 3AREC 4NNYA 4Y5YA 3QDMB 1BP3B 4I2XE 2HKHH 3RKDC 1P7KA 3NA4A 5CGTA 1K8IA 4DGVL 5IW6B 1T6VN 4O02L 3MX0A 5FGCB 1G7QB 4XNYH 5DHVA 2XY1A 2VDKH 4LSDA 1LO0H 4ZOBA 4BQ6A 2W60A 5CD3B 3E6HB 5C0JB 3IU4H 1HK6A 4BZ1L 5E6ID 3HS0B 5GSVB 2VDPH 4MB4A 2DQFB 4PP1C 3NIGF 1EEZA 5GIRB 1D6EA 4XBPA 3PWPE 2CJUH 4HJGA 4CVWA 4OV6F 5CEYB 2AXFA 2PXYC 3Q6FA 4WHCA 2AJYL 4POZC 4XXCA 1F6FB 2VDLL 2DQEH 1OAZL 3INUL 3HI6L 1MCNA 1EIBA 3CLEH 1A6ZB 3KDMB 3CMOH 1Z5LA 1T0MA 3VI4F 3DX7B 3UP1A 4M1DH 1JNLL 5BV7B 2XRAL 3CK0L 4D9RE 2W0FA 3IDJA 2ARJA 1S8DB 3JWOH 4UT9L 4KDWA 1IGJA 4OZHA 1DVFC 5IG7A 1D5XB 3NGBC 4PJ9D 2BNRE 2UZXB 5DD3L 1ED3B 1FVCB 1N8ZB 1QOKA 3QIUA 4XPTL 3BPOB 4WFEE 3D3VD 5ENWA 5D7LE 4M93B 5ERWA 1CDIA 4D2NA 4LNRB 1HEZB 3P0VH 3HR5A 2I9TB 4J3TA 3V6ZB 4KTDH 1URLA 4BH8A 2DLGA 1OAKH 2EDNA 3BIAX 3MBEB 3MXWL 3ARTA 4H1LB 4WFFD 4EI5A 5FYLH 1T04B 3Q6GL 4MGXA 5I73C 3VDCA 4CAGA 3OKKA 4OCWL 3O2WH 3HZKB 4H26A 4TNVF 3BP5B 3ULUL 4AZ8A 2V2WB 2VXTL 3VXME 4GRWB 3X3GH 3C09C 3RU8L 3FO2B 3T65A 1N7ML 4YHIB 5EU5B 1IARB 4GSDH 3ZE2E 3K2UL 4NQDE 5ITFA 1FFPB 4Z7OF 3THMH 2EDBA 1ZHBA 3MGOB 4P2OD 1NKRA 2CDFB 4N9GA 2XWBB 4LIQH 2DTSA 3QG7H 2PYEE 4PG9A 3O4LE 1M7XA 1A2YA 4P9HC 3QSKB 3ARFD 2CIIB 3EJYC 1G84A 3EHBD 3PABA 4NKMB 5MP6H 4FXKA 1AR1D 2CRYA 3AREA 1OPGH 4C83B 4GAFB 5T3ZE 4PGEB 3CLFH 4ZUUA 3U0PA 4PTUA 3RL2B 5H37G 3MRIB 3PGFH 4ETQA 1F6AB 1FGNH 1MREH 1R3KA 3CH1B 1NANI 5ESQB 1YEGH 3D9AH 2E5EA 2WBJB 4XB7A 1XAUA 4PJIA 4PGDB 1K85A 5DJ0A 2IPUK 1TENA 1JJUA 1E27B 3U46A 1BQLL 3F58H 2ADFL 5TJWK 4HG4K 4YJZL 3LRGA 2RQ8A 1A3RL 1F3JB 3MV9A 3LIZH 1TQCB 4KKCD 1ZE3C 1XF5B 3KLSA 3SDDC 3SE9H 1FO0H 3VRIA 3SO3C 3VG0H 1VACA 3P9MA 5AWNH 5C3LD 1S5IH 1HQRB 1IAOA 4R3SA 1MCFA 1HI6B 5DC9B 4L1DA 2C5DC 2RJMA 2X4NB 4KK8C 1XGPB 4B50A 4Z7NF 1T20B 1R5VA 4WJ5B 3HI5H 3V6OA 1YY8B 2K7QA 3FRUA 1LO5B 3EYOB 2F5AH 3MLYH 2NR6D 5E2VL 1NGPL 5DD0L 2AI0L 2YKLH 1FYHB 1U8JA 4NKIL 2A6KB 1XF2A 4QCIA 3BW9A 1I9IL 1PGRB 4HEPG 3TFKC 2VKXA 3FCTA 3GMOA 2JJWA 2AKRB 2EYTB 2IQAA 3L7FA 3HNVL 5HHOA 1X5IA 4PJ5A 3TF7C 5BQ7A 1EBPA 4NKOB 5E5MA 5DDHB 3BE1H 3KXFB 3ULUC 3KPSB 1UYWH 3H9SE 2HG5B 4KV5F 5HI3D 5HDQL 1EFXA 4NC2B 4RZCA 2WIMA 3GHBH 1LE9A 1ZV5A 3LH2H 5SWQA 5EUOE 2HRPL 4MS8D 4OB5H 5HGDB 3QIUD 1BECA 4YFLF 3STZB 2A38A 4MXQC 1R5WA 3QFDA 5I1LA 4GKNB 2OI9B 4HUNB 1CR9L 4ZYKA 5CEZL 4AIOA 1FGVL 4Z7UF 4LHJB 4OZ4A 4DAGL 4X6CA 2VDRH 1KXQE 4AT6B 5TDNB 3ROOA 2G5BB 4J3SA 3SDYL 3SJVE 5AUMA 3EOAA 4H1LH 4EI5D 3NN8B 3P0YL 4ZS6C 5E1AB 5DK2B 4M00A 3PDDA 3HNSH 1QVOA 2X09A 5D2LE 3V6FB 2AJUL 5MENA 3IETB 1JHTB 1MCRA 2CUMA 3VFRB 2ICEB 1ITBB 5F3HA 5BVPH 2ZPKH 4GRWH 5T5NG 4GXVL 3D2UB 3WO4C 3RJQB 1NMBL 3DVGB 3HMXH 3ECBA 3VFWB 1DR9A 5SWZA 1ZS8A 1BZQK 3JTTA 1BFOA 2GCYA 3FKUS 1QFUH 2C1PA 4X7TB 5HI5C 5I71C 2F54A 3LEYH 3QEHA 3IRZA 5D1ZC 2YEZB 4MAUL 4IJ3B 4R4FH 4APQD 1WWCA 2R23A 2VQUA 3IGAB 5C09B 2B5IC 2YUZA 2E27L 4AK1A 3RL1B 1MJ8L 3D85B 4JFOB 2DBLL 1FHGA 3OJVC 1IMHC 4PRBB 3RY4A 3O3EB 2DQHH 3UO1L 5LVEA 3R1GH 2D9QB 4RGNE 1HNGA 2DQDL 3WXVL 2DMCA 4CMHB 4U6VH 1OAXL 3TYFA 3EO9L 1B4RA 3GSNB 4EUPG 2FLRT 1V7NL 1CLOH 1JPTH 1K4CA 2VDML 5DUMH 1G7PA 3TIDB 3LQZA 1Q94A 4L29A 3SGEI 2DM3A 2YN5A 4RBPK 3SDDA 2E7LC 3GMQA 4PJAF 5TF1L 3RZCB 1ZGLB 1O5DT 1SYSB 4I4WA 4K9EH 2NY5L 2MMXA 3MV9D 5JR1L 1QPPA 3WYRA 1GGIH 1MI5B 1OP3K 5EN2B 1FN4B 2CRZA 4U1SA 4P46C 1CD1B 1WFOA 4JJ5B 4X5WA 2DAVA 4CN1A 2F74B 2X9XA 4JDTL 4ALAL 3BGMA 1F2QA 2VXUL 5FYKE 3I84A 4R96B 1SEBB 4JFEE 4P2CG 5BRZA 2MQ3A 4S2SA 3NCCB 3QIBC 3L5HA 4HZLB 4ZPTB 2H1PH 1WAAA 4P5MB 4NRZB 3VWKB 3MRQA 1OAUL 5D93B 1OM3H 5ABDE 3QUYB 2XT1B 4UIKH 5IHUL 5FF6B 2NY1D 3HA0A 3BKCH 2BHZA 2J8OA 2YD6A 1KJ2A 4M4RA 3I6GB 1KV3A 2OK0H 4OF8A 1DBBH 3BH9B 4HIEA 1BJMA 4JPIA 3T77B 4JPVH 1HHJA 4Y5VC 5CMAB 4JB9L 5IIEB 3GMNB 3VRJA 5HHOD 2G2RA 4PJ5D 4NQVA 3O2DL 4Z7VF 5KSAA 1C1EL 5IW1B 1QBBA 4PV8B 4WU7B 1U3HA 3D3VE 4JRYE 5CKGA 1EFXD 1UZ6E 1JYVA 1JWUB 5MHSD 4M02A 2D0GA 4JFPA 3HPLB 2HP4A 5L2KB 1GOHA 3LV3A 2ED9A 1PLGH 3UEZA 4XPBH 4EI6A 5IR1A 2ZJSH 4HAGA 3IB4A 3WNOA 4JFDB 4N0YH 2NY6C 2IALA 3HE6C 4GBXC 5E8NB 1DBJH 4KMTH 3LSOA 5CSZB 3WFHA 3MLSL 4LK4A 2VYRE 4OGXH 5FHBL 5BZWB 3K7UA 4PY8J 4IDJL 5IB4A 15C8H 4XP6L 2UVEA 3QPQC 2ZKHL 4IRJA 5JXEC 4GT7A 4XAKE 2P8LB 2MFNA 3KYNA 2GK0B 3KR3L 2FZ3B 4JFHD 3STBA 2FBOJ 3KS0J 5ILTL 2BY3A 1I9RH 4JN2B 1EBAA 5H8DA 5IFJA 5B21A 4NQCB 1LQSR 3BH8B 1RMFH 4Y16D 4WUUB 1M71B 5HSFA 1MWAL 5D1ZA 1TVHB 5SWZD 4X4YB 4G9FA 4HFUL 2FJHA 5FK9B 3WFBH 4C56E 5KVDH 1CFVH 2F54D 4LF3A 5J3HD 1T7ZA 2W91A 3RQ3A 4XCYA 3LS4H 3D1MC 3BYTA 1TJIL 2NY5C 1ZLVH 2YA2A 3HAEB 3PWLA 3SCMB 2JCCB 4BK4A 3MUGA 2WK2A 1NFIB 5DZOA 3AROA 3U4BH 2QL1A 2EC9U 3DUSA 1UB6B 3UTTA 5HD8C 2IMNA 3FONA 4HMCA 4XRCA 5FUZH 3RY6A 2EYRA 5EDXA 2E7LA 2X4PB 3T1FA 2C1OA 3ZE1E 3GSNH 2VR9A 4NWUL 4GRMB 1VERA 4LLVA 2D0FA 1HKLH 5C6PB 5T5FH 5L0QB 3BYYA 4TOYH 5CIPH 5I18H 1T5WA 1JGUH 5SX4I 2EDXA 1U58B 1JPFB 1GGBH 3ZTJH 1AGDB 2CK0L 5I1HH 1CXKA 1HKFA 2VZ3A 1NKOA 5I16B 4KRLB 4LCWA 3PV6B 1MY7A 3EJJX 3STLB 3B5GA 3EYSH 4P5TB 4O9HL 5HHVL 2YWYA 1A3LL 3OKDB 2G60H 3ILQD 1JNJA 1E4XI 3S96B 2OM5A 4DW2H 3K8MA 4ODUB 3B8YA 2Z92A 1ZT1B 4ONGH 2D03L 3HZYB 4L4TA 1BIHA 5F88A 3GK8H 4S10A 4D94A 4RGMB 3T09A 4PJDB 3V0VB 3T8XA 2BP3A 4XCEA 2OR9H 5I19L 1C12B 3LMJH 3DX8B 4KQ3H 4HIIA 4XAWL 4XC3L 2B0SH 1PW3A 2FJGA 2YSSB 1I1YB 4M7JH 1XF1A 4OTXL 3QUKA 4OZHE 2BOBA 3BISA 4I0PC 1UEMA 3QHZH 3DYOA 1KJMB 2MWCA 3RWIA 4OZIA 1A6AA 1QO3A 5KSAD 3IXTA 4HBCH 3QNZB 3TYGH 1RZKL 1E4KC 1BAFH 1PSKL 4TUJA 1U3HD 3CDFA 3IFNL 4OQTH 1ZHLA 5DJXB 5ISZA 2VC2H 1IC5H 2P8PB 3H3PL 4P3CL 2F8OA 4I18A 3HE6A 2PR4H 1I7UA 1FPTH 4HS3B 4YPGB 4ZO6A 3PP3K 5I8KH 1XGTB 3GMLA 1MIMH 1K8DA 4WEUD 5HGGS 4N0UE 1ZA3B 4MJ5B 4ZFZB 9CGTA 1WK0A 2QQKH 3JBG7 4JKLA 1JBJA 5HHXL 3O6FA 3LPFA 3QUZC 1AC6A 1CU4H 5GQBA 4OD2B 4L4VA 3B6SB 5DVNA 3TIEA 4NC1E 1YN6B 4IRJD 2DI8A 3OAZH 1J1OH 1FAIH 4UINH 5CHNA 4CDGC 1BZ7B 5F7WC 1MCPH 2FJFB 4U7MA 1R3HA 2ZCHH 5ALCL 2QKIA 4OIIL 3VFNB 5LGHL 5IM7B 1F3DH 1J9CT 1RURH 4KK5C 5HI5D 5SV4A 1KPVA 1L9NA 4F57H 2VXVH 5D1ZD 3K8KA 4FQCL 1UKTA 4RFNB 1K2DA 1OT1A 4G9FD 4KK6D 4G80A 3SQBA 5BV7C 2HJFB 5JO5B 1XZ0A 1IAMA 1LHZA 3HAEH 2XFXA 1A6WH 4MA7H 2FCBA 3NCYS 4OLEA 3T0ED 5GRUH 3TPUB 3QO1A 3TBVA 1JPSL 3IAPA 4WEMB 4C4KT 5KW9H 4PJIE 5LCVL 4TN9A 4ZAKA 1GYAA 3RWCA 1YNKH 4I5BB 1QSEB 3IVKB 2BSTB 3N1FC 4PY7B 1NFDF 1RZGA 3IKCA 3WDJA 4IS6A 4QTIL 3C60B 1G0XA 3MV9E 5HDOA 1DFBH 4L9LC 5CWSA 5GS2D 4LKXA 5FM5M 3UYOD 4ZUWA 1VFAB 5E8OA 2D3VA 2ZUTA 1NCCH 5I8EA 3FFCB 1H3GA 5C0ND 4AIZB 2W0PA 1ZTXL 4QY8A 2AJXH 3BP6B 3LHPH 5EO9B 2VSCA 5C0CE 1AJ7H 4G6FB 3NZ8A 4ZFOB 1H3WM 5C07A 1RZIB 1CDCA 1UCTA 3C9NA 2R1WA 1RZKC 3V6OE 1SM3L 3PGDB 5E99H 4KJPD 1HH6B 3NFNA 2GJZA 4L4TD 4P23C 1I8MA 3D87B 2NY2B 2P24B 3RWFA 3QO0A 3CZFA 4RMWA 1KCVH 4I0PA 1YNLH 1RSFA 1CGSL 4Y4FB 4ZO7A 5HHOE 4G42A 5E00B 2GW5A 1KF9B 3EOBA 2O5ZL 5D71H 1HHKA 4ZQKA 2HAZA 1E4KA 3OKLB 2HVKA 4L5FH 4DVBB 3GO1H 3QDMA 3MYJB 5K59E 5TQ0H 1U8OB 1NC4A 1ULVA 2ADGB 4W81A 5IW6A 3G04B 5C9JB 5KSBE 5FM4A 1OAQL 5DT1L 1G7QA 3VXRD 2C9AA 2X7LB 5ISZD 3QP3A 1B6DA 5ICYB 1RIVL 4PS4L 2DIJA 2NY0B 1KB5L 1VHPA 3LKSB 3HE6D 4WV1B 1NAKL 3E6HA 4M8QB 2UZIL 1KPUA 3GKZA 2J5LB 4DGVH 5C0JA 3EDDA 5GGUB 4CDHA 3HS0A 3SE4A 5GSVA 4O02H 3SGKC 3RIFF 3G6JF 4EOWL 2DQFA 1JFQL 3TNNB 4JGUA 3W2DL 4XNXL 2K9UA 5E70A 4NN5C 3TO2A 5MENE 3V5DB 5FM5O 1FNSL 3O6FD 4DGYL 2EDQA 4OFIA 4EXKA 4BZ1H 4HGWB 4GRLC 1R3IH 1AI1L 1IAIM 2YZ1A 3KDMA 3X13B 4FFZH 2ID5A 2BY0A 2GUOB 2NY4C 3DX7A 4UTBL 4NZDA 3U4EB 4IOFD 2F54E 3O6ML 4ZSOB 1S8DA 2FR4B 1OAZH 2XOTA 3CFDA 1P4BH 4YDVB 1S7VB 4N0CC 1YN7B 4XBEL 1P4LB 3GSRB 3WIFB 1P5VA 1NCNA 1D5XA 5BZDA 4W6WB 3RVVC 4Y4KC 3T4AA 1ED3A 2Q87A 4PPTA 1J1XH 5GJTL 1FVCA 2AEIT 1N8ZA 2YRLA 2XRAH 3CK0H 4HKZA 1MPAH 1YUHB 4JPWH 2GSGB 5CCKH 4ZDHA 3V52H 1HEZA 4UT9H 3BPNC 2EDJA 5ETUB 3V6ZA 1A7RL 2VZVA 3GRWL 1B4JL 3VFSB 2YN3A 4I0CC 4ZAKD 3MBEA 3VD9A 2N56A 4DKFH 1I9JL 3BD3A 4H1LA 3DUUB 1OP5H 2APTA 5FYLD 2HFFB 2OI9C 5SWSB 1T04A 3EDEA 2H9GB 4U1MB 4JPKH 4G7VL 4MNGB 4PJXF 3BP5A 4YXKL 4OFPA 5EBMB 5SX5H 3MXWH 2V2WA 1KLFA 3Q2CA 4JFFA 3S35X 2GFBB 1LP9F 1T1ZB 4UZGA 2M2DA 2VLRB 2UWEF 2I07B 4TNVK 3SDCB 1G6RB 3Q6GH 3X11B 1PYWA 5EU6B 3HMXA 4P4KC 2V5MA 1RIUL 2FEEI 4YHIA 3RVXC 5GGSB 4KJYB 4HWUA 4P23A 4OCWH 5C07D 3LRHA 5BRZE 1EJOH 4P49A 5L7XL 4OCYL 2QADD 2JIXD 3MGOA 3WSQL 1YQVL 2BSSA 2CDFA 4BK5A 3GSXB 1WAAE 2XWBA 3B83A 2P5EB 4ODWB 1TNMA 1YMMB 4GFTB 3ARRA 2CIIA 4RISL 4EQ3A 3DGGA 3B9KB 2W59A 4BZ2L 3K2UH 4NKMA 4C83A 2IAMC 1MQKL 2YPKB 4B5EA 4DZ8B 3AB0C 4NZTH 4PGEA 1VESA 4I0PD 3RL2A 5IP4A 3MRIA 1QZ1A 2D7OA 1F6AA 1QFWL 1FDLL 3CH1A 3TN0B 1QA9B 1LDPH 5ESQA 5IROA 3QDMD 2NW3A 1U93A 3B9AA 4LASL 4OM1L 4PGDA 2DIAA 2IF7A 4M62L 3NCFB 2IH3B 3VU2A 1UQSB 1E27A 3RVWC 5KVFL 1T66C 1YZZA 5IQ7L 4RMQA 3H42H 1F3JA 4F7MA 3MV01 2WLZA 5MI0B 5K9QI 1M05B 3IYLW 1XF5A 2I5YL 5F9WB 2ADFH 1HQRA 4MCZB 1KT2A 4JQIL 1HXMB 1A5FH 5AZ2H 1HI6A 3QPXL 3MNZB 1A3RH 1G9NL 1JNNH 2X4NA 4GRLA 3DYMA 1DQML 1T20A 3MODL 2QR0A 4XT1C 4WJ5A 5TF0A 4PRIB 5EZIL 3WO3B 1YY8A 1LO5A 3EYOA 3LVEA 3I02B 3NVQA 1GVIA 5TGBB 4LSTH 4GS7B 5F1OB 1IGFL 1BD2E 3I6LD 4NBZB 4NN6C 3O9WB 1UWXK 5F1IB 2I25N 4M1CC 4G9FE 4QXTB 2R8SL 1L4IA 3VWKC 3QIWC 2AS5M 3ZYZA 2EYTA 4Y4KA 4P57A 2YD4A 1MFCL 1XR8B 1TJGL 2XQYK 5E2VH 4GMSH 4LFHG 4NKOA 4YQXH 5C2BL 5DDHA 3P4OB 5GRJH 3RA7H 3KXFA 3WUZA 2AEPL 5CBAB 4KKLD 4NKIH 4YUEL 5EBWB 5DC0A 3EOTH 1QG3A 2R0LL 3UTTE 4M6ML 35C8H 5I1AB 4TUKL 5DUBB 3STZA 3BWUC 3PP4L 2E6JA 2FDBP 3QFJB 1RU9H 3T1WA 5TDNA 3MBED 2G5BA 2HRPH 4LHUB 3C6SA 1LO4L 1OP9A 4RAVB 4XWOD 4Z9KB 5J1AA 3U0TB 1MCIA 2VLKA 1Z0MA 5E1AA 4WW2F 1B0RB 5C08B 4U7SA 4Q9RH 3V6FA 1CR9H 1ETZB 5CEZH 1FGVH 3IETA 4Z76B 4FQHA 4J6RL 3DWTA 4P4KA 3VFRA 2NPLX 1SMAA 4DAGH 4LCWE 2G75B 4GG6E 2ICEA 4MA1B 1A14L 5D96B 2AP2A 1FL3A 4FFYL 2VLJA 3P77B 3P0YH 4FHBD 4LP4A 2PN5A 3QDAA 3FT2B 4ZXBC 4HPOL 5GGTL 4HGMA 3LKQB 4KMQA 3VFWA 5C0DB 2YPVL 1DEDA 3O3AB 2DJSA 1T1YB 1T2JA 4GAGL 3ALPA 4X7TA 1I9EA 3MGAA 4G6AC 2SEBB 2IAMA 2YEZA 2AK1H 3L3JB 3S3JA 1NMBH 3CFEB 4QYOA 3IGAA 5C09A 3ZDZF 5TE6L 3RL1A 4F9LA 1B0WA 4K3DL 2ICCA 4K3JL 4JFOA 3GJEB 1T7WA 5C0FA 4PRBA 3SCMC 2P43B 1DLHB 3O3EA 1BX2B 5GGVL 2R0WH 1WICA 1Y6NR 5CJOL 1MFAL 5FCUH 1G9NC 4OZIE 4PRPE 1OGAB 1RD6A 4OLYL 3TCLB 1E6JH 1HWGB 3GSNA 4Z7UA 2WBJD 2E27H 3HRZB 1KC5L 4NJAL 3NBNA 2DBLH 5ISZE 5IESH 2V6HA 4MMZC 4KROC 4XHQA 1KIQB 3WXVH 1I7TB 3RZCA 1ZGLA 5HI4C 3D39B 4PREB 1SYSA 1V7NH 3S4SB 1JNHB 4DEPC 4LBEB 5K9KB 1MI5A 3LD8C 2RHEA 4QT5A 5HHPB 4KJQC 4U0QB 3CXDL 2J6EH 2O93L 3LQAL 4CJ0A 4JJ5A 2GIYA 4ZD3H 4X8JA 2F74A 4QXUH 3REWB 4L4VE 4PJ8C 3IFLH 2Y6SD 12E8L 4R4ND 5IF0B 2VSDA 5F9JB 1QSZA 5ID1A 1HN1A 4YPJA 1SEBA 2Y23A 3RNQB 3H3BC 1AXSB 5BOPA 4HZLA 4ZPTA 2Y9RT 3OAZK 3SKNB 4P5MA 4NRZA 3VWKA 4JDTH 3QUYA 2VXUH 2X1XR 4PY8I 1N5YL 1EH9A 4ZNEA 3CC5B 2C7UB 2OZ4L 4PLKD 5FA4B 4YAQB 5KOVC 3I6GA 4C4KO 4JCLA 4G6JL 3BH9A 2CLVB 2Z8SA 4NP4H 4S1SH 1NCDL 3T77A 5CMAA 1RFDL 2B2XL 3GMNA 4WWKB 1OTUD 1WBXB 1OAUH 8CGTA 4PUBL 5IHUH 3W0WB 1G9MH 1MCJA 1A1NA 3KXFD 1IKNC 2EIBA 3KPSD 4PV8A 5TE7L 5L2JB 3T0DA 4HUWA 5FV1L 4OQTA 1AKJB 3HG1B 4OFKA 3KPMB 4LEXL 1CDGA 3HPLA 3QQ4B 4PJAA 5DA0B 5L2KA 3DROB 4J12A 3BRGC 2FWOB 1DQQA 2DTML 3C08L 5JIIA 3GSUA 1ERNA 1C1EH 3DI2B 4IRSB 2CQVA 4JFDA 3FN0H 4P3WA 5IB2B 5E8NA 5F96L 5CSZA 3ARYA 1AXTH 3CSYB 1ORSB 1YJDL 4OD3H 4LLWB 5BZWA 2IG2H 3BVNB 4D0DB 2XZCL 1Z2KA 1KIPB 4YDJB 5F7LB 1ES0B 5AYUH 4ZXBA 3ZLQC 4P5KB 1NLBL 1GAFH 3O4OB 2GK0A 3FRPG 2FZ3A 4XVUC 1MIEL 4Y2OA 5D5MF 2DL2A 4JN2A 2C26A 4O2EB 4NQCA 5FHBH 1MCWW 4HCRA 3BH8A 2P49B 3D2UD 2NYYD 4CGTA 2BXZA 1M71A 4WUUA 4LP5A 2ZKHH 1TVHA 3L9RA 3MV8D 2R2EB 2RFXA 1MNUL 4X4YA 1A9BB 1VCAA 3KR3H 5FK9A 5J6GB 4K7FA 2ATPB 5CEXA 5ILTH 2Y07H 4D8PA 3DJ9A 2HTLD 4H25B 1EFQA 4Z7VA 2HRLA 1DUYB 3QT2A 1XCTB 3LKNB 3HAEA 3SCMA 1DN2A 1YYLL 3QRFM 4M48L 1FFRA 1MWAH 5C09D 2AJSL 4OCNC 2WV3A 1XH3B 5CS7A 1NFIA 3MSPA 3MOBH 4TTGA 3LQAC 4KUCD 1JV5A 3D85D 1UB6A 3QDME 1C5CH 4QRUB 5GGSY 1HH9B 3NCBB 2C3GA 3C5ZC 3WEXB 2X4PA 4UOJA 1BZ9B 1L7TL 3RVWD 5K9JL 1F13A 3ULVH 4IEFB 3N1PC 2YUXA 5AZEL 1GIGL 4X7SL 4J4PD 2DQTL 3MLUL 4QHNB 1U58A 2YPLB 1JPFA 3QEGL 4XP1H 3RZCD 1AGDA 4QHLB 1CE6B 1N0LA 1OLZA 4AM0B 3C60C 5HPMB 5E7FA 4NWUH 5I75B 1MI5D 3BEVB 3QH3B 4QEGA 5I16A 1Q9OA 4U3CA 2BVPB 3EOYG 4GW5B 1AQDA 3PV6A 3STLA 5TFSH 4Q97A 4P5TA 3DV4B 1EMTH 4LRNH 1EZVX 2OTPA 3OKDA 2BK8A 1MRFL 4NN7B 3S96A 3I2CH 1IQDB 4ODUA 1S7XA 1ZT1A 2P45B 3HZYA 4JN1L 3I6LE 3OPZL 3CAFA 3R0NA 4FQJH 4HJJL 1FNEB 5D1QB 4Z0XB 4PJDA 2WUCL 2FECI 3O0RL 4XC1L 2DQUL 1C12A 3VWKD 2VR4A 5I30H 3DX8A 3QUYD 1A3LH 3BN9D 1CZ8L 3VFTB 1SMOA 5EIIA 4PJEF 2LAGB 2D03H 2QHRL 1KIUA 2YSSA 1DL7H 1IKNA 4BFEA 1I1YA 1NDGB 1YJDC 1LWRA 4F37F 1KJMA 4IM8A 5D7KE 3G6DL 3OXRB 3VXUB 3QNZA 3TH3T 1KJVB 4TSAH 3P11H 4XAWH 2QTEA 2EICA 3T0XA 4UB0H 5H94A 3GKWL 3ARSA 3OF6A 1HINH 4OTXH 4N1EA 4HXAH 2P8PA 5L2KD 1V05A 2MCPH 1F58H 1G7MB 2JJUA 1HSAB 3HI1B 1WWAX 1XGYH 5CJ8A 3VXTA 4NUJB 4YPGA 3U9PH 2YA0A 1IGML 1PSKH 1S3KH 4JFDD 3SDAC 1CS6A 1VFUA 1ZA3A 3F7PC 4ZFZA 3AAZB 1WIUA 4P2QB 3H3PH 4OD2A 1ACYL 3B6SA 3BKML 4JFFE 1FYTB 1YN6A 4I9WD 3MLZL 3RX8A 3BZFB 4I3RL 4IIQB 3MFGB 2FJFA 4UILL 4ISVB 2XKNB 1NBQA 3VI4E 2H2SC 4W4OC 5IM7A 3B4NA 4NQCD 2YD9A 1RZ8B 4HLZH 2A6JB 4R97C 1FZOB 3U36B 4WUUD 4BZYA 4PJEB 2XN9A 5I2IA 1FLRL 4HAFA 4O2FA 2FX7L 3MYZA 4S1QH 4OIIH 4DCQB 3SCMD 3QCTL 1QNZL 1QLFB 2MNUA 1N4XL 3EYQC 1EHAA 4J23A 3B2VL 4FQCH 2X70A 2KH2B 3C5ZA 4OD1L 4PYHA 4OI9A 1RUAH 1ADQL 1X5FA 3TPUA 5JW4N 5JW4M 1TPXB 2NZ9D 1F4YL 1FZJB 2EIEA 3FT3A 4I5BA 1QSEA 3IVKA 3WKMH 4Q9QH 4EN3C 5LGJB 2BSTA 3IJYA 1K3ZA 4PY7A 1Q1JL 3E6FA 1KEGL 3GMPB 4HT1H 5BO1L 1BREA 3QYCA 2VLME 1BGXL 3DPBA 3C60A 4YXHL 3CZJA 3ZYJA 3MNVB 1JPSH 4ZS7L 3H0TB 1ZLUH 2D4FA 1NUGA 1UM5L 4JM2B 1PDKA 4WTZG 1VENA 3P9WB 1VFAA 4H0HB 3N1MC 3FFCA 4AIZA 4WHYH 3NA9L 5DMIH 2XZQL 3ARGC 4QTIH 3BP6A 5EO9A 2OQJA 2Y7QA 4HXBL 3B5TA 5INCB 1R3LB 4ZFOA 1OSZB 1RZIA 3H7LA 4U05A 2AV1B 4P5TD 3WIIL 1U8PB 4HKXA 2XYCA 4XZUB 2KZWA 5JUEL 3N1QC 2X42A 3PGDA 1HH6A 4NM4L 4MD4B 2IJ0C 4GXUN 5DLML 4M5ZL 4R26L 1YECL 4GXUM 5T3XL 4F3FB 2YC1B 5HYFA 2P24A 2RB8A 4BQ9A 5L8LB 2FRGP 5DO2C 1SJHA 4O00A 3VGGA 1BFSA 3UMTA 5IOPA 2CKBB 4Y4FA 3ZKQD 3ALXA 3I50H 5E00A 5IBTL 2R1XB 3MC0A 3OKLA 1X4YA 4DVBA 5D7SL 3KXFE 4KH2A 1T4KB 1BJ1J 2H26B 3MYJA 3E0GA 4M3JA 2ADGA 3ZKNC 4K2UL 3G04A 2P8MB 5C9JA 4PTTB 5IB1B 3KPRE 1T6WA 4JQXA 2D7QA 2X7LA 3CGTA 1T2QL 2O5ZH 4LSSL 3OF6D 4JG1L 2X4UB 2LFGA 3JV5A 5ICYA 1KYOJ 3V4UL 3UC0L 4J3WA 2YUVA 3V7AE 3AVEA 4WV1A 4K94H 4LVHC 4M8QA 4PJGF 4GLRI 4ODHH 5GGUA 3UAJC 1OAQH 5EOQH 2VLKE 3I3DA 2KUTA 3K3QA 1JPST 1YEFL 3QG6B 1RIVH 2G5RA 3S36X 3UPAA 1HHHB 4JVUA 4Z7NE 4XH2B 5TE4L 3V5DA 3RIFK 5F9WC 4U1GB 4NRYB 1NAKH 5IFAH 3TLRA 3WUWG 4JHZA 5B8CB 3QXDB 2PCPB 4W4OA 4HGWA 1KNOB 2VLJE 5CP7B 1NJ9A 5FYJH 4EOWH 3B43A 3CU1A 1T03L 3X13A 1CT8B 5EWIH 2GUOA 4GS7C 2PTUA 3U4EA 5KVMC 4F7PB 2J7LA 2OP4L 2JB5L 3MJ9L 2FR4A 4WFHD 5DD1L 2APWA 1G1CA 1AI1H 1S7VA 3K0WA 2RAMA 1YN7A 1P4LA 3GSRA 4KV5E 4P59L 4NQTA 2PW1B 1UGNA 2UVFA 3ZDXE 4IBLT 2LU3A 1HXYA 4JY6A 1I75A 1I3GL 2NX5E 1YUHA 2GSGA 3QI9C 1O0VA 4YNYB 3MV7B 3SHSA 3CDCA 4XBEH 3U30B 1U42A 4Z7UE 5ETUA 2P4AB 4KZEL 3QAZB 3VFSA 2NY3C 4WHDA 4N90D 1UB5B 1QSED 3DUUA 1R3JB 2HFFA 5SWSA 2EIZB 1LDSA 1FLTX 2H9GA 1ACZA 3ARBB 4TYUA 4U1MA 4G8EA 3O6KL 3GSQB 3H3KA 3WHE0 3C60D 3VCLB 3X3FL 1BEYL 3WL9B 1A7RH 4MCYB 4RSVA 3ARGA 1KOAA 3HCVB 5EBMA 1B4JH 4WRLA 4WHTB 5J13C 1WZMA 4JREB 1I9JH 1BQSA 4B0MM 2GFBA 5D70L 1T1ZA 3BRDA 1NUNB 2I07A 1FFNB 2ITDA 3SDCA 1G6RA 3FFCD 3H7BB 3S3PA 5EU6A 5EBLB 5FHAH 4G7VH 4KJYA 1AGEB 4G6FD 4AMKH 5B3JE 5D96C 3GNML 5B4MD 1OF2B 4RFOH 4V1DA 4YXKH 3IDUA 1JTPA 1BFVH 1QP1A 2ZCLH 3FB8B 3OAUL 3GSXA 1JZ5A 4BQBA 3FB7B 1WISA 3PL6C 4KMLB 1JPGB 3AY4A 1L7IH 2D7PA 2J8HA 2P5EA 3K1KC 3MUHL 3PF2A 4ODWA 1YMMA 3ZDYF 5D2LF 5DQDH 1RIUH 1YEDB 2NY2D 3RUGB 1NEZG 4ZNEE 4YR6B 3UTPE 5IVOA 5DJZB 2XTJB 3NPSB 5TQ2L 2YPKA 2Z91B 4DZ8A 2OL3B 5L7XH 4IRZL 4CJ1A 5FO7B 3WSQH 3MLPA 1YQVH 4NM8L 3JWDH 1MRDH 4Y4FD 2CKBH 2EDHA 1MJUL 3OKEA 4EUPB 5KS9F 3TN0A 3CVHL 1QA9A 4RISH 1KLUB 4OLVL 3CMGA 4XTRD 1D5BB 2NW2B 4G6MH 1X3DA 4NQXB 4WTXA 2HT4C 2IH3A 4PJAE 5L2KE 4X6BB 2ICWJ 3RTQB 5J6HB 4L1HA 2N1KA 2I26N 1QFWH 5F9AC 3WIHA 4PJFB 3QQNA 2AJVH 2NY0D 2D0HA 5LWYH 5IB3B 4OM1H 1J5OL 2J6EA 4WW2C 3MCLH 2FX8L 2EXWD 4M62H 2YMXL 4IMLB 1TTGA 2BMKB 5D1XC 5JHDB 2QQQA 3TPKA 4MCZA 5KVFH 1HXMA 1I85C 4N5ED 3HTLX 4WO4B 3MNZA 4N0FB 5DI8B 4P48A 5HYJB 5GZOD 4KVNL 2J4WL 2I5YH 4UV4L 4B41A 1WSST 4LCUB 1HYRC 4PRIA 3KPOB 3I02A 1HDMB 3WXWH 2FEDC 1ZSDB 3RWDB 3F7RA 4NQCE 5CZXD 5DJYB 1BLNB 4BUGA 4JQIH 5IQ9B 5F44A 4E0RA 1A4JB 3GSWB 2NY7L 3O9WA 1IC1A 1S7UB 5F1IA 1DQMH 4QXTA 4PP2B 3BESR 1KCSL 2F19H 3MODH 4Q6IB 4JDVB 3RVUD 1SY6L 5EZIH 2EECA 1HYSC 1EVUA 5E8PB 5HHNB 2ZUVA 4Z7VE 1NQBA 1IGFH 1S9VA 2ICES 1LMKA 5DFWH 2EDOA 4YC2B 2KKQA 5CBAA 3QI9A 2AK4B 5EBWA 1UG9A 1W72L 4QXWA 5AG8A 5I1AA 4MLIA 5DUBA 2EO9A 2PF6A 1T7YA 1S7QB 1TJGH 2NXZC 3F7VB 5C2BH 3QFJA 2HH0L 1R0AL 4FMFA 4YUEH 1VEMA 5IB5B 4K3EL 4Y19B 3MLWL 1GHFL 1I1FB 1J8HB 1VADB 1KEML 5SWSD 3MLRL 3PP4H 1F45A 3UJIL 4OCXL 2W38A 5C08A 4LCCB 1GZQB 3PWUB 5CINL 1RAMA 1ETZA 4MZ2A 3BP4A 1Q38A 4Z76A 1UZ6F 3HE7C 3FQTB 5D9SB 2G75A 3D0VA 3U9UB 4TTDD 1SVCP 4NYLB 2NXYB 1X5JA 4YFLI 3T2PA 2VLRD 3SDCD 2IBZY 3FT2A 1P84J 4GJTB 5EU6D 3LKQA 1N0XL 1EO8L 4CUCA 5C0DA 2GAZB 2IBGA 3NPZB 1T1YA 1KTKE 1MHPL 3C5JA 4O5LL 5KTEL 3QXVA 3VXOB 1A14H 2P1YA 1DBMH 3HFML 3M07A 1S7RA 2SEBA 2HTKC 2DQIL 5DJAA 4OZGF 3L3JA 4NQEB 4HPOH 2C4FU 2P5ED 1YMMD 4ZFGL 3CDGB 3WD5L 1BM3L 3JWNC 3B9KD 1J87A 2YPVH 4TRPL 5CD5C 5DR5H 3MQIA 3GJEA 1DLHA 2OL3H 1BX2A 2AERT 4RNRB 2DL9A 5E4EB 5IEKB 1NBZB 1MCEA 3M8OL 1OGAA 4MJIB 1INEL 2CLRB 2H6PB 2WW8A 1CIUA 5E6YA 3TN0D 5A2JH 3TCLA 3VI3F 5JIPA 3SOBH 4QHKJ 5EOCH 3HRZA 1IFHL 4Z0BL 5EORL 3TWCH 4K3JH 3ZL4L 4XVSH 1BF8A 1FZKB 3S3SA 1HOCB 5T33H 1Z6JT 1B2WL 4DGIL 4LLDA 1I7TA 2BVOB 3D39A 4UU9B 1L0XA 4PREA 5D1XA 1JE6A 4X9GA 4Q9BA 3S4SA 1JNHA 4LBEA 5JPMB 3CX5K 1I85A 2X9WA 4KJWC 5HHPA 1LE5B 1DBKL 2YA1A 2KBGA 3LZFL 5D8JL 2ERJB 1FORL 2CGRH 4HHAB 2R0KL 5DC4B 3RNQA 2PTTA 5LGKA 3A6CL 2P5WA 1AXSA 5C8JA 3CXDH 4Q58C 1Q0YH 4PRID 5JZ7C 2Y25A 1IILE 3TM6A 1IM9B 3SKNA 3B9EA 5IGXL 3HRPA 1JTOA 3MRNA 12E8H 1D5MB 4QNPE 2XN9E 3GSVB 2C7UA 3O9WD 5FA4A 4YAQA 5HHMB 5K9QG 5IBLD 1DLFL 1NEUA 2CLVA 4J3VA 1A8JH 2BY2A 3CSPA 3MOAH 4WWKA 1CE1L 4JQVC 1WBXA 2EXYD 1D3CA 3GBNH 5DZLA 5EUKB 1M7DB 1T0PB 1TZIB 3W0WA 1WCQA 1CL7L 3TBWB 1N5YH 1HCFX 5GZND 4HF5H 2IPUG 4HQQL 1AKJA 3ARFB 1M6OA 3KPMA 4H20L 2YD1A 5IMLB 4G6JH 2CMRH 1N2RB 1I7RB 1NCBL 3QQ4A 3R06B 1DANU 4MAYB 4WDIA 3V2AR 3MR9A 1RFDH 1ZT4B 2B2XH 3TO4C 1KPRB 3K4AA 2WMPA 4N90E 3B5HA 1I3RA 5F1NB 1CD0A 3QFJD 3SPVB 2DN7A 2AXGB 5IB2A 4X6DB 1CXIA 2JE8A 4ACPA 4LEXH 4OZHF 3CX5J 3VW3H 5KJRH 4LHUD 4O58L 4L8SB 1CBVL 3HE7A 3CSYA 4MLSA 3EYVB 4LLWA 4MQXD 3C08H 1H5BB 1JF6A 3L95B 3BVNA 4D0DA 5GRZA 3KAAA 3C6LB 5C08D 1KIPA 4YDJA 3VA2C 2BDNH 5C6TL 5BCAA 1ES0A 2JLLA 2L0DA 3AS3A 4QLRA 4X80L 4P5KA 1ZLUK 3QXAB 1X9QA 2EDRA 4Z7WB 5ADPL 5F96H 1EEUA 4GQ9L 5E4IA 5I8CB 3O3DA 2DJUA 2H2PD 1VGKB 4NZRL 1XGRB 1YC7A 2CDGB 3CDYA 4HIJB 2XA8L 4LLMB 5IHZA 4IIQC 3OMZA 1JGDB 3ZE0E 1NLBH 4ZG1A 3UTOA 1A9BA 2O5YH 2GTZB 2ZCKH 4H88L 1MIEH 2ATPA 4U1JB 5DEFB 4KZDL 1AE6H 2IFFL 3DURB 4NFCA 1AQKL 3U7WH 3LKNA 4OI7A 5DFVC 4LVOC 2Q6WB 3N9GL 4KI5D 2Z8WC 2OMNA 1XH3A 4X98B 3RNKB 4DTGL 4YDKL 4GUPB 1YYML 4QRUA 1HH9A 2HT4D 1OGAD 3WEXA 2VKWA 2Y36L 4DJMA 5B3NA 1JRHL 4BKLB 3ULVD 1KB9J 4A6YB 1RJZB 1KN4L 1KN2L 1A7PH 4YH6A 2F53A 4EDWH 4YHKL 3MUZ1 4XNQA 4QHNA 1H8SA 1IQWL 2Z31B 2YPLA 4P0DA 3QUXB 4YIQB 1OVZA 2IGFL 3W9EB 4B7IA 3D39D 3OR6A 4QHLA 1CE6A 2L7UA 1L7TH 5HVFB 4AM0A 5HPMA 4OM0L 3BEVA 2M8XA 3QH3A 3EIFA 4I3SH 1W72A 2BVPA 4GW5A 4X7SH 5D5MA 2EZ0D 3TVMD 1KGCE 4Z5RB 3VRLF 1X5AA 4PRAB 3T4YB 2DI9A 4PJIF 1ZT7B 3DV4A 4WWID 4YDLB 1F4WL 3ABZA 1AXIB 3TEUA 4Q7DA 4PFEA 3KVQA 5FECB 3F8UB 1F11B 1JZ3A 3GGWB 4KKAC 4XI5C 5D1QA 4Z0XA 5T3ZL 1Y6MR 1HZHL 1JUFA 5IBUG 3BMWA 4G5ZH 4XB8A 3MRFA 4JQVA 5GGQH 1CGTA 1F90L 4JN1H 2IH1A 1A7QH 1OGTB 4HFWB 1NDGA 3O8XC 4NO5B 2XIDA 1H9VA 3OGOE 4WWKD 1RQ5A 4WI2A 2WUCH 1TQBB 3O0RH 4WCYH 3OXRA 3C8DA 3K80A 4Y2DB 5TDOB 3FZUC 3AUVA 3VXUA 3W0WD 1CZ8H 1KJVA 2MQCA 1FBIL 4YFDB 1IZKA 1AKJD 3HG1D 4NO3B 2QHRH 1N64L 5D72H 4MHHG 5L9DH 3KPPB 4R0LB 5I6XC 4JR9H 4GW1B 1CCZA 1U8LA 1HSAA 3G6DH 3O6LH 3HI1A 4QHUB 3V6BR 5I74B 3IFOB 2OTWB 5F97E 3JTSB 3DETD 3G6JE 5SWSE 4IRSD 3PJSB 1QQDA 3FB5B 5DURB 1YEEH 2GEEA 1MF2L 3AAZA 3L3DB 1R24B 5JIHA 2DD8L 4P2QA 5IV2B 5GS0H 1JWSB 1GPOL 3OKOB 1FSKB 4OBSA 4Y1AA 1FYTA 3T0VA 1IGMH 1XGQB 4OF0A 3BZFA 4ZUSB 43C9B 4ENEC 3SEPA 5JORB 3C2AL 4LGRB 1NL0L 4IIQA 5EU6E 4ISVA 3GI8L 2XKNA 1A9EB 4K8RL 3VE0A 2A74B 3VGDA 3VXPA 4QRQB 4RMSA 4X6CF 3PWJB 4FQXC 1ACYH 3O81A 4N0RA 4V1DE 1RZ8A 1FZMA 2A6JA 1FZOA 1AFVH 3KWWB 3U36A 4ESKA 4LDLB 4PJEA 1CVRA 1E28B 3MLZH 4NOBA 4XXDB 3RKPA 4FNLL 4UILH 4KVCH 5KBNC 1Q0XL 3NH7L 4N9OB 4QHMB 4Y0GA 1NAML 4DCQA 1VPOH 1QLFA 1KFAL 1QFWM 3SDXB 1MCOL 4ELMF 5H2BB 1OD7A 4DKDC 3GJFB 3QCVH 5FUCE 1T22B 1FVEB 4K7PY 2VXQH 1MAML 1PG7W 2B1HL 4OLXH 1WC7A 4F7TB 4F33B 1FZJA 3C87A 5DJCA 2V17L 3TBYB 3QCTH 3ESVF 1QNZH 1JZ2A 2WUBH 5LGJA 5EZLA 3I3BA 5FUOL 1KBGL 3U30C 3GMPA 3FQNB 5IMMB 1VKXB 4OD1H 4A6YH 1ADQH 5MERA 3N85H 2Q7NA 1UADC 3MNVA 2ORBL 3BIKB 2DQJL 1EV2E 2YPLD 1WUNT 3Q1SH 2B8OT 3NCEB 4JM2A 1AY1L 1LP9E 3IDXL 4Y4HB 1VA9A 1KEGH