2X44D

Structure of a strand-swapped dimeric form of ctla-4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
121
structure length
121
Chain Sequence
MKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOTOXIC T-LYMPHOCYTE PROTEIN 4
publication title Domain Metastability: A Molecular Basis for Immunoglobulin Deposition?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x44D01
4LARH 1AR1D 3WIIL 2YS4A 2A74A 1RU9H 4BFIA 1F6LL 1Z2KA 4LEXH 2XKNB 4IRSC 4G6JL 1MPAL 1S78C 3P30L 2K7QA 4PJHF 1CVSC 4GW1A 4N1HB 1W72H 1QFWM 2OJZH 2DQJH 1H9VA 3DRQA 1P69B 4HMDA 3JV0A 1NDGA 1LO5A 1Z3GL 2J5LC 1CZ8L 3EYQD 1MCSA 4M3JA 5C0CA 1NFDF 2HJLB 3BE1L 3LB6C 4LEOB 4LCWE 2XPGA 5GRJH 4CL7A 5C0IA 4PJGB 3VXPB 4ORGB 4M9OA 4XMPH 5KSAA 2I9LB 1BGXL 5DRZA 1FZOB 4JHAH 4MVBD 3BN3B 1A6WH 4ONHB 1VADA 5CINL 4Z8FH 4XZUB 3G6AA 3ARRA 1MJ8H 2BFVL 1MAJA 5I19H 5F8RC 2E6JA 5CUSH 4TVPH 2Z31B 5JXEA 1ZLSH 1QBAA 1JP5A 3MCKB 1INEL 4KUZL 2Q86A 2XXCB 2V9TA 5D93B 2IAMB 3BEWB 3DVFA 1V05A 1PKQB 4KRLB 3D25B 4GAJH 1T0MA 4BSWB 2IANE 3SGDI 4S1SL 4TUJA 1I1AC 4QWWC 4KHTH 1DBBH 2K1MA 1CD9B 5GGRY 3ULVD 3FQNA 5K59E 4JVPA 3FQWB 3K4ZA 3T77A 1OB1A 5J7CC 1OGTA 5JW4Q 1S3KH 2YD2A 3ARDA 4YQXH 2HLFD 1SM3H 2R4RL 2H6PB 4DAGH 1FFOB 1RMFL 3W5MA 2F53D 5I75C 1BM3L 3BIKA 5CS7A 2DD8L 3KHQA 4U6TA 4HS8L 1KB5A 2H26A 3BVNA 5IMKB 2KKQA 2ESVA 4HMEA 4JZJA 2R2EA 1IAOB 4O00A 4O2CB 3RGVB 2N56A 5C0JA 1UB6A 2BC4B 3WL9A 5F93C 3VWKD 3V5HB 1LP9A 1CL7L 4DTGH 2VDNL 3QO0A 1WIUA 3SGEH 3VFOA 4M6NH 3RNKB 1RI8A 3OKKA 5I1DB 4NGHL 4PLJD 3G04A 1KPRB 3AAZA 3RVWD 1N64L 4FXKB 3ULSA 2D0HA 5DT1L 1BD2D 1UZ6F 1ZA6A 2AK1L 4AZ8A 5GRXG 4R3SA 3WIIH 1TZGH 2HFEA 3MA9L 3P4MB 3HS0A 3VMPA 1RHHB 5ESQA 5EPMA 3QQ4B 4DKEL 5CJQL 5C1MB 2ID5A 5TE6L 4X7SL 4G6JH 2UZYB 4LMQI 3HFML 3OAZH 1KJ2L 5MEPA 3OQ3B 5CWSA 1N0LA 1H15B 4N5UA 1U8HA 3ZE2E 1QPXA 3T0EB 4OBSA 2H41A 4WI8A 4X9FA 2ZUVA 5J3HC 2DTSA 4JO2L 1Z3GH 4TYUA 5B38G 3GJFB 1X4XA 4RNRB 2Z93A 1A9EA 2FJGA 4QRPE 3BE1H 1KCVL 5FKPB 4WHCA 1LO4H 4BFGA 5I16B 2BERA 5C0GB 1V3JA 1G9EA 1BGXH 1KPVB 4KI5D 2QADD 1WICA 3QUYA 5C9KA 4IOIA 3TH2T 1ZHNB 5EB9A 5CINH 4NSKA 3R1GH 2BFVH 4JFDE 2GSGA 3RX5A 4MD4A 3DETD 4G43A 1NCNA 1AGEA 5HVGB 5JW5B 4NWUH 4OKDA 1INEH 4PJGF 3WFZA 1JYWA 4M00A 1FE8H 2P8PB 3RIAK 4EUPB 2X4QB 4PJBA 4HIXH 2Y1VA 4MXQC 1FAIL 4PJ5D 1I3VA 4E5XB 3J8F7 3CZFB 5DRNA 3QP3A 4M7ZC 3O0RL 4U1IB 2IMNA 1RZIB 3OAUL 2R4RH 4PGDA 1NMCC 1NMAL 4WEUD 2EH7L 5D5ME 1JMZA 4ZXBB 4C83A 5IVNA 4RAVB 1BM3H 2DD8H 4M1CC 3EAKA 1GGBL 3SDCC 4LKCB 1T7VA 3EOYG 4PV8B 5C0NC 2FH6A 5FM8A 1DUYB 1XIWC 1BFSA 4QRPB 5CSBA 5C0BE 1I8LA 1D6VL 1CL7H 4AIOA 4HG4J 1PYWB 2VDNH 1CD1A 1Q94B 4F7EB 3RWGA 4N0YL 4E42A 4L8SC 3S4SG 1BAFL 4FTVB 4NGHH 1N59B 4Y5XA 3MGAA 3SE3C 2RHEA 5IMLA 3JZ7A 3VXNA 3K4AA 5DT1H 5GZND 4D8PB 3CUPA 2Q8BH 5KN5A 4XVUD 3QJFB 1N5YL 2V9RA 3OB0H 3BW9B 3MA9H 4D0CA 4X8JA 5IJKA 5C08E 4OCXL 1MI5D 4DKEH 5CJQH 5IBTH 3E6FA 3FT3B 1FBIL 5TE6H 4X7SH 4AYFA 4NQDB 4O4YL 2VKXA 1CGVA 3DBXB 3HFMH 4HBCH 1KJ2H 3S34L 2P5WE 1OAKL 1B0GA 5C0AA 4RMSA 1CTOA 5EC1B 4QGYA 1FCGA 4PJDE 5JDSB 4JO2H 2NY4C 2Y36L 3LKSA 5D5MB 4RAHA 4FFWC 2E9WA 1BX2B 3GKZA 1KCVH 5TQ0L 3TBSA 1D5IL 2DI8A 1QBML 4G8EA 4PJAA 5EO1B 2RAMA 5EOQL 5K59F 1HWHB 3VD9A 3RWFB 3B8SA 1I7ZA 3CFDA 3UMTA 4KDVA 4KQ3L 1CLYL 2FEDC 1WBZA 2R2HA 5C0BB 2BDNL 5CEZD 2FZ3A 1EGJL 1PZ5A 1RUML 4YHNB 3DSFL 3V7MA 3WJLC 3PDGA 3IDXL 2ICWB 3TN0A 3KNBB 2FDBP 4X6DB 4LSSL 2VJXA 2AJUL 3X3FL 2KZ1B 3V5DA 4PJXA 4W4OC 1NC2A 3U46A 3BKYL 3CFJB 1FAIH 1NPUA 2DQCL 3B5TA 3SKMB 2XWTA 2W0KA 1NMAH 1XGQA 2V5RA 2EH7H 3ZHDA 4I18A 4FXGA 2UUDH 4QXUH 3DV4A 1CE1L 2ZSVB 4U1MB 3U9UB 1GGBH 1IGFH 3DTXA 4JFHD 3ARDD 3LRHA 5EZJA 3T4YA 4JN2A 3IU3A 2VC2L 3CX5K 5KOMC 3CSGA 2EDJA 2AJSL 4LNVA 4YDKL 3SOBL 3OKDB 3VE0B 1D6VH 3M8OH 1IC7L 1YUHB 4PYHA 4XBGB 5DHXB 1N5AB 4JRWA 3AREA 3WNLA 4X5WA 4N0YH 2PXYA 4AM0B 4GLRH 5DC4B 3QXTA 1BAFH 4TQEL 3ZE2F 4ZPVA 3HG1D 3RP1A 2X4SB 4BZ2L 1NGWB 2EYSB 4H1LG 1O0VA 4MA3B 3HA0A 5DI8B 1A1NB 3VXSA 5ANMA 4YR6A 4FOMA 4P48A 4XCFH 5CMAA 2Z92B 4Z0XB 1FN4B 4A6YB 4OCXH 4K3DH 1QD0A 5C0EB 1FBIH 1ERNA 1CIUA 4O4YH 1U8NA 3W0WE 3ZE1E 2VE6A 3S34H 1KV3A 4R96A 4WI6A 5HYJE 3FKUS 4R4BA 1AXSB 5ILTH 2CR3A 1MHHA 1S8DB 4OD1L 1JPST 1ES0B 3MGOA 4RMTA 5EO0B 1H0DA 3S96A 3RL2B 1FORL 3D3VA 3UROR 1HZHL 1JF1B 2OK0H 5TQ0H 1P1ZB 4I48B 1D5IH 1QBMH 2GTWA 2HT2D 4LL9A 5EOQH 3BEVA 4UQ3A 5EU5A 3SDDB 4X0KB 4DGIL 4LMQE 1EDQA 1UVQA 3FOMA 5A2KH 2D2OA 3MZGB 4KQ3H 4WY7H 3DO7B 1CLYH 3H8NA 1EGJH 2NX5A 1Q9WB 1RUMH 4LCUA 5T1DH 4M93B 5D5MF 3FCTB 4E0RA 2Z8VC 3IDXH 1W0VA 1TTGA 3CSYB 3RWEB 5LCVH 1G7HA 1WISA 4MSWB 3GFUA 4OI9A 4LSSH 3TFKD 2YRZA 4RFNB 3VWJB 2AJUH 3EO0A 5DMIL 1T03L 3OR6A 1YZZA 3X3FH 3HTLX 1FZJA 3NBNA 1JGDA 5GS1B 1U3HB 2Y7QB 1ZLWK 3T65A 3BKYH 3TBYA 4I0KA 4NFCA 4KMLB 4ZFFB 3RDTC 3CSBA 3HLAA 4F8QA 2NR6D 4WO4D 3D85B 1JZ3A 1U8MB 4P57B 3QIWC 4HV8A 1YEJL 4KVCL 3VD4A 3TNMB 3G6JA 4OGZA 4Y1AD 3WXVL 4PLKC 2EZ0C 2APBA 1ROWA 5HY9A 3O3AA 2HP4A 3MRNB 1YMME 3TVMA 2ICCA 4JCLA 2ED7A 3QDJD 4XPGL 1VGKA 2V7NB 5C86A 4KZDH 5HYJB 1R0AL 2C7UA 5JO5B 5DVMA 1I1RA 5HYSA 1YY9D 5BS0D 2AJSH 1D5BB 5IW1A 2VAAB 4X9IA 4K94C 4YDKH 3ARGA 4QHUA 3SOBH 4ZTOL 4GW5B 3WIFB 3X14B 1RSFA 1A7OL 1IC7H 3GJEA 4JQIL 1EFXB 1NKRA 3HPJA 2FD6L 2OI9B 3UDWA 1VFAA 4KROD 1PY9A 5EU4A 4NRYB 4UNTA 1AGDB 4OFKA 3IDJA 3MV8A 4NQVA 1MCWW 1FZMB 4NO2A 4NBXB 1EEQA 4PJDF 4IMLA 2YUVA 1BZ7A 5AAMA 1LE5A 2EDWA 4JANA 5BVJB 5IMMB 2PN5A 5IB4A 3CJJA 4U1JA 1M71A 3VFGL 3RPKA 3MLUL 2A0LC 3O9WA 5DD1H 2IADB 1HH9A 1IGTB 5M94B 1HI6A 1O7SA 4U0QB 4FQLH 1OSZB 2YA2A 3HR5A 1L7IL 4PTTA 2DM3A 4I13B 1KTDB 3QSKB 4RBPK 3RA7H 3BP4B 4OD1H 1CDHA 4NNPL 2HT3D 4G5ZH 1FORH 2P5ED 1R5VA 3TCXA 4YPJA 3KDMB 1YMMB 5F6HI 2NW3A 1HZHH 2XA3A 1D5ZA 2AXGA 3PGDB 3PWJB 4KUCD 4ZO6A 2VAJA 4LDEB 2EYTA 2DWDA 1ZHBA 4JRYA 3RI5K 1VGEL 1BF2A 2H2PD 1U36A 4NKIH 4MCYB 4DGIH 1EA9C 4Z95L 4FMKA 3H0TB 1FV1A 1HH6B 1UXSB 2NY0B 4QYOB 5TGBA 1CGSH 1E6OH 4ZUVA 3ARSA 2PF6A 3VD7A 2OQJB 2GTZB 1JK8A 2V2TB 3LPGA 3QDGB 1F2XK 4TSAL 4XGZA 2FECI 4PRPA 5T1MB 4NPYB 4KAQL 1KTRL 3MLXL 2C3HA 2VZSA 3GB7B 2E5EA 2EC9U 2X7LA 3OGOE 2JB6A 4YBQC 5JHDD 5KSBE 5MEND 2AJ3A 1ETZB 3DGGA 4HWBL 3RL1A 3TBVB 2VL4A 3QIBB 5FECA 2H3NA 4LCCA 1FNFA 4U3CA 1WITA 1YEJH 4KVCH 5EU6D 1VEPA 1U9KA 3PWPD 4HKZA 3WXVH 4NN6B 1QRND 5FYJL 3SCMC 3DLQR 1XH3A 4LLMA 1KC5L 3UYRH 5IB3B 4XPGH 4PLNC 3G08A 2Q6WB 4KK9D 3B4NA 3O45A 1R0AH 5A2LH 1C5DA 2IH1B 4OCYL 4LGRB 1J10A 3E2HC 1Z0MA 4ZTOH 1VHPA 4BH8B 3UBXA 5DHVH 3VG9B 3RZCB 1T04B 2YSSB 3UTPD 4M61B 5TFSH 4JQIH 2PO6A 3IXAB 3ARBD 3D2UD 5DHVA 3MXWL 3ZE1F 2GHWB 4H5SA 3NABL 3OV6A 1JF6A 2GYSA 4J3XA 1C7SA 4P23D 3DX6A 4GAGL 1WBYA 4AIZB 4WU7A 3ZZ1A 1W8OA 5T5FL 1YYML 2X4PB 1XGRA 3VFGH 1FVCB 3MLUH 5D1XA 2VZUA 5EIQA 1S7VB 5IF0B 3G5ZA 3O4OC 2WZPD 3QAZB 4JM2C 3VDAA 4AT6B 3FONA 4OCWL 4XCCL 3BZFB 3Q3GA 5GRVL 4EUPG 1L7IH 5I9QB 4GAFB 1GYAA 1Y0LA 3FB8A 3UJIH 4FABH 4K2UL 4W6XB 4K07A 3P73A 3IDIB 5ISZB 2VZOA 4OFVA 3DROB 3ZT6A 4NNPH 3LMJL 5HPMA 2NTSP 4POZC 3V8CA 3TBTA 5ICXA 1NKOA 1YQ2A 4RAUA 4PB9L 1AGBB 1VGEH 1DVFD 1DQMH 3T1FA 4LHUA 4K3JL 1T5WB 2IPUG 5IQ7L 4PTUB 2GCYA 2VZ1A 4MD5B 2X9YA 5FAAA 1QYGL 1DANT 3B3IA 5JMOC 3C5ZD 5JZ7D 1E6JL 5CZKA 5FYJU 1K2DB 2ZUXA 4LVOC 3CFBA 1JMXA 3PL6D 4GKSB 2AAVA 3FOLA 2RFXA 3OAZK 2QKIB 4TSAH 3CZJA 1F4HA 1ORQA 4ODVL 4DQOL 4KK8D 4EN3A 1ZA3B 1P4BL 4KAQH 2CQVA 3MLXH 4WUUE 1N6QL 1MFAL 4PGEB 1T7YA 3A67L 4HWBH 4JGUA 1I8IB 1JI2A 5ID1A 2IAMA 2EIDA 5DJ2A 5JNYA 4LLQB 1IQWL 1PJ9A 3BD4A 4K9EC 2VXUL 3CU1A 4LVHB 4HS6B 5FYJH 4NRZA 1CBVL 1WAAA 3F12A 4KK5C 4N8VA 1RZGA 1DBMH 4NC1E 4JFEA 1GRWA 1KC5H 4LLWB 4LPXA 5HYQA 3VDCA 2JTDA 5HHOA 4N90D 2YHGA 5CKAA 4EXPX 1JUFA 3MV7D 3WFHB 1QHPA 1UYWL 1T0NB 1IGJB 4OCYH 4MAYA 1FIGL 15C8L 1IC1A 5EWIL 3SDYH 3JWDH 4GW4A 3O6FA 1SVCP 4Y4KB 1T4KA 4JHWL 5ITFB 3LDBC 5ERWB 1G7JA 3DECA 2Q8AH 2A6JA 3NABH 2MFNA 2BVQA 3CCHA 3L3IA 4KK6C 3MLPA 4PJ8D 1D6EB 3H9SB 3FJTA 4Z77A 3KPRE 1OAZH 2R2CA 3QEQD 4GAGH 2GJ6A 2NY3C 4GOSA 4DGVL 1AFVL 3DV6A 3UTSE 4TTGA 4RMWA 4IDJL 5T5FH 4F3FB 3HMXL 4GRLC 2DWEA 5KS9A 5L8KB 1BZ9A 3HE6A 3FQTB 4OZHA 2CO7B 1BHGA 2W59A 4OCWH 4XCCH 3V0VB 2IBZX 3MBXL 2WBJA 3STZB 5BZDB 1JZ6A 5E4EB 3GSRB 1J1PL 4WU5A 3M07A 4K2UH 2IJ0C 1XCQB 2DBJA 2GT9A 2PW1B 3LMJH 1KPUA 2E6QA 2G60L 5CP3H 1IKNA 4D9LL 4GG8A 5B8CC 2COQA 2VLJD 4BYHA 2BMKB 4PB9H 5CP3A 2XXMB 1Q9OB 5I73C 3MRMA 1O5DT 4K3JH 4G9FD 5IQ7H 1NANH 2UY6A 5CBAA 1P84K 3OB0K 1UXWB 5DR5L 1QYGH 3FT2A 4O2EA 2AXJA 1F8TL 1E6JH 3G5VA 3PGFL 3ZSSA 4NN5C 5DFWH 2VDRL 2W65A 3NN8A 4IRJB 1FYHB 3MRJB 1A4KA 2F19L 5L2KB 1F2QA 3RTQC 2EKJA 4GS7B 1LDSA 2PYFB 1DQQB 1XF4A 5J11C 3OR7B 2X4OB 3W9DB 3QO1A 4Q74A 1P4BH 4G8IB 3WFDH 4XNXL 5B39B 4XPBL 3X11B 4NQED 4XX1E 2X4TA 4U6XA 3KPRB 2FJFB 4U1SB 2W92A 3A67H 1PG7X 2EDLA 3LRSA 3TYGL 3UTSB 3ALXA 3HAEG 4JFYB 2XWBB 2ZUYA 1Q9KB 1IQWH 1N6UA 1WZMA 2AXHA 2L0DA 5HGGS 4Q9BA 1I1YA 4JRXB 1Z5LB 3RQ3A 2RBLA 1CBVH 4P3DA 5DZLA 1FG2B 1J8HD 1G9NH 1KT2A 5CJXC 2ZOLA 1MHEB 2F54A 2ICES 4XWGL 4NC1C 1WFOA 1HSBB 5A16A 2M8XA 4ISVA 4OUUB 1AJ7L 4MZ3A 4K7PX 4OLZL 4XCYB 4ZXBA 1UYWH 3WS6C 1Q0YH 4NHUB 4PV9A 1E4KC 15C8H 3V4VH 4DUXA 1HSAA 5EWIH 3E0GA 4JFOB 1QQDA 3O2WL 4JHWH 5BRZB 4K23L 3VGAB 4MAUL 5JPMA 2H9GA 4O51B 4QRQB 1WWCA 5C0DB 4HPOL 3MFGB 2Z8SA 1PYWA 1NGQL 4L3AA 3PWNB 2H32B 2BNQB 1S9VA 1I7UB 4DGVH 1AFVH 1MCEA 1YPZB 2PO6D 2FL5A 3L3JA 5K9QI 3GIZL 1F4XL 3FTGB 1N59A 1JV5B 3HMXH 5IEHB 3S37L 4FRWA 4R2GD 4L3EE 3HMXA 1UZ8A 2VWEE 2BJMH 2VLKD 5GJSH 3QJFA 5GHWL 3MBXH 2Q3ZA 4GKNA 5H94A 1CFNB 1J1PH 4Z7WE 5E1AA 4UILL 4EQ3A 3DIFB 5BW7A 5J8OA 4PJCA 3HE7B 5DA4A 3RY5A 1GGIL 2DM4A 3ZTJH 4P5TC 5F9OL 2G60H 4D9LH 4NM4L 3W81A 5I1AA 4NWTL 4P5KB 5E5MB 3TYFB 1KIUA 4AENA 1T2XA 4OZFH 4XBPA 4Y16B 4LIQE 2J6EH 3OL2A 1B0RB 4QCIB 3BN9D 2BCKA 3UJTH 2W0FA 2RCSL 3O41A 4YC2C 1S7WB 2VDRH 2F19H 2J2ZA 2EDBA 3C8KB 5E95B 4C56A 1BEYL 4LF3B 3D0VA 1OLLA 3RRQA 2ADIB 2DBLL 4XNXH 5EUKB 4HK3N 3PV6A 3QUMB 4X6DA 1PZUB 3GNML 5F7MC 3TH3T 3TYGH 1KTKE 4FZ8L 3BHBA 1DE4A 1EFQA 2I9TB 1MFDL 4XCNB 2E7LC 4G7YL 5B4MC 1Q9LA 1RJYB 1LEKB 4ZNCD 5B3NA 3VFUB 4L3EB 3RWIB 1VKXA 2Z31D 1NCCH 3CH8A 3GMRB 1IAII 2MCPL 3UZQA 4P2OB 4EEEA 4U1KB 4HGWB 4Y2DC 5F7WC 1HXYA 3IXTB 2IAMD 3CK0L 3GBNH 4OLZH 1B4RA 4U1MA 4U2YA 2CH8A 4JFPA 2MOVA 4QRRE 3B5GA 3O3DB 2DQTL 1UFUA 1BVKB 4JLRB 1CE6A 3O2WH 3O8XC 4MA7H 3WO3B 5J0BA 5IFHL 5HGAA 4MAUH 3QCUH 4NC0B 3WNOA 3PWUA 2IFFL 2DIJA 2Q76B 2NYYC 1NJ9B 2VO5A 3BH8B 3HI1B 5IB1A 3I6KA 4ZFGH 3R06A 4OFYA 2PTTB 1RZKH 5JR1L 5DZNA 1ODAA 1MVUB 1EAPA 4XRCB 3RGVD 3GIZH 3RKDD 1F4XH 5EC2B 2BNRA 4MA3A 3S37H 5C8JB 1WBXA 3DURA 4HG4K 2MKWA 5D71H 3EGSB 5GRYA 3HI5L 2AS5M 2WLYA 5GHWH 4HX1A 5I74B 3T3PE 3AFLA 2VWEC 1JPGB 3RPIA 4Z0XA 4LHQB 1CFSB 1FN4A 3L3KB 4U4BA 1UWXH 3RUGB 4UILH 2WNGA 3N0PB 4Q58C 3TIEB 5MEQA 5F71A 5F88B 1QFWL 3KPSE 2PCPA 5HVHC 1RVFL 4NM4H 2DM2A 4Y4HA 5F1OB 1S8DA 1E4WL 1A14H 4K3GA 5KG9B 3RL2A 3RVXD 3KXFE 3SBWA 3FQUA 3MR9A 1YECL 4XVJL 3U48A 1BIHA 2IMMA 4H25B 3B6SB 2YUZA 4Y5YB 3C6LC 1TNNA 1TETL 1LNUB 2L7JA 4H0IA 3T0ED 4UIMB 5EZIL 1BBJB 1S7TA 3QA3A 4JZNA 1BEYH 1OOAA 4KTYA 4NO5A 1IEAA 1RJCA 2DBLH 3ARZA 3RWEA 3L6FB 3H9YA 3WNPA 1HCFX 4TRPL 3GNMH 3NAAH 4GKOA 3KJ4B 4JO4L 2C9AA 3BWUC 4FZ8H 1JBJA 1MFDH 3QI9A 4G7YH 3ZMRA 4NKMB 3JTTB 1ZT1A 3N1MC 4FQPA 4CGTA 3AMLA 3UTTB 2NQCA 1CICB 2MCPH 2O93L 5LGHL 1OAUH 1FLTX 3CK0H 4UZGA 4MLSA 4NUJA 3V6BR 2YPVL 2MMXA 4AH2B 2R0WH 4DZ8A 1UH3A 4O58L 5EORL 3KPSB 2ADJA 1I9IL 1PEWA 1ZOXA 4KMTL 2DQTH 1Y6NR 2NPLX 4LOUD 1RPQA 5IFHH 4W6YB 1NC4A 2WWKO 3KXFB 3K1KC 2JELL 3MRCB 1JPSL 2IFFH 1L9NA 2HLAB 1JWUB 2CK0L 4LCIL 4Z7WF 1XF1A 3LEYH 3NIFF 3S36L 5SV4A 5GZOD 2B20A 2FJHA 5IW6A 4OT1L 1BJ1J 2NTFB 4LSUL 5FUCE 5JR1H 3WN5A 3S7GA 4PRNA 4OF7A 3UX9B 3O3BB 4RQQA 3UTZB 4QRPD 1WIPA 3PIQB 1P5UA 1Z9SA 2Y5TA 3WE6B 2YPKA 3TA3A 1F00I 2K9UA 3HI5H 3VFWA 1YEGL 2C1PA 4UBDC 3QUZC 1GOHA 4FTVD 1TPXB 3U36A 2OMBA 4M48L 4IJ3C 2ZCHL 3ZT7A 1EJ6A 5FK9A 1QFWH 1YEIH 5DVLA 4QHNB 4F15C 1RVFH 4GBXC 4WHDA 1E4WH 4P2YA 4LVNC 5AD0B 4B41A 4R7DB 1YECH 4XVJH 1T66D 5FO9A 1R3KA 3VFTB 3IVKA 4NQDD 4RX4D 3IETB 5E8PA 4X5LA 3P9MA 2CLVB 4WI7A 1TETH 3CDGA 4MJIE 2WIMA 5FB8B 4OAWB 2NLJA 3IKKA 1MCFA 2FHFA 2IGFH 3DMMA 3HRZB 1D5XA 5J1AA 4QHKI 2V2TA 3N1PC 4XXDB 3QDGA 4N0CD 1LDPL 4TRPH 4HJJL 4X7CC 3VFSA 4KMQA 5I2IA 4NPYA 3PG2A 5ELIA 5C0BD 3GB7A 1H3WM 4G7VL 4YXHL 1YJDL 3VFVB 4XNMA 4OKVA 3QIBA 1RZ8A 5LGHH 2R69L 4OZIE 1V3KA 4G8GE 4HUMB 2DMKA 2BZDA 5BZWB 1U95B 4L29A 1KNOB 3MJ6A 5IEKA 4PY8I 4ZAKA 4O58H 1Q1JL 5EORH 2VLRA 1I9IH 2R0ZL 3LN4A 3CFKA 5DJZB 3DARA 4ZG1A 1JTTA 5HDOA 1KLGB 5H37H 4LVEA 4YAQA 4QXGL 1NUNB 3T3PF 5C08D 4EBQH 1NBZA 1DTUA 2X4UB 4LCIH 4BH8A 2VUOA 3RY6A 3T4AA 1BLNB 2NY1B 3RZCA 3S36H 5D7JA 2ERJB 4FQHB 3BP7A 1TJIL 4FQXB 3VXTA 3MYZA 4RFEB 4OT1H 4LSUH 4M7JL 3TT3L 2GW5A 32C2B 4HIHA 5IHZA 5FUCC 4BK5A 1CN4A 3LV3B 1EBAA 1DDHB 4PJEB 3L3GB 5GGTL 5GIRB 3NFNA 5F9AC 5F9DC 4P3WA 1YEGH 1HQRB 2F8VA 3BPNC 5B39G 1MLCA 2BXZA 3IGAA 5ITBH 4PPTA 5FHAL 4Q9CA 3OX8B 1EHAA 3I75A 4M48H 4L9LA 5GISH 5HHME 1KJVB 3QRGH 1NBVL 4U05A 2PYEA 3FL7A 1K5NB 1XZ0A 3VXRB 3ULUE 3LKOB 5I1HL 1VFMA 5ISZA 1NLBL 3KYAA 1CD0A 2F5AL 5DEGB 4Q6YA 4LSPL 3L3OA 2Z8WC 3L3DA 4U1LB 1CDIA 3OKOA 5IFJB 1P5VA 3O81A 2G5BB 3BO8A 2F74B 2D0FA 3EKCA 4JFFA 3TBWA 1D9KB 5GRVK 1U6AL 4HT1L 3OHXB 4BKLA 5DYOB 3KR3L 5EUOA 1UKQA 3VXUE 1IGYA 2CIIA 4O9HL 1HXMB 1MY5A 1WWBX 3DUSA 4HZLB 3MOBL 5GSRA 3SDDD 4QY8A 1LDPH 2ZUQB 1BFVL 4HJJH 4NRXA 4JKKA 2G9HA 5J12C 1U2HA 1UM6L 1P6FA 4HGKC 1U3YA 4G7VH 1YJDH 1I8IA 3BUYA 3UP1A 1U58B 2R69H 3VWJD 3VI4E 1FL3B 5J1TC 2ITDB 1FNSH 1RK0B 2YC1A 1UT9A 4XX1G 3FB5A 1WFUA 2AV7B 3K0WA 3F58L 3BQUC 1U3HD 1DSFL 1NCAL 5HHMB 3MBEB 3L7FA 4D0DA 3K3QA 1Q1JH 2FATL 3IFLL 1NANI 1EZVY 2EE6A 5HYEA 2R0ZH 4Z9KB 4R7NA 3U30B 5IM7A 2A0LD 4NIKB 3D85D 2ZOKB 5K93A 2HVKB 3U79A 4Y19E 4PJFA 4Q9QL 5INCB 3ZKXB 1JYVA 3IYLW 1A1MB 4XP6L 1EEZA 2R8SL 1E4JA 4CVUA 1YC8A 1INQB 2IH3B 5DZOA 5ADOL 5D1QA 4BQCA 5HYJD 1E4XH 1TJIH 1EERB 4FHBD 5DURB 2DQFA 2YPLE 3MNWB 3TT3H 1PEZA 4HF5H 2G5RA 2DQUL 1D6EA 5E8NA 1ONQB 1EO8L 2R4SL 1LGVA 5KZCB 2WIIB 3EOBA 4ZOBA 5FGCE 5GGTH 1EFXD 5E9DB 2C1OB 1OF2B 3NCYS 3QIUC 3RVVD 5GGTA 5DVKA 3PP3H 5DS8B 3TM6A 1NH6A 5FHAH 4WGVB 4BZYA 5DJDB 2VKWA 2HRPL 3HPLA 1V7NH 5J6GA 3VG0H 3STZA 3HMWL 4U1NB 3GSRA 4G9DB 1RIHL 1BZQK 1GC1H 3KPQB 3BYTA 4XBEL 1KEGL 2C4FT 1RJZA 2F5AH 3ULUC 4YBQD 5DHYB 1XCQA 3C5SB 5GSVA 3MRKA 1AH1A 4LSPH 4K8RD 3FN0L 2QV2A 2YEZA 3TESA 3ZKXC 3OXSA 1S5HA 4YIQB 1FPTH 4MQ7B 4FG6D 4NYLB 5INDA 1MREL 4J4PA 1QKZL 4OZIF 1VERA 5E6IB 4L8BA 1U6AH 4HT1H 1YMMD 2LU7A 5J9PA 3KR3H 2AXFB 4OCMC 4CVXB 4O9HH 3E6HB 5L2KA 3FO9A 1IGIH 1HDMB 1OAXL 3MOBH 3OKMA 2X42A 3KPOB 3VXQA 1BFVH 2YPLB 1I3RB 4YPGA 2VL5B 3SKOA 5JPNB 2IBBA 3CFCL 3PGCA 5DRXB 3REVB 3WEXB 1BVLB 1UM6H 2C3VB 3QB7C 5IVZB 5C7XL 3QDGD 2DLEA 1Q9KA 1UEMA 4NOBA 1MJJA 4R0LB 3MCG1 1CFVL 2GJJA 4LLUB 3QFJA 2HA1A 1F3RB 4F9LA 2J4WL 3F58H 3P3YA 3IFPB 1NCAH 5AZEL 4X9BA 1BWWA 3IT8D 2FATH 3IFLH 3FHQA 2XQYK 1Z9LA 3QIBD 3SJVE 4P46C 1DANU 4LHJB 3BAEL 1PGRB 1T0PB 2E8YA 1BQHA 4XCYA 1ITCA 1KCUL 3VFPB 1F4YL 4XP6H 1S7SA 3EJZC 4MQXC 3O4LA 2R8SH 3GSXA 3BPCA 2ENYA 1AE6L 3KWWA 4OGAC 4DGYL 4LKXB 1VFOA 4P4KB 3MRLA 3OXRB 3QFDA 4HJ0C 4QRQA 4V1DE 2MWCA 3DHMA 3MV9E 1K8IA 4GRMB 4MNHA 4ZUTA 3QUXB 1I7TA 2APXA 3PQYA 2DQUH 2M1KA 1OQXA 2R4SH 4Z7UE 4UUJA 3RZCD 1NDMB 5FIEA 5MHSE 4MWFB 2GK0A 4DKDC 1OAQL 1J9CT 1NFDA 4J6RL 5HI3C 1AD9A 1CIDA 3GSWA 1QBLL 1NAMB 3VFNA 4R0LC 4KRMB 1X5JA 1FG9C 5HHVL 2KUTA 4RGOH 5DJ8B 4YDJB 3TZVA 3IJYA 1GL4B 4TNWK 3IU4L 1R5IA 3HMWH 2DQGH 4YK4C 1RIHH 1S7UB 3LD8C 3HE7A 1KEGH 1LO0L 3KYNB 3I02B 3FN0H 5HVWA 5FGBC 4NQCE 5F1NA 4H1LH 1KBGL 5I71C 1SJVA 3SJVB 3RHWF 3B2UC 5ESVB 1HHHA 3W2DL 4DJMA 1G7PB 3BPOB 5D1ZB 1YNTB 1RUAL 3FRPG 1XGUB 5ISZD 1QTYT 1MREH 1QKZH 3VI4F 5EBWB 4FFYL 1FH5L 2W9DH 1X5IA 2YKLL 4JPVL 1QBBA 3CC5B 1UWXK 3MZTA 1YC7A 4OZ4A 1ZVSB 5ALBL 2OR9H 3QWOA 5HI4D 4YFEA 4I9WE 1OAXH 1HQ4B 3MV9B 3H9HA 3QXDA 2OSLB 4P5MB 5EIVA 4W70A 1A7PH 5C07A 3LKQB 4CJ0A 1G7QB 3C60A 5E6YA 3CFCH 3SKNA 4Z7UB 3SO3C 5C7XH 1G1CA 5E99H 1RZ7L 2EICA 4I0PC 4UINL 2VXTL 3X12A 4K7FB 5F9WB 4DZBB 3LN9A 5CZXD 2A38A 4IRSA 1HILA 1OTSD 1CFVH 3FRUA 2EEDA 1BIIB 1SYSA 1J0YA 5L88L 3IDGA 3ES6A 4IS6B 1CT8A 3RWHA 5K9OA 3BAEH 1GOGA 1CDYA 1F4YH 3QCTL 2G2RA 3NIGE 4NQCB 5A1AA 3Q5TA 3QNYA 1AE6H 4DGYH 1HHGA 1FNLA 4LAJH 2P8LA 4WI5A 4QHMA 1FVEB 2EDTA 4MX7A 4E41A 3NA9L 1P53A 2DF3A 3ULVE 4Y4KD 4IIQC 1FNEA 1K4DA 1QEWB 3HUJE 3MREA 2ZWLT 3KS0H 4QGTA 1OAQH 1SYVB 4XVSH 3MJ9L 4HUNB 1I1AA 4J1UB 3BZEA 1AHWB 1SJEA 2F53E 4OCNC 1IQDA 3FFCA 3GSOB 4O02L 5HHVH 3H9SD 4WJ5B 5I76B 3TO4B 3IU4H 1M7IA 5I1LB 3C09C 5EIIA 5CJBA 4HIJA 5TF0A 3CH1B 1QO3A 3PDOA 5D7KE 4NNYA 3MV01 2AV1B 1KBGH 4XPHL 5HHXL 2DMBA 1A6ZA 3AXLB 4QXTB 1RUAH 1Z9MA 2QSVA 2X4RB 4CVZA 4ZD3L 2JJWA 4FFYH 1T21A 5DJCB 2F58L 3MLSL 4YDIL 1UGNA 3B6SA 3RVUC 3K2MC 4P9HC 3QQ9C 2ZPKL 1BD2E 2JLLA 2FGZA 2OL3L 3F5WA 1IILE 1MRCL 1TDQA 2Q7YB 1FIEA 1LILA 3JWDC 2AJZA 2OM5A 1AR1C 1P7KA 3RIAF 1V5JA 5DJAA 1SBSH 3T09A 3VXME 1A21A 1AHWC 2FIKB 5CHNA 2N7BA 1SJHB 5EA0L 4IRJD 3HUJB 3EYOA 5L2KD 1RZ7H 3BP6B 3TNNB 4UINH 3GRWL 5E8DL 4NQXB 4APQB 4AG4L 1KYOJ 1DJSA 4WDIA 1A9BB 3NCEB 4F7CB 1ZGLB 3EYQC 1VSCA 3D69B 2WBKA 3MMEA 3KPRD 5L88H 4JY4A 3R0MA 5ADPL 3O3EB 1CFQB 4Z7UF 3UTSD 4HKXB 4X6CA 4Q6IB 5JXAL 4AH2A 4XAKD 4UT7L 1X5LA 4PJ9B 1JHKH 5IQ9B 2HYMA 2HVJB 4JRXD 3AU1B 2IQAB 4MVBC 4JKWA 1OP9A 1M7DB 3AB0B 4G8FB 1IAKB 4LCWA 4PP2A 1IL1B 5GGUB 1FFQA 2DYPA 1ED3B 2X05A 4OFPA 2EE3A 1RZJC 1VPOL 3KGRA 3VCLA 3VU2A 5IB5B 4L4VE 1QFHA 3NA9H 3VGGA 2HT4C 3MUY1 4H0HB 4F9PC 1FVDB 2P49B 4PJ5E 3V6FB 5FFLA 3ULVC 5FGSA 5BRZD 4ONOA 3VH8B 4BZ1L 4RCAA 5ESAA 8FABA 1HIML 4RDQF 1K8DA 3UTZA 2HLFC 3B9KB 1JRHI 4NN7B 1FO0A 4WENB 3VXMB 4NNXA 4HLZG 7CGTA 1G84A 3MJ9A 4P2QE 1DL7H 3BXNB 4O02H 2BNQD 1FDLH 5SWZA 1C16A 2DLTA 1CGYA 2XNAB 2DJ4A 3QH3B 3PNWA 5FF6B 1U8PA 3GJFH 1A4JA 1J88A 3KVQA 1CVRA 1J18A 4LLDB 4N0UA 3TLRA 2XV6B 2HFFB 3SDCA 5T3ZE 1U91A 4NKDB 5CP7A 1JHTB 3VWKC 1CXLA 4I1NB 4ETYA 1XAUA 2NCMA 4XPHH 5HHXH 1GGUA 1G9NC 3QQ3B 2EDYA 3SY0B 4QOKB 1IAIM 1XIWA 1IE5A 3HE7D 4Y4FB 3BIAX 4NT6A 5CJOL 4CU7A 1E27B 2F58H 4YDIH 1B4JL 4PLJC 1QLEL 3RVWC 2ZPKH 1KIPA 1G6RL 3IKCA 5IKCB 2V7HB 4L8SA 2OL3H 1F3JA 1HWGB 1MRCH 2QR0B 4PJIE 1BFOA 3D1MC 1F58L 4Y16D 4F33A 5FB8A 1OP5H 1CFTA 2OL3A 4HWNA 4L4VB 2CDEB 1MI5E 2FIRT 3SE3A 1JCKA 2R1YA 4OLWL 3TPKA 4Q2ZA 5CD3A 1R3LB 2I5YL 4L5FL 4ZUUB 4G80B 4CUCA 1XF2B 4POUB 5EA0H 4U33A 2JB5L 4OM1L 2WINB 3OSKA 4H88H 3NIGF 3I6LE 5DSCB 5D9SA 2L4OA 3MRBB 3QJHB 5A3ID 4K55A 5IMOA 4B53A 3LKNA 5E8DH 3MYJB 5SWQB 4FQJL 2CR6A 3GRWA 3VFVA 3GGWB 3GM0A 1ZHLB 4WHTB 4P2QB 3BWAB 3GSUA 2FEEI 2IWGA 3PWLA 5HJ3A 2ZCKH 4KRNA 4LP5A 3E1F1 3OGCB 3ULVF 1MF2L 1KJMA 5ADPH 5D2LA 1T22B 2VR5A 4ZPTB 3HUJF 2VXVL 1YN6A 1AGCA 2QADC 5CEZE 4L4TB 2AJXH 1BMGA 3NOIA 5ID0A 2A83B 4L3ED 1QSFA 4I8DA 4GRWB 3V0WL 4P2OD 3VRLE 4IDLA 1DQTA 1RFDL 1VPOH 2X70A 2EYRB 1YNKL 3DETC 3KLAA 5D7LA 3VJ6A 1WTLA 4Y5VC 3DX7B 3WJLA 1IM9B 4X6BB 2FO4B 4TPRH 5IIEA 4N9GB 4JFDA 4RFEA 4BFBD 3NCJL 3G5YB 2EECA 5EU3B 4BZ1H 1R5WA 1QSEB 5E5UB 4N68A 1DQJB 4W4OA 1HIMH 4IEFB 5IROC 5ICYB 3MRDA 4PJEA 1WCBB 2ZJSH 1EX0A 3QISA 5HYIA 3V0AC 4M5YL 4WFFE 1EV2E 3ARFB 5F96H 2JIXA 1OSPL 4BQ9A 3OF6D 4BFIB 1ZKAA 3E8UH 3SKJL 1KEML 4ONFL 4LSDA 3GO1L 5D6DA 4GW1B 4YUEH 1X9QA 3LKOA 2A77L 3I3EA 4HK3J 4K94L 3S35L 1NDGB 3WJJC 1Q72L 3H7BA 5C0CB 3S3PA 4YHYC 4TOYH 4UT9L 5CJOH 1E4XI 1A47A 1IVLA 3WHE1 2XPGB 1LP9E 1B4JH 1TFHA 1QLEH 5C0IB 3PP3K 1ZEAL 2VLME 1G6RH 2NY2B 4Y89A 5F1SA 4EDXB 2CK2A 5GZNC 5KSAB 2IEPA 1D9KA 1G6RA 4XVUC 2A73A 1NSNL 1F58H 3V4PL 2R0KH 5DJXA 5SWSA 2Y4SA 2AK4A 2D7MA 2DJUA 1I9RH 1QSVA 3ESUF 5HDQL 1VADB 2K3TA 3S37X 3G6AB 4I3RL 5CILH 2I5YH 3QPQD 1IBGL 4X5XA 2LVEA 4OM1H 2Q86B 1T0MB 5FGRA 1RZKC 4TUJB 3X13A 4FQJH 3KPNA 1CCZA 5AUMA 3T77B 1NEZA 1OB1B 1OGTB 4LDOB 1MF2H 2EXWD 2OP4L 4PS4H 3U9PL 1UA6H 2C4XA 2P5WA 3K46A 2ITDA 3VD5A 5IW3A 4IRZL 2NY6B 5KANG 3IRZA 3QNZA 1HK6A 2VXVH 5HHNB 4PJDA 4KKCD 3U6RA 2YZ8A 2X1OA 1NAKL 3BIKB 3FZUD 4X98A 3UTTD 1KB5B 2H26B 1CICD 4JFXB 3RBSA 3V0WH 3BH9A 4L9DA 1RFDH 5HDBE 4ELMA 2QTEA 4JJHA 1JNLL 2ESVB 1YNKH 4JZJB 3HAEH 2R2EB 5KSAC 3VGHA 2YD3A 5C0JB 1CXEA 3WL9B 2AQ1A 1LP9B 3KPSD 3P9LA 3G9VA 3QO0B 2MHAA 4H20L 3VFOB 3NCJH 1A3QA 5FDYA 4WW2A 4MJ5A 3CSPA 3CMGA 4E9LA 4A6YH 3MNWA 2BHYA 3GHBL 4KTDL 5JXEC 3OKKB 3KXFD 2OBGA 3D39A 3DUHA 3BMVA 3GBML 3AGVA 3G04B 4N8CL 3AAZB 3ARWA 4HULB 1DCLA 2L7UA 1ZMYA 3GI8L 4KKAD 3RDTA 4OV6F 4RGNB 3ULSB 3QDJE 1ZA6B 3TO2A 3QIWA 5BV7B 2YA0A 4R3SB 2HFEB 2FLBT 3STLA 5I1EH 5DS8A 2MPAH 4OGYL 2B1HL 3ARDC 4PJIF 5BS0E 5ESQB 5EPMB 2NY6C 2E6PA 2FR4A 3CVHL 2F5BL 1QHOA 3SKJH 2IPKA 4KY1H 1KEMH 3V79C 3SGDH 3RWJA 1OGAA 3GO1H 2V17L 5MEPB 4G9DA 3B8YA 1U8HB 2A77H 3RI5F 2J8UA 2ZNWA 3S35H 3LH2L 1FAKT 1RV6X 3C5SA 1Q72H 4EI5B 5K9JL 1A9EB 2FJGB 4UT9H 5IWLC 1EEUA 1H3XA 1OTUD 3C2SA 2VDPL 4GQ9L 1ZEAH 3I50H 1QSZA 5JW4N 1Q0XL 5H2BA 1A7QL 5CIPA 1HHIA 2H1PL 5F7EL 3QUYB 3WDJA 1NSNH 1U8KA 3V4PH 4IOIB 3V5KA 2HFTA 4ZOAA 1JPTL 1LK2A 1TQBB 4RDQG 5HDQH 4NSKB 4PGCA 4I3RH 4XB7A 4Z7QE 1JPFA 2GSGB 4MD4B 3IAGC 3MSPA 4G43B 1IBGH 3KPOA 3FB6A 1AGEB 3MLWH 3VRLF 2ZSWA 2EE9A 3ZHKA 5FKAA 5C0RL 5JPNA 1RIVL 4PJBB 4NO0A 2P5EE 4PRHA 4X9HA 2BY3A 1BVLA 3KYOA 2C3VA 1A6VH 1FSKB 2OMNA 3W0WA 5FYKL 3WUWA 5DRNB 3U9PH 3GMNB 5DUPH 4QF1A 2HT2C 4IRZH 4PGDB 3Q2CA 3F8UB 3I3BA 1XFPA 1TCMA 5DQJA 3SKUD 4C83B 1NAKH 4R90L 1LEIA 4JQVC 3S5LA 2X1XR 3CXDL 3BSZL 3QHTC 1MFCL 3MX0A 1S7QA 12E8L 2BVPB 3UYPA 3VFPA 1A7RH 3TFKC 5DK3A 5D7SL 3FQXA 3BDBA 5K9KA 1UEYA 1QNZH 2KBGA 5E5RB 5MENE 3QEUA 1TJGL 4U0RC 4H20H 1CD1B 2V2WA 1KULA 3RWGB 5LQBH 4E42B 3D87B 1AO7A 2ED9A 4TTDD 4KTDH 2NR6C 4WO4C 3IJSA 5EU6E 5DD0H 3PWPE 4Q0XL 4CNIA 4PJXE 3GBMH 5JUEL 3HI6H 4Y5XB 2NY1D 3U4EA 1NDMA 5IMLB 5F7FA 3GI8H 5JW4M 1KIQA 1WTGT 3VXNB 4K9EL 3VXOB 4RA0C 3CUPB 1UJ3C 2BOBA 1LP9F 4FQXD 5KN5B 1A6AA 4U2ZA 1CFBA 4JM4L 1F42A 4D0CB 4X8JB 2I27N 2B1HH 3SCMA 3E6FB 2F5BH 1YY9C 2NZ9D 2ORBL 4DEPB 5LGKA 4OLYL 1YQVL 5LKNA 3UTPE 2V17H 3CVHA 1QFOA 1S7UA 1B0GB 4UTBL 5C0AB 3GSNL 3LH2H 2A6KA 3QDMB 4KROC 1PX3A 3LKSB 5K9JH 3QXAA 4BA8A 2LTQB 4YFLI 3TBSB 3QWRA 3S36X 2D03H 4G8EB 5C6WH 1JVKA 4GQ9H 4PJAB 2CXGA 3VXRD 1MJ7H 1Q0XH 3EYFB 5HGDA 1TTUA 4PG9B 2OTPA 4JEGB 1YDPA 5FYKU 5F7EH 1I7ZB 3CFDB 1WZ1L 2R2HB 1WBZB 3F7PC 2FZ3B 1BREA 4OUOA 1UADC 1PZ5B 1OLZA 2APTA 4RGMC 5BJTA 4FXLA 1MCNA 2E9IA 3TN0B 3VXSE 2Q7NA 1WWWX 2QJDA 2OSLA 2GSIB 5HDBF 3VW3L 4QRTA 5C3LD 4Z18A 2CDGA 3V5DB 4PJXB 1RIVH 1OD7A 3AMKA 5C0RH 3SDAA 4JM2A 4KGJA 1NC2B 3VH8G 5IJKC 2HT3C 2C4FU 3U46B 1VDGA 1TLKA 4NC2B 2NZIA 3JV5A 3SO5A 1OVZA 2H2PC 1RK1A 2XWTB 1YA5A 3DXAA 2YZ1A 1XGQB 4NCC1 4I18B 4FXGB 2HKFH 3DV4B 2OX5A 3CXDH 2IQ9L 2AQ3A 3BSZH 3DTXB 1WF5A 4F7MA 1MFCH 4JPWH 5EULV 5EZJB 3O6ML 2JF1A 3T4YB 4JN2B 3IU3B 5T3XD 5I1JL 2B0SH 5I6XB 3DWTA 4QHLB 5HHMD 3MBED 1MIEL 3MRRB 4UAOB 4EKXA 2VR4A 3EDEA 3TPUB 1TJGH 3AREB 4X5WB 2PXYB 1K3IA 4HSQA 1ZANL 1P7QB 5IVXA 4ZPVB 4Q0XH 5EOCJ 5JUEH 4NM8L 2WBWB 4NQSB 1ZLUH 4Z7NE 5KSBA 4K9EH 2KZWA 2XFXA 4XP4H 3VXSB 5ANMB 4YR6B 4N90E 5DURD 5CMAB 4JM4H 1JYXA 4KK9C 3RKPA 1KGCE 4RWYL 2E9BA 2FRGP 3HC0A 5I76A 2OS7A 2P7TA 2RJMA 1S7XA 5KZCD 3BKCH 2ORBH 3UPAA 4OLYH 5E9DD 1YQVH 1U8NB 5FEBA 3MJ8A 2VE6B 4R4NC 5A2FA 1CDUA 4R96B 4Z7QF 1F90L 4R4BB 3UZEA 1MHHB 1JZ4A 3GSNH 3ARBC 3MGOB 1I3GL 1H0DB 3S96B 5SV3A 3D3VB 4RFOH 4J2XA 2Z91A 2APVA 4ODXA 1UKTA 2AV1A 4GQPH 2OZ4L 3ZKMC 3E3QE 4F57L 4KUCF 2FB4L 2EO9A 2GTWB 3BEVB 1UWEL 4UQ3B 5EU5B 5I8OH 4LBEA 2HN7A 3ILQD 3MV8E 1UVQB 2PXYC 4JDVA 3MRHA 3FOMB 4JFZL 2CUHA 2NX5B 5DTFA 3O6LL 4LCUB 4E0RB 1W0VB 1G7HB 3HKFA 1B90A 2R29H 3EJZD 4FS0A 4PJAF 4GRLA 4MQXD 4HH9A 1BECA 3EO0B 5E6ID 5TF1L 3VW3H 4ODUA 3OR6B 1FZJB 2VIRA 1QLFA 4N5ED 2VR9A 3VRJA 1ACYH 3T65B 3TBYB 5E00A 4OIAA 1GGCL 3HLAB 4LGPB 1VESA 2YPLD 4APQA 4G9FE 1DVFC 5D2NB 2GUOA 3G6JB 4RRPA 2OLDA 3ZYJA 5HY9B 3O3AB 5B8CA 4PJXF 3TVMB 1OP5K 4HKXA 3C5ZC 3NPSB 5JZ7C 1VGKB 2JJSC 2XZCL 3GK8H 1XF3A 2X10A 2IQ9H 1JN6A 3LQMA 4F37K 3QT2A 4WEMB 4ONGH 2C7UB 2GAZA 3AU1A 3PL6C 4CADA 3PABA 2NXYB 5SX5H 5I1JH 1M7DA 5TDPA 1GC1C 4G8FA 4EDWL 1JNNL 3GUTA 4KK8C 4NQEE 2ATPB 3ARGB 1T1XA 4QHUB 1MIEH 1GOFA 2WWMD 1HINL 1J7VR 3GJEB 3RTQA 3HPJB 5JIPA 2I24N 1VFAB 5EU4B 2G75A 4NQVB 3MV8B 1JZ7A 5E2TL 1ZANH 4ZQKA 3EFDL 4HUXA 4NO2B 4U31A 4KWUA 1H5BA 4NM8H 4MDJA 4IMLB 3B2UD 3N1GC 1BZ7B 4KC3B 3WMSA 4WUUA 2A6DA 4OIBA 4ZDHA 1LE5B 4KDTC 4NOFA 3LSOA 4ESKA 4P4KD 1JWMA 4XT1C 5DEZA 4I0CC 4LLAA 1NGZA 5IB4B 5KBNC 3VI3E 3QUXD 1M71B 3IJHA 4I5BA 3O9WB 3ECBB 4RWYH 3MA7B 1HH9B 2FECL 3K80A 1HI6B 2FLRT 1BOYA 4PUBH 5CJXA 4CAGA 1SY6H 1ZV5A 3HR5B 5LXGL 2DKSA 5MI0C 4RISL 4PTTB 2C3GA 1F90H 5DUMH 3DYMA 5EU7E 2NY5C 3WS6A 4WI3A 4OIIL 1I3GH 1GH7A 1E4KA 1R5VB 3PJSA 1D5ZB 1W72L 2OJZL 2OZ4H 2DQJL 2DWDB 2EYTB 1ZHBB 4JRYB 5C09A 2AP2A 2FB4H 3QQ3A 1OAYL 3RFZC 1UWEH 3E3QC 4J3VA 2QSCL 2ZG2A 1LO2L 1FV1B 5GRJL 1R24A 3QUML 4JFZH 4ZUVB 2AEWA 4PRIA 3O6LH 4G6AC 1JK8B 1AC0A 3P2TA 1SVZA 4O2FA 3SJVD 4Z7VA 3VGEA 1DFBL 4JHAL 1GSMA 5D1ZD 3U2SA 3KPLA 2JCCB 4TN9A 5E08L 4PRPB 5F6IC 5TF1H 1WFNA 1AY1H 2X4NA 5DQ9A 5DO2D 2JJTC 1MJ8L 2E3VA 1MCCA 5CUSL 1MIML 4ZNEA 2X7LB 2IBZY 2JB6B 1EUTA 4IOFD 1K9TA 2AJ3B 3DGGB 3MRBA 2FX8L 2XKSA 1GGCH 1L0XA 3MV9D 5FECB 2H3NB 4LCCB 4M4RA 4ENED 4P5TA 3BWAA 2CXKA 5KJRH 3ZSTA 3C9NA 3OGCA 1S3KL 1XH3B 4LSQH 4YQXL 5AAWA 4OQTA 4KU1A 1PLGH 2XZCH 1S9KC 4S1RL 4LIQL 4Z7NF 3EZJB 2ICWI 3O45B 1C5DB 2R23A 3ESVF 1FFNA 5DMKA 2V2XA 2J8OA 3QDHA 3EYUH 2DDQL 4N9OB 5C6PB 1U8OA 4ODWA 3UBXB 1KOAA 3BPLC 2J3SA 1HINH 2VQ1A 3VRIA 1J0ZA 1TMCB 3OKLA 5DHVB 4H5SB 5KW9L 2LU4A 1SEBA 2JKXA 3DX7A 5E2TH 4F80A 1IM9A 4HFWA 4DTGL 3EFDH 2PKDA 2ATKA 4WUKL 3OJDA 4NQCD 3DX6B 5I30L 4M6NL 2DI7A 4ZMAT 1WBYB 2X89D 5GGSA 5EU3A 2HMID 4XHJD 4ZFOA 5DGQA 3OZ9L 4WU7B 1FYTB 4L1HA 1DQJA 1XGRB 3NFPA 2E7LA 4M8VA 3U0PA 2QQNL 3QQ9D 4X6FA 5AZ2L 5D1XB 3SN6N 3G5ZB 1WCBA 3R8BB 4CMHC 4Y7MA 5GS0D 1J1XL 1KXTB 3FONB 1TENA 4Y2DA 4JFEE 3Q3GB 3ARFA 5LXGH 4RISH 1TZGL 1WZKA 1UCBL 4I9WD 4X6EA 5HHOE 1Y0LB 3FB8B 4K7PY 2R0LL 3IS1X 3HZVA 3P73B 5EOTA 5I66A 1FCCA 2XQBL 5DFVD 4Z5RA 4OIIH 1BQSA 1P84J 4DCQA 4Q9RL 4WNQB 5HPMB 4BQ8A 2BK8A 2MQCA 3TO4D 2M26A 3O8XA 5IVOA 5ICXB 3TBTB 4HEME 4RAUB 1W72A 4CJ1A 1OAYH 3T1FB 4FZEL 4LHUB 2DTMH 5IOPA 1KLUA 2PO6C 2QSCH 4YHOH 1LO2H 2GCYB 1LO4L 3QUMH 3B3IB 4NZDA 4EDXA 1F5WA 3FQRA 3NCYP 4R2GC 3WSQH 3CFBB 2GJ6E 2XY1A 1DFBH 1J87A 3FOLB 2RFXB 5F1IA 3WO4B 5T33L 1MRDL 1ORQB 1M6OB 2ILLA 5E08H 4GMTL 4EN3B 2GFBA 4BELD 3R1GL 1MNUH 3UO1L 5BXFA 3ARPA 2GIYA 1MIMH 1U8JA 4OZHE 4CW1A 4AIXA 4NWUL 1WCQA 1FE8L 3MROA 2FX8H 5ECJE 5ID1B 1JGUL 5DJ2B 3OKNA 4UDUA 1F11A 5F9JA 5JNYB 1YEEL 4OLEA 1WC7A 3EYVA 4HIXL 2HT4D 3C8DA 1HYSD 4J8RA 3UAJD 3M45A 2CKBL 4XNYL 1PVHA 4NRZB 3O2DH 3F12B 4N8VB 3T0BA 1RZGB 1YEDA 4JFEB 3BN9C 3ZT5A 5HYQB 3ARYA 3T0EE 4S1RH 1U41A 5HHOB 4LIQH 1ZT7A 5HHNA 5HVFB 1JUFB 1U8QB 3NZ8A 4PB0H 3DVGB 3VI3F 4MAYB 3P9WB 4JFQA 5GGVY 2DDQH 1G7IA 3QULA 3C6LA 4JFXA 4GW4B 4P2RA 3O6FB 3WDIA 1RIUH 5M7QA 1T4KB 3EIFA 1UWGL 4PJ9D 1R6VA 1G7JB 3B2VL 2A6JB 5KW9H 3SGJC 4X7FC 2BVQB 3CCHB 3ILPA 3L3IB 1PAMA 3FB7A 5D7KD 1BP3B 4WUKH 5I30H 5DJYA 4TUOA 4Z77B 4U7SA 4M62L 2IALA 2Z31C 2GJ6B 3EYSL 3OZ9H 4CKVX 5I17A 3DV6B 4XH2A 4NFBA 2KQMA 1CXHA 5D93C 2IAMC 1C5BL 5DD3L 2QQNH 5AZ2H 2DWEB 5KS9B 1BZ9B 2QQQA 5LGJA 3HE6B 2AJVL 2EEBA 2Q8BL 4OZHB 4DK6A 3CU7A 1WIOA 1J1XH 4LAQL 1OD9A 5D70H 2F54E 4CN1A 5CGMA 2WBJB 1UCBH 4TULL 4HC1H 3DYPA 1H3GA 2R0LH 4WU5B 5IBTL 3B9KD 2YWZA 2XQBH 2YRLA 5C71A 3VXMD 5C92A 4YFLF 3ROLA 4HBCL 2GT9B 3RIFF 4NO3A 1KPUB 4Q9RH 1ZT4A 2M2DA 2AW2A 4GG8B 1CLZL 4S2SA 1MRFH 3GMQA 4FZEH 3MRMB 5T1KA 4EI5A 3BI9X 1A6TA 1DQDL 4HKBA 5CBAB 2O5YH 4WFHD 3ARVA 5DK0A 4PIRF 3RGVC 1T83C 3RKDC 1S7RA 3QZWA 5DLML 3FT2B 1HEZA 3LN5A 4O2EB 4PBWD 3G5VB 2W65B 3NN8B 2VN4A 1ORSA 1A4KB 1F3DH 5DD6A 4QOKD 3HNSL 4FTVE 4JREB 5T33H 1L0QA 1MRDH 4Y4FD 1CDJA 5LBSL 1XF4B 4GMTH 3QO1B 3LEXA 5GRUH 3UO1H 2X4TB 2XTJB 4U6XB 4YHZL 1P7HL 1X5AA 3QUZA 3LRSB 2UV3A 1JGUH 2HFGH 1WK0A 5JOPD 4G6KL 1YEEH 4M1GH 4JJ5A 4L4VD 5FA4A 1I1YB 4PJCE 5MP6L 5F70A 4CBPA 3RVXC 2CKBH 4XNYH 4NQDE 4P3DB 3JV4A 5HGBA 1KT2B 4GBXA 5EO9B 3TH4T 2D3VA 2R9HD 2ZOLB 3GMNA 2F54B 1NCBL 1TZHA 5L7XH 5A16B 1NFKA 3T0EC 4ISVB 4QXUL 1K85A 4RIRA 3O6KL 4P2QD 4PV9B 1HSAB 2JK5A 1IGFL 3OG6B 4OLUL 5IBUB 1QQDB 3DRTA 1UWGH 2BVPA 5D7IA 1BPVA 4C54A 5JPMB 2H9GB 3B2VH 5DA0B 1LE9A 4C56E 4L4TD 3MODL 3M8OL 5E2JA 1FLRL 5T3ZD 1P4LA 5ALCL 4YHKH 1L9MA 1SJXA 2W9LA 4C55A 1S9VB 4DOHE 2HAZA 4X6DE 4M62H 3EYSH 3B9DA 5IHLB 4S0SD 2FL5B 4UV4H 3L3JB 5D96B 1C5BH 5DD3H 3S3JA 3VXOA 1CU4H 2AJVH 4I4WA 4BFEA 3U7AA 1UZ8B 4LAQH 4XCFL 4GKNB 2VABA 1ZE3C 35C8L 4TULH 1IEBB 1QSED 4M9PA 5H94B 3R8QA 3MLTA 2ADFL 4DVRH 5I8EB 4LOUC 5E1AB 4K3DL 4PJCB 4J3WA 1FJ1A 5IBLD 4ZXBC 2GK2A 1KF9B 1ADQL 3I6LD 1VENA 4K3HA 3ARFD 5ILTL 2XWJA 4OZHF 1KJ2A 5I1AB 1CLZH 1IAIL 4AENB 4JPIA 5GZOC 1TQCB 3QDMA 1ZLUK 4XBPB 1DQDH 5DVOA 4R97B 4FFZL 1QOKA 1GJIA 2IFGA 2OK0L 4JKMA 5JORA 1MCOL 4BH7A 2BCKB 1E0OB 5DLMH 2W0FB 3O41B 2R2BA 3EYFA 5HYSG 4PG9A 2VUYA 2WQ8A 1G9MH 4D0BA 5FO7A 4ZS6D 3HNSH 3IAQA 3CGTA 4WY7L 5C0CD 1VACB 4C56B 1GAFH 5LBSH 3D0VB 5T1DL 2BNRE 4F7PA 3I6GA 5LCVL 3PV6B 2NY2D 3VFMB 4DOHB 3U0TA 4YHZH 2GSIA 4MMZC 3ABZA 5KSAD 4HLJA 1R3JA 1FP5A 4YXKL 2ITCA 4G6KH 1PQZB 1DE4B 3BHBB 5GRZA 1IT9L 4G3YL 1Q9LB 5MP6H 3SDXB 5J4MA 1VKXB 3ULUL 4UNUA 1T66C 5JXED 1P2CA 2B39A 5TE4H 1JZ2A 1NCBH 4DUWA 1HXYB 4TVPD 1YEKL 4OB5L 3NCFB 2BNUA 5KVGL 1KN4H 1KFAL 5GS3A 3BDYH 3O6KH 1ZHKA 3T0AA 4X4YB 4JFPB 4KZDL 4WFFD 2I07A 4OLUH 1CE6B 1AGFA 4N0CC 3O11A 2NY6D 5HGAB 3FMGL 1BJ8A 4H0GA 4PR5A 4MA1B 4MJIA 4LLYA 1MFBH 1KELL 3PWUB 4QHLA 3MODH 3D6GA 2Z4QB 3MRRA 1FLRH 4M3KB 3TPUA 1J05A 1P9MA 5IB1B 5ALCH 2I60L 3I6KB 4YE4L 4YH6A 3R06B 1KCLA 2ESVD 2EH8H 3S3SA 1EAPB 1P7QA 3W5NA 1N2RA 2ZUTA 5JOEA 2BNRB 4NQSA 1WBXB 3DURB 2ZNXA 2VLMD 5SX5K 3L9RA 3BD5A 4LQ1A 2EDHA 1AKJA 1PSKL 4HX1B 3T2NL 4KPHH 3UPRA 35C8H 3RPIB 5DD1L 4OZIA 2UY7A 4GXVL 3WBDA 2ADFH 1AIFA 4G8GA 3BQUA 5DEFA 4FQLL 4QHKJ 5MEQB 3TT1L 4RGND 2PCPB 4IHOA 3L3HB 5E2VH 4NUGH 1ADQH 5F7KC 4Y4HB 5CZVL 1IAIH 3DYOA 3RA7L 3QDAA 1UJTA 1ADQA 3B9AA 4G5ZL 1IKFL 1DLFL 3FQUB 3NTCL 3Q1SL 2D7TL 2NXZB 4FFZH 3A0OA 3MR9B 1ZLVK 1MCOH 4PJCF 1K4CB 1A3RH 5I18H 4L4JA 4NKIL 3GIVA 5C2BL 4JG1H 3GEWB 4B0MM 4LASH 1T3FA 4EI5D 1S7TB 3QA3B 1CGSL 1E6OL 4JZNB 3UBXG 4H26A 4PY8J 5IGXL 4FQQA 4NO5B 1IEAB 3B43A 4MDIA 4X80L 43CAA 1EGJA 1A64A 3CLFH 3QIUA 3G5XA 3KLSA 1YMHA 4YXKH 1UENA 3QUYD 2ZUWA 3NZHL 1MWAL 4P3CL 1IT9H 1ZWIA 2J12B 3QI9B 4YEFA 2YMXH 4G3YH 1S9XA 1ZT1B 4C4KT 2DIBA 1OWWA 2BHUA 3ULUH 2EDEA 1N6VA 2CLRB 2J8HA 3KPTA 2B4CH 3CVIL 3WNKA 5D2NA 4PD4K 3BGFB 1YEKH 4X6DF 4NUJB 3L95A 3S35X 2CRMA 3V6ZA 4OB5H 3MV11 1JF5A 5TPWL 3TIDA 2UYLA 4OTXL 3CD4A 5KVGH 3AUVA 1KFAH 4WWKA 3OPZH 4DZ8B 3UYRL 2ADJB 4PY7A 5ENWA 4TSBL 5CBEA 3BUTA 1QLRA 3GMOA 3T3ME 3FMGH 1NC4B 3SDDC 3JVGA 1KELH 4YWGL 2ATPA 1X5KA 5GS2H 4LHUG 3VXUA 5TFSL 3QDGE 2I60H 4YE4H 3T0WA 4ZFZA 4M93C 2YD5A 2FJHB 5IW6B 4CN4A 3LY6A 3WN5B 1NAML 3F65A 1CXKA 1C12A 2HH0H 4PRNB 3ZYIA 1WGOA 4RFNC 3VWJC 5JW3H 2R1WA 4RQQB 5IR1A 1ZXQA 2Y5TB 3BISA 5J6HA 5GS1C 4GAYA 2YPKB 3TA3B 1U3HC 4ELKA 5I1CL 3U4BH 3NCCB 2VZ3A 3VFWB 4MJ4A 3NACL 2C1PB 5A2JH 1B6DA 1PSKH 3F7YA 4KKNA 4WV1B 4TNWF 3T2NH 4LSVH 2DQHL 1ZVHA 3EDDA 3ZTNL 3ECBA 4GXVH 3ME0A 2X09A 3U36B 3MA7A 4YDVB 4CDGC 1WZLA 1FNGA 3TT1H 5IK3A 5FK9B 4LCYA 1FC2D 2VLRE 4P46A 2Z9TA 2AJYL 2XN9A 4X7DC 3UJIL 4FABL 5CLWA 5DUBB 1EH9A 4EI6A 3P4OA 5CZVH 4YHIA 5CEXA 4XNUL 1AI1H 5C9JA 4N8VG 1G7MB 1IKFH 1DLFH 4Y19A 3NTCH 3Q1SH 2D7TH 4MCZB 5FO9B 3IVKB 1UM5L 4X4ME 1R3KB 3ARUA 2DLGA 3I9GH 5E8PB 1DQML 3P9MB 5C0AD 2PR4L 4MXVE 5C2BH 3GKWL 3HB3D 3CDGB 2OI9C 2EDFA 3BKML 4EXKA 3RVVC 5EN2A 2NLJB 4LPCA 5IGXH 3RX8A 2JE8A 2D9QB 4HH8A 3DMMB 5J1AB 1D5XB 2A9ML 2GY7B 4X80H 3N1QC 4Y8DC 1JIBA 4XAWL 4WHYH 4GJTB 2JCCA 2LQRA 4HFUL 3W11D 3VFSB 3EDJA 5I2IB 5JLZA 2LFGA 3NZHH 1MWAH 4P3CH 5LG1A 4HK0A 1CGUA 3L5WA 3MNVB 1DN0A 1MWAA 2NMSA 4K8RC 4YHPA 3IDYB 2QEJA 4XNMB 4OKVB 4LRIC 3TN0D 2PYEE 1RZ8B 4XNQA 3CVIH 3DX9A 5F7DA 1T80A 1U92A 2MQ3A 5ISZE 4FG6C 5TPWH 4OTXH 3HCVB 4L29B 5FGBA 5L0QB 4M43L 1NC2D 1DBML 5IEKB 4ZAKB 2FWOA 2VLRB 4OGXL 3LN4B 3CFKB 4TSBH 1S9YB 2H8PA 3KPMA 2EEAA 4KDWA 3P0VH 4JN1L 4KV5E 4P9HL 4XTRD 3WLBA 4YAQB 3L5IA 4YWGH 1NBZB 1YN7B 3JWDL 3SDYL 2NY0C 1QACA 4R4ND 3T4AB 5EUOE 3A6CL 4JVUA 3IAPA 5D7JB 1OWRM 4NKQB 1CLOL 3BP7B 4Z78A 3VXTB 2Q8AL 3ARTA 1BWMA 5JQ6L 4HUVB 4WWID 1NAMH 4MNQB 4D2NA 1XCTA 4HIHB 5IHZB 3ZKMD 2CDFB 3DX8A 3WHXA 1H3VA 5F3HA 5CSGA 1T7WA 1OAZL 1FYTA 4I0PA 5I1CH 1F6AA 1X7QA 4RZCA 3ARED 3NFNB 2PXYD 3NACH 1XGYL 4POYA 1IARB 3QIBC 2DQHH 1MLCB 4U1GB 1P7QD 3ZTNH 2VSDA 3IGAB 2BSSA 5FDWA 3I75B 5J13B 4NN6C 3ZYZA 1MQ8A 4L9LB 3VXSD 2PYEB 2AJYH 1XZ0B 2B2XL 3DNKA 4XNUH 2YXMA 1RZJL 4WNQA 3T08A 4JR9L 3L3OB 1UM5H 3L3DB 4D9RD 5F7LB 1GZQA 3OKOB 2ENSA 1EVTC 4RWHA 3VG9C 3RZCC 5HBBA 2ADGA 2PR4H 3BO8B 3GKWH 4V1DA 3G9AB 4ZUSA 4JFFB 3TBWB 4ERSH 3ULVL 3L5JA 3BKMH 4KQ4H 3D3VD 4BKLB 2JJUA 5IBUG 3Q5OA 5T1LA 3FFDA 4IIQA 5EUOB 3H9SE 3V6OE 1IGYB 2CIIB 4X7TB 2SEBB 2A9MH 1VEOA 2V5SA 3DUSB 1MLBB 4XAWH 1TVHA 5GSRB 3MACH 4KKBD 4QY8B 4WFEE 1M6OA 4HFUH 4LSTL 4NRXB 4X4ZA 2G9HB 3K2UL 5E2UH 2APWA 4LGSB 3WFDL 3T3MF 1OL0A 1GIGL 5E2WH 2NX5D 4KRPB 4QTHA 2D31A 3ZDXE 4DKFL 4M5ZL 5KVFL 3BUYB 4X99A 3QAZC 4OZGA 4QXWA 1WFTA 1GGTA 3HZYA 3EDFA 4HWBA 5I9QC 2EKSB 2YC1B 4HIIA 1MUJA 3FB5B 3D18A 5JHLL 1G9NL 4UTAL 4M43H 4UQ2A 3CMOL 5DDHA 1F97A 3L7FB 4D0DB 4U1HA 2YD7A 4OGXH 1MJUL 4R7NB 2WUCL 5IM7B 5I1KL 3K8KA 2YUWA 4JN1H 4P9HH 3S97C 5HI4C 5CEYA 1U8QA 4KJWD 1FNHA 1U8LA 4PREA 1KGCD 3DVGA 1Q0YL 4PJFB 1MOEA 4AJ0A 1EEZB 2VZVA 3WIHH 3V4VL 5GS0H 3TVMD 4LSRL 4PBXA 4PRDA 1H8OA 1BF8A 3A6CH 1LD9A 1YY8A 3PHQA 3U0WL 2B5IB 3C6SA 2WP3T 1HHKA 1CLOH 1I1FA 5D1QB 5L2KE 1J0JA 1UQSA 4OCLC 4QRUA 5JQ6H 3QQNA 2DQFB 2NXYD 1MCHA 2AQ2A 5I0DA 2D9CA 1UKSA 5CZXC 3ARGD 3X17A 5TDOA 1OTSC 5E8NB 1MVFA 4L8DA 3EOBB 4K71B 3H9ZA 3RU8L 4KRPC 4L8CB 2DLFL 1PG7L 1DQLL 4XAKE 1XGYH 5TQ2L 3MV8D 4MXVF 4JRXE 2UZIL 2EC9T 2XQYG 4JDZA 3QFJE 4G6AD 1A7BA 4LVHC 2BJML 5GJSL 4JGMA 3HPLB 5IB2A 1CG9A 5J6GB 1SMAA 5EBLA 2B2XH 3GDBA 3O9WD 3A6OA 4HPYH 1RJZB 4ZUWA 4K7PL 1RZJH 4UU9A 1JNHB 3TEUA 5GSVB 3MRKB 3T8XA 3U83A 2YEZB 4JR9H 3O4LE 2UVFA 2X40A 5BRZE 3OXSB 1S5HB 3FO0L 1AQKL 4Y4KC 4EZMA 2PUQT 3OMZA 2FHBA 5IV2A 2J6EL 2ICEA 2JJVA 5INDB 1ZTXL 3ULVH 4FQ1L 1UH4A 4L8BB 2VYRE 4W6WB 4F9PA 3UJTL 5I0ZA 4DN4H 5J9PB 2BNQE 4BSVA 3KLDA 4JRYD 2E9JA 5J56B 3FO9B 3V6OC 3STBA 1YPZE 1D5MA 3FN9A 3OKMB 5E7BA 3VXQB 5L9DL 3GBLA 2E27L 5IHUL 4LSTH 4NDMA 4KV5F 2X44D 3K2UH 4YPGB 5LAXA 1LEGA 3AROA 3SKOB 1MFEL 2F53A 1W0WA 1N0XL 1GIGH 3NVQA 5E1HB 3PGCB 4DKFH 4M5ZH 5KVFH 5EUOF 5FOBA 5E0QA 1T1ZA 4NCC2 5MERA 1C1EL 3PUCA 3VD3A 1MJJB 2QLVB 4PRPD 5E4EC 5T3ZL 3QFJB 5ETUA 1DBAL 1NCCL 5JHLH 2H45A 4HWUA 3VWKA 4DN3L 4YDLB 4UTAH 5EO9A 3CMOH 3QG6A 1I1CA 1PD6A 1MJUH 4JDTH 4FQCL 2WUCH 4YNYA 2EXYD 3GBNL 5I1KH 2A9NL 1EXUA 5JDJA 1BQHB 1H3PH 1S7SB 4HKJA 3O4LB 4LSRH 3GSXB 3BPCB 1BD2A 4MA7L 3KWWB 3Q6FA 3SGKC 1NFIA 4LPTA 3U0WH 2VQTA 3QCUL 3H7LA 3MRLB 4IRJC 3QFDB 3H3PL 1WLHA 2VDML 4MNHB 1K8IB 3JSSA 4ZUTB 5IG7A 4GS7C 1I7TB 4LNRA 3PQYB 1SHMA 3MCLL 4KKLD 5C07E 3QUKA 4PJFF 4ZFGL 2OTWA 4PFEA 4Z76A 1CDBA 1B0WA 4UUJB 1RZKL 2UUDK 5DJ0A 1G7LA 3H6JA 3RU8H 2DLFH 1PG7H 4FQ2L 2GK0B 4ZYKA 1DQLH 2HJFA 3JTSA 1NGYA 5TQ2H 4XCEA 1RAMA 1NFDB 1AD9B 3GSWB 1S5IL 2UZIH 4FMFA 3M17A 1EUUA 5D71L 1HHJA 3VFNB 3OWEA 3T0XA 3HZMA 5IJVA 3TZVB 3IJYB 1FYTD 1IEBA 5JIKA 3D0LA 4ZOEA 1R5IB 5I8EA 5CEZL 3NIFE 4PGBB 5D1XD 1ZLWH 1U93A 4K7PH 1J86A 4MD0A 1NGXB 3DPBA 5F1NB 1A14L 3ZDXF 3FO0H 1AQKH 2YD9A 4G42A 2ARJA 4HW6A 1HHHB 5DK2A 4Y5VA 3VGAC 1ZTXH 4OZFA 4E41E 1EIBA 4FQ1H 4IMKC 1BVZA 2J6EA 4Y2OA 3QYCA 3CPLA 2CD0A 4OZ4B 3VMNA 2XZQL 3QWOB 2OTUA 2VLLA 4LHUD 3N85L 5IROA 1I4FA 2ZCLH 1VACA 3H9HB 3QXDB 5L9DH 2E27H 5IHUH 1ZSDA 4C4KO 5C07B 3C60B 1MFEH 3WV0A 1N0XH 3WFBL 2VISA 3FFCE 2P8MA 3VFMA 3SKNB 3NAAL 4RMRA 4HUWA 1C1EH 3RVTD 3X12B 3RUGE 1PQZA 1VCAA 3O2VL 4EN3D 3SDXA 4IRSB 5J89A 4JY6A 1HILB 1A02N 4WW1B 1P4IH 5T3ZH 2D7PA 3FRUB 1DBAH 3HE7C 1DEEA 1SYSB 4PRAA 4DN3H 4WTZA 4I3SL 1OAUL 3IDGB 3ES6B 3NCMA 2OXHA 5GGRA 3WJJA 1CT8B 2BY2A 4FQCH 3RWHB 5K9OB 2J5LB 2A9NH 2BVOA 3UYOD 2R0WL 2I25N 4PRBA 4Y16C 4X4YA 1V3LA 2G2RB 4GSDL 4JFED 1KCSL 5FYJD 3QNYB 4RBPH 5HHOD 2Q87A 3TWCH 1HHGB 4JKLA 3H3PH 2P8LB 3HN3A 2VDMH 4QHMB 3L1OL 4MX7B 5A3IC 2Z4QA 3LEYL 4E41B 1MH5A 1MI5A 3MCLH 4MAYD 3FT4A 3MGTA 3O6FD 5BV7L 1FNEB 2MTPA 3GMLA 1Y6MR 3SE4C 1K4DB 1T7XA 2RGSA 2FCBA 1WSST 3MREB 3IDMA 4FQ2H 5KTEH 2AERT 2D4FA 1I1AB 3BZEB 1OARL 1S5IH 1SJEB 3GSVA 4I2XA 1IQDB 3FFCB 4YEEA 3UTTE 3MFFB 1LHZA 4EIZC 2GJ6D 1N3NA 4P2OC 3LZFL 1M7IB 4X6CE 5CEZH 5EIIB 2W60A 4HIJB 1YPZF 2VH5H 1L6XA 3LQZB 4MA8L 5C0FB 2FX9H 5I75B 4GG6A 5HI5D 1N8ZA 3HE6D 4OI7A 1YEIL 4AEIL 3WDHA 3L3HA 1RUPL 1QO3B 3PDOB 4NNYB 2DQDL 4ZSOA 1OTTD 2WBJD 3RHWK 2VITA 1QFPA 1A6ZB 5I8CA 4RMQA 3SPVA 2QHRL 2WM0A 3FO2A 4CVZB 3F62A 4U6YA 1T21B 3MO1A 4ZTPH 1K4CA 4OCSL 3MJ7A 2VRAA 2VB5A 4HXAL 3F5WB 4ALAL 2XZQH 5H37G 3U82B 4F7TA 2AJZB 3N85H 1TITA 1P7KB 3QBTB 1E28B 2IGFL 5DJAB 4ETQA 4Z0BL 1OHQA 4WEBL 4PP1D 3WFBH 3EBAA 5CHNB 5SWZE 3BP5A 3JWNC 2V9QA 1QFUL 1MSPA 1JTOA 3EYOB 3L7EA 5I74C 4EVNA 3JUYA 4XPTL 2MKLC 3BESR 3O2VH 4WDIB 3IDNA 4N0UE 1KB5H 2P45B 4ZO8A 1JRHL 1HKFA 1EEYA 2CLRA 2XTJD 3BJ91 3MMEB 2DB8A 4JY4B 4I3SH 5FHBH 1NBYA 2W1NA 4X6CB 4UMGA 3HZKA 1T6WA 1ZVYA 3ZL4H 5CGTA 2BOCA 5EBGA 5IWLA 1M1SA 3P4LA 3HG1A 2CUMA 4LCWB 4PP2B 4HS3A 4D3CL 4GSDH 2DYPB 1KCSH 2UWEA 1KACB 2F54D 5CKGA 2O61A 4Y5YC 1OY3B 5EFIA 3S8WA 1M4KA 3QPQC 4J3UA 4EBQL 3VCLB 3L1OH 4ZXBD 3RWDA 3LIZL 3HNVH 1M7XA 2BSRA 5CD5D 2J7LA 1GHFL 1OW0C 5BV7H 2B1AH 3LKRA 4AMKL 3OJVC 1L7TL 2EXWC 5ESAB 8FABB 3JV6A 3KJ4C 4JY5L 1K8DB 1OARH 1FO0B 2IANB 4N0FA 1LMKA 4NNXB 4XPFL 1C5CL 1T20A 4KKCC 2XZZA 5SWZB 1C16B 1MPAH 4M7ZB 3P30H 3FZUC 4ZODA 4PG2C 5D2LE 4WV1A 4OV5A 1CICC 1NMCB 4GH7B 3PF2A 3LZFH 3PNWB 5ITBL 4YDVA 1U8PB 1A4JB 4Z7OF 3ZLQC 4GMSL 4MA8H 5GISL 7FABL 5DC9B 4N0UB 1CZ8H 3QRGL 2YXFA 4JQVA 4QTIL 3SDCB 1QSFE 1U91B 3Q6GL 5CP7B 3ZKQD 4AEIH 1RUPH 3OKEA 5MEOA 5DUBA 2DQDH 1DUZA 2FEEL 1G7MA 2Z35A 5D7LE 4YBHA 1XIWB 2QHRH 4MCZA 5HXMA 4NQTA 3RUGF 1DBKL 4NT6B 1Z9OA 1NL0L 4XWOC 3Q5YA 5CAYB 4OCSH 5BQ7A 1KIPB 3IKCB 4KKAC 5KANI 4L8SB 2BVTA 4HXAH 4ALAH 1F3JB 4S0TD 4WO4A 1BFOB 4KUZH 4F33B 4KTEL 1CFTB 2OL3B 2EIZA 1V8HA 3NFSL 4Y1AA 5CCKL 2R1YB 5HHQA 4Z0BH 4S1SH 2F8XC 4Q2ZB 1F6FB 4PJEE 4WEBH 5CD3B 1UJ3A 2APFA 5D6CA 1R3HA 2CKNA 3QDJA 1QFUH 5D9SB 1LO3L 4NZRL 2HTKD 3LQAC 5IMOB 3T2PA 4XPTH 4C56D 1DN2A 3LKNB 3MNVA 1TPXC 5BS0A 1RMFH 3GSUB 3IFOA 2DICA 3MUGA 1JRHH 3PWLB 5HJ3B 1KJMB 4HS8H 1OTUC 4YX2L 3VXRE 1JWSA 5D2LB 1IEHA 1FNSL 1F4WL 4V2CB 4KGLA 5CJ5A 3FAXA 1G0XA 2NY4B 5EG6C 3HCVA 1YN6B 1AGCB 1IM3A 1XF5A 4U6HA 4QEGA 2FSEA 5ID0B 1QSFB 2WP3O 2GQHA 1S9YA 4R8WL 4D3CH 3QEHA 4D9QD 2EDDA 2X70B 1RJLA 5HD8D 2W0LA 3KLAB 2P46B 1X5HA 3QPXL 2ARJQ 4GUPA 5D7LB 3DOSA 3VJ6B 4X6CF 3GSQA 2D4DA 1YN7A 5GQBA 5SWSE 2AK4E 3LIZH 3S98A 1JJUA 5FM4A 3X3GL 3UTQA 1TCRB 3HC3L 1N64H 1GHFH 5IIEB 1E4XL 4LK4A 4JFDB 4AMKH 1L7TH 3F7VA 3CLEL 4HUVA 2AK1H 1REIA 4MNQA 4HF5L 1R5WB 4CMMA 1A7NL 2Q20A 2CDFA 4JY5H 1I75A 3MRDB 1G9MC 2P5EA 1I7RA 1A1OA 4XPFH 1C5CH 4OFYD 2PW2A 2OJEA 1U3JA 1VEMA 1S9WA 2HKHL 2JIXB 3OKYA 5T3XE 4H8WC 1JL8A 1RURL 4GMSH 2BNRD 3M1BA 5BCAA 2XYCA 7FABH 1V7NL 5IHBA 3VG0L 4QTIH 2VDLL 3Q6GH 1D3CA 1GC1L 4ELME 5A43C 4X83A 5J57B 2R1XA 3KPPA 4YO0A 3H7BB 4TTDC 1AXIB 1DBKH 5CSZA 1NL0H 3G6DL 1FPTL 5JHDA 2NY1C 2VDQL 5MENA 4HHAA 1BQHG 1EO5A 4JZOA 4XI5D 4Y4HD 3WUZA 2ERJC 3AY4C 1UH2A 4IBLT 4FQXC 1G6RB 2A73B 4KTEH 3D39E 1A0QL 2NXZD 4HIEA 5DJXB 5EU6A 2AK4B 3NFSH 3PWPA 5SWSB 5CCKH 1QRNA 5L8JB 3IFNL 4X7TA 1F13A 2SEBA 1KIRB 2UVEA 5E9DE 1MLBA 2NZ9C 1IGIL 1DEDA 4X5XB 1I8KA 5E8EA 3LKPB 3O0RH 1LO3H 4NZRH 3OAUH 3TJHD 3ZE0E 1KTLA 5C08B 3X13B 3KPNB 4J3SA 2NY5L 3QXWA 5AUMB 1OGAE 5B38A 1NEZB 4YX2H 2P5WB 5D6DC 1F4WH 3ARBA 2EKSA 2J8UE 3D2UA 1GZPA 5AYUL 3AM8C 5DD5L 2W38A 3QNZB 2H2SD 4F37F 5FO8A 2W91A 3UC0L 2GY5A 3I2CL 3QI9D 4JVWA 4PJDB 3ARQA 3U6RB 2ZZUT 4CVWA 5TDNA 2LABA 3GI9L 4P23A 4X98B 4OD2A 4NHCL 4R8WH 3BH9B 4ELMB 5ACZA 4XP5L 5D2LF 3QPXH 2KL6A 1D9KC 3BZ4A 1X5XA 3HAEB 4JHZA 5B3JE 3WHE0 3P9LB 3X3GH 3HC3H 1B9ZA 2MHAB 4GFTB 1ACZA 3CLEH 4MJ5B 4WW2B 1NC4D 4TNVF 2ZUQC 1N5YH 1A7NH 3D39B 3WYRA 3LVEA 4NZUL 4UOW1 4PRHE 4GKZA 3WS3A 1KCRL 5KSUA 2C26A 3RDTB 4L8CA 4FA8A 3TO2B 2Y72A 5FYLE 3FAWA 1JGEA 1DVFA 3QIWB 3P77A 1YEHL 3GM8A 2HKHH 1OAKH 1WWAX 3STLB 3CAFA 3VFRA 1RURH 1T6VN 3KS0J 2FR4B 4XMLL 2N4IA 2CIKA 1U3ZA 2IPKB 2Y36H 3FO1A 4RGOL 4UDTA 3C5ZA 3TA3D 2JJSA 3RWJB 5CLTA 1OGAB 3V4UL 3MBEC 2VDLH 2DQGL 3REWA 4PJEF 3LPWA 4Y8AA 3PL6A 1C08A 1IC5L 1MHCB 2FBJL 2J8UB 3U30C 1CR9L 4NBZB 2A6IA 1JNHA 3MRIA 2B4CC 4F2MA 3S4SA 3BGAA 2BDNH 6FABL 3G6DH 2VDQH 3DSFH 4BUHA 1RHFA 5H2BB 5CIPB 1HHIB 1AO7E 3OG4B 2BY0A 2W9DL 1U8KB 4WW2C 1A2YA 3V5KB 3MRQA 1LK2B