3IFOB

X-ray structure of amyloid beta peptide:antibody (abeta1-7:10d5) complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQNIIHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKIKKVEAEDLGIYYCFQGSHVPLTFGAGTKLELERADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10D5 FAB antibody heavy chain
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 53
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifoB01
4NQED 5T3XH 5FFLA 5C09A 2IH3A 4KHTH 3OXRB 1JNHA 2A77L 3SDAC 1VACA 3BHBB 4YDVB 4PJBB 4JANA 2GI7A 2J8UE 1WBXB 2AERT 4HJJH 4LSPL 4XH2A 3FO0H 4P9HC 5D1ZC 1VFOA 5ANMA 5DMGC 4I48B 4AIZA 4XNQB 5J89A 4L9LC 1KCSH 4MA8L 4DCQA 3RUGA 3QI9A 4X4YA 4YDKH 3KLAB 3TC9A 3V6OE 1QHPA 5L88L 4Y1AD 2EXWD 3MV11 3M17A 1MPAL 1R5VB 1FNFA 1MRDH 3KYKH 4JKLA 1CR9L 4IIQB 5DFVC 2V7HB 1V8HA 2YA0A 4K94C 3U7WL 2FZ3A 4B0MM 1DBJH 1OAUL 1MELA 3CZFB 2B5IC 4NNYA 5JR1L 3QUYC 1J1OL 1ZWIB 1IZJA 3UJTH 1EGJH 5GGSY 2LAAA 1BQHG 1XGUB 5E8DL 5HDOA 2DRUA 1FCGA 1FHGA 2XYCA 4OT1H 1XT5A 3T09A 1YQVH 2ZUYA 2P45B 4G80A 1LEGB 4DZ8A 4Y19A 5I1DA 1JGUH 1NFIA 1QFOA 2W59A 4KKAD 4P49A 3WL9A 3HMWL 3VCLA 4AIXA 4BSJA 3UTPE 1X5LA 3T2PA 2EDJA 1M71B 1FL6B 3M8OL 1OTSD 4YHOH 1X4ZA 1A7QH 4F15C 2M8XA 4FXKB 3TNMA 5ERWB 1JF6A 1NCBL 1JHKL 3L5XH 1YEFH 1KACB 1GC1C 5CMAA 1GAFH 2OZ4H 5E94B 3E6FA 5FDWA 1KC5H 1PG7X 4A6YB 4Z7VF 1QD0A 4O4YH 3V6OC 1QEWA 3D85A 1T0MB 4OLVL 2D7TL 3QT2A 1UQSB 4M5ZL 1B6DA 2YMXL 5DRNB 3TT3H 3O3BB 3G5XA 4P5TC 4ZDHA 3LKPA 2CIIA 1EEYB 3ARTA 2VQTA 4OAWB 4Z8FL 3SDDB 1G7LB 1T2JA 3NAAH 5TQ2L 4JQXA 4X9IA 2YRZA 1QACA 2APWA 3VFNA 1MWAB 5JPNB 4PBXA 4FG6C 2DQGH 2BNQE 1QRNA 1AD9B 4BQ9A 4MJ5A 2UVEA 1UWGL 3KLHD 4NJ9L 3BKMH 2NW2B 3RWEA 5ILTH 5F7EL 5HDQH 5SWZE 4JFFE 3SY0B 1ZGLB 1OP3H 2JCCF 5BV7H 2EIDA 2YD4A 5ETUA 2RFXA 4P23C 1BIIB 3RRQA 5MEOA 1DEEB 1YEGL 2BVTA 1IC7H 1T1WA 4OZHA 3LPGA 2YZ1A 3QCUL 5DUBA 4CVZA 2OXGA 4LHJB 1R6VA 3EJZC 1FAIL 3TV3H 4U1JA 3EDJA 1J0IA 2IPTH 1JPGB 3DURA 3FMGH 1KPRA 3A6CH 2XWTB 1OP5K 1WAAE 3V5HB 2CJUL 5E2WH 2IAMC 1I1AD 1DUYB 2Z31C 1EHXA 2B1AH 1JWUB 4NPYB 2HVJB 5TFSL 1M1SA 2Q8AH 4JZJA 1W2KT 3F7PC 4ACPA 6FABH 4RGMC 4L4TD 4NWUH 5JQ6L 1KB5A 2Y23A 2EE9A 2OM5A 2HFGL 4JFZL 2ED7A 2EXWC 2UV3A 1BD2B 2DIBA 2WINA 5D7LA 5IMLA 2QADC 1RK1A 1LVEA 5BXFA 4MZ2A 4NDMB 3GO1L 1CLZH 1TJHH 3B6SA 3MLZL 3KPMB 4JGJA 2R8SH 4KRNA 3DXAD 3C8KB 1NCWH 4N8VB 1BQHA 4S2SA 1KIQB 5J1AB 4MXWH 2PYEA 3RJQB 4OCRH 2Q87A 1VGEL 5E7FA 1OAYH 3C6SA 5E8NA 4NC1E 5E9DB 1V7NL 1QSZA 3MV9A 2UYLB 5IHLB 3EJYD 3MLYL 5GZND 1HI6A 2PUQT 2DKUA 3B3IB 4PG9B 4XCNA 5CSZB 1RZIA 3TCLA 3BP5A 3N1MC 3U4BL 4RGOH 1JUFA 5IKCA 3Q6FA 3QWRD 1Q8MA 4IOSD 4ZUVB 3PWUB 4W4OC 3HG1A 3F12A 4NZRH 2VZTA 2DTML 1OGTB 1ZANH 1TZGL 4FABH 5CUSH 1UVQA 4YK4B 1NFDE 5IB2B 3G6JB 3MBXH 4NO3B 4KMLB 5EUOA 4MD5B 5GGTL 3DRTB 3LZFL 1YEJH 3FOLB 4ONOA 1NBVL 2R2HB 1BF2A 1OP9A 2AJXL 5D71H 3V6FA 4YBQD 4P0DA 3PIQB 5DHXB 2DL9A 2HTKD 4HGKC 3SO5A 2BXZA 3U9UA 2VKXA 4X4ME 3H42L 2CRYA 5ESAB 4CVWA 1DQLL 1FNSH 2CXGA 3REWA 5KVEH 2EC9U 5KOVC 5C0ND 3MFFA 1FE8L 5BVPH 4P2OD 4HS3A 3C5SB 2MJWA 1FPTH 4U05A 4G8GD 2AJVL 4UIMB 4D8PA 4RFNC 2VLKE 5IW3A 1JWMB 2W91A 3Q5TA 1OSZB 3THMH 2XY2A 4YHIB 3FCTA 3MROB 5I1IH 3DX6B 4KRPB 4KPHH 4QRRE 1VKXA 1OF2B 5DMKA 4Z7UB 3GMRA 1TPXB 2JE8A 4JKPH 1G7QB 2Y7QA 4NC1C 3SDXE 5GSVB 5FYLL 1IAMA 4H0GA 2NCMA 1HH6A 2JK5B 3QFJB 3NA9L 4GBXB 4MAYA 4LASH 1R3JB 4MS8D 2A1WL 1B9ZA 3O4OC 3KYOA 5L2KB 5EU6D 5DT1H 3SKOB 3VFWB 4Z9KB 1M7DB 5TE7H 1P7QA 3U2SB 2Q7YB 3TA3B 3TZVA 1I9JL 3F8UB 1R5WA 4P2QE 1EZVX 3UC0H 1CTNA 1NGZB 3RTQD 5MERA 5HDBF 5D1QC 2OSLA 2AJSL 5AYQA 4JJ5B 2FSEB 4PJGB 4JKMA 1NKOA 5C2UB 3PNWB 4AEFA 3LDBB 3FB8A 5DRWB 4JPIB 4H5SA 5F9JB 1N6VA 1CXHA 3RKPA 5TDNB 1TXKA 1NDGA 1YC8A 5D72H 3QXAA 3VWJC 4XXDB 1JPTH 3D0VA 1CU4H 1MY7A 3U4EB 2AKRB 1HNFA 1F6AB 3MJGX 4ZODA 5IHBA 1N5YL 3HUJF 3MUGB 4NQVB 3F7RA 5DXWA 4PJCB 4KK5D 5C0AD 3EFFB 3JTSA 2BSTB 4ODTL 3GMQB 1NC2B 3MJ9A 3HAEB 3OWEA 3STBA 1XZ0B 15C8L 1FBIL 3O11B 4PV8A 3UYOD 4C4KO 2NX5E 4M7KL 4GAGL 1W0WA 5D2LA 5TPWL 4N5UA 2FIRT 2FWOA 2NY5C 3IFOA 4F7EB 2AGJH 5KTEH 3MRCB 5DQ9B 1MCRA 1KGCE 4APQD 5F44A 3UYRH 1V3JA 4DKFH 3JSSA 2BMKB 5ACZB 4LHQB 2CKBL 4HJGB 4BYHA 2DDQL 3T0EA 2AVGA 4TOYH 4O02H 1KCRH 5DJDA 2BHUA 1OAZL 1UC6A 5JIIA 3QDGA 1XIWD 1I8KB 2BY0A 2VR5A 2DOCA 1QQDA 3IB4A 2F58H 1CIDA 2X9XA 4IRSD 3HZVB 1RZGB 3SQBA 4AEHH 2ZOLA 1I3RA 3KPSB 1NANI 2JJTA 1S5IH 2DN7A 2XKNB 4NOBA 3NN8B 4YGVA 1HEZB 4YGAB 4ZUSA 5I16B 1U3HA 4FNLH 1AJ7H 4HUVB 4IMKC 3FRPG 1H8OA 4NHCH 2EECA 4HFUL 3IXAA 1LEKB 3LQAL 3GGWB 1F3DH 4OLYL 3D2UB 3RWIA 4IBLT 3QUMH 3FB7B 2R4SL 2L0DA 1KCUL 3FN0L 3LOWA 2GCYB 4MQ7B 4XC1H 1S78C 4ZXBB 4WO4A 1AGEA 2HJKB 5D5MF 4EI5A 5KVDH 5H94B 3BN9D 3KS0J 4LNVA 2ARJA 3CVHH 5A3ID 4I18B 2NLJA 4K71C 4WEUD 5F3BB 1BQUA 1YEDA 2OQJB 1FZKA 1EEQA 3L7EA 1ZVSB 4JM4L 2VL5B 2AJZA 2X10A 1JTPA 2D4FA 4DAGH 2Z91B 3VXUE 3IU3B 1CIUA 4HKZA 3IXTA 1RULH 4KROD 4AYFA 1KTLB 5SX4H 3WFBH 4HCRL 1TQBB 1FLRH 4NZJA 4YNYB 1A9BB 4DUVA 4R4FL 4NCC2 5IB4B 3B5TA 3QDAA 1FSKB 5B3JF 5FM4A 3GI9H 2WWKT 2A9NL 5IBTH 4M4RA 3TO2A 3DVFA 3I02A 3K4ZA 4FP8H 3VFRA 3QNYA 1AIFA 4JFOB 3S34L 1S9XA 2QQKL 4NT6B 4N0FA 4Z7VA 4E41A 3DO3A 4FQXD 5E6IC 4UT7H 4PUBH 1NH6A 2QQNH 1NBYB 5GS1C 3BQUC 3DV6B 4F9LA 2AABH 2VZVA 4JB9H 1D5BA 1G1YA 1TZIB 4J7RA 1KIRB 2PTVA 2BCKB 3FFCE 3GSNL 3IDXL 2PYFB 3SO3C 2AV1B 3MRKA 4NKMA 1S7RA 5I0ZA 1LE9B 4TUKL 2R56L 3QO1B 5GGVH 4M7ZB 3P9MB 1FYTD 4GG6E 3BGFC 4PD4J 4X8XA 5ALBL 3SDCA 3ZYIA 4R9HA 3IFNH 1B4JH 1XF2A 5F89A 5EBGA 5DRZA 1WFNA 4NJAL 3TYGH 4P5MA 4XBEL 4P46C 1S7TB 3QHFH 5CJ5A 1S7VA 4FXGB 2JCCA 3CFEA 1CS6A 2CUMA 4CU8A 2CXKA 4ISVB 5JXEC 4M6OL 2Z92B 5D2NB 2VOTA 5IW6B 3OJDA 1C7SA 2H32H 1H5BB 2OTUB 4YHZH 5T1KD 3VGHA 3FJTA 1OGAE 3RP1A 3K0WA 1QRKA 1WV7T 4PFEA 2F9BT 5CCKH 2DQDL 1A1MA 1UXWB 1QSFD 1QFUH 1Q94B 2Q3ZA 4K2UL 2HMIC 3V4PL 3JWDC 4XX1G 3EYSH 1E4WL 12E8H 2HN7B 1FNEB 3R8BB 1FG2B 5F1IA 3GJEB 5GISL 4X7SL 2J6EH 2X4UA 1F13A 5I1GH 1K3ZA 3F7VB 5HXMA 3ZKNC 2OTPA 4OIIH 3UPCA 4O2EA 3HCVB 5HYIA 3MJ8A 3FRPA 3P0VH 1IM9A 1RVFH 4UBDC 3L3KA 5CZXD 1Q9WB 3N9GH 3OAZK 4O58H 3ARFB 1MI5E 5HGGS 2MKWA 4Z0BH 2AEPL 1YNKL 2DYPB 3ROOA 4RX4D 1UACH 2HH0L 2NY7L 5MENA 1IL1A 2XQBH 1OSPH 2OK0L 4RNRB 3L3IA 1GZQB 2FJGA 2BOCB 3G6JF 5GGQH 3QJHB 3QAZB 5GSRB 4LVHC 3TH2T 5JDJA 4H20L 1HINL 3FQWB 1IGTB 3OL2A 4PRHD 3VXSB 1I1YB 2CLZB 2IQAA 1CFTA 1JYVA 4KY1L 4QO1A 4G6FD 2VQ1A 4R4BB 3UJIL 3S35X 3PGFH 4LAJH 2VLRA 1BFSA 2D31B 2B4CC 2I9LB 4M62H 3JVGC 3BEWA 4TNWK 5KAQF 5DLML 4WFHD 1K4DA 2R23B 4AT6B 3K2MC 4WEMB 3VXMB 4PLNC 3BI9X 5K9QG 1BEYL 1YY9C 4GFTB 4WTWA 5FGSA 1TZHA 4ZFGL 5A2LH 3OAYH 5H35A 4L3ED 5KSAC 1KTDA 1JF1A 3MV8B 3OR6B 4EOWL 4NQDD 4E5XB 4FFWD 5H2BB 5EO9A 4R26H 2AS5M 4S1SH 4JFPB 4RA0C 3M07A 2Q6WA 3Q3GA 1G6RB 5IQ9B 4KZEH 4UTBH 1KJ3H 3L9RB 5DMIH 3MPCA 3ALXA 4U2YA 5DQJB 2VZ1A 4URTB 5IT2L 3AM8C 4Z7UF 3QNZA 3U82B 4X0KB 4PJEE 2CK0H 1P9MC 2X6MA 3H7BA 3HMXL 3BPLB 4HQQL 3MRJA 3P4OB 2NMSA 4I3GA 5JOPE 1E0OB 3PL6B 3CMOH 4ZYKB 1BZQK 2R0LH 4MDIA 2V2WA 1AXIB 1E27A 3QIBA 4PS4L 2ZSWA 4P5KB 4N9GA 4NM8H 5C9KA 3MLVH 1IC4L 3ZKQD 3I3EA 4OFPA 2P5EA 3FQRB 3VWKA 3LRGA 1Y6MR 2R69L 3I3BA 2P5WD 4U31A 4M61A 4ZUTB 3G08A 2LV4A 5SWSE 1A21A 1IAIH 4ZQKA 4Z7WF 1J8HA 3SJVD 2PCPA 4ZFFA 4LBEA 1UKSA 4PJGF 1KN2H 4PJ5D 1FO0L 2E27L 4OCSH 2YUXA 4ZFZB 1DQJA 2KL6A 3KPRA 4PREB 2J8HA 3C8HA 4OFIA 5LGJA 4CNIA 3MXWL 1FIGL 2IPUK 3WEXB 1DBBH 5D7JB 4E0RA 3O3UN 4NYLA 2JJWA 3TPUA 3RU8L 3DVNB 1F5WA 2AJUH 4BFGA 5E8PA 3FTGB 4PJXB 4NUGH 1IRAY 1Q9OA 3MA9L 4X6BA 3V4VL 3AROA 4NQCE 3VG0L 3GSWA 1IARB 4L1HA 1E4XH 3CCHB 5F1NA 4ZOBA 5E03A 1DQTA 4HCRA 2L4OA 4TN9A 5IIEB 3CLEL 2J8OA 1IEAB 3FO1A 1T04A 4HUKB 4MA7H 3ROLA 4X83A 2IMMA 1A6UL 1MHEB 4Y4FB 5C0BA 8CGTA 1W0VB 2FX8H 4P9HH 1L7TH 2JIXB 5FUZL 2ZCKL 3EOAB 3RDTC 1S3KL 4IM8A 3NIDF 5AZEH 4RCAA 3QDHA 3LPFA 4YHYB 4HWBH 1CWVA 1P84K 1T22B 4BK5A 3HC4L 4ONGH 3BHBA 3DLQR 2GUOB 4YDVA 1L6XA 1OLLA 5FO7B 4LARH 1N59A 5MEQA 3T4YA 1JHLH 3DRQA 3I6GA 4OBSA 3QUZD 4I48A 4JRYB 2W1NA 5CEZH 4JFHE 3QHTC 1AGCB 3AY4C 1IGJA 1FN4A 1KIPA 1Q9LB 2UWEE 5DK0B 4FQCH 3ZHLA 1MRCL 4PJDF 2RAMA 2QQLH 3KLAA 3ZDYE 3UTQB 2BXYA 3QCVH 4K94H 5TF1H 4NZTH 1VESA 2PXYC 3L3HB 1DJSA 3D25B 3EYQC 5SX5K 2XRAL 1GGIL 2QHRH 3IDNB 1D5ZB 4PJ7F 2HLFD 4EDXA 3U0TB 2AK4A 3UJJH 4JDZB 1AE6L 4IIQA 3ULUE 2YS4A 4OGYH 1O7SA 3UZEA 3CZFA 5I73C 4RQQA 1ZWIA 3WXVH 3DX8A 1U3ZA 4RFEB 4F33B 3D0LB 5IR1B 5ESQB 2WBJC 1ZMYA 1XGUA 4PD4K 2VMFA 1KTRL 5GJTL 2DI9A 3L7FB 3TO4D 5AG8A 2W0FA 1BPVA 4HXBH 1MCNA 1RIVH 4AENB 4L4VB 5B39B 5C08D 1LEGA 1U8MA 4TTDC 1AP2B 4W6XB 1KBGL 4XNYH 7FABH 2GSGB 3PWJB 2XN9D 4W6YB 5CJQH 5DJXA 3RVXD 5KSBE 1KEGL 3IFPB 5JPMB 1CD0A 1GC1H 1IGIL 2B7DT 3ZO0A 1KXTB 4D0DB 2R4RH 2W9EH 2QL1A 3PGCB 1EUUA 5JXAL 2CDFA 4K8RD 4P4KB 1M71A 3N1GC 2FECI 3VFTB 4I9WE 1FL6A 2OTWA 3VD4A 1JYXA 3T65B 3EYUH 1MCOH 5ERWA 4ZSOE 5CD3B 2DLIA 4PRDB 5DRXB 5BRZD 1KENH 3KJ4C 3SCMB 4WNQB 2NYYD 5HJ3A 4WU5B 4MQTB 4X5LA 1HSAB 4L29B 1N2RB 1MIEH 1JZ7A 3GHEH 2YR3A 4HWEH 4TSBL 2GJJA 2Z4QA 4LEXH 1UQSA 2F54D 4LIQE 5DRNA 4I2XE 3W2DH 4Y4KD 3O3BA 2F74B 2N7AA 3ULUC 3MBEA 1P2CB 2VABB 5KAQG 3KGRA 4NKIL 1EEYA 2NXYB 4LLUA 4XMKL 2VUYA 2VDNH 1M7IB 1ONQB 3SDDA 4HAFA 1AO7B 4FFYL 5IK3B 2YN5A 3D3VE 5TDOB 5LGHH 4GMTH 4M48L 3JV5A 5JPNA 2H2PC 3CUPA 2X9WA 4LRIC 3X12A 3TFKD 3MRHB 1U8NB 4OF5A 2DM2A 2FB4L 4OB5H 3T3MF 1UT9A 3IFLH 4FQ2L 5T1DH 3ZT5A 5CHNA 1HDMB 4PJIF 4XNUH 2GY7B 3FONB 4C56E 2ZJSH 5BV7B 1ZGLA 1A4JB 1CGSL 5I8KH 2EH8L 1DEEA 4HC1H 4LCCC 4PRPA 5KS9F 2YKLL 4QRPE 2GTZB 3S96B 1S9KC 4MDJA 2KDGA 3FOMB 4GLRI 1KPVB 1YEIL 5FYJL 4D9RD 1JI2A 4ZTOH 2EDBA 4M1CD 3BKCL 1FZMB 5GS0D 3O2DL 2PTUA 3SGEI 1JPGA 1MCPH 5D7SL 1JNJA 1O0VA 2VWEE 3V5HA 1WF5A 1IJ9A 3NPSC 4PG2C 4MGXA 1R3KB 5E1AA 2XZCL 4NPYA 1JWUA 2VDML 4WTZG 4Y4HD 2V5YA 2HVJA 1FZOA 5DSCA 2CLVA 4F58H 1U0QA 1T89C 3HI6L 3K8LA 2X1XR 4XZUB 5H8DA 2FNBA 1J1PL 5JIKA 1A22B 3N85L 2A9ML 1BD2A 5HGDA 1Y18A 1XH3A 1FO0A 2Y1VA 1M6OB 5A2KH 1KYOJ 4M1DL 3LKSB 3R1GH 1UM4L 2E7BA 2R0WH 3FKUS 1NLDH 4Y5YC 3S4SB 5ADPH 2G9HB 1PX4A 2DWDB 4Z7NE 4U6VH 3BUYB 3O3AB 4JHBA 5DJ2B 3C8KA 3CFBA 4MNQE 4N8VA 4FRWA 4LRNH 4ZS7L 3F5WB 5CBAB 5C6TH 1N5AB 4R4NC 1CDYA 3HAEG 3MXVL 4LLYB 1YY8B 4R2GB 5DZNA 5E9DA 4WJ5B 3OKOB 3QPXL 2Q1EA 3RFZC 4QEGA 1HYSD 1T7VA 1BOGB 3B3IA 4JN1L 4ODSH 2RGSA 1WEJH 4WY7H 4XNZC 4ODUB 4PGJA 3B2VH 4QHUB 4PRAB 3LKRA 4Z0XB 2DQHH 4TVSa 3HPJB 2GIYA 3BW9B 1IAKB 1UWEL 3O6KH 4KTDH 3W81A 5J13C 5JDSB 1OGTA 5H37H 1T2QH 5I1AB 3VRJB 4I0PB 4ELKA 5EFIB 2RR3A 1G0DA 4HIEA 4FS0A 1XR8B 4PBWD 5IB2A 3E8UL 2VWEC 5T1LD 3G6JA 5MEPB 2H2SC 5DTFB 4NUJB 5F93C 2OI9C 1BVLB 3PQYA 1X6LA 3DI2B 1BZ9B 2NYYC 1AKJB 2MQ0A 3PIQA 5FK9B 4PRNA 2JLLA 1URLA 4JZNB 4N0CD 1VHPA 2X4QA 4M02A 4UT9L 5IB3B 3GBLA 5ESAA 3DGGA 1AI1L 4Y4KC 1ACYL 5BQ7B 3FO9A 4ZNEE 5LXGH 4XP4L 5GRUH 1LP9E 3MCLH 4KGJA 2VAAB 3C5SA 1NGPL 4JY5H 3OJMB 1UB6B 5FYJU 1U8LB 3K74B 4JDVB 1OSZA 4PJ9A 3B9DA 4GRLC 1WITA 4YHIA 5DZLA 3HZKB 3OKDB 2FLBT 4NIKB 4MCYA 2WIMA 2WIIB 3B9EA 5IHZB 3JV6B 3V79C 3UTTA 1BZ7B 4Z7UA 5BS0A 2HFFA 4DEPB 1ZXQA 4IOIB 4K7PY 5ITBL 4YFEA 3BH8A 2VXVL 1GH7A 1VEPA 3QFJA 3WNKA 1JGVH 4ODVH 2OJZH 3KPPB 1OTUD 1GGCH 1N64L 4JDTH 5JHLL 1WZLA 5CFHA 2F53D 4TUOB 4OM0H 4WHYG 3VFWA 1M7DA 3NFPA 3NCFB 4CN4A 4JG1L 3SGKA 3T8XB 2Q7YA 1LO3H 3BDYL 3GHBH 1YPZF 1ZA3A 5CS7A 2XFXA 3S37H 4WWID 1MHHB 4V2BA 4LAQH 2GJ6B 3EAKA 4RBPH 5BO1L 3WE6A 4X7TA 5L6YH 4DUWA 4O00A 2KQMA 1MH5A 3HE7B 4G3YH 1J1XL 3L3DB 4Z7WA 3STZA 5FA4A 4Y5VB 4XP9L 4HUUB 4WTZA 1U92A 4Y2DB 1NCDH 5DFTA 4LVNC 4KXZI 4PJGA 5EZOL 5IB1B 4WI4A 2MSPA 3L1OL 2EKJA 4PB0L 3WN5A 1FGVL 1BFTA 5DRWA 4O51A 4XMPH 4JPIA 3S36X 3ULVD 4TQEL 1UEYA 3PDOB 2VSDA 4KWUA 1QFPA 3BRDA 4GJTB 4WV1C 3MGOB 4HGMA 5J7CC 4G9DB 5IOPB 3WS3A 4U49A 2GKIA 4XXDA 5CEXA 1XGYL 3H9SE 4H88H 4YXKH 1A2YA 4XT1C 3ARQA 5FKAA 5ABDE 5I1CL 3KLSA 1OP3K 1F6AA 4HX1B 4ETYA 4NQVA 1G9NC 3I2CH 2MCG1 2NY5H 1OQXA 2PW1B 2NXZB 3EFFA 5E2VH 1UZ6F 3GMQA 2ICWJ 4DN3L 4KGLA 3HAEA 2DD8L 4IOFD 1XGTB 1F3DJ 3QR2A 3ZKMD 4U1MA 2HWZH 3RX5A 2ZSVB 4N0UE 2RIKA 4PRIB 4F7EA 2AI0H 5GRJH 1LE5A 3IDYB 3BDXA 3DMMD 4FFZL 4KK8D 3UBXB 1R24B 3ZL4H 4P9ML 1IFHL 3LKOB 1QLFB 3ARGC 4HJGA 4FTVD 5L2JB 5DHVA 1FNGA 2DQEH 5D70L 4G6KH 4PGZA 4S0TD 4OF0A 2VR9A 4TVPD 3SE4A 5ELIA 1V7MH 1XF3A 2X4RB 1YQ2A 3AREA 3MFGB 3GEWB 3O2DA 4H1LH 4PJDA 2BSSB 4JLRA 1RZGA 3MLTB 1ZLWH 2DKMA 4QXGL 3P9LA 2XKNA 4GQ9L 4XC3L 4PB9H 4NN7C 2YN3A 4LLQB 4G9FA 4GRWF 2ICWB 3GBMH 1RHHA 1D9KB 4PJ7A 1OLZA 5IQ7H 1NCAH 4PJAB 5F97E 4Q6IC 1LEKA 1E6OH 5CD5D 3QUMB 3TP4A 1UM6H 3DSFL 1FFQA 1LK2A 1FC1A 3MA7A 5JLZB 3EO9H 1T3FA 1HWHB 2GCYA 4MQ7A 2IADA 3ARBC 3GBNL 5DR5L 5TDPB 2XNAB 4JHWL 1U41A 1DDHA 1RUPH 1U91B 1DLHA 5H94A 3CVHB 3U0PB 3CFJB 4G6AD 4C4KT 2ADJB 4XPGH 1AQDB 4GKSB 4N5EC 2VLJE 4I18A 4OTXH 1EA9C 5F3BA 3B9KD 1MFAH 2OQJA 3O6FC 3SQOH 1YEHL 1ZVSA 4FFVD 4HLZG 4QF1A 2VL5A 3O2WL 4KJQD 4KKCD 5DJZB 4F8TA 4CMHC 3IAGC 2VITB 5AYUL 4GT7A 3EBAA 3CK0L 3QEQA 1MNUH 1QP1A 2X7LA 3WS6C 3ABZA 5JMRA 4HUXB 5C09D 5D1XA 4EIGB 3KPTA 1FYHB 4UOW1 3Q6GL 4O2FB 5ICZA 2BNRB 3O9WD 4F80A 1CZ8L 3QUXA 1XGRB 5E2TL 3IS0X 1R3IL 4JM2B 3N50A 4JFOA 4KUZL 4PV9A 4NT6A 3HE6C 4QHKJ 1VFUA 1JNNH 3TBSB 2W9DH 3DJ9A 1NBYA 4HKJA 3OG4B 1WLHA 4KKBD 3DV6A 3OKLB 2FH8A 2Q20A 5HI3C 2MCPH 5HHQB 1TZIA 4L8SB 4J2XA 2X09A 4YH6A 2JJUA 1SQ2N 3VFUB 1KIRA 4X6EA 1QLRB 4M4PA 1PQZB 1RJCA 2FHBA 1NMBH 5GGUB 4Q9QH 1PGRB 4O9HL 2R2BB 1LE9A 3JWNC 2ERJB 1C08A 3DBXA 1HK6A 3UTSB 3HZMA 2A6KB 3KXFE 3O8XA 2O5ZL 5DVNA 1ADQL 4I5BA 3VH8B 2FR4A 4N8CL 3RA7H 1A14L 1RJYB 3C5ZB 1U95A 1S7TA 4PJIA 2VDOL 3OMZA 4XMLL 1JPST 4KKLC 3WNOA 1KB9J 4PPTA 4Z7QF 2F5AH 2AQ2A 1PKQB 4Y19D 2EEBA 4QTIH 3WJJA 2Y6SD 3JWDH 4ISVA 1ZHNB 1DLFH 1NEZB 4UAOC 4EBQL 5KS9A 3W5MA 1A7NL 2H32B 5D2NA 5ADOH 4PY8J 2NY1D 4ZAKB 1H5BA 4ZTPL 4F7PA 4XP6L 5IF0B 3V52L 1VFBB 1C5BH 1YYMH 3EGSB 5FAAA 4DOHE 2NY6C 1A6VH 5HSFA 5C7XH 1FNEA 2H41A 1RK0B 3GJEA 2NY4B 4QXUH 3IS1X 25C8L 2VDKL 2YPLA 4JFYA 4FZEH 3AAZA 4PGCA 4RMRA 5EC1B 3RUGE 3KAAA 3BPCB 4WWKB 1R5IB 2O93L 2X40A 1G1CA 3D85D 2PO6B 4Z77A 1Q9WA 3ZE2F 3ARFA 5TE4L 1DP0A 2IPKB 3L5XL 4OLZH 3WIIH 3BKYH 1WSST 2Z9TA 2R9HD 1GRWA 5HHPB 1CFNA 2VXTL 4RNRA 3GSQB 4V1DB 1GZQA 2VR4A 5DD0H 1KN4L 2BOCA 3UDWC 4I1NB 1MOEA 1WBYA 2B4CH 3BWAA 5JORB 5GSRA 3T77B 5CGYC 3RGVB 1QA9B 5IG7B 3UPRB 1NAKH 3KR3H 1FFRA 2P1YA 4YZFE 1MJJB 1I1YA 5CJXA 5CEYB 2R0ZL 5HHOE 1WIPA 4MYWB 1W72L 1ROWA 4IRZH 4XWGL 1CGUA 3RNQA 5I8OH 1I8MA 1PEWA 1LO5B 2D31A 2EDRA 4DVRH 2CQVA 1RZ8B 4JO2H 4DW2H 3CSBA 3EFDL 2NTFB 3HPLA 2VC2L 2J12B 4AT6A 1QFHA 2DQGL 3M45A 4XGZA 3VXMA 1J8KA 2CDGB 5HHVL 1Z3GL 2PR4H 2HAZA 4UNTA 2EDYA 5LWYH 3C9NA 1EMTH 1RFDH 3RKDD 3SKNB 3MV8A 2NY0C 3NABL 5H2BA 1GL4B 4Y1AA 1MFCL 4LEOB 2LE9A 5BV7L 1AHWA 4JQIL 4NNPL 4A2MA 1KCKA 4S1QL 3KG5A 4C83A 4L5FH 1CICB 3QQ4A 4KTEL 4JKWA 1SM3L 4M6NL 5IMMA 5DQDH 3I50H 1T83A 3QI9C 1RZJL 5T33H 3P4OA 2C7UA 4GKNB 1U8QB 5EIVA 2EYRA 1CT8B 4GQPH 3MLWH 1J0KA 2ZNXA 5DVLA 2XI9A 5EG6C 3ES6A 4OLWH 4KJPD 3DX7B 2GEEA 3L3OB 4ELMB 5F6HI 1RZFH 4FQ1H 4RA3A 3IDMA 1LEIA 1WFUA 3FT2B 3NCEB 5B38G 3OKMB 1TENA 1DVFC 3BH9B 4NWUL 3VI4E 3BP6B 3QEUB 3QDJD 5A16B 4X8JA 4PIRF 1NLBL 2Y5TB 3PV7A 3MRFB 4HUWB 3V8OA 5FECB 3INUH 5HHXH 3TT1H 1QRNE 4ZFZA 5J6HB 2DQUH 4RGNB 4BZYA 3LN5A 4PREA 4K07A 2DLFL 4DKAA 4F7MB 1PZUB 4OKVA 1R3LA 3NACL 1PZ5A 5EA0L 1KG0B 1LD9B 2Y36L 4HGWB 4IRJD 1YN7B 3DVNA 1IAOB 5EO1B 4PJXA 1H3PL 3WLWD 3GK8H 3B2UD 1CK0H 5JZ7C 4OZHE 1QR4A 4M00A 1PSKH 3VMNA 4I4WB 4LCIH 5C07B 2XPGB 2ID5A 5EZJB 1YPZA 4PGEA 2HRLA 3F58L 5E99H 5IIEA 3NCCB 3SDAB 4AEIL 4WHCA 1BOYA 5DK2A 3EDDA 4ZUWA 4YX2L 2P8LB 1IGFL 5JO5B 5C0DA 1SBSH 5D1ZB 4LHUB 1W0VA 4OLXH 1I3UA 4CAGA 2P43B 4L9LB 1AR2A 4RMWA 4WDIA 1CDBA 1T22A 1DEDA 1GZPA 2GSIA 5IJKA 3EYFB 2A0LD 1X7QA 1VPOH 5D7LE 3VFOB 3UTZB 1MEXH 4WW2F 5D71L 4XPAH 1S7QB 2C3XA 4JRYA 4OD3L 3RAJH 1AGCA 5BOZG 1IBGL 1N8ZB 1CFVL 1Q9LA 4JQXC 2B5IB 4OQTL 5L7XH 2VDRL 5CKGA 5J6GB 3L3HA 3D25A 2H1PH 1XR9B 2HRPH 4X9GA 1MCLA 2PYEE 1ADQA 2VDLL 5C0EA 2B2XL 1XCQB 1I7UB 3BGAA 3UZQA 4ORZC 3P11L 2DQCH 3U7YL 3P4NA 1J86A 4L8DB 1IEHA 5BW7A 4NM4H 3O6LH 1NANH 4MVBD 3S4SG 4MAYD 1HKLL 3BRFA 4YBLC 3QFDB 5JMOC 1Q0YL 3VFVB 1I1AA 3MLUL 1L7IL 4ODHH 2D9QB 3I3DA 4RFEA 4ENED 4F33A 3MGTB 1JPSL 3U1SH 4B53A 3VFMB 3HG1E 1ZGLP 3TZVD 4KDTC 5C2BH 1BX2B 2OXHA 3MRDA 5LG1A 3SE9H 3VXNB 3MRQA 5GRXG 4L4VA 3T0WA 2J8UB 43CAB 5EUOE 1QSED 1S7XB 1UH2A 5C0CB 1S7SB 4F15B 1KB9K 2GSGA 3O0RL 3Q5YA 4QKXB 4JZJC 4X6CE 1HE7A 5JPMA 4KZDL 3AS2A 3CSYA 3PGCA 1A5FL 4X99B 4ONHB 3VFTA 1F00I 3KJ6L 4NSKA 4PJFE 4U3CA 5E00B 5B38A 5FYKH 3T65A 1MJ7L 1ZSDB 3ZZ1A 2H3NB 3MRPB 4P3WA 1HXMB 2OZ4A 5CD3A 2EDQA 4K3DH 4P5TB 1NKRA 2GAZB 1MIML 4OCXH 3SCMA 5L8KB 3ULUH 5DD3L 1JNLH 5MHSE 4ZFOL 1FRGL 2ZP0T 3OV6A 3QWRA 2GITB 2OR9H 2E7HA 1EH9A 1O7VA 3VDCA 3GI8L 4GAFB 4ZOAA 2A83A 1RU9L 3KYNB 3V5KA 2JB5H 4LSQH 3PGDB 1MQKH 4UV7L 1PKOA 5D93C 3SPVA 4OFKA 3SOBL 3IVKB 5AG9A 4JO4H 3MOQA 4HPOH 4P23B 3VRIA 4EN3D 2AGJL 1K3IA 1U8NA 1X5XA 3MRHA 5K9KB 1YYLH 3QDGD 4UINH 3I84A 4CW1A 3VXQA 3FONA 1QG3A 4JQVC 3C6LD 1PYWA 4QHMB 3REVB 4I3RL 4TOYL 3CGTA 4G8EB 5LBSH 2A6JB 2WM0A 1FFOA 4G8GA 1U2HA 2D03L 3PXHA 3O2VH 4LU5L 4X9HA 1U3HD 3WDHA 2IAMB 4POYA 2GTZA 3BISA 1ZT1A 2Z31B 3FOMA 1A6PA 5AWNH 1FH5H 4RGMB 3FO2B 3CXDH 4G5ZH 1FORH 2A0LC 3VRLE 3QG7L 4HJ0D 5EIQA 3Q2CA 1HH9A 4HS8L 3EOBB 3MRGB 4S1RH 2QADB 4LIQH 4GKOA 5HTSA 3QWOA 4X6FA 2VXSL 3ZKXC 1R3KA 1T80A 4JPWH 4M5YL 4WO4D 3ZYJA 4EI5D 1EZVY 5GGSB 4XVJL 3ZDZE 3QH3B 5ESVA 5EU6A 4MCZA 4FQJL 4XZUA 4PRBB 1T6VN 1I9RH 4YHLL 2BFVH 4OFVA 2WZPD 1IC5H 2BNQB 4HIHB 2H26A 4MXVE 1Q72H 4CMMB 2UZYB 3FB5B 2X4NB 5D2LE 3FT4A 1CFQA 3MODL 3LKSA 1ORQB 2CLRB 4P3CL 1V3KA 2OJEB 4E9LA 3S4SA 4JFFB 4P2RD 1KJMA 1RIUH 1CD1B 4X98A 5EOCL 3RVVD 4JFHD 1IGCL 5T3ZD 4MNGB 5DJ2A 3ZTNL 2X05A 1SVZA 3RWDB 3MREA 3F5WA 1MCIA 1E4KC 2FX9H 3S98A 4P48A 2NR6D 4OJFH 4OD1H 1A0QL 2BHZA 3GSOB 4QRSA 1SJEA 3IETA 1U93B 3WHXB 4D9LH 1YDPB 4RWHA 4E41D 2XZAH 3KNBB 4U1KA 3HTLX 4MB5A 2Z0BA 4K9EL 4PTTA 3UBXG 3U9PL 5GS2D 1G7HB 4PBVC 4ODUA 1SEBA 3W0WE 4X9BA 3ARDD 4PRAA 2DQIL 2E8ZA 2HA1A 2VO5A 1IAKA 1YJDL 3O6MH 5JDSA 1OL0A 3AMKA 4N1EA 1GXEA 3DV4A 1X5ZA 5F7NC 2I27N 3VRJA 2KBGA 1NAML 2YD1A 1CDHA 5EFIA 1SYSB 3WDIA 5IB5B 1HHGB 3QISA 5MEPA 2NY2C 1F4AA 5DTFA 4NUJA 3MRBA 3ELAT 3GSVB 1BVLA 2DLHA 4APQA 1BBDH 3HC3L 4KMTL 5E8OB 2ZG1A 3SDCD 1AKJA 5ITFA 3P30L 4RFNB 2VXUH 3DTXB 2A73B 5DD5L 3W9EA 4YHKH 4JFDD 3HN3A 5IB3A 3IDGB 1OHQA 4Y16C 1ZV5A 5BQ7A 2W38A 4M03A 4WI5A 5HPMA 5DUMH 2WUBH 4POZD 4BZ2L 5KJRL 4YJZL 4TUJB 1FAKT 2VAAA 8FABB 5JW5B 2IANE 5T3XE 1BLNB 2A6DB 1UB6A 5HVHC 2R39A 4PLKD 2GTWB 1X44A 5K9QI 3T3PE 3T0EC 3OKDA 2VLMD 3O4OB 3WFEH 2WIIA 3RZCD 1JPFA 2BVOA 1YEKL 1MHPH 3JV6A 1DBAH 3NOIA 1OM3L 2H8PA 5CGMA 4JFED 4PLJC 3E2HC 2BRQA 1FZJA 4IJ3C 1N0XH 3OXSA 3QDMD 3GMNB 1NFDB 4Z7VE 4NQUA 1PBYA 1F4WH 1HKFA 3U46B 5EC2B 5D1QB 2JJTC 3QQ9C 3V0AC 1QR1A 3D3VD 1YA5A 1EO8H 5D8JL 5E7BA 4I0CC 2P8MB 5HI4C 1BJ1H 5EWIH 3T8XA 5DJAB 4JHAL 4BQ8A 5MEND 1J5OH 1UGNA 1ZHKA 3WHE0 3VWJB 4HLJA 1RVFL 4Y5VA 4HUUA 4WI9A 2DQTH 4K7FB 4BFEA 1B90A 4WU7A 1EPFA 4NOFA 4Y2DA 3QCTH 4QXTA 5E6ZA 5IB1A 2AEQH 2M2DA 5DHYB 3TCXA 2DLEA 2IBBA 1XF4A 4EVNA 2VLKB 4KJYA 1Q1JL 4LLVA 3PDOA 1G9NH 3MGOA 3BT2L 3MLRH 2X70B 3KDMA 5IOPA 1G0XA 1KLGB 5DA4A 3ILQD 4PR5A 1A6AB 3NPZB 3BKJL 4Z76B 4QRRB 1AGDB 3CC5A 1U3YA 1NCCH 5IMOB 5I9QC 4M6ML 1CYGA 2CRIA 2APFA 2PW1A 1G9EA 2GY5A 3VH8G 1HCFX 3PWVB 3D9AH 1WZKA 1BFVH 4HV8B 4ORGA 1QFWL 4HIJB 4KHXH 1TJGL 1XGTA 3L5JA 1D6EB 4PGDA 2N4IA 4LKXA 1OY3B 3OR7A 4NN5C 1NMAH 5DEFB 4P2QB 5K9JL 4PRIA 1KELH 2V7NA 4CKVX 1MRFH 3UBXA 1NL0H 3JV4B 1M05B 1S7UA 5I1EL 4NP4H 4F9LC 3G9VA 1SY6H 5L2JA 5K9OA 1YN6A 1TLKA 4XPTH 4LSVL 4G8FB 1NGXB 2P5ED 4WW2A 1G84A 2D0GA 3VWKD 4UV4L 5I17B 3CMOL 1AO7E 2E8YA 5I71C 2XICA 4H1LB 1I9IH 2C4FT 2X4RA 4QHLB 4MQXD 4H25A 2J8UF 5JHDB 4X4XA 2VSCA 1T0NA 4JRXD 1SJHA 3HS0A 3MNVA 4RRPG 5I66B 5EUKA 3SE8L 1JZ6A 5EORH 4J23A 4WFGE 2BDNH 2I5YL 5F96L 5L0QC 1D9KA 3LEYH 2V9RA 2GT9B 4IEFB 3GSUB 1KEMH 1QSFA 2VLRE 1A7BA 4K3HA 3IRPX 4ODBD 1L4IA 5T5FL 2NX5B 1DCLA 4Y5XA 3QUMA 4K7PH 1S8DB 2YEZB 2CRZA 2L7JA 3GMOB 4NO0B 5I1KH 1BVKB 1UA6H 2CRMA 2HYMA 5JLZA 3FRUB 5B21A 1QO3A 1QYGH 2FL5B 1EEZA 1T66D 2P44B 2UZXB 3GMMB 4NBZB 4GMSH 3CVHA 2G5BB 1YEEL 4K8RL 3QXWA 1JGLL 1I4FA 1WGOA 3TVMC 1AQDA 1V3LA 3MRRB 3QPQD 4NO2A 4WEBH 5FCUH 3LKNB 3I6LE 5DUPL 4UB0L 3NH7L 4QNPE 4RX4A 3DETD 1WWWX 1IT9H 3TIEA 1DFBH 1H15B 1S9WB 1FG9C 5DWUH 3T0BA 1P5VA 2Y9RT 4HZAA 4CDHA 2VTFA 3GIVB 1NUDA 4JPVH 3L95A 5FM5M 3H9HB 2NNAB 4YEEA 3BIKB 5E6IB 1NCTA 1OW0A 1U3JA 2H9GB 3MMEA 4L9DA 4ZUUB 4AL8H 4Z6AT 5AD0B 5GS1B 5JA8B 3BQUB 3P0GB 1FV1A 4JY6B 4O2FA 3OZ9H 2BNRA 2BZDA 1D5MB 4OCWL 4M43L 2R1WA 1XGRA 3S97C 4F57H 5CP7B 4TNVK 1DE4B 1JWSB 3RIFF 4HWBL 3SO3B 1NAMA 2VZOA 1Z0NA 4CL7A 1RSFA 4P59L 3WIFA 32C2A 3NFNB 3EO1A 3UO1H 2CDEB 4L3EA 2EIZA 4XXCA 3VXRE 3MNZB 3BGFB 1JRHL 2R0KL 5FGCE 1S5HA 5LCVH 3KPRE 2YPVL 4AMKL 5HHME 2EDOA 3VFUA 1BIHA 5EPMA 1VGKA 1Q9KB 4P46B 2AP2A 4Y88A 4LSTH 5GGUA 1QKZH 5I1HH 5IFHH 2F8XC 3GRWH 1U8OB 3UTSA 2YK1H 2FX7H 3VXUB 3U36A 4E42B 5IFAL 1CE1H 3GNMH 3VH8A 4GLRH 2AJYL 3UJJL 2IFFL 2X4TB 1GGBH 5GS0L 1L0YA 3K2UL 1EVTC 1C5CL 1SVCP 5ISZB 4XX1E 5HPOA 3GMLB 1WZ1L 2ADFH 3SGEH 1HHIB 4KVCH 2J88H 4Y89A 2OP4L 5ENWA 2ITCA 1H0DB 1A8JH 3DECA 1QUNA 4RBPK 2Y06L 1T21B 2P5WA 3RVWD 5I2IB 2EE2A 4YWGL 2H32A 1U8IA 1J0YA 1H3WM 4GW1A 1CDGA 5B4MD 3DUHA 5DJ8A 1AQKH 3I6KB 4ONFH 4LQFH 4MD0B 2BK8A 2FIKB 4RAVA 4BZ1L 3WNNA 5C0RH 5IF0A 2DBLL 3LCYA 1YMME 1VFBA 3QIBC 4PJ5A 3EGSA 5F7MC 4Z95L 1P1ZB 4NN6C 3ULVF 3V0WH 4HSQA 4ZO8A 4LDLB 1AR1C 3BZEB 5BZDB 1CL7L 2J6EA 4CU7A 1G9ML 4KJWD 3VWKC 3QEGL 4XTRC 5EO0A 2V9QA 4JGUA 2B0SL 2HKFL 3HUJE 3FFCB 3LQAC 5D7IF 1YZZA 5FO9B 4RRPA 2R4RL 4XVTH 2ATKB 4WWKA 4LSUL 4LHUG 5IHUL 3UZVB 4LVHB 4G6MH 5DJYB 4GG6B 1DQMH 2EXYD 1KPUB 3MUHL 5LAXB 3WIHL 4O2CA 1NDMA 2B1HL 3BO8B 4KK9D 5DYOA 5DD1H 2CK2A 1UKQA 2ZUXA 1Z0MA 3QA3A 4V1DA 3SDDD 2RBLA 4KV5E 4MWFA 1C1EL 4HPYL 1LDPH 4OSUH 5IG7A 5T1MB 1QBMH 3UP1A 1MJJA 3IKCA 3MR9A 3HA0A 1H3GA 35C8H 4WCYH 5KSAB 1OGAB 2OMNA 1GIGH 1F6LL 4HMCA 3G6DH 2DQJH 1OTTC 3KPQA 3QEHB 3OB0H 4HF5H 1I8LA 2QSVA 2ZCHH 3FQNA 2X9YA 5TH2B 2JELL 3QUZA 3KYMB 2V17H 4OF6A 4YC2C 2VDPL 1TTGA 1V3MA 5EDXA 1J05B 3EZ8A 4XB8A 4MJIB 4OCLC 2ZJSL 3PWLA 3SKNA 4BSWA 3LEVH 1CXEA 1OAXH 5I8KL 1R3HB 1ORSA 1TITA 4GAJH 1PG7W 3BP4B 4NO5A 1MI5B 1RHFA 1ZHLA 4DVBB 5IFJA 3JXAA 1EAPB 2AQ3A 3PP4L 4JREC 5D5ME 2OMBA 3J7HA 4ZTOL 3QIWA 4HT1L 4XHQA 1JZ2A 1KIUA 4YO0A 3QG6B 3BZ4B 3OHXB 4R96A 4KI5D 1BD2D 3MLSH 1MHCB 4QOKE 1KCVH 3L3OA 5E5MB 1HIMH 2FBJH 3RWFA 5J9PA 1K85A 2X5PA 5JW4R 3BP6A 3F6IA 3VGBA 4AM0B 2XN9A 4V2CB 2Y5TA 2V2XB 3MRFA 4NGHL 2V5RA 3ECBB 1AXTL 2X44D 2I60H 3L5WB 5J6HA 5IROA 5DC9B 3W39A 3MRMA 4U6VL 5EZIL 4FQLH 1DBKL 1DQQA 1X4YA 5E9DD 4XP1L 1MUJA 4MMXC 2EDEA 4KXZH 1MAMH 5BRZA 3WCYA 4PJEB 3ULVL 3CXHJ 4M7JL 4PRPE 4NZUL 3SDXF 3JWOL 1MFBL 5GHWH 1S7WB 1INDL 3OAZH 4PJAE 2XPGA 5MP6H 3RDTB 3G04B 2CIKB 3TWCH 4HIIB 5IEHB 5KVFL 4JRWA 1IQWL 3RWGB 4LDEB 3AXLB 5F7FA 2AJ3B 3SDAA 5CJOH 1CGWA 1QNZL 1L9MA 4KJWC 1U58A 2P8LA 2EZ0D 4R7DA 3QJFB 3WSQL 4LHUA 2IC2A 2BSRA 4K23L 2EIEA 4P3DB 4HWBA 3U30C 4L8CB 2XA8H 4JY4B 1BVZA 3DYMA 4Q9BA 3V0VB 4WFED 3MACH 1AGBB 3O4LB 4OI7A 2D7OA 2PXYB 4Q0XL 3EYFA 4CADA 3IJYA 4D9QD 3UTOA 3VFOA 2QR0A 4OZ4A 3MBEC 4YAQB 3UTZA 1S7QA 3LB6C 1JN6B 4YXHH 4JCLA 5E4EC 4YXLL 1YNLL 1N4XL 4JKKA 1DUZA 1AC0A 2Z35A 2IF7A 5DI8A 3VFGL 5I73B 2EDXA 4LCWE 4WW1B 3WKMH 1BF8A 1N0LA 1XCQA 2YUZA 3QXDB 4NQCB 4TVPL 4KRPD 3RHWK 3CFIC 4O5LL 1REIA 2WBJB 2MHAB 3NCJL 3TJEL 1NGQH 4TSAL 5FKPA 4RFOH 5HY9B 4MSWA 3NCYS 2Y07H 4G6JH 5FHBH 3QFJD 2HT3D 3VMOA 5JUEL 4GBXD 2Q86B 4XBPA 1UM5L 5L2KD 3LS4L 3HC0B 4LSRH 5DVKA 3NTCL 2R29H 2C4FU 4X6DF 2W65B 3X11B 1YUHA 3IDJA 3MGTA 3S36H 3VFMA 3TA3D 1A47A 5HYJE 4EI6B 2OJZL 3ZHDA 3VXTB 4JZOB 5EB9A 3VXNA 4GW4B 1N6UA 1YECL 4MNHB 2J8UA 2E9WA 1V05A 4QRUB 1S7XA 3G6AB 4HHAB 2HJLB 3D1MC 3PQYE 1IKFL 3L3JB 4JFQA 3MJ7B 1JGEA 4XCEA 2ICEB 7CGTA 3TF7C 1F4XL 3KJ4B 1FGNL 2UWEB 1NSNH 4BH7B 2G60L 2EKSB 3V6OA 3X13B 3MQIA 4BFIB 4PJ8B 4LSDA 2H6PB 5I19L 2ESVB 1XFPA 4ONHA 4JN2B 5H37G 1NCDL 4AG4H 2IGFH 1PKQE 3ZE1E 4YHNB 3VW3H 1A6WH 1ZSDA 5I15H 1MAJA 3RI5F 4DGVL 1HXMA 1KFAL 2VISB 4LCYB 3ESVF 1RUMH 1ZLSL 2YD3A 3H0TA 5JIPA 1U6AL 1NC2D 2O61A 3WUZA 1MJUH 4DKEH 3MV7E 4MA3A 1C16B 4QCIA 5F6IC 1K9TA 4TTGA 3V5DB 4FQIH 5F9DC 3UTTE 5EBLA 4KFZC 1NC4B 3E6HB 5BS0E 4KK6C 2ATPA 5HGAB 2J3SA 4MX7A 2YD6A 2ZUWA 1B0GA 5DD6B 3LKQB 2A77H 3LSOB 2VDQL 5DURB 4P23A 2PNDA 4YIQA 3GJFA 1WTLA 3GIZL 5KSBB 1RJZB 5GRJL 3D48R 3PWPB 5F7DB 5K9KA 4MA8H 3K46A 4X5WA 3NCBB 1ES0B 4TRPL 2HT2D 5EU4A 4JO1L 2BHYA 1IKNA 4QHMA 1KCLA 2XTJC 5L88H 2E7LA 4G8EA 4TSCL 3KPSD 1TTFA 2NY3C 3QIUC 4LMQI 4OBRA 1MPAH 3NPSB 1ZLVH 4R90L 1LMKA 1VA9A 5SX5H 4OIBA 2IAMA 2AQ1A 2ZUSA 1CR9H 3GKWL 4J12A 3HR6A 1P69B 1WISA 1X5AA 3C08H 3DROA 5ALCL 3U7WH 3K4AA 1OAUH 2P24B 4EQ3A 3AUVA 4R97C 5JR1H 3R0MA 2PETA 3DVGB 3MRGA 1J1OH 3D2UD 3CJJA 1J10A 4I2XB 5J3HD 3QRGL 5IBLD 1MLBB 4ZXBD 5IQ7L 1KUMA 4Y5YB 4WUUE 4PJ9C 2GJZB 3MCKB 4EDWL 4HKBA 4WVRA 2EDTA 4RIRA 2Z8VC 4PRBA 2IG2L 2X4OB 1G7PA 2BNQA 1MVUB 3FB5A 3HMWH 2FD6L 1TCRB 1VSCA 1ORQA 4NQXB 2CLRA 1IQDA 5FA3B 3KPNB 5SWZA 4C56B 3IJSB 4XHJD 4DWHA 1Y0LA 3NIDE 4J3OC 2WP3O 2V5TA 3M8OH 1VCAA 2DJUA 3TBWA 2E5EA 4XNZB 4QRPB 1T5XB 1QBLL 1ZAGA 1NCBH 3EHBD 1JHKH 2DM3A 4ZOCA 1M4KA 3S37X 2VL4A 4P4RB 1MFDL 3FQUB 5KZCB 2Y4SA 5J13B 5FYJE 1E6JL 3BE1L 1ULVA 5F9WC 2QHLA 5AUMB 5GPRA 5D7IA 2YUWA 4K3JL 5HD8C 1C12A 1S9YB 4HBCL 5E70A 2HVKB 4OLVH 1T1YB 1JFQL 4M5ZH 2OI9B 2YMXH 1CBVL 1CDJA 3WN5C 5L8LB 4OZIE 1JHTA 4OGAC 4PJ7E 2EC9T 1OWWA 3BEVA 4L8BB 4QYOA 5TQ2H 4AY0A 1SYSA 3ZYZA 4QHNA 5CIPA 5IB5A 2ICCA 3WNMA 3OKNB 3EOTL 1CXLA 3TBTA 3DMMA 2Q8BL 4Q2ZA 1UWGH 2SEBA 5E8OA 1K6QL 4NJ9H 1J9CT 2DICA 1BJ1J 5F7EH 5J1SC 1IGML 3DTXA 3T2NL 5CILL 2A73A 4JFXB 4UU9A 4MNQB 4GRLB 2Y5EA 4QWWD 3DOSA 1RZKL 3LPWA 4OF3A 5DZOA 1T5WB 1FCCA 2J1KA 3ARZA 1H8NA 1CGVA 1I8IB 1YEGH 1A7PL 1EX0A 1HHJB 5C0FA 3QCUH 1WC7B 3TN0B 4Z78B 3FT3B 8FABA 3QEQE 2JB6A 1KB5L 5FB8B 5GZOC 1FAIH 5K33A 3RQ3A 2GTWA 2WBKA 5HGBB 4AZ8A 4DQOL 4F37K 2WQ8A 3X3FL 1I3GL 4F2MB 3VGAC 2CJUH 2AAVA 1CTOA 4RMQA 5GJSH 3CU7A 3ULSA 4MHHG 4LLWB 1PG7L 4JAMA 3SE4C 2YPLD 3T0VA 3AREC 3GMNA 4AH2B 3HZYB 5JQ6H 1E28A 2LABA 2HFGH 4JFZH 4Q9RL 3ZMRA 5D1QA 4B50A 4OCYL 4S0SD 2XKUA 1HWGB 2NW3B 1I1FB 1F02I 3BMWA 1LO2L 4LVNB 2P8MA 3ARFD 4G7YL 3A6BL 1CG9B 1ZA6A 1AFVL 4FZEL 5DJAA 3GO1H 4BM7A 2DYPD 3B9KA 4NC0B 3MLZH 3TPKA 1P7HL 5KN5B 2D3VA 4X4MA 3WJLA 5I76B 5LGKA 4ODWA 5C0GA 2BY3A 1B2WL 2BRRL 4PJHE 3MUZ1 1VEOA 1ZT7B 4LSSL 2DL2A 1LP9B 4G43B 3WUWB 3VXSD 3VJ6B 1D5IL 4OZGE 1VGEH 3T3ME 2FEDD 2UVFA 1V7NH 5EZLB 3LS5L 1K8IB 4PJIE 4XCCL 3RPKA 4KU1A 3RWJB 4NRXB 3J8F7 3MLYH 3VMPA 5C0CE 1EDQA 1HHKA 1A6AA 3O9WA 1CE6B 1QZ1A 3U4BH 4QRRA 2R1XB 3VXMD 1MLCB 43C9B 5KS9E 3SDXA 5DK3A 4XHJC 3SGJC 3MNWB 3FHQA 2DTMH 1TZGH 4PTUA 3MV8D 5E08L 4DW2L 1TQCC 3PWVA 5D1XC 3ARGB 4LP5A 1UB5A 1BGXL 4JPKL 5GGRB 3U48A 3RX8A 5GGTH 3LZFH 3N0PB 1NBVH 3GDBA 3QUXC 2ZUVA 5DEFA 2PW2B 4X9FA 2AJXH 4J4PD 3JV4A 5HGHA 5TE6L 3PL6D 1M05A 2JJSA 5TGBB 1DQLH 2FGWL 3NFSL 3I9GL 1X5KA 4QTHA 4G8FA 4NN7B 1FE8H 4DN4L 1ND0A 2DI7A 3F7QA 1NGXA 2AJVH 4KRMB 3NZ8B 1UCBL 1K2DA 5DO2D 5LQBL 4Q6IB 2A74A 2CMRL 4MD4A 4XNXL 1FVDB 4L3CB 3H9SB 1BHGA 1A3RH 1BBJB 2P7TA 3O8XC 3QZWB 5ICYA 1BM3L 3MYJA 1XGQB 3VGEA 5B22A 3ARBB 3ME0A 3M1BB 5I6XC 2O5XL 2OL3L 3B43A 4NQEE 5FYLH 2GT9A 3ZDYF 3TNNB 3VA2C 1TNNA 3NA9H 3GSXA 2ADIA 2XXCB 1Y6KR 5IVZB 4YDJB 2NX5A 3O6FB 2A1WH 3H2WA 3QO0A 2YEZA 5IMKA 1BVKA 1A6ZB 5TQ0L 1WIOA 3FRUA 4N0UB 2GW5A 4HS6B 4UIKL 4CMHB 5EU5A 4F7TA 4X6DA 1I9JH 4YDLC 4GSDL 4LQ1A 2ZUTA 4ZG1A 2G5BA 4Y1AE 4WHTB 2AJSH 2ITDB 1INQB 4LMQE 4XBGB 2X89A 1KT2A 2OR8A 4K3EL 3C2SA 4MXQC 2I26N 3ARPA 4Y4FD 4MJ4A 3MJ9L 2JIXD 2HT4C 3GIVA 1LGVA 3HE6B 2IQ9H 5T3XD 1U2CA 5E6IA 2LU3A 5LVEA 2MTPA 3FN9A 5CJBA 1EXUA 2H9GA 3ARFC 5AD0A 2YD2A 5GS1A 2MPAL 5IWLA 5DGQA 1HNGA 4NFBA 2W60B 4JG0L 1IGYB 1P7KA 5DS8B 3TJHC 2IJ0C 4F3FA 4JRYD 4ZS6C 4ODTH 4H8WL 1DE4A 4MNGE 4YUEL 2C4XA 2P8PB 2W0LA 15C8H 4XCYB 1FBIH 4K55A 4ZD3L 4M7KH 4GAGH 4ZMAT 4U6XB 3F7YB 2QV2A 4JE4B 1RUAL 4OGXL 3D39B 1PFCA 4M3KB 5TPWH 5CJXC 3G5ZB 1F90L 4S1DD 4BH8B 1K5NB 1ETZB 2AXFA 3OX8A 2X1QA 3P2TA 3HNVL 3BX7C 2VLJB 4P46A 4HKXB 3L5IA 2YPKA 2CKBH 2WSKA 4IDJL 2CUIA 3BPOC 1JF5A 1GGTA 2H1PL 3B9VA 2DDQH 3HB3D 4I3SL 4QGTA 5K59E 4FQHA 1ZKAA 5KSUB 2ORBL 1OAZH 3VXUA 4J6RL 3DYPA 4UAOB 5JXEA 4UILL 3G5VA 4PYGA 4W70A 4UT6L 2X4TA 1P4IL 3QSKB 5DEGA 1AHWC 1YPZE 2AXGB 1HN1A 4Z7OE 2VXQL 5F7YC 1J12A 1HHIA 1AY1L 4U1NB 4L4VD 2NY6B 1MCCA 3OGOE 3BD3A 2VLLB 1ZS8B 4XAKD 1T21A 1CLYL 1T83C 2X4PB 2X2YA 5I2IA 3QDJA 4HFUH 1GHFL 3MOBH 3DIFB 4GUPA 3LQAH 4OLYH 5EU7E 4P4KD 3HLAA 2HLAB 1FFPA 2R4SH 2R2EA 3B83A 1KCUH 5CZVL 1JE6A 5BZDA 3DUSA 5FF6B 4HH9A 4LKCA 4B7IA 1A3LL 5T3ZL 3FFCA 4IRJA 5FO9A 2ZCLL 3PHOA 3SCMD 4KKAC 2ATKA 1UZ6E 3ZDXE 4JM4H 3KXFB 4OUOA 5I1LA 1PAMA 3GKZA 1KPUA 1WICA 5IVXF 1RURL 4J8RA 4K3DL 3RVUD 5C8JB 2EYSA 4OD2A 1OTSC 2NXYD 2YUVA 1UENA 2Q3AA 4U1SA 3GB7B 4HCRH 1NGWB 3LV3A 4OKDA 4YHML 4R4FH 3SKJH 3T1FB 5T1MA 2WUCL 2A9NH 4L4TE 5IBUB 1DN2A 5CGTA 1OGAA 5F3HB 5F88A 3S34H 2NY0B 2QQKH 3OAUL 4DOHB 3QEHA 4JANB 1CLOL 1XF1A 1UJ3A 5ANMB 3KYMA 4KAQL 1KLUB 4CBPA 4J3UA 1YYLL 4K3GA 1J05A 4ZNCD 5I1JL 5GIRB 4DCQB 3DXAE 1MCWW 4GRWE 3QI9B 1TVBB 4U1HA 3RIFK 1DQDL 3RUGB 5FUCC 2AXJA 1F8TL 3QHZL 4X4YB 4YHYC 3GSNH 3IDXH 5EU7C 2N1KA 4TUKH 3KLHC 2R56H 3P77A 4U1GC 2HTLD 1RQ5A 1MI5A 5F72S 5IW1A 5ALBH 1EJOL 2EE6A 5JW3L 4BELD 5EBMA 4NJAH 3X14B 4YDIL 4XBEH 2FZ3B 1DVFB 3TM6A 4NNYB 3S5LB 2LU7A 2ZKHL 2V5SA 5F8RC 4CVUA 1XF5A 3BZ4A 3OHXA 4KDWA 4MJ6A 3W9DB 5HHOB 2OL3A 4UQ2A 4M6OH 5BMFL 1RZ7L 3H3PL 3CFKA 1GVIA 1EHLL 3BYYA 4LPXA 5BW7C 1P6FA 1QSEA 2P42B 3NIFE 3RIAF 2DQDH 4G80B 5IEKB 1DL7L 1I1AC 4K2UH 3UAJD 4DFHA 1NFIB 5EN2B 1LNUA 1E4WH 1LQSR 3VCLB 3T1WA 3ESUF 4UMGA 1EO5A 3ECBA 4WFFD 5GISH 3L5WA 3IF1A 5J12C 1I3VA 1P53A 4X7SH 3LIZL 2DQFB 4QRQB 3BDBA 3CD4A 2P46B 4PJBF 5F70A 4R2GD 2D7PA 5JHDE 4PGBB 1P4BL 2P47B 1MCDA 4G8GE 5B8CC 1JJUA 5CMAB 3W11D 2AEPH 1YNKH 1S7WA 3E6FB 1RV6X 2HH0H 2NY7H 3PABA 3KPOB 2OK0H 3RDTA 3G04A 3D69A 3S8WA 3HI5L 4I0PD 3RWGA 2QQQA 3N1QC 2VRAA 3LHPL 3TBVB 2MQ3A 4H20H 1HINH 3BP7B 2VE6A 2XZQL 4HAGA 3G5XB 4GH7B 4KY1H 3UJIH 3EJYC 5GZNC 1TETL 5AZ2L 4HG4K 4JCMA 1AKJD 2V2TB 1F3JA 5SWSA 3VE0A 1ED3A 5EU6E 3P4LA 3VFNB 4EN3A 5DLMH 3FZUD 2PXYA 1KJ2L 1QRNB 3NGBC 1DSFH 3QULA 1BEYH 2VIRA 2EC8A 4ZFGH 4M7LT 5FO8B 3H8NA 2FYYB 3RWEB 3C6LA 1JN6A 2DTSA 4EOWH 1U36A 3VXOB 2ZPKL 2BVPB 2RFXB 1A7OL 2GK2A 4J1UA 5MEOB 4WW1A 2UZIL 4YBLB 4YBQC 2HTKC 2WUBL 4OZHB 5IT2H 3RWCA 3D18B 4OF7A 3RVTD 3QXDA 3HMXH 4CVZB 2CKNA 3BAEL 5EOTA 5BJTB 3OBAA 4HQQH 4H0HB 2WBJA 2MHAA 5BV7C 5HY9A 5HVGB 5C0NC 3O45B 5KVGL 3DURB 4XAWL 4P2OC 4PS4H 1YC7A 3BRGC 1JGDB 1IC4H 3HC0A 1MHPL 2I07A 4X80L 5C0AE 4JO3L 1RZJC 3IJHA 4JZJB 1FNHA 2R69H 1N0XL 5JNYA 3AS3A 4G7VL 4PP1D 1MJ8L 4EI6A 5D4QA 4NKOB 5IESL 1B3JA 2Q76B 2GJ6D 4GW4A 2WINB 3HE7D 5D7LB 5IMLB 1CD8A 2WNGA 2IFGA 4LPCA 5KW9L 4HHAA 1FO0H 2E27H 2UUDK 4Y2DD 4P2RA 2HJFB 5BXFB 4FZ8L 3MJ7A 3EO0A 1P84J 1NUGA 5EBWA 3S35L 3B6SB 2ICEA 4MS8C 5CWSB 4D0BA 1DN0B 5ISZE 2UWEA 4HWZA 4XB7A 4BH7A 1WBZB 1FIGH 4XVSL 5I74C 3EDFA 1BQHB 4PJ8A 4S2SB 4C57C 2FJHA 1T7YA 3RU8H 1PLGL 3WFHA 2PYEB 4NQSA 4X7EC 4KVNH 1SEQL 4YHNA 1QFWM 3AB0C 3P4MA 1G7IA 4D3CL 1QLEL 2XY1A 3OB0K 4U6YA 2FATL 3CVIL 4LCYA 1RUQL 3MA9H 3RTQC 3V4VH 3VG0H 3C6SB 1ZT4A 5CJ8A 1C7TA 5D93B 2DB8A 1IE5A 1X5IA 5B3NA 3MV9B 2NXZD 4BFBD 5ID1B 1HI6B 5CSBA 3CLEH 3ARDA 3TCLB 4XVUD 1CI5A 1JUFB 5IKCB 5IJVA 2B20A 1C16A 3TYFA 1A6UH 1CF8L 3V5DA 3A67L 3HG1B 3F12B 4KQ4L 1WCBA 1I85A 3NCMA 2DKSA 4C54A 3E6HA 4PRID 5FUZH 2ZCKH 3HI1A 1UVQB 1S3KH 5HGAA 1J11A 1GPOL 4U3HA 3VGFA 5EUOB 3HC4H 3LSOA 1QFWI 3BXNA 4KK5C 4FQPA 1LK3L 1JP5A 1DR9A 1RJZA 2ZG3A 2RHEA 4X6CB 4ERSL 4JFDA 5FUOL 3U9UB 4KI5F 1ES0A 1FDLL 1QPPA 1XCTB 2G75B 4PJFB 4NP4L 3ARWA 1A4KA 3REWB 2XRAH 1GGIH 4APQC 3OF6D 2C3WA 3MFFB 4ZSOA 5ICXB 4HS3B 5D7KD 4M9OA 3ZKXB 2XWBB 1AE6H 1D9KD 3TH4T 1QBAA 3RZCA 1T6WA 1OOAA 1U8HB 1XIWC 5GRVK 1HYRC 3DVGA 4NBYB 4I2XA 4HFWB 4JFEA 3X3GL 3LRSA 1IILE 5DMKB 5JW4M 3QDMA 3U6RA 2Y7QB 1MLBA 4IRSC 4MJIE 2QSCL 1HH6B 3BJ91 1BQLH 1CQYA 5GJTH 2GJZA 3RNKB 3BIBX 1P5UA 3D3VA 4HK3N 4OZFG 3KYOB 4QT5A 1P4LA 1T1XA 1VB9A 4WUKL 1KBGH 1P7QB 4U7KA 1QYGL 3RY5A 2H45A 1TCRA 4LLDA 1R5WB 4NQXA 4A6YL 1KEGH 5FA3A 2HKHL 3KPNA 2HFEA 4C56A 3LD8B 3GUTB 5MERB 5JXAH 3MLPA 2OSLB 3JUYA 4DUXA 1FYTE 1T7ZA 1W0YT 3IU4L 4NWTL 1CGXA 3STLA 4EQ2A 3BN9C 2R1YB 3KPLA 4I77L 4QRPA 1T5XA 1IT9L 3N06B 5A3IC 4H5SB 2BNRD 4P4RA 3FQUA 4XI5D 3WDJA 4JM2D 1S9YA 1MCFA 1MWAL 4Y5VC 2HVKA 4TSBH 3MRNA 3DUUA 2NY2B 4KROC 5L9DL 2YBRA 3CH1B 5F6HJ 5IVXA 5CBEB 4NKIH 4XMKH 1N6QL 3RL2B 4GS7C 1QSFE 3HRZA 4FFYH 3QYCA 4HDIA 1W0WB 1LO0L 1KJ2A 4M48H 5D2LB 4Y16B 2C3GA 4XP5L 3UTSD 3IFOB 5E8EB 3ET9F 1IM3A 4FQXC 2C3VB 1JRHI 2FB4H 4FQ2H 4R0LA 3K8KA 4KQ3L 4KUCD 3ZLQC 3V4UL 4S10A 5HVHB 5TF0A 4M7LL 3GRWL 1CGSH 3T0EB 2DLTA 3T2QA 1HXYA 5DHVH 5DJDB 2BERA 4MZ3A 1T5WA 2CO7B 1I8IA 2RB8A 2YKLH 5C9JA 1FL5A 1HHJA 2DIJA 2VH5L 2B8OT 3TN0A 2QKIA 3FT3A 1YEIH 4IJ3B 5FYJH 2WP3T 3ARUA 4JRXA 4ZAKD 2EYTA 3BKCH 4DFIA 3O4LE 4KVCL 5HGBA 2ZOLB 5I8EB 3O2DH 4PRHE 4UTAL 4YGVB 5D7SH 1EEUA 3W0WB 4QGYA 4F2MA 2B39A 3QQNA 4GKZB 4WW2C 2XZCH 2VDMH 2NY4D 3IXAB 3PWNA 3HI6H 1ERNA 1VFAB 5GRWA 1J1PH 4WWKD 4X7FC 3DO7B 3RWIB 1D6VL 4EUPH 3N85H 2A9MH 2F5BL 4S11A 1N7ML 2PO6D 4R7NB 1I1FA 4L3EE 1KF9B 3N1PC 2FO4A 4PJCF 5E2UL 1A1OB 4R8WL 4ETQA 1MCEA 5HI5D 4NQDE 1CL7I 1UM4H 3GSRB 1JK8A 3RL1A 2C1OA 5KN5A 2NLJB 2WMPA 5I76A 2NZ9D 4K7PX 1U8KA 1YEDB 4Y5XC 1FZKB 1AGFB 3L7EB 4V1DD 3HHRB 4X5XA 2WLZA 4U6HB 4ZS7H 2AJZB 4ZNEA 1ZT7A 4UUJA 3RGVD 3FB6A 2YSSB 3WUWA 1T1ZA 5FOBB 3MXVH 3VJ6A 3IXTB 2IANB 4OZFA 3PHSA 5I9QB 3VI4F 4CUCA 2DBJA 5CZXC 3OXRA 2Y25A 4WHYH 4PJBA 3WLBB 1QOKA 3QPXH 4TNWF 5DJ6B 1WBXA 2MWCA 3LN4B 3O41B 3CFCL 4JN1H 3OPZL 3UYPA 1INEL 3VG9C 4XNQA 2P5WE 4NN5B 3I02B 4WCYL 1MFEL 2LTQC 3VFRB 3QNYB 1AIFB 1UWEH 4GG8B 1S9XB 3JTTB 3SJVE 3G6DL 4Z7VB 4XRCB 1DANT 3UX9B 1Z6JT 1ZLVK 2ESVE 5FYKE 4K9EC 3WHE1 3E8UH 5GGRA 1R5VA 1U42A 1EAJA 3JZ7A 1D5BB 1CICD 2EEAA 1YJDC 5CSGA 2PW2A 4LVEA 3C09C 2V7HA 1HZHL 1DBML 3BPNC 3MOAL 3QIWD 5I71B 3S88H 3VDAA 5FGBC 4UT9H 3BSZL 5EOQL 2JJVA 1AI1H 5TGBA 4DZBB 1ACYH 4CU6A 2WWMD 4MB3A 4N8VG 1XF2B 2W0KA 4XP4H 4FFWC 5F89B 5DRZB 3DSNA 3H7LA 3P0YL 5L0QB 1UG9A 1NGPH 3P9WB 3NZ8A 1BFOB 1IEBB 1FVDA 4L3CA 3RY6A 3SKMB 3CFEB 4GO6B 2YC1B 1QSVA 2IMNA 3Q1SL 1OCWL 5IP4A 3ARBA 3M1BA 3PWPE 5ECJE 4RGND 3ILPB 4HIXL 5ITBH 2IBZX 3LEXB 2VXVH 2D0HA 3C5JB 3TVMB 1N64H 5FIEA 5IVZA 4YDJA 3O6FA 4FXKA 5JHLH 2BNUB 4N0UA 5E94A 5D6DA 4JG1H 2N56A 4R6UA 2X4UB 4A6YA 6CGTA 3BDYH 3KVQA 5C07D 1W8NA 2DMBA 3D87B 3MJ8B 5BO1H 1T0MA 2XG5A 5C71A 1IM9B 1J1XH 2ITDA 4XP9H 2JKXA 3SDAD 5EZOH 3L1OH 1SYVB 5F1KC 3ROOB 4L4JA 3JV0A 4PB0H 1FGVH 4OAWA 5D1ZD 1FVEB 4Q9CA 5DMGD 1IL1B 1G7LA 4LHUD 4TQEH 1W8OA 1JIBA 2FJGB 4WWKC 5CLTA 1MWAA 2FJFB 1T03L 3B5HA 1XGYH 2DWEB 5HI5C 1AD9A 3F6LA 5I1CH 2IQAB 4U7MA 4X6CF 2NW2A 2VQ1B 5CEZD 4XPBL 3SY0A 2VLRB 3FFDB 3L5HA 5F9OL 3SE3C 4MAUL 4HLZH 3CX5K 5C08E 5DFVD 3BEWB 2ZOKB 4DN3H 4PJFF 4OIAA 2DD8H 1BIIA 1K4DB 4XCYA 1YMHB 2XN9E 1AXSB 1TZHB 4LPUA 5H35B 3VFPB 4BH8A 1K5NA 4RZCB 1KTDB 1QBBA 3RBGA 4FFZH 5EO9B 3UEZA 2CKBB 4P9MH 1IFHH 4HKXA 1I8LC 4YQXL 3GRWA 2XWTA 5KOMC 3WKML 2X42A 3QUZC 5D70H 3MZGB 1OAKL 3QNZB 2AK1L 3ARRA 2XACC 1DUYA 3H7BB 3TESA 3ZSTA 4C58B 3MRJB 1ZVYA 4WIQA 4X7CC 2AXGA 4ALAL 2D4DA 2F54E 1SJVA 3QIBB 2ZSWB 2HLFC 2MOVA 5AAWA 4QXGH 4NN6B 3HNTL 4NKDB 4LVOC 1ZHBB 5C0CD 4GQ9H 4XC3H 3BD4A 1ZS8A 4NDMA 3VWKB 2X4PA 3PXJA 3QIWC 3KPMA 4CJ0A 4ZQKB 1J8HB 2PCPB 2EDWA 2BP3A 4ZFFB 4LBEB 1KIQA 4XCFL 5J1AA 3DSFH 5GQBA 5DA0B 1T4KB 3VXRB 1JVKA 5FGCB 1A9EB 4B41A 3TO4C 3KPRB 5DR5H 5HHMB 2Z93B 3IKKA 4JHWH 4NRYB 2F8VA 2X4SB 4GXVL 3WO3B 5LGJB 4P5TD 2UYLA 1JMXA 3WFDL 2CPCA 4E0RB 4NYLB 3TPUB 1JTOA 4PG9A 5CSZA 1D3CA 2DM7A 3UDWA 1YEHH 4JR9L 1BWWA 1J7VR 5E8PB 3RVXC 3KXFA 1AH1A 3O2WH 4ZUVA 3PWUA 4A2LA 1Q9OB 4FG6D 4X6BB 4D9RE 3SDYL 2QEJA 3GSWB 5IROC 4K8RC 5AYUH 3ZDZF 1LO4L 5C8JA 1X4XA 5F1NB 3CK0H 5I18L 5J0BA 4Q58C 3RY4A 1OWRM 3MCG1 3NMEA 3WFCL 2COQA 3GB7A 4NO3A 1T04B 4MXVF 4MD5A 4GOSA 3ROLB 3DRTA 3FOLA 2R2HA 3I85A 3Q6GH 4P23D 5C0BB 4QLRA 3UTPD 1CZ8H 2DM4A 3MTRA 2HG5B 1S9VB 5E2TH 1NCNA 1YMMB 4KUZH 2FO1A 3EJZD 1XAUA 3TIDB 1R0AL 1WFOA 4N68A 1N59B 5MEQB 3T4YB 3I6GB 3DRQB 3K8MA 4UIMA 1II4E 1KLUA 3NIGF 3HUJB 1HCVA 2IAMD 4JREB 1JWMA 3GSNB 5GIRA 1IGJB 1FN4B 1KIPB 1OARL 1TVBA 2Z31D 2O5YL 3ZTJG 4O9HH 3TFKC 1ZLUH 4R3SB 3MROA 3DX6A 1OF2A 2WK2A 2KPNA 3LH2L 4I13B 2O5ZH 1TJIL 1ADQH 4EDXB 5IGXL 4OV6F 1G7QA 2QADD 4N8CH 3RBSA 1L0QA 5GSVA 2AK4B 1ZEAL 4XPFL 2JK5A 3O3DB 5I30L 5C6WH 3C08L 5KG9B 1CFBA 1A14H 3X14A 4HXAL 2DAVA 3MGAA 2VDOH 1DVFA 1R3JA 3HFML 3CPLB 4GBXA 4XMLH 4DTGL 3S5LA 2KH2B 4PJXF 5L2KA 4RQQB 3SKOA 2YD7A 3DX8B 3U2SA 3TA3A 1UH3A 2BNQD 3W9DA 4HWUA 5D6CB 4M1CC 5HHOA 2IPUG 5GS0C 4EBQH 1A7NH 2F19L 2E9IA 4ZTPH 1NGZA 5SWZD 2W0FB 4JFFD 4ZO6A 4XP6H 3V8CA 4LLMB 1MREL 3LY6A 1WVZA 3V52H 4JJ5A 2FSEA 1BQSA 5IEKA 1U8MB 4Y4HC 1F4YL 3PNWA 5EN2A 3BIAX 5DJXB 3E0GA 5F9JA 1MCJA 1XEDA 1VERA 5TDNA 25C8H 2VDKH 2DQFA 4GRWH 4RISL 4QRQA 3EUUA 2CGRL 1CVRA 3T3PF 2CDFB 2EH7L 1WJ3A 2OTWB 3U4EA 2AKRA 4PGBA 1G9MC 3CLFL 4MHHI 3MUGA 5FHAL 5TE4H 3WXWL 4PJCA 5D5MB 2BSTA 5HJ3B 1RUKL 1NC2A 3EKCA 2VXTH 1X5HA 4H26B 3KWWB 3KPOA 1XZ0A 3U30B 3O11A 3BGMB 1G0YR 1KN4H 4F9PC 2Z4QB 2EDHA 5I75C 3I75B 1RIHL 4QOKB 3TBVA 2ZWLT 4NFDA 3HR5B 3BP7A 3MRCA 5DQ9A 3MBEB 2R0ZH 3KLDA 4LLUB 4OLEA 1W72H 1HYSC 4OM1L 4XWGH 2BMKA 5E4EB 5ACZA 2BJML 1ZTXL 2V2TA 2F53E 1G6RL 1WQVT 3EFDH 4P99A 2VC2H 3PHQB 4OLUH 3CUPB 1DANU 2IBGA 3X12B 5HHVH 1Z3GH 4W6WB 2ZUUA 2ADGB 3U79A 1I8KA 5CHNB 5FO8A 3BD5A 2FYYA 3S3PA 4KTYA 4DGIL 3WD5H 3NABH 1FLTX 2DJSA 3HZVA 3VXOA 1MFCH 5ACLA 1UWXH 5IVNA 4JQIH 3KPSA 4NNPH 2BVPA 2CR3A 5I16A 3NN8A 1HEZA 2J5LC 4HBQA 4S1QH 4PRPB 4KTEH 4HUVA 3K81A 3ULVE 3OKYA 4N0CC 1SM3H 3D18A 4MDJB 4M6NH 1F6FB 1GCFA 4CN1A 5BJTA 4XPHL 1RZJH 1WZMA 3GGWA 4KDTA 4U4BA 3CAFA 5CINL 3D2UA 5D7IE 1RMFL 1IKNC 5FXCH 3O45A 2E7LC 3FB7A 4HWNA 3DARA 5D1QD 3D39E 4ZXBA 2HJKA 1JGDA 5GJSL 3FQTB 5E1AB 3C60B 4DGYL 1FZOB 5DSCB 2CLVB 5F7UA 1Z2KA 2KUTA 4N0YL 2NZIA 1UYWL 3SKUD 2LQRA 1MF2L 4NKOA 2Q76A 4PYHA 5HGDB 1Y18B 3VWJD 1NLBH 1XH3B 1FO0B 4AQ1B 4MA1C 2Z91A 2OYPA 3LMJL 3IU3A 2HJFA 1OTUC 3W82A 1KTLA 5CWSA 2K7QA 2DLFH 1DN0A 4DK6A 2WAHA 2VLKD 1RY7B 4FTVE 4M3JA 1WBZA 3NACH 3RIAK 1GYAA 5EA0H 3CFBB 4YNYA 1A9BA 2Y36H 4LCWB 4F8QA 5IB4A 3QQ3B 5F6IB 1H3PH 4ZPVB 4QRRD 4TVPE 1MFNA 1MCQA 1VFMA 5T3XL 1FIEA 2YA1A 4KHTL 4LGSB 3MV01 5D96C 1J87A 1O5DT 2E6JA 4TPRH 5ID1A 3F58H 1I75A 4HJJL 5DFWH 1MVFA 3FO0L 1SHMA 4AEIH 1B0WA 1HQ4B 1T20B 3B9AA 3ULVC 3JWOC 1SMOA 5C1MB 4YX2H 3LKRB 2OLDA 1LWRA 2RQ8A 1IGFH 1KCSL 4NQTA 4PLOB 5HYJB 1RI8A 2BCKA 4YDKL 2RCSH 2PYFA 2Z8SA 4P2QD 2AV1A 4U6TA 4ELKB 2A6IB 4JQVA 3QO1A 4HIEB 5DVOA 1A7RH 4QNPF 3B5GA 2XTJB 1UZ8B 3P9MA 3PQYB 1MRDL 3KYKL 2NY3B 3QIUB 3QP3A 5F7LB 4ODXB 3RJDA 4X6CA 2UY6A 4IOFC 4X7DC 1DBJL 4OD3H 4PRNB 1NJ9B 3ZKMC 4ESKA 2X4QB 1IBGH 3OSKA 1CFVH 4FXGA 1XCTA 2G75A 4OGZA 3DGGB 4OQTH 4R97B 4PJFA 2VDRH 1Z5LB 4U1LB 5JHDD 3FO9B 3UJTL 4G42B 1EGJL 3DMMC 4KK8C 5JA9A 5ICXA 4NRZB 2VDLH 2Z92A 2B2XH 5IW6A 2OTUA 1S78D 3ARXA 3P11H 1CGTA 4OT1L 1YQVL 2XWBA 3LVEA 3U7YH 5C09E 4PJ9B 3ORJA 1UXWA 1Q94A 1JGUL 1A3RL 4MCYB 3MV7B 1NEUA 2HN7A 2NX5D 1HKLH 1U8HA 1Q0YH 5ANME 3MLUH 1FG2A 1L7IH 4NO0D 4HFWA 3UTTB 4N8PA 5BS0B 2HFFB 1JPSH 3F7VA 3MLXH 1KGCD 3BH8B 1H9VA 3HCVA 4YHOL 3RNKA 1TTUA 1CGYA 2HP4A 1A7QL 4N1HB 2PTTB 5F7WC 3V7MA 1YEFL 3NFPB 1GAFL 2OZ4L 3OJ2C 2DYPA 1KC5L 2X89D 1E4KA 1F58H 3O0RH 4GAYB 4QXWA 5CD5C 4O4YL 1ZA3B 1JBJA 2XFXB 4KZDH 2BX5A 9CGTA 1EFXB 5J11C 3V7AE 5F9WB 3GUTA 3WE6B 3QJHA 4X7TB 1MH5B 1A5FH 4RDQF 3STZB 4Z7WB 5FA4B 1U92B 3TT3L 5E6ID 3KJ6H 3FQWA 1IGTA 3VXSA 5LKNA 3TLRA 1A6TB 2CLZA 1MJ7H 2R1YA 5LJYH 4OUUB 4G6AC 3BQUD 1TNMA 3WN5B 4R4BA 4O51B 3MZTA 3NAAL 3B9KC 2FH6A 3WJLC 4FFVC 1MIMH 2I9LA 5DD3H 4KJQC 3WS3B 2IQ9L 4KKCC 1FRGH 1NQBA 3ZHKA 5CEXB 2R23A 3AS1A 4RMTA 4Y19E 1A2YB 5FKAB 3NVQA 3VI3F 3BKML 3GI8H 3CH1A 5ILTL 1RU9H 2D7QA 5HDQL 3OR6A 2YA2A 1I7TB 4E5XA 1PVHA 4WUUB 4ZO7A 5CBEA 4OCNC 4UV7H 4JFPA 3RL2A 5IQ9A 1G6RA 3SOBH 3L9RA 4P46D 3T0XA 4IS6B 3O9WC 3L6FB 1IC7L 4U1MB 5DQJA 4X0KA 2FEEL 4Y16A 4J4PA 4RAHA 4YFLF 5B39G 5E8EA 4Y7MA 3MUJA 3VXUD 1LE5B 4X6DE 2C3VA 3TV3L 5JXED 3PL6A 4ZYKA 4LF3B 4KKBC 4KV5F 2IPTL 3WYRA 5ISZD 3FMGL 3A6CL 4P5KA 2BVQB 2P48B 5C0JB 5DHVB 1FNGB 4QRTB 4I3RH 5E2WL 5FOJA 2B1AL 2HMID 3VGAB 2D03H 2ZNWA 4LU5H 3FQRA 2Q8AL 6FABL 3K80A 3CU1A 4ZUTA 1XF3B 3AREB 2JJSC 4PJDB 3ZKND 2ICES 4JLRB 3QG7H 4P57B 1NMCC 2WW8A 5I8EA 2IEPA 3P9LB 4HS8H 2X1OA 3W0WA 4UBDD 1U8JB 4G9FB 5CAYB 1CLZL 2E9BA 1TJHL 1RHHB 4OZIB 4PJ7B 4GKZA 2VXSH 4M5YH 2R8SL 2YZ8A 3WEXA 3CSPA 3MOBL 1NCWL 4XVJH 5D7JA 3KYAA 3FFCD 5JW4N 1UJTA 1VFAA