3P0GB

Structure of a nanobody-stabilized active state of the beta2 adrenoceptor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
b'VQLQESGGGLVQAGGSLRLSCAASGSIFSINTMGWYRQAPGKQRELVAAIHSGGSTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDYGAVLYEYDYWGQGTQVTVSSHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2 adrenergic receptor, Lysozyme
molecule tags Signaling protein, hydrolase
source organism Homo sapiens
publication title Structure of a nanobody-stabilized active state of the b2 adrenoceptor
pubmed doi rcsb
total genus 25
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2010-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p0gB00
1EGJA 1NEZB 2EDKA 5C0RH 1CDJA 4LVHC 2EYSA 4DK6A 3EZ8A 4XP9H 5CD3B 4ZSOA 3EHBC 5A2FA 4GQPH 1QYGL 3QIUD 4YDKH 5E99L 5DFTA 3RWHB 1SMOA 4YX2H 3LV3A 2F53B 2AV1B 3FQXB 2GT9B 5KTEH 5DRZB 2R0ZH 4RWYL 5IB1A 4YFLF 4P5TA 1BLNA 3IDUA 3TN0B 3DX7A 3WIFA 1KPRA 1KIQA 3AREA 5DS8A 1ZHLB 5F7NC 4PRIA 3R8QA 3VD4A 2R9HD 1G9EA 3RWCB 1YNTA 2NLJA 2R0LL 3BOVA 1DBBL 2IAND 1CBVL 3HMXL 4D0DA 2IBZX 4HZLA 1Q9OA 2OSLA 4PJHB 3MUZ1 1MRCL 1CG9B 1B0RB 2X4PB 3E6HA 4KK6C 5GS0D 2YKLH 5J6GB 4ORZC 5JUEL 3LN5B 1PQZB 2DJSA 2X44D 5K59E 3ULVL 5DDHB 3C5SB 4JR9H 4L3CA 3VFMA 5C0AD 2Z35A 2F19L 3Q6GL 4X98A 5SWZD 2VQ1B 3TFKD 3DOSA 4FZ8L 1FYTA 3OJDA 1HCVA 3G6AB 2RQ8A 4NRZA 4WNQB 1JVKA 4HWBA 1UYWH 4J6RL 3MLRL 5JW5A 2AK1H 3FN9A 1EEQA 3VW3H 4NUGL 2DWEB 2PW2A 1OD7A 3BW9B 2V2TA 1UZ6E 3I3DA 4FXKB 2A0LC 3PJSB 1NC4A 4ZQKB 3TCLB 4OM1L 1BBDL 1J1XL 2YRZA 2JJTA 2HVJA 5EWIH 4Y1AE 1OARH 2OBGA 3S5LG 2VITB 3BDYL 4L4TA 3B3IB 1EMTH 2NY4C 5HPMB 5IHZB 4L8CB 2X5PA 4R9HA 4GKZA 3HAEB 1LE9B 3UJIL 4EI5C 1TVBB 4OUOA 4LSPL 2Y23A 4IRJA 4X8XA 3ARYA 2F8XC 1IEBA 4MHHG 4XPHH 4NQTA 1A6VL 1YYLH 3UYPA 3PE9A 2GSGB 4D0CA 4LAJH 4PRDA 4JAMA 4RMQA 1RZKH 3KYMA 3IU3B 2DMKA 4QXTA 4AEHH 1NLBL 5TQ0H 2J6EH 3PL6D 1Y6MR 2ICEA 4RMRA 1AXTL 1YZZA 1BVKA 2J8UB 5DQ9A 3GEWB 4KDVA 1P7QA 1NCTA 5IW1A 2MCPL 5T5NG 4Y19D 1CU4H 3DSNA 4FFZL 4OLYL 4X9IA 5JR1L 5EBWB 5ECJE 3HCVA 2YPLE 2GTWB 1S9VB 2IFFL 4XHQA 4QF1A 2ZOLA 2ATPB 5E6YA 2NY4B 2CMRL 4YHNA 4WEUD 1LP9A 1NANH 1X5ZA 1NCAH 1T3FB 4JJ5A 2QADD 5F8QC 4KMQA 4LLMB 5E6IA 4ZUUA 2IAMB 1FNGB 5JHDB 4EI5B 4P3DB 4ZXBB 2OK0H 1A6UL 1A7NH 1NGXA 4NC0B 5EPMA 4FXGB 1MWAA 1L7IH 2VZOA 1HOCA 3QIBA 2Q7YB 3QEHA 5FM4A 3MJ6A 2ZCHL 1FVEA 3TLRA 3L3JA 4K3DH 2Q86B 2DQEL 2NY6C 4KK8D 4PGBB 2DQGH 4M7LT 1MAMH 1UH4A 3MC0A 3TNNB 2VXTL 4KUCD 5D7JA 5T3XD 4EN3B 4PB9H 2DKUA 5I1CL 2R4RL 4GAGL 3ARGA 4MVBD 3BFOA 5JXAH 5HGDB 1VPOH 4D9LL 3RDTA 1R3HA 1T7ZA 4G9DA 4ONOA 5D70H 3UTPE 4WU5B 1OM3L 3MRBB 4HJ0C 3UDWA 2AJVH 2J5LC 5INDB 4M1CC 4X6DF 3CC5A 1XGUB 3MACL 4Z7NF 1RZ7H 5E9DA 1ZLWH 2DD8L 2J8UF 1BOGB 4L9LA 4WUKL 4NQCA 1MHEA 4BK5A 2CKBH 32C2B 2Z31D 3A6BL 2EIEA 4LKXB 2GITB 3MMEA 2BXYA 3O3DB 3HUJF 2B2XL 3SGKC 5TF1L 3P9MA 4JQVA 2BJML 2Y1VA 3MRMB 1RUPL 3ROLB 1MCOL 4K94L 3ARSA 1NC4B 4UBDD 4YE4L 4ZQKA 3QJFB 1JPST 1RIUL 1N3NB 1RZGA 4LLYB 4ZNCD 5J1AA 1ZTXL 5D1XC 4G8EB 4Z7WA 5IWLC 3C09B 2R2BA 5ELIA 4I3RH 1QQDB 2EXWC 1ZT1A 2DTMH 4R4FL 5BQ7B 2J5LB 4Z7OE 2UV3A 1YN7A 4CVZA 1DLHB 2VXUH 1RIVH 4MCYB 2VITA 4XP4L 3ILQC 3GMQB 2CDGB 5GS0L 5B39B 2E9IA 4QHLA 3IFPA 4MA3B 3M17A 4FFYL 4FFWD 2R2EA 1TTUA 3D48R 1HHJA 1V7MH 1QRNE 1FL5A 4IRJB 1IGCH 5SV3A 3RWJA 3L3IB 1BJ1J 3RHWF 4JDZA 4Q2ZA 4ONGL 5FO9A 1I3RA 5C09E 3TGXA 2FSEA 4QXTB 3S35X 5GGSA 5TDNA 5IIEB 1EXUA 4GKOA 3GMNB 1H3WM 5EU4B 5FOBB 2XIDA 1NMAH 4F80A 1KT2B 3QIWA 3OG6B 3PDDA 1K4DA 2I07B 3O3BB 5I1KH 1OGAD 2XFXA 3C5ZC 3HRPA 1VEOA 4PJBB 4LQFL 1JI1A 5K9QI 1PSKL 3GMLA 2A73A 1AR1D 3SE9L 3OZ9L 2Q6WB 4H88L 1OPGL 3ARBD 4BZ1L 5A3IC 4CDGC 3C6SA 4XVSH 1HNGA 5FM5O 4WHYH 2R1WB 4WCYH 5E2TL 3HI5H 3KPRB 5FKPA 3HC3H 4FQHA 1C5CL 1Q94A 4G6KL 3SHSA 5JW4Q 2R2HA 3BP4B 4UAOB 2YK1L 1WCBB 2EDDA 3UJJH 3G5YB 3KYNB 4BQ6A 3FFCD 3DX8A 5F7YC 3MV9E 3MV8A 5D7JB 4EN3A 4OIIH 3DVGB 3C08H 5LAXA 3BQUD 4HS8L 4F7EB 3STBA 1IC5L 5KZCB 3PABB 1A5FH 5I1JH 1XGQB 5MEQB 5I1LA 5DZNA 3T65B 1JZ3A 2AJUL 3V4UH 1YA5A 2WK2A 1INDL 2VXQL 4KWUA 4JE4B 4NBXB 3OPZL 2PF6A 4HWZB 4CU8A 1U3HD 5EC2A 5E1AA 4I0PD 3SQOL 1JNLL 5DD1H 1W8NA 1HKFA 4HKJA 4Y19B 4Q0XL 5KSAA 2GY5A 3S3SA 3OG4B 5CJQL 1CQYA 3OWEA 5FECB 3VI4F 3ZKNC 1Y18A 5D8JL 3HUJE 4G43A 1O7VA 1KIQB 5SX5H 1M7DB 3WXVH 3AVEA 1WEJH 3Q6FA 1NDMA 5E08L 1GIGL 4K3EH 6FABL 3U0TB 2H6PA 2X10A 5GGVL 4JRWA 2BNRE 5CIPB 5CP7B 4F15B 5D7JC 5F9OL 3TWCH 5E5MA 1I3UA 5J1AB 4QNPF 5ITFA 4YK4C 4X7TB 3MRMA 4DFHA 5I18L 2YN3A 5BS0B 5ITBH 3LHPL 4ODXA 4PJFB 3VFSA 2BNQD 5C08B 3HMXA 1U42A 1PZ5A 4L5FL 2D7NA 3MSPA 4LNRB 5DJ0B 3MRQB 1I1AC 1IILE 1C16B 4PGEA 3EYQD 1KGCE 5LVEA 2HG5A 1U8OA 4M6NL 1D5ZA 3MLWL 4JN2B 3QQ9C 4CDHA 5L2KE 2VDMH 5EUOE 1BZ9A 2AJ3A 3P73B 4H8WC 1U8LA 3ULVD 5FYKL 3WSQH 3REWB 4OKVA 3WNOA 1CDGA 5KSBF 1K5NA 4L8SB 1FCCA 1G7LB 1IRAY 3F12B 3GFUA 4R96B 4PJCB 5CJOH 3P9WB 3FO0L 3EOTL 3P0YH 4ZS6C 1P9MA 1V3MA 3DJ9A 5GGSY 4EN3D 4MGXA 1OB1B 5EU7C 1I1YB 3QUYD 3TWCL 3ECBA 1JPFA 4HJJL 2P8LA 1JNHA 4PGJA 4F2MA 2D31A 1B4JH 1DVFA 3U9UB 3SO3C 3T0VA 4FQIL 4WENB 1D9KC 4APQB 4XVJH 3A6OA 5D8JH 4JO1L 2A9ML 5CJQH 3MRCA 2JJSC 1CDYA 2B4CH 4MB5A 1JF6A 2YPKB 5T1KA 2NY1D 2WUBL 5DRXA 3BT2H 4QGYA 2QQNL 3DGGB 1INDH 2VXQH 5E00A 3V4UL 3K8LA 2OCFD 2CLRB 5HYJA 3QQ4A 1ROWA 3SJVD 3PWPB 5EOTA 1QSFD 5B8CA 1S9WA 3V4PH 1HXYA 2FGWH 1MOEA 3NAAH 5FA3B 3EJZD 3V0AC 4U7MA 1BREA 5DMKA 1NC2A 3QXDB 4ELME 1OWRM 1MVFA 1XIWB 1A9BA 1OLZA 1UM5H 2H3NA 4G6KH 2NXYC 1ZGLM 1WZKA 3NCCB 3HC3L 4HMCA 3UMTA 4I1NB 4PBWD 4XNZC 4YHYC 2IQAB 1E6JH 4F7MA 1Y18B 2C3WA 5C92A 3BH8A 3O6FC 5F1NB 1EEUA 3TBTA 3MO1B 4U6YA 2BERA 5LBSL 4WCYL 5BRZD 1W8OA 4P3WA 5KG9B 2DM7A 1YY9C 1CD0A 1QFWH 5IROA 35C8L 3SE9H 5C07A 2BNRD 3HRZA 3CXHK 3R8BB 4KGLA 4FQLH 3GSUA 5D93C 4MNHB 3CLFL 4OFKA 3LSOA 5ITFB 3TESA 4JFDA 3H9HB 4WW2F 4JCLA 4YHKL 2I9TA 4S0SD 5IBUB 3BH9A 2UUDK 1W2KT 3CJJA 4S1DD 5E6ZA 5KN5B 2JLLA 5TGBB 4RFEA 1QD0A 4GG8B 4LSQH 4BKLB 2NXYB 1A6WL 3LKPB 1V7ML 1D5ZB 2HJKA 2EH8L 1XF4A 3HR5A 1PLGL 3I3BA 2NR6C 3SGDH 3QUML 3WEXB 3GM8A 4L1DA 3RGHA 5F7HA 3RFZC 1RIVL 1ITCA 3MJ7A 4S10A 2W9DL 3LZFL 5ETUB 2OTWA 2JJWA 3CU1A 3P77A 2RGSA 5BXFB 3QNXB 1IAII 3VJ6B 4E41A 4C59B 4XHJC 1B0GB 3UTZA 1HIML 1FNEA 3UCRA 4HF5H 3B2VH 2AEPH 2GJZB 2KKQA 4GXVL 5FKAB 2V9RA 3PQYB 5F7FA 3IS1X 2XICA 1RUPH 5GRZA 2D03H 4OKDA 5TF1H 3UTSB 5C0DB 1I9EA 2JCCA 2MHAA 3B9DA 3A6BH 3IFPB 4UDUB 5I1HL 3L6FB 2XWJA 4J3VA 1U92B 4EXKA 3GJFK 2F8OA 4KI5F 4PG2A 5BOZG 2N7BA 3QUYC 3WS6C 2AQ2A 4IRJD 1VESA 3MJ8B 1X5HA 3FO2B 3BJLA 5F96H 2DL2A 1MFNA 3NCJL 2DDQL 3S35H 5SX5K 3SGKA 1G9NH 1JCKA 3IKCA 2IQ9H 4WDIB 1CF8H 4HKXB 5C0BD 5I1CH 1AGFB 1BD2A 3BRFA 3O6ML 1ORQA 5E8NB 4HDIA 2DM4A 1Q1JL 2FJFB 4F9LC 4MNQB 3V5DA 2DQGL 3AS1A 4H20L 2OL3L 5JW4M 2HTKC 4EUPG 1CXKA 1TJHH 1NLDL 1YQVL 4JFQB 5EBMB 5LQBL 1G9MH 2VLKD 2ZCHH 1S5IH 1EEYB 1A7PL 3QQ3B 1OAKL 1YEIH 4XBPB 2DJUA 4KTDH 3QIUA 1AGCA 1L7IL 3B9KC 1RHHB 2AEQL 2NNAB 2JIXB 3F7YA 3QEQB 4LSRH 2R2HB 3BP4A 1L9MA 4RGND 4H0GA 1FGNH 4KVNL 3MCKB 2WM0A 5D2NB 1MCWW 5B38B 5L7XH 3KYNA 4X4XA 2FEEI 3MXVH 1YEKL 4G80A 3HI6L 1JHTA 3IDIA 5FYKD 1F58H 3MMEB 1G1YA 4HKBB 4JG0H 4LK4A 3MPCA 4C56E 3CVHB 1U8HB 2W0KA 4WV1A 3GRWH 1AP2A 4YUEH 4PRID 3LVEA 2G2RA 3LQAL 4MDIA 1ZOXA 5TE7L 3U9PH 4D9QD 3FQWB 1UWXH 4MCZB 3DBXB 4P5TD 2KQNA 4NKDA 3WKML 3BHBA 2FGZA 3I6GA 5A16B 2WWKT 3T0EE 2A6JA 2EXYD 4ZAKD 2X89A 3CMOH 4G6MH 1QQDA 2J6EL 3ZHDA 4QRSA 5EZLB 1K3IA 5DRNB 1ED3A 4P2YA 3FOLA 5EC1B 2IALA 4OB5H 1JF5A 4Z7WF 3B9KB 4HWBH 5F9DC 2QSVA 4EDXA 4PV9A 4WW2C 1FP5A 1KG0B 2P7TA 4LSPH 2HJKB 4O2CA 3O0RL 4QRTB 5IWLA 4GUPB 4NQCD 2BOBA 4YIQB 3T2NL 4R7DB 4NQSA 4Q9CA 2EYTB 5IB3B 4MA7H 1MQKL 5SX4I 2YSSA 4C54A 3ALPA 2V2WA 4DN3H 2E6JA 1UKQA 3O6LL 5IFHH 3SE8L 1BQLH 2LU7A 1KENL 5L2JA 1MJ8H 5F7KC 3L3GB 1FAIL 3UTZB 4LLDA 1I1AA 3FB8B 5DURD 1E4KC 1VEMA 4NOBA 4WHTA 3JTTB 3GO1L 1MH5A 4R90H 4Y2DB 1XGPA 3GRWL 4ISVA 4OLWL 2Y5TA 4X9GA 4KRNA 5C70A 4KKBD 3ZE2E 1M71B 2J88H 4BFEA 1KLFA 4KI5D 4XVUD 4LSSL 2WIMA 4J4PC 1H3GA 1J7VR 1ZEAL 3U30B 3SE4C 2VMFA 3WE6B 4HK3J 4XVTL 4R4BA 3VXSA 5FIEA 1FGNL 4KVNH 5FHAL 1HYSC 2JJUA 4ZPVB 1BPVA 3ULVH 3PWNA 1K8IB 1OAXH 1CQKA 3OKYA 3O2DA 4LLVB 4ORGA 1LEKA 3V6ZB 1YEIL 1I8LC 1OAKH 4LHUG 5C0BA 1B4RA 1MRCH 1QPXA 1G9ML 1DUYB 4LEXL 5E8NA 2XZAL 2O5ZH 3D69A 1IVLA 4MNQA 1KB5L 2JCCF 1I85A 1ONQA 3GMRB 4NWUH 4P59L 4NZUL 25C8H 1QG3A 1ORQB 2JF1A 5DJ6A 4PD4J 3KLHD 4XCEA 4ZSOE 1AQDA 4EEEA 5F1KC 3TYFA 2LE9A 3CFDA 2DDQH 3S35L 1C1EH 4N68A 4J12A 1F90H 5DLML 2B5IB 5FXCH 4CADA 4DVBA 2AK4D 1CLYL 2GI7A 5I9QC 1QYGH 3HZVB 4QRRB 2XWBB 5DJYB 2GJ6A 1N5AB 1FCGA 4CNIA 5K9KA 2QADC 2EDNA 2R69L 4PJEA 3QPQC 5DJCB 1JHTB 2BNQB 3G6JE 1IJ9A 5JIHA 3TVMB 4PY8J 5TH2B 2XRAL 1H3VA 4PJIE 4HEPG 2D03L 3I2CL 1I1FB 1S78C 4PJ9B 1T5WA 3RAJL 5I19L 5DRNA 3DXAD 3F7VB 2FX8L 2AEPL 3MREB 1J10A 1W72H 5A16A 2P5WD 4N0YH 4A2LA 4L4TB 2HN7A 3I6LE 3QO1A 5K9JH 2OZ4L 4KKLD 2AS5M 1HZHL 3VXUA 4MVBC 1UKSA 1KB9K 5ID1A 4MJ2A 4XX1E 1AHWB 2ZUQB 5L8LB 2AJXH 4HHAA 2GSGA 5C09D 5IB4B 4KH2A 3VFUB 5K9QG 3U36B 3EYUH 2EH8H 1J0IA 3W9EA 2HP4A 4HIXH 4JKPL 1R3KA 4CGTA 4B50A 5GRJH 3ARFB 4PJ7E 1INQB 4TQEH 4V1DA 5I8CB 1HYRC 1XZ0A 4XPBL 1T0MA 3BVNB 5HI5D 1LE9A 1CCZA 1ZSDA 1KFAH 4HLZG 5D7IE 5EU3A 3UBXG 2GAZA 3LN4B 3MRJB 3CNKA 5CJBA 4YHKH 2P49B 5GXBB 4N5EC 3PQYD 3ARVA 3KR3H 5CEZD 1UXWB 3WL9A 4DW2L 3MYZA 3MV11 1S7TA 5TFSH 4K23L 5JO5B 2DB8A 5IQ9A 1WJ3A 2LU3A 4F7TB 3R06A 1NEUA 1ADQH 4JB9H 4P3DA 2B1HH 3E3QE 4ZXBA 1OWWA 1UWXK 5BCAA 4OUUA 3ARWA 4NT6B 4Q9QH 1EGJL 3QUMA 3CGTA 3FFCE 4LVNC 4NHUA 5DFWH 4ZFFA 4YR6B 2JCCE 1IGFH 1R3LB 4DJMA 4OLUL 2ARJB 2ADGB 4HCRA 4JPKL 1S9WB 4NRXB 4PPTA 2FECL 3Q3GA 2KH2B 3SKOB 3X11A 1MWAB 5DFVD 1OGAA 3RZCA 4O2EB 3BZFB 5EO0A 4JZJC 4WTZA 5BW7C 3BGMA 3MBED 4OQTL 5FF6A 1CD1A 4KJWD 4LPVA 3VFGH 4IOIA 1Q9WB 4G9DB 2H3NB 2UUDH 2KPNA 4CU6A 3PWVB 5A43C 4FQJH 5HDOA 5E4EC 3FZUC 2CD0A 4MD5A 2O61A 2GJ6E 4P4KC 1LD9B 3FQXA 3QCUH 2B4CL 4EKXA 4OD2B 3EDEA 1NAMA 3BPCB 3RU8L 4ZNEE 2AV7A 2W65B 4JO1H 1WFUA 4YBHA 3RVXD 1NGQL 5C0JB 3EAKA 5ILTH 5JDSB 3QUZC 1DL7H 3UYRL 2GJ6B 4YLQT 4JANA 4OZIA 5HVWA 1EK3A 1I85C 4IDJH 4GSDH 1KN2H 5HHXL 5IK3B 2OP4H 2ZCLH 4PRBA 4Y5YA 3FB6B 3MLSL 3PGCA 3RUGF 3NIGF 3AGVA 5MP6H 2W0FA 4JZJB 3S96B 3WFBH 5DD0H 3S8WA 1S7XA 5BVPL 2VR4A 3FO0H 5CJOL 1U8JA 4HKJB 5ICZB 5HHQB 3FHAA 4KMLB 3FT4B 2Z91B 1B3JA 2IEPA 1DBML 1JFQL 5E4EB 3ROOA 1P4LB 5T1MB 5IMLA 1K2DB 2EE2A 3JV6A 2ZG3A 1RUKH 4I2XA 1JYVA 2X4QA 1W0WA 1NL0L 2NYYD 5DEFB 5I0ZA 5DRWA 1YEGL 2H6PB 4N8CL 4QTIL 3DGCR 3EOBA 4KJQC 4CJ1A 2AJZB 3SPVA 1GGBL 1ZLUH 3SE3A 3U7YL 2X4OA 4JPVL 1GC1C 2VZ1A 1BIIA 4NDMB 5C9KA 2OQJB 4K07A 4M8VA 3L5HA 4ODXB 4PJFA 3VFSB 3KNBB 4XWGH 1M6OB 1EXUB 1OHQA 3MLYH 1NCBL 5ITBL 1VFAB 1FBIL 4MDJA 5GRUL 3VFTA 3MFGB 5EOCJ 4LNRA 5DJ0A 4LMQE 4YXKH 2H8PB 4OF7A 4P4RA 5CEXB 1BOYA 4YDLC 3LRSA 1BFVH 3L3IA 4PY7A 3UROR 1MUJB 1BFTA 5DEGB 4LIQH 2DKSA 3UZQA 4K3EL 4YHZH 5E08H 4F37K 4WO4B 3WXVL 3QT2A 3IXAB 4JM4L 2VN4A 2XTJB 3R06B 1CR9H 4L4TD 1LO3L 1MF2H 3G5ZB 3JV5A 4N5ED 3CVHL 2NY3B 4XZUB 1EVTC 4JFOA 2D7OA 5DEZA 3OKDA 2VRAA 5B8CC 1OGAE 3TN0A 2R39A 1NFIA 5DHVB 4R4ND 2R1WA 2ARJA 5HI5C 4Y8AA 4WEMB 1LEIB 3BE1L 4PUBL 4F7EA 5EOQH 5E1HB 4JKLA 5LJYH 1CDIA 1XGQA 4OGAD 5JORB 4XNUL 4PJIB 4UNVA 1WBZA 2WMPA 3OAYH 1M05B 4PJDB 1I7RA 1NUNB 1WZ1H 2J1KA 2FBJL 4R4BB 3EYFB 3VXSB 1IL1B 4WFGD 1ZMYA 5D7IB 4Y19A 3HB3D 3KGRA 5TDOB 3MLXL 1MCEA 5HHNA 1ZGLA 1MFAH 2XTJC 4P46D 1RJYA 3T4AB 1NGWA 4TNVF 3IDIB 4KHTH 2AKRB 4XVSL 4U1LA 2F54A 4MJIE 5FM8A 2PUQT 2NQCA 5FUZL 3P9LA 4JQXA 5SWSD 3MUY1 3SDDC 3SKNA 1LK2B 3QZWB 4G8GE 4EI6B 1CLZL 3UJTH 4P0DA 2VAAB 3EDKA 4LPXA 4OZIF 1WGOA 3E1F1 1S3KL 5ICZA 4QRUB 5EU7E 1TTFA 1N2RA 2F74B 4XBGB 1J0YA 3D39E 3MBEC 4GG6F 4MJIA 4HUXA 5DUPH 3I9GH 3R1GL 4WUUE 1R0AH 2FATH 2HTLD 3HNSL 2FEDD 5GPRA 4UTAH 3FT2B 2CR3A 2MQCA 3QZWG 4N90E 4ALAL 4Y5VA 3RWDB 3EW3B 1CFSB 3RIFF 4QHMB 4B41A 5J12C 5I2IA 3NZ8A 1JN6A 4R3SA 3SE4A 3UAJD 1E4WH 1VA9A 1YEDA 2Q76B 5GS0H 5E8OB 1LMKA 4OZFG 1OTUC 2A77L 2HLFD 2QHRL 1N26A 5HGBB 3ES6B 4O58L 1CGWA 2PXYC 5T1KD 4UOW1 1ACYL 1CWVA 1IAOB 5CD5C 3V7MA 4P2RD 5F93C 4Z76A 4I0KA 5C09B 4JKWA 1A1NB 1HHHB 4I3RL 4R96A 3V6BR 4RNRA 1RZIA 1WZMA 3HE7C 3PWLB 4E41D 1S9YA 4M1GH 1X5AA 2X4TB 4L3AA 1QRNB 5AD0A 4PJEE 4I48B 1GC1L 2VDKL 4KHXH 3MBEB 3SOBL 1MCOH 3L3HA 4Y2DA 4Z7UE 4P9MH 4ZS7H 4X4ME 1JF1B 2FEDC 5L2KD 4NN6C 4LDLB 1AKJB 4DGYL 4X5WA 3P0GB 2R23B 5E7BA 3ARDB 1V5JA 4UU9A 5C9JB 4Q6IB 3ZYJA 4MD0B 1EO5A 4QRQA 3W9EB 2NY5H 3KPQB 1DBKL 3LY6A 4XHJD 5KAQG 3KPRD 2ZSWB 5J13B 4FQ1H 3D0LA 2X40A 4IIQA 1DQTA 4IEFB 1MFEH 2XN9A 3FL7A 3EYVB 1CE1H 2Q7YA 4ODUB 4QHNA 4KJYA 1EEZB 3Q1SH 2V17L 5DHVA 2N56A 2FEEL 1DUYA 1OLLA 4XMPL 1MLCB 2RIKA 5HHOE 1T3FA 2YUVA 5GJSH 2APXA 2XKNA 4P2QD 3OKDB 4ZO7A 5JXAL 1FNGA 5JHDA 4XP6L 1ZWIB 3QUZA 3QEUA 3CVIH 3VFPB 5JORA 3KLAB 3VFOA 3MRRA 3RY5A 4POZD 1U41A 4LHUD 5FFLA 3IAPA 1WTGT 4OLXL 5DD3H 2CDFB 2BX5A 4WUUA 1TQCC 4OFVA 4CU7A 4ODVL 4K3DL 1CD9B 4C56B 2YZ1A 2VLJB 3WXWL 5A2LH 4RGOL 2PCPB 1AXSB 4EVNB 3RVTC 1ZV5A 3G04A 3ARBB 1DBAL 1KCSL 3ARGB 4OGYL 4HMDA 2D7MA 2P48B 1WBYA 2Q8BL 3GMMA 1IFHH 1AY1L 3WHXB 3ZE1F 2C4XA 3E8UL 4UOW0 4M1CD 1F4YH 3GJEA 2C9AA 5KBNC 4LCCA 1X44A 3T0ED 4H26A 3EJYD 2AEWA 2NLJB 4JFDB 1RUQH 2X41A 3ULSA 3TJEH 1NMCB 4LSVL 4DOHE 1YEEL 4HUNB 1OQOA 3L7EB 4UINL 3OB0H 2YWZA 4AL8L 3DX7B 32C2A 2QHLA 3ULUC 4N1EA 4AIXA 3LN5A 2DQHH 1WTLA 4QRUA 5FDYA 3PHOA 5E4IA 1NLBH 4NQCE 2SEBB 4XT1C 2M2DA 3HPJB 4UNTA 2FD6H 5GS0C 3BKML 3V6OE 3NACL 3S36H 3JV0A 4MAYC 3GSRB 4YGAB 1NBZA 3FRPA 4M7LL 5C6TH 1GZPB 1LO2H 3QULA 3MLTB 4XB8A 1JPGA 4A6YH 5I16A 2X1QA 3VFMB 4J3SA 1IAKB 2E7MA 1D3CA 2ORBL 3I6GB 4RIRA 4AJ0A 4FN0A 2VQ1A 4OCRL 1KF9B 3MNWB 2ESVB 3VG9B 1BEYL 3S34H 4FMFA 3TCLA 4MXWH 2G5BB 3RUGB 2HVJB 3QEQD 3PWLA 1MCDA 1KCVH 1HHJB 3F7PC 1DZBA 4HV8A 4G9FA 3MLZH 3RWJB 3EO1B 1CFVH 4AQ1B 4BQ9A 1P1ZB 4UU9B 3MLRH 4L8CA 1P7KB 2PR4L 2Y9RT 4P5TC 3V7AG 1YECL 2CR6A 3OR6A 4MX7B 1M4KA 5T5FL 3SDYL 1SYVA 4UDTB 4H1LA 3S4SA 4XWOD 2NXZD 5FDWB 4U3CA 4M6OH 2FZ3A 1FO0A 2NW3A 4JR9L 5EZIH 5AEAA 4LF3A 2X42A 1KEML 4XAKE 3LEVH 1U3JA 3KPPA 4EDWH 1TJGH 4P2QE 2EH7L 3SDAA 3EYVA 1BAFH 2W0PA 3ARUA 3UPAA 5FYJD 1T21A 3H0TA 4JM2F 5DQJB 1XGPB 2YWYA 4PLJC 3HE7A 5M94B 1LNUB 2ID5A 4WW1A 1GPOH 3CDCA 4WO4A 2ZOLB 4HG4J 1QSFA 5HVFB 1DDHB 4D0DB 3V52L 2W59A 3TO4D 4APQA 1WC7A 4P5TB 1HI6A 3FMGH 3WIFB 4D9RE 4JRYE 4OSUL 1EBAA 3DHMA 4KJPD 1ZVYA 2R0ZL 3QDME 2EDOA 3ZZ1A 1SY6L 4MZ3A 4ZNEA 2AQ3A 2OJZH 1TIUA 1G0DA 2ATPA 3OKKA 1SJHB 1XR8A 4Y5VC 4XAWH 1QACA 4ENEC 3VI3F 2V5SA 5T3ZH 2VE6B 5BRZA 5C0AB 3MOQA 1QZ1A 3NMEA 4CMHC 3TZVB 5CZKA 2IANE 2R4SH 2VXVH 1JL8A 1EJ6A 3PGCB 3NN8B 4KY1H 2ED7A 3REVA 2CIKA 1U3HB 4OV6F 4YXLL 4XPAL 4JHWH 1D5XB 3P0VL 4NCC2 5HHQA 3ESVF 4FFVC 1DUZB 3CX5K 2DBJA 3PWPE 3HG1A 4MNQD 1UGNA 5J6HA 1K6QL 4KDTA 4NM4L 1ZA3B 3W5NA 4KRPB 5L88L 5IMMB 3O9WB 1KC5H 2VDRL 3H42H 4PRNA 4JFYA 4MYWB 4ZD3L 2DWEA 1P53A 5IJKA 3ZYZA 4ZTPH 2AJYH 3MV7B 2B0SH 2EE9A 5BS0A 1ZK9A 4MHHI 4ONHA 1WFTA 5C08A 1GGCL 1CGSL 4UB0H 2HKHL 4CAGA 3KDMA 3F7QA 3BN9C 1P4IL 1K5NB 5A1AA 3JZ7A 2DQDL 1Q72L 4IHOA 1SYSA 4P9HH 2OR7A 2YPVH 1KJVB 1NKRA 5F1SA 5D7IF 1T22B 5ESVA 2J8UA 4M4RA 2BVPB 2PTTA 2QQLL 4LIQE 3BD5A 3K46A 4BYHA 1U8KB 2AJ3B 5C07E 4ZO9A 5CZVH 4JHBA 3BKCH 5E2VH 2BSSB 4NNXB 5D1XA 3W0WA 1JGEA 5GS1B 4OT1H 1FZOB 2D31B 4HQQH 4W4NA 3VWKA 3RDTD 1I7TB 1JGVH 2Q20A 1KEGH 3D0VA 1I8LA 3U36A 1OAZL 1P9MC 3LKOA 5J8OA 1I1YA 4EBQL 1ORSB 3OKEA 5EUOB 4M1DH 1NH6A 4V2BA 5KW9H 1M1SA 3DI3B 3BPNB 3BIAX 2IWGA 1NCWH 1LP9F 4ZFOA 3BO8A 2ZJSL 1OQXA 1IC4H 2NW3B 1A3RL 2CDGA 1VENA 3L1OL 2VL4A 4ODBD 5HYJB 4F58H 3BX7C 4K7PL 4F33B 3C2SA 1KTKE 3MBXH 2JCCB 3N1QC 3PWNB 4WWKC 4YPGB 1E4KA 1FLRL 4JDZB 4Q2ZB 5EH1A 1R3IL 4P2QB 1IE5A 1YEFL 5DQJA 2DQCH 1KB9J 2O93L 1QA9A 1G9MC 4CVUA 5DJ8A 2BC4A 4X8JB 4WW1B 3N85L 2R29H 4XVUC 3C6SB 1A02N 2C5DC 2A74A 1RFDH 3BWAB 2BNUA 4FTVE 4Y2DD 3H3PL 1QR4A 1RIHH 3OGCB 2AXGA 3D9AL 4P3CH 1JIBA 3OJVC 4LFHD 5TDPA 3BKJH 5BO1L 1NGPL 3ZDYF 5F6IC 2F54D 3QB7C 2Z31C 3EFFA 3P4OA 3TM6A 1R24B 1I8IA 2D3VA 2WUCL 4HUWB 5F72S 1EAPB 1OAQH 4M5ZH 4PRIB 5KZCD 4NZTL 4WW2A 1D5IL 2MKWA 3P9MB 4UZGA 3BI9X 1OW0C 4WWKB 5GHWL 4M48L 5F6HI 1AFVH 4TUOA 5I1EL 4N9GA 3IJYA 4XCNA 4Y88A 4DEPC 2VDQL 3SDXE 3TH4T 2HH0H 3WFEH 1XGRB 4HBQA 4JFEB 5GISL 5HHME 4K94C 4DQOL 3Q5YA 5DVOA 2AP2A 3D18A 1UM6L 3Q6FB 5F6IB 2CK0L 4TNWK 3IU4L 4LASL 3V8CA 1BBJA 1AJ7L 2FYYA 1CICC 1JWSB 1BZQK 3WJLA 4HUUA 3ZTNL 3GUTB 1A6TA 1S7UB 1HILB 3VFWA 3VXSD 2MPAH 5IQ7H 4RZCA 1Q0XH 4Q97A 1G0XA 5EU6B 1N6QH 1S7VB 4PJGA 3NPSC 2BNRA 2ZUSA 4YBLB 3S37L 2EO1A 4RISL 1FL6A 4MAYD 1Z5LB 1EV2E 3O45B 1IGJB 2DL9A 3OXSA 2PETA 4OCXL 3LMJH 1JGLL 15C8L 4QRRE 1MFDH 1G7PA 4DEPB 5I8KH 1FPTH 5I8CA 3P4MA 5EORH 1A3LH 1URLA 1KV3A 2EDLA 3GMPB 3LS4L 4M5YH 2UY6A 1N0XL 3VFNB 1MSPA 1TCRA 4S1RL 1XF2A 4MWFA 3C09C 4FQPA 3AU1B 3MA7A 2EYTA 4NT6A 1PZ5B 1YY8B 5GZND 4PRDB 5T1DH 5ANMB 4OKVB 3IU3A 2IPUG 2XQYK 4RA3A 2OTUA 2X70B 5CFHA 1VFBA 3V5KB 1HINH 5IHZA 5T1LB 3GMLB 3QDGD 1J8HA 5L2JB 2DQIH 3M8OL 4L3ED 3AFLA 4OCLC 5IB2A 3VA6A 3CFEB 3NPSB 4Q9BA 1UWGL 4NKIL 4DKFH 5I76A 1PGRB 2VKWA 5C0GB 3DRQB 4PRPD 2FDBP 4G7VL 2YD5A 4L4VB 3GBMH 3BEWB 2L0DA 1UFUA 3PDOA 2Z8WC 5JA8B 1MIEH 1F4WL 3DMMC 2VLLA 4BSWB 5HYIA 3N1PC 5KOMC 4EI5A 1L0QA 4BQCA 3WIIL 4U6HB 4NN5C 5IHBA 1BX2A 3FCTB 4M7KH 2NCMA 3QG7L 2BP3A 4TUKL 2OXGA 5C0BB 1XEDA 4KV5E 4QF1B 3SDAC 2NY0B 4G43B 4HUWA 4WFEE 3VMPA 4MMXC 1M7DA 4YDIL 3W11C 4U0RB 5I8OH 5DMIL 3PGDA 1D9KA 4RWHA 1HH9A 2EC9T 3TVMD 3V6FB 4QOKB 4WWKA 2GSIB 2G2RB 5C0BE 2XWTA 4G8GA 3IJSA 5FEBA 4NQEA 3F6IA 3CUPB 4X6CB 3BEVB 3U4BH 3DPBA 5F21B 2VOTA 1YC8A 4FQ2L 4YC2C 5DK2A 3BQUC 3V9FA 4R7NB 4QY8A 2EYRA 5DUBB 3BDBA 4OD1H 3VCLB 3C6LD 4LRIC 4TYUA 3TF7C 4ZUWA 5IBLD 3TNNA 5DTFA 1KB5B 2VIRB 3TPKA 5CP3A 5FGSA 5DMKB 1MVUA 3FTGB 4M3JA 1I4FB 5DJZA 1UXSA 1KTRL 4DAGH 5E6IC 5A2KH 3PF2A 4N0FA 3CFJB 2YS4A 3O2WL 1F8TL 4KPHL 5J57B 3NIFF 4Y4FA 1NANI 3QSKB 5CMAA 2Q3ZA 3K1DA 4OTXH 3PIQA 4UOJA 3THML 2IADB 4O4YL 3GUTA 4JZOA 5ANME 3O45A 4O2CB 4QWWD 4JVUA 1SMAA 3C60D 3FT2A 4H8WL 5I1AB 1FH5L 3MJ9H 3MV8E 1OF2A 1OW0A 3B9EA 3C5ZD 1CICD 3EDDA 4F15C 3QUXB 3OKNA 2H2SD 1H3PH 1F5WA 4KZEL 3QPXL 4X6DE 2QR0B 3O6FD 3UDWC 1Z5LA 2HLAB 1KCKA 1NUDA 4F3FB 2OI9C 3QHFH 1T03L 5D7SL 2Q76A 4HGMA 4PYGA 2YA1A 3VDBA 3DXAB 2Y7QB 3WLBB 3GSNL 4FQCH 5IG7B 4DZBA 1VDGA 2HFEA 3CSPA 3IXTB 1GZQB 5C0FA 5HGAB 3CLEH 4X6DA 3RWGB 4LLMA 5E6IB 1U8MB 1I1AB 4ZUUB 1F4XL 1RZFH 5MHSE 3DIFB 1TVHA 3TIDB 3WIHA 2DLFH 3AU1A 3MA7B 5F71A 1EVUA 1G7MB 5CLTA 2GYSA 3MR9B 3IDJB 5ANMA 4TTDD 4J1UA 3STLA 3OJMB 1PYWB 4WEBH 1E0OB 5KVGH 1ETZB 2JTDA 3X13B 3ILPB 3DGGA 4YAQA 5E2UL 3X3FH 1IM9D 4UT9L 2DS4A 2DQFA 4TPRL 4ONFH 3WV0A 4Y4FC 4O5LL 1FFNA 4WY7H 5CWSB 3I02B 5BXFA 2X1OA 3BSZL 1A7RL 1UB5A 4FXGA 5EUOF 3I50L 3S98A 4NNYA 5C0ND 2G60L 1I7RB 4TULH 4Z7VA 2CIIA 1QFPA 5ACZB 2V7HB 3SDXB 4I4WA 4OFPA 1OL0A 5IIEA 3LKNB 1KELH 2J4WL 5E00B 1CI5A 4JFED 4M61B 4ODTH 1PD6A 5TDOA 4Z7NE 1DN2A 3NGBB 1JZ2A 3QG6B 1NFDA 1UZ8B 2E6PA 4GW4B 5JZ7D 4R26H 4Z78B 4JRYD 3KJ6L 4U1MA 1HK6A 4IRZH 1WBZB 4YHPA 3GBLA 1NBQA 5L0QB 4M6AA 3TP4A 1D9KB 4KTEH 4Z0XA 4PRIE 5HHVH 4APQC 1T7XA 4W81A 5TPWL 1A21A 1RUMH 5SWZA 3GSOA 3MNVA 3NZHH 3M45A 3O2DL 3EOAB 1MHPL 1MNUL 4ZUTA 2YHGA 1HN1A 6CGTA 3V5DB 4EUPA 2IPTH 3HI1A 3LSOB 1A1OA 1R5VB 4JM2C 2BHZA 1IKFH 4LLUB 4PJXE 1JHLH 1IM9A 1KJ3L 3GHEL 4Y1AB 1J05B 3P30H 3TO4B 4D3CH 4LSDA 3QJFA 4FFVD 4KK9D 2ZKHL 2UZYB 3CFCH 1OAYH 2CGRL 5J6GA 1FFOA 4E42B 1AO7B 4K2UH 4HXAH 1IQWH 4X4XB 5JXEC 4X98B 3LB6D 5E95B 1XIWC 4GMSL 1MCPL 3MRHB 2XZCL 5EULV 1SVZA 3OJDB 4OJFH 2VNCA 5BZDA 2WBWB 2V7NB 2L7JA 3EO9H 4G3YL 4TUOB 1U91B 5HYJD 2DQTL 5BV7B 4MAUH 5IP4A 4KQ4H 3KHQA 5AD0B 5DK3A 1LK3H 3GMOA 2E7CA 3G6AA 1TJIL 3S37X 1X7QA 3KPOA 3TO4C 1G0YR 2VKXA 2EKSB 1L7TL 1MJUL 1PG7H 2FX9L 5HYQA 2C1OA 4GQ9H 3MYJA 4HK0A 1JTPA 3UPCA 1UXWA 3WL9B 3U0WH 4GW5B 3IXTA 4OI7A 4MA1C 1A22B 3UO1L 4JO2H 3QRGL 4HGWA 4X6FA 1B2WL 2R56H 2XZQL 2IANB 1VFOA 2BFVL 1NSNH 1Y6NR 1JZ8A 4JGJA 3TA3C 4NDMA 1BWMA 2CH8A 2E27L 1UZ6F 1YN6A 1ES0A 3QFJA 1FGVH 5GGRY 4XPGH 5D5MF 4PJHF 1U0QA 2UVEA 1CXHA 2RHEA 1S7WA 1LO4L 4GKZB 4G6AC 5ICXB 4OLVH 3ZSTA 4WI7A 1UM4H 5J7CC 3ZE0E 3ARRA 1U8LB 4K8RH 3SCMD 2H45A 5JXED 4Z7VB 5CLWA 2IGFL 2P8LB 2EZ0D 2DQUH 2NY6B 5KVFL 1G1CA 1DP0A 3UO1H 1MFCH 5FCUL 4KK5D 2GT9A 3L5XH 1SYVB 4Z95L 1G84A 3QXAB 2ADGA 4XRCB 3CIQA 4MA1B 2XKSA 4GW4A 4HWEH 2G75A 2O61B 1L7TH 3V7AE 4OD2A 4M61A 1MPAL 3ARQA 1MWAH 1YEHH 1NCDH 3WFHA 3DRTA 2FHFA 4MAUL 3NCYS 1AQKL 4F7CA 4PRHB 4NWTH 4PP1D 2VH5H 5I1IL 5F9WC 2Q8AH 4FQXC 3HG1E 1AE6L 4JPIA 2VLJA 4PP2A 1WISA 4A6YB 1QSFB 3BUYA 5KANG 5TE4H 3PWPD 4PV8B 3MRCB 2XN9E 4AEFA 4KQ3L 1FE8H 5HHPA 2JB5L 4MAYA 1MEXH 3ZT7A 4KJWC 4LARL 4GO6B 4XNXL 3HFML 3TYFB 4FXLA 1VACA 5F7MC 3B8YA 1KOAA 5JPMB 5KS9A 1OAYL 2BZDA 2D9CA 1UQSA 5A2IH 1HHKA 5DJDA 3FN0L 3OXRB 3IFNL 3CSYB 4TSBH 2DJ4A 3FRPG 1IZKA 1BZ7B 5DJ2B 2FB4H 4I77H 4JDTH 3EYQC 1P69B 1NC4D 2V5TA 2VYRE 3BP7B 1NAML 4K7FB 2D4FA 3SKMA 4NM8H 1UJTA 1CDBA 4J4PA 3RL2B 2OR9H 2CSPA 4POYA 1HDMA 2NZ9C 4LOUD 5D2NC 3IDGA 5HHVL 3LPFA 4KTEL 1U8PB 3INUH 5C6WH 5MEND 5C0CD 2WNGA 3RA7L 3MV7D 5EIIA 4JM2D 2CRZA 1N3NA 1RZGB 1SBSL 1TPXC 4LLYA 5KS9E 3WDHA 4BZ2L 1G7QB 4LLQB 1VB9A 4RMWA 3HUJB 3FO9B 3ZKMC 3PGFL 1AGDA 4JN1H 4APQD 5GS2H 2E6QA 3C5ZB 3SGEH 1XF2B 3PP4H 2G60H 3UTTA 1JYXA 3D3VD 1LEGA 4H1LG 4GW5A 4HBCH 3F7VA 5TQ2H 3BSZH 1I8MB 4QWWC 5FYLH 1QUNA 4WY7L 4F9LA 3KLHC 2UZIH 5C09A 4PS4H 5D72H 5CD5D 1J88A 4IMLA 1Y0LB 4QLRA 4BSJA 1OTTC 4E0RA 2ERJB 5DRXB 3RTQD 5TDNB 1FVCB 4LPWA 2YC1B 4LU5L 1IGIH 3HC0A 5EZJB 1VGEH 3QI9C 1V3LA 4QXUH 3VH8B 4NHCH 4N1CA 2R2EB 4L3EE 3FONB 5GRYA 3EFDL 2NY2B 3GMRA 4G6FD 5D1ZC 5IBLC 3C2AL 5IVZA 4X4YB 4M43H 5CBEA 3SCMA 2Y06L 5LXGL 1LE5B 2H2SC 4B0MM 4X7DC 2MQ3A 1RK0A 1JPTH 2DIJA 4FRWA 1TETL 2R1YB 2VDOH 2YEZA 1ZLUK 2WSKA 1CXIA 2C1PB 2Q86A 3FCTA 1DQJB 2B7DT 2K1MA 2A83B 4LSUL 5D6DC 4QHKJ 4M7ZB 2G9HB 2WZPD 5KSBB 4PJBE 1K4CB 2X4SA 3GSQA 4X4MA 5BJTA 1Q94B 1CLOL 2WBKA 3O4LA 3HZMB 3RWFB 4K71C 4X9FA 1OTUD 2HLFC 4UV7H 5C0AA 3U6RB 1U92A 3IAGC 2ERJC 4UNUA 4IS6B 2NY1B 1AGEA 2WBJC 4RGNE 3WIHH 3MROA 3EGSB 1EERB 4P46C 3K81A 3S3JA 2CIIB 5E9DD 2FJFA 4UIKL 5IESH 4EI6A 5EA0L 4CADB 2CDFA 4U1KA 3UP1A 4XXCA 3S9DB 3AXLB 4YDJB 1A14H 1FIGL 1YNKH 4LEOA 1P7HL 1AI1H 3GZKA 5L6YL 2X4RA 2KZ1B 4HUVB 3ZDZF 3MLUL 4PB0L 5D96B 1KB5A 1FZMB 2FH8A 3PP3K 3R4DA 4UT7H 2BDNL 2B8OT 3MA9H 3MRKB 1WCQA 3NZ8B 1T4KA 4R4NC 1T80A 2V9TA 3SKJH 3VGHA 4KMTL 2EDEA 2DYPB 4PG2C 4PG9A 1SM3L 3GMQA 5D7LE 4NQXB 1QLRB 3SY0A 4ERSL 5DMIH 5I71C 5C0CE 1BVZA 5CIPA 5CP7A 3K74B 4QNPE 1FL5B 5F89A 1BM3H 3JTSB 4XP5H 5SWSE 3KG5A 4M62L 3PDGA 5H94A 5LGHL 3U83A 1BD2E 4M4PA 2GJZA 2GCYB 4M7KL 1ZT7B 1AD9A 3WIIH 7FABH 2ZNWA 3TVMC 5HGBA 3FQUA 1I3VA 1AO7D 1CGXA 3N1MC 4LOUC 2JELH 4J23A 5JW5B 1JYWA 4KRMB 2AW2A 3X14A 4EDXB 4JZJA 5IFAL 3QCVL 1GVIA 3SGJA 4HFWB 2P24A 2QBWA 2FYYB 4QRTA 3MLVL 3TT3H 1O5DT 2BVYA 3HAEA 2QSCL 4Z5RA 4KROC 2C3HA 1FFRA 2KBGA 2FIRT 1DE4A 2X1XR 4DKFL 5FGRA 2X4OB 4YEEA 4HCRH 5B4MC 2YSSB 5KVMC 2P1YA 3C60C 5EZOL 4E5XA 1LWRA 4D94A 4HT1L 3IJHB 3CFKA 1AHWC 4P2RE 2MHAB 2DQFB 1V7NH 4IMLB 4GKSB 5DRWB 4HXBL 4Q6IA 1CGVA 3BESR 3PHQB 3DYMA 1J9CT 1AXIB 3W9DA 1FZKB 3ZHKA 3ARFC 3P4MB 4DUXA 5KSAC 1T1YA 1JNJA 2QSCH 3IFLL 2C4FU 2X4NB 2VDLL 4M5YL 5J11C 2VDNL 1MCKA 2HT2C 3H8NA 2F15A 2ATKA 3L7FA 2YD9A 4BUGA 3NCYP 3S37H 1RHHA 2NNAA 2VWEC 2YPLB 3F7YB 4NO3B 2DF3A 4XNZB 4YHYB 4PREA 2NY4D 3LQZA 3FB7B 5DHYA 2FL5B 2A74B 4HKZB 1C08A 4G80B 5C0EA 2QLVB 1DSFH 3TH3T 2ZPKH 2I24N 3DUSA 1B0RA 1KTDB 2L4OA 3HS0B 4LASH 2CK0H 2JIXA 4ZPTB 4NQVA 4UUJA 4NRYA 3SKJL 4LAQL 4PD4K 4XCFH 3G5XB 3WFEL 3HLAA 3TV3L 1RK1B 3QCTH 1FYTB 1IT9H 1NBVL 2WLYA 2XPGB 4KUCF 1HHGA 4BELD 3BGFC 3SE3C 1J5OL 3GI8H 3MGTB 4JFEA 3ELAT 2VLKE 3OAUH 5I1EH 3FT3B 3V2AR 5L6YH 2H32H 1FIGH 3FQWA 4UQ3A 5H37G 2XQYG 1JYNA 1TMCB 4ODWA 4JPWL 5FUCC 3HKFA 5EA0H 2EDHA 4DKDC 5LKNA 4JRXD 1KXQE 4S2SB 4JY4A 5C2BH 4WU5A 2XWTB 2P45B 3QNYB 3VXMB 3SBWA 5E8EA 4MNGE 3REWA 4UV7L 5HDLA 1RJLA 4GOSA 1QR1B 1CLOH 2DBLH 5T1LD 1MHEB 1QSEA 1A4KB 3RVUC 1RIHL 4JN2A 5HYJE 4XXDA 3VXPB 3G5VA 5EO9A 4MS8D 3DX9A 1GGTA 4NOFA 4OCSH 1JGDB 4MNHA 3BGFB 5AZEH 4Y4HA 1T5XA 1JN6B 4R3SB 5EU6A 4EZMA 3VFNA 1PG7X 5LXGH 3BISA 4LRNL 4QKXB 3C2AH 3KAAA 1VADB 1YPZB 2PTUA 3IXAA 3VWKD 1MCWM 2H26B 5HJ3A 1C7TA 4PJCA 1FSKB 2YD4A 4IOFC 4NHCL 4RFEB 3CD4A 5J1SC 4MLSA 1P7QB 3EO1A 2GK2A 3LKPA 3QNXA 1KBGH 3MXWL 3MCLL 2LAGB 1MAJA 3QWOA 1WAAA 2YD8A 4ZAKB 1A7OH 3LN4A 4JQIL 1BGXH 5D5MA 2BK8A 4PS4L 1HXMA 4LFHG 4OZGF 3DSFH 3MFFA 4MD4A 2VLRA 3OL2A 3QUZD 5IVXF 4B53A 2DRUA 4W70A 1TTGA 4F9PC 4JFHD 5D6CA 1SQ2N 2ZCKH 5FYLE 1JRHL 1NGZB 1ZHBA 3MOBL 2G75B 2X4NA 4JN1L 4NZRH 1XIWA 1MI5E 1XGTB 3HNVL 4P4KD 4C4KO 5CZVL 2W9EH 3AM8A 5ISZE 5FUOH 4RX4A 2I60L 4XCYB 3CU7A 2QQLH 3KPRA 4Y0GA 4AK1A 2CRYA 4AENA 4ZUSA 4OCWH 4MSWA 3DI2B 2W9LA 5DRZA 3JWOL 4P9HL 5DJYA 1HI6B 4NFCA 1NC2B 3QXDA 4A6YA 4QGTA 2E7LA 1XT5A 4G7YH 2IG2H 1U9KA 1XAUA 2VUOA 3BD3A 4PJ8D 8CGTA 5CD3A 4KC3B 2NY3C 3REVB 3FO1A 5HHNB 1ZGLB 1TFHA 2AJYL 4DGVH 3T3ME 3RWCA 2HWZH 2MQ0A 1AR2A 4NO0B 1KTDA 1RD6A 2CKNA 3HZKB 1HCFX 1HHIA 2GQHA 3CSBA 1WCBA 3TYGL 4UQ2A 4XNYH 4ZYKA 1NFDB 4O9HL 1S78D 4F57H 1N5YL 3G6DH 1WFOA 4WI6A 4N8VA 4OAWB 1CFBA 5AAMA 3DO7B 3PP3H 5EB9A 1NAMB 3BPCA 1W72B 3D25B 1RQ5A 3MJ9A 4K7FA 4FNLL 5HTSA 1GL4B 1JZ7A 3C8DA 8FABA 1A0QH 4KQ3H 2BSED 2VXVL 2R4SL 3IFOA 3MREA 3HPLA 4DCQB 1UH2A 5IB4A 2P42B 4Y5YB 2Q8AL 2IH1A 3FFCB 2W0FB 3HE6C 4JHAH 3KYAA 2FHBA 1XF3A 3BAEL 4LHQB 1GJIA 4X7TA 1GGIH 4G6JL 4N90D 3LEYH 4TSAL 4OSUH 5IEHA 4XXDB 1JUFB 1H8NA 4IHOB 2ILLA 2IMNA 3V52H 3LS5L 5H8DA 1IGMH 1I7ZA 4KVCL 5T33H 3V6OC 4FP8L 4ODSL 3U7WH 3P40A 1FNFA 3QHTC 4JRYA 4KJPC 3PHOB 4EOWH 4OCYH 3IDJA 1RVFH 3L3KA 5CGYC 1ERNA 3STLB 4Y5YC 5IG7A 1NEZG 5I15H 5HVGB 3RUGE 4M6OL 4X6DB 3C5JA 2Q6WA 2CRIA 3WUWA 5KJRL 2O5XL 1BZ9B 4RAHA 1DQDH 3QUKA 1CGUA 1F6AA 3SDYH 2DLHA 1IAKA 4ZSOB 1P1ZA 2E8ZA 1GGUA 1OSPL 2ESVA 1PYWA 2X9WA 3KPRE 1CFVL 4L4JA 1T1XB 1MCLA 1DEEA 1ZKAA 4MLIA 3AMLA 3UTSD 4Z7OF 1KTLB 4MZ2A 1SJEA 3G08B 1DN0A 2J3SA 2DMBA 3ARDC 1LK3L 4YGVA 2Q87A 1MLBA 5ACZA 2B5IC 2Y5TB 5FF6B 3F7RA 5D2NA 1AGEB 5E2WH 5IHUL 2UVFA 4DN4L 1FO0H 2K9UA 3LKSB 3S4SB 4H1LH 3E2HC 3OKMA 5IJVB 4P2RB 3TA3A 1ND0A 4MD5B 4DOHB 5JQ6H 1Q0YL 4O51B 2PYED 4OJFL 1DVFC 4U1MB 1LD9A 1NCCH 2NTFB 4X5XB 5EPMB 5L8JB 3F6LA 1RU9L 1G6RH 2ATKB 3L7FB 4GMSH 1MCIA 2ZUYA 43CAA 4UI2A 1EBPA 4QOKE 3KPNA 3GIZH 1QFUL 2XY2A 1FZMA 2VR5A 1C7SA 1T2QL 4LCCB 4IJ3C 2DQHL 4G8IB 1DQLH 3CZJA 2VISA 4HPOL 1CZ8H 4KKBC 3T1FB 4UINH 3IKKA 1A6ZA 1YMHA 2WLZA 2WIIB 1FNSL 1TQCB 4WUUD 3TJEL 3ULUL 4AG4L 3JXAA 3LB6C 4K9EL 5CINL 1HH9B 5K9KB 4BH7A 2E7LC 3VWJC 3GKWH 2ICWB 4U1SB 4DUWA 4RGNB 3K4AA 5ALBL 2CIKB 5SWSB 3VFWB 5IB3A 2SEBA 4KTYA 1IFHL 1RUML 5F3HA 4GRMA 1JNNL 3LRGA 4ZUVB 2V2WB 1D5BB 2C7UB 4JG1H 2WWKO 3GHBH 5IOPB 3OV6A 1ZT7A 2XI9A 4QXGH 4QTHA 4RGOH 3O9WD 4GUPA 5KS9F 1ZA6B 2PW1A 3NIDF 1U6AH 1JWUA 2VIRA 4R97C 4GW1B 4M7JL 1KELL 1LDPH 3MUJA 5DJZB 4NZJA 1QKZL 3JWDL 3O8XC 3DNKA 1YN7B 4XC1L 3RY6A 4N0FB 2WQ8A 1J11A 4TULL 5D1XD 3W0WD 4P23D 4LHUA 5F6HJ 1CFQA 5EUKB 2DTSA 5MI0B 1FG2A 3GSNA 4I0PC 2XY1A 5CEZL 4QXGL 3P77B 5D2NE 4LSTL 5KVGL 4AEIH 3QEQE 4UTBL 4O02L 2QL1A 4LLQA 4GG6B 4MWFB 1T1ZA 4PRHD 3WN5A 5ALBH 5TF0A 2HKFH 1J1PH 4P2OD 1YYMH 3TNMB 2PYEA 2ZP0T 4JJ5B 4YXHL 5T3ZD 4U1HB 2OJEB 3EDJA 3VG9C 4AG4H 4ZPVA 4WI5A 4PJIA 5I73B 5T1LA 3MRNB 5DT1H 1CZ8L 1E4XI 3WLWC 2COQA 3QHFL 3IRPX 3SDCD 3STZB 3WHE0 1UC6A 2YA2A 5HDQH 4KHXL 4FS0A 4TOYL 5DVKA 3MR9A 3OTTA 3GI9H 4ODHL 1A7QH 4H8WH 4P4KB 5LCVL 4JY6B 3V6OA 5IT2H 2AJSH 3KXFD 3CX5J 1NCCL 3O4LD 4OTXL 2EXWD 4ELKB 5JNYB 1B9ZA 3WBDA 1MI5A 1WITA 3VG0L 4NQEE 1D5MB 3QR2A 1ZS8A 2C4FT 3V8OA 4DN4H 5LAXB 3T09A 5IHUH 3DECA 3KYOB 4DAGL 1MJ7L 2DMCA 4XC3H 2MWCA 4CVXB 3OGOE 2YD3A 1EZVY 2J2ZA 1FDLL 2J8OA 5AYUH 5FUCE 1E4XL 4ALAH 4MJIB 5ESAB 4KKAD 1ZLSL 4PP2B 12E8L 1MRDL 3IDYC 1QBBA 1AGFA 1IAIM 2K7QA 2EDBA 3SKNB 5CGMA 3KLDA 4G8IA 3S97C 3O3DA 2QQKH 3P4OB 4UILL 1OSPH 3LOWA 1CLZH 1R24A 1KCRH 1YUHB 3L3OA 2DLTA 1D7FA 1VACB 1CFNB 4NJAH 3VXSE 1Z3GL 4G6FB 1KXVC 3E6FB 1EEYA 4PJDE 4BQ8A 4ZXBD 4U1KB 3LD8B 4Y5VB 3LRHA 2YA0A 4M9OA 2APBA 4OGZA 2IBGA 4F7PA 1QLFA 1QLEH 2H2PC 4GKNB 1I8IB 2BY1A 5JDSA 1U8JB 4S1SL 1QRNA 4TUKH 1ZA6A 1EHAA 2PW1B 3WEXA 3RL2A 2ICCA 1HE7A 4GRWB 3U7WL 1MFBL 4FP8H 4ODSH 3PXJA 4Z0BL 1KIUA 4I3SH 4PGZA 1CK0H 3FQRB 2VXSL 1HHHA 3IFOB 1CFQB 3QISA 1N6VA 5E5MB 4KK6D 3IJYB 5EOQL 4YQXL 4MXQD 4JREB 1BVLB 4WO4C 5CSZB 4HWUA 2QV2A 4WU7A 2O26U 5A40E 1N7ML 3O9WC 3P73A 1KUMA 1XGRA 5IVNA 1EH9A 3QH3B 1NMBH 1T20B 3LPWA 2WAHA 4F8TA 2X2YA 3CH8A 1FORL 2FBOJ 2W0LA 2P5EE 5JOPE 3ME0A 1P5VA 1R5WA 1UCBL 5DMYA 4JM4H 3LKOB 4FABL 2NY6D 4KK8C 2XNAB 2AABL 1MUJA 4IIQB 1I9RL 1YMME 1N0XH 3PL6C 1KXTB 2DQJH 5DD6A 1A3LL 5D9SA 3LKNA 1WIUA 3NH7L 3MRDA 3NH7H 3QO0A 4Y5XB 3TBYA 1JGLH 4OCXH 4YXKL 5CEXA 1EJOH 4JREC 4U4BA 2OTUB 4R8WH 5GRUH 4PY7B 4GAYA 4RISH 4PBXA 4AIOA 4JCMA 1UCBH 3S88L 2HWZL 1CD1B 4I0CC 1YNTB 2GTWA 3QBTB 4GAJH 3GSOB 3MNVB 4L29B 2MPAL 2AI0H 3OHXB 4KGJA 4L3EA 1VEPA 4RAUA 3BZEB 3LQMA 2H1PH 3QQ4B 2HT4D 5KSBA 5E1AB 3NCMA 5C7XL 1NL0H 3MODL 4N5UA 2NY7L 2GEEA 3PV6A 3SDDB 4HPYL 4IIQC 3RY4A 3X3GL 5F1IA 5E8PB 2PYFA 3F5WA 3HMWH 4HIEA 1P6FA 4IRSD 3SO5A 4LRIA 3PL6B 3VDAA 3QDGB 4ZTOH 2WINA 5E70A 2VJXA 2HH0L 1D6VL 1GCFA 4Q7DA 4YGVB 5C86A 3UPRA 4NZRL 5EN2A 3RGVD 5BVPH 4JRXE 4Z0BH 1VKXA 4UV4L 5F1NA 3FB5B 3TO2B 3TFKC 3H7LA 4C83A 1N64H 1GXEA 5GHWH 4S1SH 5J12B 5IGXL 5GGVY 4HIHA 3U82B 3KPMB 5BV7L 4QHKI 5EIVA 3UYRH 2MOVA 3FQNB 3TVMA 2Z31B 4F7MB 2ADIB 1P4LA 3MV01 3MRGA 4JFZL 3HNTL 4GBXB 1ZXQA 3EZJB 3O6KL 2A6KB 3MNZB 3ALXA 2NY0D 4NJAL 4X83A 2XA3A 1T89A 5BRZB 3TBSA 3KPTA 3MGTA 4MDJB 4PIRF 4O2FB 3FJTA 2GJJA 1F4HA 5HYQB 2H8PA 4DKAA 3H3PH 4QCIB 2Y4SA 3O9WA 1YEJH 4PRNB 3VU2A 4XGZA 3VFGL 3QXVA 1T04B 1BIIB 1UA6H 4IM8A 1NAKL 2OTPA 4Z5RB 2BRRL 4NN6B 1XCQA 2CKBB 1YEJL 2YMXH 4C4KT 4HH9B 3I75A 4M6MH 2P8PA 5ICYB 2HT3D 4H1LB 5ETUA 1C5BH 2BXZA 1YN6B 4NJ9L 1SYSB 2HJFB 1FO0B 3FB8A 5J06A 4OLUH 2X7LB 2VZSA 4KKAC 3MV9A 5DA4A 5I1AA 4LPCA 3ZT6A 3BRGC 4MCYA 3RGVC 3QUXA 5HGGS 2MTPA 5FO7A 1F11A 1WWBX 2IAMD 4KKLC 5LCVH 4JPWH 1ES0B 3QFJB 1INEL 2FZ3B 5IGXH 1NDGB 1INQA 3HAEG 2F5AH 5I17A 3KR3L 4UV4H 3TBVA 3RVUD 5BS0E 5DT1L 3NFPB 1EUUA 2VABB 1EPFA 4WGWB 1IT9L 3QIUC 1X4ZA 3I6KB 4NKMA 1GAFL 3QCTL 3QWOB 1Z0MA 2P5WA 1TZGL 4NHUB 4ZTOL 4OI8A 1PEZA 3RWIA 1OGTB 1ETZA 3X3GH 1F3RB 3MOAL 3QPQD 4XMLL 1I7TA 5DZOA 5AG8A 1MJJA 4RAUB 3D0VB 2DM2A 4HIXL 5C7XH 1YQ2A 3WLWD 4ZODA 2BVOA 3DTXB 5DJAA 5DVMA 3DIFA 1JGUH 3TIDA 2H1PL 4LDOB 1GGCH 2HFGH 1ADQA 3CXDL 5E94B 4NNYB 1B6DA 4WHYG 3P11H 4NFDA 4HIEB 3NFNA 3LQZB 3S88H 2VAAA 2OZ4H 3RX8A 1C08B 2YOCA 1NMCC 3J8F7 1CS6A 3GGWB 5T3XH 2A38A 3DHJA 4NM4H 3ZKQD 3FZUD 4X7FC 1AGCB 3QIUB 3T2OA 2WP3T 5IW6A 5DJXB 5FYKE 2D9QB 2AGJL 3RKPA 3H9ZA 2DQJL 4XPFH 4HLJA 4Z6AT 1YEDB 5IBTL 1ZS8B 4NN5B 3GRWA 2XQBL 4KY1L 4JG1L 2QSQA 4WGVB 4FABH 4CVXA 1XR9A 5F3HB 3Q5TA 2BHYA 2G5RA 2DKMA 4JQXC 1HYSD 2FWOB 3CK0H 4CN6A 3G04B 4OF8A 1TDQA 3GB7B 3O41A 3EYOB 1MCFA 4PJFF 1V8HA 5I1GL 1SY6H 4K9EH 5CINH 5EBGA 4N0UE 4CVZB 1N7MH 3QDAA 4YHLH 2HLAA 5KSVA 1YUHA 1MHCA 3LEXA 1G7JA 3QCVH 1XH3B 4R2GB 1AC6A 5D2LF 1W0YT 4Y1AA 3UTTB 1MCCA 4DVRL 4PLKD 4YC2B 4PG9B 1OTSC 4K3JH 4JJHA 4P59H 1I8MA 4NWUL 1DQML 2AK4B 5H37H 4Y16C 2O5ZL 4FQQA 3GK8L 1U8MA 3NVQA 4X99B 4F9PA 4X6CE 3S6CA 3ZE2F 4F7PB 1U91A 3F62A 1S7UA 1ZAGA 4L1HA 4X9BA 2AXFA 5JQ6L 5JQHC 3MNWA 4M62H 1NBYB 2H41A 2VZ3A 3IDNB 4EDWL 1XGYH 3WD5H 4N1HB 5EZIL 4CW1B 5C9JA 2Z92B 1GZPA 4X6EB 3KPQA 3RJQB 3O4OC 3NCEB 4LSSH 5B3JF 4P23C 1U95B 1XCTA 1UENA 1Z6JT 5CBAB 3KLAA 3VFOB 2K7PA 4TNWF 3RZCD 1P7KA 2V7HA 4BJLA 2EICA 2PR4H 5FKPB 4I5BA 1QBLL 3AY4A 4G8FB 1ZHKB 4IMKC 4YNYA 4BFGA 5CJXA 4PJDF 4GXUM 1IZJA 1BJ8A 1UB6B 1E28B 2P5EA 1QBLH 4PB0H 3C8KB 3RX7A 1T20A 2WBJD 2BY2A 4FHBD 4WV1C 4U0QB 1BQLL 4S1QH 3T0XA 3T2QA 1AI1L 2HYMA 4EUPH 3HG1D 4MXWL 3VDCA 3FOMA 3MRRB 4HLZH 1FDLH 3GSVA 3O6LH 4NKMB 3VXUE 1LEKB 4ORGB 4XC3L 3WUWB 4K7PX 1MQKH 5SWZB 7CGTA 4PLNC 4MA7L 3QUKB 5I15L 2CDEA 1CL7H 2C26A 4URTB 5C2UB 1DQJA 3DMMD 3NA4A 2YD1A 3GJEB 2VL5B 2J8HA 2VDPL 1RVFL 4HWZA 1C12A 5E6ID 1FVEB 3O4OB 4OLZL 1AXSA 3I3EA 4HWBL 5LG1A 3RPKA 3HZMA 4JFEE 4RA0C 1HOCB 4FQXD 3GK8H 2FLBT 3VXNB 4NBYB 3C6LC 4K3JL 4IDLA 4TOYH 5C0GA 3V95A 2W07A 3BXNA 2VQTA 1ZT4A 2OL3A 1CXEA 2VDOL 3FRUA 4V2CB 5I75B 2FIKB 1AD0B 3WKMH 3H7BA 4WV1B 2FJHB 2VLKA 4YHLL 3MRBA 4G6JH 1DVFD 5F70A 1G7IA 5E2JA 4PRAA 4NKDB 5ISZA 1XR9B 3HR6A 4YXHH 4JHAL 3P4NA 3BZ4A 1YYML 1J1PL 2EZ0C 2HKFL 4JFFA 1QFOA 3B43A 4K3HA 4CN1A 4O02H 1ZVHA 3QIBD 5JHDE 2IALB 3ZDXF 1CL7I 4OZGE 3RRQA 3WYRA 4FNLH 4I18C 5CEZH 1J0HA 3LIZL 1E6OL 3S3PA 2EE6A 3P9LB 5FYLL 4R6UA 1S5IL 1TZHB 3C6LB 3O2VH 1IC7H 4ODVH 1YQVH 1TJHL 1R3JA 1PKQA 1XF1A 5MERA 3K0WA 4HFWA 4OGAC 5I2IB 3CH1A 3G6DL 4RSVA 5T3XL 3UTTD 1RZ8A 3FAWA 4OQTA 5JHLH 1YY8A 1CF8L 2AERT 2OYPA 5IJKC 1HHKB 4KUZL 3V4VH 3DARA 5DJ2A 3CXDH 2JJSA 4W6YB 3O3AA 2IG2L 3RBGA 1F02I 3PQYE 2IAMC 3MV7A 3CDGB 4QCIA 4EQ2A 5E8OA 1A7BA 1JWUB 4CL7A 1F6AB 5I76B 3MOAH 4GFTB 4XMLH 4ZOEA 2QJDA 1DBKH 5HHOA 3KPLB 1U58A 4D0BB 1CICA 1TZGH 2I60H 4G8FA 5JPNA 1A9EA 1KPVB 1HSAB 2HA1A 2FHCA 5D9SB 2UWEE 1FNSH 3VJ6A 4E41B 4JFOB 2ITDB 1KTLA 5DF0A 1ZLWK 3AS2A 4TSCH 1T2QH 1T21B 3K80A 1QFUH 3L5WB 3BP6A 1NEZA 4LARH 4M03A 4M1GL 1I8KB 4F7CB 4N8VG 5E9DE 2CDEB 1BGXL 1KNOB 4XI5D 5HBBA 2ARJQ 1F6FB 3TA3B 5IROC 3LZFH 3LV3B 4O58H 1NDGA 2N4IA 3MCLH 3T0EA 5AZ2L 5I17B 3QUMB 5F1IB 4TVPE 1C5BL 2GJ6D 4HUKB 3RNQA 4J1UB 5DJ8B 4PRHA 1YEHL 2MMXA 3H9SE 4NQDB 1KPRB 4JEGB 1FN4A 3BQUA 2BRRH 1PY4A 3QG6A 3HNSH 3I9GL 4Z78A 3AS3A 4YPGA 3T04D 4Z95H 1DCLA 1N4XL 1S3KH 4ACPA 2VR9A 2VWEE 3U48A 4K3GA 4JFFE 4XB7A 3E6HB 4BH7B 3KVQA 5CCKH 5C0JA 1X5IA 4ENED 5I1LB 2EDJA 4IOSD 4HZLB 4LCWE 1IEAB 2Z93A 4JANB 4XH2B 5C0AE 2HTLC 2Z35B 3HNTH 1U8NA 4ELMF 35C8H 2F53E 4ZXBC 5DJDB 1FYTD 2D2OA 5BV7H 2NW2A 3K7UA 4O2FA 2E7HA 4IRSB 3QDMB 3GBNL 1S7XB 1EUTA 2ZUXA 5ID1B 3MLXH 4P48A 4IRJC 3VRLE 3WNNA 2EIBA 2LFGA 4WNQA 1EFXA 2FX7L 4Y4HB 3VFRB 4GLRI 3UTOA 5T33L 5T1MA 5KVEL 5EU5A 5CKGA 5JW3L 3OJ2C 4P23A 2Y7QA 1CIUA 4EN3C 1P6AB 3V4PL 1QSEB 5DEFA 4GQ9L 4HJGA 3ZLQC 1ZLVH 1VFUA 1A3QA 1IQDA 1MJUH 3HMWL 2KDGA 4BFIB 4TSAH 3MRJA 1TJIH 1U8QB 3PQYA 3MODH 4P5MA 3OR7B 2QR0A 2QQNH 5D1QD 3ROOB 4EI5D 5BW7A 5BMFH 1FZOA 1RJCA 4G3YH 4LHJB 4QRPB 2CO6B 3CVHH 2AI0L 4U1GC 1GZQA 5C0FB 1NFDE 5IQ9B 2AAVA 4GAJL 4U6XB 4IRSC 4LCWB 4CKVX 5FK9B 5JPNB 1F3JB 3W0WE 4YEFA 4FQIH 2XZCH 5MEPA 4K55A 3MRNA 1EJOL 1DTUA 1IQWL 3MRFA 1KLGA 4P99A 4HJJH 4ZO8A 3B4NA 3W2DH 1DEDA 1QFWI 1O7SA 3GSXB 4PJAA 3CFCL 1I9RH 3JWOC 3TYGH 2QKIB 4AM0B 2AABH 43C9A 3TIEB 1UVQB 1CT8B 4P5KA 3KPPB 3VMNA 5C08E 5EO0B 4KI5C 3SDAB 3T2PA 4JPVH 3ALWA 3LCYA 1JI2A 1MCBA 2BRQA 1GGBH 4ZFGH 5IKCA 4HS3B 1G6RB 3H0TB 4M93C 3DROA 4XX1G 1YC7A 4AZ8A 3O2DH 2BVQA 4QTIH 2UY7A 4PJXF 3VXRB 2AXGB 3MLWH 3OGCA 5DD6B 2YD2A 1JK8B 3CFKB 4Z7QE 3JWOH 1VFBB 5DQDH 3V5KA 3OX8B 4OZIE 1MCHA 1KJ2B 4R26L 4Z7UA 3OKLB 1WC7B 1NJ9B 3MZGB 3VGFA 2NY2C 4NC2B 1FVDB 4ODTL 2A1WL 2CLRA 3BQUB 2ZSVA 4OZFH 3VGEA 3VGBA 3L9RB 4JQVC 1HQ4A 4PTTA 4OV5B 2X4UB 1MFBH 3DV6A 1IM9B 5C0EB 1A7RH 1C8PA 5ESAA 2VE6A 3VA2C 5KAQF 3DUSB 2YRLA 3EDFA 4U33A 1HH6B 2AV1A 1GIGH 2CUMA 4NQDE 4XP5L 1SHMA 3U2SB 2XG5A 2W38A 4ZS6D 4M93B 3GJFB 4BSVB 5E8PA 4PREB 1K8DB 4H25A 3HRZB 1RK1A 4RRPA 1Z3GH 5D71H 4Y4KB 3FFDB 2R8SH 4P46B 1N5AA 4UAOC 5EN2B 4L9LB 1KCRL 1KG0A 3FQUB 3DYPA 2QQKL 3FQRA 1U8IA 1I9IL 4XI5C 4LRNH 4UQ3B 5E8DH 5J9PB 4MQXC 3IJSB 4BA8A 1BIHA 5E5RB 4JHZA 2OI9B 4DTGL 1ZLSH 1N2RB 1E4XH 3QPXH 1PBYA 1H3PL 1YNKL 2P8MB 4HWNA 4KZEH 5D7LB 3CDYA 3PV7A 1WQVT 3MJ9L 4PR5A 1B0WA 4YFDB 4JPKH 5IESL 4UIKH 3IJHA 3BP5B 4M00A 3DMMA 1JRHI 3WIHL 4BK4A 3G6JA 5MENA 1FNHA 3PHQA 2ZUTA 1M7IA 4KPHH 1OCWL 3NPZB 5HHMD 3VE0A 3DX9B 2OM5A 4XWOC 4Q9QL 3W9DB 4BH8A 5C2BL 2YUXA 2AJSL 2ICWJ 4PJ7A 5EBLB 4Y4FB 4PJ8A 5CMAB 4F3FA 2YRPA 3OAZK 1T0NB 1FC2D 1OP5H 1QR1A 4UIMA 5EIIB 1PSKH 2EC9U 5ADOH 5EUKA 5IHLB 1ZVSA 2XFXB 3RL1A 1FG2B 3GSNB 2O5YL 5I1KL 1FLTX 3RP1A 5E8DL 3ESUF 3MBEA 3L3DA 5EU4A 5FOBA 3NGBC 3U0PA 3QIWD 1K4DB 2I07A 2XKUA 3O3BA 3RPIA 1BHGA 1IGIL 4PJ5E 1HEZB 3PDOB 2MNUA 3RZWA 3LH2L 5L0QC 1DEEB 5HGAA 3KPSE 5FM5M 1AKJD 5HHOB 3VH8A 3VH8G 4WTWA 4UTBH 4FFYH 4U05A 5HYSB 3HHRB 3VD5A 2ZPKL 1QVOA 4N0UA 4AIZB 1DSFL 5JIIA 2AJXL 2RBLA 2PKDA 1Z9MA 1A6PA 1PEWA 3UBXI 2UZIL 4E0RB 3BPOB 5CZXD 4JM2B 1WLHA 3QG7H 4RQQB 3CPLB 2APTA 2LQRA 1ZT4B 2OL3B 2AKRA 2F8VA 4UMGA 2JE8A 4QY8B 5F9AC 4L4VD 3VWJD 3JWDH 5DUML 1OGTA 2EYRB 1FC1A 1W72L 5J11B 3T1FA 1LDPL 4JFXB 5I19H 2R0WL 2C3XA 3MUGA 1YNLH 4H0HB 4MJ6A 1U6AL 4K94H 5EIQA 4LVEA 4G8GB 3QDJE 1QA9B 1CG9A 5CS7A 2VDLH 2BVOB 3PABA 3BP7A 4WI2A 3CAFA 3KS0J 2Y36H 3BEVA 3WHXA 1KJMB 5K33A 3GHBL 3QFJD 2GIYA 2A83A 2X05A 2C3VB 1K8DA 2XTJD 1UQSB 4XBPA 2DAVA 5HYFA 3O3EA 3O4LB 3JVGA 4NM8L 1QBMH 2CQVA 1BQHA 1WZLA 5IB5A 3GGWA 1C5DB 2XN9D 3MACH 3T8XA 5BV7C 3B9KD 5EZOH 4D8PA 3BPOC 4I9WD 5SWZE 4J8RB 1T83A 3ULUH 1OM3H 1OF2B 2P43B 3UZEA 1C1EL 1W72A 1MCRA 1BD2D 3JWDC 4CMMB 1DQLL 4HAFA 1X9QA 4MJID 3JUYA 4X7EC 4QRSB 1A1NA 2XACC 1MFDL 4D9QE 2IPKA 4YO0B 4DZBB 3VI4E 3S96A 2X09A 1LO0L 4OZFA 2X1PA 3BIKB 5GSRA 1MEXL 3KHOA 3MRLB 1G6RL 1RU9H 1B90A 5HPMA 3NBNA 3C8HA 5TE4L 2HRLA 2ZUVA 1Q0YH 1AE6H 3QP3A 4WI9A 4YIQA 1JF1A 5HI4D 1QPPA 2EIZB 1W0WB 3ZTNH 2R23A 5BMFL 2OK0L 2JIXD 3ZTJG 1CXLA 5FO7B 3TNMA 5E2WL 3SQBA 3A6CH 4LBEB 4P57A 3DVNA 4MMZC 1SM3H 1WBXB 1FJ1A 1A6TB 2NZ9D 1EO7A 2J88L 2IFFH 1TENA 5H94B 2XN9B 2VZTA 5D1ZD 2N1KA 5GISH 5JR1H 4PTUB 2ENSA 1W0VB 2ESVD 1ZT1B 4UT7L 4XAKD 2MCPH 3D85B 5JW3H 1IGJA 2HJLB 5KVEH 2KQMA 1MJ8L 3WCYA 2ED8A 2CXKA 4K8RL 5IFHL 4AYFA 1H0DA 1R6VA 1YDPB 2BMKB 5IVZB 1LE5A 3TJHC 4LCWA 5KJRH 3GBNH 5FV2A 3WS3B 5ID0A 3QXUA 5ICXA 1F3JA 1QVOB 2Z8VC 4N0UB 4AIZA 5J3HD 2XNAA 1OAQL 4XPHL 3BWAA 1FGVL 1SEBB 1KJ2H 4JLRA 5T1KB 3OF6D 4QOKD 3L3KB 1Q38A 3RWIB 4P49A 4DZ8B 4RCAA 4CUCA 4LL9A 4WHDA 1EMTL 4LF3B 2YXMA 2GTZB 5CCKL 5C71A 5EWIL 4TUJB 2A0LD 2JB6A 3T3MF 2YR3A 1N4XH 4N8VB 5IW6B 3CMOL 4NZDA 3VXQA 1XMWA 5F3BA 1JPTL 5HGDA 1PG7L 1A2YA 2J6EA 3CCHA 1ZANH 4L8DA 5GGRA 3NTCL 1GOGA 4N8PA 3QFJE 1CTOA 3IAQA 5TE7H 3U9PL 3QIWC 2D0HA 1GGIL 4J3WA 5T3XE 2DI9A 2NX5E 4OBSA 4YUEL 4QEGA 3HPLB 4DCQA 1MCJA 4JG0L 5AZ2H 2BSTB 1YY9D 3VXTB 4E42A 5FV1L 1YEKH 3GB7A 2IQAA 3EIFA 1AGBA 2F19H 3T0WA 3UTQA 5DWUL 5FA4B 1K2DA 4U1NA 1FFQA 2PO6B 3UPRB 4M1DL 4I2XB 4U1LB 5IJVA 5KG9A 2NXYD 5BZDB 3QUXD 2X4UA 1A7PH 1NBZB 2ARWA 5GGUB 2N7AA 1YPZF 4PV8A 4P2OA 1JGVL 1KEGL 3RGVA 4HBCL 1T5WB 5LQBH 4PRPA 4TSCL 1Q9OB 3GSUB 1AIFB 1UJ3B 3ETBF 1DBBH 2R0LH 3EJZC 2ZKHH 3KPNB 5E2VL 3BKCL 4XNYL 3QEGL 2Y6SC 4NQUA 5BVJA 5MEOA 5D1QA 1X6NA 5GRWA 1VCAA 5F8RC 3L5IA 3WKNA 3MRGB 1JZ4A 2IPTL 3QH3A 1JUFA 1IARB 4DGVL 4RWYH 2A6KA 1EHNA 2V5YA 4JFYB 4YFLI 3VGAC 3RA7H 5BZWB 3RHWK 2DQDH 3MJ7B 3INUL 5DEGA 5MHSD 1O0VA 3UZVB 1T22A 5ESVB 1ODAA 3OR6B 4MX7A 3P2TA 4EIZC 1PKQB 3V4VL 2BOCA 4BFBD 5GGTA 2B0SL 5B3NA 3QI9B 4OCWL 1NAMH 4KUZH 1T0MB 3KDMB 4PJXB 2EEAA 3Q2CA 2FB4L 5JHLL 1J8KA 2VDRH 3H42L 2EO9A 1VADA 3IFNH 2J4WH 1T1XA 3QEGH 5L88H 1UJ3C 2H26A 3KXFE 1K6QH 5JXEA 1A1MB 1U8KA 2ZCKL 5JW4R 3ARZA 1IC7L 3O2VL 1G7MA 2EC8A 2Q3AA 2Y72A 1U36A 3HFMH 3P3YA 3BYYA 4ZAKA 1A4JA 1E4JA 3VFVB 1HIMH 3LIZH 4TPRH 3RIAF 4YHIA 3M07A 4UT9H 3X3FL 2HFEB 5DWUH 4KJQD 3D39A 1G7LA 2WBJB 5SWQB 3VD7A 5HHOD 1RULL 1D6EA 1TITA 4XAWL 2RR3A 3QUMH 1KJ2A 1F4XH 1RZFL 4JLRB 3WFHB 3QNZB 1AQKH 1CYGA 2I5YH 1MPAH 3RZCB 1ZHLA 3GSNH 4FQCL 3PWJB 3VI3E 3NTCH 4I2XE 3BGMB 1HHGB 1ZANL 4F2MB 4P4KA 3OB0K 1C12B 5AAWA 4YHOL 3IDMB 3T77B 3T65A 4JRXB 5DMJB 1MCSA 3Q0HA 1GPOL 1U3HA 1BF8A 1J12A 4ELKA 3VXNA 4X8JA 3HLAB 2P4AB 2BSTA 4U6TA 1I7UB 1IGTB 2NX5B 4O4YH 4JY4B 4ZDHB 2AV7B 2ITCB 9CGTA 1WAAF 5C0NC 3ZHLA 4OLVL 3HI1B 1LO4H 5HI3D 2PCPA 1KJ2L 4LCUA 1D5BA 4YHPB 1CL7L 4NO2A 1FIEA 2ZG1A 1Q9KB 3E2HB 5CGTA 5LBSH 4PRAB 1S7SA 2Z8RA 2ZUWA 3KJ4C 4L9DA 5IVXA 3PNWA 3ZE0F 1UXSB 4X0KA 4MJ6B 3RZCC 5I1DA 3J7HA 5D7LD 1VSCA 1UM5L 4S1QL 1J8HE 2XZQH 3T0BA 1JV5B 3SGJC 4AT6B 4U2YA 1YECH 3UEZA 3GI8L 4JO2L 1J5OH 1EHLH 3B6SA 2XV6B 2IADA 1NBVH 2DYPA 4IJ3B 3KPSA 1YPZA 3U4BL 1X4XA 2A2QT 3TV3H 1LHZA 1GHFH 3CC5B 5E9DB 2BY0A 4KROB 4CN4A 4ELMA 1K9TA 2NW2B 3F65A 5I8EA 3UBXA 3A6CL 2BNQE 3G6JB 4GKNA 4OCRH 4KQ4L 4NPYA 3C60B 1KLUB 2ORBH 5JA9A 1UEMA 3Q48A 4HUMB 2PYEB 3WUZA 2AQ1A 1MHCB 4HSQA 1P2CA 4GRLB 3S36L 1DANT 3RNKB 3UX9B 2ICEB 1KPUA 2FD6L 1MCPH 1B4JL 4OZFB 3RL1B 1LO0H 3CDGA 4HXAL 2XXMB 3K8KA 1F4WH 3EJYC 4PJ9C 2WWMC 2Q7NA 4D0CB 4BQBA 3D87B 3RUGA 4G7VH 3RPIB 3L3GA 3ARED 3P0YL 2W1NA 3IFLH 3O8XB 2G9HA 4HV8B 3BMVA 3QFDA 4KI5E 1RJZB 4YHNB 1KJ3H 3GHEH 1QOKA 3DETC 4PJ9D 5B39A 1GGYA 4LCYB 5LWYL 4X6FB 2OZ4A 1TCRB 2X1WL 2R1YA 2YEZB 1HINL 2EKJA 1IGYA 3CK0L 3H3BC 1QBML 1F4YL 2CLZA 5C8JB 2D7QA 1F97A 5ENWB 2JJTC 3RVVC 1AY1H 3NZHL 2VLJD 3MV9D 4JM2A 1DBAH 1KCSH 3N9GL 4KKNA 4OGYH 5GIRB 4HEME 5FYJE 3RQ3A 2XQBH 1NCUA 3S36X 5IBTH 1UB6A 4EVNA 2Y36L 1IC1A 4XPFL 2HVKB 2EDFA 3LS4H 5FYLD 5EORL 2AGJH 4X6BA 3MROB 1NFKA 3EOAA 3T0EB 1YNLL 1DN0B 2LTQC 5DJXA 5I73C 1EAJA 2R0WH 2JELL 4NO3A 4QT5A 3W39A 5JLZA 5I18H 4I18A 3O4LE 5DUMH 3SDCA 3CFDB 1KJMA 3MRDB 4OI9A 5F9OH 4LVOC 5GGQL 3OKMB 1N6QL 1Z0NA 5INDA 3P11L 1A6AB 1HQRB 4WFGE 3O81A 5E2UH 2HFGL 3QDJB 1CDUA 1QP1A 2B20A 4WEBL