2X44D

Structure of a strand-swapped dimeric form of ctla-4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
121
structure length
121
Chain Sequence
b'MKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOTOXIC T-LYMPHOCYTE PROTEIN 4
publication title Domain Metastability: A Molecular Basis for Immunoglobulin Deposition?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x44D01
4OIAA 1F11B 4M7LT 4ODHH 4Y4HD 5C09D 1K6QH 4Y19E 4QRRE 4X80H 1OP9A 1NAMA 3S8WA 1AXSA 4BFIB 2QQKH 2OTWB 4LU5H 1G6RL 5FYJH 1RUAH 3C9NA 1QUNA 4YR6A 3MRJB 1BHGA 2CIIB 3DLQR 3OKNB 4YK4B 3T65A 1MAML 3HNSL 3HAEH 4OCXH 5DWUL 3SE8L 4MJ4A 5JW4Q 3RX8A 2FYYB 2JTDA 3BE1L 3C5SA 3GJEA 5DS8A 3GSWB 5F7KC 1OAQL 3DUHA 3JUYA 3T1FB 5E95B 1BEYH 2R1WA 3L3IA 3LKNB 5FHBH 3UTSB 1HOCA 3FZUD 2EIEA 4F7PB 2ATPB 1AGFA 1E6OH 1YMMA 1CD9B 4NHUB 3ZYIA 5IR1B 4CADB 3BYTA 3SKJL 3VFOB 2W60A 2N56A 3C5ZB 5AZEH 3WN5B 5MENE 4PY8I 3VH8A 3PP3K 2D7OA 1I1FA 3ZT7A 2XICA 3I75B 2Y36L 5E2WL 3VXPA 4M61B 5BVPH 4PV9B 5K59F 3DVNA 3X13A 1H3PH 4JM2A 2BHUA 3AGVA 2VXTH 4JREB 4LP5A 5CEZH 2BK8A 3KPRD 4P2QD 1BQLH 1ZVYA 3KNBB 4Z5RA 4JPIA 4KRMB 3VXUA 4WFGE 5INDB 2AXGB 4YHMH 2UWEE 4J1UA 3ZE1F 1FGNL 4HK0B 1T22B 1KB5A 4YBQC 4G6MH 5F3HA 5IB5A 4MHHI 4P5MB 3MBEA 4Z7UB 3EO0B 1I3GH 1YEJH 3L3GA 4M00A 4L3EA 3CPLA 5E94B 5TDNA 2EYSA 1QP1A 3T0WA 2G2RB 3FCTA 4C59B 4WI3A 4N5ED 4D9LH 2FL5A 4GAJH 3T0EC 4JZJC 4KU1A 3C8KA 5AEAA 4UNVA 2GITA 5BV7C 1U8HA 4PJAA 2AJYH 5K33A 5DJDA 1JNLL 3IRPX 5C6TH 1RK1B 1LD9A 2ZUXA 4M8QA 3JWDL 5ENWB 1RZJC 2DD8H 3MO1B 4UI2A 3IU3A 1DCLA 3RIAF 2H26B 2VQUA 4KXZH 4FMFA 4KPHL 1YNTB 4GRMA 4Y4FC 3LN4B 2HT3D 3NIGE 3DBXB 4N0CC 1B90A 3OKEA 4HS8L 4ONGL 4P23A 2BSSA 2Z4QA 2HFEA 3QIUB 4FQLH 2X5PA 1SHMA 1QFWH 1J5OL 4TQEL 3SHSA 1G7PB 2A6KB 1DANU 2NY5H 1X5FA 3MCKB 4ZOEA 3T4AA 3I02A 2FBJL 1IEAA 3M07A 2A83A 4UINH 1ZXQA 4XVSL 2AEIT 3O4LD 4KZDL 2XWJB 4GH7B 4S10A 3ZKMD 1OGAE 3MXWL 3EHBC 3V6OC 1KENL 2G75A 1IKFH 5FM8A 1A9EB 5DZOA 5D7LE 1LO3L 3UC0L 3CSGA 3T0EB 4G7VH 4HLZH 4JZJB 5HPMA 1TQCC 5MEPB 4QXTB 4XWOD 5I8CA 1QLRB 5LQBH 1T1ZB 1JNJA 2YBRB 5BV7B 1LO5A 3OXSA 2HN7A 1X6LA 3GSXA 4YFLI 1SM3H 5JNYA 5ESVA 4YHOH 5CCKH 1CXFA 1C08B 3CFDB 1N0XH 3RWJB 5HYIA 5E08H 2ED7A 2PKDA 4ODTL 1M7XA 3H9YA 4XP6H 3MLUH 4HKZB 3JV4A 2FSEA 3O6KH 4Y4FB 1PDKA 3SKMB 1H3VA 1VEPA 1BVLA 2BC4A 4KKNA 4M93C 2BVOB 4HWZA 2YPLA 4WI2A 2ICWI 3DV6B 1N8ZB 2NY0B 1B0RA 3MV8D 5D1QC 4NO3B 3E6FB 1ZE3C 4HG4J 3IETB 4EN3C 4RIRB 1MHPL 5T5NF 1IGCH 4XMPH 3QUXA 4N9GB 4L8SA 1JL8A 5EORH 3RWCB 2ED8A 3BP4B 1WZ1H 5I66B 3C5JA 1T21A 5E9DD 1EH9A 4ETQA 1EAPB 4HH9A 1INQA 5CFHA 4MX7B 1FGVH 2WUCH 2LTQC 5A16B 2C3XA 1MOEA 4OCWL 3V8OA 5C0JA 5T3ZH 1FYTA 5AD0B 4MNQA 4UDTA 5HHNA 1CR9L 4OV5A 4NQCA 2D7TH 5IROC 4E41D 3NA9H 1U95A 3DI3B 1QKZL 3FJTA 3UYRH 4X6CE 2BSRB 4XB8A 5DK3A 4PREB 2XKNB 4LHJB 2HLFD 2GSIA 2EXYC 3I50H 1ZHBB 5JR1H 2FATL 4PBXA 2VR9A 3U6RA 5FO8A 4JFDE 2IQAB 5DEFA 5IFJB 3K4AA 2P5EE 1JUFB 5FDWB 3WL9B 2P24A 2V7HB 1M71B 4Z7WE 4PB9L 2A77H 4M93B 5DDHB 5IT2H 3PQYD 5LGKA 5J8OA 4WDIA 5D1QB 5CLTA 1KFAH 3GRWH 1DVFD 3GZKA 4K7FB 3C08H 4U1KA 4QRSB 4FS0A 3BKJL 1RJYA 4I3RL 1UM4H 4WUUB 5J6GA 2VDOH 1ORQA 3MJ8B 4J4PD 4AIZA 4HWNA 4YGVB 4PJFF 4MNGE 4U1LB 1P84K 2JCCE 1CLYL 2LTQB 3QHFL 1KIQA 5I2IA 3TIDA 5C0AE 1M7DB 4WWID 3MRGB 2XKUA 2GJ6B 4MNHB 4AH2B 3NCYP 4XZUA 3TPUB 3AY4A 1U3HC 1OCWL 2Y23A 1G9MC 2YPKB 1NPUA 2R2BB 5E8PB 4R4BA 4Y8DC 3V6FA 4G8EA 4OCNC 4Y4KD 3VFPB 3MX0A 4KUCF 4F8QA 4Q2ZB 3V4VL 3Q6GH 4AEIH 1G0YR 1WFTA 5DUMH 5DRZA 1T2JA 1NEZA 3UTPD 2PN5A 5L9DL 2GTWB 2MSPA 2PUQT 2VNCA 3SGJA 4O58L 4GSDH 4ZPTB 4HMDA 5DGQA 3MRRA 2C1PA 1HXMB 1CT8A 2NY6C 4G8GB 1EO8L 3IFLH 4BH8A 2GFBB 1T7VA 4U6HB 5LBSL 1YYLH 1ZT4A 1B4JL 3WYRA 3SDCA 4HS3A 2CIKA 3HMXH 4OLYH 3HI5H 4K71C 3WD5H 1GGBH 3QUMB 1B4RA 4L4TB 3B2VH 3ULVH 2Y07L 1JBJA 4M5ZL 3O3UN 2I60L 2NX5D 5GSVA 4Q9RH 4KJYB 4OFKA 3VRIA 1EZVX 3MUZ1 1VPOL 2Q86B 2RAMA 5CUSH 4JG1L 5IQ9A 2DDQH 3C6SB 4WCYL 1PKQE 3TC9A 3GUTB 4NSKA 1LP9B 2YPVH 2V9RA 1U3HB 3D2UA 3HC4L 4JVWA 5SX5H 4J23A 5IESL 1A6TB 5SWZA 2FB4H 3BH9A 4D3CL 4L8DA 4PJGA 4UOW1 4PPTA 1IJ9A 1A6WL 1TXKA 3MOQA 4P3DA 4LLWB 2D9CA 5M94B 5IW6B 4Y8AA 4JRYA 3LSOB 1XGQA 2PF6A 3V52L 3UBXI 2VC2L 5FUZH 3S35L 1VESA 5I1LB 4MQ7A 5FYKE 1WUNT 2NY6B 3ALWA 1GSMA 3OKDB 5GRUL 5F1IA 1DFBL 1AE6H 1U58B 3OXRB 3FQWA 4XPGH 1NGZA 1JI2A 4K71B 4BZYA 1JZ5A 1NDGB 2GYSA 2X1OA 2AK4A 4JKWA 4LPTA 5IBTL 2J5LC 3L3DB 3WFDH 4DKFL 3J8F7 5EUOA 3HRZA 5E00B 4YHLL 5F9AC 1CZ8H 1NANI 1OSPH 5F9JB 3HPLA 1REIA 5LWYH 1GC1H 3QDJA 4HZLB 1KEML 1QRKA 3F58H 5I8EB 4H0IA 4M6NH 3BD5A 5DJXA 1JHLH 3UPRB 3U9UA 1R5IB 4DZBB 1W8NA 1NL0H 2VLRD 1A6AA 1J18A 1UKQA 1MJ7H 3F7PC 4UV4L 5IHBA 4XMLL 1BVKB 1AGCB 2XOTA 1S3KL 3CX5K 2EDXA 3E2HB 3RNQB 1RUML 2X7LA 4GG6F 4P4RB 3TNMA 1BQSA 1NDMB 5SWSE 4F9LA 3BDBA 3VWKC 5KS9A 5E5MA 1A6PA 1A7QH 1A6ZA 1VA9A 3D25B 4PRNA 4RX4D 2XRAL 2PYFA 3DMMC 3TT3L 1YN7A 4P4KD 4PP2B 4DKDC 5CHNA 1SMAA 5GRJL 1KPRB 5E5UB 4P0DA 4NDMB 4GMSL 4YXLL 3EYOA 4UMGA 5C86A 3CJJA 1U42A 1LWRA 2EE3A 2J5LB 2AJ3A 2IMNA 2AQ3A 2XY1A 3MV9A 1NCDL 1MY7A 4GO6B 2FIKB 2BHYA 5CSZA 2WLZA 3OJVC 2EDDA 5BMFL 1KN2H 2CUIA 5C0IB 1E4WL 1K8IA 5D2NC 3FT3A 2DJ4A 2F19L 3BQUD 3IS0X 3T2NL 3M45A 4FZEH 4TOYH 2DWDA 2AQ2A 3ARYA 2YA0A 3R06B 4JB9L 5EA0L 4EI6A 2BNRA 4XNMA 1CDYA 4LPXA 1Q9OA 3HLAA 1ZVSA 5IVXA 4IRZL 3CFEA 4HBCH 4XVJL 3K7UA 5FKAB 3MACL 3DSFH 1B0WA 1F4YH 5ACMA 2UZIL 1MI5A 4Q58C 3EYVA 2OZ4L 1R0AL 5DMKB 1JGEB 1MLBA 2EDEA 3CIQA 2G9HB 3Q2CA 1BIIA 5EZOH 1FL5A 1K4CB 1QFOA 3VWKB 3E1F1 2MCPH 2P8MA 2UVEA 5AG8A 3RAJH 5ITBH 1OQXA 2YXMA 5I1IL 4ZXBA 4QO1A 2P1YA 3UTTE 4PJBB 5GGRY 4CJ0A 5ID0A 3NBNA 2Q3AA 1MRFH 1LQSR 3TCLA 3G6AA 3V5HB 1EX0A 1EFXD 5CJQH 4XCCH 1J0HA 2FECI 3RZCB 4G5ZL 1TZIA 3QUYA 5IOPA 1T66C 2AEPL 4AENA 5EU6D 4JCMA 4PJCE 1YC7A 2VDNH 2CK0H 1IT9L 2DQHL 2J8OA 4OZIF 2C1OA 3PDDA 1SJEA 1U41A 4K7PX 3MLWH 4DWHA 3EW3B 5D2NB 3B6SB 4NQXB 3GMOA 4GAFB 2PTVA 3OAYH 4EVNB 3BSZH 1VCAA 4HKBA 3D0LB 3T0AA 2VISB 1DBML 4EQ2A 4AL8L 4NZTL 4FTVA 3STZB 4TRPH 3ARBA 4WFED 2BSED 5FUOL 3TBTA 1RMFL 5TDPA 4J8RA 3AMLA 3HE6D 2HWZH 1TPXC 4ODSL 4PRIA 4PRPD 4P59H 4QWWC 3EYSL 4HIEA 5I1KH 3L5IA 4U1NB 2BERA 5IMKA 4NUGH 4F3FA 4OBSA 3WNNA 2IGFH 1P4BH 4FOMA 4GKOA 2VDRH 3BDYL 1RUQH 5GZOD 1MNUH 2WAHA 4QHKI 2EDBA 2XZZA 2W07A 4XAWH 1SJXA 4X5WB 4OFYD 1SBSL 3BP6A 3H0TA 2H9GB 5H8DA 3P4NA 5EOQL 2X40A 4KV5F 1TTGA 5C8JA 2WLYA 4NFCA 5E03A 2OSLA 1U3JA 2CRMA 3DUSA 4PLJC 5EZIH 3BP7A 4G43B 5E8NB 5GGVL 1HH6B 2FH6A 4ZO8A 5SWZE 3SO3B 4DVBA 5T33L 3EOAB 4PJGE 5D7IF 3P77A 3THMH 3O2VH 15C8L 1C12A 2X9WA 5D1ZD 4MD4A 1EJOL 3OB0K 3ESVF 3HB3D 5DUPL 3NIFE 2QTEA 4M7JL 2DQJH 4QXGL 4LP4A 4HT1L 3ZT6A 1QO3B 3MXVH 3SDYH 4HJJL 4HDIA 2BRQA 3WXVH 3U46B 5CILH 1G84A 2GCYB 4P2OB 3KLSA 3MLPA 1I7RA 2J88L 3S36X 5IVZB 2FWOA 1A3LH 3KPOB 5CINH 1TPXB 2NLJA 2EDQA 4NQDD 4POZD 4L29A 4O2EB 1EZVY 3DMMA 1B0GA 2IH3B 3JWOH 1GVIA 1I8LA 4Y19B 4QRRB 1J05B 3TZVA 2Z0BA 2J6EA 1E6JL 3O41B 1YA5A 1MREL 4PLNC 1AY1H 1M6OA 1QVOB 3MOBH 5D9SB 3GM8A 2ZSWA 1C16B 5IM7A 2VDQL 4JDVA 1FFOB 3MRMA 3I6KA 3OAUL 3TYFB 3RBGA 3OWEA 3NCCB 2C3GA 4HUMB 1N3NB 4PJ7A 1CL7I 5HDQH 4Z7UF 5E8DH 5CD5D 3DO3A 4NRZA 4UIMA 2XZAL 2JELL 4NQED 1U93B 1QQDB 4HEPG 3WFCL 2DL2A 5D1XC 3U0TB 3WLWD 1AQDA 2RGSA 2X9YA 1A4JB 4LIQL 3HAEA 4HKJA 5BVJA 3ZKND 3TVMD 5MENB 3KYOA 1Y0LB 2B8OT 4FQJH 4ZUWB 5BQ7B 1IGIH 1MRCL 3HG1A 1NCWL 1KC5L 3WS6A 2E7LA 3VWJD 4XI5C 4YHKH 3WCYA 4DCQB 4QF1A 2JJVA 4NFBA 4KMQA 1HHKA 2VR4A 1UH2A 2R0ZL 4JFPB 3KPQA 3OJMB 5DJ6B 3JZ7A 4NOBA 2EDOA 4K3DH 4I48B 4MA1C 1S7VB 5BW7A 2CDEB 4KQ4H 2HKHL 2UWEB 4YXHL 1JPGB 1FNEA 1I8MB 3OV6A 4NM8H 4IMLB 1OY3B 3TBYA 1C5BH 1LDPH 1MCOH 3B2UC 2NXZB 1M05B 4IRJA 5GJTH 2JK5A 3IJYA 3DROB 3U0WH 2OL3B 2EDRA 4K55A 5I1EH 4L8CB 1QSEA 3P73B 1NKOA 1MWAL 3CXHK 1WGOA 2HVJA 2J1KA 3O3EB 1HE7A 5B4MC 2GIYA 3NABH 2YKLL 4NQVB 5DMGC 3FB6A 1UA6L 4TULL 1PBYA 1CCZA 2VLKD 4G9FA 1MCWW 5IVNA 1X7QB 3UO1H 4P48A 4OLWH 1UH3A 4ZPVB 4JKPL 4L4VA 1L7TH 3D3VD 4JJ5A 1X5HA 3BKYL 4Z8FL 1CFSB 1KT2A 2XZQL 4X6EB 1I3RA 1ITCA 3CFCL 25C8L 3PWVA 4F9PC 5IB3B 2EH7L 5E5RB 5EZLB 1H0DA 1GGCL 2XA8H 4TUOB 1FLRH 4H5SB 1I1YA 2H6PA 2B1HL 2VLJE 5TJWK 3QXWA 4HKXB 5GGRB 4I13B 2GHWB 1WFNA 3LV3B 5KSAD 3UBXA 5I1DA 2ERJC 4Y2DD 5JOFA 1FVEB 1KXQE 4IBLT 3LKRA 4MA1B 5J9PB 2K7QA 4X6BA 1NFDA 5CWSA 4JPWL 1ORSA 4LCIH 4ZTOL 4XC3H 1OGAB 4UOJA 4Z7OF 1NFKA 3FFCD 1T5XA 5C0BA 3BPCA 4PTTB 4S1RH 5CGYD 2ZCKH 1WIPA 2BY1A 3VGHA 4P5TA 5D7LB 3KHOA 4OGYH 2X9XA 4MJIA 4MAYA 1EEYB 5EO0A 1CGSH 1SYVA 2HJLB 5IWLC 4OZGA 1A1OB 2DMCA 3V6ZB 4PRAB 2Y06L 4URTB 3ARXA 4BM7A 1H3TA 4LLYA 2JB6A 3STLA 3F5WA 3QZWG 1JGDA 1CICA 1MFAL 1URLA 3VD5A 1VADB 2BVQA 4H25A 5I18L 2GSGA 3RL1B 2EIZB 2YZ8A 4RBPK 5CJXA 2H2SC 1FNSL 4PGBB 4NZJA 12E8H 4YAQA 3NA4A 2X4PB 3O3BA 4DGIH 2QHLA 3L9RB 2NY4C 1Q72H 1PFCA 2UYLB 2CDFB 4NT6A 1K2DB 2OP4H 3NTCH 1A47A 3PWJA 4UIKL 2ERJB 5IFAH 1ACZA 3RWIB 3S5LG 4K7PY 5GGTL 1QNZH 3WS3B 3VXNB 3BHBA 2FCBA 3CAFA 3QXVA 2OR9H 4JFEE 3VRLE 5IB2B 3VI3E 3CFIC 3MRDB 2WBJA 4HEME 5IUSA 1MSPA 4OFPA 1FFNB 5E1HB 3I2CL 1NC2D 4GQ9H 2DJUA 5ILTL 1KCVL 5BRZE 5D1XA 4LCWD 1RZKH 3SDDC 1A64A 1RZFH 3QI9D 1DE4A 4X6CB 3UPAA 2M2DA 1U6AH 4YC2B 5KW9H 5GS2D 4JG0L 3QG6A 3K81A 1OPGH 1CBVL 4NYLB 1GGUA 2VZTA 2QHRH 2DQEL 5D7JD 3WHE0 5DQJB 3P0VH 4JFDB 4ELKB 5FA3A 2JE8A 4YDVA 5T3XE 1K4DA 1T1XB 2P5EB 4C83A 4Z7WB 1H9VA 3LEVH 1J1XL 4WU7A 1FZJA 1TETL 1AXSB 2NY4B 5IMMB 4GKNA 5D2LA 1BD2A 2ZOLB 5EH1A 5EBMB 2P48B 2DQIL 4IIQC 5HYJD 2FEEI 2OMNA 3DXAD 4RA0C 5DC0A 2GTZB 4WW2A 4NN5C 4Y5YC 1VGKB 2D7QA 3QB7C 5EC1A 1JGLL 1SEQH 4W68A 4WHTB 4MJ6A 4MNGB 4X7EC 2JCCB 3NACL 5FYJE 1AGFB 2R9HD 1PAMA 4U1HA 4LRIC 5C0AB 1KB9K 5ADOL 3NH7H 3BX7C 1HSBA 4K23L 4LPUA 4OF7A 2IALA 3VD9A 3KPSD 1A6VL 1XR9A 5B38A 1R24A 1YNKL 3AS1A 3GMQB 3H3KA 2HFGH 1IKNA 1TJGL 3FL7A 1UCBL 5T1LA 4OFVA 4U1MA 1LP9F 3LS4L 1FL3A 5TH2A 4OT1L 2D4DA 3MYZA 4BUGA 4FQHA 5I19H 1RZ7H 4XNYH 2DTML 2GW5A 4Q9BA 5DRWB 4Z7VE 4Z7NF 4Z5RB 5F1NA 2VH5L 3KJ6L 2CLVA 3PL6D 3KPLA 3MA9L 4NBYB 3ROLB 1G7JA 2JJSC 4RFEB 1H15A 4J1UB 4M9OA 4E5XA 3NIDF 1IQDA 1G6RH 5EPMB 3KWWB 4M1CD 3BVNA 4IIQB 5CEZE 3E0GA 1MAMH 2PXYC 2X2YA 3HNSH 5DWUH 3SE8H 1PZ5A 2W9EL 3AFLA 3BE1H 4KJQC 5HVWA 4NN5B 1OAQH 3S37L 4S1DC 2NZ9C 5L8LB 2AI0H 1GZPB 1S7SA 4FP8L 1D5XA 5C08E 2J8UA 4NC0B 1P7QD 4YGAB 3ZKXC 5B39B 4HUNB 4MB3A 4J7RA 4ZYKB 3UJTH 3SKJH 5JPNB 1PKQB 3QEUB 1BZ7B 4GRMB 1YJDC 2WMPA 5BS0D 5HHPA 4LCYA 3SGKC 4NRYB 4S1SL 1Q9WB 3O3AA 3BEWB 2ARJA 3B5HA 3MNVA 3QNYA 5FGBA 4AQOA 3OKEB 4EEEA 5E2WH 1NGWA 2Y36H 1PG7W 1F4XL 5MEQB 4HMCA 3RPIA 5GS1A 2GY5A 3EJJX 4NO5A 1XIWC 4EBQL 3LKPB 1D6EA 4GAYA 4JHBA 2DLFL 3HR5A 4L9LC 3Q6FA 3WDHA 1KB5L 3JTSB 4TTDD 1CGWA 2VLLA 5ITFB 3X3FL 1QRNE 3EDJA 3SQBA 1DQQB 4PJHE 1FGNH 2H32A 3UTQA 2COQA 4LGPB 4DUXA 2A2QT 5D6CB 3WJLC 3MLRH 3GMRB 5GGUB 3EAKA 3ALXA 5HJ3A 43C9A 3HC0B 2PXYB 4LPCA 1A2YB 3PWPA 3UEZA 4V1DA 5GRZA 4RQQA 1P9MC 4X4YA 2VXVL 4LHUB 1JNLH 5F96H 1ZVHA 5EZJB 3JWDH 1IZJA 4I18A 4LLUB 4AY0A 3ZKXB 5TGBA 5E4EC 4F2MB 3TA3C 3BIBX 4MQTB 2ARWA 3RU8L 3G5ZB 3TGXA 3DV4B 1DL7L 4KPHH 4CVUA 4XNQA 5HXMA 3EZJB 4H8WC 5FGSA 3FOLB 3GMPB 4PG9B 2BNQD 4HJGA 4KKAD 1P2CB 4EUPH 3IXTB 4HS8H 4ONGH 1MHEB 2YPLB 1CD1B 1X4ZA 4M7LL 3EO1B 4EI5C 2UY7A 5C0CA 1XIWB 2L7UA 1D6VL 1LMKA 4PRBA 3DECA 3FO0L 1J5OH 4TQEH 4R7NA 2F54D 2F8VA 1K8DA 4GUPB 1D9KA 4D8PA 5JO5B 5EBGA 3VXMD 3PGCA 5EU3B 2FBJH 2YR3A 1R3LA 3L5JA 4XVSH 1I1CA 1XGUB 4ETQB 4KZDH 2EH8L 4HH9B 2YRPA 3I85A 3MXWH 2ICEA 3G5XB 4EUPG 1HCVA 4X9GA 1KENH 3BZ4A 4ZS7H 1HHIA 4WRLA 1LO3H 1FYTB 3DO7B 3UC0H 2A73A 5IHZB 4KUCD 4PD4J 4GRWE 2DB8A 1DLFL 1C1EH 4PJBF 1CGVA 1U95B 1LEIA 4KK5C 2E8ZA 2N1KA 3RVWC 4PJDA 3GDBA 3VJ6B 5EOCL 2HJKA 5EIIB 1OAZL 3A6BL 3OF6A 2Y5EA 1JHTB 5E4EB 3TA3B 4ODTH 2OXHA 1EK3A 3KYMA 3VXQB 2ADJA 3VXOA 5DEFB 3VGDA 4RA3A 3BJLA 4U6YB 3ARDA 1AR1D 5F6HI 1Q8MA 4JRWA 4NNYA 3RWFA 3BFOA 4RMQA 3ARGA 4OZFG 2IADB 4A6YA 4UTBL 3QIWC 1ES0B 1YN6B 1IAOA 5I74C 4EI5B 4BELD 5I17A 1DQJA 4NRXB 4JPKL 4HJ0D 1WBXB 1MHPH 4P2RA 3SY0A 2HFFA 2QLVB 1F90L 4PYGA 1UJ3C 3WFHA 4PUBL 4U6XA 3MGOB 3PGFL 1AC0A 1WC7A 1YDPA 3QJFA 2X89A 5DUBB 5KSVB 4WENB 4LAJH 3C60A 1IGJB 3UTTB 4BQBA 1FFPA 3GSUA 5MHSD 2DM2A 4NPYA 4TVPL 4U49A 3QQ3A 2P8PA 3U9PL 2MHAB 5ESAA 1CR9H 3ULSA 2WANA 3DETD 4OCLC 1DQTA 3W5MA 1QKZH 4NO2A 4PJCB 1NC4A 1KCRL 3SGKA 3GMMA 1UFUA 8FABB 4OQTL 3SCMC 2FATH 4PJXE 4ZAKC 5CIPB 5GIRA 1SBBA 3N1PC 4D2NA 2ESVA 3RWDA 3MRHB 2QADD 4JGMA 2YD2A 4NBXB 4I0PC 4PB9H 5DO2D 3MRRB 3B3IB 3X3GL 4AM0B 3AMKA 5I6XC 4XCEB 1BBJB 1BOYA 3QIWB 5I74B 1NCNA 1DN0B 3TYGL 1ZT4B 5BCAA 3VFUA 3BKJH 5HY9A 4WV1B 4I3RH 2P49B 4KJPD 2CIKB 3BYYA 5FECA 3FRPG 2R0LH 2KPNA 1MAKA 3P4OA 5E6IA 5FO9B 4EIGB 3NN8B 1RK0A 5L0QC 2C3HA 1JZ2A 2MCG1 1JN6B 4P2CG 5I1GL 1KULA 3CNKA 2CKBB 1CLYH 3QHFH 1MCRA 3CH8A 3VRIB 2XN9E 3KLHD 1FH5L 3OL2A 5F7WC 4BZ2H 1HHJA 4H0HB 2F53E 4G9DA 2PO6D 2A9ML 1F6FB 1MF2L 3VFWB 3ULVE 3KS0H 1OCWH 3D2UB 3S34L 3FB7A 5SWZB 5IBUB 4OGAD 4QRPD 3BH9B 4PJGB 4BYHA 5GRYA 4LPYA 3T2PA 2DKMA 3FQUB 3L7EA 5DK2A 3V4VH 3SCMB 4WFFE 4R96B 5TE7L 1XGTA 2C7UA 5L9DH 2LE9A 4I0PB 5ICYB 3L1OL 4OF3A 5I6XB 1EO8H 4I0KA 2EZ0D 2DI8A 1AD9B 5LBSH 5IQ7L 4MVBC 1B4JH 1I7ZB 5L7XL 1QFPA 1E27B 4N1EA 1FFRA 3V2AR 3NOIA 5GGQL 4Y4HA 5C09A 4HZAA 1ED3A 3B9EA 1RIUL 5FXCH 2Y07H 1CDJA 1T89C 3DSNA 1T83C 4Y2OA 4M5ZH 1MCLA 2I60H 2DTSA 4K9EC 1L7IL 1N5AB 3HPLB 1CK0L 4K94H 3PHOA 2UWEF 2FEDD 2IPTL 3F7VB 1B9ZA 4JG1H 4UB0H 3SDAC 2GAZA 3IDGA 4WCYH 5DJ2B 3FOMB 3WNPA 4MJ5A 4XTRD 5KTEL 1L0YA 1CN4A 1C7TA 3HC4H 4OUUA 2ADIB 5IESH 1CGTA 4D0DA 3QXAB 4MD0A 4N8VG 3VXSE 4D3CH 3F12B 3U9UB 5I15L 3BRGC 3QQ9C 1INEL 3RTQC 1C5CL 1EHLL 4YFDB 5C0CE 1LE5A 5F9OL 3FONB 2XXMB 4LASL 1S78C 4RGMC 3C6LC 1HEZA 1OAKH 4PG2C 3WIFB 4ORZC 2EE6A 2X7LB 3V52H 1WWAX 4X4XA 5DC4B 4H88L 5CZXD 5KSBA 4NKDB 4JM2D 4OLZL 3S35H 5HSFA 4M43L 3CH1A 5TE6L 4M4RA 5E5MB 2O61A 3OKYA 2BMKA 1YEHL 2EDKA 5DD5L 5GRUH 5DHXB 1WQVT 1KPVA 3NIGF 1IE5A 1DFBH 2V2TB 1G9NC 3KPRA 4P2QA 3FQNB 3RVUD 2BVTA 1ONQA 2OYPA 2BOBA 1F2QA 5IBTH 1MAJA 4DKFH 2NY2B 3MBED 4LKCA 3HZMA 2ID5A 4YHLH 2EO1A 4JFFD 1RPQA 4P57B 1FQ9C 5HI3D 4P46C 1YPZE 5DT1L 1K8IB 2NW3A 3CUPA 3T0BA 5H37H 1YUHA 1KEMH 3SDAB 3MJ9L 4QXUL 2O5ZL 5EOCJ 4XNMB 2AKRA 3PV7A 3HLAB 3LY6A 4AJ0A 3RTQB 1FNGB 3V5DB 4JFHD 3D39E 4UV4H 4XMLH 5LG1A 3X12A 5INCA 1G1CA 4JY6A 1S3KH 1JV5A 3IXAA 5A2JH 3C6LB 3ZSSA 4ELME 1SVZA 3QDHA 2VXUL 1RUMH 4JVPA 1CS6A 3U4AA 3Q5OA 3IKCB 3TNNB 1MEXL 1TLKA 5H37G 3SO5A 3DVGB 2W0LA 2P8MB 5GHWL 1Z2KA 4POYA 3PDOA 1KV3A 2XRAH 1U0QA 2W38A 4F7MB 5HVHC 3FTGA 2E7MA 4OKDA 1B2WL 1NBYA 1QACA 4YXLH 3GJFB 3NZHL 5HYQB 2EXWC 4EDXB 3VXRE 3FFDB 3RVVC 1KJVB 1TZIB 3O4LA 2PYEE 3U4EA 3UTSD 2D31A 3ECBA 4I3GA 2BNUA 3TBVB 3WEXA 2DBJA 4AYFA 5BMFH 2C1OB 4P46B 3HZKA 1IC5L 1OF2A 1W0WB 3UMTA 2C26A 2F19H 2HAZA 3T2NH 1BAFL 5CBAA 3C5ZD 4N0UE 4N1CA 1P69B 1ND0A 4LEOB 3S98A 4JB9H 5EA0H 1VB9A 1T3FA 2NXYC 3MLYL 3JVGC 2C4XA 4FTVB 3BGMB 3ARBB 3RIFK 4IRZH 2CH8A 4XVJH 3TF7C 5D70L 5FM4A 4J8RB 3MACH 2H1PL 3T3PE 3NZ8B 1BBDL 3HZVA 5E99L 2Z93A 4X6CF 1T80A 4QT5B 2Z92B 2OZ4H 5A2LH 3S9DB 3WUWB 4LSTL 4HIEB 1B6DA 1RUPL 1I85A 1S5IL 1RUKL 1MFEL 5DF0A 1KPUA 3MV8A 3G5YA 1NLBL 2EYTA 3BT2L 5I1IH 1O5DT 5HVHB 3QWRD 4Z7WF 1N59A 5EN2B 1JK8A 3KYNA 4M62L 1FNHA 3AS2A 2OSLB 2X1WL 4MQXC 3DUSB 4X6FA 2E6JA 5ANMA 2L0DA 1PY9A 4G5ZH 5E9DA 1XF5B 4NKOA 4JFEB 2AEPH 2RBLA 2PW2A 1NAKL 1MCBA 5D8JL 1TCRA 4MWFA 3RWEB 1GJIA 4E42B 3CMOL 4MDJB 3MLZL 3TO2A 5GS2H 1IT9H 1TIUA 2DQHH 3P77B 1BZQK 2AXHA 4I77H 4W81A 3BXNB 1PG7X 3DX8A 5LAXA 4MD4B 4YO0B 3O45A 1W72A 4TVPD 2DIBA 4E41A 5BRZB 2JCCF 2BVUA 3SBWA 1IGFH 1DBMH 2NXYB 4HDIB 3ALPA 4N68A 1RU9H 4O5LL 4NZTH 4UUJA 5AWNH 2ORBL 4DGVH 4XP1L 5FUOH 1RMFH 2NTFA 4LCUA 5F88A 5LKNA 4W4OA 4GMTL 4Y5VC 2OJEB 4ODSH 2HVKA 5IGXL 1U8MB 3EYSH 3GM0A 3IDMA 3JV0A 3BD3A 3D69A 1DBJL 4FFWC 4G8FA 2V7NA 1BPVA 3PQYA 3TZVB 3DTXB 3BDYH 4XBPB 4XCFH 1MELA 3KXFE 3DOSA 1M6OB 5JW4R 1DVFA 4YBQD 1R3IH 1SBSH 1BM3L 3GK8L 4Z6AT 3V5KA 4M48L 3JWNC 4CU8A 4KY1L 3T0ED 1UCTA 3TH2T 4AIXA 2NNAA 4WNQA 3FQTB 1MJJA 3HE7C 4J4PA 4RNRB 5GGVH 5EBLB 5T33H 3I3DA 4OIBA 3EYQC 1ZSDA 5CJBA 4JO3H 3WHXB 15C8H 4U2YA 1TCMA 1UVQB 5CD3A 1AQDB 4NCDA 1EJOH 4R26L 1PZUB 4M7JH 4QXGH 2R23B 4HT1H 3QWOA 3KPPA 4ONHB 4Y4FD 4BZ1L 4HJJH 5DVMA 4NUJA 2GT9A 2Z91A 4N0CD 1T0PB 4Y1AE 4UT7L 2HYMA 2J88H 3H3PH 4CW1A 3MCG1 1OARL 4Q6IC 4AT6A 2YD5A 4WO4C 2J6EL 1BLNB 3FRUB 5ADPL 5EO1B 3KPRE 4MLSA 1V3MA 2ZUTA 4Z7VB 3CFKA 3NCJL 1E6JH 1KLGB 2EEBA 1KG0B 4OCRL 3OR6A 1JYXA 5JDSB 1MREH 1FNEB 4JQVC 4CDGC 1MCHA 1I7UA 3IDNB 1NEUA 3EHBD 2EIDA 2BFVL 2VDQH 4IRJB 3U36B 4X4ME 4MXVE 3OAUH 5ICZA 4TN9A 5IJKA 4LU5L 1RUAL 4HIJA 4NCC1 4OAWB 1CQYA 3HE7B 3W2DL 1KIRB 1S7UB 4LGRB 2CD0A 3UTZA 2NX5A 2W0KA 3QNZA 2XZAH 2JELH 1KTRL 4XCNA 1UXWB 5IMLA 5C08B 3NGBB 5GGSA 3WFCH 5IKCA 3JVGA 3K3QA 4LIQH 3V79C 4PY8J 4X6DE 2FHCA 4JJ5B 1KT2B 5C07E 5B22A 2Q8AL 2DMBA 1JYWA 3K2UL 2ZOKA 4OUOA 1MRCH 2A9NL 1UJTA 2OQJA 1NCWH 1KC5H 1JTOA 2OJZH 5D1QD 2AW2A 3UTOA 1LO2L 2H6PB 4UQ2A 4EN3D 4WO4B 1MFBL 2I9LA 2R0ZH 4OM0L 2YD3A 2XQYG 4PJ8C 3MLXL 3ES6B 3BD4A 4D9RD 5JOFB 1PKOA 1RURL 3M1BB 3AB0B 3OKOB 3TJEL 4LNVA 3V4UL 2HKHH 1LEGA 1QRNB 1NFDB 4YXHH 1AGBB 1RJZA 5J1AA 4PJHB 1YEGL 2RR3A 2UZXB 3QNXA 4WHYH 2AK4D 2IBBA 3VDCA 5A43C 3B9KC 4XX1G 5AYQA 4J3UA 5JXEC 4P5TB 5J89A 1EXUB 2N4IA 5FOJA 4UOW0 5JXAL 1MWAH 5DVLA 1HDMB 1ITBB 5DJ8B 1YEJL 1SYVB 4YZFE 1H8OA 1I8KB 2PTTA 5L8KB 2YKLH 4JZOA 1ZA3A 3MPCA 5D6DC 2YN5A 4TULH 2EXYD 4RRPA 2JB6B 3P0YL 3LHPL 4ZOCA 2AJYL 4BKLA 4OGXL 3LKSB 4FQQA 3BZFB 4JKPH 2ADGB 3QEQE 3SGDI 1BFTA 2R0KL 2BSTB 3BKYH 3ELAT 5DMYA 4Z8FH 2XZQH 3FQXB 4J3OC 4QRQA 1IGYA 3NPZB 3CFCH 25C8H 2EEDA 2EH7H 4G8GD 5CP3H 1BP3B 1GGCH 3AS0A 2IQ9L 1HNFA 2B1HH 2EDNA 4OZ4B 5FB8A 3QT2A 4N0FA 7CGTA 3F6LA 5E7FA 4P3CL 5IK3A 4ZNEA 1HH9A 1N2RA 1F3JB 1ZGLB 1BECA 4L4TD 3Q1SL 5ANME 4EUPA 4TSAL 4X7SL 2OS7A 4JPWH 4C56E 3AREC 4RX4A 3D87B 3HZYB 2VWEE 3M17B 2E9JA 4MA8L 4P4KA 5I76A 1JTPA 3RY6A 4TUJB 3ROOA 3B9KB 4ZFZA 4JRXD 4RAUA 3BP5B 4YHZL 1FN4A 4J3WA 1FAIL 2X4RA 4GRWB 4E41E 1U3HD 1WV7T 4BSWA 1VFMA 5HHME 3RY5A 4X9HA 2Y06H 4X8XA 4GKZB 2R1YA 3EOBB 3QG6B 1MFAH 1CG9A 2ZKHL 3TFKC 3BQUA 4JFQB 5J56B 1OGTA 5HGDB 5I18H 1JGUL 2DS4A 4PJCF 3ULUC 4PD4K 4YDVB 1FNSH 1E4XI 3VFVB 2ICWJ 5E2JA 3QEHA 4PGCB 2NY6D 3RVTC 5FA4B 1WIOA 4LSQL 3WO4C 4PJEE 1Z0MA 4NQUA 2H8PA 3SEPA 3VFSA 1ADQA 1B88A 3IKKA 3CGTA 5GGTH 4IDJL 5F8RC 4WW2B 1QR4A 4F7EB 4UILH 3AREB 3ISWA 3BUYA 5DHVH 4FABL 3MOAL 4OLXH 5JORB 1VFAB 3GSVB 5A40E 4Y16C 1Q94A 1JMZA 3QFDA 4LVOC 3I2CH 3DX6B 1EFXA 3MUGB 1U8PB 3WKML 1FGVL 5ILTH 2UUDH 1KTDA 4O2FB 1KCVH 4RDQF 2KL6A 3ULVC 4KRPC 1C5DA 5EU6A 3VI4E 4O4YL 1NCUA 5T3ZL 1RFDH 2YD4A 5JW5A 1BFOA 5C70A 2AV1A 4JG0H 1JNHB 4DVRL 1CFQA 4QHUA 3HTLX 1CBVH 5IFHL 4U1MB 2FR4B 1FNLA 2DQEH 3UTPE 4R2GC 1NGPL 1VFBB 5D5MA 1NGXA 4KTEL 2YC1A 1DJSA 1J1XH 1CQKA 1KXVC 3QQ4B 4LOUC 2CLVB 3ARRA 4PJ8A 3T0XA 1TETH 3NIFF 4P5KA 3HE6A 1G7JB 1H15B 3LH2L 3ZMRA 4PY7A 4PRPA 1CDCA 5LJYH 1AIFB 5JA9A 2DQIH 5IW3A 2R56L 4JDZB 4R97C 1BMGA 2YD9A 3LKQA 3VU2A 1I9IL 1SJHA 2YEZB 1JGLH 2APTA 3IDIA 1L0QA 2FECL 4OFYA 2VDOL 3BEVB 3NACH 4LVHB 2XN9B 4M5YL 4ENEC 1S8DA 2XFXA 3FQRA 4K23H 1A6VH 1UWXK 4NQSA 3VGEA 4KVNL 1CTOA 3QPQC 2XNAA 1TVDA 3O3AB 3EFDL 1IM3B 3HNTH 3OZ9H 3MLTA 1NGWB 2MKWA 1EERB 1TJGH 4S0TD 4APQC 1X44A 1EFQA 1UCBH 4O02L 5D1ZA 5GS1B 1GC1C 2Z31C 5EWIL 4KH2A 1Q9KB 1D5MA 4OT1H 1Q9LB 4MYWB 2KH2B 2DTMH 3IAQA 4YXKL 1GHFL 2XPGA 2VH5H 3KJ6H 4CN4A 3VWKD 2VLLB 1O0VA 4Z78A 2V2WB 4LFHD 2Y25A 1XCQB 3QO0B 3DMMD 2QKIA 5BJTA 4NQDA 5CJ5A 4QHMB 5DRNB 5JLZB 1EHAA 4I2XA 3OX8A 2Q76A 2ZZUT 5ID1B 2W9EH 4HUVB 2AV7A 1I7TB 2R69H 1OP3K 2H3NA 5F7HA 5HHQB 5E1AB 3MLVL 1OSZB 3S37H 4F33A 3PV6B 4ODWB 1IEBA 5ABDE 1TVBA 4FP8H 1ZGLM 3H3BC 4KMLB 5GRVL 1JPFA 4HMEA 3QFJE 4RZCA 1F45A 1I1RA 5TGBB 1QA9B 3GKWL 3GSNB 4HGMA 4CUCA 4QEGA 3WNMA 4RMUA 4HHAB 3ZE2E 4S1SH 3WLBB 3VXSB 4PB0L 4NQEA 2VLRE 3FKUS 1MJ8L 1F4XH 4APQB 4HBQA 3BESR 3QIBC 3PNWA 2OR7A 5C0CB 4FNLH 4EBQH 2Z31B 4WJ5A 2IAMC 2DLFH 1G7MB 5K9JL 3TVMA 2FO4A 1QSFD 4F7TA 5JUEL 1KB5H 3SDXA 3VH8G 4EOWL 3X3FH 2P45B 3VWJA 5DVNA 3TH3T 1F6AB 1HHGB 4GBXC 3ZO0A 5CJOL 4D0CA 5FUZL 1R6VA 4IJ3C 3BISA 4XPTL 2VAAB 3KHQA 4J3TA 1KGCE 2OM5A 4PJ9C 2A73B 3A6CL 1WTLA 3DX9B 2BY3A 4XPGL 1T66D 2VXVH 3OG6B 3V6BR 1CL7L 5HGAB 3PJSB 4H1LH 4WFHD 2W9LA 1IM9B 3K74B 1CU4H 1YPZB 2HJKB 2Z8WC 4KFZC 4KKBC 3PWUB 2A6IA 3RU8H 3EJYC 1DL7H 4D9QD 32C2A 3Q5TA 3RRQA 3I6LE 4G9FD 1TZHB 4YUEL 5AUMB 5LWYL 1CDIA 4XH2B 2VIRB 5ACZB 4OD1L 4ZS6C 1IGTB 1HQRA 4M7LH 4MSWB 3F58L 5FDYA 1Z9SA 2X4OA 3H9ZA 3GSQA 4AEHL 2ICES 2WQ8A 1MFCL 4UQ3A 3AAZA 3D39B 4B50A 2V6HA 3FO0H 4QWWD 3D3VA 5JIHA 5DLML 3SY0B 4ELMB 4XBGB 1AO7E 1WF5A 4H1LG 4Y19D 1K9TA 1A7OL 3WFHB 3EBAA 4U6XB 3MRBA 5EU4B 1S9YA 1YDPB 1OP5K 2VZOA 4JO4L 2EH8H 1XF2A 4GBXB 5FYLE 4W70A 4HD9A 4G6FB 1YY9C 4DQOH 5KSAA 3G6JA 3MV11 4IJ3B 4Y2DA 2BOCB 4POUB 4PLJD 5H2BB 4R7DA 5B21A 3FT4A 1EUUA 4PJ9B 3JTTA 2CRZA 5ESAB 3VXRB 5DVOA 1INDL 1DLFH 4IEFB 2PYEB 2WZPD 4PTUA 1C7SA 4GAGH 4NO2B 3SPVA 3FFCA 1RJLA 3LN5A 3CCHA 1NC4B 3KAAA 1OAZH 3A6BH 3K8MA 2AXFA 4N0UB 4A6YL 2X41A 3VRLF 1NSNL 3RWDB 3ZDXE 3VI3F 1WAAE 5MEND 1UQSB 5F9WC 1CLCA 2ITCA 5FYKL 4WFEE 2VN7A 3L3KB 4FZEL 5I1HL 1G7IA 4MCYA 1JZ3A 5F8QC 3T3ME 1AGEA 2X4SA 4UTBH 3DX7B 4ZO9A 1JE6A 2N7BA 4JPKH 4XBEL 4CN1A 4M6OL 5DJZA 3V8CA 3VFUB 2O5YL 1F90H 5J06A 5E6IB 2P5WE 1FLTX 1HIML 1J8HE 1U8OB 2CLRA 4ODUB 4PUBH 3PGFH 2PW1A 1KIUA 1U8NB 4HIIA 4QTHA 3S96A 3GKZA 4HS6A 4R3SB 1FAKT 1G1YA 2C3VA 3SE9H 3O11A 2OZ4A 5EO9B 4OF0A 1H3UA 4TVPH 1QYGH 3U9PH 5C0FB 1ZWIB 3MFFA 4ZSOE 1AP2A 2DAVA 2EKSA 4Q0XL 3FB7B 5F71A 2NY3C 4U3XA 2MFNA 3WIHL 4N8PA 4QRTA 3IJHB 2VABA 4MJ2A 1KCRH 5D1XD 4OQTH 5DYOB 3TP4A 5DK2B 3HI1B 1NC2A 4B53A 43CAB 3RA7L 4G42A 4XGZA 3HS0A 1WZLA 4LCWA 2E8YA 4LVNC 5C0EA 3QI9A 3MLWL 3QRFM 2IAMA 4D0BA 2CLZA 5K9KA 3X3GH 1LK3L 2FJFA 1T4KB 1VENA 2BRRL 3TYGH 5D7JA 3MJ6A 2QR0B 3D0VA 3FB5B 4U7SA 5DA4A 1P7KA 3RFZC 4HV8A 5CKAA 2BCKA 1BD2D 4QHKJ 1ED3B 3WKNA 4LCCA 5BO1L 3KXFB 2VZ3A 3EYFA 1NFIA 3B2UD 4FQ1L 4Z7VF 5HYJA 1RIHH 3CDFA 3DXAA 5D7LD 2DWEB 4ZUSA 1MVUB 3OAZK 4H8WL 4YHNB 2A9MH 1MF2H 2NR6C 3FT2A 1XGRA 4KHTL 5B4MD 1KJ3L 3S34H 1HZHL 3S3JA 5DMGD 3V7AG 3VMPA 3DNKA 1HSAA 2NY3B 5IV2A 4MB5A 1SEBA 4F7CB 3U0PB 1VDGA 4Q9CA 4Y89A 4CBPA 1LGVA 1RJCA 4ZUVB 3KPSA 1HKFA 3OKMB 5TE7H 4AQ1B 4LVNB 3RDTC 3RNKA 4QHNA 2IBZX 4EZMA 5ETUA 1AQKL 4BH7B 1S9WA 5DURB 3B4NA 3MRFB 1XH3A 2BJMH 3L1OH 4Y1AB 4Z76B 3H9HB 5JHDE 3SDYL 1NBZA 4BQ8A 1WTGT 5L7XH 1MQKL 1NEZG 3FO1A 3S36L 1BOGA 4YBHA 3KPRB 5GGQH 1KF9B 1ONQB 2FEEL 3PL6A 1RIUH 3HA0A 4LKCB 3VD4A 1Z5LB 1MCQA 2NY7L 3EGSB 3JWOL 1HHHA 1XF3B 1L7IH 1CK0H 4QYOB 2IPTH 2D7MA 5E6YA 1J9CT 4X5XA 4PJHF 5DI8A 4FFYL 1H5BC 1OTTC 3CU1A 4KKLC 5KTEH 1J0ZA 3WO3B 2ZSVB 2Q7YB 4HW6A 5I15H 2YUZA 3IDJA 1ZA6A 3OKKB 1INEH 2YMXL 1C5CH 4JR9L 2VLKE 1P7QA 1EHLH 4CVZB 2X4TB 4FXGB 4RISL 4F80A 2Q6WA 5E8DL 5F9OH 4JY4A 4LASH 1I9RL 3D85B 5DK0A 3GNML 5CEYB 5I0ZA 4JFDD 4ZUTB 1AJ7L 2YK1L 4X6DB 4WTZA 2H2SD 2P5ED 3LEXA 2D03L 4KGLA 4S2SA 3RDTB 5BS0A 3LQZA 5F70A 5C07B 1JWMA 3X14B 4H88H 5L2KA 3ARPA 1MLCA 5EC2A 3IFOB 4OLZH 4M43H 1DDHA 4DGYL 5TE6H 2K9UA 2NY4D 3VFTA 1YEHH 4XNZC 4B7IA 4LARL 3SJVD 4LDEB 5DD5H 5DJCA 3FTGB 4BQCA 4NKQB 4KROC 2YD6A 5DD6A 5C0GB 2ZG2A 1T2QL 2D0GA 3I84A 1I3UA 3PP4L 1YY8A 3MMEB 1GZQA 4AK1A 3FO2B 4ZODA 4Z7QE 3NFPA 4WVRA 2VWEC 2EEAA 2MWCA 3AXLA 1JIBA 4N9OB 5C0AD 5DT1H 1VKXA 1OF2B 1U8LA 2CGRL 3UDWA 3V0VB 4YHIB 5GSRA 3MJ9H 5GJTL 4QXUH 2C9AA 4BSVB 3RUGE 3SDDD 2O5ZH 3QZWB 3DRQB 4CMMA 1MH5B 1J88A 4GRWF 3TT1H 3W11C 4I3SL 5DHYA 3O8XC 4IM8A 5ESQA 3HZVB 5IF0A 5D72L 1T20B 2Z93B 3QEQB 1MWAA 2F5AL 3QUMH 2BNQA 1RZKC 1WZMA 4LNRB 1MEXH 4MZ3A 3KPMA 2LABA 2V2XA 3V0WL 4H26A 5AZ2L 5FO7B 2R15A 4L1HA 4XXCA 4XNZB 3S5LB 3F65A 4JVUA 3RP1A 2F54A 4R0LA 1B2WH 4PJFA 5DD3L 3VXMA 4KROB 4WWKC 1FCGA 3RWGA 1F00I 3NZHH 4QRUA 5ANMB 5JIKA 1QG3A 4G6AC 1IZKA 4C56B 3GSOB 5ISZD 1FZKA 3VG9C 1TCRB 1MCJA 4X5LA 3WFEL 1JWUA 2DL9A 1IC5H 5J57B 4MXQC 1RZIB 5E8OB 1BAFH 4LKXA 1JRHH 3O45B 1FE8L 1KJ2B 5I0DA 3P9LB 1DSFL 3T04D 4E41B 3GJFK 3ZYJA 1AD0A 1AC6A 4G7YL 3FB8B 4QCIB 3QQNA 5TDOA 3MLYH 5GQBA 4MHHG 5HHMB 1IL1B 2I26N 5D70H 1ZHLB 2NTFB 1QLFB 2H1PH 4IRSC 4XPAH 5C0DB 2I5YL 1LEKA 1BBDH 2VXSL 3RHWF 3W9EB 1I3VA 3CDGA 5IB1A 2Y7QB 4LSTH 4LVEA 5HHOE 3MV7E 4MAUL 3U2SA 5ECJE 1RUPH 3MRLA 4G8FB 4PJXF 3ZTNH 1S5IH 5FYKD 1CXEA 2CK2A 1RUKH 1MFEH 4PV8A 3ARFC 1NLBH 3BT2H 4PJEB 3REVB 4QOKE 1GGYA 1DUYA 2R1XB 3LD8C 3S4SA 3BO8A 1ZHKA 2OTUA 3VMNA 1RHHA 4WWKB 3DXAE 4M62H 1R3JB 1Q72L 2PXYD 3MRNA 3I6GA 1GOGA 2NNAB 4KJQD 4WNQB 3EIFA 5HBBA 1I9EA 3LPGA 4S1DD 1PX4A 2NZ9D 4LHUD 1RZGB 5D8JH 1WCBA 1W72L 4CNIA 3CFBB 3CMOH 3VG9B 5I16B 5F7UA 2I24N 4G80A 1A1MB 1RHFA 3PWNB 3MREB 5CD3B 3Q3GB 1KCSL 5GGTA 3O2DL 4Q9QL 3NCMA 3QWOB 1VHPA 5KVGL 3BKCL 4Q74A 3BIAX 2P7TB 2R2CA 3MNWB 4JAMB 4O5LH 2AP2A 4XP1H 4HAGA 3SKOB 5K93A 2V5TA 4Y4KB 1XIWD 4G8IB 1EMTL 1KLUA 2VB5A 1RZFL 4IRSB 3ULVF 4AT6B 5KG9B 4WU5A 5EUKB 5B8CC 1KACB 2A6JA 5IGXH 2AAVA 2FZ3A 1UC6A 1E4KA 1DUZB 1DBJH 1W0VB 1UM5L 5SWSD 1OB1A 2AK1L 3OGCA 5FAAA 3LQAC 3WSQL 4XXDA 4LSVL 5EBWA 4ZFOB 3AU1A 4KTDL 5L2JA 3ARFB 3CD4A 1BM3H 2W65A 5DSCB 3GK8H 1T1YA 3MROA 3Q0HA 3L3OB 4M48H 2B20A 5C92A 2WW8A 1R3HB 5EIQA 4DKEL 4DOHE 1FNFA 3OR7A 1CFNA 4YK4C 4HFUL 3HNVL 3B9AA 4WTWA 2YSSA 2MQ3A 1G6RB 1NJ9B 3CC5B 5DXWA 4GG8A 3FO9A 1ZLUK 2EYRA 1YQVL 2JJTA 3EDDA 4ZFGL 5DD0L 4L8BB 3TA3D 2V9TA 2PO6A 4R26H 1T0NA 1JWSB 1LO0L 3GSRB 1ZT1B 5JHLL 1FL6A 4BZ1H 5K9OB 2V5MA 3FAXA 4QRPA 5L2KE 4JM4L 2HA1A 1Y6MR 3NH7L 4GG6A 2R2HB 2VE6B 4UT7H 4J6RH 1QR1A 4EI5D 3JWDC 4IS6B 4ACPA 1OARH 2DBLL 3OJDB 4LK4A 5KANI 4HUXB 4JZNA 2ATKA 1F4WL 2J6EH 4LIQE 5IMOB 3GGWA 3PABB 1RZ8A 1O7SA 3NFNB 3U7AA 4QKXB 5ADPH 5TF1H 3E8UH 4IOIA 4AG4L 5GS0C 2B2XL 3NCJH 4OCRH 3BRDA 2B5IC 4XX1E 5DRXB 2CRIA 4XNYL 1CF8L 3DJ9A 1O7VA 5EFIA 1CGYA 3H9SE 3UTTD 3K1DA 4WGWB 2BFVH 1WBYA 5HYSA 4E0RA 4LLQB 1OTSC 5IEHB 3MODL 4GW1B 4QTIL 1JF1A 3QDME 3L3HA 1S5HA 3W2DH 4U3HA 4HFWA 1AHWA 1HK6A 4DEPB 4KK5D 4KGJA 4D94A 2EDLA 1ZA3B 1AKJB 3RVWD 1KEGL 4YPGB 4KQ3H 3F7YA 3QFJB 4ODXA 2GUOA 2FJGA 1F4HA 1SQ2N 1ZGLP 2AI0L 5MP6L 4BKLB 5I8KL 1V3LA 2CDGB 1U91A 3BAEL 2SEBB 2DQFB 1FBIL 3L3JA 2FBOJ 3SE3A 2Q8AH 3TIEA 2GK2A 1YPZF 3UJTL 3K2UH 2VLRB 2A9NH 4PBVC 1NGQL 4V2BA 3N1FC 2M1KA 3QIWD 4KK6C 3B5GA 4OI8A 1FZOB 1LO2H 4ISVA 4HSQA 1UENA 1MFBH 3HAEG 1ZS8A 4N0FB 4EDWL 4OM0H 5IK3B 3MLXH 1MHHA 1CLZL 1RURH 5SWQB 1KIPA 1UB5A 3QIUC 3TJEH 3L7FA 3V4UH 3ZE0E 4ORGB 2B5IB 4ELMF 1R5WB 1YEGH 3KDMA 4N90E 2IAND 1XGPA 3MR9A 4X7TA 4LSRL 1OD7A 3ROOB 4OZIA 3UP1A 4XP9L 4YHPA 3QH3A 2R4RL 2QV2A 5KVMC 1FN4B 5JXAH 2X4RB 4RAVA 3MLRL 4TSCL 3FHQA 4JFFA 4M4PA 4NN6C 2CJUL 1CDUA 2ITDB 3CSYA 2FJHA 4PRDA 3QULA 4I5BA 3P0YH 3LHPH 3SCMD 4OZHE 4U1GC 4ZAKD 3BQUB 5F96L 4OGXH 4M1GL 4OZFB 2XV6B 2ZWLT 4AMKL 2R0KH 1JRHI 2VZSA 2Y72A 3HUJE 3QUKB 4I0PD 5FFLA 1X3DA 3VFMA 5IEKA 3T77A 3VCLA 3LPFA 7FABL 3ARSA 1R3KB 1X5KA 2IQ9H 4H1LA 4OI9A 2WINB 4Z77B 4HGWB 5F21B 4NNXB 4PYHA 4YBLB 4R6UA 1DEEA 4P3CH 1AO7B 1F11A 2NY0C 3OHXB 1OAYL 2ZNXA 3Q1SH 3T3PF 4BFIA 4TSAH 2OTWA 3LQMA 3QDGE 4X7SH 5LVEA 5BOZG 4KKCC 3GMLB 4E9LA 3BW9B 4MA8H 3MRJA 4ZFFB 1ZANL 2CIIA 3OKNA 4JJHA 3UBXG 1Q94B 4PJIE 3MGAA 5D7IA 5J4MA 2EE9A 2FYYA 1NANH 2X4NB 1SYSB 4YHZH 1FAIH 3T1FA 4GKSB 2B39A 3IFPB 3PWLB 2HJFB 4UAOB 3LKNA 3UTSA 4ZS7L 2V5RA 4F7PA 4NN6B 2KZWA 5FGCE 3R1GL 3DGGB 4NP4L 4NHUA 1N26A 2B7DT 1C1EL 5IR1A 3ILPB 3EZ8A 5HGHA 4CADA 3MRIB 2ZKHH 3VFOA 2LFGA 1WBZA 3LRSB 4M7KL 4U1GB 3C5ZA 4KAQL 2APXA 2XA3A 4HUUB 3WN5A 4BFGA 1XF4A 5F6HJ 1JGUH 4K3EH 3CSPA 3QO1B 2DYPB 4P9HC 1H3WM 4WHCA 4GW5B 5EU5B 4PV9A 1ADQL 1EEZB 1S7QB 2E9BA 3MUHL 3HE6B 4LSQH 3T09A 4MVBD 1A9BB 3K0WA 1N4XL 4HLZG 3KNBA 3O9WC 3B83A 5INDA 2KKQA 4U6VL 2P5WB 2AXGA 1J8HB 4IDJH 3GBNL 5T1DL 4PS4H 4MCZB 5J6HB 3KVQA 5K9QI 4GS7C 1K5NB 4HK0A 5T1MB 2B1AL 4FABH 3MOAH 4P5MA 4Z7UA 5DR5L 4OI7A 4H0GA 3EO0A 3QWRA 1IAKA 5E94A 1HINL 2IEPA 4PRHE 1VGEL 1CIUA 3GBML 3SDAD 1BQHB 2L4OA 5FYKU 3WKMH 5F7DB 2G60H 4ZSOB 1IC7L 4O4YH 1NLDL 3ESUF 4X0KB 4JN2B 2XWBB 5ENWA 3QQ9D 3MO1A 3PGDB 3RTQD 4PGEB 4O00A 4DVRH 4LL9A 2H26A 5D71L 5IFHH 3SKNB 5DQDL 1S78D 2QSVA 1TENA 3C6LD 1YNTA 1NGYB 1U36A 3S88L 1NGPH 3LN4A 3WJJC 4RGNE 3NCEB 3DBXA 5ICXB 1XFPA 4KTEH 4K2UH 2XPGB 1PSKL 5FHAL 2P4AB 3RHWK 2GKIA 1CVSC 5BXFB 4X8JA 3LH2H 3K46A 4OQTA 2VLJD 5CEXB 4Q7DA 2QKIB 2LU3A 1JYVA 2A6KA 2R56H 4WI6A 4LGSB 3MCKA 3O9WB 4MGXA 3C8DA 1ETZA 1I9IH 2HTKC 2XWJA 4GS7B 2R0LL 3W39B 2YD1A 1IEBB 3D1MC 4HK3J 2RB8A 4NKIL 4P46D 4A2LA 1QPPA 4M5YH 3T0EA 4JZJA 4N8VB 3UAJC 5MEPA 4CVXB 4QXTA 1T1ZA 2YBRA 4NO0D 4HAFA 1Q0YL 1YMME 4PIRF 4BZ2L 4KVNH 4MXVF 3EFDH 5LGJA 2QBWA 3IRZA 1ZLWH 1C08A 4NHCL 3CFDA 4O02H 3R8QA 1ZHNB 4NWUL 3TLRA 5T5FL 3PNWB 5EWIH 1FVCB 2MNUA 3QR2A 3MNZA 5JMOC 4HKZA 4KI5E 1ACYL 5EULV 5HDLA 3GO1L 4Y4FA 3HFML 3SKMA 3T8XB 5B38G 3PIQB 3REWB 1JPST 4YXKH 1GHFH 3MGTB 5HGBA 3DV6A 1LK2B 2XG4A 1N8ZA 3VWJB 3B8YA 3ZT5A 4NO3A 1IBGL 3E6FA 4GXVL 4LF3A 4X6DF 5JHDB 3IETA 2ZUSA 4RIRA 3VXUE 1JZ7A 4N9GA 4JY5L 3RWCA 1JZ6A 3BP4A 1KXTB 1DQDL 1SY6A 4EJ1C 2DICA 3BN3B 1XCTA 4QGYA 2EXWD 5TQ0L 5SX5K 5E56A 3RVVD 3MLVH 4JFED 1EAPA 2A6DA 1PLGL 4L3EE 4MX7A 1RD6A 5A16A 2YD7A 3V6OA 3G5VB 3IVKB 1WSST 5AD0A 4OCMC 4PJAE 5CS7A 4QNPE 2D3VA 4O51A 3GKWH 1I8IA 3TBWB 3HHRB 3ULUL 5BRZD 1XR8B 1F58L 2JIXD 4M6ML 4F8TA 2NXYD 4K94L 2MQCA 2BSRA 1AXTL 4PREA 2XKNA 1TTFA 4PB0H 4UB0L 1MJ8H 1MFNA 3C09C 1T1WA 1JNNL 2VLKB 1HQRB 3DI2B 3QXDB 4EQ3A 3EFFB 3JXAA 3RJDA 2G5BB 2IQAA 1JGVL 4HCRA 4YZFF 5SX4I 5IFJA 2R39A 2IPKB 3B9DA 5FDWA 3WL9A 4PR5B 5K9JH 2V7HA 1M71A 1WCQA 5JUEH 2H32H 4WI9A 5DDHA 4BQ6A 2YA1A 4EOWH 1P7HL 5KVDL 3DURB 4JLRB 3E2HC 1OAKL 3MRCB 5D1QA 2APWA 2W0FB 5L8JB 4K7FA 3BIKB 4QRSA 4EN3A 2EICA 1LNUA 3CVIL 1IC4L 5CJOH 5I9QB 4WUUA 1FPTL 4XPTH 5D7IE 5D93C 1IFHL 3C2AL 4MQXD 5CBEB 1QD0A 5JW3L 5IIEB 3FT4B 3MJ8A 3A6CH 3JTTB 4YGVA 4ZNCD 4U1LA 2JB5L 3O6FC 4U3CA 2WIIB 1CL7H 4R9HA 1OT1A 1NBVL 5FYJD 3U4BL 1MHCA 4IDLA 1M7DA 2KBGA 1EO7A 3MRGA 2GJ6A 4AH2A 1UACL 1FG2B 3TPUA 5IROA 1ZT7B 4X98A 1A5FL 2R2BA 3ARZA 3RUGB 3LMJL 4YUEH 5E8PA 2IH1B 4OD1H 1G7IB 4KWUA 3C09B 1AGEB 4Q2ZA 3TO4C 1I1AC 2GJZB 3H8NA 4AEHH 2QL1A 1F42A 1MFCH 2MPAL 1OW0C 2VQ1B 2YPLE 3MJ9A 4WHDA 2ARJQ 5DLMH 3VFNB 5HDBF 4XPFL 4ZPTA 2EECA 3OB8A 3OQ3B 4FFWD 4I8DA 4WI8A 3ZTJH 1A7OH 2O5XL 4G8GA 4ZUUB 2GFBA 4U6HA 2AJXL 3LKOB 5KVEL 2DN7A 4JO4H 2Z35B 2AERT 4X9BA 2VLME 1U3ZA 4QTHB 3ILQC 4NKMB 4FFVC 4HS6B 1EGJL 1DEDA 2CR3A 3OTTA 1HXYB 5D93B 3QUMA 3GSNL 3IDYC 4L4TA 1U8QB 2IMMA 2E3VA 3HE7D 4PJEF 1INDH 3WE6B 1VERA 4JANB 1V7NL 2HLAA 3O6FB 4JO1L 2Y6SC 1FYTE 4O2CB 4KJYA 4XVUC 4MNQE 3X11B 1L9MA 3EYQD 3L5WB 3ZTJG 3FN3A 5C08D 3RZCC 2Q86A 4NQCE 3TV3L 2GJJA 1DLHB 5GZNC 4JRXA 3C6SA 3VFRB 1D5BB 1LP9A 4XGZB 1U3HA 4A6YH 1L6XA 1J0JA 1L4IA 1NSNH 4LCWB 1A6TA 3NCYS 5FKPB 1ODAA 4JQXC 1CE6B 5FYKH 5I1HH 3OPZL 4LLWA 1TMCB 4YDLC 3TO4B 1I1AB 5IW6A 1MIEL 3DIFB 5I1AB 3LSOA 4XBEH 3KYAA 4M6OH 4WO4D 3VI4F 5D7JB 3C87A 1IAII 1KJMB 2O5YH 5F89B 4Y5XC 1FJ1B 2HH0L 2ZUQC 5HHOB 3MV7B 1HIMH 5I1LA 5ELIA 3ZHLA 5DJ0B 3D6GA 1BZ9B 3G6DH 4F37F 3OKDA 2B4CL 3RKPA 1U58A 3OXRA 4QOKB 5HHVL 4LLMB 1U8KA 1LE9B 4GRLC 1NDGA 3DXAB 3OAYK 3IDYB 4U31A 3V7AE 1IEHA 3L3DA 5E00A 1TVHB 2F74B 4Q0XH 3G08B 5F9JA 4B0MM 4W6WB 4ONFL 3WIHH 3MV01 3SO3C 2X70B 3RA7H 5DZLA 5JA8B 1GIGL 3PF2A 5I8EA 4K7PH 4MA3A 1PG7L 4I77L 4GLRH 2E7CA 4HX1B 3UPRA 2RFXB 3KS0J 1R5IA 5D7KE 1E4XL 1LK3H 2YRZA 4YDLB 4MD5B 1R5VB 1BVKA 1IGFL 4FFZL 2GI7A 1AGCA 2BRRH 2CR6A 4NJAL 1RU9L 5AWNL 4XAKE 3D18B 4P2OC 4DGVL 3RNQA 4HPOL 4P4RA 4PJ8D 2UVFA 4Y5XB 1NDMA 2ZUQB 4LLDB 1A6UL 1WT5C 3PL6B 3WHE1 5IB4B 3MRKA 3RKDC 3KLAA 5BO1H 5KN5B 4U1SB 1ROWA 1X4YA 1PYWB 1M1SA 5FK9A 2ICWA 1HHHB 4FQ1H 3DUUA 4PP2A 3D5OF 3B9KD 1KPRA 3MRQB 4GRLB 4XCFL 3TN0C 4NDMA 5JXED 4U1IB 3GIZL 2BY0A 1R3IL 4H8WH 4L3CA 1FO0L 3K8LA 2DMKA 2VYRE 3DHJA 4UV7H 4DOHB 4YDJA 4KHTH 1KJ3H 1HZHH 2FIKA 4XVTL 3IDJB 2DQDL 4RWYL 2BXZA 1BVZA 5C0IA 1VSCA 1P7QB 4JFYB 1MFDH 4JY4B 5DK0B 3TESA 4DTGL 3L95B 4JO3L 2UY6A 3VA6A 1EHNA 4RAHA 4YIQB 1AQKH 4HK3N 3LQZB 3UYOD 4KMTL 1OW0A 5L2KB 1MLCB 4NBZB 4JRYE 1P84J 5FKAA 3K80A 2FX7L 1A8JH 3HCVB 3VDAA 4M3JA 1MQKH 2P8LB 5DMKA 1JGEA 3ZE2F 1IAMA 3S36H 2G9HA 4D9RE 3H3PL 3QG7L 1HI6B 5E6ZA 1K4CA 2IPUK 5FEBA 5HYEA 1OWRM 1EBAA 3VWKA 4U1JB 4JHWL 4HIHB 1H3XA 1OLZA 2HT4C 2E7HA 3ARED 2NY7H 1ZLVH 1YYML 1CXLA 4PJBA 5CKGA 2AK4E 2VDKL 3H9SB 5HD8C 3DRTB 3TH4T 3QUZC 5EUOE 3TN0B 1N5YL 3G9VA 1MQ8A 2ZPKL 4YX2L 4FFYH 2NXZC 2VERN 3F8UB 3QDMB 5ACLA 3RY4A 3TWCH 2Y4SA 1GAFL 4L9DA 3QDJE 3MLSL 3OKLA 2YOCA 3IDXH 1I75A 2YMXH 4JR9H 3GIVB 4CMMB 2PNDA 5D2NA 3O3DB 4RISH 3B6SA 4NQXA 4JDTL 5F7FA 5HDOA 4TUKL 3TFKD 1MCCA 4EVNA 1I9RH 1A4KB 1Z3GL 3DPBA 3GNMH 3D0LA 1AJ7H 4LPVA 2YK1H 5IF0B 3ULUD 3GB7B 1UWGL 1MWAB 2D03H 1AXIB 5T1KD 3QEGL 4FXKB 2E6QA 3BMVA 3RVTD 4DGYH 4H26B 4YWGL 1WFUA 4LARH 2PCPB 1JZ8A 3ARVA 4ZDHB 1YQ2A 5KS9E 4PJFB 1QSFA 4U1NA 2OJZL 2IPUG 1QBLL 5KAQF 3RWGB 3QAZB 4OCSL 1T2QH 2F58L 9CGTA 3NAAL 3MA7A 3PP4H 3ZKSD 1H3GA 4LQ1A 4ZOAA 2VL5B 4X5WA 1UZ6E 2ZUVA 4ETYA 4OSUL 2H9GA 3QJHB 4Z0XB 2F9BT 4KDTC 1FZKB 1FVDB 4QHLB 5FV1L 4Y16D 3ARQA 2XN9D 3RL2A 3QUZB 3MV9E 4JRXE 2CGRH 2F53D 5CJ8A 4G43A 5EOTB 4LKXB 4YDIL 5E8NA 1HH6A 3ULVD 3WFBL 4KRPD 5DQ9B 4DK6A 3ETBF 2ENYA 3EOAA 1UB6B 4JKMA 2YS4A 4DKAA 1AI1L 4QY8B 3BH8B 1FNAA 1UXSB 3W81A 4I3SH 2BNRE 4WFFD 4P9ML 4OZHB 5I1JL 3MJ7B 4R2GD 5IVXE 5IG7B 1QO3A 2XI9A 5D72H 4YNYB 2F5AH 3CDGB 1MCEA 3U46A 1WICA 5FYJU 2GCYA 3HUJB 3QPXL 4LOUD 4JFOA 4HXBL 1MI5E 4U6TA 3V0WH 5AZ2H 5IVZA 4FQXC 3DARA 3MZTA 3ZDXF 1WAAF 1EAJA 2F8XC 2Y9RT 5DD3H 4DZ8A 4Q6YA 1A21A 1TDQA 2AJVL 3T3MF 1UM6L 3T4YA 4Y19A 3TBSB 3MJGX 3O41A 1UH4A 3BMWA 3QDGB 1QVOA 3LVEA 5D9SA 5JQHC 2HG5B 1W0YT 4LSPH 3CVHB 3WFZA 2WK2A 1C16A 5DMJB 1FFOA 3WFEH 1N0LA 2VUYA 1HILB 4G80B 3RJQB 3GMNB 4PJIB 1JF6A 4ENED 1XZ0B 4XWGH 1AGDA 3P11L 1FE8H 5H35B 3HR6A 1DSFH 5MEOA 4G7YH 4LDOB 3DYOA 3UZVB 3QPQD 3VXSD 1U93A 1QQDA 5DHVB 5FGCB 4APQD 3U0TA 1A4JA 3RGVC 2Z31D 1KLUB 4HUWB 2C3WA 2I5YH 2VXSH 4FTVE 1TJHH 2A6JB 4YC2C 5MENA 4RGNC 5C2UB 1Y0LA 4ZUWA 5BQ7A 4JO2L 4MAUH 4GLRI 4PRIE 5L88H 3H2WA 2OLDA 4DCQA 4FQXB 3CMGA 5EBWB 5DJ6A 2ZG1A 5F3BB 1GRWA 2NW2A 3CFJA 2CDEA 1G0XA 2VSCA 2UWEA 3P9MB 1JPGA 1I8MA 4IMLA 1A1NB 1CFNB 5EB9A 1CFTB 4LLVB 1M05A 1W72H 5DZNA 1A14L 1IM9D 3DROA 2XWTB 4PRHB 4L8CA 4HGKC 4UILL 2UV3A 5FF6B 1D5ZB 3P73A 1KCSH 3W0WD 5E8EB 4OLXL 5F7EL 3SGEI 3O2DH 4Q9QH 3O3EA 1A7RL 5KVGH 3BKCH 4HG4K 5JZ7C 4FZ8L 4DUWA 1X7QA 1ZTXL 3QIBD 1EMTH 3RGVB 3D39D 4OF5A 1RFDL 4ZPVA 2P47B 2A1WL 2IAMD 4KI5C 1F3DJ 1OVZA 4X6EA 1NMCC 4RGNB 3BZEB 4FHBD 4IOIB 5IB3A 1UM5H 5EZLA 4OLUL 4I4WB 4TUOA 2AK1H 3WSQH 1RY7B 1NUFA 4LSVH 5DJAB 5F93C 3T0VA 4GBXD 3CU7A 4KTDH 4HKXA 5GGRA 5IW1A 5H94B 3QHZL 3LV3A 3KR3L 3P9WB 4X7CC 1FVEA 5JIIA 1WBYB 1NAMB 1T5WA 4F37K 1KJ2L 1XT5A 4PJ9D 5J9PA 4DKEH 3VXRD 3BJ91 3C9NB 3X17A 2WIMA 4YR6B 1AHWB 2PYED 4HFUH 3HNVH 3T65B 1OGAA 1EHXA 3MUJA 1FIGL 2CMRL 4PTTA 4PJ7E 3C5SB 3GJEB 1YQVH 5DS8B 4RGOL 4ZFGH 5D7LA 5DD0H 5A1AA 4KKBD 2VXQL 2R1WB 1RAMA 3L3IB 3EJYD 2RJMA 1HOCB 1A7NL 4GXUM 2HJLA 2N7AA 1YNLL 4FXLA 1LO0H 5JHLH 3V6ZA 1YMMB 4PRAA 3SKUD 3TIEB 2APVA 4JM4H 1L0XA 2VKWA 4DJMA 1PVHA 4ZS6D 4DFHA 4M8VA 1EPFA 2W60B 2DBLH 3VH8B 3RL1A 1F4WH 1I1FB 2E7BA 3HNTL 2EIZA 4P23C 3OZ9L 3HG1E 4PGBA 3VXPB 1NMCB 5I30H 4AG4H 1V3JA 3DVNB 4F9PA 3X13B 2X4PA 2B2XH 4JM2B 3L9RA 3WUWG 2UYLA 2CDFA 1K2DA 1CF8H 1KN4L 3IYLW 3AM8C 1YY9D 4JPIB 3VXUB 3MR9B 4KK8C 3RWIA 3HPJA 1I9JL 3WS3A 3VXNA 2F5BL 4YHPB 3RZWA 3MODH 1KB5B 4QTIH 2NZIA 3EOTL 5F3HB 5IB5B 3MBEB 3L3GB 1WLHA 4L3EB 3CPLB 5TDNB 2EYSB 3TJHC 4JFFB 3FCTB 2XG5A 3MRDA 3CSYB 2FL5B 1KEGH 1QSEE 3C8KB 2R69L 2XTLA 1IAIM 2GITB 3QULB 4FA8A 1U8HB 4PJAB 4Z7QF 3O0RL 5MP6H 5I8KH 5DJDB 3BAEH 1LD9B 4M8QB 5IWLA 4NGHL 2HRPL 4G9FE 1FBIH 3EJZC 4X6CA 2EC9U 3IU3B 4L1DA 2JJUA 4ERSL 1NGQH 4ZFOL 4L4VE 4M3KB 1YEFL 4H1LB 1QFHA 2NQCA 2ENSA 1XMWA 4WEBL 3RUGF 1BWMA 5DQJA 3LB6C 4JFDA 4S11A 4ELKA 4CU6A 4EDWH 4P23B 2P5EA 1F3RB 3IAGC 4YEEA 1CLZH 4Z7WA 1UGNA 2BSSB 2Z4QB 4FNLL 2LAAA 2HFEB 4IOFC 2O93L 1U92A 5IMMA 3KXFD 3QUXC 4L8SC 4TNVK 2ZOLA 3SJVA 5EBMA 3QHTC 1EUTA 4LAQL 3T4AB 3I02B 1IEAB 4LSRH 2A83B 1NFDE 4OB5H 5D7IB 1F02I 2GTZA 4XP9H 1BX2A 2R4RH 3MZGB 1EEUA 2LVCA 1VGKA 4FQ2H 5E2UH 5C0BE 5CAYB 1BJ1H 4TSCH 2G75B 4OF8A 4WHTA 4MNGA 3HMWL 4C55A 2JCCA 2CJUH 2NY3D 1ULVA 1OAXL 4MJIE 5C0AA 5HPMB 2MJWA 5I8CB 3W9DA 1LO5B 5HGHB 3OXSB 4OZGE 4HPYL 2HN7B 1WBZB 4CMHC 2V17L 4M1GH 3GSXB 5JNYB 1FC1A 1XF4B 5ESVB 3SDDA 4AMKH 1DTUA 1CU4L 5J13B 5DURD 2AGJL 3GMQA 3VE0A 3LQAL 3RIFF 4Y1AD 7FABH 5GS3A 4RRPG 1IGML 1Y18A 3JV4B 2FSEB 3JSSA 1BVLB 2BC4B 4HWZB 3QBTB 5DRWA 3CXHJ 3A67L 1B0RB 3ET9F 4WTXA 1OAYH 3ROLA 1G7HA 4RFEA 5CP7A 5EPMA 1CI5A 3QUXB 1F8TH 4L8SB 3KWWA 1HQ4A 4XNUL 3B8SA 3PP3H 3O2WL 1ZANH 2F8OA 4IIQA 1IAKB 3C5JB 3BWAA 1T21B 5E2TL 1INQB 4Y5YA 4ZO6A 4DQOL 2NR6D 4LHQB 3LOWA 2WUBL 1GZPA 5C0JB 3TCXA 1HCFX 5ISZA 5C9JA 3IJSA 4MNQB 4UDTB 5HHNB 4CDHA 4TTGA 3R1GH 5TPWL 4NP4H 4DN3L 5B39A 4OV5B 4LRIA 3AY4C 2DI9A 4NQCB 4ZYKA 4TPRH 3N1MC 1N6VA 3D85D 5JPNA 1PKQA 4M7KH 1IRAY 4KAQH 4CMHB 4GAGL 3QEUA 1BZ7A 5GS0L 4GJTB 3RDTD 2GSIB 4OD2A 3ZDZE 3K4DA 4NRYA 5C07D 1Q9WA 3BEWA 4PJ5D 3WUZA 5T3ZE 1EO5A 5MEQA 3U6RB 1ADQH 5FO8B 2H41A 3SGJC 3LKPA 3L5XL 4X8JB 1DQLL 2P24B 5M95B 4XHJC 1N4XH 2FGWL 5KSUA 4MZ2A 3JTSA 3AM8A 4U6VH 2HT2C 5D2LE 4WDIB 5ITFA 1BD2E 3GBNH 5T1DH 3S3SA 1DQQA 3VD3A 4U1KB 1ETZB 4WV1C 2JJSA 3SDCC 3S6CA 1J87A 1RJYB 2VDLL 2B1AH 3HKFA 3N06B 5DR5H 3G04A 5J6GB 5D6CA 3GMRA 5GGUA 1HINH 1ORQB 5KVFL 3HC0A 2PXYA 1JI1A 1A2YA 4AIZB 1VGEH 2BY2A 3GBMH 1YEEL 1OTTD 4KKLD 4J3VA 3SE9L 1IC7H 1KIQB 4LHUA 5I2IB 1NLDH 5FCUL 2YHGA 3TIDB 1T03L 2XXCB 2LAGB 2W1NA 2FRGP 5EZJA 1MJUL 1QYGL 1TFHA 5LGJB 4LLUA 4N1HB 4F2MA 4XZUB 5D71H 5GJSL 3G5ZA 5DQDH 3DV4A 3MNZB 4R4BB 2YUWA 3QEQD 2RIKA 4L5FL 3V6FB 3S88H 3FOLA 3GMPA 4PG9A 4YFEA 4G8EB 1P2CA 2X6MA 1ZK9A 4B41A 3IXTA 1MHEA 1CD1A 1PSKH 5FHAH 5DRZB 5HGBB 3EO1A 1NEZB 1II4E 1XIWA 3WIHA 5FYLL 4LF3B 4RWHA 4GUPA 2C1PB 1LHZA 1CT8B 5C9KA 5JO5A 4KROD 4L9LA 4BH8B 5EU3A 4GRWH 5SWSA 3UPCA 1XCTB 5CZVH 1XGUA 1KYOJ 2VAJA 3V9FA 3SDCB 4HS3B 3K8KA 4C56D 2A6DB 5I73C 1W8OA 4WW1A 3G5XA 5BV7L 3WJLA 2ICCA 2FHFA 4NKIH 3KGRA 3DO7A 5IHZA 1Y6KR 3LN9A 4O51B 1I8IB 2DQTL 1RZJL 1TQCB 3LZFL 1P9MA 5GSVB 2J8UE 1Q0YH 1RIHL 1PX3A 5HHMD 1UADC 2Z8RA 5IQ9B 3JV6A 3VJ6A 5EIIA 4NHCH 1T1WB 4NSKB 3W11D 1JHTA 2APFA 4NWUH 3TA3A 5T5FH 3O8XD 3VXQA 4L8DB 5ERWA 1ACYH 4U6YA 3GO1H 3HFMH 4ZD3L 1NKRA 4P3DB 1SMOA 1ZLSH 2IADA 4JRYB 1OHQA 1ES0A 1YN6A 1XGQB 4EI5A 5HI5C 5JOPD 1IQWL 3N9GH 4NRXA 1IBGH 1WZKA 4GXVH 3SJVE 1SY6L 1WBXA 4EN3B 1KB9J 1LNUB 2BJML 4F9LC 3SN6N 2JF1A 4JY5H 3SQOL 4WWKD 4MQ7B 1DQDH 3DWTA 3MGOA 5TQ0H 2ZCHL 5DUBA 4I9WD 5F1IB 4G6AD 5KSVA 5F44A 4K3JL 3FQWB 5F72S 1PLGH 1NGZB 1IGJA 5I73B 3UTTA 2AK4B 3PWPE 1MHCB 4V1DE 4NNPL 1GOFA 2NY2C 5EUOB 4XHQA 3ZE0F 3HRZB 2MHAA 3IU4L 4LEXL 4MXQD 2V5YA 3ULUH 4P9HL 1E4JA 1F58H 4M6MH 1IILE 4X98B 3OGOE 1SJVA 1AXTH 4CL7A 1VEMA 4PJCA 1CGXA 4HCRL 3QDJB 4JE4B 5HI4C 8FABA 1JNNH 3CDCA 1A7PL 4IRSD 1EA9C 5CIPA 3SE4C 4HUKB 4U2ZA 1IC1A 3EYUL 5DJXB 1JGVH 1X5GA 1A6AB 3MRHA 3QCTL 3B3IA 1Z9OA 2BDNL 4AM0A 5KVDH 4XCEA 1BBJA 4OZHF 3QIWA 4HWBL 3JBG7 4UBDC 1DN0A 1D3CA 3ARFD 2EDJA 3TNMB 3CVIH 2BZDA 4WV1A 1IC4H 3HUJF 5L2KD 1T7ZA 4KVCL 3BOVA 5KS9B 1FPTH 5GISL 2IF7A 5FO9A 1IFHH 1UJ3A 3NN8A 2DLTA 1A6ZB 1XGYL 3C2AH 3EO9L 4PRNB 5JW3H 4ZXBC 4KTYA 1JN6A 2PYFB 4EKXA 1YN7B 4QXWA 2CKBA 2JB5H 5CHNB 5ISZE 2HLAB 4MLIA 2IANA 1NBVH 2AJSL 5D7SL 3U4BH 3EYOB 3QUYC 2AJ3B 3MV9B 1N6QL 3VGBA 4JRXB 4K8RC 1UACH 3CLFL 3VFWA 1N64L 4YQXL 4PJDE 5CSZB 4M7ZC 1A5FH 3BN9C 1IVLA 3LMJH 3ARWA 4FN0A 2VDPL 3FT3B 3IT8D 1A0QL 2H2PC 3QYCA 4PJIF 1D5IL 1JPSL 2DWDB 3E6HA 3VW3L 3FQUA 1HYSC 3SCMA 4N8CL 4EI6B 4ZAKA 2BNRB 4R96A 1Q9OB 3ARBC 2MPAH 1ZVSB 4WEUD 5IVXB 5DEGA 5KZCB 2WWMC 4KXZI 5ALCL 4XPFH 3CFEB 4ZG1A 3ZHKA 3TT1L 1PEWA 4I0PA 3AROA 2XTJE 4OGZA 5ICYA 4OM1L 2O5XH 5C7XL 1MI5B 3PHQA 1AD9A 4P2RE 2AJXH 3EYVB 5KVEH 3QUML 1I7ZA 3WIIL 1MLBB 5SV4A 1E0OB 4C54A 1MCFA 2Y5TA 1E27A 3N1GC 1BIIB 3MFGB 1FL5B 1EGJH 1U8KB 1BF8A 1QFWI 3GSNH 1IARB 2ZP0T 4ZXBB 1J12A 2DQCL 5ID0B 1V7NH 4JO1H 5AG9A 2MMXA 1AKJD 3TCLB 1GOHA 1B3JA 3G6AB 1N5AA 3QFJD 2XY2A 1G9ML 3TV3H 3F7VA 1TJIL 3QUYB 5IOPB 4HF5L 5DJ2A 5J3HC 4AENB 3FOMA 1G7QA 4RFNC 1A3RH 2W9DL 2ADIA 4MA3B 4TNWF 5C0NC 4M7ZB 3VDBA 3QXAA 1SJEB 5F7NC 3F12A 2VTFA 4KDWA 2R2EA 3SGDH 3GMOB 3OPZH 1JRHL 3RWHA 2AQ1A 4HKBB 1P5UA 2V9QA 2ESVE 3UJJL 1MIEH 3FONA 5IBLC 4XPHL 3BPLC 1UEMA 3WIFA 3V0AC 4MB4A 3TBTB 4HH8A 4ONOA 5TDPB 4FMKA 5GS0D 2HH0H 2W59A 1W2KT 4NKDA 4B5EA 3HC3H 4XPAL 1J8KA 3IAPA 4PRIB 3MRKB 1CVRA 3KLAB 1MUJA 1BGXH 2B4CH 1X5ZA 4M03A 5F1OB 5FK9B 5IMKB 2V2TA 2ICWB 1I8LC 4F3FB 5HHVH 5J11C 3TZVC 4NWTL 3ZTNL 3DUUB 2XIDA 3FQNA 4B7LA 1QSVA 3VGAC 1KGCD 1OTSD 2CPCA 4L3CB 1TNMA 1T89A 3BP6B 1T83A 3V7MA 3H0TB 5DFVC 2D0FA 3P4NB 4YDJB 5C8JB 4P57A 4NIKB 4MS8C 4ONFH 3BP7B 3QCVH 1NMAL