1P7QD

Crystal structure of hla-a2 bound to lir-1, a host and viral mhc receptor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
195
structure length
183
Chain Sequence
PKPTLWAEPGSVITQGSPVTLRCQTQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Crystal structure of HLA-A2 bound to LIR-1, a host and viral major histocompatibility complex receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 183
sequence length 195
ec nomenclature
pdb deposition date 2003-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7qD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7qD02
5DUBB 5DD6B 3S88H 1Z9MA 4FFWC 1JMZA 3GSRB 4GAGH 5EG6C 3JUZA 3PQYA 4UINL 2VN4A 4MSWB 3KLHC 1OPGH 4DAGH 4NFBA 3QDGD 1BAFH 1IM9A 2YPVL 4OZIB 3KPOB 4HHAA 2Y06H 2HT3D 1URLA 4WI5A 5DRZB 2DM2A 2WQ8A 4HX1B 2RR3A 5HI3D 3BMWA 3QXUA 4J3XA 3HI1A 1J12A 1TJHL 4JPKL 4PGBB 3VH8A 3DYMA 5ETUA 4L4TE 3CFJA 3IJHB 3S5LG 5FYKL 1CLZH 1BGXH 5FB8B 4ZUVA 2N7AA 4J2XA 1RZFH 5D1ZD 1IAKB 5CD3B 1FL3A 3ZHLA 5T3ZH 1ZHKA 2GIYA 2R9HD 3WE6B 3ZDZE 5I8OH 3EGSB 3BPOC 1F6LL 4L29A 4OGZA 4GRMA 1FVEA 5IHUL 4GKZB 4KTYA 4YHZH 1C8PA 2GK0B 2GY7B 4JFYB 4LRNH 3FFDA 3RA7L 4D9LH 4KK5D 3SGJA 4HAFA 2R1XB 3G5YB 3SDXE 5IVXF 5C08E 1AGEB 3AMKA 4RNRB 3TN0A 4D9RD 5I17B 3OKKB 3KPNA 2DQDL 1UM5H 3WS6A 4L4VB 3JBG7 3X3GL 4L3EB 1MCFA 5I1LB 2ADFH 4MXVE 2VC2L 1K6QH 4JFOA 3PUCA 2H3NA 4WW1B 4EN3A 4AL8L 1K8IB 5DVNA 5L0QB 2FLRT 3C5JA 1PEZA 3VFPA 1EVTC 3VFVB 1Z0NA 5C07E 4F9LC 1UH2A 5DT1H 3QDGB 4GQ9L 4Y4FD 4ZXBA 3QPQD 1MRCH 4JPVL 5CCKH 1DQDL 4Z7VF 5FCUL 1J7VR 3JV6B 1KLUA 5HHMB 3O2DL 1WZKA 4PRIA 4O00A 2NY7H 1LD9B 1FO0B 3MACL 2X9XA 4RAUA 5DI8B 4EZMA 4DKEH 3UTTE 1X5ZA 3KPMA 3QJHB 3TYFB 5E4EC 3O6LH 1PG7X 2D7TL 4JLRA 5IB2A 3HE7D 3OJDB 4G5ZL 1AGBB 2VDOL 5GSRA 5D1ZB 3ZKND 2CKNA 2BSRA 1SBSH 1Q0XH 5EBMB 2BMKB 4Q97A 4QY8B 2OCFD 4R90L 4XI5C 4D3CH 3QDJA 1Z2KA 4JFFE 4PJDB 3MRRB 3RWCA 5HYEA 3BZ4B 1UCTA 3L3HB 4OLWH 3OKDA 5BW7C 2HRLA 1T1WA 1JJUA 1KXTB 3KPRE 3QFJB 4JM2C 4PRAA 3G08A 3CMOH 3E2HB 5JORA 4GKNA 5JIPA 3U4EB 2NXZC 1K3IA 4XP4H 2HVKA 3RP1A 1MLCA 2V17L 4QRRE 4PJ9C 1AE6H 3L3OA 1MHPL 3BH9A 3K2UL 4YHOL 1DVFA 4HKJA 4KKBD 5E8DH 1MFCL 1DJSA 1GGTA 5D5MA 4PUBL 1RIUH 5LBSH 2HLAA 3SQOH 1OD7A 1D9KC 4A6YH 1T1XB 3FT2A 1JNHB 3BP6A 4X8XA 5C2UB 1WZ1H 4HUVB 4IDJL 1KGCE 4KHXL 5EIIA 4W68A 5E8NA 1TVBB 3B8SA 4MX7B 1EEYA 2ZKHH 2VLKD 4ODWA 4Y4FB 5DS8A 5LXGH 4M61A 1C12A 5HHVH 1JGLH 4ZFOB 1E27B 2GQHA 1XGUB 1K2DA 4KK8C 4WI9A 1KCUH 8FABB 1KEML 4ZUTB 3H42H 1ZHNA 2BHZA 3BGAA 3F8UB 2WIMA 2D9QB 3VMOA 4MMZC 3W0WE 3VE0B 1CXFA 1JHKH 1I1AC 3PWUB 5E2VH 3S96A 3GMQA 2J88L 2V5RA 3QEGL 3MJGX 4OIIL 3P77A 1D6VL 1FVCB 5D93B 1ZHBB 5D7LA 4WI8A 5FYKD 1MFAH 4ZNCD 2D03H 3LS5H 4OLYH 3PDOA 4JREC 4Z77B 3OG4B 3STLB 5D8JH 2VERN 2XACC 5D1QC 5MP6L 1CDYA 3BHBB 4R0LA 1HHHB 1X7QB 2X9WA 5J11B 1S7TB 2ESVA 3BDYL 1OP3K 1OL0A 3SGEI 5DJ2B 3EYVA 4G6KL 5FM5O 5FO8A 4PJXE 1HWHB 4JAMB 3KVQA 4K9EH 2GJ6E 5J3HC 5DEGA 4I4WB 1J0IA 5DF0A 3I9GH 5JQ6L 5C70A 3N1PC 5DC0A 1DCLA 3MRKB 4E41D 2CO6B 1CFQA 3OXRA 4D2NA 1UKTA 1LO3H 5SV3A 1LP9A 5JDSA 4OUUA 3DGCR 2FIRT 4GAJL 4F7CA 3MJ9L 3V6OA 4KI1A 1U8KA 2YD5A 1RZIB 3CSYA 5JNYA 1PVHA 2EYTB 3BUYA 3RWHA 5EC1B 1CR9H 2B8OT 1KSRA 4UQ2A 1DDHA 1E6OL 3KYOA 4ONHA 4PY7A 3HHRB 4M9OA 4Y5YB 3DLQR 4ZODA 3TH4T 3LKRA 3V0VA 1UJTA 3NPSC 2VLKB 5T1KD 1QLRB 1IFHH 3W82A 2E7HA 3SBWC 5EZIL 2GY5A 3LKSB 3Q2CA 3X12A 3TBSB 3QEUB 1TCMA 1X5YA 4D0DB 3U6RA 4OGAD 3QH3A 3KWWB 1YN7A 4UTAH 5T5NF 1A8JH 4QTHB 1GC1L 5I6XC 3VXNA 3AAZB 3ILQD 1S3KH 2OM5A 2GFBB 4Z76B 1BJ1J 1XGRB 1W0WA 4KVCH 1KCKA 2OBGA 4P2QE 3RWGB 3W9DB 3ZT6A 5KVDH 5IWLA 3GBMH 2R1WB 4OFPA 3FO9B 5DJ6B 3ZSSA 3MBEC 3BSZL 4QEGA 3VA6A 3ARGD 3EZJB 1NUNB 3PABA 4R8WL 4G8EB 4ALAL 4ZO8A 3MLRL 2NLJB 1XR8A 2IADB 3PWNA 4TVPH 1AQKL 1NEZA 1P7KB 3ARBC 4I3SH 4Z7NF 3WLBB 4CNIB 1VFAB 4YO0B 2UZYB 5JHLL 2EDWA 4DN3H 3ROLB 5F88B 1ZHLB 1LDSA 2YD6A 3MUY1 5LQBL 1E0OB 1S5HA 4QGTA 5EO0A 2JJTC 4UV4H 3KAAA 1FFPB 4E41B 3EYFA 3QHFL 5ISZA 4CBPA 1YDPB 4PLNC 5DJYA 4HS3B 4NZDA 2CK2A 1ES0A 1F2QA 5F8RC 4GS7C 4MD4B 1C5BH 3RL2B 5T3XE 2PTVA 1CXIA 2XWTB 3NACL 4PTTA 4KQ4H 3M07A 4S2SA 1HHJB 2CMRH 2YA2A 1XH3A 1S9KC 3L3DB 4XRCB 2BSSB 5JXED 4KY1H 3NIGE 5T1KB 3Q48A 3MLZH 4M6NL 3S6CA 3SGEH 1EMTH 5J6GB 1NFDF 1F4WL 2H2SC 5H94A 3LHPH 3LN4A 1DFBL 5SWZD 1OGTB 1UZ6E 3CDYA 3WFHB 4OBSA 3Q6FB 3BN3B 1H3UA 3IETB 4X6FB 4JY5L 5GGRB 5CZXD 4FHBD 3ZE0E 4ONGL 5CJBA 4FQ2L 5JR1L 1XF3B 4OCYL 3N9GL 2EO1A 4UUJA 3O6KL 1D3CA 4RGOH 1U42A 4MQXD 3S8WA 5E08H 1ADQH 1T2XA 3AY4A 5F93C 3P11L 3S37H 3P0YH 4XPGH 5C7XH 4K55A 5DFVC 3BIAX 4RGNE 4K23L 5C0BE 5IG7B 3ARFC 4Y4HD 1KEGL 4WW2A 1EAJA 3WUWB 4ODSL 5FECB 2VLJD 2FSEA 3RWEB 3E0GA 5F6IB 3L3IA 1UYWL 3QBTB 1KN4H 3MV7B 2DJ4A 3D69B 2HTLC 2YPLA 3NA4A 2R2EB 4P3DA 5C0DA 2FEEI 4LLDA 1RIHL 4LPWA 5DVLA 4N0CD 1UG9A 3MUGA 3VWKA 4CU8A 1LMKA 4XNMB 1BBJB 4RMWA 4J3SA 3PHQA 2AJYL 5LGHH 2EE3A 2DLFL 1YYMH 5I9QB 3O4OC 2AV7B 4XPTL 1AO7A 3UPCA 5C07D 1MCKA 4F7TB 5MEND 4QRPE 2F5BL 4KJWC 1IKFH 3B2UC 1L7TH 2HJKB 4M48L 3HC3H 5I1HL 1AFVL 2NQCA 2X4SB 4KXZI 3LH2H 1DANT 4NN6B 2OSLA 4RRPA 5SWZB 2FBJH 3QXTA 5CIPA 3MRNA 4EQ2A 1LNUA 3L5XH 2P47B 1K4DA 4L3AA 3IDJA 4KMTL 2VAAB 4AQOA 2KBGA 1GGBL 1BBDH 1SJEB 4HFUH 3VFNA 2X1QA 1NGXA 2E3VA 5KJRH 2C1OA 3SCMB 5CKAA 1U36A 3CJJA 3HR5B 3H3KA 4NFDA 1HWGB 3OQ3B 1S9XB 3LDBC 2R0WL 3UJIH 5D2NC 1G0XA 2F8OA 4S1DC 4FG6D 3SKNB 2DQIL 4XB7A 5IR1A 2DIAA 1R3IL 1T22B 1MNUL 1LGVA 1FNSH 2H6PB 3GRWA 3VWJC 4Z7VE 1VESA 4Y4HB 5BZWB 1B88A 4GXUN 4C83B 5GGUA 3RAJL 3MLTA 5FYLE 2IMNA 1AI1H 4MAUL 3D0VB 5E2UL 2NZIA 1T7YA 4M9PA 2A6JA 3FQRB 1WTGT 4OCLC 1CLYH 3TBWA 3MLSL 1P4IL 5EDXA 4F57H 4L8CA 3QUZA 3MODL 2ZUXA 1E28A 2HT4D 4WO4C 4ZG1A 5CGMA 3BWAB 4IBLT 4MLSA 3I6KA 4O2FA 4X4XA 3VD3A 4KWUA 3CUPB 4OF0A 4M7ZC 2BSTA 4NWTL 5MENB 2X4PA 3TLRA 4JHAH 4GG6F 1K8DA 1BQLL 1R0AH 4LP5A 3MSPA 3ARQA 1XFPA 4CRPA 4WWKD 2CRIA 1NAML 4TSAH 2APFA 4K8RC 2NW2B 2YHGA 1LEKA 2VSCA 2BX5A 3KYAA 2D7NA 2WUCL 4NUJA 4J4PC 1XEDA 1B0WA 5DZNA 1FZKA 1OM3L 3EO9H 5F3BA 4LEOB 4TULL 3PWJB 3TYGL 3MA7B 4O4YL 2XYCA 3MRFB 5D6DA 3QDMD 4HV8A 3VFTA 2Q76B 3O8XA 4Y2DA 3KYNA 2UWEB 4YEEA 1KPRA 1Q72L 2BVTA 1GOHA 2G2RA 5C09E 2OQJA 1IBGH 2QSTA 1TITA 4WV1C 2A38A 1QBAA 2CIKB 5JW3L 3T0EB 3VFGH 3NA9L 2YXFA 2VZ3A 2OZ4H 1S7UB 3QUYA 1A7NL 5JPMA 4OQTH 1JYWA 4PB9L 4MA7L 2XY2A 1I3GH 2VN7A 3D48R 3MOBH 5DTFA 3C5SB 3JWNC 5E94A 2C4FT 1QP1A 3HZKA 1B2WL 4HD9A 1KPVB 4XVUD 4WFFE 5TE6L 5HGBA 3VFUA 1OSPL 4TYUA 3L7EB 1E4KC 4H8WC 2EEAA 1IZKA 4RAHA 3I75B 3QNYA 3BD3A 2Z8WC 3GHBL 3PNWA 1JYXA 3FQXA 1RUKH 4XP1L 4YDVA 2UYLB 1IL1B 1IRAY 4G8FA 4XPHL 5DJ8B 2P5EA 4DKAA 2J8UB 4WU5B 3MLVL 1QKZL 2V2TA 5DJZB 3OAUH 3QIUA 2ZG3A 4HCRH 2FX7H 4F7EB 1FLRL 1Q9OA 4X6CF 3DVIA 1MF2L 4MNGE 4JRYA 5ITFB 1A4JB 5A16B 2YD8A 5IKCB 1N8ZB 4FQCH 5GGQH 4XGZA 1RMFL 2FATL 4LVNC 3EOTH 4PLKC 1NMBL 1HSBA 1T20B 4MJ4A 4P2QD 3HI6L 5KSAC 3B8YA 3QDMB 3K8LA 5C0JA 3VRJB 1ITBB 1RZ7H 4POZD 5I1CH 4DGVH 4EI6A 2FGZA 4HJ0D 1DN0A 3GI9H 2XZQH 5L2KE 1KJ3H 4GLRI 4CVZB 1NUDA 2QSQA 3H0TB 2IQ9H 4HS6B 1PZ5A 5GRWA 1BMGA 3RGVD 3J8F7 4DTGL 3MNWB 4A6YA 4MZ2A 3EOAB 4JB9H 4HJGA 5FHAH 3U0PB 3E8UL 1QSED 4GBXA 1A3LL 3Q1SL 3IJSA 4GKOA 4P9MH 2BNRD 1GHFL 4BZ2H 1YEDA 3DUSB 1MREH 5TQ0L 3SGKA 3NCYP 4GRLC 4V2BA 4NCC2 4FZEH 1VPOH 1F2XK 3CNKA 2QKIB 2G9HA 1IAIL 2Z4QA 3FMGH 2DQGL 1ZT1B 3H8NA 4MJ6B 2PXYB 4Y4KC 43CAA 4QWWD 4Q6IA 1OF2B 5IBTH 1OW0C 1BVLB 4LLQB 1B6UA 4P2RE 2AXFB 3NN8A 3ARWA 4Z7NE 3ARYA 1IM3A 2FECL 4FS0A 3ZKMD 1HQRB 2PETA 3M1BA 1ZGLA 3KXFE 5SX5K 4AEIL 5ADOL 2MCG1 3WJLA 1OB1A 1MEXL 3DSNA 4XC3L 3RVXD 3ZTJG 4P4KA 3GMNB 5DHXB 3VRIA 3RUGF 5I8EA 2YWZA 4JDZA 4IRSA 3QPXL 3U9UA 3VCLB 3GO1H 1WT5A 4X7SH 3IKCA 3KLHD 1MVFA 1WSST 3U9PL 4E42B 3MJ6A 3HNVH 3KYMB 4XAWH 3RZCA 4PJ7B 2DI8A 5FUOL 2ZCHH 2BVUA 4ZPTB 1UCBH 1AXTH 3FQTA 1N6UA 4CW1A 4YR6B 1JZ3A 3BX7C 1NFDE 1WBXB 1EA9C 4OZHA 2AJVH 1QSEB 1PLGL 4AEFA 2PF6A 5E6IA 1I7RB 4AH2A 5I1DB 4KGJA 5JXAH 3T4AB 4JO3L 2DTML 5CEZL 2BNRB 4XVTL 1G0YR 1W72L 3FQWB 4ONFL 5E7FA 5HGAB 3VD7A 3WFBL 4O2EB 3V5HB 2WBJC 4XMLH 5DD0L 3SY0A 3CH8A 1X5JA 2QQLL 3PWPD 2ZWLT 4WUUA 1MJ8H 4NQUA 1NEZG 2YSSA 1W2KT 5GRZA 3DYPA 3G6JA 3HFML 4MNHB 1J0ZA 3F7QA 4P2CG 1S78D 1EEZB 3T2NL 4UDTA 2IQAB 4L8BA 1YY8B 5IFAH 4WRLA 1MPAL 1I9IH 1CD1B 5FGRA 2GSIB 3ZYOA 1YMME 2BRQA 4XH2B 5E5RB 3O45A 4LSUL 1SMAA 4BH7A 2GK2A 4QT5A 3AREA 3Q0HA 3QT2A 3T65A 1KNOB 3NCYS 4A2LA 3CX5J 1NAMB 5CJQL 5AAMA 2R4RL 3DECA 1A7RL 2YPVH 1N59A 5FA3B 2FO4A 2R23B 4Z0XA 4O51A 2XY1A 3RY5A 3IGAB 5J7CC 1K9TA 5A2JH 3SDAB 1HH9A 1TJHH 4OD3L 5IMOA 5LGJA 1NLDL 1FG2A 3MRDB 5FYKH 2JCCF 4DUWA 1ONQB 5JW5B 3RVVC 2XTJC 1AGDA 2EE9A 1U8HB 3L3GB 3BOVA 2EDEA 3MUHL 5HHXL 4ZFZA 3SDDD 3DRQA 1JNNL 3C8DA 1C08A 2O5XL 4PJCA 4YHIB 1WC7A 5D2LA 5IHUH 3BP5B 5ANMA 2ZUQB 1ZKAA 2XKNA 4PGZA 2XWBA 3MRQA 5D2NE 3PWPB 3UEZA 3RA7H 5JIKA 3BPOB 3TNMB 2EZ0D 2ZUWA 3RDTA 1ZVYA 3DRTA 2EDRA 4U6TA 4L1DA 3QI9D 4G42A 4LGSB 3TZVA 1IEAA 1M05A 4FTVD 3OJ2C 3QQ3B 4JM2D 4EVNB 1CXHA 4PJBF 5AD0B 5FF6A 1MCIA 2P8LA 5J8OA 4ELMA 3X3GH 4XCEB 4OFVA 2DM4A 3I6LE 2NXZD 1NBVL 3IFPA 2VC2H 3U7WL 4XXCA 2A2QT 2BVOA 1BD2E 4AL8H 1ADQA 1ZA6A 4HIXL 2DBLL 4G8GA 3EYOA 3RIFF 4LQ1A 1EIBA 2ZUTA 1HXMA 4GQ9H 2ZNWA 5ADPL 1IGYB 5KS9B 5I8KH 4JPVH 3FOLA 1DQDH 5FCUH 3P9MA 2JB6B 4LDEB 5JTWA 4JFHE 3MLYL 1VERA 3G04B 3O2DH 4RRPG 5C09D 4R96B 1IAOA 1NMAL 2AGJL 4NC0B 3MACH 1PEWA 4XAKE 2VQ1B 4JFED 4GG6E 5JPNA 4ODXB 4PJAF 2VUOA 4XP5L 3UTSD 4KK8D 2D7TH 2DQFB 4G5ZH 1UB5B 2VDOH 4KAQL 4CVWA 4IRJA 1FFOA 1I7ZA 1XF2B 2EDQA 4U1HA 4PY8J 3SDDB 4R90H 4OLUL 4C56A 2FX8H 4WFFD 4LCIH 4AZ8A 4PD4K 5IOPB 1U95B 4NZUL 1G7QB 3LS4L 3TPUB 4RDQF 5C9JB 5CEZD 1G9EA 4LCWA 2Q20A 5KVEL 5IMKA 3F5WA 3F58L 1SM3L 3RIAF 1CFNB 3QI9B 2V17H 1CFSA 5IBLC 2Q8BL 1SYVA 3LN5A 4JM2B 1MHPH 3K2UH 2FD6L 4YHOH 1MFCH 2XN9D 1JWUB 4PUBH 2NXZB 4I13B 3H9SA 1JYNA 2AV1B 3MJ8B 4NZRL 4RAVA 1A1NB 4RBPK 4IDJH 3FB5B 3GMRA 4KHXH 1MJJA 3NZ8A 3SGJC 1B0GA 4DQOL 5EFIA 5GS0C 1YN6B 3L95B 5KSVB 1WF5A 5D7SL 2FEDC 4U49A 1GGCL 2NTSP 2H8PA 1NDMA 1BIHA 1QBLL 1I4FB 4ZDHA 5C0RL 3WS6C 4P9HC 4R7NB 3CXDL 3T0VA 3IF1B 4KV5F 4LNRA 1NMCC 1GPOL 4PRPA 1FRGL 1C7SA 1KEMH 1VGEL 3AB0C 4U6HA 4JFEB 2JIXA 4LGRB 3UTSB 5HVFB 2H32B 1CFTB 5CHNB 5GSVA 5HHNB 4I18B 3QQNA 4PJ8D 2J88H 1MI5A 3QEGH 2W9LA 4OIIH 1D6VH 4ZXBC 1NJ9B 2WV3A 5DUBA 1F58L 5DD6A 5JW4R 1X4XA 4MAYD 3GSRA 1A6TB 1RZ8B 2EDNA 4GH7B 1H0DB 5E2JA 1PQZB 3F65A 3BDYH 3O4LD 4G6KH 2FH8A 4OZIA 3KPOA 3ZHKA 4NP4L 3MBED 5GGSB 1W72B 5C0AD 5DRZA 1RSFA 2DKMA 4K94C 4NRZB 3CVHL 4ZUSB 5JQ6H 1TTUA 3VJ6B 4PGBA 4ZOBA 3FRPA 5BXFB 4HMEA 5T1LD 3ARBD 3IJHA 1IQWL 1J86A 2AERT 2OMNA 1F42A 2XN9B 5FB8A 5E6ZA 2JJVA 3MJ9H 4R4FL 1IAKA 5CD3A 1NC4D 4JRWA 4NWUL 2NY1B 3MMEB 2CIIB 4KPHL 3WE6A 4YH6A 3EGSA 3S36X 2DOCA 5JW4M 1N0LA 1E6OH 2RB8A 2Y6SD 5D96C 2ITCB 1CG9B 4NKMB 3HLAB 5IW6B 4GKZA 2GK0A 4WI7A 5D5MF 1DVFC 5EZIH 5DD1H 2R1XA 3G5YA 1T04B 2HYMA 2CR3A 4O58H 1AGEA 4KUCF 1CL7L 2A83B 5I17A 3OKKA 4LVOB 3G5VB 2H2SD 1G7IB 5E00B 3ARSA 3HG1E 4L4VA 2P49B 2Z8SA 4J3TA 3P9LB 4L3EA 4NQEA 3NTCL 3VXRB 5I1LA 5EU6E 4PJ8B 5ALCH 4WW1A 1WGOA 3UCRA 3T0BA 1K8IA 2DQHL 2IPUG 5JZ7D 5C86A 4MAYB 4NGHL 3BSZH 3VDCA 2B1HL 4M3JA 3U46A 5ESQB 2BRRL 4FQJL 3VFVA 4ZUUB 3RWJB 4IEFB 3RUGE 3V4UL 4R8WH 1D5ZB 4ZO6A 1JBJA 4ALAH 3MLRH 3QDGA 1OP3H 3O4LB 4CU7A 5DMIL 1AQKH 1A9BB 3RWFB 4KRPD 5C0AB 3JV6A 1GRWA 2NY0D 2Z35B 3TV3L 2Y7QB 2V9RA 2RCSL 2MQ3A 1A64A 1LD9A 1FO0A 5H37H 5HYFA 3HB3C 3ARFD 2KKQA 1CS6A 3QHFH 2XQYK 5DI8A 2B0SL 5T1LB 3TYFA 4MVBC 4U3CA 2NY2C 5K33A 1CWVA 4IOIB 5D7JD 3OJDA 4R0LC 3LRSB 1AGBA 1FGNL 3DJ9A 5D1ZA 1KCRL 5B39B 5CZVL 4HXBL 3NACH 4S10A 2XWJB 5KVGL 2BMKA 2X4QB 4QY8A 4MB4A 5K59F 3MRRA 3IDIA 1XGTB 4OZ4A 3BZ4A 2QR0B 3L3HA 1LP9F 4M6NH 4WTZG 1AY1H 1F4WH 3QFJA 2FHBA 1DFBH 4P4RB 4M7LL 4KJWD 3B2UD 3GSVB 3U4EA 5CJ5A 2D31B 4XPAL 1ZVHA 1U9KA 4MNQE 4XX1G 4JY5H 2C3XA 3SKOB 5F9OH 2MSPA 4ONGH 5JR1H 1NUGA 2DS4A 2IFFL 4LCUB 4OCYH 3N9GH 1BIIB 3O6KH 2E9WA 3UTQB 3CVIL 1T1XA 1JNHA 3DV4B 4HUVA 4CJ1A 3OKOB 5FGSA 5A2FA 2YD4A 3B9DA 1CD0A 1OTUD 1TVBA 2R39A 4MX7A 5FDYA 4JFPB 4K23H 4S1DD 4Y4FA 2JJSC 1ZT4A 5GS2D 1KEGH 3KG5A 5CGYC 3VW3L 4ODSH 1OAQL 4KRPB 2W38A 4ZFOA 4F7PB 1E27A 2NY0B 1XGUA 3V4VL 1H15B 8FABA 3FO2B 2X42A 3IT8D 5IWLC 3ARFB 4ZUTA 1RIHH 3C60D 4JKMA 5K9QI 3DUHA 2JCCE 4GOSA 4PRDB 1KTRL 3OGCB 3VE0A 1KXQE 4XB8A 1HCFX 3PWUA 5D7JB 3IKKA 2PNDA 3HAEH 3IDGB 2FDBP 2AJYH 1VFUA 1LILA 1FVCA 2DLFH 1N6QL 1ZHBA 3R8QA 4XPTH 4M4RA 4YHMH 5JIIA 2PTUA 4GG8B 4MD5B 5C3TA 4Z77A 3V4PL 4N90E 3STLA 2F5BH 5FEBA 2AJZA 5IFHL 4WO4D 1HHHA 1X7QA 1S7TA 4M48H 5DJ2A 4Y5VB 5I1HH 1AFVH 3O4OB 1MAMH 5BS0D 3KDMB 4KVNL 4KDVA 1FH5L 3GKZA 3MYJB 4I4WA 4I0PC 3LY6A 1SYSB 4KMTH 4PJBE 1GGBH 5DFTA 3BIBX 3MRKA 3ZKQD 3O2VL 3UMTA 3C9NA 5F1OB 2AJ3A 4N8VB 3VD5A 1UWGL 2HTKD 1IARB 3A67L 2R0WH 1LE5B 1RZIA 1RY7B 1HDMB 2EYTA 4TQEL 2DQIH 5EC1A 4MA8H 2PW1B 1FIEA 1R3IH 2NCMA 4LCCB 4Y5YA 4OB5L 2ERJC 1MNUH 1HINL 2VLKA 1QLRA 2BNQE 1UKSA 2UZIL 5F7DB 3DHMA 5M94B 4I9WD 3LKSA 4MAUH 1PAMA 3TBSA 3QEUA 2VLRD 2OTWB 4HKZA 4LSTL 3KWWA 3PQYE 1KOAA 4PJAE 5DO2C 1GZQB 5E2UH 3DUUA 4X83A 1RULL 3KPSD 4QTHA 4N9GB 3C60B 3AAZA 3AY4C 4Y1AD 5C0IB 4IM8A 3MLSH 2GFBA 1P4IH 3CVHB 4M03A 4Z76A 1XGRA 2NR6C 3RWGA 5EZOL 4WW2F 3W9DA 1T7XA 1T5WB 2IPKB 1WZLA 4WW2C 2R1WA 5IB1B 3N1FC 3FO9A 3PJSB 5DJ6A 4L9LB 4NRYA 3HZYA 3LKPA 5HYSG 1BQLH 4XNYL 3ZE2F 4G8EA 2VDLL 2O26U 2NLJA 1NAMH 2IADA 1I8LA 2FHFA 2X89D 1P7KA 1RJLB 5BS0B 3WLBA 4CNIA 1VFAA 4YO0A 4KKCD 4M7ZB 3VWKC 3RWIB 3ROLA 5F88A 1ZHLA 2WUCH 3IB4A 1T66D 5LVEA 1FFPA 1JPTL 4E41A 1OM3H 2ITDB 1YDPA 2DKSA 1HNFA 2DF3A 4TULH 3TYGH 4HS3A 4O4YH 5AUMB 1UT9A 1IAII 1PY9A 3D39D 3V6ZA 3VXPA 1PX3A 4LEXL 2GSGB 1Q72H 4MD4A 4OCNC 3VGGA 3RL2A 2XWTA 3QJFA 1BWWA 2EIBA 3CSBA 5KSAD 1HHJA 1CDGA 3L3DA 2IBZY 3SGDI 5FKPB 5JW3H 2Z8VC 4XRCA 2ORBL 2BSSA 3VXPB 3NA9H 2RQ8A 5T1KA 2G5RA 2FECI 1A7NH 5J6GA 5F72S 2F53D 4PB9H 4MA7H 4PGEB 3ULSB 5HGHB 1IGIL 3SHSA 2EYSB 4KV5E 2HFGL 3AXLB 1OGTA 3WFHA 2Y36L 3BKCL 1FGVL 2J12B 5IBUG 3Q6FA 1B2WH 3FOMB 4Q9RH 4PR5B 5E4IA 3IETA 4X6FA 4OTXL 4YBHA 5GGRA 5T1DL 3K4ZA 5TE6H 4LAQL 1OSPH 1XF3A 1II4E 3O2DA 3NABL 2X2YA 3ARPA 4JN2B 4X99B 2R4SL 2EIEA 3GHBH 5DK2B 1G6RL 3OJVC 4PRIE 4XP1H 1ZWIB 5FOJA 5HHOB 3FN9A 3N85H 4XPHH 3GSXB 1H3PH 3ARGA 3TJHD 4XVSL 3HNTL 3MLVH 1FBIL 1QKZH 2AEQH 4KQ3L 2VR9A 5IG7A 2FRGP 5JOPE 3MLPA 3QQ9D 3RBGA 1FLRH 5AWNL 3WUWA 5D7IB 5C6TL 1MF2H 3QULB 3RWEA 1RJYA 2NPLX 4EJ1C 1I3RB 3QUZC 3D69A 1ZTXL 2NY6B 4M93C 3QDJE 4AG4L 3HG1D 2R2EA 2WP3T 1RMFH 2AI0L 2FATH 3D3VB 3BAEL 1NMBH 4UV7L 3HI6H 1C7TA 2LU7A 4XNMA 1BBJA 5I66B 3VGEA 4HEPG 1KJMB 3DNKA 3Q6GL 2DBJA 4YGAB 1B4JL 2ADIB 2AV7A 1LE9B 3REWB 1ZMYA 5KSAB 4JFDE 4F7TA 4ZUWB 5JO5B 4HEME 1UACL 4X6BB 3WKNA 5JXEA 2HJKA 4NBZB 5D5ME 1MLBB 4UTBL 3E8UH 3UROR 1KC5L 2F53B 1A3LH 5E8EB 1RK0B 5SWZA 1JV5B 5C0ND 2R8SL 3BN9C 1GHFH 3ARTA 3O8XC 4D9QD 4LNVA 2YN5A 4Y0GA 1SJEA 3VI3F 1GJIA 4CGTA 1EHLL 4OCWL 2EDDA 2VLMD 4XCCL 3WKML 1IAIH 2LVCA 4H88L 2DQGH 1S9XA 4WHYG 3QQ4B 3CFIC 2R0ZL 4XMPL 3K80A 2OP4L 3QUYC 1I9JL 3ZKXC 1I8IB 2Z91B 3SKNA 1TXKA 1XGQA 3FRPG 1T22A 3EHBC 1O7VA 2H6PA 3QUXB 2F19L 3VD9A 1TVHA 3OR6B 4Y4HA 1H3XA 5BZWA 4YXLL 4C83A 4PTUB 3MV01 1TPXC 2VLJA 5D7LE 1RUML 4W4NA 3D0VA 5GS0L 4NPYB 4OD1L 4PV8B 1V3MA 1MEXH 1QR1B 1EJ6A 1J10A 1GAFL 5EOCJ 2ESVE 4P9HL 5B8CB 2OXHA 3QPXH 4HWBA 2H32H 4YBLC 4I0CC 1U8IB 4Q6YA 2VDMH 3U9PH 3VFOB 5K59E 4WU7B 3EFFB 2XA3A 4DN4L 4WEUD 5FUOH 3CUPA 2EEDA 5MENA 1LP9E 2OK0L 3V6OE 1PLGH 1S7QB 2NW2A 4JO3H 2W9DL 2DTMH 3SDCC 5CEZH 2JB5L 4XVTH 1W72H 2A9ML 5KTEL 5L2JB 4ONFH 3BPCB 1J0KA 3BGMB 4RX4D 1PYWB 1YC7A 2WWKO 3RVVD 5J56B 2XTJD 3WFBH 1YA5A 1Z0MA 4K71C 5DD0H 1J05B 1X5AA 2UVFA 2QQLH 4LEOA 3PWJA 3MA7A 3UZEA 3MRFA 2M8XA 1OD9A 3E6FB 2C26A 2Q76A 3IJYB 2UWEA 3ULUL 4U0RC 2MOVA 1LO2L 4GBXC 4BH8B 4U7KA 4HXAL 4U33A 3T2NH 1KB9J 1F3RB 1BVZA 2Z31C 3SGKC 3V0AC 5JLZB 2DN7A 3H9ZA 1MPAH 4PJHB 3T0EA 1ED3B 1YEFL 4OZFB 5KANG 2YD7A 1QR4A 3RU8L 1NGQL 1S7UA 1PY4A 3VRLF 4DGIL 2HP4A 3DROB 3WSQL 5F71A 3TVMB 1A6VL 3VXTB 5SX5H 4W4OA 4B0MM 1MCPL 3C5SA 4UOJA 3GJFB 4H0IA 5CJQH 2DWEB 1KPVA 43C9B 2R4RH 4Q6IC 1A7RH 4HZLB 3SO5A 1XIWD 4G6JL 2NXYB 3LCYA 1AD9B 1FCCA 3I75A 3TCLB 2IEPA 4OD3H 5DK3A 2UYLA 3BYYA 1IL1A 3EYQD 1NLDH 1A6UL 1WISA 2B2XL 3O2WL 5DJ8A 2LVEA 5ISZE 2J8UA 4WU5A 4H5SA 2DWDB 4BQ6A 2LV4A 1TZIB 5DJZA 2XFXB 5DJDB 5ITBL 4P4KC 4F7EA 2BC4B 4K9EC 1BFOB 2XIDA 3UZQA 5HHXH 4C4KO 4OLEA 3PQYD 4IRSC 1JNNH 5ITFA 1A4JA 4JFFB 5A16A 3NIFF 2O5XH 3BRGC 5IKCA 1N8ZA 5A3IC 2W59A 2K7QA 1KFAL 1T20A 4JR9L 1NGPL 3PV6B 3QDMA 5GS3A 3VRJA 4OZHF 3TEUA 1WIPA 4XVJL 2NY4C 5E6IC 1QBML 5T1MB 1QEWB 4CVZA 4RCAA 2GKIA 3H0TA 4HS6A 2ZSVB 1FC2D 4DWHA 1BX2B 3MNWA 1NBVH 4B53A 1FZMB 3U7WH 3QP3A 1G6RB 1NDGB 3EOAA 3UC0L 1XCTB 3U0PA 2H1PL 5ERWB 4WI2A 1WLHA 1AXSB 3FO1B 4HIXH 4X5WB 3DTXA 2DBLH 1VGKB 3DUSA 3G6JF 2Q1EA 1A02N 4X9HA 4KK6C 2P5WD 5ADPH 4N0FB 4EBQL 4S1SL 1DQQB 1XIWB 1DQML 2ED8A 2KZWA 1LK2B 3HRZA 2QKIA 2PO6B 3MLYH 5GS0D 5IUSA 5C0CD 4U1NB 2FEDD 1FVDB 4G43B 3MYZA 4MJ6A 2PXYA 1NMAH 2AGJH 2DM3A 5IQ9B 1OF2A 5E99L 1BVLA 4LLQA 4XP5H 3BKML 3ZE2E 5FO7B 5IVOA 4GSDL 5EWIL 3I85A 1P5VA 3VXUD 3AREC 1GGIL 2AXFA 4I2XB 1MQKL 1V5JA 4KAQH 5BV7L 4S0SD 2EE2A 3TF7C 1HQRA 1A9EB 1CBVL 3T09A 1JTTA 4OLUH 1OP5K 1AKJD 1AO7E 5A1AA 4NZUH 5MEPB 4M1CD 2VZSA 3LS4H 4PRHD 1I3VA 3GMNA 3B9AA 2JJUA 3TO4D 1BJ1H 1M7IB 4OFYD 3BJ91 4P23B 4BFGA 5KVEH 1UVQB 5HY9B 2D4FA 3F58H 2YKLL 1SM3H 3VCLA 5D6CB 2EDHA 4OT1L 4OKVB 4IS6B 3KYMA 2Q8BH 3FFCB 4PJ7A 4PJCF 1JGDB 2ZUSA 2FD6H 5D2LF 3TGXA 4ZPTA 3WDIA 2DLGA 1RPQA 3RGVA 5F1KC 4YR6A 3ULUD 1CN4A 2WM0A 1WBXA 2HJFB 1QSEA 1CDBA 5HDOA 1S9YB 4NZRH 1I7RA 3Q3GB 5I1DA 3T4AA 2I07A 1FN4B 3RDTC 2BNRA 4DQOH 4MCYB 4QTIL 4UU9B 4YNYB 2X1PA 4LLVB 4ZOEA 1KIPB 3BPNC 3FQWA 1U2HA 5JOEA 5SWQB 1GGCH 3TZVC 4U1GB 5HGAA 4O2EA 3V5HA 2P5WB 2V9TA 4N0UB 1QBLH 4ELMF 4JCLA 5C0RH 1KUMA 4NDMB 1A6ZA 1XR9B 1AP2B 4RGMB 3DX9B 1L0YA 3CXDH 1CVSC 1BQHB 2N1KA 5C0CB 2CGRL 5MHSE 5EZLB 1YECL 1GPOH 4MNHA 2PW2B 2X1WL 1FRGH 1VGEH 3CLFL 3QO0A 2DDQH 4KJPC 1EEZA 3OV6A 2IQAA 2KQMA 1T2QL 4G80B 4X9BA 5CJXA 1YY8A 3VXUB 4PG9B 3TCXA 1CD1A 2AW2A 4OF6A 1FL6B 3B5GA 5GGTL 2GSIA 4ZFGL 1UA6L 4XH2A 5J0BA 1GGYA 5GS2H 1WBZA 5IB3B 1AKJB 1A6PA 2FB4L 1KNOA 1NAMA 2EH7L 5DRNB 4PRHB 5FA3A 2R23A 4NP4H 3TO4B 3MOAL 5T3ZE 3IGAA 4FOMA 4LVHB 3BEWA 4QF1B 5DD5L 3CVHH 5I74B 3H9HB 3SDAA 4NN5C 3WO4B 4IRJC 4JJ5A 2OL3B 3VG9C 5IEKB 2NW3B 5MERB 1IQWH 1ZS8B 2E9JA 3MRDA 3EDKA 3PL6C 3F6IA 1QRND 3QRGL 1JZ5A 1ONQA 5JW5A 1VADB 4IOFC 3VMPA 3HB3D 2HAZA 3L3GA 4NWUH 1ZVSB 4KPHH 2ZNXA 1S7WA 4RBPH 3V6FB 4D8PA 5F9WC 2YUVA 1JHLL 1UXWB 1RZKL 4N68A 2ESVD 3BP5A 2ARJB 5TQ2H 4JPIB 1X5LA 2EKJA 3VG0H 4HWUA 1DLFL 3PWPA 1VA9A 3QZWG 3QA3B 3TNMA 1EFXD 3QYCA 4TTDC 4NM4L 2WWMD 5IJVB 2ID5A 2QQQA 1CL7H 2YMXL 3NH7L 4GW5A 3QQ3A 1ODAA 4EVNA 5AD0A 1V7NL 2Q8AL 4ETQB 1FDLL 2YUXA 3PDGA 4XCEA 1MCEA 3NTCH 5KOVC 5D71L 1TJGL 4ODUB 5BZDB 2HG5B 5AYUL 2QBWA 5EU7E 2DQHH 4WJ5B 5K9JL 4NGHH 1Y6NR 5LKNA 1CDJA 2B1HH 1LO4L 3HI5L 1GXEA 2DD8L 3BQUC 2BRRH 3QAZB 3FCTA 4FQJH 5IP4A 4RGNB 4XWGL 3V4UH 2P5EE 1XF5A 3S4SG 4R97C 2BHYA 5DMIH 1EVUA 5KS9A 1NC2B 2JB6A 15C8L 5I1GL 3TV3H 3G04A 1N3NB 2RCSH 4PG2A 4JRYE 4K3DH 3V9FA 4R96A 2FIKB 4HW6A 2VQ1A 4QXWA 3VDBA 1KJ2B 4ODXA 3P0VL 2DYPD 2B0SH 1WCBB 5CGYD 1U8NB 1QRNB 2DQFA 5CGTA 1QHPA 4OZIF 1UB5A 5F7LB 1FC1A 1FGNH 5GZND 1KCRH 5JUEL 5CZVH 1XF2A 4HXBH 5KVGH 1HKFA 4MDJB 3STZB 3MRIB 3AVEA 3SDDA 1J8HD 4QRPB 3MLUL 5IOPA 1U95A 1G7QA 3B3IB 1R6VA 2ZCLL 3TPUA 1FV1B 2VXSL 5C9JA 4L5FL 1EFXB 4M7LH 3D85D 4XPAH 1CFNA 3QI9A 5FYJE 5D7KE 4FTVA 4JZOB 2X9YA 4JM2A 3RI5F 1DBAH 4JGJA 2H45A 4MCZB 4QO1A 5C92A 2IFFH 2RBLA 2XTLA 2FL5B 4I0PD 5I1IH 3QRFM 1R5IB 3VRLE 1G1YA 2V5SA 3CVIH 2AV1A 3WN5B 3MJ8A 25C8L 1A1NA 4ENED 3FB5A 5F7KC 1ZANL 2CLZB 1YN6A 3L95A 3MNVA 5BV7B 1MHEB 1TZGL 1I4FA 1QSFD 3VW3H 4R7NA 3FQUB 4NYLB 3IF1A 3V4VH 4IMLB 1H3TA 1SEQL 3T77B 3TO2B 4PJGE 4JFEA 1WWBX 5L0QC 2DYPB 3UTSA 5IB4B 2H32A 1CFTA 4G6FD 5CHNA 1XCQB 3QIWB 5ENWB 4NQSB 5HHNA 1OCWL 4I18A 4KHTL 1TQCB 4ODTL 5DO2D 4W6WB 1NL0L 1N6QH 1NJ9A 3P0GB 3B2VL 1PSKL 3NIFE 1A6TA 5LWYL 1RZ8A 2OLDA 1J8HB 3HZVB 3RVWD 3V4PH 5GRXG 4M00A 1H0DA 5HI3C 2X7LB 5IFHH 3FB8B 1PQZA 5F7MC 1WWCA 2DLHA 3MNZB 4YXKL 4X9IA 4R3SA 3L3KB 4OZHE 4KVNH 5GGSA 1W72A 2D2OA 3D85B 5I2IB 4NRZA 4N8CH 1IC7L 4ZUSA 2I9LB 2YPLD 2G75B 3VJ6A 5BXFA 3UDWA 2R9HC 3O2VH 4PREB 5CSBA 1MELA 1FAIL 3CDGB 3DHJA 2XN9A 4WWID 4NQCD 1UWGH 3L9RB 3A67H 3GK8L 4WUUE 1IGFL 1T6VN 2ARWA 2PYED 5H37G 4TQEH 3G6JE 2CIIA 3SJVD 3JWOC 4PLOB 3NCEB 3E2HC 5DSCB 3KPTA 1FNAA 3QXAB 2ITCA 2F54D 1CG9A 4NKMA 3HLAA 5IW6A 4OB5H 3LV3B 1CDUA 1HINH 2OTPA 2AK4D 1E4WL 1FSKB 3U1SL 2UZIH 1QSFB 2AS5M 1J88A 4LKCA 1T04A 1ZSDB 4LSTH 4J3VA 4UIMB 5DMGC 1JGUL 2A83A 5KBNC 4KZDL 3S7GA 1QQDB 3G5VA 4FABL 5JDJA 3SBWA 1G7IA 4TVPE 4G6FB 3P9LA 1BWMA 3CDCA 3GBNL 5ECJE 4WFHE 4BA8A 4PJ8A 4YDLC 5F7UA 5EZOH 1UH4A 4OZFH 4Y4FC 3QPQC 4LK4A 4MAYA 5ESQA 4ZUUA 5FYJL 4Y5XB 1CVRA 4XNYH 3RWJA 1D5ZA 3G5ZB 4HUNB 1T0MB 2VDLH 4YPGB 3PHOB 4ORGB 3O4LA 4TNVF 2MKLC 4JHZA 4U1JB 5DC4B 3MCLL 5HXMA 1A9BA 2HN7B 5C0AA 4G6ML 2Z35A 5DLML 2Y7QA 3T0AA 4PJCE 5D93C 5D2LE 1JPTH 1DQJB 2L7JA 5ANME 3ARBA 5T1LA 4BFBD 1V7MH 3O3UN 4IOIA 4NQCB 2ED7A 5J11C 3LRSA 2JJTA 1F13A 1NC4A 4LEXH 2PYEB 1EXUA 3O3BB 5B39A 4OKDA 3HNSL 2XWJA 3SJVB 3SE4A 3ZO0A 2X4QA 3DURB 1INDL 1MFBL 1FFNA 1BHGA 2P45B 1XGTA 2F54B 2QR0A 1KXVC 4GAYB 4ELME 1ZGLM 5KZCB 5EOCL 3HAEG 2AK4B 4JZJB 1DUYB 4AENB 3NFNB 4DW2L 5MEOB 4QHMB 1IGIH 5DR5H 5HPOA 2HFGH 4P4RA 5FOBB 3MROB 3GSVA 2Y36H 3BKCH 1FGVH 2D31A 4QGYA 4E0RB 4G8GE 5GGVL 2M26A 4OTXH 3VXSD 3WDJA 5T1DH 3GSNB 4LAQH 1MRFL 4RQQB 4NNYB 4F37F 4LHQB 2HWZL 3NABH 4Y5YC 2DKUA 3UTQA 1E4XL 1JHTB 2R4SH 1A21A 5SX4I 1G6RH 1CZ8L 4HMDA 5D4QA 3DV4A 2A6IB 4BFEA 3OKOA 4XCFL 2AEWA 5BVJB 4AT6B 4FQXB 5I8CB 1BZ9A 4XVSH 1RFDL 3HNTH 1FBIH 2D0GA 1AQDA 4KQ3H 3QUYD 1F5WA 4JFPA 1U8LB 2XV6B 3L5WB 5AWNH 4K7PL 5C6TH 3P9WB 1CDCA 1BPVA 3HA0A 4F7PA 3CXHJ 1X5IA 4HKBB 1H15A 4Z9KB 4C56E 4AG4H 5ESAB 3ARFA 4HIJA 2WK2A 2NNAB 3BAEH 1Z9SA 4UV7H 4PRDA 3X3FL 3OGCA 3IDMB 4UAOC 4CUCA 4Y88A 5D7JA 4JDTL 3DX6A 1YEKL 2APBA 2ADJB 3IDGA 4LMQI 3C8HA 1EUUA 4G9FD 4RMRA 3Q6GH 1I8LC 1CD9B 1B4JH 1ERNA 4GG8A 4MD5A 1GIGL 4F9PA 3QCTL 1OAKL 4Z95L 5DFWH 4P99A 1UACH 3CFEB 5ICYB 2YA0A 4Z78B 3MRHB 2DIBA 4UTBH 4Y5VA 1IKNA 1KC5H 3H9SE 3KDMA 5BMFL 4X7DC 2R8SH 3MYJA 3LB6D 5I15L 1SYSA 5DEZA 3B4NA 1JUFB 3VXSB 3IRZA 3RL1B 3LQAL 5J57B 1EHLH 4OCWH 4TUOB 3SDCD 4DCQB 1RI8A 3WIIL 2DQCL 5BJTB 1VDGA 2EKSA 4XCCH 3WKMH 3MQIA 4N8VA 4H88H 3ETBF 3CLEL 1LE5A 2R0ZH 3DVNA 1I9JH 4HJJL 1HDMA 3U4AA 1P4BL 2Y23A 4PRPE 4UQ3B 1PKQB 3ECBB 2X70B 4MXQD 4E9LA 3G6DL 3I3EA 2PW1A 3FB6B 4OCXL 4LCCA 4OGAC 2F19H 3DPBA 4GBXD 1G7JB 4YXLH 1MI5E 5B38G 5F7DA 4Y16B 2A6DB 2Z31D 1RUMH 5FYJD 2OTWA 5GS0H 4OD1H 4JKKA 1GZQA 4OQ1A 4OJFL 3MRBB 5C0EB 2F5AH 1GAFH 4N9GA 5F89B 1QO3B 3C60A 1INQB 4M8QB 5C0IA 4OZIE 4P9HH 1SVZA 3CVHA 3PP4L 1MCWW 1K5NB 4G9FB 4HUKB 2IPKA 1IGCL 3O6FD 4CVXA 3PJSA 5IW1B 1OY3B 4DN4H 2X09A 2VSDA 4L9LA 5F6IC 5TJWK 1ZE3C 3W2DH 5F96L 3DXAD 4YBLB 2X4RB 3F7PC 1LO5B 4JE4B 1U8MB 4WO4A 3W5MA 5HGGS 3FO0L 2OK0H 1CF8L 5I18L 2I27N 1RJLA 2RJMA 5BS0A 4M6OL 1BZ7B 2W9DH 3MLWL 2JB5H 5DK0B 2KPNA 4JVUA 2O5YL 3RWIA 5KTEH 5FFLA 3PGDB 5ABDE 1X9QA 1CFBA 4NKQB 5I9QC 2ITDA 2CDEB 1HN1A 4IRSD 4P5MB 1EHAA 1ORQB 5AUMA 1JIBA 4N9OB 4WTXA 4K94H 5EZJB 1NKRA 1IE5A 5GRVK 1QTYT 5E1HB 3ULUH 2GSGA 2IFGA 1LO2H 2X05A 1W8NA 4HXAH 4NN6C 5FGCB 3S5LB 2GAZB 3GIZL 5F70A 2V7HB 2ICWJ 5FKPA 1D5BB 4L4VE 5F9JB 1F4XL 1GZPB 1MJ7H 1YEFH 4L3EE 4NQEE 1EEUA 4PJFB 4RFOL 3IRPX 4ZAKB 3RU8H 4BQ9A 1NGQH 3K4AA 4DGIH 3DO3A 3ULSA 3QDHA 4F15C 4FMFA 3SCMC 3AXLA 2Z31B 1A7QL 2VLRA 1MCPH 1FHGA 4PR5A 1OT2A 3KPSA 4R2GC 3SO3B 3QDGE 5IROC 1QYGL 4G6JH 2M2DA 1U92B 1T1ZB 2HKHL 4JDVB 4JN2A 4X99A 5HHME 5DK2A 1U6AL 5GISL 4Y4HC 1T03L 4JG1L 1ZWIA 2FGWL 3O6FB 3P2TA 5B21A 5HHOA 1UENA 5F7NC 4V2CB 1HOCB 1A6UH 2P8PB 3GSXA 4Q7DA 3O2WH 1R24B 3TJEL 2E6QA 3DXAB 3FZUD 4GMSL 5ITBH 2W0KA 4QHLB 2X89A 5D7IA 4J1UB 3QULA 4N0CC 2I9TB 4LPCA 3TC9A 1KTLB 1I3RA 5I1AB 4U1SB 4EUPG 2FCBA 3LN9A 2QADC 3ZL4L 2AJXL 1ZXQA 1CGUA 1KFAH 1X44A 3HMXL 4JR9H 4C57C 1MCLA 4BKLB 5I66A 5GRVL 1KJMA 4XVJH 5BOZG 3OJMB 4I77L 3VXMD 2P24B 1QBMH 2ADIA 3REWA 5KSAA 3ZZ1A 4D9RE 3DVFA 3AS1A 5IQ7L 4PJ5D 5JO5A 3KPPB 3OXSB 2W60B 4MJID 4LIQE 4X6BA 1NPUA 1MLBA 3UC0H 2DLEA 4EI5B 2H1PH 2ICEB 5FAAA 4P57A 2F53A 2CJUL 5E8EA 1RK0A 3LPGA 1JV5A 2L0DA 1NBQA 5TFSL 2UWEF 3SQBA 1GC1C 4KZEL 2FEEL 3V6BR 4FG6C 4H26B 3GKWL 1JRHI 1AR2A 4S1SH 1DQMH 3T0EC 4KDWA 2UY7A 4F80A 2LFGA 3QQ4A 3G5XB 4HSQA 4NSKB 1I8IA 2XZAL 4PGCB 2Z91A 4LSVL 5E99H 4I1NB 5TGBB 3BKMH 1WEJL 4J6RL 1FZJB 4KUZL 4GSDH 2FLBT 5EWIH 5IVZA 1GGIH 1YZZA 4W4OC 4WEBL 1MQKH 3QUXA 1TVDA 5BV7H 2M1KA 1A7OL 4PGDB 3OR6A 3BEVA 3MPCA 5DJXA 4PTUA 2A74B 2GTZB 3QUKB 2EE6A 4NPYA 1KJVB 4PV8A 1QR1A 1KTKE 4XNXH 3X11B 5BO1L 1J5OL 1B6DA 5IIEB 2J8UF 1DEEB 5B8CA 1TNNA 4K3JH 4OCSL 3SKUD 2QTEA 2YKLH 1U8IA 2VLLB 4OT1H 1KB5B 3VXMB 4WU7A 3EFFA 2GITB 1ROWA 4MYWB 1KCSL 4X0KB 1V3KA 1DEDA 4PJ5B 1I1FB 1A14L 4MJIB 1EX0A 4LDLB 2FHCA 1S7QA 1TIUA 2W91A 3PL6D 1F6AB 2X10A 5T5NG 5L2JA 4M02A 3BPCA 3BGMA 1PYWA 1JF1B 3I84A 2CUHA 1FO0L 4KU1A 2QLVB 3O9WD 1J05A 2VLKE 4LCWD 1F02I 5C3LD 1HZHL 4I48B 3E6FA 2CGRH 3U7YL 5TDOB 4FFYL 3NIDF 3IJYA 3ARUA 1YECH 2CRYA 3X13B 3CLFH 1LQSR 4R4ND 4G6AC 1DBJH 4BH8A 4EXPX 1HEZB 1T2QH 3H7BA 4TTDD 5JLZA 4R26L 4I5BB 4XNQB 4PJHA 5EU6B 3W81A 1ED3A 4OZFA 4Z0BL 1XZ0B 4XVUC 5C2BL 5GGTH 4ZFGH 1UA6H 3C2SA 3DROA 3HR6A 3SPVB 3JWOL 3LEXA 3MRCB 5B39G 5FYKE 3VXTA 4K2UL 1OP5H 2FB4H 2R0KL 2OMBA 3GJFA 2PXYC 2A1WL 2EH7H 2DWEA 43C9A 5J06A 4NOBA 3D2UB 4N1CA 4HZLA 3MOAH 2R2CA 2EXYC 3BQUD 3GB7B 4LIQL 1JZ2A 4NO0B 1FLTX 5DD5H 1AD9A 2H9GB 4JG0H 2YOCA 1JFQL 3TCLA 5HHPB 2CDFB 3KS0J 2FJGB 2DIJA 1DP0A 4E41E 4EKXA 3BGFC 1WIUA 2DWDA 1TZIA 2XFXA 5DJDA 1F3DJ 5JMRA 2BC4A 2E6JA 1BFOA 3BKYL 2CQVA 4LFHD 2WAHA 3PL6B 2Q6WB 1JHLH 5JW4Q 1RZKH 2MFNA 4R4BB 1MVUB 5FV2A 4PJ7F 3WBDA 3O9WB 1OAYL 3RWDB 1DLFH 4NM4H 3PV6A 3SE3C 3I3DA 5HDQL 2F8VA 2YMXH 3NH7H 3DARA 4GRWB 4DFHA 1IEHA 5T1MA 1QEWA 2XA8L 1V7NH 5CP3H 2Q8AH 1FDLH 1RHHB 5IV2B 2ZUYA 1BX2A 2P42B 4I3RL 3G9VA 1FZMA 4LSRL 1G6RA 1NDGA 5D71H 1TJGH 3UJJL 5AYUH 2A73B 1Q9LB 5ERWA 5HGDB 5K9JH 2MKWA 1AXSA 3FO1A 3OKLB 4H0GA 4X5WA 1VGKA 3HI5H 4OIAA 2DD8H 1D5XB 5CIPH 1R3KB 4XWGH 3AMLA 2ILLA 4QWWC 3O3EB 2ATKB 4UB0L 1DQQA 1XIWA 4HZAA 15C8H 1LK2A 2PO6A 3BQUB 4G3YL 4Z5RB 5I1GH 4U1NA 1FVDA 4G43A 5FGBC 2A0LD 4YFLI 4TSBL 4TUJB 5IQ9A 4EEEA 3UTZB 3P0VH 3D0LB 5FO7A 2CRZA 4I2XA 3Q5TA 3LIZL 1W0YT 2BY0A 4MQ7B 3TT1H 3RVXC 3GRWH 4N8VG 5JUEH 1A9EA 1JVKA 2WUBL 1PGRB 2EEBA 4X6DB 5CMAB 3MLUH 3SDAC 5MEPA 1BFTA 3E3QC 4LARL 3MX0A 2ZCLH 4HUXB 2H26B 4BFIB 1NCNA 2VXSH 5JA9A 1M7IA 3M8OL 4KKAD 4L5FH 3K8MA 5HHMD 1UVQA 5HY9A 2DQJL 1U8JB 5SWZE 5D6CA 2C4XA 3ZHDA 4OKVA 4IS6A 4RA3A 3FFCA 1JGDA 3BD4A 1WZMA 1MIML 2JELL 3ES6B 3IDNB 4AIXA 4Q74A 4NO2B 2OJEB 1LWRA 2ZUQC 3NCJL 2HJFA 4HGWB 1S9YA 25C8H 3CXHK 1MCRA 3Q3GA 1FN4A 4MCYA 4UU9A 4YNYA 1KIPA 3CPLB 5SWQA 3DETD 1IC4L 3NFPB 2P5WA 2BXZA 4N0UA 1TZGH 3QFJD 4PP2A 1S78C 1MHHB 1NH6A 4N5EC 3VGFA 4ZNEA 4LKXB 3QWRA 1XR9A 1AP2A 4P5TD 3DX9A 3WNLA 1BQHA 5C0CA 3FB7B 1Z3GL 5EZLA 4UDUA 2MHAB 2VLJE 4ZFFB 4PJAB 4K07A 2HA1A 2PW2A 5ICZB 4Q9CA 1AD0B 3B6SB 5DQ9B 4G80A 3GMOB 3VXUA 1D6EB 1OCWH 4PG9A 5DMGD 4ODTH 1T83A 5KS9F 1FL6A 1NL0H 2AAVA 1JTOA 3B2VH 1PSKH 4HS8H 4NJ9L 5AZEL 5LWYH 2J1KA 2X4OB 4U3HA 5IB3A 5HYQB 1AKJA 1ZA3B 4TRPL 4PG2C 4P46B 5MENE 3DX8B 1Y6KR 4YXKH 1IQDB 5DRNA 4MA1B 2IALB 2VB5A 4PRHA 1N0XH 1C5CL 5KSUB 3TO4A 4YE4L 2EC8A 3PE9A 1TLKA 4OFYA 4QF1A 1E6JL 2E7CA 1IC7H 5DRXB 3H9HA 2VMFA 2OL3A 3I2CL 2GT9B 3FJTA 2NW3A 3TBYB 4B50A 5IEKA 3QWOB 5MERA 1ZS8A 2CPCA 3SDDC 4G7VL 1KBGL 1FAIH 3FFDB 5L9DL 3U0TB 3TA3D 5ID0B 1TZHB 3GK8H 4TN9A 1E4XI 1VADA 1IGFH 1T21B 1J9CT 2UWEE 2I5YL 1ZVSA 4CKVX 5DVOA 1PW3A 4JRXD 3V6FA 35C8L 2EZ0C 3KPNB 4K3GA 1JI1A 1UXWA 3BPLB 5EU4B 2PN5A 3QI9C 5J12B 4JM2F 4JPIA 5FUCE 3KR3L 5EPMB 1NCAH 3H2WA 1E4WH 1CXLA 1CGYA 2FWOB 4P5TB 2YZ1A 3KJ4B 3QA3A 5IJVA 1VEOA 2FBOJ 3I3BA 2VDKL 1JGUH 4QXGL 1MHCB 4KZDH 3QEHB 4FABH 3EUUA 5HD8C 1MSPA 4ETQA 1T0PB 3GBNH 3K2MC 3THML 5IJKA 1MCBA 1ZGLP 1KLUB 5BZDA 4ODUA 3ALPA 3PIQB 4PRIB 3T0DA 2HG5A 4ELKA 4XMKL 4WJ5A 3PP3K 2IAND 4RAUB 4XWOD 4U3XA 4Z7WB 2P43B 5FYJH 3W9EB 4YDLB 2HJLB 3RX8A 4OFDA 3LRGA 4ETYA 4JY6A 2J8UE 3ZE1F 1P84J 2OR8A 3MCLH 4MDIB 3GUTB 1MY5A 4G6MH 3BFOA 5DLMH 4I18C 1N3NA 1NGWB 3VGBA 4YXHL 2FIKA 3LKQB 3RRQA 3HZMB 1AGFB 1KJ2A 3OPZL 1WCBA 5CD5C 4NO5B 3CCHB 5CLTA 1QRNA 4X8JA 3TA3B 2UV3A 3QDME 3DO7B 2VXQL 1MUJB 3HNSH 1WV7T 3LZFL 4MDJA 3STZA 1QZ1A 1INDH 1MFBH 2CLVB 3MRIA 4JRXB 3NOIA 4JFDB 2XQYG 4KK9C 1V3JA 1TQBB 1SEBA 2W92A 3P3YA 5EOCH 3B3IA 4OV5B 4KKLD 4NBYB 3UDWC 3PWVB 4DW2H 1FV1A 2FYYB 3NIDE 3FT2B 1EFXA 5EUOB 4YDKL 2IGFL 4HWBL 3MOQA 5IHZB 1F4YL 3FHAA 4JZOA 2NY1C 5GGVH 4HK3N 4RFNB 1EEYB 4MCZA 1BREA 4N5UA 2LE9A 4KC3B 1MRFH 1WIOA 2W0LA 2VDRL 2FL5A 4GXVL 1C12B 1R5IA 2HWZH 3QXDB 1N26A 1E4XH 4TNWK 1CZ8H 3WN5A 1JZ7A 2WP3O 3DYOA 4J3OC 4XCFH 3RVUC 2IANB 2CLZA 2W9EL 1MCHA 3ORJA 1QOKA 4LVOC 1MHEA 3UBXB 4K7PH 4Z7OF 3MV8D 4GKSB 3FQUA 4NYLA 3D18B 4ODVL 1QG3A 2AKRB 4OI9A 4PJ8C 3O41B 4IMLA 2C9AA 2JJSA 5JOFB 1REIA 4MAYC 1N5AB 2DYPA 5IB4A 2XKUA 3X3FH 1XCQA 3BRDA 4NQSA 2A9NL 4JDTH 1YEKH 1C5DB 3HPJB 1GIGH 3HZVA 1J8HA 3QCTH 4UAOB 5BRZD 1OAKH 4Z95H 1OAXL 4PJ7E 5FKAB 2X7LA 3ZTNL 1NSNL 3FB8A 1DR9A 3MNZA 4NQDB 1QLEL 4FFZL 1P2CB 4OZFG 1RZFL 3L3KA 4OAWB 5BMFH 1QSEE 1EERB 3BUYB 2BNUB 3MV7D 5I15H 3D85A 2I9LA 4MXWH 2BNRE 2G75A 4ONHB 2HLFD 5IESL 5JHDD 3LQAH 3SE4C 4PREA 3DI2B 3CDGA 2F9BT 3WIIH 2DQCH 2NTFB 2Y6SC 2DQEL 3A6OA 4I0PA 1DBMH 2B7DT 3L9RA 1B90A 3CLEH 3NCMA 2ICES 4TUKH 3NFSL 1IJ9A 4HJJH 1LEIB 4N0YL 1A5FL 2B4CL 1P4BH 2IPUK 2X1XR 7CGTA 2Y9RT 1A47A 3QWQB 3G6DH 5DSCA 2NX5D 1MIEL 5DUML 4Z7UB 5DRWB 1F11B 3QXAA 4OCXH 4XZUB 4DOHB 2UY6A 5GGTA 3BISA 5JMOC 3JV4B 5CBEB 2ICCA 1QSFA 3MV8B 2J7LA 4WHTB 3K4DA 1YNLL 1ZSDA 4DZ8B 4UIMA 1J1PL 4JFZL 4OJFH 4YEFA 2IH1B 1J1XH 5JZ7C 1QQDA 4KMLB 1FL5A 3SCMD 4PLJD 3WS3B 1L0XA 2I26N 3PP4H 2HT2C 4FXGB 1IGCH 4R2GD 5DHVB 3FHQA 4GXUM 4KRPC 2NY0C 5BRZB 1CQYA 4DKEL 5F96H 5DDHB 4Y5XA 3G5ZA 3ARVA 1T0MA 4YPGA 3PHOA 3FO0H 4ORGA 4U1JA 1CF8H 5I18H 3P40A 4CMHC 4M6OH 1SBSL 2HN7A 3MLWH 2YR3A 2O5YH 5D7JC 1S9WB 4HWEH 1QFWI 2CDGB 4HG4J 4LPTA 5KOMC 4S0TD 1DQJA 1P6FA 1TTGA 4R7DB 4HIHB 5JHDB 3KGRA 5C9KA 4YLQT 4F9PC 1GGUA 4U7SA 3PWPE 4NQCA 2EDOA 2QADD 5D70L 4Y5VC 1IKNC 2PYEA 3HE6D 4YHKL 5CP3A 3DVGB 3SJVA 3DURA 4QRTB 5I71B 1HH6B 2NX5B 2F54A 4GAYA 1F4XH 4RFOH 4M1GL 2AK4A 4JZJA 1DUYA 4AENA 5IVXE 5MEOA 1NQBA 4QHMA 4KTDL 1WZ1L 5FOBA 3MROA 1A7QH 1D5IL 1I1YB 2UUDK 4WTWA 4LCYB 3WNNA 4YK4B 2C3HA 4E0RA 4JM4L 2CD0A 3GSNA 2J8OA 4GRWH 4F15B 1QYGH 4RQQA 4NNYA 4GJTB 4XT1C 2HKHH 5KS9E 1OTUC 2AEPL 4L4JA 4LCCC 3K46A 4YQXL 3NAAL 3LKOB 5EN2B 1MWAB 4XCNB 1U6AH 5GISH 1KCUL 4HPYL 4R2GB 1T03H 4JG1H 2FGWH 5DGRA 2ZP0T 5EBWB 3VH8G 2A6IA 3JWDC 4RA0C 4HULB 5BVJA 4AT6A 3TJEH 4FQXA 3T0ED 5I8CA 1BJ8A 2PTTB 1RZJC 1UGNA 4HC1A 4JO2L 4RDQG 1JHKL 5K9OA 1KTDB 4GMSH 1U8LA 3L5WA 3QIBD 3C60C 3VXQB 1CGSL 2FX9L 2YA1A 2HH0L 2AQ1A 1TENA 3FQNB 4I0KA 4HKBA 5ESAA 2H2PD 1JL8A 4UIKL 3ZL4H 2AJXH 2NNAA 4L9LC 3HMXH 3LEVL 1HCVA 1MCJA 3IDMA 3NCCB 3VFSB 3MLXL 5CEYB 3HKFA 2ADJA 4BSJA 5F7WC 2QADB 2R2BB 1V8HA 4JY4B 3HE6B 4I77H 3TIDA 4FTVE 2X4UB 2Z92B 1Z9LA 5EU5B 3VFNB 1XMWA 3RJQB 3ZSTA 4YFDB 2HMIC 1FNEB 1HI6A 3CFEA 5ICYA 4Z78A 1BOGB 3MRHA 3FTGB 2E27L 1UFUA 4M43L 2SEBB 2CJUH 3EDFA 3MV11 5TFSH 2CKBL 2HTKC 3OKMB 2MPAH 1BF2A 5HVHB 4KZEH 1JNJA 1JUFA 1U41A 4D0BB 3VXSA 3BH8B 3GKWH 4OCRL 3RL1A 5LJYH 4TUOA 5FUZL 4DCQA 1IFHL 4OM0L 5BJTA 1DE4B 4HBQA 1MH5B 3LAFA 3WNPA 4LLWB 1FAKT 3C08L 3MXWH 3WLWC 2ICWB 4LSVH 4UQ3A 5IF0B 3DIFB 1PKQA 3ECBA 2X70A 5GIRA 1WEJH 4J6RH 1N5YL 4KUZH 4JFEE 3FB6A 3ZE1E 3VXOB 3T08A 3UTSE 3TBWB 1WQVT 4WEBH 4KVCL 4YX2L 1A7OH 2RGSA 4KXZH 4G6AD 1E28B 1MCDA 3QIBB 3IU3B 4MA3B 4RSVA 1WAAA 2A6DA 3U4BL 2WANA 5EBLB 5FIEA 3SE8L 4V1DD 5C0EA 3MV9D 4RIRB 4YHNB 5BO1H 1J5OH 2XNAB 5F89A 1QO3A 5CUSL 3MJ7B 1INQA 4M8QA 1MFEL 2C1PB 2FJHB 2X4NB 4TPRL 3KHOA 5CEZE 4OCSH 1ZLWK 3IS0X 1Q0YL 1K5NA 2DJSA 4B7IA 2PXYD 4FFVD 1INEL 4FXLA 4G9FA 5D7IF 5DQDL 4X9GA 3RY6A 1HHGB 3UYOD 3RNKB 5IW1A 1KCSH 2EXYD 3CD4A 4KKCC 1FZKB 1MCWM 3MO1B 1A14H 4DVBB 3N1MC 2NY6C 4AMKL 2X4RA 1LO5A 1T66C 1U8MA 2XN9E 3OAZK 5J4MA 3F6LA 1KPRB 3EO0B 4YIQB 3VGDA 4OFIA 1I8MB 4M3KB 5DK0A 3DMMD 1I9EA 2FJFB 2QEJA 4LF3B 4XHQA 2AXJA 3PGDA 1EO7A 1GVIA 4ZSOB 1FO0H 2CDEA 3SDCA 1ORQA 1HZHH 3U7YH 3REVB 4FFYH 5EZJA 4HIIB 4WFED 2RFXB 2OJZH 3RKPA 1VFMA 4L8DB 3S5LA 1A1MA 5C8JB 1TETL 4R26H 1KN2L 1X6NA 1D5BA 2EIZB 5F9JA 1GZPA 4ZAKA 1HNGA 1JGVL 4Z0BH 4PJFA 4Z7OE 5C2BH 1J1OL 9CGTA 4Y8AA 3UBXI 1QD0A 3JWOH 1ZLSL 2Z31A 1CXEA 1JK8B 4K2UH 4G8FB 2R0KH 4XPGL 4KROD 4V1DB 1K85A 1WCQA 3MV9B 5F9AC 3QIUB 3ULVL 3O4LE 1U92A 1T1ZA 2BY3A 3TJHC 4LIQH 4P59L 1DN2A 1IILE 1U0QA 4JDVA 5C0AE 5DJAB 3QUXC 1JFQH 4HQQL 2WBWB 4X5XB 1IAIM 1VKXB 3QQ9C 1A6AB 4AM0B 3O6FA 1AHWB 1HOCA 1L7IL 2P8PA 1R24A 5HI5C 2J6EL 1S9VB 3DXAA 1H5BB 4QHLA 5IFJB 2EIDA 4LVEA 3BKYH 4J1UA 5B8CC 2I9TA 3BGFB 3DMMB 5I1AA 4U1SA 5IHLB 4EDWL 4QHNB 5HVWA 3V5KB 2FO1A 4OGYL 5I19L 2YRZA 5CEXA 1OAYH 4URTB 5SWSD 1QNZL 4YHYB 1OTTC 4BKLA 5HDQH 4O5LL 3SDAD 5GXBB 1I8KB 2VH5L 3LRHA 4LLUB 2P24A 3M17A 4KH2A 2XA8H 4ZS6D 5C0NC 4M1DL 3KPPA 3OXSA 2X44D 4I3RH 1CE1L 4LSRH 3UJJH 4EI5A 2ICEA 3GM0A 3OL2A 4L8SB 1EZVY 4KJQC 5AZ2H 1A7PL 3OR7B 4KROB 2OTUB 4H26A 4UB0H 5IMLB 4PJHF 4XPBL 5EO9B 4G3YH 4WEMB 3M1BB 1AI1L 2DB8A 4TSBH 1OGAD 4GO6B 4NSKA 4PGCA 4KJYA 1ITCA 4N5ED 4PJGB 4GLRH 4FQIL 1HQ4B 4OM1L 5TGBA 5C0FB 3TVMC 1TFHA 1FZJA 4U31A 3LIZH 2YBRB 2YUZA 1SBBA 4PGDA 1NANI 2VZOA 5KN5B 2A74A 3BD5A 2GTZA 2NXYC 4UINH 3QUKA 3IXAB 1Q9WA 5F9DC 3RZCB 3FAWA 2VAJA 1KJVA 3UAJC 4LARH 1LO0L 4XTRD 3X11A 5SWSB 5IIEA 4EIGB 3M8OH 1DEEA 2CKBB 4DEPB 5INDB 4FQPA 2DQJH 1AJ7L 3BO8B 1CQKA 4JPKH 3IDYB 2VLLA 3N06B 3WFZA 4RISL 1KB5A 3VXMA 3S35L 2GITA 3ARXA 5TPWL 3QXWA 4PJ5A 1I1FA 4QHUA 1Y18B 1MIMH 2JELH 1RUPL 2XZCL 4MJIA 2V6HA 3NCJH 5JIHA 5DYOB 2D3VA 1P1ZB 3WNKA 4TOYL 5AAWA 1IC1A 1F6AA 1IBGL 1H3VA 2Z0BA 5HPMB 1JF1A 4RWYL 1IC4H 3EIFA 2E9BA 2OZ4L 1S7XB 1NGYA 4OQTL 3K1KC 3I6GA 4NHCL 1ACYL 4I48A 2PKDA 1Z3GH 2EDKA 1FYTD 5TDOA 3K81A 3ALWA 3LKNB 3WHE1 3WL9B 3X13A 1OGAB 2CUIA 3ULVD 2DQDH 3C6SB 5JQHC 4PS4L 1HEZA 1K4CB 3QUML 1RVFL 4U1MB 1L0QA 2DI9A 4I5BA 5EU6A 3EJYC 1XZ0A 3MGOB 3HCVB 1A4KB 4ERSL 1LEGB 5HD8D 6FABL 1HH9B 1XIWC 3SPVA 4NJ9H 3MRCA 1I85A 3QXVA 2PO6C 4MHHI 5AZEH 3ALXA 2ZOLB 3VGHA 4TRPH 3B83A 3O0RL 3OAUL 3BI9X 1C5CH 3EYQC 4HCRL 2CXKA 1N7ML 1E6JH 4NO0A 3OF6D 5BS0E 4N1HB 2H9GA 4POYA 2E6PA 3BDBA 4W70A 5HHPA 2CDFA 2FJGA 5HTSA 3I2CH 5DHVH 3BZFB 4PJIB 4G7VH 1KBGH 3PHSA 4BM7A 1ZAGA 5L9DH 4Y89A 2K1MA 3ESUF 4DKDC 3HUJA 2GEEA 2I5YH 1UEYA 1M05B 4QLRA 5CD5D 4DGVL 2UVEA 4P23C 3GI9L 2XZQL 1PG7W 3PL6A 1ULVA 2Q6WA 1SHMA 5HYSB 5IB5B 1ETZB 1N2RB 4I3GA 2VL5B 4R4BA 3CFKB 3LQZA 1MVUA 5IGXL 3KR3H 4NOFA 3UTOA 1SVCP 3GJEB 3O9WA 3RWDA 2D7PA 4KK9D 2QSCL 4J3WA 1FYTB 4CADB 3IXTB 4I9WE 4PRBB 3PWLB 2VLRE 4QXGH 1AGCB 2ADGB 3UX9B 2ICWI 3BMVA 1OQXA 3KPSE 3UXFA 2VISA 1RHHA 1HKLL 5IV2A 4Y1AE 3HMWL 1M71B 3THMH 4U1GC 4NN7B 3BWUC 3FMGL 2NY1D 3EYUL 2A73A 4XMKH 3IDXL 1Q9LA 5FM4A 5KW9L 5DMJB 3BW9B 4RGMC 1ZLVK 5IBTL 3PXJA 3DGGB 3C5ZD 5HHOE 2P46B 1D5XA 1UM4L 5K93A 3KJ6L 1R3KA 3JTTB 5TF1L 5ALBL 4ZD3L 3QNZB 5TF0A 3O3EA 2ATKA 1EO5A 2NMSA 5I75B 3RVUD 3BQUA 5D7IE 4Z5RA 3UZVB 3ZKSD 3MFFB 1T83C 2P8MB 4TUJA 2ZUVA 4MB5A 3UTZA 3HMXA 3OPZH 3D0LA 1UM6L 4I8DA 3VXRD 4WFGD 4MQ7A 4BUHA 4X6CE 5IMKB 2VXQH 1T4KB 4M1CC 3D39E 1VSCA 1KIQB 5E6YA 4AIZB 3TO4C 5E0QA 1CICD 3LZFH 4IJ3B 2DQTL 1Y0LB 3JWDL 4LVHC 4MSWA 5E9DD 5MP6H 5I74C 4X6DA 5CMAA 5GS1B 1Z9OA 1RZJL 3WO4C 3EJZC 2AQ3A 4HUXA 5CAYB 2H26A 2VTFA 4BFIA 2AQ2A 1I3UA 3EOYG 3ULUF 4HX1A 2F53E 2LTQB 4YDKH 2IGFH 3GBLA 4HWBH 1U8JA 2Q7YB 1MJJB 3ULUC 3WYRA 5HYJD 1FIGL 1SJXA 5TDNB 5EOQL 1EBAA 3WHXB 3DV6B 2R29L 2VDRH 1KULA 3NZHL 2Y07L 3OB0K 4GAJH 4GXVH 3ES6A 3IDNA 3NIGF 2V7NB 4BSVB 4NO2A 2OJEA 3U0WL 1IZJA 3C09C 4HGWA 1J18A 1JNLL 3C5ZB 3PP3H 3CPLA 2W9EH 1U93B 5GSVB 3NGBB 2JTDA 3F7RA 2WWKT 3NFPA 4JFYA 1MI5B 1YNTB 1T5XB 4JGMA 4LKXA 3BP4B 1ZEAL 3CX2A 3FB7A 3RX7A 2MHAA 4ZFFA 4ODVH 5IJKC 4RNRA 4K3HA 1RD6A 4PJAA 4F33B 2JK5B 3TH3T 5ICZA 1U3HB 4OF5A 1AD0A 1GC1H 3T2PA 3B6SA 4OV6F 1G9ML 5DQ9A 5C1MB 4N0RA 2Y1VA 3GMOA 3BDXA 1CE6B 3QAZC 2A9NH 5E8PB 1D6EA 4RGNC 4MD0B 1FQ9C 4JFQB 3RTQC 3UPRB 1CICB 4CN4A 5E9DB 2X4OA 1OAXH 5HYQA 1ZA3A 2HT2D 3ZTNH 1NSNH 4P46A 3DX8A 1SMOA 1QLEH 1IQDA 4FFZH 2IALA 4HF5L 5KSUA 2IC2A 1NCCL 5JHLH 3KPLB 5F21B 4QYOB 3N0PB 5DRXA 5LQBH 1U8QB 2B5IB 3R0NA 3QHZL 3F62A 5HYJB 3WEXB 1HSAB 4NT6B 4D9QE 5IESH 1G7LB 3TBYA 2GT9A 3QWOA 3VU2A 3QJHA 1BQUA 2V9QA 4M7JL 4W6XB 4QCIB 2DQEH 3U0TA 1EHNA 4NJAL 5ID0A 3JTSB 1TZHA 2VLME 3NFSH 1T21A 5I1EL 4N0YH 1A5FH 1BEYL 2B4CH 3QUMB 5EBMA 1JI2A 2QHRL 4PJDA 4C4KT 2WWMC 4JO4L 4LSQL 1MIEH 5DUMH 1PZUB 5LG1A 5EU4A 2DTSA 4NQEB 4ODHL 5EPMA 4PJHE 3N1GC 3WD5L 5ID1B 2FWOA 4P5TA 1BM3L 2Y5TB 2VNCA 1EZVX 3GFUA 1YNLH 3U46B 1QSVA 1J1PH 4JFZH 3WN5C 1MHCA 3QEHA 4FQ2H 2JE8A 4UOW1 2J4WL 1MJUL 3IFNL 5TE4L 5I8KL 3TBTB 2ZG1A 5BV7C 3OSKA 3GMPB 3PIQA 3PDDA 4X4ZA 2APVA 2A77L 3VD4A 2VXVL 4F58L 3RKDC 2VABB 2VOTA 3MRMB 3P11H 5DJCB 4Z7WA 3W9EA 2HJLA 4X7EC 2F8XC 3DX7B 3BT2L 1HYSD 1U2CA 4MDIA 3QEQD 3GUTA 1UYWH 4LLMB 2NY5L 3OBAA 3QIWC 2APWA 2PUQT 1TQCC 1NGWA 2FX8L 5GZNC 3IDIB 5B4MD 4LCIL 4OZ4B 4X80L 3LKQA 2AP2A 3HZMA 1AGFA 2XTJE 1Q9KB 4CMHB 4YC2B 4NO5A 2IPTL 3CCHA 3TA3A 3O3DB 2ZJSL 1MRDL 5D70H 3DO7A 3U2SB 1SQ2N 5ILTL 1RURL 1MUJA 4YHKH 1F00I 1J87A 4JRXA 2CLVA 4JFDA 3TIEB 3BHBA 4MWFB 5F3HB 3H3PL 3GJFK 4KI5D 5GJSL 4M1GH 4OV5A 3PF2A 2BOCB 5HDLA 1MFNA 3QCVL 3PWVA 4M5ZL 4EIZC 4JAMA 2FYYA 5A43C 4KTDH 3CK0L 1JN6B 5EUOA 4YBQC 4RMQA 2HMID 1D5IH 5IHZA 3SKJL 3RX5A 4X7FC 5ACMA 4JM4H 3ILPB 3IVKB 4ENEC 3OB8A 1ZT4B 1XAUA 2AEPH 4FQLL 3RHWK 5DURD 3QXDA 4YQXH 3NAAH 1YQVL 5MI0B 2IJ0C 4HPYH 1FSKC 3CH1B 4YUEL 5I1KL 2IANA 4JO2H 2YEZB 5FHBL 4C55A 4QOKD 4I2XE 1UJ3B 3HE7B 5EC2B 3UBXA 3WLWD 5FYKU 3AFLA 1CGSH 1ZK9A 3QEQB 4GKSA 3RAJH 2FX9H 1ACZA 4IIQC 2HH0H 5KVFL 1R3LB 3D18A 4YDIL 4D0DA 5DEFB 2AKRA 3S98A 3O41A 1G84A 2AJZB 1M4KA 1EDQA 4UIKH 1OWWA 3P4OB 5JOFA 4JQXC 4NBXB 5D1XD 1N5AA 3LEVH 3RVWC 3MODH 4Y5XC 3MLXH 1RJZB 3QR2A 1C5DA 3HPJA 3D6GA 5HHOD 2R0LL 1DANU 5IM7B 4NWTH 1RZKC 3FFCE 5FKAA 3AU1B 2VJXA 2BK8A 3PG2A 3C9NB 2QSVA 4NQDA 2AJ3B 3VFRB 2E27H 1YC8A 1P2CA 4M43H 4NZTL 4K7FB 4OAWA 2BNUA 2CKBH 2PYFB 2NY6D 3KS0H 4RMTA 2QL1A 3MGAA 4WNQB 2UUDH 5KSBB 3D3VD 1XGYL 5FCSH 4OCRH 1X3DA 5FUZH 2P5WE 3B5TA 4N0UE 4OM0H 4ZNEE 2NTFA 3V7AE 5H8DA 2P7TB 1F3DH 5DURB 5CFHA 3TFKC 5DD1L 5C0CE 4JZJC 4LHUD 4HKZB 4O58L 2LABA 1LEIA 3C08H 1QPXA 1IGTB 3OZ9L 4Y19D 3BRFA 3DUUB 1BJMA 1N5YH 3CX5K 2ZZUT 4Z7UA 5DRWA 1F11A 4XZUA 3SEPA 3MCG1 3HC0B 3VXUE 4QOKB 4YX2H 2OI9B 3GHEL 3MRPB 5ALCL 3JV4A 3TWCL 4BUGA 5CBEA 4NKIL 3MV8A 4NNXB 1CGWA 4CDGC 3SN6N 1X5GA 4WHTA 2BVEA 4NRYB 3HZYB 3U4BH 3UJTL 4DZ8A 3GMMB 1RK1B 3SE8H 4UNTA 3LKPB 2IH1A 5D1XB 1QFUL 2IBGA 5CUSH 4XHJD 2QHLA 1MFEH 4PRHE 4AJ0A 4TPRH 4WI4A 4FQXC 3WS3A 1Q0YH 1U58B 1INEH 5DQDH 4FXGA 5DHVA 4PJEB 5ICXB 5BRZA 4UT9L 3WXVL 4LSPL 1RIVL 5DDHA 3T0WA 4AMKH 3QUXD 4LMQE 3V6ZB 3ULUE 5FECA 1DLHB 4L3CB 5HI5D 4NUGL 3QJFB 3IU4L 3MV7A 1S9WA 4XBPB 3R06B 1C16B 4MS8D 4Y7MA 2CDGA 4XPFL 4LPXA 2K9UA 3W11D 3CU7A 4R7DA 4HIHA 5JHDA 5E5MB 1BLNB 5EBGA 1AY1L 2V2XB 1YPZB 2RAMA 4X98B 2IAMD 32C2B 4OZGB 4NO3B 3MFGB 1HIML 4LHUB 4L4TD 4P5KB 4Y19B 3DVGA 4JHBA 4QRTA 1OTTD 4PD4J 1HH6A 1V3LA 5F9OL 2NX5A 4HPOL 4MJ5B 2RIKA 3GM8A 4DTGH 1TETH 4HK0B 1KN2H 4GW4B 1JGVH 2C4FU 4ZYKB 2X4SA 4K7PX 1J1OH 2C5DC 4FP8L 4X5LA 2YK1L 4U05A 3Q1SH 4CJ0A 4L9DA 1ZLSH 5TQ0H 3RBSA 1OTSD 1I1YA 2VAAA 4LFHG 3ARGB 4IMKA 4LCYA 5A2KH 1RUAL 3CFDB 3L5HA 3RFZC 5I30L 2WW8A 1I9RL 3ULVH 3QZWB 3SCMA 3HR5A 5C08D 3U83A 4KJQD 4P59H 5B3NA 1G7MB 3MCKB 1ZLWH 1RJYB 2ATPB 1H9VA 3LKOA 5EN2A 4HQQH 1MWAA 5ACZB 4XCNA 1WAAF 5EBWA 2ZPKL 4Y16C 5IROA 1L7IH 3SGDH 1G6VK 2BHUA 5D72L 2PTTA 1HYRC 2J6EH 2AEIT 1KTDA 1QRNE 4BJLA 3V5DB 3B9KC 3OAZH 3V0WL 5I0ZA 4WVRA 3VXQA 2EDBA 3TVMD 4YFLF 4AEIH 5ADOH 4YHML 1MFDL 3FQNA 5L6YL 3BZEB 2DJUA 4UILL 4EDWH 4XC3H 4M7KL 3RY6C 4OGYH 3S4SB 3L6FB 5I19H 4RZCB 3FQRA 1QNZH 5DWUL 4ZO9A 4DZBB 2NXYD 4ESKA 2QJDA 1MAML 3ZT5A 1P4LB 1B4RA 4P2OD 3VFSA 4PFEA 4O5LH 5CEYA 3UAJD 3WFDL 2IAMB 3BWAA 4ORZC 4KRMB 2VH5H 2R2BA 4JY4A 3HE6A 4L4TB 3DBXB 3UTTD 3EDEA 2VXUL 2X4UA 2EDJA 2Z92A 4M1DH 5EU5A 2NYYD 3LB6C 4CMMB 2X1OA 5C0GB 1FNEA 1CE1H 3C6LD 1KIRB 1BOGA 3QNXB 3FTGA 4LLAA 2Q87A 2SEBA 1OSZB 4POUB 4M7LT 5LCVL 4Z8FL 1S5IL 2WINB 4JFFD 4NQTA 4P3CL 1XGQB 4MA8L 1O5DT 1A7PH 4KKNA 3OKMA 3TH2T 4D0BA 3KPRD 1JP5A 2CSPA 3BH8A 3PGCB 2OL3L 4ZTOL 4MXQC 1TVHB 4ISVB 3SDXB 3EO1B 4XPBH 5C08B 4PJFF 4OSUL 1DE4A 2VLJB 1MH5A 3JSSA 4ZAKC 3HFMH 4QRRD 3UP1A 4LLWA 3CC5B 2R2HB 3ARDD 3TBVB 3S37X 2ICWA 5T3XL 5IF0A 3DIFA 4FQIH 4OM1H 5HVGB 3HC4L 2J2ZA 2CIKA 3VXOA 1EAPB 4G9DB 1IT9L 3H9YA 5F6HJ 5KANI 3SO3C 3QIBA 1KGCD 3IU3A