4GLRH

Structure of the anti-ptau fab (pt231/ps235_1) in complex with phosphoepitope pt231/ps235
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
229
structure length
229
Chain Sequence
b'AVTLDESGGGLQTPGGGLSLVCKASGFTLSSYQMMWVRQAPGKGLEWVAGITSRGGVTGYGSAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKPALDSDQCGFPEAGCIDAWGHGTEVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phospho-peptide
publication title An Ultra-specific Avian Antibody to Phosphorylated Tau Protein Reveals a Unique Mechanism for Phosphoepitope Recognition.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 46
structure length 229
sequence length 229
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4glrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4glrH01
1U9KA 3V5KB 4EEEA 3DUHA 5MERA 5CINH 2D0GA 3DSNA 3RPIA 5BMFL 5D8JL 2HTLC 3ZL4H 4LGSB 1A6VL 5C0EA 1BOGB 3GSNH 1QPPA 3WDJA 4UNUA 3VWKC 1CGXA 4L9LA 1G84A 4L8SB 3NMEA 1OY3B 4HH9A 1F4HA 4ZOCA 1N5AA 4JFQA 4JB9H 4OGAC 5CJ8A 3MNVB 1FC2D 3RWEA 4YHKL 3KPNA 4K7PL 3ARYA 3O4LA 3MLWH 5D70H 3EOBB 4PFEA 3HRZB 3GRWH 3QWOB 5DD1H 3THML 2X7LB 1CIDA 4JFPA 1ERNA 1S8DB 2GFBB 4G5ZL 3REVA 4KH2A 2CKBA 4NC0B 3TESA 3F7QA 2P43B 1F11A 4N0YH 5JLZA 1KB9J 5SV4A 1GH7A 2N7BA 2OL3B 5FO8B 3QPQC 5I8KL 1OF2B 5I17B 1XGUA 5IMLA 5E56A 3ZE1F 4Z6AT 2EZ0D 1G0XA 1BGXH 4G6AC 1J1XL 1JZ5A 3L1OL 3U30C 2ZUTA 3MRLA 4F2MA 3PV7A 5I76A 2Y72A 1HNGA 4L9LC 4OCWH 5DRWA 3KLSA 3QAZC 1B4RA 1DQJB 4MMZC 4C57C 5F3HB 3T0ED 1FAIL 1X6LA 4KHTH 2I9LA 3CX5J 4FMFA 3DMMC 4F7MB 1KJVA 3NAAH 4Z7VF 4ZUTA 1FLRL 1EHNA 3V6FA 2BVEA 3MUHL 3B9DA 2BNQD 3TBYB 5CEZD 5JMRA 2P5ED 1IC4H 3VGEA 2Y7QA 4EDWH 4O2FA 3K8LA 1I1CA 2CLZB 1OAYL 4XH2A 3MRNA 1X5LA 2UUDK 1KIPB 2IPKA 1KACB 1U8NA 4RWHA 4Y5YC 2JJUA 1CTOA 1NMCB 5I1IH 1UWXK 1VKXB 2AK4E 1I4FA 3FOMA 4UAOC 4XNQB 1KB5L 1BBDL 4PV9A 5H94B 1CICD 2A1WL 4P2RE 1S9YA 2HN7A 4G80A 1HXMA 3T77B 1OAQL 3C8KA 3GM8A 1FNFA 1IFHL 4WWKA 5K9QI 1WIPA 4U6XB 2VZ3A 2C9AA 1INQB 3WFDL 4UBDC 1XH3A 4XZUB 1YJDH 2J4WH 1ZLWK 2XZCL 5EU6D 4O02H 4WW2A 3AMLA 1R3KB 3TYFB 5KZCB 1DSFL 5FXCH 3ZKSD 2WUBL 1FE8L 5KS9F 3KG5A 2IAMA 3EBAA 3VXSD 3SKJH 3WBDA 5JPMB 1DTUA 1QLFA 4EUPG 2FHBA 1DDHA 3MOAL 4L4VE 1I1AD 1XIWC 1JZ6A 3S3PA 5F9JB 1JNHA 1RK1A 1TZIB 5CGTA 4NM8L 3DECA 3TNMB 5D2LB 5IFJA 1JV5A 5AWNH 1C1EH 1QVOA 2HFFA 4P3DB 1R3LB 4ZFOB 5I1HH 1BWWA 4QXGL 3VXUD 3RZCA 1YYMH 4OKVB 1YNLL 1OGAA 1D5BA 1CGSL 3MCKB 4J6RL 5HI4C 2F54A 5BO1H 4YQXH 4RNRA 3GBML 3MRBA 3TCLA 4KJWC 2XY1A 1JZ2A 4LLAA 1N64H 4POYA 1M7DA 3D0LB 5C0FA 4R8WH 1MCPH 2OR9L 2IAMC 4NPYA 4ODXA 2ZSVB 1JE6A 3JSSA 2NTFA 3RWFA 3K74B 3U0PA 3VXTA 2DJSA 2ZNWA 3PWNA 1GGUA 4N5UA 1F13A 3DYMA 5DJ0B 3O3UN 3SGJA 2CR3A 1AC0A 3WIIL 5HJ3A 4TVPL 3BZFA 4JE4B 3WNNA 4Y4KC 3CFIC 2GHWB 1JMXA 4NKOB 1RZGA 3JV6A 3PG2A 4Q58C 2AV1A 3M8OL 2PXYA 4OFYD 3LEVH 3NCCB 5DUBB 1NFDE 4G6KH 5HGDA 4F37F 4ZUUA 1JWUA 5AZ2L 2Z92B 1GHFH 2E7LA 2X4PA 2QSCH 1EMTH 3DV4A 3LMJL 3UTZA 1RUMH 3QRGH 4DCQA 3VFUA 1P5VA 1EEZA 1NCUA 1NEUA 3OF6D 4P23D 1DQTA 2CPCA 2VR4A 3VXPB 5HYJE 3H3PL 2A6DA 5KSAA 1EJ6A 5KW9H 1MJUL 2VB5A 3C9NB 5B4MD 3SGJC 1YEFL 5KBNC 4MB5A 4B53A 5E2UL 1N26A 1JGEB 2ITCA 4HS6B 5D2NB 5JHDB 5ANMA 3IU3B 5EBLB 2YBRA 2PXYC 3ZHKA 4YXLL 4GOSA 4HH8A 5ETUB 5EZIH 2ZOKA 3AU1A 1VFOA 5DD6B 3T0VA 3C60A 2NXZD 1T4KB 2NY5H 3MRPA 4MAUL 2UWEB 2JK5B 5DZNA 3M1BA 3QDJB 5DK0A 4EXPX 1DBAL 2PCPA 4OGYL 1GGIL 3RDTB 3S3JA 3WFZA 3S3SA 1RJLA 1V3JA 2R15A 4PJDE 1Z3GH 4PY8I 3CSYA 3OGCA 5KSAC 4PJGF 4P9ML 5TQ2H 3HE6A 2VH5L 1OARH 4OZHA 5CSGA 3V7AG 4DZ8A 3U0TA 4QHLA 5C0JA 5ELIA 5IBLC 5ESVA 4OIIH 4NQCA 1TTFA 2RQ8A 2VZUA 5IF0B 5JA9A 4D0DB 4BKLB 2P46B 5CJXC 2ZCLL 2OL3H 1DBML 4ELMF 3P11L 3UBXI 4L1HA 3TWCL 5DMIL 4LKCB 4U1IA 1NCCH 2XTLA 4XGZB 5FO7A 1ED3B 3VRLE 4PRDB 3KWWB 5HYSB 5BZDA 3OKMB 1T1WA 1L9NA 4RMWA 5DD3H 1D6VH 3SJVA 3QUZD 4OAWA 4Q74A 4EUPA 1IAKA 2B7DT 4RMRA 1W72L 2GJ6A 2H2PC 3HE6C 1F6LL 4C56B 4K3DL 2OTUB 2N56A 1OVZA 4PJXB 3SO5A 1IGJA 1OLLA 4RFNC 2I07B 5DJYB 3TIEB 5I1LB 4N9OB 1A7PL 5E8PB 4Q9QL 2XRAL 5ERWA 3MLYL 3HI6H 5C0ND 4IRZL 5KVGH 1FPTL 4MAYB 3SE9H 4P4KB 5I8CA 3MLSL 2X4QB 3SEPA 2W9EH 1AY1L 5GIRA 1A1NA 5ICYB 4G8GD 1JCKA 3DXAB 4HGMA 4HX1B 1QRNB 3CFJB 2XA8L 3S96A 5I18L 3V0WH 1P4BH 5ID0B 2OI9B 1ZHLA 3GBNH 5GRWA 4NN5B 2XG4A 2V7NA 1WZKA 3NIDF 4R7DB 4I5BA 4FABH 4RISL 1KIQA 3BO8A 4F57L 3I6GB 2XN9E 4HK3N 4MWFA 3GJEB 1XR8B 2DTML 5ALBH 3T3MF 3CPLA 2X9XA 1QBBA 2DQFB 2QQNH 3QHZL 2APVA 3FQRA 1I3UA 3TFKD 4MYWB 4MA1B 1CL7H 5GRJH 1NLDH 1OQXA 3OZ9H 5SX5H 1NCBL 3ZE0F 3EYSL 5MEPA 1M7IB 3EKCA 4PJ5A 2GITA 3VXRD 5E08H 4E9LA 1BM3H 1H3XA 3EZJB 1MRDH 4BFIB 1Y0LA 3NCJL 4FFWD 4CADB 1MIEL 1WFNA 1J7VR 4Z5RA 3H7BB 4M9PA 4ZODA 3IJYA 4YC2C 3ZDYF 3ULVD 4ZUSA 4HWUA 3MBEB 3QFJB 5GGVL 2D03H 1MH5A 1U8IB 3UZVB 5MI0B 1QSFA 5DJCA 4ZTPL 1FGNH 4IMKA 3DSFH 3SE8H 4YDVB 4WHTA 1QLRB 3PUCA 1CU4H 4DJMA 1ZS8B 4W6WB 3W0WD 3V4UL 2IBZX 1C08B 1I1FA 3P40A 5H37H 4WJ5B 3RI5F 5GJTL 3TA3D 1U8MB 3UC0L 5I1JL 2FHFA 5FUZH 5F7EH 1SBSL 2PTTA 1P4LB 5K59F 4PY7B 4F9LC 2NYYD 5BZWB 1D5XB 3D39E 4MVBD 3ZZ1A 2C4XA 3A6CL 3TEUA 1U0QA 3PQYD 3EOYG 3LKQB 2E27H 4R90H 5IOPB 4X7SL 5GJSL 1C5DA 3MRRA 4J3XA 1F8TH 1N7MH 3R0NA 4NNPH 4OLUH 1QLEL 3ZDXE 3MFGB 1B6UA 3F7VA 3FQXA 5KSBF 3GSWB 1EEYB 3KLHD 4XRCA 1R5WB 4CRPA 1KLUB 4F7PB 1TQCC 1N4XL 3OKDB 1U8PA 3LSOA 4P48A 3SDDD 4QF1B 3BX7C 3P9MB 5E6IB 1G0DA 1FGVL 3FB7B 5E24E 1AGEB 3SPVB 3OJ2C 3EFFA 4I4WB 3SDAB 2AJZB 2FD6L 5ITBH 1YQVL 2H32B 1OP5H 4JANB 1SM3L 1L0XA 4Y19B 4XAWL 1YMMA 4QRRA 2EYTA 5L6YH 3MR9B 5TE7L 4ZPTA 1K8DB 2Y06H 4WENB 1AR2A 1T83A 1ZA3A 5ITFB 3SGDH 5F9WB 2I5YH 4Y1AD 5D1XB 4F80A 2V2XA 1IQDA 4XNYL 1YEKH 1K9TA 2XNAB 3MOBL 1BEYL 4HWBH 4YZFF 2RJMA 3CCHB 4OZFA 3TF7C 1TJHL 2ATPA 4JFDB 3RWHB 2HP4A 2VYRE 3V6BR 5JPNB 2RFXA 2FEDC 4NJAH 4HCRL 4O4YH 3EFDL 4XP6L 1QO3B 3G9VA 4JKMA 3D3VD 3MACL 1MHHA 4X9FA 4HUNB 4ZD3L 1ADQL 2Q76A 3VG9C 2NY4B 3K2MC 1NPUA 3O6FC 2IADB 4M1CC 1Y6KR 2AJSH 1R5IA 2D7OA 4P5MA 1XFPA 4P49A 3FB5B 4ZQKB 1WWWX 2B1HL 2Z93A 5E8OB 4U4BA 2R2HA 4KQ4H 3VH8B 3LS4L 4N9GA 1S9WA 1E4WL 2YD1A 5EN2A 4HXBL 3RWCA 4F7CB 1LO5A 2D31B 5L0QB 2Y1VA 1HH9A 1QZ1A 2QADB 3QHFL 3O6KL 2VNCA 4HUXB 4S11A 3WXWH 1VGEL 1MFCH 4Z7NE 5EO0B 2HJKA 2XZQL 3WIHA 2P8LA 3LEYH 2DLFH 4HC1L 4JKLA 1L7IH 1JPTH 2OR8A 3MV11 4OSUH 3RJQB 5CLWA 3Q6FB 4PBWD 4L3EA 1FG2A 5TF1L 1K4CB 1UKSA 5EC2B 3FQNB 1HHJB 4WEMB 1LO0L 4KMTH 4PG9B 4Y16C 3TIDB 5C07E 1KC5H 4IOIA 1CFNB 5CEYB 2VXVL 4L9DA 4X5WA 5F7MC 4G9FA 4LPYA 1BBJA 3EW3B 1YQ2A 5E7FA 4ZFZA 4NQCE 3JTTB 5F6IC 3KPOA 1G7QA 1QYGL 2DDQL 4U1HB 1WBZB 1ZEAH 3RAJH 1VCAA 3U6RB 4LSDA 5I30L 4PGDB 5JZ7C 4CDGC 3ETBF 5IFHH 5IFAH 5MEQA 5L2JB 3LRHA 1CE1H 1QA9B 2DBLL 2H3NB 2QJDA 4Z0XA 2F19H 5GGRY 3VG0L 1BIHA 1F4YL 1U93B 4Q2ZA 4JAMB 2ENYA 4X99A 1L0YA 1TJGL 2D3VA 1UWGH 1OAXH 1NCTA 2EYRA 3KPLA 2QTEA 4LLDA 1AKJB 5C0IB 2IFGA 5E03A 3VRJB 3FT2A 4HFUL 3BQUB 3ARFB 1JNNL 1LK3H 4XCNA 1T0NB 1EO7A 3H0TA 1AGCB 4E41E 1EEUA 2EDQA 3IDUA 4PRNB 5EZJB 5HHQB 2MFNA 2P4AB 1ZVHA 2VZTA 3FB8A 1BF8A 2R1WB 1P1ZA 1Q1JL 1V3MA 4PJIF 5BXFA 5T33L 2EKSB 4UQ3B 2HLFD 1F02I 1U95B 3QUYA 4EN3D 3C5SB 5HGBA 4JPKL 2CSPA 4XCCL 1G6VK 3L95A 4OBRA 4XWOD 4JDZA 3BWUC 3O3BB 3HR6A 4V1DA 3ZKXB 5INDA 1YNKL 4YUEH 5DJDA 2ESVA 4U0RC 4YGVA 4QYOB 2AEPH 2PN5A 5MHSD 1C5CH 2IQAB 1J5OL 4W4OA 1OW0A 3T0WA 1YEDB 5DJXA 5A40E 1P7QB 2OQJB 4PRAA 5C0CA 1QFOA 5TH2B 1UCBH 3KPRD 1SYVB 2FNBA 4MXQC 1QTYT 1A5FL 1JGUH 3AM8A 1J0JA 12E8H 1SJEA 4KROC 4ZNEA 3P9WB 5JHLL 4K9EC 1TVDA 1SEBA 2X89D 3QUYC 4KUZL 4ODUA 5FYJH 3T0XA 5JQ6H 3T65A 1XF2A 3RBGA 4Y2DD 3RL1A 1UA6L 4U2YA 4KTDL 3EGSB 1OT2A 5EUOF 2Q8AL 3SCMA 1NGYB 5IHZB 1YDPA 2H32H 5IMOA 5LJYH 3HZMB 2BC4B 4KK6D 4W4OC 1U3ZA 1SJHA 1BX2A 4W81A 1XGQA 1C12B 3MLXL 1A7NH 4IDJH 4NQUA 3QDGB 4ZXBB 5LVEA 5B8CB 3QXDB 4IIQA 4JGUA 5C92A 2VL4A 4BSVB 4EI5B 4YH6A 3QXTA 3LV3B 2D4FA 1J8KA 5SWSB 3RPKA 3AM8C 1TVBA 3L3JA 1XF5B 4XXDB 3AMKA 5CKAA 1ZE3C 2IMNA 5MEOB 2DQDH 5C0GA 5KOVC 3DX6B 4Z77A 2CDFA 2H8PB 3C6LB 1HH6B 4U1KA 5HD8C 2FX7L 3DGGA 4F33B 3O3AB 5JW3L 4WRLA 2C4FT 2I24N 1IQWL 5KJRH 3TO4A 3P4NB 4NWTL 1NFKA 3U9UA 4OGXH 1KYOJ 3QDHA 5IROA 3QIBD 3FO0L 4EIZC 4I8DA 3DWTA 4JKPL 2B20A 4ONHA 1UVQA 4CU7A 4XMKH 3NCYS 4KVNL 4QCIB 2A2QT 3QCVH 5I9QC 3U0WL 3EO0A 2QHRH 5BV7B 1X5YA 2VLJA 1ZHKA 5C0NC 2B4CH 2R69H 4MJ2A 3P0VL 4AG4L 1R0AL 3AFLA 2OCFD 2X6MA 3NA9L 5JR1L 5F88B 1MUJA 4OCXH 2IGFL 4GW4A 4PJBE 3OR7A 4ZTOH 4QHUB 2H2SC 2OK0H 3BJLA 2FL5B 1MREH 1Q9LB 2CMRH 3OV6A 3UP1A 3UROR 1HQ4A 2A6KA 5IROC 5HYQB 3NTCH 4Z8FH 4LIQL 5I66A 4J4PA 4ORGB 2HVJA 3U7AA 4MQXD 4QGTA 4YHYC 4PP2B 2BNQE 5A2LH 3RZCD 1OB1A 5CEZE 1PEZA 3MLRH 3R06B 1OGAD 2O26U 5DR5L 2BNUB 4PD4K 1AGFA 1QQDB 2IALB 4B7IA 2F54D 4RX4A 1Q94B 5DJZA 2DLIA 3BP6A 5IVZB 4JPVH 1NGQH 5CJOL 1S7SA 4NRYA 4RGMB 4KRPB 1PEWA 4M7LH 4DQOH 4U6YA 3QEGL 3OAYK 3WFCL 3T1FA 4CBPA 5FUOH 3P0GB 1HHIB 5BJTB 3L5WB 5IK3A 1IMHC 1JWMA 3OKEA 2KDGA 1NFDF 2P7TB 1CR9L 2HT2C 2E8ZA 3WHXB 25C8H 5JIPA 1FIGL 5I73C 5EU6E 3ULVC 4J4PC 3PHQB 2PR4H 3GK8H 4HKJB 4MDJB 3O8XB 5DDHB 3RTQB 3VFVA 5KAQG 4JRXB 2X4TA 2AJ3B 4OFDA 5KN5B 2A0LD 2BSSB 4NT6A 4L8DA 5JOPE 1H8NA 4BQ6A 1T5XA 4MZ2A 1WT5A 1HZHL 4I77H 2YWZA 4LSPH 4KKCC 1A6UH 4Y4FA 4HQQH 5B3JF 2VIRA 4F7TB 1T1ZA 2NY2C 4X5LA 2IH1B 5F1SA 4DN3H 3DX8A 5HHVH 4YLQT 2EDYA 4FQCL 3SDXB 1MFEL 3QFDB 3MRHA 3TBWA 2J88H 3INUL 4GT7A 1BVKB 3KGRA 3HPLA 3JWDH 4AENB 1LDPL 1FNSL 4N0UA 5K9OB 3U4EB 1KCSL 2RB8A 1TZGL 1T7XA 3RWJB 3KJ6L 4HJ0C 3RGVA 5E0QA 5ISZD 4ALAL 2OJEA 3GI8H 4LKXB 4JREC 1FL6B 3PDOB 5EO1B 4NQEB 1FNGA 2VMFA 5DK3A 3DRTB 4PGEB 1ZV5A 2PO6A 1WT5C 4C58B 3VXMA 2NY1B 2IANA 1CFVL 4HV8B 1MRCH 4ENEC 1PX3A 5TE4L 3VGDA 4OLVH 1YZZA 3IDYB 4QTIH 4OJFH 2G60H 3D0VB 3VFSA 4HF5L 4OF0A 4X80L 1WFUA 5DHYA 4IBLT 4JY5H 4RBPH 1KSRA 4WTWA 2DD8L 3KPSB 1MEXH 2CKBL 2IH3B 4JKWA 1PVHA 4RGOH 5IEKB 3O6LH 5T5FL 2HFEB 3RGVC 5DWUH 3X3FH 1B0RA 1KPUA 5I16A 4NNYB 5A3IC 2HKFL 5HI3C 2DQUH 1M7XA 3WNLA 2PO6C 1MLBB 3QCTH 1I8MA 4NFCA 4WI6A 4WEBH 5D71L 1JGLL 1FG9C 5JDSA 1TNNA 2DYPA 3PWJB 3SQOL 4NQTA 1YEGL 3SJVD 1MI5B 4HDIA 3BP4A 4DKFH 3WJJC 2X4OB 3PIQB 5E99L 2H6PA 2GJ6D 3DUSB 4JN1L 5HHOB 4K8RH 1KJ2A 2W60A 3G6JB 4X4MA 8CGTA 5J9PB 4D3CL 1G7IA 1C5BH 1QP1A 5D5MB 2QKIB 4HBCH 4BH7A 5DEZA 4MQTB 3CVHA 4RA0C 2UY7A 4GW5B 2AP2A 3LQZA 5ICXB 1IEAA 1LEGA 4KQ3L 3OJDA 3VA2C 5C0CE 3HNTH 1HINH 3G6DL 2X44D 7CGTA 1XMWA 5IHLB 5FOBB 4FQIL 2VLLB 5GGSY 1DR9A 1SMOA 1U8HB 3VFPA 3BWAB 3PWPD 1CGYA 5D7JA 3T4AA 4PRBB 5E6ZA 1NBZB 4FZEH 4S0TD 3VMOA 4WY7H 3TZVC 4G8EA 5BV7H 4JM2A 3RY6C 4QOKA 2BOCB 1YN7A 4M6MH 4X8XA 4HKBA 3BGFB 2FJGB 4S0SD 4H20L 5D72L 5IMKA 4RRPA 1P4IL 2E7HA 4XCFH 4LLYA 3WV0A 2APWA 3L3HA 3VFWB 1CDHA 3IB4A 1FP5A 5IWLA 3G5VB 1FFQA 2EO9A 2W0LA 3IVKA 4PJ5D 2X4RB 5KSVB 1F97A 3O3DB 4PJ8D 1JF1B 4L8BB 3ZYZA 2BSRA 4KZDL 1YN6A 4X6DB 1WISA 3UMTA 1EX0A 1VENA 5I1DB 2C3GA 3QIUA 1FZKB 3SKMA 4R2GC 3Q2CA 4R4BB 5FDWB 2D7TL 4JO1L 4EI6B 4GRMA 1JRHL 5FF6B 3QJHB 2J5LB 3C2AH 1QSFD 4MCYA 4APQB 4YK4C 5T3XD 4DKEL 1RY7B 4Y5VA 2QSQA 5DJ2A 1UACL 1A7BA 4J3TA 4O51B 1P69B 2WNGA 1DBJH 2J6EH 4DVRH 3BYYA 3G04B 1MJ8L 2AAVA 1Q0XH 4J3OC 1PZ5B 2R0LH 4PJCE 4FXGA 3N9GL 3PWLA 4MCZB 1E27A 4WW2F 4LCCB 3G6AB 1RMFH 4Y0GA 1B4JH 3UJTH 1CK0L 1CN4A 1MF2H 1T0MA 4N1EA 5C0BB 1QBMH 4POZC 4BFGA 1CBVL 4JR9H 2J1KA 3MV8A 3ZDXF 1FFRA 5DRNB 1C16B 2JCCA 3REWB 1DQQA 5DGRA 2YKLL 1KOAA 3OG4B 1WBYB 2C1PA 1CL7I 1R3HA 4LDOB 2E7BA 3ROOB 4Y5VC 3QH3B 2OTWB 1RUAH 4PRIE 3LH2H 4XPTH 1GOHA 1RZKC 1LE5B 4FFZH 4FQHA 5HDQH 3SO3C 3PNWB 2GT9B 2V5SA 1HI6B 3KLAB 4N1HB 3DHMA 4UT6L 3HMWL 3UZQA 2F74A 4LQFL 1XR9A 2VC2H 5LAXA 5MEND 4W4NA 4HIIA 5D96B 1A7QH 3GMPA 1GGTA 4HWZA 3ULSB 3BAEH 4TRPL 3ULVE 1HYRC 4LU5H 2B1AH 2BNRB 1JZ4A 1D9KB 5GQBA 4CVXA 1R5VB 2YR3A 4G7VL 4BELD 3IXAB 1HNFA 3ILPA 3EOTH 4JHAH 1QEWA 3W0WE 1YY8B 4KGJA 4DGIL 4NNXA 1PKQA 3QG7L 4NZUL 3VFTB 3KHOA 4OM1H 5GRUL 2O5XL 1QNZH 2BK8A 1LQSR 3KYNB 1YUHA 4M48L 5DURB 3BHBB 4PJAB 1ITBB 4KJPC 3GHBL 5CILH 2FX9L 1RUKL 3L3DB 4O00A 4B7LA 1OAKL 3BE1H 5C0AB 4YDJB 5L2KA 4WHCA 3LKRA 4WI8A 3W39A 3JV0A 1MCHA 1NGPL 1MCBA 4H5SB 2X4NB 1GVIA 1I9IL 1QBLH 4IRJD 3QIWB 5EBMB 5BS0E 1K8IA 2R9HD 1TCRB 2YK1H 1JNLL 5IB2B 4L4TB 1O7SA 2VXUH 4P3CL 1RIVH 3FQUB 1NEZG 3G5XB 3GSQB 1KN4L 5DA4A 1RVFL 1TETH 4LARH 3WO4B 4HT1H 1X7QA 4LPTA 5E94A 1T21B 2UVEA 1DBBL 1NJ9B 1DL7L 4FNLH 1RJYA 5J06A 3IS1X 4WVRA 3TVMD 2VQ1A 3GMRB 4P9HC 1AD0B 5C3TA 4OTXL 2NLJB 3MUGA 3WD5L 3MV9A 4PLJC 1DLFH 2YS4A 3VDCA 4Z7NF 2F5BH 1S7QA 2ZUXA 1OQOA 4FN0A 4ODHH 1LEKA 1P7KB 5DS8A 2VLRB 5EU3B 4K94L 4MNQB 1VADB 3SGDI 3NZHH 1UH2A 4JFHD 5T1LD 5E1AA 1VHPA 1CE6B 2DQJL 3HE7C 3FFCE 1FNLA 1CFSA 3EYUL 3CH1A 3G08A 5C08A 2DN7A 2AXFA 4JFXA 1U3HB 4L3ED 4NKMB 1FL5A 3L3OA 3VXME 4JRYE 3QJFA 2EXWC 2Y36H 4X7CC 4KV5E 4U1SA 5IW6B 4HFWA 4JZJA 1HKFA 1BD2D 2HRPL 5J3HD 4Q9BA 3D3VE 4G9FD 3ZHLA 1I9RH 1CLYL 3Q5TA 1FFNA 1FH5H 2ZUQC 1AD9A 3GGWA 1TPXB 3PL6B 5E00B 2OSLA 5LGJA 1J8HE 4Q97A 1V7NH 1DEEA 5K9KB 1KN2L 1RUQL 2HJFB 4ZYKA 1ZA6B 5GGQH 3VD4A 1EGJA 2X1PA 3OQ3B 1INEH 4MNGA 4XNZB 2ICEB 1WC7A 4AYFA 5DD0H 3P30H 1T1XA 1EAPB 3BEVB 2DQTH 3T09A 5LXGL 1WAAA 3HC0B 4PRHB 1KTRL 4LNVA 4DKDC 1IGFH 1Z0NA 5C70A 3NCBB 3KYMB 3TN0C 4PP1D 4JZJC 5HGAB 5ESQA 1G7JB 2Q1EA 4YNYA 4WFED 1DQML 1D7FA 1ZHNA 4D9LL 2Z8RA 1HILB 1YPZA 4WUKL 2YA2A 1N8ZA 1EAJA 5A1AA 1MHEA 1KCRH 4M62H 4CVWA 5BQ7A 4W68A 4C4KT 3WN5A 2R0WL 5KS9B 1S5HB 2B5IB 2Z0BA 4MHHG 2E6PA 3PP3H 4HWEH 2VABA 3MODH 4TSAL 5GS2H 1ZVYA 3NCYP 4M1DL 1GC1H 3KYOB 5T3XL 2VITB 2JJWA 4LSUL 5SWZA 5DEGA 1OTUC 2R2BB 1OTTD 1Z9SA 2P5WB 2JB6B 4IOFD 2WUCH 5GZOC 3WLWD 2FX8H 4MD0B 3ESUF 5F1IA 3MLUL 3S37X 5FCUH 3IF1A 3OPZH 3T3PF 5M7QA 1PKOA 3LVEA 5CMAA 5DGQA 1SY6A 43C9B 1A1MB 4S2SB 5FV1L 1KB5B 3Q1SH 2CLVB 2P47B 3MNZA 5AG9A 3WN5C 1DVFB 5J56B 1T89A 2DKUA 1V7MH 2WBJB 1MY5A 3S5LB 2FO4B 3HCVA 1HHGA 4GLRH 4WW1B 5JORB 2BX5A 2NY6C 2ORBL 2YD6A 5CZVL 1PG7H 5DHVB 3MV7A 1GCFA 3DTXA 4LBEB 1KCUL 5ILTL 5GRZA 1DE4B 3ABZA 3DV6B 3DROA 4XHJD 5GS0H 1MFBL 4PPTA 1E4XH 3KYKL 5D93C 2NXYC 3C5ZA 1NEZA 3HUJE 2OXHA 1ZT1B 4QY8B 5F7KC 4XTRC 5ESAB 1LHZA 3SCMD 1G9MH 1QFUL 3BPNB 3QNZA 5D1QB 5KZCD 2BVQA 3PWUB 3OKNA 1LGVA 3IDMB 2WW8A 2GJZB 2ZZUT 2CK0H 1FVEA 4P59H 1H3VA 1ZT7A 2P44B 5JW4M 1XCQA 2CJUL 1BP3B 2XQBH 5D6DC 1A3LH 1JUFB 1KFAH 1LE9B 5DF0A 1DJSA 2XWTB 4LLUB 1T89C 5GS1C 3ARDC 2L7UA 2PW1A 1ZLSL 2FBJH 4OF5A 3T2QA 4GUPA 3QI9C 4ISVA 4ZFFB 1RHHA 4L29A 4NSKB 3CXHJ 3BXNB 5L7XH 4JEGB 4R6UA 3VI3E 2IG2L 3C5ZC 1ACZA 4UTBL 5CJ5A 5F7LB 4XVUD 4ZS7H 4G6MH 4JFYB 4YHPB 5GPRA 4P2QD 3T0BA 3TO4D 2VKWA 5CLTA 4F58L 3KPRE 3DRQB 3EJYC 3MLTA 2JCCE 4LEXL 2X1WL 5IQ7H 1F58H 3LHPL 3QUKA 4TQEL 2Q86B 3VI4F 3B6SB 3GIZH 4MA8L 4PJEA 4YX2L 3IGAB 3SE3A 4TTDC 3FFDA 5E2TH 2PW2B 1MIMH 3O6ML 1NAMA 4K3EL 2HJLB 3HZVB 4LVNB 4U3XA 5HVHB 4PJGB 15C8L 4PGCB 4Z7OE 2AKRA 5KG9A 3RL2B 4ZDHA 1IGYB 4IS6A 2YZ1A 2VLJD 4JHWH 5EZOL 3DUUA 4WCYL 4XBEH 2APFA 1NMAL 3ULUC 3WKML 2BVUA 3S98A 2WM0A 1QFHA 4D8PB 5HHNB 4CU6A 4ELMB 1KJ3H 2FHCA 5DC0A 4N8CH 1QPXA 3OB0H 1RK0B 3GMNB 2W91A 1VERA 4L5FL 3WIHL 1N59B 4M6NL 4YXKH 4ZSOE 4TULL 3IDIA 3O3EB 5D8JH 5BMFH 5E9DA 3SE3C 4UIKL 4K71C 1A6VH 3WL9B 4HLZH 1N6QL 4B0MM 3LN5A 1GRWA 3WJLC 4MS8D 2KKQA 1SMAA 2K7PA 1HSAA 2YXFA 2A73A 3E6FA 2HLAB 5AG8A 4Y5XB 4GMSL 2XZAL 5D7LB 4M8QA 3MREB 4AEEA 1JYNA 3LQMA 5I75C 1T04B 4YHKH 4N5ED 2GK0B 2YPLD 3SDCA 3MYJA 3QDJD 1ZWIB 1UJ3B 4K7PH 2QQKH 4KY1L 5I6XC 2BSTA 5DO2D 5SWQB 3THMH 1NUGA 2F8XC 3LZFL 3KYAA 3MMEB 2X9WA 3GO1L 3W11C 3KNBB 1RAMA 5GRXG 5J1TC 3MJ7B 1D5ZB 1Y6NR 4E0RA 1EFQA 4ZS6C 4A6YB 1W0VB 4DOHB 3L3KB 1R24A 3DVFA 4LCYB 5I8KH 4Q6IA 3QNYA 2JIXA 3RVWC 2VLKA 4AIOA 1J1XH 3L1OH 4XX1G 5KOMC 2IEPA 5JOFB 2A6IA 3CUPB 5FUCE 5ENWA 4P0DA 4XAKD 3FT3B 4OCSL 5D1ZA 4Y4FD 1BAFL 3K46A 4EOWL 1ORSA 3SKNB 5I74B 4X9GA 2EEBA 4R0LC 4PV8A 4XC1L 2V2WA 3QR2A 3UTQB 1TQBC 2CR6A 2FYYA 1DANU 1NANI 4FG6D 3LIZL 1W72B 3BP7B 1FLRH 5IB3B 2BOBA 2ERJC 5GGTA 4LGRB 2ICWB 1NSNL 1U8OA 3EDFA 3OB8A 4K9EL 3FN3A 4DVBA 1QR4A 2FJHB 2H26B 2ADIA 5DI8B 3N1QC 4LFHG 1KV3A 4L3CA 3C2SA 2P5EB 1OAYH 3QQ3B 5IVXE 4C83A 3ARGB 1CFQB 3GEWB 1LP9A 1JHTA 4P2YA 4PREA 1DQDH 2GSIA 2CIIB 3MGOA 3ARVA 5DJ6A 1H5BB 4MAYD 1KB5H 1BBDH 3HG1E 3KHQA 5D1ZC 3VWJD 2A1WH 2W07A 1S7WB 2J8UA 5B3NA 4BSWB 1WFTA 1YJDC 1CICB 4OV5A 1SQ2N 1IFHH 5DHVH 2F8OA 2PYEA 4PJ9B 1CCZA 1QRND 5FCSH 3WFDH 1JPFB 2XZCH 5IMMB 4RGND 1XCTB 1GJIA 4IJ3C 2XTJB 3MA7B 5F3BB 2WUBH 4ZUWB 1FE8H 3NIFE 4I3RL 5E8NB 3ALXA 1I1YB 4LP4A 3HS0B 3MOAH 1MJ7L 3VXSB 1S3KL 3EOAB 1ZANL 4GMTL 2VDKL 4TUOB 2DYPD 2CDGB 3DX9B 1I1AB 4NM8H 4XHQA 3RVXD 2MSPA 5KSBB 1MFDL 4DZBB 2PKDA 32C2B 4LVOC 4QXGH 3FO9A 4U1GC 5SWZE 1XF4B 2VLME 4BYHA 5IIEB 1CGSH 4P4RA 2AJYH 3P4MA 3BKYH 4J6RH 3VXUB 2AJVL 1CDJA 2A77L 5T3ZD 5ISZE 3CFKA 4YHIA 3MBED 3QFJD 1ZLVH 2ZNXA 1UM5L 4GBXC 4WDIB 3P4LA 2OR9H 1CLZH 2E9WA 3PGCB 4WFGD 1EH9A 5GSVB 3TGXA 3H2WA 3TNNA 4EKXA 3QEQB 1UG9A 4P5TA 4LLVB 3WIIH 3K2UL 4TVPH 2VE6B 4P46A 2B0SL 3BZDA 1A1OA 4ZAKA 1OSZB 3M8OH 1ND0A 3V4VL 1XZ0A 4FQLL 2FEEI 5D4QA 5GZNC 5D7JD 1EPFA 2EH8L 3WIFA 3AS0A 1GGBL 4JJ5A 3HAEG 1H0DA 1NCDL 4L8SA 1M1SA 3B3IB 5AZ2H 3RWGA 2FR4B 5E1HB 3BW9B 4JM2D 1CXLA 4Z78A 4N90E 4PRPB 3LMJH 4X7TB 3MNVA 3B9EA 4BH8B 1BZ7B 1LNUB 4U6HA 4XVJL 5E2WL 1YECL 2EO1A 4Y8DC 1J87A 2YSSB 3HRZA 3GMOA 3H3PH 2X7LA 2ED7A 4HMCA 1BQLL 1MJUH 1ZTXL 2FO1A 3I02A 1YEFH 4P5TC 3VCLA 1T5WA 5CZXC 2E3VA 4P46C 5FK9A 5J6GB 4JPIA 5I17A 3L3IB 4OZ4A 3QIUD 5T1MA 5CP3H 4YXLH 4YWGL 2Z35A 2NY5C 5IB1B 5EA0L 3ARED 4FP8H 3ZKMC 4N0CC 4L8SC 1MVUB 2H9GB 1IGIH 4J3VA 3ULUE 3CFDB 1EZVY 3RIFK 1FCGA 3TH2T 4KKLC 1B0WA 2BY3A 4MJ6B 4X5XA 1JJUA 4JQVA 1DBAH 3LKSA 1GGIH 1DN0B 1EO8L 5D1XD 4X6BA 3L6FA 4U1NB 4WUUA 3PWVA 3LPFA 4JVUA 3OKKB 4MB3A 3VW3L 1INDL 4NQSB 4XCYA 2VH5H 3RX7A 1ETZA 4NQDE 3PWPE 1GZPB 5EC1B 1G1CA 5C86A 4PJEE 1LO4H 1F6AB 3WS3B 1RZ7L 2OR7A 3MRJB 5HY9B 1KIPA 2I25N 4M6OL 2ZCLH 1ZVSB 3FQWB 3NZ8B 4IMLA 1DBMH 4PD4J 2XFXA 3H3BC 4GAGL 3IJHB 5HDBF 5DMIH 1EIBA 3T4YA 2UUDH 3T77A 3EHBC 4RFOL 2QR0A 2AJXH 5IQ9A 2NY4D 3UTTE 2PUQT 1ES0B 4NQXB 4CMMB 2VISB 4JQVC 2E9BA 5KANG 3U4BL 5HPOA 3IRPX 1MLCB 1PD6A 2BVPB 3RU8L 2QQLL 5DFTA 1MJJA 5EPMA 1HHKB 5FKAA 5EFIB 1W72H 4BFBD 5CBEB 4K3DH 1U8QB 3OR6A 1I8KA 4HPYL 1FN4B 1EERB 2ZUWA 5JPMA 2DQCH 5B39G 4MXWL 3ZYJA 3MJ8B 4Q9QH 2XRAH 4AQOA 3MLYH 2NW2A 4IRZH 1FPTH 3MLSH 3I3EA 5D2LA 1HKLL 4UT9L 4XNMB 4HK3J 4S1SL 1AY1H 4JFOA 1D5IL 4PJIB 3IU4L 4NO2A 1J18A 3UTOA 4R96B 2XA8H 3MCKA 1ZLUH 4G8GB 1VESA 5I18H 4KZEL 3RUGE 4D0BB 1NLBL 4I48A 2DLEA 2FWOA 3GMMA 5L2KD 4GQ9L 1X44A 4U2ZA 2X05A 4HEPG 4FQXD 4RISH 5IBTL 4F57H 1SYSB 5GRVK 5BRZA 2YPKB 2DTMH 3ISWA 5ADOL 3LB6C 1N0XL 2YUWA 1FHGA 4KK5C 3BPCB 3QHZH 3JWNC 2FZ3B 4DWHA 1T66C 4WFFE 3CFBB 3HAEA 5TDOA 1X5KA 4TUJA 4H26B 3VD5A 2K1MA 3QDMA 1E0OB 2WINB 4MSWA 1NCBH 3CX5K 1MELA 3EYSH 5DXWA 1OD9A 1WK0A 5MENE 4MHHI 4IHOB 3QA3A 4ZG1A 2PETA 4GKNB 1T3FB 4ZO6A 3VXRB 4KK8C 4RMVA 2V6HA 3Q6GH 2A74A 4F9PA 4PBVC 5HHME 3WFHA 2XA3A 3BEWB 4PJFE 5GGVH 4LCWA 1JHKL 4R3SA 3H9SB 1SJXA 3KPPB 5EUOB 3BQUD 3ARFD 4ZTPH 1KJ2L 3A67L 4RIRA 4M43L 4PGJA 3HI5L 3CNKA 5T3ZL 3HNSL 2ZSWA 4OQTA 3V4UH 3C9NA 3DVGA 3HI1B 1P7HL 2JJVA 3NABL 3CVHL 4KV5F 4AT6A 5C08D 5GJTH 3CGTA 5D2NA 5F7DA 3UC0H 1AE6L 5JHDA 3VXQB 4NHCH 5I1JH 1WV7T 3WE6B 1MVFA 1D3CA 1QFWM 4FTVA 2EDEA 1SBSH 4LRNL 4G42A 5DD6A 5HI5C 3FRUB 1MHCB 4X6CE 4MA3A 2MWCA 2AABL 1EHXA 1Y18B 4YEFA 3A6CH 4F9PC 5CP7A 5DMGC 1YA5A 4MD5B 5CBAA 4Z9KB 3LDBB 1IL1A 5FKPB 5EU4B 1Q9KA 1JIBA 1KT2B 3IFOB 5D7IA 5ID1B 3D2UA 4JZNA 3RX5A 4X98A 3LRSB 1QLEH 4M5ZL 3O9WB 2UZIL 1IM3B 3BUTA 1J12A 1JF5A 4X4XB 4XC3L 3WDIA 1UXSB 1NGZA 3N1FC 3NFPB 5DRZB 3CLFL 3PDDA 3VXNA 5IKCA 3X13A 1N4XH 5D2NC 3FONA 3EJZC 2WMPA 4Y4HA 2KZ1B 4GRWB 1FGVH 4BZYA 1K5NB 5ACZB 4Y7MA 3EYQC 2FD6H 4HHAA 3T04D 3A6BL 3MQIA 1YQVH 3DBXA 4JM4L 4IRSB 1IGCL 2F53E 5DTFA 2DICA 1QSEA 1SM3H 4OCNC 4QXUL 4XGZA 2VL5B 5HYSA 5TE7H 2DQIL 2A9ML 4QHMB 1FFPB 1FZOA 4JFHE 3OKOB 5IBUG 2EDNA 5CUSL 3QQ4B 3RDTC 3SDYL 5IG7A 1JMZA 3CJJA 4XNYH 4ERSL 1OP3K 3MOBH 1BEYH 4U1JB 3WLBB 4EI5D 5B39A 1TJHH 3PHOA 3OKLA 1UEMA 5SWSD 3TBSA 1PYWB 4PLKD 5CSZA 3IYLW 4K8RD 1GAFL 4HCRH 4XP6H 3EFDH 2ZOLA 1S7XA 4NO3B 3T0AA 5DUPL 4OUUA 3GKZA 3MACH 4JM2F 4RBPK 3AXLA 4WU7A 4AIZB 5J12C 5DSCB 2ARJB 2ZPKL 4ZD3H 1ADQH 2C26A 3JV4B 4N8VG 1I7TA 4YPJA 4LSSL 4JQXA 8FABB 2DLHA 1MCRA 4M7KH 5ICYA 3AS2A 1MCSA 5J6HA 3X14B 2B1HH 4AH2B 5DQJB 3F5WB 3MV7D 1RZIA 4X4YA 3QZWA 1UQSA 3LS4H 4GW1B 5FYLD 1E4WH 3GSRB 5D7KD 4WNQA 4ZPVA 3QWQB 5ADPL 2LU4A 2NW3B 4XP5L 2NY0C 1AGDA 1A6TB 1JF6A 4LF3A 3QHFH 1RULL 3B4NA 3L9RB 1MCWW 3CZFB 3O6KH 3GSOA 4KI1A 2BHYA 4CVZA 5DYOA 3AB0B 4NJ9L 4OFPA 2MCPL 4X0KB 1VGEH 3QQNA 4QKXB 2C7UA 4P4KC 1A4JB 2D7QA 2XZQH 3H3KA 4K7FA 3RKDC 2BRQA 1HCVA 4HC1H 2D4DA 4U1LA 5HYJB 4S1DC 4JQXC 4I0KA 3HNVL 2XT1B 1U92B 3AGVA 3Q48A 4FHBD 5TF1H 3VI3F 4P57A 2L0DA 2DF3A 2OMBA 1LO0H 2LVCA 4LHQB 1WITA 2OI9C 4O2EA 1U8KA 3QO1A 4NN5C 5F8RC 1AQDB 2VXVH 1CD1A 3UO1L 4UV7L 1NAKL 2BCKB 2W65B 4UQ2A 1NFIB 1K6QL 4LLMA 4DEPB 2JCCF 3B9AA 2Z4QB 1QYGH 1S9XA 1NMBL 4GLRI 3IETB 4NKQB 2VAAB 4EXKA 1AO7A 2Z31A 5C09A 4QRPB 4RSVA 3HPJA 2DBLH 2XKNA 1X5HA 2EDFA 2JJTA 1GZQB 1E4XI 1AR1D 2AGJL 1CF8L 3VG0H 5HXMA 1F4YH 5BZWA 1W8OA 3GSUB 3IDGB 1TJGH 3NCFB 3GM0A 1EUUA 3FQTA 4LEOB 1UKQA 4NUGL 1HCFX 3O8XD 1J1PH 4NHUA 1BVZA 1JNNH 3MRCB 3CDGA 2HFTA 3UJIL 3SKOA 4POUB 3KXFA 5IT2L 5DUML 4RAUA 1WWBX 3S34L 1Q1JH 5T33H 4LLWA 4OCRL 3NN8B 4R4FL 3RNKA 3P9MA 4G8IA 1FC1A 2VXQL 3X3GL 5E5MB 1F3RB 2Z31C 3G5ZA 5D2LE 4XWGL 4I4WA 4JPKH 3W5NA 4XCCH 5EOTB 5H2BB 2JJTC 1NKOA 1JPGA 3U7WL 1QSVA 4I2XA 3FOLA 3RPIB 1NC4A 5FHBL 1YNKH 3M45A 5JXEC 3I3BA 1IARB 2UY6A 4JGMA 5F21B 4BQ8A 1JPST 1P6AB 3NACL 5C0EB 1J5OH 4R4NC 4FFYH 1J0KA 4TOYL 3FL7A 4GXVL 4L9LB 2CUIA 3C8HA 4HH9B 4OD2A 3QAZB 5CD5D 3B9VA 4TNVK 3SDCD 5HVWA 1N5AB 3V5HA 4JFQB 3ZKND 1L7TL 1A5FH 3R1GL 3RWEB 2X70A 4JO4L 4ZUVA 5JHLH 5LGHL 4KUZH 1EGJL 5E6IC 3KPNB 4N8VA 3O4LB 1CYGA 1I9JL 1FVDA 4OM0L 4YGAB 1UA6H 3SDAC 3R8BB 1LK2A 4JFPB 5HPMA 4KTDH 3REVB 2CKBB 2Q8AH 1IGTA 1F11B 2JIXD 5JA8B 3STLB 2VLKD 3VE0A 2ADFL 5JLZB 5J1SC 3ARQA 5E5UB 1XGUB 3KPSD 3RP1A 4GAYA 5IMLB 1A9BA 3FO1B 2HYMA 4CU8A 4TNWF 3MRLB 4A2LA 4F2MB 5I76B 3MLXH 1Z5LA 1HDMA 2UV3A 1J0HA 5DRWB 1XGPA 4OZGA 1Z9MA 4TTGA 2H45A 4NM4L 5F7UA 3MO1A 3ARTA 2I9LB 1VEOA 5D2NE 1AGBB 1TVHA 2HT3C 1KJVB 2BMKB 4ZUTB 3MZGB 1UWEH 5JHDE 1HWGB 4J2XA 3V6FB 3IAQA 4MJIA 5HHOD 3KR3L 4G7YL 2DWDA 2FX7H 4Y8AA 4NN7B 4OLYL 2Y7QB 5JW3H 3S4SA 2XG5A 5JUEL 4O2FB 1KPVA 3P9LA 1FNAA 1I3GL 1IQWH 1V8HA 4XH2B 3MRNB 4X4ZA 2G2RA 1VEPA 5FAAA 4NWTH 2EH7L 2IPKB 1U8NB 3CU1A 2D0HA 3OSKA 2VWEC 2R2EA 4FFVC 1SY6L 1I4FB 3FOMB 4JFEA 1WAAF 3FO0H 2ZUYA 4PV9B 4BFEA 4J12A 3U2SB 1S9YB 2HN7B 4G80B 2AI0L 1QKZL 1HXMB 4JKPH 5JIIA 1OOAA 4NIKB 4LSTL 2VO5A 2PYED 4KVNH 3C8KB 3LRGA 5L0QC 5J13B 3MUZ1 2QQQA 4WWKB 3U0WH 3NIFF 2QADC 5ABDE 5T1KA 3RVTC 5FYLL 1LDSA 1BPVA 1YPZF 1XH3B 2RBLA 4WW2B 1B2WL 4JKKA 3UTSA 3O4OB 3P0VH 3U6RA 2QBWA 4AG4H 5E4IA 3TJHC 4JG1L 1I8IA 1VFMA 3NA9H 5JR1H 5JDJA 5FGBC 2IGFH 4UIMA 4HUWA 2BJMH 4OD3L 2AXHA 1DDHB 5K9JL 4JFFA 3UYRL 2AV7A 1RK1B 3OX8A 3DYPA 4LIQH 4YPGA 1PFCA 4NBYB 5AAMA 3UJJL 2M8XA 1CQYA 5IFJB 1JV5B 3F8UB 1G6RA 1QVOB 2HFFB 3EYOA 5DR5H 4C56E 1IT9L 5DC9B 1AGCA 5E2JA 3RZCB 4CKVX 4PJXE 1OGAB 4NP4L 2YRPA 4AQ1B 2VZSA 5C9JA 2F54B 4K3JL 4RNRB 5CJOH 3IKCA 3TCLB 3VGBA 2EKSA 3ULUL 4APQD 1F5WA 2HG5A 1GGYA 1ZHBA 1M7DB 1U91A 5C0FB 5GS2D 3RWDA 4NPYB 4ODXB 2AXJA 2MQ0A 3QEGH 5IEHA 2NTFB 3RWFB 4XB8A 3U0PB 3VXTB 3WFCH 2C3HA 3CX2A 3PWNB 1CR9H 3U82B 3DXAE 5BVPL 3STZA 1E4KA 1QRNE 4OBSA 5HJ3B 1FYTA 3BZFB 1D5MA 4LSVL 3PV6A 4DTGL 1RZGB 3JV6B 5K33A 2AV1B 2PXYB 5KANI 2RAMA 4W6XB 1KULA 1E6JH 3C08L 3B43A 5HGDB 4D0CA 1NAML 4ZUUB 5TDNA 1JWUB 4E5XA 2X4PB 3BESR 4H8WC 1HZHH 3DV4B 4PJHA 3OXRA 4JB9L 3K4AA 3UTZB 1U8JA 2DLTA 4DCQB 1VDGA 5IM7B 3VFUB 4YHML 1EEZB 2IFFL 2YD8A 3JWDC 5DVOA 4FQCH 4HUVA 2A6DB 5KSAB 1MFEH 1EXUA 5GS0D 1B9ZA 3BFOA 3INUH 2DL9A 2ZP0T 3OXSA 4KKBC 2EDHA 1E4KC 1S7VA 3HR5A 1LDPH 3DLQR 3ZKXC 1XGRB 3ULUF 1FNSH 5ANMB 1KCSH 2YBRB 3QFJE 1IAMA 3KJ6H 5FM8A 3SE4A 4J3UA 2ZOKB 4ALAH 1SHMA 1J1OL 3AU1B 4OCWL 2FRGP 3C60B 4FOMA 4ZO7A 5FYKD 1FCCA 5EOCL 3MRPB 5GS3A 1BVLA 1CFVH 2ZUSA 4LFHD 4XVSL 4M03A 3M1BB 1NQBA 5TE4H 5DK0B 4WUUD 4KTEH 2PCPB 3BGMA 4PJEF 1RJLB 1WWAX 1QUNA 2BRRL 2WIIA 3W5MA 2FJFA 2YUZA 3CSYB 3C6LA 3OGCB 4X80H 3HE6B 4RWYL 4OZHB 5EIIA 1CXFA 2LABA 4DZ8B 4Y2OA 3U0TB 4QHLB 5C0JB 1S9KC 2DD8H 5ESVB 1OP9A 2CKBH 5A2FA 3VMNA 5T5FH 4I3SL 1MCCA 4ZXBC 1F3DH 1G7HA 2HKFH 5TQ0L 3BUYA 4U1IB 4UU9A 5FO9A 1K2DA 3RHWK 4OUOA 3MROA 5FO7B 5D71H 1JGLH 3KXFE 1XGYH 2B8OT 5BZDB 1DLHA 1TITA 5FYJE 3SQOH 1YEGH 1HSBA 4DKAA 1T1WB 4ELKA 3FO2A 2X41A 2GAZA 4YHLL 2YZ8A 5E99H 3SJVB 2GUOA 4JN1H 4PGZA 3B8YA 1CZ8L 1IKNC 4OAWB 3C6LC 4NKIH 4EUPB 3UPCA 4D3CH 2GJ6B 5FOJA 3ARSA 2GY5A 5GGTL 3C5JA 5LGKA 2DL2A 4Y19E 3ARXA 1IGJB 5CS7A 4QHUA 1XF3A 5ERWB 2FL5A 2NNAB 3HRPA 1JTPA 2JE8A 3S36X 5I8CB 3RUGF 3G6DH 4WI3A 4GRLA 3SY0A 2AK1L 1OSPL 2F58L 4JFDE 4X6EA 5GIRB 5BOPA 1CDIA 5C9KA 4FQIH 3I6LE 2NZIA 6FABL 3S96B 3H9ZA 3AAZA 2F15A 3RWIA 4G43A 1YEIL 5HGHA 1ZHLB 4TVSa 1DUYA 1JI2A 4JG0H 2V7NB 5DMKA 1S7TA 2AJUL 4I5BB 3CZJA 1KIQB 3BO8B 1G1YA 3PL6D 3LQAH 4H20H 5D72H 4MWFB 4QRUA 1P4IH 1CLCA 1DN2A 1HHIA 3CK0H 3CPLB 2AK4A 2LTQC 3O0RL 4MA7L 4UTAL 4P2RA 3FQRB 3QDMD 3OB0K 1T20A 2OXGA 4M8VA 2YN3A 3QXAA 4HKJA 5DDHA 4KZDH 4JRXA 5IUSA 5KVEL 2BFVL 1HEZA 5MEPB 4M4PA 4PJ5B 3BIKB 3F12A 4TYUA 1ORQA 3O2WL 1BZ9B 5A43C 3MPCA 4OF3A 3L7FA 4LCWD 2CRIA 1KCKA 2D7TH 4JO1H 3FCTA 4MXVF 4Z5RB 1JRHH 5GHWH 5T1DL 3IJYB 1RUML 1MOEA 3KAAA 4ZUSB 1TCMA 4U05A 1AXTL 1LP9F 1MH5B 4KRPC 2BY0A 3QSKB 4DKEH 1QSFB 4R7NA 5DJCB 3UPRB 5IESL 1UT9A 1UACH 3NPZB 4NZJA 4WHTB 4L4VA 5C71A 3SDXA 4G9DA 3MJ6A 5KW9L 1KYOK 4X7DC 2O93L 1I1FB 3UAJD 5A2IH 3QP3A 4LCIL 1MJ8H 1J05A 4V2CB 2DMCA 3AS3A 2Q3ZA 4JFEE 3N9GH 3M07A 4KAQL 2OJZH 3O8XC 3RTQC 5FV2A 3RWJA 1H3UA 2PTTB 1NL0L 1CK0H 3MGAA 3ZDZF 3PDOA 3KPMA 1CBVH 3MLVL 4L3AA 4WO4A 4PG2A 5EUKA 2GTWB 2YKLH 3D2UD 43CAA 1WIUA 1F00I 4QTHB 3MRRB 4YBQD 2Q6WA 3TT1L 1IC1A 1WZ1L 4JDVA 3F7VB 3L5IA 3U46A 3FQXB 3WUWG 2XXCB 4UT6H 3HMWH 3BVNA 4LQFH 4Y4HD 3RVVC 3LKOA 4TRPH 1BQHG 2DI9A 3EFFB 1PZUB 1QSED 1NGXA 3GJFA 3PDGA 2ZWLT 4G7VH 4PG2C 4CVUA 3VG9B 4LHUG 1YMMB 3GMLA 4LK4A 4QRRB 2EYTB 2NY1C 4DGIH 4ZPTB 2WBWB 3QG7H 4NZUH 1I9EA 1ROWA 1ZA3B 5GRUH 2O5XH 3IDYC 1M71B 1D6VL 2V2XB 1IQDB 3PF2A 4M48H 4XBGA 5FYKL 3BPLC 4OZFB 1B88A 3BD5A 3GHBH 3P73A 2AEQL 3QEHB 2ATPB 1IEHA 2FX9H 1RZ8B 1OAKH 5L8JB 4KRLB 1G9EA 2RFXB 3NCMA 2ARJQ 1CGUA 1CQKA 3JWOL 4I9WE 5FA3A 4AMKL 1I9IH 3BN3B 1MHHB 1JNLH 4D2NA 4ODWA 4P3CH 4LRIA 4IRJB 4Z0BL 2Q76B 1KN4H 3QULA 4F37K 1RVFH 4DUVA 1OAUL 4QHKJ 2EXYD 1KIRA 2Y5TA 1R5IB 1OWRM 3MNWA 4P5MB 3S7GA 5H8DA 4PJDA 1DBBH 1GPOL 5IR1B 2Z93B 1YEJL 5CIPA 3GUTA 4Z7UA 2R2HB 4PRBA 4N9GB 4HJGA 1NBZA 1S9WB 3BT2L 4TSBL 4X8JA 4OTXH 5EN2B 3RWCB 5CKGA 3WD5H 1JWSA 4M5YL 3VGAB 4FABL 1LO5B 1HH9B 4PUBL 4F8QA 4EUPH 2Q7YA 5ALBL 5F6IB 4K94H 4S1RL 1L0QA 1ZLVK 3O41A 2MNUA 1P53A 4J23A 3O11A 2DQJH 3QDGE 1J9CT 4LRIC 2P8LB 1NLDL 3EYUH 2X4RA 1ZT4A 5TDPA 5I1DA 3ZO0A 2VDOL 5SWSE 1MRDL 1FZKA 3K7UA 4L3EB 1FG2B 3KDMA 3QT2A 1LVEA 1LWRA 4R4BA 1CTNA 1MAMH 2HRPH 3QG6A 2EDKA 5IB4A 1AI1L 4IOIB 2Y4SA 3H9HB 4M6AA 1U2CA 1BD2B 1UCTA 1CLYH 4MJ5A 4X5WB 3RNQA 4PJ7A 1FV1A 3BGFC 3S35X 4G9FB 4D9RE 1BBJB 4CDHA 3RZWA 4QNPE 1H15A 2WLZA 1KN2H 1RUQH 4ZFZB 1I8LA 3E6HA 3KPOB 1G7QB 2FATL 4NO0A 4JDTL 4NKDA 5D7LD 5GGRA 1MFAL 1AO7D 4HUMB 4KHXL 5C09D 1T2QL 1PZ5A 5LXGH 3LKNA 5MEQB 1F90L 5IB5A 2FIKA 2DQHL 3DETC 1YC8A 4Z0XB 4Y89A 5C0BA 3DMMA 2CO6B 1A8JH 1MWAB 5I8EA 4Q2ZB 5EO9A 4X99B 1DQMH 4M9OA 2V7HA 1C16A 4XNUL 4D9LH 2NZ9C 4WUKH 2J5LC 2ZG2A 2EYRB 2V17L 4KI5C 2E27L 4WFHD 4WHYH 3KPLB 1MNUH 3OAUL 4LLDB 3WUWA 2MCG1 2XN9A 3FT2B 1N7ML 2OTWA 4XCNB 5I1AA 4Q6YA 2R0WH 3H0TB 4KKAD 1GC1C 4C54A 4YDIL 4YHNA 5D2LF 3N50A 4Y5YA 1CDUA 1I8LC 4TSAH 4AL8L 1BQHA 5TE6H 3FB8B 4M1DH 5T3XH 4I0CC 1P1ZB 2NX5D 2FH6A 2YPVL 4LSUH 3B9KD 4TN9A 4XNXL 5EBWA 2OZ4A 5BXFB 4FRWA 4OI9A 2ADGA 4OQTL 4DFIA 3QUYB 3RY5A 1DZBA 3V2AR 5HGBB 4LHUA 4LP5A 1DUZA 1HYSC 3CFCL 4XBPB 1NC4D 3L95B 5ITBL 2P24A 4JDZB 3NVQA 2I9TA 4V1DB 1YY8A 5INDB 5DJDB 2ESVB 4YGVB 2CDEA 1E28A 1WFOA 3O81A 3DO3A 3ARGD 4M00A 1KNOA 5T5NF 5EULV 3SN6N 3SBWC 5DJXB 2DI7A 4NRZA 5DRXA 5IW1A 4PRAB 2NR6D 5C0CB 1CFTA 2ORBH 1JK8B 2UYLA 5CZVH 1TMCB 4GG6A 1RFDL 1XIWA 3VFMB 4NGHL 1KCUH 5IJKC 2XYCA 5ILTH 4U6VL 2G9HA 1EFXA 1H8SA 5D96C 2YD3A 1AJ7H 3KYKH 4NJAL 1SEBB 3ES6A 3BN9C 5IGXL 1XF2B 3T65B 4PJ9D 1IKFL 3RL1B 1D9KC 5EBMA 3QIWA 1FZJA 4JRXE 2DTSA 3D39A 3W9DB 1QFUH 3VMPA 2XTJD 5F6HJ 1FDLL 5BCAA 1MCOH 1K85A 1I3VA 3SCMB 1IAOA 2LAGB 2DM4A 1YDPB 5ACMA 5IMOB 2CJUH 5DJAA 2OP4L 3QPXL 1YEEH 3DARA 4IEFB 1SJHB 3P4OA 1BX2B 1XGQB 5IW3A 2CQVA 1ZLSH 4IIQB 3LCYA 4KQ4L 1WTGT 4O5LL 3SDXE 5DQ9A 3TV3L 1EZVX 4R9HA 1P6FA 3EO9H 4Y4KA 4C59B 1TVBB 1ZLUK 1NH6A 3L3JB 4OZFH 2IG2H 3RI5K 4UTBH 5C0GB 1FNEA 5TJWK 4GKOA 3HMXA 2CDFB 3QIWC 4U1KB 4ODBD 3DGGB 2Z9TA 3JTSA 1R3JA 5D7IF 4NQEE 2DLFL 5JQHC 4D9QE 4F58H 3BRGC 5L9DL 4P2QB 1JPTL 1U3HA 3WO4C 3TO4B 4LEXH 3BIBX 1T03L 4XXCC 3U9UB 1BFOA 2EC9U 3LHPH 1FVCA 3I2CH 2EDTA 4N68A 4TQEH 3QEQD 2AVGA 1P84J 4MA8H 4YX2H 1BWMA 4KK9C 3O6MH 4K3EH 4ONHB 15C8H 4Z18A 1UVQB 5KVFL 5CEXA 1EHLL 1FZMA 1RIHL 2E5EA 3EO0B 5EZOH 3R8QA 4WCYH 1A7RL 1UC6A 1UZ6E 1NMAH 1QR1A 3WKMH 4OLZL 2VLJB 1ZHKB 3ZYOA 2X2YA 3CXDL 5ALCL 4LOUC 4PRPD 4XMPL 2VERN 3FN0L 2FB4L 1NCAL 5BVJA 1VFBA 5IFHL 1U3HC 4RCAA 1MUJB 4JFFD 4GW4B 2DQEL 4L5FH 1YYLL 4WHYG 3OR7B 3WHE0 1KTDA 4M6NH 3TCXA 1MI5E 4QWWC 4TPRL 1FJ1A 1HQ4B 2A6KB 4HUUB 1JL8A 1OAXL 4IDLA 5I66B 4UINL 3MBXL 2HVJB 4UIKH 5FHAL 5HHOE 3G6JE 3BH9A 5I1KL 1OB1B 3X17A 5D5ME 1TPXC 3T0DA 1I75A 1EUTA 4NZDA 3H8NA 3ME0A 1DCLA 5CJXA 5DJZB 2VAJA 4GMSH 2XZAH 5J11B 1IE5A 3BP6B 4MDIA 1KGCE 2OTPA 4FQJL 1FORL 1S7SB 3FZUC 4NRYB 2OLDA 4HK0B 1L6XA 4U6YB 1JPSL 4KY1H 5INCA 2YPLB 3CMOL 4BUHA 3LZFH 3GO1H 5IK3B 1JWMB 3OKEB 5D6CA 5C07A 1DQLL 2KZWA 2YUXA 5J1AA 5K93A 5I8OL 4Z7UE 3RVUC 4WU5A 1T1YA 3MC0A 3GMQB 1MPAL 1MWAH 2NY3C 2A9NH 3VFVB 2X4TB 4GKZA 2X9YA 3F62A 5AYUL 3BZEA 3RFZC 2WBJA 4JREB 3S5LA 3MGTA 2B5IC 4NT6B 5JXAL 4L8DB 4OCSH 1A3RL 1BAFH 1T5XB 4EOWH 4FQQA 1FO0A 5DFVD 4Y4FB 1DE4A 2VIRB 2O5YL 1EV2E 1T1ZB 4XC1H 12E8L 1YY9C 1BIIA 5FYJL 3LIZH 1K3ZA 1Q72L 1Q9OA 2VSDA 4X6DE 1JN6B 5DT1L 1NSNH 4KVCH 3MRHB 3TBWB 1X5IA 3HPLB 4Z7QE 2FCBA 1Q0YL 3K3QA 2NY7L 4J1UA 4N0UB 3F58H 2OMNA 4KI5E 5KVDL 3HB3D 4AEIL 4E41A 3QUXA 1D6EA 3RGVB 3UYOD 1DVFC 2OJEB 2WBJC 4PJ7E 5KTEH 1O0VA 1FNGB 4OZFG 3TO2A 2WAHA 2HMID 2PO6B 4YDLC 2IANB 4HZAA 5HGGS 3VWJB 5I1GL 2XY2A 3QQ9D 4F15B 1AXSA 3ZE2E 3VFSB 1OTSD 4JO3H 4UT7L 3BPNC 4JFYA 5D1QC 5DHYB 1F4XL 5C0BE 1XEDA 4RGNB 5DJ8A 5AAWA 2VKXA 5DMJB 1TENA 3DRQA 1FFOB 3GIVA 2HFGL 4KRNA 3SHSA 3R0MA 1GL4B 3QUXC 3V6ZA 1MJ7H 1S3KH 1B0RB 1KPUB 1ZANH 4GMTH 5I16B 3SOBH 2R2CA 1OAZL 2VDKH 3KS0J 1J0IA 3S97C 4P2OA 4LLQA 1DEDA 1UB5A 3HZVA 4LSRL 3WDHA 1I8MB 3CSPA 1FAKT 2FECL 5JDSB 2DYPB 1S78C 4RMQA 4QRSA 3PGDA 3BP4B 1WVZA 1KXVC 1N6UA 1BLNA 4I0PA 3M17A 1B0GA 2H6PB 4OLXL 2W1NA 1SEQL 2AJVH 2AXGA 4NOBA 3NBNA 1KJ2B 2BNRE 3QYCA 4F9LA 1G7IB 3QO0A 3L3GA 3CH8A 2CIKA 1IEBA 3H9SD 4MX7B 4LAQL 4RZCA 4BH7B 3CVHB 1ZMYA 2D2OA 3ILQD 1BJ1H 1T22A 5C6WH 5TPWL 5FB8A 3LQZB 5EOCJ 2D9QB 2HT4D 4EZMA 1IEAB 5GGSA 5EOQH 1LEGB 4GRLD 2WBKA 3FTGA 3OJDB 4KDWA 4WV1B 3K2UH 1H3TA 4P2OC 4PJAE 3MA9L 3V4VH 4GG6E 4FQLH 3ZTJG 3LN4A 2FH8A 3OHXA 4OF6A 4NO5A 2EH8H 5C0AE 1GGBH 3GHEL 1EJOL 1NCDH 3WEXA 1EVTC 4I0PC 5D7JB 3CFEA 1G7MA 1MFNA 4JM2B 4YK4B 4QOKB 3IXTA 5LG1A 4L4TE 1YN7B 2DIBA 4HKBB 2EC9T 4HMDA 3DYOA 1YECH 4XVJH 5E2WH 5F9OL 5IMKB 4OZGF 5ICZA 5SWQA 5M95B 4P2RD 4LLYB 3ARUA 3L3HB 3IDJB 1BQLH 1ZTXH 3O9WD 4OLEA 5TGBA 3IDNA 3V0VA 1W0YT 1UB6A 4A6YA 3DURA 4O9HL 1QFWL 4YJZL 4J3SA 3IVKB 1K3IA 2BSRB 3CXHK 1YN6B 1P2CA 5LBSL 1NBVL 4YWGH 5IHUL 5EU7C 5EA0H 1A4KA 4EVNA 3QIUB 4X7EC 1WEJL 2ZUVA 4PB0L 3FRPA 3HC4L 4IRSD 3SKMB 3OMZA 5HHPA 4Y5XC 3AREB 1G6RL 2VLRE 5EIVA 4GRMB 1IC5L 1A6UL 4MNQE 1ZGLP 4MCYB 4HIHB 1F2QA 4H8WL 4Y5VB 3O6FA 1UJ3C 4PJBA 5DJ2B 3T0EA 1EO8H 1NBQA 4P99A 3S37L 4XI5D 2MKWA 2ICWA 3VW3H 1INDH 2C4FU 3FN9A 4NRXB 2BNQA 3UTPE 1YMHA 1TIUA 4FXGB 3ROLA 1CFQA 4FQ2H 3U9PL 1E27B 4M6OH 4PGBB 4XPBL 1GIGL 4XPFL 1T0MB 2EZ0C 4WI2A 4GAGH 1S9VA 3MV8B 1S7WA 4OFVA 2IWGA 4RFOH 3AUVA 5EZLA 1Z9OA 2H41A 4YIQA 4JGJA 2C1PB 5TF0A 1R3HB 4OLVL 4RA3A 3U4BH 4C4KO 3T0EC 4QXTA 3RU8H 2QQLH 4PRHE 1PSKH 4FQHB 3NCEB 5F7NC 5EU6A 4ZUWA 2F74B 4Y16A 1XR9B 3PHSA 1U8LA 4LNRA 3VJ6A 4DGYL 3GSXA 4H25A 5LAXB 1F3JA 4UILL 4HIIB 1JRHI 3GMPB 2A83A 4HPYH 3HS0A 4MXWH 3O6LL 2D7NA 2NTSP 4K07A 1CIUA 3BIAX 4CVXB 2J7LA 4RDQF 4HWNA 1H5BC 5KS9E 1A9EB 1OPGH 3ILPB 2HTKD 1QEWB 3QHTC 1HKLH 4UT9H 4NNXB 5HYJD 1PKQB 1CICC 1D5IH 3IU4H 3TPUA 3KPQA 5J57B 3QUMA 1YUHB 3B2UD 1QG3A 2EIDA 4KZEH 1NLBH 2E9IA 2P5WE 3ARBD 3VFRA 3UX9B 4GQ9H 4GH7B 4HBCL 4E42B 5IBTH 5L2KB 3PGCA 1LD9A 2KBGA 1KEML 3LKRB 3W39B 1RJZA 4FQXB 3TBVA 5ADOH 2VQUA 4PJHF 1IILE 1N0XH 3GJFK 3GB7A 4P5KA 3SGEH 1K8IB 1MCKA 1I1AC 1HINL 4HIXL 4QRPD 3SQBA 1X7QB 3O2DA 5E94B 4EDXA 5FA4A 3RIAK 4U31A 1RJYB 3BW9A 3QXWA 2HTLD 2V5YA 3Q3GB 4X7TA 4M61A 3MUGB 1JHKH 3MV9B 1KJ2H 1S7QB 3VWKD 4M43H 1LEKB 3HI5H 3OF6A 4OB5L 4WEUD 4P23A 5T3ZH 1DFBL 1QACA 1WZLA 3NPSB 1UXWA 3NABH 3CVHH 4OGAD 5E1AB 5L88H 1AE6H 1CFSB 3CH1B 3G08B 5MP6L 5C08B 2AXFB 1M05B 1F45A 3CAFA 4JFXB 5IB1A 1FL5B 3L3OB 3QJFB 4LRNH 5EBGA 1JGVL 3IFPA 1SJVA 2Z91A 4YBLC 4HFWB 4QRTA 2AABH 4WTZG 4UI2A 4KC3B 3MXVL 3QPQD 1HOCA 3NFNA 4PS4L 1FFNB 3E8UL 1AD9B 4G6AD 3GGWB 2OSLB 5LGJB 2CUHA 3HFML 4M5ZH 1DEEB 3IAGC 1P9MC 2DIJA 5J0BA 2UZIH 5DQDL 4P23C 4ZYKB 4XC3H 1VACA 1X5JA 4GFTB 4TVPE 4MNGB 4DVRL 3CLFH 1O5DT 1WC7B 1BFVL 4H1LG 5B4MC 2EYSA 2WWMD 3DMMD 2B2XL 5CD3A 3O4LD 1RMFL 3PJSA 1AQKL 4PJGE 3ARRA 1B4JL 2V2TA 2X4SA 4JR9L 1IGCH 1PY4A 2PF6A 5ESQB 3U48A 3WO3B 5ECJE 4YNYB 4X83A 4QXUH 5E8EA 1ZHNB 1YPZB 4M93B 1N8ZB 2DQIH 1MHEB 2CK2A 4BUGA 2PTVA 2R1XA 2NXZC 2VISA 5DVMA 5CUSH 5BQ7B 3SDYH 4ELME 4HGWA 3OL2A 4ERSH 2AQ2A 1ZKAA 2VABB 4AJ0A 2K7QA 1LEIA 3PP4L 1CGTA 1T2JA 3QUZA 4HKXA 5SWZB 5DEGB 4LHUD 1OM3L 2R23A 5D93B 1GAFH 2BHZA 3IKKA 2B1AL 4XVTL 3WCYA 1G7PA 3HLAA 4NWUL 4UBDD 3HA0A 5DUPH 3EUUA 5EU7E 5F1IB 2ZPKH 4XPGL 1ZGLM 3BJ91 5HVFB 1JP5A 3IF1B 5DZOA 2P42B 1VFAB 4LSSH 1KEGH 3MTRA 4OM1L 2VDLL 4HGKC 3MNZB 4F3FA 3E3QE 3SGKA 1XIWD 5LCVL 4NFDA 3HCVB 1HHGB 4UNTA 3P0YH 1ZAGA 4V2BA 1EFXD 3MV7B 4GSDL 4OQ1A 3DTXB 1MAKA 1FL3A 4PJCA 3QUZC 4GJTB 2CRZA 2VXTL 3DROB 4XP5H 4DOHE 3G5YA 1II4E 4WWKD 3C5ZB 1NEZB 1RULH 3D39D 4LMQE 4NJ9H 5HI4D 4J8RA 4PIRF 2MCPH 1URLA 3NIDE 2BVQB 3CFBA 3DO7A 3OKNB 4KJWD 1WIOA 5I15L 1FVEB 2DMBA 1ZT7B 4I13B 2WINA 4R26H 2IAMD 3SDXF 3T3ME 1X6NA 1XCQB 3HNVH 4PRIA 3MRKA 1AIFA 4RQQB 2D7PA 3SGKC 2PW1B 4K7PY 3T0EE 3LD8B 7FABL 4LPCA 4GUPB 3IAPA 1K4DA 4Y4KD 4ISVB 2IJ0C 4JZOA 4UUJA 1RHHB 4L29B 3VGGA 3UO1H 1NANH 4UV7H 1CG9A 1NAKH 4TSCL 1K6QH 2P5EE 1KTLA 3ZDYE 4LCUA 2FBOJ 1BZQK 1A2YA 1NMBH 3MRFA 1U6AL 3W0WA 4NC1E 4Q0XL 3QISA 4MNHA 2ZCHL 4WTZA 3TA3A 3MLTB 3TFKC 1ITCA 4I3GA 3HZKA 1P5UA 2IQ9L 4QHNA 4OCMC 1REIA 2AGJH 1CF8H 3O45A 3QUKB 2O61A 2Z8VC 4PJEB 5CSBA 2DBJA 3FFDB 2G5BA 4JY6A 4K23L 4JFZL 4FFWC 1LO3L 1RU9L 1XGTA 1NAMB 4K71B 4PB9H 2DM7A 2XTJE 3QNXA 4NUGH 5FKPA 3U83A 3W9EA 3PQYA 5K59E 2PXYD 4BQCA 5AD0A 3BZ4A 5KG9B 4RRPG 5I2IA 4IS6B 4H1LA 4YO0A 1B6DA 2EC8A 1CDYA 4KWUA 3DUUB 4OCYH 1E4JA 3AY4A 3UJIH 1DBKL 5BS0A 1VB9A 2YRLA 1UXSA 5IT2H 3NFPA 5DUMH 3S34H 3VXSE 4F7EA 5I75B 3ALWA 3GNML 4OCRH 4R4FH 3RIAF 2VXQH 3TA3C 3X3GH 3G6JF 1KENL 4XWGH 2C3XA 4UOW0 3SDDA 5KSBE 5KSAD 1IC7L 1ACYL 3U7WH 1SVCP 3IDIB 4YEEA 3F7PC 5E9DB 2YXMA 5FHBH 3RKPA 3VXUE 2NYYC 5IBLD 1FFPA 4CGTA 4MVBC 2MOVA 3NACH 2YEZA 4NQVA 3TT3L 3LN5B 4TOYH 4GXVH 4XPHL 4Y1AA 3AY4C 4U1JA 2A73B 3E6FB 3S8WA 3C60D 3VFGH 3P2TA 1EK3A 4M8QB 2FLBT 3FFCA 1RPQA 1L7TH 1I85C 3R1GH 3QEQE 4PJDF 1TQBB 3CC5A 4NUJA 5IJVB 4JO4H 1HQRA 3MYJB 3SDCB 3KLHC 5LGHH 1OP3H 2F5AL 1EGJH 4JRYA 4Z7UF 1OD7A 1I9JH 5JO5A 1U41A 2BSTB 2WUCL 4OM0H 4YZFE 5C07D 1JYVA 3C6SB 3SDDC 2FX8L 4MQ7A 2DKMA 1V5JA 2ARWA 3WJJA 2BXYA 4N0FB 3T8XA 1JBJA 5M94B 4E0RB 5FCUL 1G7LA 3D3VA 2H2PD 3HE6D 5DD5H 2ADFH 3GI9L 4GAJL 1R24B 5GSRA 3OPZL 4DW2L 4Q6IB 3VFNA 1KELL 2JIXB 1CDCA 2VLKB 4NQCD 4PRPE 1J8HA 2AQ1A 1RQ5A 3TBTA 1JTTA 2A6IB 3VRLF 5ENWB 5F97E 5D1ZB 3GSRA 2JB5L 5EIQA 1ORSB 2AW2A 4NM4H 4JN2A 1IAIM 4PV8B 3RRQA 4B5EA 2R4SL 3HKFA 2MTPA 2V2WB 1GOFA 4Z7QF 2FYYB 4YFDB 1HHHA 3W2DL 4PTUB 2BOBB 4KI5F 1PQZA 2OZ4L 1S7RA 4G3YL 3BH8A 5HHMB 3NH7L 3KR3H 4G7YH 4C55A 2M2DA 4PYGA 4DVBB 4PJ7F 4OLYH 2ADIB 3KJ4C 3DNKA 1I7UA 4P59L 4E41D 4L3CB 1I3GH 3UBXA 5DZLA 3TZVA 4C83B 3K81A 3RY6A 2EH7H 2C1OA 1LP9B 2G75A 4PREB 3U4AA 2DIAA 1RZFL 2GSIB 5A2KH 3MGOB 1SY6H 5DJ6B 3L7EA 3ZE2F 3HHRB 4NYLA 2AI0H 1QKZH 2J8UB 1KTKE 3B2VL 4DAGL 3B5TA 4LSTH 5GGUA 4OV5B 5F7HA 4LVOB 3C09B 4UZGA 4U1GB 5C0RL 4HKZA 1UM4L 2J3SA 5B38A 2PYEB 5CJQL 2V9TA 4FQ1L 4XMLH 5FYLH 3AB0C 1B2WH 1NGWA 4HSQA 2HRLA 4G6ML 2YA0A 3I75A 2CKNA 4JG1H 4PR5A 4YFLF 1MY7A 4CJ0A 3D9AL 3MRIA 1UADC 1NBYB 3IT8D 1KG0A 1N3NA 1W2KT 3MFFA 3K4ZA 2IPTL 1T7ZA 5K9JH 3WNMA 3UYRH 3GIZL 2CO7B 4Z95L 2PTUA 4N1CA 2OS7A 3GKWH 3UJJH 1MAJA 1N6VA 4MD4A 4MQSB 3HUJA 3MX0A 3BRFA 1IT9H 3FO9B 2R0ZL 3D69A 4KUCF 1ZSDA 4NP4H 2DLGA 4P4RB 3P4MB 3UDWA 1IZKA 4K3JH 3PGFL 3MLZL 3FT4A 4H0GA 3H6JA 3CFKB 1KJ3L 3HMXL 1AC6A 1Q8MA 4OLWL 3F7YB 1H8OA 4GG6F 4EN3A 3HZYA 3TNNB 4Z7WB 4I18A 4PJIE 4P5TB 1M4KA 5BVPH 4FXKA 3VRIA 2C3VA 4G8GE 4P46B 4LSVH 1A1OB 5FM5M 4DTGH 4ZAKB 3X11A 1ND0B 1XZ0B 2ZKHL 4RFEB 3C08H 4GAFB 3NFSL 3WIFB 1NAMH 4JJ5B 3RWGB 1H0DB 1YNTA 1CGWA 1MCIA 4GXUN 4L8CA 3UDWC 3P77A 4H88L 4RAVA 4PLNC 4Z78B 3AROA 3I85A 1UM6L 5F93C 2ZG1A 5FDYA 3KPRA 4YHMH 3KS0H 5AUMA 4OZIB 4XP1L 2IFFH 4U6HB 3WSQL 1AHWA 2QQKL 3OTTA 2HLFC 1AP2A 1OCWL 2X89A 3GMOB 4EN3C 3BMWA 4HG4K 1WJ3A 4Y2DA 3I02B 4I18C 2BDNL 4TUKL 3STLA 4KPHL 3VCLB 2NCMA 1T5WB 3VXRE 1ZGLA 3KLDA 1RZJH 4XWOC 1M6OA 2Y25A 5FK9B 4JPIB 2GCYA 2F9BT 2FEDD 1UYWL 4JJHA 4OZ4B 3BKJH 2E6JA 3FO1A 5T1MB 2Z35B 3H9SE 2ATKA 1J1OH 3MRMA 5EUOE 4YXHH 1TTUA 3RA7L 1WBXA 2HH0H 2XIDA 5F70A 5EOCH 1YMMD 4QRRD 3O6FD 4M1CD 4XVSH 1U3YA 3O2VL 4X5XB 3TJEL 3JBG7 2WWMC 3V5DA 3B5GA 3LKSB 1J0ZA 1AGBA 2BMKA 1AHWC 1LO2L 3L6FB 4X6BB 4ZSOA 2BRRH 3PWVB 4WUUB 3TP4A 2QL1A 4CN1A 1W0WA 2ADJA 2ZCKL 4Y2DC 4XCYB 4RWYH 1ETZB 2BVYA 1NC2A 3DVNA 5GGVY 4XT1C 4CNIA 1DQDL 3D85A 4IMLB 3PQYE 4I3SH 2XFXB 4YAQA 4KK6C 2VDML 5TQ0H 1FSKB 3U2SA 1JFQL 3LKPA 4ZMAT 2FSEA 5D7SL 3T4YB 5C8JA 4ETQA 2GTZA 2QR0B 3QIBA 5IQ9B 2OYPA 1NDGA 3HE7A 5HDLA 5DK2A 4CW1A 1FO0L 2PYFA 3I6KB 2VDRL 1VFUA 1TJIH 4YHLH 1MJJB 4GRWE 1CZ8H 5EPMB 1XT5A 4Y16D 3V7MA 3L5XH 5FKAB 5EU5A 4AEFA 4NN7C 5EDXA 1PDKA 5F1NA 5GGTH 2EIZB 3OR6B 1TTGA 2V9QA 1I8KB 5JOPD 3V95A 1RI8A 1ULVA 3VU2A 3VA6A 2NW2B 2VDQH 4Z76A 4OI8A 1KUMA 4OV6F 1UFUA 2R4RH 4Y1AE 3T1WA 5JZ7D 3ZTNL 3QIBC 2AK1H 1OSPH 2F58H 4FA8A 4JFOB 5J13C 4WWKC 4QEGA 1KPRB 4OI7A 1G9NC 4NO2B 6FABH 1FBIL 4JCMA 2AJYL 3BKYL 4I48B 1Q9WA 3MRQA 4WW2C 1YEIH 3TN0A 3LQAC 3O4OC 2FWOB 3GMMB 5IVXA 4Z7VB 2AJUH 2CGRL 3S9DB 1ONQA 1CLZL 5BRZB 3WYRA 3BP5A 3DVIA 5FUCC 3OGOE 4LGPB 5HDOA 3O0RH 4MA7H 2R0KL 3HG1A 4UTAH 2XI9A 3FMGL 2RR3A 3HAEB 2EE6A 5TDOB 4TUJB 1LILA 3QDMB 4MSWB 5KVEH 2BFVH 1KLGA 1I1RA 4MQXC 4RAHA 3RZCC 1BECA 3QA3B 1HXYA 2A38A 3O2WH 1A6ZA 2A74B 4G6FB 5T1DH 3T2NL 3WFHB 4HZLB 1AXTH 3BPOB 4LCWB 5IM7A 4HPOH 4R3SB 1HIML 1EO5A 5IESH 2CRYA 1T7VA 4FS0A 4RIRB 2V9RA 4ESKA 1IRAY 2ZSWB 3DVGB 1CI5A 4LIQE 5B3JE 2VN7A 3JZ7A 4UDTA 4M7ZB 4AT6B 4LCIH 4MXQD 4KJYA 1LMKA 1XGRA 5F7DB 4KROD 2YC1B 5HHXH 1G0YR 3QUYD 4KAQH 3MYZA 1MHPL 3VDAA 4FTVB 4CMHC 3K8MA 1NL0H 2APXA 4FP8L 4G42B 4MA3B 2E7LC 5ISZA 1IGIL 3MLVH 2A0LC 3X12A 3EYFA 5CP7B 4V1DD 2QEJA 3SGEI 3OKYA 2ESVD 5CBAB 1BFTA 4OD1L 1IL1B 2M26A 3BDBA 2X09A 1Q9KB 5D7IB 5I71C 3D2UB 4JZNB 4QGYA 4X98B 3TT1H 4KRMB 3VD9A 5D6DA 5C0CD 1WZ1H 2DMKA 4HIEA 2XWJB 4OGZA 4QRPE 4WI9A 1NGZB 1JYWA 5GS1A 2VDNL 3ARDA 2IC2A 3ET9F 5JNYA 3VXNB 3PABA 4GS7C 1TFHA 5IKCB 3QI9A 3X13B 5FECB 3GSVA 1LO4L 3FONB 3U36A 1I7ZA 2WLYA 4Y4HB 4A6YL 1CXIA 4EBQL 1PLGL 2LU7A 2AERT 1N2RA 4HHAB 2MHAA 3DBXB 5HD8D 5J12B 3C60C 5DTFB 1QSEB 3E0GA 1UGNA 2AJXL 5H35A 2FGWL 4UMGA 1FZOB 4B41A 1S7UA 3A6OA 5IVNA 1KXTB 3MJ9A 3BKML 5IG7B 5IV2A 5FYKH 5B39B 2AEQH 1RSFA 4J3WA 1FQ9C 3PHOB 3OKLB 5D9SA 3D25A 2X1OA 5GISL 3TBSB 2NY0B 3WHE1 5CSZB 2VR9A 4ONGL 2DWEA 2DQCL 3JUYA 5DEFB 2ZOLB 1S7XB 3F6IA 3JWOH 1X9QA 4NDMA 4AMKH 5A16A 1UZ8A 2Q87A 4PTTB 4OUUB 5CEZL 2NNAA 3DIFA 3AXLB 4WU7B 5CCKL 4QHKI 5MHSE 1U58A 4Z0BH 2Y07L 1I7TB 5E8DL 1OAUH 2W9DL 1FRGH 2VRAA 4X6FA 3TYGL 2Q7NA 5FGCB 2ITDA 4U1MA 2JF1A 5J6HB 2H2SD 4HIJA 1GPOH 1TNMA 2FLRT 5HSFA 1YEJH 4YR6A 3O4LE 1RZIB 4X4YB 3QZWB 1UQSB 3BT2H 4TSBH 4NQDA 4WNQB 3PWPA 4ZPVB 4DUXA 3GSNA 4M5YH 2CLRA 3VXOA 4K94C 2BVTA 4QRQA 1AGDB 4PUBH 2P8MA 4O58L 4LF3B 3GSOB 2NQCA 4GO6B 4CVZB 2WZPD 3EO1A 5DYOB 3WJLA 4S1RH 4JY4A 2MJWA 3J7HA 2C7UB 3DX7A 3EYVB 2X1XR 4PJBF 3UTTA 4K7FB 4R97B 4PRID 4U1LB 2XWBA 3GRWA 1WZMA 2VDOH 3LAFA 3BIKA 5JMOC 4PJ8A 5LQBL 4X7FC 1WICA 3QCUL 4HJJL 3VFOA 1BZ9A 4AM0A 4P57B 1DP0A 3Q6GL 2HT2D 5BOZG 2E6QA 1CD8A 1AI1H 4O2EB 1U8KB 3QO1B 2PNDA 4J4PD 2JKXA 3QUML 4JLRA 1CD1B 2GSGB 3UPRA 5JW5A 4UQ2B 2DQGL 5SX4H 2UZYB 2W0FA 5E4EB 4LLMB 5C0DA 3ORJA 4RX4D 2FATH 3D5OF 1S9XB 4JDTH 4KKCD 1JGDA 1MFAH 4KHXH 2WP3T 1T2QH 5CWSA 4NHCL 2NY2D 4R0LA