3P0GB

Structure of a nanobody-stabilized active state of the beta2 adrenoceptor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAASGSIFSINTMGWYRQAPGKQRELVAAIHSGGSTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDYGAVLYEYDYWGQGTQVTVSSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a nanobody-stabilized active state of the b2 adrenoceptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, hydrolase
molecule keywords Beta-2 adrenergic receptor, Lysozyme
total genus 25
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2010-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p0gB00
4NGHL 3RGHA 3ZSTA 5GJTL 2IH1B 4ELKA 2C1PB 4HC1A 4XZUB 1X44A 3JBG7 3D3VD 4NQDD 4QXTB 3MCKB 4NJAH 2VZOA 1B6DA 4LPWA 3B9KD 3QIWA 5T1KD 3PIQB 3Q2CA 2UV3A 2VZUA 2DQIH 4FFZH 4Y4KC 5J6GB 5EOQL 3BDYH 3AB0C 4KFZC 4HCRA 3DXAA 2CDEB 2H1PH 1HQRB 4EUPA 3LEXB 4LAJH 3QI9D 1WBZA 1MUJA 1Y0LA 1AXTL 2FX8L 4QKXB 1LO2H 3A67L 2GFBB 1P4LA 1NFIA 4AENB 1MCNA 3O4LD 2BVQB 3PV6B 3MV9D 3HMWH 5EU4A 1HH6A 3DGGA 2IPUK 5F7EL 4JQIH 3O11A 3F8UB 5D93C 2A73B 2NXYC 1VFBA 3AXLA 3GZKA 1RUMH 5IFHL 1E4KC 5MERA 2EH7H 3M1BB 1F4XH 4JDTL 1AGFB 1HYSC 2AV1B 1BJ1J 2CRZA 5FDWA 1S8DA 2C7UA 1F97A 3D39E 4AEHL 3WKMH 2BHYA 4M5ZH 5LCVH 3KNBA 3D39D 4P3CL 5IBTH 3SO3B 2ZG2A 4IJ3C 3QHFH 2R23A 4X6FB 5DWUH 1MEXH 1KN2L 4Y16C 5C09E 4H0HB 5D1ZA 1CFBA 1Z5LB 4NQEA 5D7IF 2O61A 3HCVA 2F53B 4Y16A 2W0LA 4XAWL 4P2CG 4C55A 2Y06H 4YE4H 3RGVB 2NTFB 3CMOH 4AH2A 1BLNA 1AD9A 2ATPA 4JHAL 4N0RA 1JNNL 1U9KA 4YXHL 5IF0A 1U8KB 1RZKL 4ENEC 5GZNC 5HDBE 1IQWH 4HWBH 3OKEA 1BZ9A 4PGBB 3UPRB 1MFCL 1U41A 3HI1A 2DS4A 1JGVL 2DQJL 3SKOA 2CKNA 3KLDA 3LEYH 4UTAH 1K6QH 4Y5VC 3OZ9H 2AV7B 5EOCJ 2Y9RT 3MYJA 3NZ8A 4K94C 1J88A 2DLFL 3U0PA 5JPNB 2EDXA 3EYVB 1A7RH 3WIHA 2IALA 3KLHD 1T22B 4YBHA 2APXA 1U3HC 3QUYD 1JPST 4U1KB 4F7MA 3D3VE 4P46B 5DSCB 1YPZB 4L29A 1N5AB 4NO0B 5DRWB 2R2EB 4HZLB 2R56H 3MLSH 2ICCA 2V5SA 1G0XA 4JPKL 4KK5D 1HSAB 4P9HC 1YY8A 5DJXA 3SGKA 5EIVA 3QYCA 3UTPE 3G5ZB 3AVEA 5C0RL 5ALCL 4I18A 1RK1A 2R1WB 3HZMA 4PJFA 3BZ4A 4Z5RA 3NA9H 2Y23A 5HYSB 3TH2T 4U1HA 5K9JH 5F7NC 2I9LA 1H0DA 4H8WL 5I8EB 3OR6A 4NZUL 4FQ1L 4Y5XB 4U3XA 3BOVA 1EEZA 3FRPG 5F8QC 2IMNA 4MXWL 3S98A 2NX5A 5GIRA 1JPTH 4LLVB 5KVEH 4WFGE 3ARDD 3TVMD 5MEPB 3V4PH 3GSVB 2QSQA 1XGRA 3DSNA 1CGWA 5I74C 1G0DA 3BZDA 1CTOA 1N6QH 1FVEB 4X4YA 4RWHA 1AD0B 4M7ZC 5L9DH 1JNLL 5LGHL 2FJGB 4HKXB 2A83B 4KQ3H 1DL7H 2AJXL 2CGRL 4XPBH 3O8XC 1TETH 2ZSWA 5FUZH 4OM0H 4CVWA 1G7JB 1D6VH 1KELH 1NEZB 1BZ7A 1UWXK 1EMTH 3TYGL 2KH2B 3P30L 4MWFB 3SPVA 4LSTL 2G75A 2M2DA 5E9DE 4BELD 4YHYB 5CD3B 5F9JA 1FE8H 3GSVA 4OZFB 3P73B 1Z9MA 4RIRA 3HRZA 1SJEB 2A1WL 2DD8H 3T2NL 5ETUA 6FABL 1RZIB 1U8MB 4BA8A 4QRQA 2NXYB 1LK3H 1I7TA 4J3SA 5EUOF 4BZYA 1MFBH 2Q8AL 4LSVL 1FLRH 1A5FL 3NIFF 3G5ZA 1J86A 5E99L 2WBJB 1X9QA 3FO0L 4EI6A 1NANH 1T7WA 3TVMB 5JR1L 3B43A 1QSEA 4P4KB 3VFGH 3TNMB 3C6LC 1CVRA 3W0WB 1JGDB 5KS9A 4XWOC 2BSSA 5SWZB 3ZE2F 4O02L 3OB0H 1FG9C 5I1DB 3LSOB 3BJLA 4Z77B 5D8JL 3BPLB 1UXWB 3S7GA 2V2WA 2EDJA 3E2HB 1EZVY 2VITA 2EYTB 3EYVA 4M6NL 2ZJSL 1NL0H 5JDJA 4KRPD 1TVBB 3SKMA 3PWJA 3SKOB 2K7PA 5FFLA 3FQWA 3T0EA 3CXHJ 2V2XA 1JWUB 5ITFB 1BAFH 5LGJA 3NACH 3P9LA 5HI3D 5IJKC 1G7LA 2PW1B 3HI6H 5E95B 3T2QA 4DW2H 4S2SA 3VRLF 5AYUH 1JGUH 5EUKA 3IGAA 4G43B 3RIAF 1IEBA 4O5LH 3GSOA 3JV6B 5E08H 3O0RL 4MGXA 4PJAF 3UROR 3UX9B 2AERT 4WWKA 4WW2A 4EIZC 3RKDD 2ADGA 2VLJB 4FXGB 4PGEB 4M43H 2XY2A 5E4EC 3MRLB 5MEQB 1TVDA 5GS1A 3VXUB 2H9GA 1A6AA 5HYFA 3QULB 2W9DH 3MV7D 2VDRH 1INEH 4GMTH 2XZCL 1YC8A 1BFVH 4JRYB 1QA9A 4WNQB 4FQ2L 2PTTB 3D69A 1SY6H 5E56A 2ATKA 3ILPA 3FRUB 1NFDB 5FKPA 2E27L 2X4OB 4XVSL 4S1DC 1RULH 3GK8H 5I0DA 3AC0A 3QCUL 1IMHC 5DVMA 4RFNB 5EU4B 4JVUA 5H37H 1AP2B 4Y5XC 2BVQA 3RY6A 5GGRY 2GK0A 4G6FD 5C6PB 1MRDL 3DO7B 1OTUC 3DVNB 3IDNB 2H9GB 2GJZB 3SGEH 1Y0LB 4UILH 1NQBA 4FXGA 3QUZD 2E9JA 4OI7A 1IJ9A 2Y07H 4KUCF 2MPAL 4Y5YB 4XP6H 4C59B 4R7NA 3GM0A 5SWSB 3LHPL 1N2RA 1OWWA 1P4IH 4Y4HB 4MNQD 4EEEA 4I3RH 3MLRH 5EIIB 4H5SA 4ZUWB 3NA4A 3H9SD 1A4JA 3O6LL 5DF0A 3TT1L 3UTQB 1A6VH 3FOLA 1U8JB 3WLBB 1N26A 3WO4B 5LGJB 3L7EB 4P0DA 2J8UB 4CL7A 1RHHB 5MP6L 3FQWB 2C1PA 5ESQA 1SMOA 4KHTL 1TQCB 5C0ND 3PWJB 4OZHF 2A74B 1FYTE 3RWGA 3DPBA 1OAUL 1I3RA 5GJSH 1T5XA 4NNYB 3HAEG 5E8NA 3BO8A 3B9KB 5GGVY 3SE4C 3FQRB 4NQCE 4ODSL 4FFVC 3W0WA 3VGGA 1C5CH 4NQED 5FYKE 1P4BL 3BPCB 5D2LA 2R0ZH 3RPIA 5DMKA 4TQEH 1HZHL 3ARFA 2YPKA 3Q3GB 4UUJA 4JZOA 3ARDC 5I1HL 4U6VH 3WDIA 1FZOB 4OT1H 1F2QA 4XC3H 3DTXA 4Q0XH 1MH5A 5CWSA 1KNOA 2F8XC 4I5BA 4QYOA 1WBXA 2YOCA 2J8UE 4KQ4L 1A9BA 1NBVH 1OTTD 3DSFL 4I1NB 4KTDL 1FZKB 3BUYA 3P73A 1YEHH 3FFCB 3RAJL 4JZNA 3NFPA 1ZGLM 4GFTB 3U82B 5TPWH 1JHTA 4MWFA 3SPVB 3KLSA 5A43C 4L9LB 4S1SH 1NEZA 4GG8A 1KLGA 2C4XA 3MCLH 3ZE2E 1RZJC 3NPSC 3DRTB 3PWPD 4V1DB 1P5UA 4YFLI 2W0PA 3LEVL 5SWQB 1CWVA 1DBKH 4DEPB 4LCCA 4U7MA 3VDAA 2VZ1A 1KEGL 4OF3A 3G6JF 1EGJL 1KCVL 5F3BA 3MRHB 5JO5B 1HINH 2VLRD 4J8RA 4F58H 5EU6A 5J13B 2JB5L 5FUOH 4CADA 2H26B 5ANME 5IQ9B 5MEPA 3OGCA 3VRLE 3ZMRA 3V5DB 2V6HA 2WIMA 1F6FB 2V9RA 4ZSOB 1QSED 4HIIA 4FQIH 1S7XA 4X7DC 1LQSR 2WUBL 5T5FL 3VXMB 5FA3A 2Z31C 3S3JA 4G7YH 3BZFA 4I0PB 1XR9B 3H42H 3OAYK 5IFAH 1HXYB 2V5MA 1M4KA 1IKNC 4AEFA 3WCYA 3WEXB 1GGIL 4MJIE 4PJBB 4R96B 2FO1A 1UC6A 1S5IL 1JGEB 5F7HA 1YY8B 2F19H 4DUVA 3ZE0F 4MHHI 2E7MA 5EIIA 4YHML 5JHLH 1NSNL 3H2WA 5I17A 1FFRA 1AE6H 4MYWB 5D7JB 2ADJB 3OHXB 5DQDH 1HYSD 5CS7A 3GSUA 3M07A 4WFHE 4YDLC 4J3OC 5C0BD 2FX9H 5IUSA 1C5BL 1QLFA 1CDHA 4ZO7A 4D3CL 5FYLH 3U0PB 5F97E 3EYUH 1F58H 3V6BR 2R39A 2FBJH 1T7YA 4QRPE 5J0BA 2JIXA 3MODH 4ONGL 3RTQD 1MCBA 3EO0B 4PJDA 2VDNH 4ZFOA 1XF5A 4GAYA 4GRWH 5D7JC 3HI1B 4Z0BL 2B0SH 2XQYG 2NY7H 3VXRD 2H6PB 3I6LD 4PD4J 3L5XH 5JXEC 3OKDA 4ZNEA 2J6EH 1J18A 3G6JB 1D5ZB 4U1MA 3D69B 4ZOAA 4BSVB 1ZA3A 5LVEA 1OTSC 3EOBB 4NOBA 5TQ0H 1KPVB 1MSPA 1VB9A 4JB9H 4OCXH 3HCVB 3VRIB 4U31A 4ZAKC 3INUL 4MA7L 1KCRH 4OZ4A 4RFNC 1JHLH 1QRNA 4A6YA 1TJGL 4P23C 4U7KA 4D9QE 4EQ3A 3V6OE 3HZYB 4S1QL 5D2NB 2IAMD 1I8KB 3VW3L 3F7QA 2Q8BH 2AQ1A 3SDXA 3E3QC 1RZ8A 2A2QT 4ODVH 5I2IB 2VC2L 3VFOB 3C5ZC 5I66A 4S1RH 2Z31D 1G7LB 4OZFG 1R0AL 5HI5D 5J89A 3G6JA 1GXEA 4JZJC 5IESL 3FB6A 5DD3H 2OJZH 3RPKA 4RGNE 1LD9A 1HH6B 3TIDA 1KIPA 1JYXA 2FEDD 3N06B 4ZUUA 4ORZC 3MGAA 4K3HA 4KVCL 5TE4L 4PJ7B 4EUPB 3EYSL 1JGLL 1TZHA 2N4IA 4OIIH 3L3JA 4MCYB 4RSVA 3VRJB 2VZVA 3PWVA 1CICC 1PEWA 1S7QB 5SX5H 4BSJA 4XNQA 4CMHB 5FV2A 2Z91B 4JJHA 3C5ZD 3R4DA 2EH8H 1EEYA 3NMEA 4FTVD 4Q97A 4F2MB 3BPLC 1MRCL 5J6HA 4ERSH 2C3WA 4LBEB 5DS8A 2B4CH 5TE6H 1WSST 1J5OH 1TVHA 5E94B 1PKQB 5INDA 4YFDB 1XZ0B 3RI5K 1S7RB 3ZDZE 3P77B 1ES0A 4HIIB 5BW7C 3KPNB 3TJEH 3TBTA 3HKFA 1V3LA 4KZEL 1SJHB 4BQCA 3TCLB 3ALWA 2VLKD 3I6KA 4M6AA 1CLYL 1UVQB 3MXWH 4GBXA 3UBXB 5B22A 1HHKA 2EXWD 2NY5H 4JFZL 1D5BB 1SBSH 5JXED 1QFWM 3ZKSD 1W72B 4PGCB 4NIKB 4J4PA 4IRZL 5EBLB 4HGMA 4YR6A 4K9EH 1KLGB 5FHBL 5DVLA 3NIDF 5I8KH 1NCWH 5IIEB 5GGSB 5BJTA 4KROC 2DQGH 5D1QD 4FQJL 1KPRB 4OZIA 4U2YA 4PRDB 4WHCA 1A7OL 5T1LB 4X6DE 1FNFA 3TJHC 1EEZB 2A6KA 2QLVB 1OF2A 5CLWA 2UZIL 1NCDH 3CH1A 1H3WM 1EERB 5HDBF 3UP1A 5C2UB 5HYSA 4OD3H 4KY1L 1MH5B 2PYED 4ZFGH 1FZOA 1T89A 1WGOA 4EZMA 1L6XA 4N9OB 4M6OL 4OQTL 5EZIL 2KDGA 2Q1EA 4YHPA 1U8HB 4PJXA 2Y7QB 4OLXH 3QUXB 4GS7B 1A6ZA 3ZTNL 1QO3B 4W68A 1LK2B 4UZGA 2BCKA 3O9WB 3GSWB 3LCYA 1HKLH 5DVOA 2BXZA 5DT1H 4FQPA 2BVPB 1AHWA 2MKWA 4G8GE 5A16A 1I3RB 4M93B 3EO1B 3LKRB 4P2RB 2A74A 4TNWK 4U1JA 1IGJA 1I9EA 3QXDA 2VXVL 1G7QB 3OKKA 4GW5B 3S36H 3NIDE 3LQAC 2DKUA 5F7UA 1NCUA 4U3CA 2F54E 3MV8A 4E9LA 1NLDL 5DA0B 3SJVA 4EDWL 5ICXB 4HLZG 4U6XA 4MNGB 3WLBA 3CCHB 1I9IH 4OZHE 4AQ1B 2KL6A 2E6QA 4M48H 2OZ4A 4B7IA 1CXIA 4B53A 5C2BL 1CGSL 1K8IA 1BLNB 2R69H 1N2RB 3RGVA 1V7NL 4G42B 3GMLA 2A0LD 4R7NB 3O8XA 1UACL 2JCCB 5HI3C 2F53A 3HZVA 2HJKB 3PXHA 4PRHA 5FECB 1YYML 3STZB 4OB5H 2DBLH 2VAAA 5CUSH 3LS5H 4JY4B 1I7UA 5CIPH 1UEMA 1I9RH 1XGUA 4PJFE 1F8TL 3V4VL 4CDGC 3UAJC 4UDUB 4IHOA 3TLRA 1S8DB 1YY9D 3SE8H 2HG5B 3FFDA 1V3MA 3CC5B 3RNKB 1T7XA 4JPIA 1AXSA 1VFBB 3AXLB 25C8L 1HH9A 1S7WB 3T8XA 5C09B 5D7SH 4FFVD 1ND0B 1T0NA 4F7TA 3W11C 4GRLA 5BRZA 2NW3A 3T3ME 4FMFA 1FNGB 2YEZA 2WSKA 4K3EL 3WL9B 5E6IB 5EPMB 4NN5C 5KJRH 1DQQA 2WINB 2VUOA 1N6UA 2CDEA 1CN4A 1JWSB 4NM4L 5GS0C 3FZUC 2JCCE 1ADQL 3TZVA 2VLKE 3WFEL 1IEBB 1OSPH 1NCNA 1T1WA 5J6GA 5EUKB 4CW1A 1DFBL 5C0FA 3HC4H 4XTRD 3L5HA 4XTRC 4NHUA 4OTXL 5IMOA 3A6OA 2EDFA 1WTGT 4P2OB 5BV7B 2CDFB 2YRPA 3CFCH 2LQRA 4LPYA 2H3NA 1DEDA 3TBWA 5JPMB 4KC3B 2ILLA 2YKLH 3EDJA 3QQNA 3X3GH 3MJ7B 4F57L 5A2IH 2BK8A 2JF1A 4K7PX 3O6KH 4K8RH 2VITB 2IPTH 5TQ2H 1KPUB 4HWZB 1CFNB 3S3PA 3W11D 4LKXB 1N3NB 5DJCB 5EU5B 5L6YL 5KS9B 1HHIA 5H35A 3GMOA 1WEJH 1BQLL 3KS0H 2IAMA 5B4MD 3IB4A 4S1DD 1Z0NA 5D5MB 3I6GB 4UU9A 1QP1A 2Y5TB 4KI1A 3WNMA 4L8SC 3MGTA 3T0EC 4FNLH 3MLTB 4XNMA 1TPXC 4OZGA 1A1NA 3BE1H 1RUAH 2Z31A 4WUKL 4XMPL 2HFEA 43C9B 4R0LB 2JJTC 2XTJC 4H0GA 3MA7B 4B5EA 3DUHA 1I7TB 1X5FA 3EDFA 4QRQB 4LMQI 1MJUH 4P57B 1G6RL 3QUMB 1EJOL 2YD6A 1RZJL 1INQA 1UKTA 4QWWC 1IZKA 1DQTA 4JFQB 2VDOH 1X4YA 1D9KD 3MTRA 3WNKA 2IGFL 4XBEL 1BVKB 3MJ9H 3EDDA 4NC1C 5CZXD 4ODXA 4LCIH 4WFEE 1F6AB 3VFMA 2VDKH 4RZCA 5ILTL 5CJOL 3RVVD 1DANT 1IQDA 1XR8A 5F6IC 1NDMA 3ARRA 3S37H 3STLA 4I9WD 3PHSA 4YWGL 3EOYG 1TZIA 2AW2A 4KRPC 3K46A 2VR9A 4M03A 4KJYA 1AD0A 3VXSB 3KLHC 3QUXD 2HAZA 1MCCA 4WVRA 4DGIH 3X14B 4PTTB 5FGCB 4YHIA 1FNAA 2J4WH 4JN1H 1CXEA 3MBEB 4AL8L 1KB5L 5AYQA 1DBAL 3RZWA 4HXBH 2FHBA 5GIRB 3KPRB 4XH2A 3QDJD 2C1OB 5IJKA 1YN7B 5DYOA 3C6LD 5F6HI 2Q7YB 4B7LA 4XPTL 3OR6B 3VFNA 4Y88A 2BRRH 1CDGA 1ZA6B 4M6MH 4OM1L 4PG9A 3DIFA 4WFHD 3VFMB 2XG4A 3BZ4B 4UBDD 3RVTD 5HTSA 3KJ6H 4NNXB 4E41A 5C08A 1C16A 1FO0H 1N64L 1FVDA 3RJDA 3RWHA 4PTUA 4GSDH 1DBBL 1INDH 1BGXL 4WFFE 2JJSC 2R2HB 3O2VH 1E4WH 2MFNA 4XHJD 4EXKA 2DF3A 1YYLH 5JORA 1WK0A 4F7MB 2F8VA 4KUZH 1JZ2A 1DQML 3KPRE 3T1FB 1T3FB 5CEZL 4PRBA 5HYEA 4LSQL 3MX0A 4AT6A 2DLHA 4POYA 2CXGA 2BNRB 5HGBB 1YDPB 3WLWD 2R1YB 4WI7A 2DQTH 2JJTA 3CSGA 5LBSL 1UZ8A 1N3NA 4G8EA 1IL1A 1KLUA 5I1GH 2VTFA 3LPWA 2R8SL 1BIIB 3OB0K 1H3PH 1YMHA 5E2TH 1OD9A 3IJSB 1KPUA 3RVUC 2GSIB 2Z8RA 3EYQC 3PL6C 3QQ4A 4XP1H 1CICA 2V2TB 4RAUA 1JFQH 2BVTA 5DRXB 2YZ1A 4JREC 1I7RB 3BQUB 4JEGB 5HXMA 3PWPE 3R8QA 2E6PA 2RJMA 5KVGH 5KOVC 1C1EH 4LSPL 3C9NA 3GJFK 3QHZL 4E42B 3WIHL 5DK0A 2F5AH 4NM8L 4GRLD 1JV5A 4U3HA 2WWMD 2Z8SA 3GSNB 3HC0B 1LO0H 5F7DA 1NDGA 2D3VA 5C0FB 2CDGA 1QLEH 2KKQA 3QDAA 4X8XA 1SMAA 2C7UB 2OYPA 3CFEB 1B0RB 5B8CB 1HDMB 3ET9F 4KK5C 5MERB 3OJVC 3Q6GL 1U6AL 2V17H 4HMDA 2AJYH 1QHPA 2D9CA 4JDVA 5CJXA 3O6MH 4WW2C 4WUUE 1FHGA 5KTEL 5E8DL 1IKFL 3QEHA 3D0VB 2ORBL 4CMHC 5AG8A 1HIMH 5ACZA 4R26H 2HVJB 1P7QD 2LVEA 2FEDC 1AGBB 3DOSA 4BZ1H 1IGFL 2JB6A 4K23H 2CIIA 4PPTA 5T3ZL 1PJ9A 3LN5A 4N9GB 1QFOA 1JZ5A 4YXLL 4NC2B 4OUOA 5GZND 4ENED 1NLBH 2CJUL 4AMKH 1JL8A 4LPTA 2Q76B 1M7IA 3CVIL 1URLA 1OP3K 1T4KB 3KAAA 2ZSVA 4N8VA 4FG6D 5D70L 2A9NH 2CKBB 5DJ2B 1TXKA 4HJGB 5C0IB 3RWJA 5C70A 2VXSH 3QCTH 1V7MH 4O58L 3CVHH 1FFOA 3CXDH 1UYWL 4PJGF 3MRNB 1I1YA 1NCBL 4MLSA 3IXAB 5IMKB 2EDLA 1K8IB 1WIPA 5DO2C 1F11B 1KACB 3ABZA 2F5BL 2HKFH 3VXUD 3FCTA 5EOTA 3RTQB 2Q20A 5T3XH 5A3ID 3VWKA 4LLMA 1GGTA 5I1IH 2VL5B 4R97C 2GW5A 1FL6B 3QUZA 3IDIB 5C0BB 1BX2A 2QQQA 1OAQH 5C6TH 4ODWA 2AJ3A 2OTWB 4UT7H 5DUPH 2VLJE 4OGZA 3IDXH 3LKRA 3MJ8B 4K2UL 4M61B 1E4XL 5D7JD 4XVJH 2GUOA 2P5ED 5D96B 5IR1B 3DV6B 1Y6MR 3LDBC 4TVPL 5KVFL 2XIDA 1AHWB 1AI1H 5K59F 3DRQA 1CFSA 2W60B 4OF7A 1IKNA 3PWPA 4BFGA 2RBLA 3T3PF 1F5WA 3AS2A 3KPSE 5IT2L 2OR9L 1KYOJ 5C0DB 2YA2A 3MOBH 4PG2C 1GPOL 3NCCB 4M3JA 2VLRA 3LDBB 1ZGLA 1JWMB 1M71A 2YA0A 4GQ9L 4Y4KD 5JXAH 1MFDL 1YNKL 4HULB 3QIUC 4P4RA 4I0PD 1ZHBA 2VQ1A 4QEGA 5EH1A 2DJ4A 4X6DF 3BKYL 4TOYH 3CH1B 4NQTA 5CKGA 3PHOA 2BNRE 5C86A 5DI8B 1FRGL 1ITCA 1Y6KR 4N0YH 5FUCC 4GH7B 2DQFA 2Y6SC 4XXDB 3U7WL 1JZ8A 2ZZUT 3LV3B 5DJ6A 2VLRB 1WZMA 4UDTA 2QSCL 1A7QH 1UKSA 4LDEB 3D85A 2HN7B 2EDBA 4LVNC 3S35L 4JFFA 5F88B 1X5JA 15C8H 5FYKD 5DJZA 3C08L 3L3KB 2CRYA 1RIHL 1W72A 4XCYB 1WWBX 2AGJL 3C60D 1S9WB 3CH8A 3PGCA 4YHNA 3TWCH 2OTWA 3BPOB 5BOZG 1MQKH 5E2WH 2F74B 2WUCH 3Q5YA 3RDTC 3MV9E 3VU2A 1A02N 4OF0A 4HPOL 3E0GA 3WN5C 1BOGB 3WUWG 4LLMB 3KS0J 3C87A 5A2JH 3M45A 2E9BA 1LE9B 1TJHH 2VWEE 2DDQH 2AS5M 1XZ0A 4HWBA 1EAPA 4JAMB 4R8WH 4F9LA 4MNHA 2YK1H 2CIKB 1J8HA 1F4YH 2EYRB 3PP3K 5D9SB 4FABL 4PB0H 4FMKA 1OTTC 4L8SB 1JN6B 1MCQA 4Y4FA 3SEPA 3ARDB 2OTUB 5E00B 4EN3D 5E7BA 1QSFA 3U7YL 5HYQB 3QXVA 2ZOLB 2HFGL 1AY1L 3L5JA 4NPYA 4RX4D 3BGMA 4X9BA 3IFPB 1B2WH 4DVBA 1T0MB 5F8RC 2IG2L 5E8OA 2E7HA 2ZNWA 1UWXH 4FQQA 5C08E 3RU8H 4YC2C 2A9ML 4KKLD 1RU9H 2X89D 1BQHA 3MLXL 2D4DA 2XA8L 3V52H 4HMCA 5AZ2H 5HHMD 4RMRA 1ZGLP 3VWJD 5AWNL 4UOW1 3LH2H 4H88H 1MVUB 4KDTA 1ZT4A 3HNTH 5KSVA 4HWEH 4RGOL 3V8CA 3QPXL 4AK1A 4CDHA 4XC1H 4XBGB 4UTBH 3H7LA 5FHAL 1CGXA 3DO3A 2J8OA 4OKDA 4D9RE 3H9SB 4WHDA 1ZLWH 4JKWA 5F6IB 4APQB 1KSRA 4LAQH 3VXPA 2XQBL 1B0WA 4DN4L 2DWEA 5C0NC 1FBIL 1J7VR 1U95A 1RFDH 3VJ6A 1DBMH 4NKDA 1WC7A 3Q5TA 4LKCB 4HKJB 4PLJC 1CLZH 2EYSA 1EX0A 5MI0B 3NFNB 3GHBH 4JDZB 5C7XH 4OV5A 1H5BC 4OCSL 3VXME 3ULUD 1UA6H 2DTSA 3S9DB 1QKZH 5DK0B 1AO7B 3KYKH 2DYPD 4OLWH 3OG4B 3LQAH 3SDXF 5E5MB 5IKCB 1RJYA 1KPVA 3UTPD 3QUZC 2FJHB 5MI0C 1TFHA 1GZPA 2O93L 1DCLA 1D5IH 1D5ZA 2BVOA 3X11A 3S36X 3HI5L 2DYPB 4JO3H 4ODHH 1FPTL 3TNNB 3X3FL 4JPWL 1OGAB 4R4FH 3IETA 3VG9C 5SV3A 2H32B 4A2LA 4JFHE 3BAEL 2V9TA 1PG7H 5LJYH 2ERJB 5I15L 3VFUB 3MOAL 1ZS8A 5IMLA 4NSKA 1RZ7H 3PE9A 1EFXA 3WXVH 5LQBH 1DSFH 3O4LB 4GT7A 4M7LL 4F15B 4BKLA 4OD2A 1NBQA 1XMWA 1NC2B 1HHGB 1H8NA 5BV7H 3DARA 1FVDB 3SDDA 3BPOC 4P5KA 5DDHB 2RIKA 4IRSA 4WU5B 5IHUL 5IROC 1CVSC 4MJ4A 2ITCA 4MAYA 1CL7H 1E6JH 5D71L 4N0UA 3U30C 2IQAB 4F9PA 5F3HB 1QFUH 1JYWA 5TGBA 5FA3B 1B9ZA 1I9JL 2FH6A 4F7PB 4PGDB 4JHWL 43CAB 2CUHA 3GJEA 4P4KD 4G6ML 4BJLA 4JANB 4EN3B 3RKPA 3QHTC 3C8KB 2PCPB 3IDGB 4LCWA 1XGYL 3G9VA 1KJ3L 3MFFB 1MHCA 4TPRH 4NKMA 1LO3L 3F58H 4PTTA 4CU8A 4XWOD 1X7QB 1WBYA 3BIAX 5F96L 5KSAA 2DQEH 5E8PB 1CBVL 4M9PA 1H3TA 2XWJB 3GSQA 4JZJB 4U6HA 1A7NL 3LY6A 1AGEA 1QSZA 3LKPB 4XMLH 5KSAC 4YX2L 5T1DL 2W9EL 3W0WE 1IARB 3MNWA 1QEWB 1JJUA 1GH7A 5I6XC 1FNSH 1S5HB 5K93A 2WANA 1I8LC 1F3DH 1H3VA 5DMJB 3GUTA 1BVKA 3K8LA 4X8JB 1G9EA 1EJ6A 1NJ9B 2FIRT 4JFQA 4G80B 1F4WL 2I07A 3U9UA 3B6SB 4NCDA 3GSNH 4I3GA 3V9FA 2MSPA 3S34L 2ZPKH 4NZTH 2DIJA 4YXKL 2H2SD 5FCUH 3PP3H 2DL9A 1FN4A 3SOBH 1D3CA 4FZ8L 5J06A 1MCHA 1MRFH 1DQJB 3GIVA 5E5UB 4F33B 1JI2A 3LIZL 5DC9B 3O8XD 1YQVL 4D0CA 3D18A 2VXQL 4ZPTA 3F7VB 5EUOB 3GGWA 1YNLH 4OFYA 3ARTA 3MXVL 3BISA 5GGRA 1CFTB 4I18C 4JN2A 1Z2KA 3RWCB 5IHLB 3WNOA 3LD8C 1CYGA 2V7HB 3BO8B 1S7TA 5IB5A 4Y8AA 4K3DH 1KUMA 5DK2B 5HDQL 4PJCF 2OL3A 3TO4D 1CFQB 2C9AA 2ZUXA 1MFEH 5ERWA 1LDPH 1WT5C 1C08B 1P53A 2H3NB 3BT2H 3RX8A 1SYSB 3AS0A 4KKAC 1NEZG 5IK3B 5TFSL 4L8BB 2ICES 1GC1L 3FOLB 1A0QH 3ARGA 1K3IA 1A4JB 1PDKA 4ZFFB 3B9VA 3K4ZA 2B5IB 5ISZD 1EO8L 1YN6A 3O3AB 4Y4HA 4WU7A 2WP3O 3TZVD 1UQSA 1L7TL 4MB5A 4W4OA 4Y5YA 1J1OL 1XF3A 3IDJB 2NLJB 4DKFH 4TTDD 3JTTB 1AIFB 4XAKE 1L7IH 4XNUL 5D2LE 5EG6C 5HHOD 1MJ7H 2VO5A 1ZLSL 2AJSH 5K9KA 3EZ8A 3CUPB 2W38A 3UMTA 3RGVD 3FRUA 4L3CB 1FZMB 1I7ZA 2VR5A 1J05A 1SEQL 5JQ6L 5MEOB 1GGBH 3OXRB 4L4VA 4HPYL 4JRYA 3FOMB 5EBGA 3OXSB 3MA9H 1FCGA 5BS0E 1MHPH 4HX1B 1I7UB 2AK4A 5KVMC 4JFYA 4OCWH 4AEIH 5IQ7L 3EDEA 2ID5A 3N85L 5DR5H 5D7KE 4MAUH 3EZJB 1BP3B 4YZFE 1ZEAL 5EN2A 1UADC 3B2UC 1MCSA 3BWAA 5JUEL 3IFNH 4UINH 2APTA 3DX7B 3KPPA 3K7UA 1T80A 5C07B 1T7VA 3IJYA 1KJ2L 1M1SA 3S5LA 3QI9B 5FB8B 4YHZH 4Q9CA 5FDYA 3RHWF 5FO8B 4OCNC 3MRJA 3QFDA 4D94A 1WWWX 3TA3A 3SDAC 4HK3N 4PP2B 1VGEL 1ZT7A 5C0AB 4IRSD 1YMMD 4OJFH 1WISA 5J8OA 4FRWA 3L1OH 3O3EA 2AVGA 3G5XA 3JZ7A 4NNPH 3UTSE 4LASL 5J12C 1FDLL 4ORGA 5I1LB 3SCMD 3MLUH 3NIGE 1KJMA 1ZAGA 1ORSA 3BQUD 2X4PA 2YUXA 2LAAA 2OTPA 5CJXC 1QO3A 4O9HL 1KTDB 2X09A 3I6LE 4YHPB 1HXMA 1RUQH 3AMLA 2W9LA 1I8LA 3OKOA 4OSUH 4OLEA 1KEML 3MRBA 5GS3A 1T6WA 4N5ED 1U8MA 4JG0L 2A6JB 4PJ8C 1VEOA 2BNUA 1ZK9A 1U91B 4LEXH 3WD5L 4NKIL 4KZDH 1LEGA 5IBLC 4XPAL 1HWGB 2RAMA 3OR7B 2IH3A 3K4DA 3I84A 3ECBB 1NKOA 2D0HA 4CVUA 2X44D 2ADFL 4RWYH 3F7YB 4YHKL 3MRIA 1LEKB 1S7UA 4MA8H 3IT8D 5LGKA 3HB3D 4JO1H 4YDJB 3RZCC 3F65A 1LP9E 1Q9OB 3FONB 2FJGA 1GCFA 4MD0B 5FM5M 5GHWL 3O2DL 3UYRH 2HH0H 4NDMA 5INCA 2P42B 2R2CA 4TUKH 2X10A 1QSEE 5FOJA 4GBXB 3UBXA 3IFOB 3SE3C 3PUCA 1YEFH 4X7CC 5JOEA 5DLMH 2E8ZA 1IC5H 5CEZE 4IRJB 1FFNB 5FYKH 1CFTA 2CD0A 5GRYA 3C6LB 3ZKMD 1WQVT 3QDJB 4N0CC 2Z93A 3QEUA 1FNEB 4HS8H 5ANMA 5I8EA 3PWLA 5DEGB 3ZL4L 3I50L 3MBED 5GRUH 1VCAA 3QBTB 1Q1JH 5IG7B 3WUWB 3G6JE 5DS8B 1KFAH 4MXVE 3L7FA 1DUYB 5GS1C 4Y5VA 3HUJB 1G7PA 4RISL 3FAWA 2X1OA 1DDHA 2P8LA 1UM4H 4GXVL 1V3JA 5GRVL 1ZHNB 4HMEA 4F3FB 5J56B 4HZLA 5I76A 1UJ3B 4AIZA 5CJ5A 1A9EA 2OQJB 4GO6B 4QRUA 3LKSA 1T2QH 4PS4H 4HKZA 4OGAD 1QYGL 3FO1B 3UJTL 3WFZA 3FT3B 3BP6A 1T22A 2FRGP 1P9MC 3GHEL 4JFDE 4TRPH 4ZUUB 3BMWA 1J1XL 2P4AB 3A6BH 3K80A 1A1MA 4JRXB 4U6HB 3TIDB 3VGAC 4FXKB 5J3HD 1YECH 1LD9B 2ZOKB 3DURB 2APVA 4N8VG 4ZS6D 5ADPH 2B8OT 5HD8D 1LNUB 1Q94B 1GHFH 5C0CA 1MCJA 1QLRB 4HG4J 3HG1A 4X6CB 4YGAB 1RIUL 3OWEA 2CMRH 3QWRA 5JHDE 2FX7H 1BFOB 5I1AB 2CSPA 3FO9A 4U1IB 4RGNC 5F9WC 3MROB 4G9FD 1ACYH 3HS0B 5CEZD 3GIZH 4LSUL 1QRNB 1IILE 3VXRA 3QNZA 4HKBB 4MAYB 4NGHH 1J1PH 5GJTH 3GBNL 4BQBA 5HHQA 1FZJB 4YNYA 2QQLH 4P2QB 1P7QB 2J3SA 2OL3H 2GAZB 2OJEB 4C56A 2ESVA 2DQIL 5DHVB 2KBGA 4LMQE 4MZ3A 4PRHE 5EOQH 4CMMB 2YR3A 3OJDA 5EA0L 3BDYL 4Y2DB 4MJ6A 4DWHA 2NMSA 3KR3L 3HMXL 1ZHLA 4G3YH 1LWRA 5MENA 1GAFH 4NYLB 4XVUC 5B39A 1UWGL 4WRLA 3ARZA 1PSKH 1QLFB 3Q1SL 4YO0B 3IS1X 2EIEA 3HMWL 4XMKL 3HPJB 1WWCA 2EIDA 4HXAH 35C8L 5IFHH 5DMYA 4QXUL 4O51B 2WNGA 4C4KO 4LLWB 3MV9A 3MRKA 1N0XL 1YEGH 1WFUA 1L0QA 4PJBA 2XWBB 5DURD 5DD5H 5KVDL 3WS3A 1KN2H 5E5MA 5EORH 4YAQB 3KXFB 4YHOL 5ID1B 3AY4A 3H3BC 2EKSA 1R3HB 4XAWH 5EC2A 1CGUA 4JREB 1AH1A 5I73C 1HOCA 3CMOL 5CGYC 4NUJB 2QHLA 2BMKB 4JHAH 1IAOA 5TF1L 1XIWA 4WJ5B 2EE3A 1DJSA 4XCCL 4CADB 5EU6B 4JPVL 1ED3A 2FGZA 3WJLA 1NC4D 5CSBA 5A2FA 3SE9L 2WLZA 3BP7A 2PO6D 3G08B 2DQJH 1F42A 3VXPB 3JV4B 2W65B 3LEYL 4UTAL 2NYYC 3QQ9C 5C0GB 5FYJL 5HVWA 4Z0XA 2IQ9H 3MBXH 4G5ZL 5F70A 2HRPH 2BVEA 1CD0A 4PRID 5CZKA 4UMGA 3MLWH 4DZ8A 3TYFB 3CFDB 4PJHE 3TPUA 3DROA 4YFEA 2NY6C 5D7KD 2FJFB 2UY6A 3WFBL 1F6LL 3GI8H 1CF8H 2R56L 4LVEA 1LDSA 5EZJB 2NY4D 1F3DJ 4WTZG 4PG2A 4RBPK 5GZOD 2DKMA 5BMFH 4IIQC 2O5YL 3NZHH 2G60L 3O9WD 3BYTA 5EB9A 4GS7C 2BNQA 2OM5A 3BGMB 2X4TB 3QWOA 4GUPA 3BVNA 2MCG1 2HVKB 3LQMA 1R3JA 1WCBB 2B39A 5D7LE 4V2CB 1IGIL 3GMNB 5IG7A 5KAQG 1RZGA 1XIWC 5B21A 3GMRA 4JZOB 5JHDB 4MNHB 2Y25A 3ULUL 4O2FB 3T65A 1DTUA 1EAPB 1CS6A 2E6JA 4MD5B 5E5RB 3MV01 1XGTB 2B2XH 3BD5A 3PGFH 1TJIL 1Z9SA 3H9HB 4Z7QF 4LHUG 1U2CA 4TSCH 2IFGA 5GXBB 1DQDH 2VZSA 5FM8A 1LEIB 3OPZH 1UJTA 1IM9B 3UO1H 1N6QL 2GTWB 3CX2A 4U1GB 1BZQK 3MRQA 5L9DL 1SY6A 2M1KA 4FFYH 4EVNA 4BZ2L 2PO6C 3A6CH 2CGRH 5GPRA 3EFDL 1TTUA 5LAXA 1T89C 4XPBL 2BSED 1A3QA 5EOCH 3L3KA 4NKOB 5F7KC 2DQUL 1KELL 5HDOA 1EMTL 3MLVH 3TYGH 3WFHA 1E4XI 3P30H 3ESVF 3JV5A 4JFFD 1XF2B 1FGNL 2AQ2A 4M7JH 3D85B 5CGYD 1NGWA 1GRWA 4HEPG 4JFEE 5BZDB 3GRWL 2PO6B 4IS6B 3RX7A 3HPLA 5CP3H 2DL2A 5I8OH 4LCCC 1HILA 1MLCA 5CP3A 2VJXA 3SDCA 1FFQA 3R8BB 2AXGB 3QIUB 3OKMB 4Z6AT 3WSQH 4I2XE 4J6RH 1LHZA 3JVGA 3C8HA 4HDIA 4LCWE 3HC3L 1QNZL 1JRHL 3BPNB 4ZXBD 3B5HA 5E2VL 2CPCA 3MYZA 5AUMA 4DQOH 1V5JA 4ZUVA 2HLAA 4DFIA 4CKVX 4U1LB 4FTVB 4LPXA 1YEKH 2LTQC 5JA9A 4LHUA 4HUXB 4LLYA 1ORSB 4JO4L 5I1EL 1A2YA 3H3KA 4ZYKB 4P5TC 3WS6A 4G6JH 2FZ3B 2Z92A 3IF1B 2VYRE 5FF6A 4YPGB 3MRDB 4HK0B 4RX4A 1A6AB 4BUGA 1BD2A 3B9DA 5MEQA 1JIBA 4GRMB 4M61A 4M4PA 4AG4H 1FL5A 2VLJA 4NWTH 4F7EA 3GI9H 5E9DB 3RWEA 2VNCA 4PJBF 3HA0A 3IDIA 5KN5B 3N9GL 4Q9QH 1X5XA 1T20B 2WZPD 1IEHA 3NACL 4ETYA 5EBMB 1B0GA 1VEPA 3HI6L 2OXHA 5CINH 1DANU 4XNYH 4QRTB 3NCEB 3S4SB 1I3GH 2JELH 2R29L 3DX7A 1Q72L 4X7TA 3MV7A 4Y2DD 5GGTL 5HVFB 4M1CD 1ZVSA 2Y36L 4M7KL 4P9HH 1FFOB 3V0WH 1JPGA 2XXMB 4OBSA 2GHWB 4RNRB 3QA3B 4OF8A 4HJGA 4MCZB 3FQUB 5J4MA 1AGDB 2D2OA 1T03H 2X4RA 5BO1L 2K3TA 2W9DL 3LKNB 2JJUA 5GGSY 3GSRA 4RGMB 1INEL 4ZXBB 3MNZA 2VISA 1BBJB 1IGCH 3C5SB 3GB7A 1TCMA 5MEOA 4JFOB 2EZ0C 4XVSH 3WJJA 1PY4A 5E4IA 1RURH 4ONHB 3QCUH 1G9MH 3VFVB 1FAIL 4E41E 3QUKA 3SGJA 4KRLB 1T04B 1NCAH 2HVJA 3OTTA 2R0WH 3ZHLA 2WBJA 3C2AH 1RD6A 4OCYL 4UILL 5I1KL 1EUTA 4Q6IA 2ZP0T 4GG6A 4UV4H 4YDVB 3WUZA 4IM8A 3P4LA 5GRJL 1DE4A 3G5VB 4FOMA 4ZODA 1XF3B 4R4ND 4MJ5B 1P4IL 5FO9B 2JE8A 5L7XH 4KTEH 4I3RL 4UIKL 1CDIA 4DVRL 2FGWL 2HRLA 2CDGB 2P49B 2VDPH 2PKDA 1I1RA 2G75B 3HNSH 2EDNA 3B2VL 2GY7B 5MP6H 1JZ7A 3MRFA 3I3BA 4NQCA 1W72H 3N1MC 4NFCA 5ACMA 1KV3A 4FQHB 4IDJL 4IJ3B 3K2UL 1C08A 1OAUH 3V0VB 4B50A 1MF2L 5DMGC 1XF1A 5DJYA 3QXAB 5HHPB 4YPJA 1MAJA 1NGZA 1EA9C 2GSGB 4GMSH 1BIIA 1G84A 1C5CL 1KT2A 4RA0C 4LLVA 4XVTL 3KYNB 1AFVH 4DTGL 4QRPA 4TNVK 4TQEL 1NUNB 1U36A 5I18L 4LLQB 1QFWL 1YJDL 5J11C 4HIJA 1BREA 3BKJL 4HT1H 3UZEA 5L2JB 4G8FA 5JIIA 2XN9E 3L3IA 4G6KH 1JYNA 4KJWC 1YPZE 2PYFA 3MGOB 3I3EA 1CK0H 2OR7A 3F6LA 4KQ4H 1NMAH 5SWZE 2A6IB 3LPFA 5GS0L 3BP4A 4XRCA 2EDEA 4Y0GA 4ZUTB 4EOWH 1JTPA 3RWHB 1CD1B 2DM3A 5TPWL 4N5EC 1U3JA 2A6IA 3OAYH 3PNWA 5HHME 3MCLL 1P84K 3HN3A 3V6ZA 1ZTXL 4ZQKB 4LSRL 1S9XB 3FTGA 1EHLH 4KI5D 1MCLA 5C71A 1MCOH 3MNWB 5EU6D 3LEVH 4ESKA 5C08D 4CUCA 1OAXH 2ZCLH 5I9QB 2AV7A 1BHGA 1ZLVK 3EHBC 4K3JL 1X6NA 3W9DA 2IJ0C 3KPRA 4XH2B 3LN4B 5IGXL 1BJ8A 5SX4H 1MJJA 1KIRB 3EHBD 1OY3B 2CLVB 2FO4A 1RZKC 2J5LC 5DURB 4Z9KB 2RQ8A 2WUBH 5T5FH 1VEMA 4XP5L 2YD4A 4WV1B 3C5ZB 3W2DL 4ALAL 4UNVA 1ZV5A 4NQEB 2UZXB 3BIKB 4ZD3L 3SCMB 5EFIB 12E8L 3MSPA 3U2SA 3FT4A 4LNRB 3PGDA 1NGXB 1BOYA 5J9PB 3PL6B 4NJAL 3VFWB 1FH5H 3QH3A 2ZNXA 1BIHA 4J1UB 5AZEL 2NY6B 3T77B 2H2PD 3FAXA 1U8IB 5FO9A 5D2NE 4MJ5A 1OCWL 4JKLA 4BKLB 2D7QA 5DQDL 3I02A 1CXLA 2OZ4L 2H1PL 1NFIB 3T04D 4D3CH 3ZHKA 4P59L 1F3JB 3EYUL 4Y4HD 4HCRH 2Z31B 4Y2OA 3GBLA 4ONGH 3QEQD 1OP5H 3ULUF 2DQCH 3K8KA 2VQTA 3MGTB 4L5FL 5TDNA 1SQ2N 4Z0BH 4KMTL 5HSFA 4IMKA 4PRPB 3L5XL 1TZGH 3RGVC 3RY5A 3OKLB 4WCYL 3ULSB 4X98B 2EH7L 3TNNA 1F4XL 3ES6A 4JDTH 4ZUSB 2JIXD 1QRND 2BVOB 3X11B 4KMQA 5TDPB 3WKML 4H20L 4M5ZL 4QXTA 2XV6B 5TQ0L 1KC5H 1BQUA 5LCVL 1DVFA 3BN9D 3HE7D 4JB9L 4UIMB 4NO3A 3SDYH 3PDOA 2G9HA 4MA7H 5E8EA 4QOKD 1MEXL 3TBWB 5JPMA 4DZBA 3TN0A 3Q6FA 4POZC 1AO7A 1E27B 4MS8C 4OGXL 4UIMA 3MV7B 2Y06L 6CGTA 3IKCA 3P0YL 3ARBA 3QO1A 3NGBB 3WXWL 2VC2H 4L1HA 4GKSB 4OV5B 4AZ8A 4ZPVB 3RY6C 4RFEA 4OCMC 1R0AH 4HKJA 1JNNH 1Q0YL 4YXHH 2AK4D 4KKAD 3P11L 5DTFA 3TIEA 3JSSA 1IQWL 4HWBL 1YA5A 3TZVB 5DD0L 3IKKA 5HVHC 2X4UB 5IB3A 1NGPL 1K6QL 5TDOA 4YFLF 4Q9BA 3U9PL 4BFEA 4ZO6A 3TO4C 4KVCH 2DLFH 2AK1L 2FSEB 3HNVL 5EC1A 2P8PB 3ROOB 5KSVB 1JGLH 1G6VK 2FZ3A 5T5NF 4OIIL 4G9DB 1W8OA 5HJ3A 3ZTJG 4AY0A 4OLYL 3I2CH 5K9OB 5A2LH 3PV7A 3FN0L 3TO2A 3FFDB 4JHBA 3OBAA 1QBBA 3UTTB 1JK8B 4GW4A 2UUDH 4XNXH 4D2NA 5HHOE 3STBA 1WV7T 4CVZB 2X4NB 2P5EA 5FGBA 1OGAE 1UB5B 3DETC 1Y18A 2N1KA 2FWOB 2NXZD 2OLDA 1QBMH 5HYQA 1FLTX 2AXGA 1JVKA 1TDQA 2Y72A 5E00A 1RHFA 4IRJD 1OM3L 4PR5A 1MLCB 4BFIB 2DMKA 1VACB 1N7ML 4H8WH 4WV1A 1NEUA 2FB4L 3NN8A 4FQ1H 4HUMB 5DHXB 3VGEA 3JVGC 3QZWB 1JPTL 5KVEL 3QJFA 3BXNA 3V4PL 2HYMA 3IU3A 5FGSA 1CLYH 3DX6B 5EZOH 4HAGA 4JO2L 1EGJA 2VIRB 4U6XB 3VDCA 4MAYC 1HHJB 1SBSL 3MV8B 1NMBL 1SM3L 1JYVA 5FA4A 3CVHA 3P9MA 1UCTA 4NUGH 2NYYD 3QQ9D 3DX9B 1DN0B 2OP4H 5DFVD 5DJ8A 4WWID 1YMME 2ZUSA 2XNAB 3UTTE 4XCYA 3MRQB 5ITBL 3BDBA 4ZQKA 1TIUA 1D6VL 1VERA 4K9EL 3ELAT 5I19H 3QG7H 5TE7H 3RZCB 1NGYB 4LSSH 1YQ2A 4X5XA 4P4KC 1GOFA 1FE8L 4MDIB 3T4YA 1NCCL 3D25A 1C12B 2HJFA 3F5WA 2DLIA 2ADIA 4KJPC 1U8HA 3MR9B 4UDTB 4GOSA 5DJ6B 1U92B 3CFIC 2DJUA 3S3SA 1RZGB 3MGOA 5IEKA 5F7WC 2UZIH 4QXWA 1LK3L 4U6YB 4WI4A 1R3JB 1WCBA 1M6OA 3PHOB 4CGTA 4QGTA 2B1HH 4LSVH 3B8YA 1Y18B 2HT2D 1KB5A 4G9FA 5GGUA 3RWFB 4CVZA 4K07A 1QUNA 4M6OH 4OQTH 5EZIH 5DC0A 2YMXL 4WTZA 5T1LA 3IVKA 1YMMB 2QJDA 4HGWA 1AJ7H 1CE1L 3K1DA 3DROB 1UB6B 3M17A 2IWGA 1K4CA 3PXJA 1HKLL 1S9VB 2GSGA 1MCIA 5D8JH 5DT1L 4DZ8B 4NJ9H 3T08A 3QXAA 3WNNA 3V0VA 4M6NH 2GY5A 1DQLH 3GMQA 4JY5H 4U0RB 5HYJD 3OF6A 4NO0D 1X5AA 3SO3C 3HE6D 4Q6IC 5D7IA 4FQLH 3ARPA 4MD4B 5SWSD 1O5DT 3QUYB 1KG0B 1UH3A 1ZMYA 1LE5A 1I9IL 5FGCE 4K71C 4WJ5A 5D72L 1XIWB 2BMKA 3TF7C 4E0RB 2BY3A 4NUJA 4IBLT 1CGSH 1JNJA 2R69L 4KDTC 2PYEA 5E08L 2X9YA 3O0RH 5EC2B 5DD6B 3QDHA 3T0EE 4OI8A 4N1HB 3V5HB 1RQ5A 4KXZI 1RUPL 3O9WC 4OB5L 2BRQA 32C2B 3DNKA 1CGTA 2G9HB 2MHAB 4WEBL 3NCYS 3S4SG 5GZOC 4G6AC 3MRCB 4EBQL 1T6VN 3LRSB 2VDRL 4Z7OF 1IC7L 5ICZA 3FQTB 2XZCH 3SDAA 3MRKB 4RDQG 4NQUA 5HHOB 5DEFA 4ZFZB 1AO7D 1SY6L 3LN5B 4N9GA 3TESA 3L5WA 2Q6WB 1JUFA 3GK8L 4QLRA 2VISB 1AGBA 3VFSB 1SHMA 5F71A 1Q9WB 5F1IA 3LRHA 4F9LC 1MJ8L 1XGQA 3TCXA 2YPVH 1SBBA 4K3EH 3DVGA 4WHYH 5T3ZD 5ISZB 4XXCA 3RWDB 32C2A 4OGAC 2VSDA 5KJRL 2E8YA 3HE6B 4NM4H 3V5HA 3MREB 3UTZB 2VKWA 3O3DA 1X5KA 4RQQA 3LHPH 1K5NB 4MX7B 1BFSA 3OJDB 4EDXA 3S4SA 3D0LA 3H3PL 4OKVB 1T66D 5DHVA 4PJAA 4HAFA 3CFEA 5I66B 2ERJC 1J0ZA 1A6VL 3KPMA 2OS7A 3VWJB 5I2IA 4A6YL 3VFWA 3U0TB 2KZWA 1L9MA 3PGDB 2C3XA 2M26A 2YKLL 1KN4H 4JVWA 3W0WD 3DUSB 1BD2B 1KXVC 4WTXA 1MPAL 3O6KL 3S96B 5JTWA 5GJSL 5FF6B 1NAML 3S8WA 3WFCH 7FABL 1BFOA 5I1AA 2BC4A 5DXWA 1JNHA 4ODSH 1DR9A 3T0DA 2P48B 4PP1D 4J2XA 1MWAL 1KIRA 1MJJB 1P4BH 4DGVL 3OKDB 1EH9A 3V6OC 4LOUD 3IVKB 4Y4HC 1XF5B 4FNLL 1VHPA 3RWFA 1KB5B 3RZCD 3HB3C 4LPCA 3BW9A 1U2HA 3OKMA 2AAVA 4U49A 4MNQA 4NCC2 5D7LA 1E6OH 3NCMA 4UT6L 3MPCA 2NNAA 3H0TA 1U8OA 1NBVL 4FFWD 5EO9A 4XCFL 3DSFH 1RZJH 4KTDH 2Q87A 1OSZA 2IC2A 4PBXA 3S35X 3U4AA 4M1DL 3WJLC 5DQ9B 2XA3A 3UTSB 2C3VA 4P9ML 2Y6SD 4R6UA 4MDIA 2GTZB 3MJ9L 4POUB 5MHSE 2P5WB 5CMAA 2Y1VA 4HHAA 2F8OA 1ZOXA 1MCPH 2A77L 2CLZB 4NNXA 1U8NA 3JTSB 5ILTH 5GGVL 1MHEA 4P3WA 3DIFB 4MNGE 4YWGH 4QNPE 1ZA6A 1RZFL 3EYFA 3SKUD 3FMGL 4M5YH 3BZFB 3HG1E 3G6DH 3QDJA 1FL3A 3C5JA 2APBA 1KBGL 2UVFA 3MNVB 4WV1C 5D93B 3VFPA 2CR6A 1NUDA 4FQCH 2IFFH 3V95A 3PWNA 5DD1H 2VIRA 3I9GH 3IRPX 4Z7WA 3IU3B 4XXCC 3BXNB 2W0FB 3FQNB 2XICA 2AP2A 4WHTA 5CSZA 3LKQA 4FQIL 4N0FB 3X14A 4PJ8A 4NDMB 5HI4C 3AB0B 4KJYB 1N59A 1CLOH 4R9HA 3H42L 3SY0A 5IFAL 3UCRA 1IZJA 2GI7A 2HVKA 4FQXB 3SE3A 3DRTA 4X9HA 4FTVE 1TMCB 2P5EB 1MIEH 5ABDE 1J12A 2BDNH 4PJEE 2E9IA 2XWTA 3ZHDA 3VH8B 1S78D 2PNDA 1Q9LB 5EZJA 1INDL 5JHLL 3AAZB 3QNXB 1INQB 1NSNH 3E6HB 4KJWD 5ID0A 2FJFA 4OUUA 2ICWA 1E4WL 2MTPA 4NN7C 5IOPA 3DLQR 4ZOBA 3QUMA 1FVCB 1YYLL 1CGVA 2R15A 3RVWC 1MELA 1Q9KA 5ACLA 3TYFA 3V4UH 3B9EA 4YDVA 4DK6A 4KUZL 2FX9L 4Q6IB 5DFWH 1ADQA 1DLHA 3TA3C 5CWSB 5C92A 1IC4L 2DKSA 1TNMA 2Z4QB 3O45A 2VABB 1NUFA 4NRXB 2YPKB 3Q3GA 4QOKB 1ZLUK 5DMKB 3GJFB 2WV3A 4QXGL 3EYOB 3QUML 4JKPH 4Z7OE 4GRWE 5HGHA 1TITA 2DQTL 4I48A 4Q9RL 3HE7B 1HHIB 5T3ZE 3SJVE 5EU5A 2WWKT 5I8CB 4HC1H 1EBAA 5IHZB 3G5XB 1LP9A 4LCYA 4J3UA 2P5EE 3KHOA 4XP1L 1GZQB 1S9KC 1JFQL 2LVCA 5CP7B 5B39G 4YUEH 4PRPD 1KCRL 2CRMA 3FQUA 3PQYA 4LQFL 2IF7A 4D9QD 3QA3A 1TJGH 1C1EL 4LSPH 3QEQB 1JPGB 3TZVC 2ZCKL 4S1QH 3QI9A 3AM8A 5ESQB 4P2OA 2B1AH 4NO3B 3VW3H 1MCRA 3R0MA 1QLEL 3MV9B 3MUJA 4R4NC 4EIGB 1AHWC 1PD6A 5I74B 4O51A 3LZFL 2AJVL 5IESH 3ZYIA 4LL9A 5DD3L 2OJZL 4HFUH 2AJYL 3HPJA 3RQ3A 3VD4A 4XP9L 5IEHB 5GGQL 3HZKB 1PQZB 4NC1E 2D7TL 4K8RD 3PL6D 1PEZA 5FK9B 1P2CB 2YEZB 4TUOA 1XEDA 1Y6NR 4HFWA 4GRLB 4HUWA 2AEPL 5T1KB 3CGTA 1ND0A 3QDGA 3FOMA 5AG9A 4K55A 1IGFH 4Y2DA 1HH9B 4JPIB 1BQHG 4CMMA 4PJEA 3CFKB 1KYOK 1AXIB 2PTTA 5SX5K 2XZQH 4WO4A 3BZEB 2BOCB 4IRSC 4OGYH 2X70A 3WIFB 1NLBL 4YBLC 2ED8A 4K7PH 3EKCA 3L95A 3NABH 5T1KA 2BX5A 4TUOB 2X4SB 4H0IA 5FK9A 2DLEA 2BNRD 5CILL 5EU7C 2VXSL 5TE6L 1PQZA 3TBSA 3CVHL 1J5OL 3P4NA 5IEHA 2WBWB 2J5LB 3U4EB 4L9DA 1UQSB 2FL5A 4HUUB 4G42A 3FO9B 4XHQA 1AQDB 1MLBA 2GEEA 5F7FA 5JXEA 1FV1A 3TJEL 1PX4A 2D7MA 2CLVA 4XCNA 5IJVA 4V2BA 5I71C 2ZUYA 3DXAE 2ED9A 1PYWB 3MXWL 2V2XB 2BVYA 5GISL 4JFZH 1R24A 3CDCA 2BSTB 1GGCH 3W9DB 1OAQL 1HI6A 5CZVL 5C6TL 1SJVA 3KPSD 1B88A 1HKFA 1OGTB 1CGYA 4K2UH 1E4XH 4XVJL 5KVFH 3EAKA 3ZTJH 4N0UE 4TNVF 1AI1L 4NO5B 2IADB 3X13A 2H8PB 1CFQA 5L0QC 2VL4A 1IM9A 5I1DA 2P47B 1V3KA 3UPCA 3KLAB 5KS9E 5B38G 5TF0A 3MRPB 1N5YH 1GPOH 5LG1A 5DVKA 5IVZB 5JMRA 4MD5A 3LQZA 1L4IA 4O2FA 5GSVA 3KPRD 5HPOA 4D9LL 2UZYB 1KJ2A 4ZPTB 1X4ZA 1MREH 4NRZA 1VADB 3ULVH 1IGML 2FEEI 3BKYH 4JHZA 4TSAL 3T4AA 4Y5VB 4J3TA 3MRMB 3L3GB 2X9WA 4KY1H 5KSBB 4NT6B 4BQ8A 3QWQB 5L8JB 4N0YL 1XCQA 4GUPB 3PWLB 5ETUB 5GSVB 4QWWD 4QRPD 1SJEA 1KJVB 4IOFD 4RIRB 2QSCH 4KVNL 2AXFA 5D4QA 3ZTNH 4ZMAT 5E1HB 4OZIB 1KT2B 1RI8A 4N68A 3S35H 4MJ2A 1K9TA 4NQEE 1SEBB 1IAIM 2UY7A 5CD3A 1X5HA 4LQ1A 15C8L 2WLYA 1FG2A 1H3XA 3R1GH 1D9KB 1DVFC 5INCB 5IMMB 1UCBL 3MRGA 5M95B 3TV3H 1RIHH 3QIBB 1H15A 3QDMB 4PBVC 1G9NH 4NQXA 5C0GA 1WWAX 4XB7A 1CI5A 5E2WL 4N0FA 4NQCB 4OQTA 2FECI 1PYWA 5CKAA 4YZFF 4LU5H 1J8HD 2VXUH 5D1XD 1ED3B 2W0FA 4EDWH 4ZDHB 3U0WH 4ELMB 1YNTA 1S7VA 1IM3B 3OR7A 3H9SE 4GW1B 4R8WL 5C2BH 43CAA 3GKWL 4GKNB 2YPLD 3BKMH 1PKQA 5INDB 1F4YL 2BNUB 4YEEA 3GEWB 4FABH 2E3VA 4X6EB 1I4FA 1QBLL 4Z7VB 1W0WB 3KXFA 1V8HA 2DBLL 4MXQC 5CUSL 4EUPH 5JLZA 2BFVL 3WS3B 3LS5L 1U8NB 2CLZA 4X7EC 4OLVH 4HHAB 5LWYL 4P48A 3BGFB 2HTKC 3V4VH 4MB3A 3PWUB 3TBYB 3RBSA 2J1KA 3QUKB 4XNQB 2WK2A 2A9MH 4JY6A 4L3ED 1OT2A 3BX7C 4P2OD 2FATH 2X4PB 1VGKA 3VRJA 3FL7A 25C8H 2HWZH 5I1CL 5AWNH 3WHE0 3WHE1 4F15C 1DEEB 1U8QA 2DN7A 4YK4C 4M62H 4RGOH 1NPUA 2IALB 4LVOB 4D8PA 1MCDA 4XC1L 3BW9B 4LIQL 3MYJB 5FHAH 1AGDA 4XPGL 1OAYH 3HZKA 4YLQT 4RNRA 4C56D 4KK6C 2R2BA 4IIQA 2UWEA 5E6ID 4CN4A 4XBPB 1ADQH 2XPGB 3S5LB 1K2DA 1T21B 4IMKC 1RFDL 1IBGH 1TTFA 2LV4A 3REVA 1WICA 1DLFH 1JF6A 2EEDA 1DFBH 2BP3A 3N0PB 2G5RA 3GHBL 3G5YB 1T5WB 5GS2D 3VFOA 1KTRL 2IPUG 1SVZA 4EN3C 3NPSB 1LMKA 4OTXH 4LF3A 3CJJA 4WI6A 4Y1AD 5HHQB 4Z95L 3EO9H 4PFEA 1Z5LA 3ZKQD 3QNZB 3DUSA 3MUGA 1FL5B 4MJIB 4PJBE 4OZ4B 4R0LC 4LFHD 3VFTB 2HLFD 3VRIA 4L1DA 3V7MA 1I8MB 3NFNA 4PJHF 4XI5D 3VA2C 4U33A 5EU3B 2ZUVA 3HRPA 1CE6A 2C4FU 2EO1A 3BGAA 3QAZB 3HI5H 3L3HA 4JO3L 3WDJA 4ODHL 1U95B 1H8SA 5C0CB 3GJFA 1K5NA 3BI9X 4MX7A 4D0BB 2VABA 3DGGB 3C60C 1C5DA 3PV6A 4XVUD 3RVXC 3U46B 1XCTA 3BAEH 3BE1L 2VQUA 1PG7L 1TLKA 4OFPA 3VI3F 4TTGA 3D2UB 3IS0X 4ZAKA 2QV2A 4ETQA 2L4OA 5DHYB 3IDJA 4WFED 1U8QB 1DSFL 2EXYC 5FO7B 1EJOH 3U6RA 4P2RD 4M7LH 3H9YA 4O2CA 1ZSDB 3QNYB 4XGZA 1OHQA 3PIQA 1F4HA 4EUPG 2VKXA 3MCKA 1NBYA 4KGJA 5IHUH 2OI9B 5ALBL 2MHAA 4RA3A 1CL7L 1E6JL 5D71H 4BM7A 2GCYA 1BEYL 1HEZB 1I3VA 4I0PC 2HTLC 1PZ5B 5E0QA 2EYRA 1W0WA 4Z7UF 4Z7VA 5FYLD 4PLJD 1I9JH 5ERWB 1WF5A 5CSZB 3VXSD 4G6MH 4KROD 3C6LA 5KG9B 1MIMH 4P49A 3H9HA 4ZS6C 2XN9D 4C54A 1KB5H 2R1XB 3IFOA 1LO3H 2NY2C 5C07E 5T1LD 5BVPH 1A6UH 4UQ3A 2NY4B 5F3BB 3F7VA 3D18B 2F54A 2AI0H 4HF5L 4OF5A 1EFXD 1XF4A 4YHNB 3VWJC 3EFFA 5CIPB 5T1DH 2W9EH 3QIBA 4V1DA 1C8PA 3OAZK 3MRIB 3QWOB 5IW6B 3B5TA 5A3IC 1A3LH 3KPOA 4KK9D 2GTZA 2VN4A 2EKJA 1ETZA 1N64H 2VLLA 5J12B 3ECBA 4CBPA 3MV11 1G6RA 3W9EA 1X6LA 3QZWG 4HH9B 4PJIF 2PXYD 3I75B 3FFCA 2W07A 3GUTB 3U6RB 1BGXH 5FO7A 1KJVA 2DQFB 2YXMA 4YXKH 4PJAE 3KGRA 5DI8A 4XT1C 4CVXB 1OARL 1A3RH 4NT6A 3P0VH 2NR6C 4ZTOH 3HMXA 3ZKMC 3MO1A 4P5MA 5IEKB 4Z0XB 2NZ9C 4I13B 2VXQH 5D6CB 3JWDH 1U92A 2W65A 4MA3B 4KWUA 1ZVHA 3BP7B 2FH8A 3RPIB 5FM4A 4OCLC 1KENL 5D2LB 3L9RA 2DI9A 4HH8A 1J8KA 2YC1A 3WHXA 2R8SH 3SDCD 4YHYC 5EU3A 5E2TL 5HDQH 3B9KA 1I8MA 5E8NB 4IDLA 2LU4A 2XT1B 2VDQL 4KAQL 1BM3H 3WS6C 1T5XB 3ZYOA 4JJ5A 2EKSB 1QQDB 2IADA 4E41D 4PP2A 5IW1B 1DN0A 4O4YL 5JOPD 2BZDA 3P0GB 2XWBA 1Z3GL 5FCSH 3O81A 3LVEA 4OLZH 1A14H 1GC1H 3MLZL 1KCSL 1T5WA 2VOTA 2DI7A 3RTQA 5F1NA 4ZTPL 3REVB 2WWMC 4ZUWA 1J0KA 3UTQA 3WE6B 3O3BA 1ZLWK 1L7TH 3CDYA 5EU7E 3VI4E 1J1OH 1I1YB 2V17L 5JW3H 2UWEB 2FL5B 1EXUA 4KDWA 4DKFL 3QDJE 2VDMH 2GT9B 3RWDA 3TBSB 3DVGB 4WFGD 5KTEH 5E8DH 4WI8A 1OTSD 1X5ZA 4LVHB 3VXTA 1MJ7L 5F1IB 1MI5B 4NN5B 3FKUS 3QFJD 3UC0H 4R2GD 3V6OA 4R26L 3D9AL 1OW0A 2X4NA 1ZWIB 1NMCB 4TNWF 1QPXA 1VGKB 4BZ1L 3SCMC 3DUUA 2Q7NA 1PY9A 2QTEA 4K23L 3NGBC 1MCWM 1SEQH 2CIIB 1VFUA 1NFDA 4H26B 3RNQB 4GAGL 3TT3L 4PJGB 2ESVB 1F90L 4Y19E 3TBYA 4H25B 3CUPA 5CSGA 4BH7B 3DWTA 2ZKHL 3QDGB 3SDAD 2E7BA 3MUHL 3FT2B 4DUXA 4JM4H 2P8PA 1X4XA 2RFXA 3N85H 3MRLA 2PYEE 2A9NL 1MAML 3QIWD 3VXRB 4ODUB 1I4FB 4PGEA 3JUZA 1V7ML 1U8PA 5IB3B 2PR4H 4WW2B 3ZT5A 4PREB 4K7PY 3JUYA 5GS2H 2F5BH 3DXAD 2HKFL 3E8UH 4GW1A 4OI9A 2EYSB 1IM3A 5T3XL 3BSZH 2WW8A 1IRAY 3VG0L 3WYRA 1GVIA 5MENE 1KG0A 3EOTL 4UBDC 1QLRA 4OAWA 4HUNB 4L8BA 4MD4A 4OFIA 4FG6C 4PYHA 1OQXA 5KBNC 4YHZL 4X80L 1AO7E 1E27A 1M7DA 4NC0B 1SYSA 2EC9U 4PV9A 2DQHH 1H15B 2EEBA 1VGEH 1JHKL 3FB5A 3CLFH 4U4BA 3LKOB 3MRGB 1E28B 2R0LH 3L1OL 1VPOL 5CJBA 2FD6H 5DK2A 3LSOA 5IT2H 1NBZA 1LP9B 1UKQA 4HKZB 5I8CA 3ARGC 1A9EB 2V7HA 4ZUSA 4AIZB 5E24E 1B4JL 2VDLL 1E4JA 2FHCA 4W6WB 4WUUA 3WNPA 4X5WB 5D1ZD 4GQ9H 4AT6B 5E1AA 4I4WB 5TDNB 3NAAH 5EUOA 4PRBB 5IVOA 1DDHB 1WTLA 4L8DA 2ZOLA 4OSUL 1ZE3C 2R0KL 2NX5D 1KTLB 3GBMH 3RUGE 4TOYL 3MRMA 4L8SA 4Y4FB 1RV6X 3T4AB 1CG9B 1QOKA 3EJYD 2AABH 1U3HA 4LEXL 4KZDL 3L5IA 5CD5D 1FGVL 1UWEL 1J0HA 3U9UB 4V1DD 3F5WB 1MCEA 4M1GL 1A7QL 4Z7UB 2R4RH 1FFNA 3RZCA 5D7LD 3LS4H 2ADFH 2PTUA 4QF1A 2XTJD 4TVPE 4KPHL 4NP4L 5B38B 1G7JA 3C08H 2K1MA 1W0VA 4PG9B 4BQ6A 2P8MB 3EYQD 3RVUD 1S9WA 1QG3A 2MOVA 4JCLA 2A83A 1FFPA 3O4OB 4G8GB 4HWNA 1X5LA 2HH0L 3P9MB 2XWJA 3GSQB 5FA4B 4Z7WF 1G7IA 3W39B 1HHJA 1BQSA 2WUCL 1UXSA 4NFBA 1ZVYA 4HPOH 3F7YA 4Y4KA 3MFFA 4JFXA 4P3DA 1I1AC 4PRIE 5FYKL 3M8OH 2XACC 5CJQH 1FV1B 4PJ7F 3WO3B 4YHIB 3QCVH 4M8QB 1G7IB 2J88L 3W39A 3VXSA 4XXDA 1N8ZB 4Y5XA 3ZL4H 4X6CE 1CDBA 2YBRB 1H0DB 1P1ZB 4QRRD 5ENWB 3EYFB 4KTYA 4QOKE 4U1HB 1KFAL 4RMQA 1ZLUH 3QRGL 2QADC 3EBAA 4R4BA 1R3KA 2YD5A 3U7YH 1AY1H 1BMGA 3BUTA 1UM4L 3CDFA 4GXVH 2GKIA 2F54D 2H41A 4IRSB 2NCMA 4QHLB 4PJHB 1Q0XL 4PLKD 4DAGL 2IG2H 3BZEA 5DJXB 1HXMB 5F9AC 4S11A 2G5BB 4Q7DA 1HSAA 3RU8L 3GMPB 4XRCB 2C3VB 3CLEL 3FZUD 2ENSA 5GS0D 2DTMH 2R2EA 3ZKNC 5J13C 3CZJA 5C07D 3QEGH 3DI2B 3VXRE 5A40E 3UJTH 2NNAB 4NSKB 1OTUD 2HFTA 2CKBH 3GDBA 3VFUA 5AAWA 3BWUC 4MNQB 5FV1L 3GSXB 3NTCH 4PJ5E 5L2JA 1CTNA 4FA8A 1EBPA 2X4UA 4HIJB 1LO4L 4LAQL 1BX2B 4C4KT 4LLQA 4I77L 2IAMB 2X1QA 1MCKA 4PGBA 3UPRA 4R7DB 3OKEB 1CDYA 2CMRL 2FIKB 3QUXC 4G6FB 2ZUUA 5IF0B 3U4BL 3NH7L 3SDXE 4HWZA 2DAVA 3ZE0E 5TH2A 3TN0B 1UA6L 3RL2A 3HG1D 3CSPA 1ACYL 3S5LG 1KCLA 3GIZL 3KYKL 5CZXC 2GIYA 4LSUH 5E8EB 1JF1A 5F1KC 3LQAL 4FQHA 2SEBB 2A0LC 2OBGA 4KJQD 1J1PL 4OIAA 3GBNH 2R23B 1D9KC 5I16B 1EZVX 5L2KA 4GLRI 3MRFB 1IVLA 4HGKC 2IPKB 5MHSD 3U0TA 2OCFD 4U0RC 4TSBH 3VWJA 3KPMB 4K94H 1WC7B 2X6MA 1ZLVH 1RIVH 3MRRB 3X3FH 2DWEB 4JPWH 1LGVA 4JFDB 4R4FL 4YBQD 4Q2ZA 1GAFL 3BHBB 4JRXE 4GG6B 3T0ED 1MAKA 1F3JA 1FNGA 1PSKL 1H5BB 4C57C 1T0NB 3BKCL 5FM5O 2D03L 1MUJB 3CFBB 4I2XB 1Q9KB 4HW6A 3MV8E 4XMKH 3GRWA 1OP3H 3SGEI 4QGYA 4N8CH 4Z7UE 4LNVA 3DXAB 1ORQA 1AXSB 3VFSA 5HPMA 3E6HA 5ID0B 2VMFA 3AAZA 4QXUH 3QXWA 1HDMA 4FHBD 3O3AA 3DUUB 1WT5A 3VH8A 1EO5A 1AKJA 5DEFB 4ZFZA 2VE6A 3ARGB 4Z7QE 4DVBB 3TM6A 5SWZD 4ZS7L 3GSRB 3O2DA 4W81A 3FT4B 4LNRA 4PLKC 4E42A 3BH9A 2X4RB 1U3ZA 3STZA 1I7RA 4I0KA 4YHOH 2DWDB 1QFUL 4QTIL 3O8XB 3MQIA 4HG4K 3G04B 2FLBT 4N90D 3KWWB 4Z7WE 2BY0A 2GSIA 5F7MC 1CFVL 5BRZD 3WE6A 4QRTA 1S7TB 3G9AB 5D2LF 4OFKA 4LARH 1YC7A 1BOGA 5EBMA 2O5ZH 4J3WA 2CK0L 1VFAB 5H94B 2DQEL 4MMZC 4UOJA 3QXDB 1JCKA 3KDMB 4GXUN 2E9WA 4G5ZH 5EULV 3DVFA 2D7OA 1S9YA 3BMVA 4JJ5B 5A16B 2EXWC 3MLWL 4M8VA 2OX5A 1T1ZB 4L4JA 4GKOA 4M7LT 1RVFH 4KKLC 1S9VA 4AQOA 3GI8L 1A4KB 3UAJD 2HN7A 1CF8L 2YD3A 3BP4B 1CU4L 4G80A 4ZUVB 1F4WH 2Y7QA 2UYLA 3O2WH 3WFDL 1NJ9A 3MMEB 1DBJL 3ME0A 3HLAB 4HUKB 4MNQE 1C16B 2G60H 4JG1H 3O41A 3H0TB 2QHRL 4E41B 5FCUL 5GGUB 4PUBH 3MO1B 3SOBL 1TQBB 4HZAA 4FP8H 5KAQF 4R4BB 1UH2A 2CUMA 4FZ8H 4PJDF 3SQBA 1PLGL 5HHVL 3UTOA 4Z8FH 2YBRA 3RUGA 4ZG1A 1AGEB 1YQVH 2CO6B 4OD1H 1JF5A 5E8PA 3HPLB 5KSAB 3MMEA 3KYNA 5DJ0A 1NANI 1WBYB 3ARFD 3GO1H 2KUTA 2UYLB 2X41A 1T1XA 3ZDXE 2ARJB 1NGWB 2X1WL 1CZ8L 3R0NA 1A4KA 5C0BE 3KPOB 4ISVB 3QUYC 2BC4B 1U3HD 1NGYA 5ESAB 5FGRA 1DQDL 2F58L 4K3DL 1OAZH 4XP4H 1PGRB 5DUBB 1MFEL 1NC2D 1H3GA 3NFSH 1MFAL 1IEAA 1LDPL 3BP5B 3EFDH 1XF4B 2P8MA 4N0UB 1W0VB 5L88H 2OR8A 2AJ3B 4P46D 4DGYH 5B38A 1GGYA 3MLVL 4L8CA 3V7AE 1VFAA 1WUNT 2Z0BA 4PJCE 3TCLA 4ZO9A 4WY7L 4XX1G 2EEAA 1YUHB 3QJFB 2IAMC 4KUCD 4GG6E 3Q0HA 3O3DB 2ZCHL 4DJMA 5IMKA 4HEME 1SVCP 1HSBB 3NCJH 1EFXB 1CG9A 2L0DA 1VACA 5J11B 4RMSA 4JGMA 5IMLB 2QSTA 4OFYD 4PR5B 3RWJB 5KW9L 1BF2A 4J6RL 1T4KA 3O6FD 3HC3H 1ZLSH 2X4TA 3GMMB 4DCQA 4DKEL 4JM2F 5D1QC 1OLZA 2I5YL 5JW4N 1EEUA 7CGTA 1JUFB 2YD2A 2FBOJ 3QNYA 3GMOB 4PLOB 5KANG 5KANI 5I1JH 1YEKL 4FZEH 4HPYH 3V79C 2N7BA 3FQTA 4G6JL 1EDQA 4G9DA 1AQKL 4ZAKB 2Q86B 1J11A 4R90L 1I3UA 3ZLQC 5CEYA 5IKCA 2DQDH 4NWTL 3RIFK 4X7SH 5FYJD 3SQOH 1KIPB 4Q2ZB 4MAUL 3JV4A 1PKOA 4JFEB 3UEZA 2AJZA 3N9GH 4Q9QL 3FB6B 4OAWB 4DN3L 3B9KC 3IFNL 2ARJQ 5DO2D 4OCRH 3L3HB 4KRPB 4CW1B 4URTB 3KVQA 1I3GL 4OZGE 4NKDB 5SV4A 2AEQL 1Q72H 2QKIA 1GIGL 5GGTH 3UDWC 3IDUA 4PREA 1UEYA 2Y36H 4M7KH 4P9HL 3RWEB 3V0WL 2MKLC 4APQA 4NFDA 3C9NB 3V0AC 4GRMA 4MVBC 2NY0C 4TULL 2YUWA 4AYFA 1JZ3A 3W82A 4WEUD 4F7TB 3RL2B 4EI5B 1JTTA 1CICD 3P9WB 3WJJC 2P1YA 3MJ9A 1K4CB 4BH7A 4NNPL 3G5YA 4LASH 5C09A 2XRAH 2YWYA 1S7WA 3T8XB 5ADOH 3MLUL 5M94B 4K7FB 5TDPA 2WBJD 4PJGA 4G8EB 4HGWB 4H26A 3RNQA 2WQRA 5HDLA 4O9HH 1K2DB 1T21A 4R7DA 4DOHB 5EWIL 4YGVB 5L2KD 5E8OB 4P99A 4GAJL 2J8UF 3L6FA 4EI5C 1D6EA 4NN6C 1XGUB 2R0WL 3GMMA 4X4ZA 1KIQB 2VLKA 4ODBD 1KEMH 3J7HA 5LXGH 4OF6A 4U6YA 2NZ9D 2PETA 3HZVB 2QR0A 5GRJH 4PJDE 1EXUB 1X5GA 1BF8A 1U93A 4YC2B 5L7XL 4HBCL 4LVHC 5BZDA 4GBXC 1BPVA 2HMIC 4F7CA 3GMPA 3NCBB 2FGWH 2VDPL 4NQDE 3AREB 2EECA 4C56B 1XF2A 5IVXA 1P7QA 4LRNH 4P23D 2CH8A 4P2QA 4XWGH 1F45A 4YHKH 5D1QA 4L8CB 3WEXA 4U1SA 4KI5E 4JRWA 4HIXH 3IFLL 5IBUB 1FIGH 4ZNCD 2XNAA 4JRYE 4DKDC 1AKJD 4NHCH 4P2RA 4IDJH 1A6TA 4X6EA 4YQXL 4NQSA 4I0PA 1QQDA 3BIKA 3O2DH 3UYRL 2YUVA 5T33H 4GMSL 3NCFB 3WLWC 4YH6A 1T0PB 4L9LC 3MBEA 3BEVB 4XB8A 4Y4KB 1AFVL 1FP5A 2VH5H 3MUY1 4HS8L 1YEIH 2I25N 1IFHL 4HT1L 5C0EB 1HCVA 5GRUL 1XR8B 1FAKT 1IAII 4NN7B 3BVNB 1A8JH 5D7IE 3IU4H 3QIBC 4CVXA 1CK0L 1FG2B 2R4SH 1P6AB 1ZHBB 2VQ1B 3C60A 2NY3B 4YHLH 5D1XB 2OQJA 2Z35A 1ZGLB 5E6ZA 3VFRA 3KPQB 1UJ3A 4J3VA 3SE4A 4L4TE 4W4NA 5JIKA 5IIEA 4PS4L 5HJ3B 5IW6A 1QYGH 3JV0A 1ZTXH 2D0FA 3LN9A 2EDWA 4LSRH 4PGCA 5GRVK 1WFOA 3L3IB 4MSWB 2OI9C 4TRPL 2GUOB 1UGNA 2ZCLL 4P46C 5CBAB 5B3NA 3MJ8A 1T83A 1J1XH 1MWAB 4L8DB 3A6BL 5DEGA 1PG7X 4ODTH 4ODWB 5E1AB 3E6FB 5ADPL 2E7LC 2X40A 4WUUB 3FN3A 3PP4H 1G7HA 4NBXB 4PRHD 3MRPA 3TBTB 4NZRL 1ES0B 5KG9A 4HIHA 3QO1B 4U2ZA 1T1YA 3D39B 3X13B 5CGMA 3ARFC 5I75B 3W2DH 3MRNA 3RVVC 4ALAH 1PZ5A 4XNZC 2DWDA 1HEZA 12E8H 2BY1A 5HHNA 2EE2A 2HLFC 4X0KB 4YDJA 3BH9B 4MHHG 1M7DB 2MQ0A 4KJQC 1RHHA 1LEKA 1DVFB 3T3PE 2B7DT 3L3DA 1WZKA 1U8JA 2OL3L 3G6AA 1G1YA 2LABA 1JPSL 2WQ8A 3DYMA 1ZSDA 4YDKH 1T1WB 1AQDA 2ZUWA 1U91A 2O5XL 3KR3H 1RMFH 2EE6A 3HMXH 1KGCD 2A6JA 3CK0L 2WINA 5DHYA 1KCUL 5B3JF 5EPMA 3VMOA 4I2XA 5ACZB 1GJIA 5B39B 1H5BA 3DVNA 3IDNA 4HCRL 5ICYB 2VXTH 3Q1SH 3U30B 3DO7A 3DHMA 4D0DA 2HA1A 2DQCL 3FT2A 2RR3A 4L5FH 4OLUL 4KMTH 2QQKH 2FCBA 4NQDB 1TZGL 3K0WA 4WO4B 4HXAL 4K3GA 1JMXA 35C8H 1FORH 2MCPL 4WCYH 2X4OA 1KGCE 4UV7L 3TP4A 4ELMF 1I75A 4JFPA 5B8CA 4J1UA 3O6FA 1CE6B 1C7SA 3ZKND 1N0XH 1Q8MA 4JGJA 4UDUA 4X6BA 4NWUH 1OVZA 5B8CC 3GSNA 5L2KB 4UAOB 1MI5A 5I16A 3WIIH 5DD5L 5KVDH 5IVXE 3ROLA 2HTKD 5EFIA 1OAKL 1P6FA 1S3KH 2ADGB 5EORL 4YDIH 1JF1B 1I1CA 4NZJA 4WWKB 1HK6A 1VESA 1NC4A 2HFFB 2HKHH 3P0YH 4XCEB 2J6EA 1ZA3B 1UM6H 1AR2A 1N4XL 4LVOC 4X7TB 5TF1H 5LKNA 4WI3A 2QQNH 3E3QE 3OX8B 1KLUB 1UZ8B 1CR9H 4XCCH 2FIKA 2JCCF 4HQQH 1LNUA 1Q94A 2J7LA 3QO0B 2R1YA 3OKNB 4X99B 2ZOKA 3DURA 2BNRA 2JJSA 5EN2B 4X9FA 5J1AA 4Q74A 1NGPH 4I3SH 2J2ZA 3U9PH 3JWOH 2IQ9L 3MBXL 4F7EB 3GSXA 2HRPL 4JLRB 2AK1H 3N1QC 5C0JB 3VI4F 1GZQA 1S9XA 1W2KT 3GSUB 4KHXL 3V6ZB 4JFED 4WGVB 4GKZA 3L3OA 1RY7B 2Z92B 3IF1A 3I2CL 4PY8J 3O9WA 3SN6N 4YBQC 4KDVA 1A2YB 3K8MA 4JFFE 4ONFH 1LK2A 1DVFD 3HE7A 1I7ZB 4XNXL 2G5BA 5BMFL 2O5YH 3NZHL 4PJHA 3IXTB 5K9QI 4UB0H 5D6CA 2PYFB 3KYMB 1YEJL 1ZANH 1VDGA 4QHKI 5JLZB 4X6DB 4TYUA 5ECJE 1CQYA 4LCUB 3QIUA 4X7FC 5SWSE 2OK0L 4CU7A 4TVSa 1N7MH 1FVCA 3VFNB 1CT8A 3FB7A 4IOIA 4N90E 5EO1A 2H45A 3U1SL 3BDXA 2Q7YA 4GKNA 5DYOB 5AD0B 3I75A 4NRYA 2WIIB 4XPHL 5T3XE 4LEOA 4HH9A 4IRJA 1G6RB 3W9EB 4NQVB 1T2XA 5EZOL 1RUKL 1W8NA 2YUZA 4J8RB 4TSCL 5JO5A 5F44A 3S88H 1XGPA 3H7BA 3WFHB 5HHPA 4JM2A 5DJYB 4NKOA 4FFYL 3SY0B 1HHHB 3QDMA 4BFBD 3A6CL 4EVNB 1S7UB 2IEPA 2DQUH 1WZ1L 1Z0MA 2OL3B 3OAUH 5I19L 2AEIT 4UI2A 2YA1A 5DHVH 4LSSL 3PABA 1NGQH 2XI9A 1NCTA 1FGNH 1CDCA 3DX8A 3OV6A 4LEOB 3RWCA 2WIIA 3NFPB 4Z7UA 4Z7VF 3GRWH 4LHQB 3CZFA 1FL3B 3C5JB 3MNVA 3VFPB 5C9JB 4GQPH 1JPFA 1XCQB 1RK0A 5KZCB 3GMRB 1WBXB 3T1WA 4LCWD 4UT9L 3ULVE 4KGLA 3MA7A 3L3GA 3D87B 4PY7B 1R3IL 5J6HB 3TJHD 3GJFH 2KPNA 2YD1A 3IXTA 1QNZH 1JRHH 3UJJH 2GK2A 2DBJA 5E2VH 3NIGF 1D5MB 3UJIL 3BPCA 5F6HJ 5IVZA 5DQ9A 4JFOA 3UTSA 4NO0A 3C5SA 5DMIH 3KLAA 1A6WL 5GRZA 5I1EH 4JO4H 1I1AD 3IRZA 5DGQA 2XZAH 4PB9L 2OSLA 1QD0A 3QR2A 3LKOA 4X4MA 3RJQB 1JMZA 1XCTB 3U46A 4TN9A 5J1AB 1A7BA 4FQLL 4X99A 1A7PH 3HFML 2J8UA 4PJ5D 3NIFE 5F9OH 1U8KA 1WITA 4J7RA 1T7ZA