5EBGA

Crystal structure of bovine cd8aa homodimer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
b'LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD8 alpha chain
publication title The structural basis of chicken, swine and bovine CD8 alpha alpha dimers provides insight into the co-evolution with MHC I in endotherm species.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 19
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ebgA00
1I9RL 1RUKH 5DVMA 3PABA 1L7IH 1R3KB 2AQ1A 1FVCB 5KG9A 2H6PA 1UWEL 2RJMA 3KLHC 2BK8A 4MD5A 1F4HA 1QSFB 2LQRA 3T3ME 5FYLE 1MUJB 3LEXA 3ZSSA 4Z7WB 4OF3A 3L1OH 4GRWH 5CWSB 4R90H 4R7DB 4I77L 5JHLH 2NY5L 4ZO8A 5DK0A 4YXKH 1QKZL 1A8JH 1GYAA 3MOBH 5BS0A 1RSFA 2DRUA 4TQEL 4H88H 3TPKA 4YZFF 3UTSD 2OP4L 4ELMB 1I85C 3VFTB 2PW2A 4KRPD 5FM8A 1AGBA 1OAQH 1D5MA 1X5LA 5AYUL 4X7DC 4Z7UB 1EMTH 4WUUB 2R9HD 4NO5B 5L9DL 1MI5A 2LU3A 2IQ9H 5CUSH 5F1OB 1VESA 2AV7A 4YHMH 4YWGL 3WHE1 4LDEB 1IQWL 5LGJA 4DGIL 1CYGA 3ULSB 1ES0A 2X4TB 4ZYKA 1R5IB 1U2CA 5I8OL 3NTCH 1HEZA 1H8SA 4RGMB 4Y0GA 1PKOA 3GKWL 2MPAL 5I1KL 2DN7A 3VD9A 2NY6B 3TBSB 1HWGB 5E6ID 1N6UA 4NQUA 4JFEE 1TPXC 3WFEH 1JMXA 2ITDB 3GSXB 4PJXB 4NKOA 3ULVC 1EHXA 5DLMH 3LKQA 5DJXB 2XV6B 1ZGLP 1ZSDA 3PQYD 1EJOH 5IV2A 5TE6H 1AGEA 3O4LE 1DR9A 2O93L 4KI5D 2YA1A 2EDOA 3LH2L 2XN9E 2Y9RT 1KN2L 1E4XI 1DVFD 4TNWK 1X5AA 4RIRA 1LD9A 4MDIB 4I9WE 1CICA 4A2MA 1RMFH 1E6OH 4H1LB 1JHLH 1U6AH 2WNGA 2ZP0T 4KVNL 4MNHB 4CADA 4R6UA 4XNZC 1C12A 4IRJD 5IF0B 4JFDB 4N1CA 3ROLB 4XB7A 1F13A 1NCWL 1HH9B 4X4YB 4NM4H 5C09B 1KLGB 1VFBB 3QQNA 4PRHE 4GAGL 1HXMA 1BBDL 1RFDL 2D7OA 5KVDH 3QDAA 4PBXA 2HLAB 4M7JH 4C57C 3BPCB 2Y07L 3QPQC 2X1QA 2PF6A 1RZFL 3GMQB 3RGVA 4HPYH 5EBGA 4N0RA 5CJXC 1EXUA 2BRRL 3LDBB 2EYRA 3MUY1 4KKAC 2ZJSL 1JNLL 5IKCB 1DQQA 2GT9B 3W39A 4XPBH 2I9LB 5HGDB 4PG9B 3FT4B 3C6LB 4DKDC 5IVXF 3MX0A 2AXFB 3DV6B 5D8JH 3VXTB 4OGXL 1VSCA 3ZDYE 3WXVL 3F7YB 2R8SL 5EOTB 2J4WH 4R4NC 2UZXB 5D2LA 5IB3B 2AQ3A 3K0WA 1TCRB 5I1IH 2AJUH 2ZG1A 4IS6A 5AZ2L 1UB6A 5F7HA 3IFLL 1A1MB 4R97C 4JKPH 1A7PL 4G42A 2V5TA 4X6DE 3GJFK 2AJSL 1OP9A 1ZXQA 1KG0B 2FJGB 4OUUA 3ARYA 4PJ5E 3UTTE 4DKEH 7FABH 4BH7B 2YPLB 4DN4L 4MAUL 5DMKB 1XGTB 1VGEL 1HILA 3FO2A 5H8DA 5HVHC 1RK1A 3C60C 5IVXB 4H25A 4OBRA 4KPHL 5EIQA 3W9DA 3VGAC 1NBVL 3IB4A 2D7PA 3LB6C 5DJ6B 5GJSH 1ZTXL 2NX5E 5HI3D 5T1LB 1FIEA 4GS7C 5SWSA 2BSSB 1BD2A 3FN3A 4QEGA 3LQZA 4H8WH 1R3IH 1JWMB 2HT3C 2AQ2A 3L3OB 1MWAA 4POZC 3CFKB 4NC1C 3MGOA 3MLUH 3REVB 1OAYL 2X4UA 3F7RA 1IRAY 1Z3GH 5CEYB 4BYHA 5E8DH 2NXZD 3BIAX 4PJ7F 5FCUH 1AGDB 4P46B 5I19H 1G6VK 1KIRA 4XRCA 1IM9D 3QEHB 1XGYL 3ZKSD 4LAQL 1VEOA 5GGTA 5ILTH 2EYSA 4EIGB 3C5JB 4JRXB 4QRUA 5CIPA 1KEML 4JFHE 3V4VH 2XWJA 2XTJD 2GI7A 3CSBA 3QB7C 3SDCC 2HVKA 1MH5A 2DDQH 2I9TB 2N4IA 1FBIH 4E0RB 2BCKA 4HT1L 1G6RL 3HI1A 4MNQE 3R8QA 3GI9H 4PRID 2QLVB 4PGBB 3LS4L 5IG7B 2OMBA 1T6WA 1AE6H 4X6FA 1Q94A 1FZOA 1WCBA 2OTWB 3EGSA 3LHPH 3ARBC 3WYRA 3OB0K 4BQ9A 4NO2A 1V3JA 3RY6C 4URTB 3L3IA 4NC0B 2H2PC 4HMEA 5GRVK 5F96H 1A4KA 2EDBA 4PJ7B 4PJFA 2E27H 1H3PL 5BO1H 3HE6A 3CFBB 5D7LA 3RWFB 3VXUE 4ODUA 2Y5EA 1MCQA 2FGWH 4RGNC 4GRWE 4FZEL 4U1IA 1MHPH 4OSUL 4XVJL 2DWEB 5T3ZE 3UTZA 1ITBB 2W9LA 3GI8L 4KWUA 4WHTA 1B6UA 3IF1B 5E0QA 1EX0A 4WTXA 4ZTPL 2H41A 1CL7L 3QDMA 4M7LL 5IFJA 2XTLA 3DXAA 5TF0A 5F9OH 3TVMA 3D9AL 4OD1L 2QKIA 2AI0L 2IF7A 2NR6C 2VR9A 3MRBA 1OW0C 2A77L 1EFXB 4CNIA 3BD3A 1DL7L 3JWOH 5JW4Q 3Q6GH 4H26A 1SEBA 4LPUA 5MI0B 2HKHL 3IXAB 4HW6A 1PW3A 1Z0NA 1NGZB 4RWYH 2I24N 1IZJA 43C9A 4YXLL 5KW9H 4JO4H 1HSBB 1DBJH 1P1ZB 2BDNL 4XHQA 3KLDA 4YHKL 1P6AB 1KYOK 2VLKE 3I6KB 4K7PY 5FV1L 2VXSL 5HVFB 2WSKA 4PJIA 3T65B 4ZD3L 3FONB 4M7KL 1QA9A 5F72S 1MIEL 1CG9B 2Z31B 3AM8C 3OGCA 5J6GA 1TZIA 3HRZA 3TJEL 4LCYB 1N8ZA 2QADD 5C0GB 3KPPA 5JIHA 4CW1A 2VXVH 3MRFB 4JZJB 3UJJH 1FGVL 1CU4H 1JTPA 2IGFL 1DFBH 4MA8H 5BQ7A 4NQXB 4XH2B 5E9DE 2IFFH 4K3DH 1P4BL 2FBJH 4F7TA 1AD0A 3VFPB 2DQTL 4G3YL 2G9HA 2RCSL 1F4WH 2FZ3A 3RVWD 2IPKA 4KXZI 1RUQH 1RQ5A 3GRWL 3NIDE 1V05A 4N1EA 3MNZA 3TGXA 2IAND 3AS3A 5CKAA 1X6NA 3EDEA 1I7UB 1Y6NR 4F3FA 3STBA 1JNNH 1D5IH 3O2DA 4HBQA 1C7SA 3BDBA 2BHZA 2DJSA 4NP4H 5I1DA 1J8KA 2ADJB 3T0XA 4CDGC 3MV7A 4N9GB 1DQLL 4HG4K 5EZIH 2VISA 2QSCL 1JL8A 3T2OA 3D87B 2VZVA 4QRRE 4U1SB 4U1JB 5DC4B 5IMLA 1HDMB 2QQKH 3K8MA 1FL5B 1PAMA 4JHWL 4DJMA 4UAOC 3DBXA 2FATL 3WIHL 1C8PA 1MJJA 5JORA 3OPZH 4NRYB 2NW3B 4E41A 2FEDC 32C2B 1A7QH 3QUMH 2E3VA 4Z7QE 4X9FA 5CD5D 4IRZL 3DURA 1CFSB 4KRNA 4R3SA 1VPOL 4FFYL 5L2KB 2PTTA 1RUMH 4P9HC 5IIEB 4M8QA 1BM3L 4OZFA 4NRXB 2V2WB 2E7CA 4NJ9H 3VXNB 4MAYA 3ULVH 2B0SH 1JZ7A 4M61B 4OD3L 2IAMA 3DX8A 3QIWA 4GKZA 1XIWC 4DAGL 2EDJA 1YC8A 3FN0H 5DUPH 2VWEE 5KVMC 2AGJH 1F4XH 1U91A 3QUXD 3TYGL 4EN3B 3VXRD 3PV7A 1J0KA 2YD5A 5FHBL 3MLPA 4I2XE 2DYPA 4LK4A 5BV7C 1J9CT 2XIDA 2BNRE 1F6AB 1PEWA 4KQ3H 3BDXA 5ACLA 1A5FH 1P4LB 5EPMA 4AZ8A 3RGHA 5L0QB 3I85A 1MHCA 4PUBH 3IJSB 5FA3B 4N0YH 1UXWB 5IVZA 3IKKA 4Y16A 3K8KA 5IB2A 3QQ3B 1UYWL 1U3HD 1OGAD 1JUFA 3RY4A 5HY9B 1RZGB 3L3KB 1SMOA 3SE3A 4KKNA 3STZB 4PY7B 6CGTA 2VLME 3FFCD 5D4QA 3U4EB 4EVNB 1MAKA 3L3GA 4PJDE 4QRPB 3QWOA 1LEKA 4D3CL 4DOHB 4F7EB 1TVBB 2VL5A 3BKML 4I5BB 4ONOA 3WUWA 3MQIA 2VQ1A 3C8KB 5HHNA 1VKXB 4ONHB 4HS3B 3SHSA 1CBVL 5DO2D 4UQ3B 1NC4A 4K8RL 4YH6A 3C9NA 3MRPB 5AUMA 1MEXL 1RJZB 2YPVL 3RAJL 2NLJA 3WIFB 3FB8A 2VKWA 1IILE 3NACL 3V4UH 5JIKA 1IGFL 5GS0L 1MQKH 2NTFA 2ZCLH 4FQCL 1VGKB 4NSKA 3MNWB 2WIIA 4P5TB 1A6WH 2EIBA 4WDIA 4JFXB 1XF1A 5GRVL 1E4KC 1UM6L 4HLZH 4U6YA 2BNQD 2Q7NA 5I74B 1X4XA 1KTKE 2YBRB 3TYFB 3D3VE 3FHQA 3LKRB 3PUCA 2R2BA 4OFIA 3SKMB 1JRHL 1F11A 3ARZA 3Q2CA 1ITCA 4PR5A 1BFTA 3CLFH 3PL6C 5I18L 3BX7C 3WIIL 2DBLH 3BVNB 4KRLB 5DURB 5DD0H 1Q9WB 3C5ZA 4N68A 2O5XL 2PYEA 4EI5C 3ARFA 5DJCA 1RU9L 4NDMA 4ORGB 4U05A 3F8UB 2R1YA 1ZLWH 4U1NB 3A6BL 5BRZE 4JFYB 4AEIL 5D1XC 3WSQH 5E2WL 4K3EL 5FGRA 1DQML 4G6AC 4MNGB 4JKMA 1T3FB 3RWGB 2H32B 2F53D 1KPUA 5JOFA 1X6LA 4NBZB 1VCAA 4IOIA 2VDPL 3PF2A 4XZUB 5DTFA 4GW5A 4M1CD 4XBGA 1PG7W 1H9VA 2GQHA 1DQJB 3BPLC 4IM8A 5DJ2A 1QRNA 4X6CA 2R4RL 2UYLB 5EBLA 3MA7A 1XGQB 3HKFA 2CKBH 3L95A 3T0WA 3L5WA 1NGQL 1J8HD 1EAPB 3HZVA 2AEWA 3RNKB 2ZSWA 3QFDB 4NGHL 1N59A 1HINH 3WN5B 1MCEA 2XQBL 1FZMB 3FRPG 3O6FD 4ZSOE 1KJ2H 3EOAA 2CGRH 3C08L 4LKXA 1EUUA 1XT5A 3G5ZB 5D93C 3U82B 5JXAL 3BJLA 5CBEB 3PWLA 3KPLB 3EFFB 3QBTB 2DKMA 4UINL 1BIIA 5EUOB 1IMHC 3U46A 5DMYA 3H9ZA 4G8IB 5LWYL 4FTVD 3WHE0 4ZS6D 4IDJH 4V1DE 4IOSD 2A9NL 4D0BA 2FD6H 4GMTL 4YNYA 1MCKA 1L9MA 3QEUA 4TSAL 4LLDA 4MJIE 3CFJB 2CRZA 4X98B 3VW3L 4HLJA 3TA3C 3MSPA 4WFHD 3SDXA 2D9QB 25C8H 1DDHB 1AI1L 4PJFF 5A16A 4FA8A 5CWSA 3ZDXF 2BVTA 3MO1B 2WM0A 4Y4KD 2BC4B 4QXTB 1KXVC 4G9FE 1B0RA 4Y4FD 3VG0L 4JQVA 2UZIL 3JV0A 3PDOB 2YMXL 4H0HB 2AV1B 4MVBD 1U8LA 1KFAL 2F9BT 1J05B 3QZWB 2BRQA 5TQ0H 3EJYD 2DQIL 4FP8L 5E1AB 2EH7L 4ELMA 3QNYA 5FUZH 1NFDE 5J11C 5EWIH 2A73B 4P23C 4BSWB 4MQSB 4HXAH 5I1JL 4UNVA 4U4BA 3ROOB 3DMMD 5T5FL 3ULVE 1C5CL 4G80A 4X4XB 5C0JA 3MBXH 4FQXB 3ULSA 1U8QB 1R5IA 2XPGB 1B88A 1TCMA 2OI9C 1BLNB 2ZUSA 5TE7H 3GIZL 4NZTH 4NN6C 4L4VB 2Y72A 2J8UE 3H42L 4X5XA 4LEOA 5J6HB 3IETB 3C87A 5DRZB 2GJ6A 2BY0A 3K74B 5HHQA 2ZSVB 4PJIF 1NC2A 4UBDD 4GH7B 1NH6A 3P4MB 1TZGL 1JFQH 4UIKL 5K9OA 1NDMA 2VDQH 1TVDA 2X5PA 4MA1B 3RZCD 5E6IC 5E2JA 4RGOL 3AS1A 4ZFGL 4DQOL 4XPTL 3QI9C 2XA3A 3NCCB 4Y1AE 1D9KB 2FO4B 3I02B 2P45B 1EEUA 1JWSA 1IGJB 4PB9L 4LSPH 1UJ3A 2XKNA 1TJGL 4LCWB 2QSQA 5CJQH 3WFZA 1EHLH 3GSNH 4KY1H 4DWHA 5BCAA 4OLZH 2OCFD 1BFSA 4KI5C 3BP7A 5DEGB 5DZOA 1RZJC 4XP5L 1OP3H 4Z0BL 5DUML 3V6BR 1H3GA 2I5YH 5IF0A 3LV3B 5ITFB 4HV8A 1D6VH 2ZOKB 1DVFC 5ITBH 4F7MA 4JPKL 2HT2D 5KSAD 1HCVA 4RNRB 5EU7C 5HDLA 3PGFL 1KLGA 4YHOL 1NMBL 4YGAB 5IHUL 5IWLA 2ID5A 1N6VA 4IRJC 3NA9H 4HIJB 4CJ1A 4NN5C 1A9BA 3BPCA 1DP0A 2Z35B 5C3TA 1GC1C 1PD6A 5D6CB 3HR5A 5FO9B 4UUJB 3OL2A 4HPOH 1FN4A 4X6EB 4YHYC 3R4DA 5HGDA 5SX4H 5IT2L 4Z7VE 5FUOH 5HYJA 1SYSB 5DD5L 4DZBB 1AO7E 3QJFB 2ICEB 1BJ8A 1QSED 1U8OA 1RPQA 1INDH 2XNAB 1C5DA 1WIOA 4R96B 5FYKD 5EOTA 4LPTA 1NLDL 4Y5YC 4Z76B 2PXYD 5DQDL 1UM5H 4P9HH 1G9NC 5GHWL 1N3NA 1EO5A 1V7NL 1WFTA 2X44D 2VLJE 4N0UE 3MLTB 2QEJA 4KKCD 1KCLA 3TFKD 3V0WH 4Z18A 4HCRL 2DQDH 1U8KB 4GXVH 3KPSB 5CD3A 3T1FB 3DSNA 1NJ9A 5CP7B 4NKDB 1LDPH 4WW2C 3ZYOA 1DBAL 1SBBA 1IGIL 3VWJA 2FJGA 4KTDH 2FSEB 2NY0D 1IC7L 3V52L 5BMFL 5BV7H 5E99H 1XGPB 4LCIH 5DMKA 4XPAH 1HI6B 1ZT7A 3RL1B 2VH5L 2W0LA 4QRQA 1XGUB 4NC1E 5DJ6A 1WFOA 2IADB 3KJ6L 4IIQB 5AD0B 2KKQA 2VXTL 2BSSA 5IFAL 5C2UB 3C5SA 4YR6A 3K3QA 4HC1L 3MYJB 5HI3C 2F54B 1U2HA 2NY4D 5D1QA 4CN1A 4F9LA 2FO1A 5EOCH 4JANA 2ARJQ 5EBMB 1JPTH 3C2AL 3QDGE 1FLRH 5CEYA 3F6IA 4RRPA 4YQXH 4Y19B 3O41B 1NBZB 2WLYA 3S3JA 3TO4B 4ZPVB 4WW1A 3MODH 2XWBB 2DD8L 5T1MB 4PS4L 4GSDL 4KJPC 2NXZC 4NBXB 4RMUA 5F1SA 4UOJA 1XCTA 3JV6B 1NCNA 4JRXA 3RL2A 3K2MC 2P5EB 2X4QA 3MOQA 4P49A 3WNPA 3LKOB 2WBJA 1QG3A 3A0OA 3BGFB 3MLYH 1MFCL 3H9SD 4UB0H 1NMAH 3BZ4B 4ONGH 1T1XB 1I9IL 3MV8D 4JZOA 4E0RA 3S6CA 1W0VA 5LXGH 1G7JA 3IDXH 2XTJC 4L3EA 4KK6C 3MRMB 4RGNE 3VRLE 1HK6A 3N1FC 4OFYD 4YHZL 3QEQE 4EDXB 4JFFD 3ARVA 5LG1A 3T3MF 4AT6B 5IOPA 1EEYB 4NM8L 1D5ZB 2A6DA 2V7NA 4KKLD 1ZV5A 3UJTH 4JQIL 3F12A 4LF3A 4ODHL 2IPTL 1SM3H 4PJCA 3GMOA 4WI7A 5EU6B 4OI7A 3BI9X 2HKFL 5JXED 3TN0D 5ACZB 5IROC 2B1HH 5C08E 1KELH 5C07D 5K9JH 1N26A 1UCTA 1HCFX 2H26B 1O0VA 1Q9LA 4PJ9D 2GITA 4YFLF 4WI5A 1CVRA 1S8DB 1YYLH 3HC0B 3MLWH 1IVLA 5ID0B 5ICZB 2OLDA 4I18B 1OY3B 2GTZA 5EZJB 4TYUA 1KB5L 2EECA 3HG1E 1HQRA 2XZCL 1JPSH 4Y2DA 5GGVL 2EICA 4KZEH 3RTQB 3IXAA 5D7JB 3NVQA 4MX7B 1NGZA 2BNUA 5HYFA 1ONQB 1P4IH 3NPZB 1HSBA 3O3DB 1CDUA 2P44B 3L3HB 4N5ED 2CDEB 3ESVF 3U36B 1RIUH 2ED7A 4JN1H 4K2UL 4Y2OA 2VZTA 1D6EB 2EDNA 3HUJB 2GKIA 2UWEF 1WT5A 3QUZB 1Z2KA 2Z31A 5INDA 1UZ6E 4JFOA 1CFVH 3UYPA 4FQ1L 2CQVA 5BS0D 4NNYA 5ICYA 4PYHA 1CDJA 5C0GA 5CEZL 3WKNA 3MJ9A 4ZFOL 3L6FB 4EBQH 1W72H 1GPOH 3TT3H 5ANMA 3MGAA 1MI5D 4G6JL 4JPVL 4XH2A 3O8XB 3N85L 3O6KL 3QIBD 2AEPL 4HDIB 4P57A 4PJAB 4LDOB 3OB8A 1W0WB 4TSCL 3H3PL 3KYMB 5CS7A 4PB0H 4JFEB 1ZT4B 5B4MC 2AEIT 3K4DA 3MXVH 3RPIA 1QBML 4HJGB 1WC7A 2O5YL 1QVOB 3QWQB 5L7XL 1KCRL 1I7UA 3RVWC 4LPVA 4KVCL 2NMSA 4Q97A 1UWGL 4NCC2 4MSWA 1ZOXA 2BXYA 3O4LB 3VRJB 1EV2E 2CJUL 2QBWA 5HHOE 1WBZB 1HSAA 4N9GA 3IJHA 5ID1A 3ZDYF 5EG6C 2P8MA 2Y1VA 4U1SA 3BDYH 2VDML 1U8MB 1IBGL 1EGJA 3T2QA 1RURL 1HHKB 2WZPD 4NKIL 4YDVA 4HH9B 1UVQB 4U0QB 2AKRB 3NAAL 4KK9D 5CILH 1CICD 3BEWA 2NW3A 1NEZB 4PRHB 1L7TH 2EE3A 3KPOB 4I3GA 3BW9A 3HI6H 5T5NG 1G7PB 1DJSA 4MJ5B 3GSUB 4NZUH 5L2KA 4XPHL 1OTUD 3P9WB 2MSPA 2DLFL 4QRSA 2V2WA 5E4IA 3IDMB 3VXNA 2VLLA 5C9KA 4ODVH 3RGVD 1KULA 3CAFA 1A7OH 1A6UH 4B53A 5IJVB 4LEXL 4U6VH 4YFDB 1CQYA 1U8NA 1HYRC 3PWPE 4JM2A 4EN3A 1TJIH 1FC2D 3LEVH 5HHPB 4AEEA 1CR9L 3DX7A 1QOKA 4PJBE 1BOGA 4HGWA 1RZJH 2FLRT 1RZ7H 3QXDB 4AMKH 4YX2H 5DI8B 1YEDA 4X6DB 4ZXBB 5FA3A 3IJSA 3W11D 4HQQL 3UTTB 4PJ5B 1BECA 1YN6B 3K81A 3EYVA 1KF9B 2X7LB 5DQ9A 1RZGA 2D7NA 1LK3L 4PJ8B 1N0XH 4ZNCD 1GC1H 2UZYB 5E08H 3TNNA 3MLZL 1OF2B 3G6AA 4UDTB 2NX5B 4AM0A 1U3HC 4B7IA 4PV8B 4QRPA 1TVBA 3L3JB 3DVIA 2NY2D 4I5BA 3HB3D 4RX4A 3L3DA 4FG6D 2VDOL 3NCYS 4Q6IA 1ORSA 1UCBL 3NFNB 4HKBA 3T0EE 4ONHA 4HS3A 4QY8A 1KGCE 1S5HB 3SKNB 4TVSa 2R0WL 4P3CL 4DW2L 2FL5A 1LP9E 3HTLX 5A2IH 5KZCD 1ZHBB 1U36A 4X7CC 5SWSD 4WEMB 1RJZA 1G9NH 1BD2D 1FZJB 4TPRH 5D6DA 1T03L 2V17H 5DO2C 4F2MA 1JGLL 3EW3B 4W4NA 2HH0L 4OLVL 4G7YL 4JY6B 4M5ZH 5D1ZB 2CUIA 3MNWA 4QOKE 4GRWF 5EZOH 3FAXA 4L3AA 2OL3A 4HK0B 1YYMH 2EDDA 3HNTL 1NCUA 5DD3L 5LCVH 1KJVB 1QYGL 4N8CH 3QIUB 3BRDA 1MELA 3FMGH 2OZ4H 1FFNB 2AJ3A 4MQTB 2N7AA 3SKMA 5JIPA 1NGPL 3GBLA 3CK0H 1A6TA 4O2EA 2YRLA 4PREB 2D7QA 3FFDB 2CO6B 2DMBA 5F9AC 2WMPA 3TCLB 1U8IB 4OD2B 3HZKA 1JN6B 3IDGB 4MNQB 2FHCA 1IEAB 3S36L 5D2NC 4Y89A 3VRIB 1U92A 3ARDB 1TNMA 3NIGE 4WO4A 4ORGA 4KQ4H 4QRTA 5GJTL 2X4PB 1ZLSL 1PLGL 1FC1A 3VXUB 4Y5XA 3LY6A 3B3IB 3WBDA 1V5JA 4GRWB 4J2XA 2QV2A 1DBML 2WQ8A 2BOBA 4MNGA 5D7LD 2H32A 5I66A 3I6LD 4KAQH 4LLVB 4B41A 1INEL 4JRYE 4PGJA 4NHCH 4XZUA 2NTSP 3FQNB 3I3EA 2NYYD 4L8BB 4NFCA 5M7QA 3B5TA 1GIGH 2VRAA 1EIBA 1I8LC 1Q0XL 5I1CH 3SO3C 1NGXB 1AXSB 4XXDB 2XYCA 3HE7B 3QDMD 1MPAL 3PWJA 1FH5L 1FSKC 3K2UL 4KC3B 4LIQL 4YUEH 1B0GA 5EIIB 3CU1A 3DXAD 3R0NA 1ZHKB 4ZOEA 1UENA 5FM5M 4OZGA 1FHGA 3TVMD 5T1KA 3REWA 1EAPA 1XMWA 1UKTA 5B38B 3RNKA 2P47B 4XMPH 5CJXA 1A6PA 3MRQA 4S1QL 4WI8A 5HD8D 1JYXA 5JA9A 2YN5A 1PX4A 2VLKB 4N0CD 5MEPB 4LAJH 2M8XA 3NPSC 3BZEB 4WIQA 3NIDF 1S7XB 2DI9A 2MCPH 2IALB 2EC9U 5DMGC 4JR9H 4P2CG 4G8IA 4YPGA 5DUBB 2GSIB 4PV9A 3AVEA 4P99A 5KVGH 3VDBA 4O9HL 4OZIA 5E6YA 3WEXB 1AFVL 5D7IE 4U1MB 2BJMH 1MCDA 2A1WH 2JF1A 4RMRA 4ZS6C 4XXCC 2F58L 4M4RA 2C3HA 2D31B 4TOYL 1FFPB 4NQCE 4QYOA 3TWCL 5CJOH 4PJCF 5E9DB 4UTBH 3O9WB 1IGML 5F8RC 3KPMA 1QFHA 2BC4A 4QXTA 4LSVL 3FN9A 3TF7C 1QHPA 2BVEA 4ZNEA 1YUHB 1Q9OB 3GGWB 1ZA6B 1GHFH 3PDOA 3LZFL 4Z7QF 2ICES 3UTSE 2R4SL 2NY3C 1SJHA 2YEZA 3TBYA 2EDFA 2CKNA 3ALPA 1MCPH 2RGSA 2GEEA 3CVHB 1GGBH 1LO3H 4KTEH 4Y4FC 5E1AA 3SCMA 5I2IB 5B8CC 2EYTA 4BFGA 3BQUB 2GJZA 3NIFF 3V5DB 4MVBC 3FT2A 5GGUA 1WVZA 4L8SB 4ZDHA 3EJYC 5I1AA 3KNBB 1IGCH 4QXGL 3V8OA 3ROOA 2DBJA 3GKZA 3JVGC 1NCTA 2Z93B 3TH2T 3QT2A 3HMWL 1MIML 1FNFA 1HH6B 1U8QA 2XPGA 1WITA 1OAKL 4GW1B 3KYKL 3MV7D 1BLNA 3GSOB 4CMMB 3DMMC 5ESQA 3VDAA 3NZHH 3BYTA 3GMLB 3IETA 3JBG7 2F15A 5DRZA 1JPFB 3BP5B 4WI9A 4O4YH 3S35L 3PQYE 5D72H 1S9VB 1SEQL 1YEKH 1ZT1A 4LHQB 5L88L 1CGXA 4KI5E 1SBSL 3C09B 4E41D 2PCPA 3ME0A 1QFWM 4QXWA 4UBDC 1P7KA 3EFDH 5I1HH 3U9PH 2FIKB 5EU7E 1A7NH 1AP2B 3RZCC 1H3WM 3QO1B 3IXTA 5GZOD 1U58B 4YHNB 3GSWB 1T21A 1KJ2A 1MHEA 2YR3A 3B9DA 2VABB 2ATKA 4MAYD 3X3FH 1JJUA 3LV3A 2WQRA 5ITFA 5IK3A 2IAMD 4YHIA 3LSOB 2XRAH 2ZOKA 3QHZL 4QT5B 3TZVD 5I6XB 2WBWB 5KSBA 3QIWD 4NWTH 1I8MA 4ISVA 1FYTA 5ISZB 1AR2A 4I2XB 4OZHE 1T5WB 5HGBB 1JRHI 1FVDB 5CMAB 4N9OB 3CC5A 2WUBL 2CK0H 2MJWA 3P11H 5I75C 2R0ZL 2HT2C 1J11A 2DYPD 1N4XL 4BQCA 4ODSL 4UUJA 2ADFL 4XAWH 5TFSL 5E8NB 5ETUB 3VFUA 5HDQH 2GHWB 4PD4J 4XBPA 2DQEL 4M1GL 4C59B 3QJFA 1JGDB 2GK2A 1UM4H 4HWUA 4A6YH 2XNAA 2FX8L 2HJKA 4Y16D 4AIZB 1T83C 2E6JA 2XZQL 4PJDB 2Y36H 5IBLC 1AHWA 2VLRE 2D7MA 2J12B 2ZNWA 5IEKA 3MLTA 5JR1L 5DR5H 1KPVB 5AZEH 2P42B 2HFFA 1FLTX 3PIQA 4G8EB 1U8KA 1OD7A 2ORBL 4HUXA 4QF1B 4G6MH 2ICCA 4K3JL 3RHWF 3U30B 1YNLL 4KKCC 4TRPL 5DK2B 2FSEA 1NC4D 5LBSL 4YJZL 3RX8A 5I1EH 2UY6A 4L8DB 4PTTB 3MRDB 3VFWB 3BSZH 4IJ3C 5B39B 1NL0L 2D03L 1MJ7L 2ICWB 1X3DA 2R2EB 5JPMA 3X12A 3RL1A 3AGVA 3MZGB 1ADQH 3BUYB 4X4ME 2NY0C 3NCEB 4BSVB 1FAIL 1WAAA 1XGUA 5C0EB 2JLLA 1JGVL 3D3VB 5ESAB 1XF4A 4Q9BA 2YPKB 3ARGD 3UXFA 4FFWD 4GW4B 2G75A 4XB8A 1DBBH 1MJUH 3LKNB 3UC0H 4XNXH 2W38A 3MBEB 1OAZH 2F54A 2G2RA 4HFUL 1UQSB 1E4WL 3EKCA 3GEWB 3MA9H 3C6SA 4LNRA 1A3QA 3BE1H 5EBMA 4LASH 3BD4A 2P8LB 1QBAA 3G5YA 4HK3J 3OKKA 4JAMA 3GSNA 1J5OH 1AQKL 2D0FA 4ZPVA 1P5UA 3LCYA 3VFGH 4W70A 3HAEB 2ADGA 1HHHB 1UEMA 3C5ZD 3FO9B 5BRZB 4PRDB 3QG7H 4M6NH 5KJRL 3FO0L 1VEPA 2PO6B 3ARFD 2XTJE 1YEJL 4YGVB 3CVIH 3JV6A 4S11A 1Q72H 3QEGL 4LHUA 4ZUSB 1X5IA 2GFBB 4HF5H 2VDLH 4OZFG 3C2SA 3G04B 4U31A 4UMGA 1RJLB 1JGEB 1NANH 1S9WB 2Y06L 1HHIB 1A14L 5J9PA 1MY5A 4OV6F 5E8EB 3H9HB 4QCIB 2IH3A 2IWGA 5IMOB 3O3EA 4MZ3A 5C86A 1AJ7L 2V2XA 1U0QA 1I9RH 2X2YA 1EEYA 3LN4B 1BMGA 1FCCA 1CGYA 4LSTL 4K7PL 4YDJB 3ZKXB 4DEPB 1T5XB 5CGTA 1QRND 2WINB 5EU6A 2ERJB 3DYOA 4RAUB 1MVFA 1BFVL 4KKLC 4YE4L 2Y6SD 3MRIB 4I77H 3VGHA 5CJ5A 5DJAA 1S5IH 1WZ1L 1T7WA 2W91A 2H26A 2CLVA 2CH8A 1IEHA 5A1AA 2B1AH 5JXEC 1WBYB 3TN0C 1ORQB 1FL6B 5CEXB 5EU5A 3HC0A 4V1DB 2D0GA 2OP4H 5ID0A 4FMKA 3TH3T 2FLBT 4K9EL 2DI8A 3DI3B 2ZOLA 4PJ9C 3IGAA 3S5LA 3V7MA 5AYUH 4W4OC 5ERWB 3MACL 4MJIB 2MCG1 4QTHB 3TBTA 2DM7A 3WUWG 3L5JA 3NN8A 3W0WA 2HJFA 4U6HA 1AKJA 4GAJL 3RVXD 4DGIH 4K23L 1S7RB 4OKDA 1T04A 4G9FB 4S1SH 3U36A 5FYJD 1HN1A 3IFOB 1VADA 1T1WB 3WLWC 1C5BH 1D6EA 2GY5A 2R69L 3HUJA 4YK4C 4CVUA 4N5EC 5CJBA 4X99A 4MMXC 1YECL 5F9DC 3QUMB 5DZLA 3OJ2C 2DLEA 1M7XA 2PNDA 5JOEA 5CCKL 1EO7A 1NFDB 3DX9A 2DTSA 4PTUA 2HMID 4NO0B 5FKAB 3L6FA 3DRTA 3EDKA 4OF0A 4JB9L 1TPXB 3HC4L 4N5UA 4XNMB 3SE4A 1IAIL 3RFZC 2BVPA 3QJHB 1JZ5A 3KPNB 2V5RA 1OP5K 3LS5H 4J23A 2JIXB 5JW5B 1MRFL 4PJAA 3VFVA 2X70A 2J8UB 4N0FB 5C2BL 3OBAA 1NAMH 2F19L 5J8OA 1N7ML 4C83B 3QIBC 3FTGB 3FQWB 1QVOA 1IAIM 4DGVL 2GJ6D 4GBXB 1G9ML 4OZIF 1NC2D 1BP3B 2DQUL 1Y18A 3AB0B 3GHBH 3WFBL 4Y1AB 2OX5A 1WBZA 5C8JB 2N7BA 4M6OL 1JNLH 1CQKA 1MCLA 3CDGA 3D0VA 3MV9A 3PL6A 4JN2B 5J12C 5HYEA 1MCSA 4HH9A 1UVQA 4I0PA 3ARTA 5DHVH 4GKSA 1AY1H 4EI5A 2AKRA 5ADOH 1A1NA 2R8SH 2IMNA 2VXQH 2D3VA 4G43B 1NEZA 3MOAH 1DBKL 1T7XA 3N9GH 3CGTA 3MUJA 3O3UN 3GSQA 2XY1A 3MNVA 4J3TA 4KK9C 1GAFH 3CXHJ 3MRLB 5C09D 1CICC 3EYOA 1J1PL 4MJ5A 2GAZA 2VSDA 4PRAB 1KJMB 3CDYA 3V6FB 1YNTB 2AJSH 3U48A 4IMLA 4Z7VB 4FXKA 3IDYC 4GXUN 5F6HJ 1AO7B 5I8KH 3ZE2E 4R97B 4P5MB 3SKJL 5FYKU 3VXRE 1OTUC 3FZUC 5H94A 4MAUH 1I7TA 1QBLL 4Y5VC 4KK5D 1N6QH 5HYJD 5L2JA 3RGVC 2R2HB 6FABL 1A4JA 3RDTB 5LQBL 2FB4H 3BKJH 4Q2ZB 2DLHA 1BQHB 2VLJB 3PGDA 4N0UB 4I3SL 3WDIA 1UH4A 5DF0A 3TV3H 3ZZ1A 3QXDA 1FNHA 2JTDA 3VFOA 1LO5A 4ZS7L 3D2UB 2XACC 3RVTD 4X8XA 3DRQB 2GCYA 4LVHC 4L9LB 5GSVB 1XGRA 4KJYA 4PJ5A 1OGAE 2RFXB 1OD9A 3ORJA 1YPZE 2UVEA 4LLYA 1S9XB 4JHAL 2X7LA 3DOSA 3FFCE 4NQVB 4PJ8A 5MEQB 3W11C 3D39B 5DYOA 1CS6A 3KG5A 4YXHH 2BY1A 3MJ8B 3HPLB 1I8IB 2W9DL 1QFUL 1NCCH 4DTGH 2Q8AL 1T1ZB 5BZDB 4G6KH 4MJ6B 5I17B 1N5YH 3R06B 3MXWL 4F7PB 3NFNA 3K7UA 4W6XB 1NCBH 4QGTA 35C8L 5EB9A 2NXYD 4N8VA 4LQ1A 2NY2C 4FQ2H 3H7BA 4FG6C 3LRSB 2PETA 1U8PA 2B4CL 3QDGB 5BVJB 1T4KA 5D1QD 2PW1B 3SDCB 5FYKH 4P3DA 3HI5L 5C9JB 1BZQK 4H5SB 3VFNB 2CKBB 2ITCB 3GO1H 2BNQE 2VKXA 4XVUD 1I4FA 4HK0A 4YHLL 1IGYA 1FP5A 4P23A 3MR9A 3SGDI 5GS1A 1H3PH 4L8CA 3UPRA 5IMKA 5K9KB 5DD1H 1CE6B 3P30H 1S3KH 2V9RA 1QLFB 3ARBB 1AQDA 3LEYL 3RWHB 5D71H 3RBSA 4JRXD 3GI8H 4HWEL 3ULUD 4PREA 1CI5A 1CL7H 3TNMB 3E3QC 2WBJD 3PNWA 5E4EC 2HRLA 4P9ML 1JN6A 3K1KC 4RGNB 3QEQB 4OD1H 3HZMB 5C1MB 4TSBL 4YC2C 2W60B 5HHXH 4L3ED 3VCLA 3CFCL 5I8CA 2MQCA 1KCVL 4NQTA 2EKSB 1DL7H 3H3BC 3QI9A 2H45A 4F7CA 1JV5A 4OQTL 4YXLH 2C3XA 3V0VB 4TVPD 1U8JA 2F53E 4YHKH 5C08B 1UZ6F 2R2CA 4C58B 4NOBA 3ARUA 4PD4K 4LDLB 2G60H 4YZFE 3UMTA 5KS9A 4UNTA 1CD0A 2A83B 4JO1H 1IJ9A 1JWUA 2Q76B 2UY7A 3MUGB 1J8HE 3HG1B 1ZHKA 2NYYC 3WXWH 5TDOB 1CDGA 3U9UA 3Q1SL 4LSDA 5B38A 1WFNA 3OKNB 5JQ6H 3MROB 4C56A 2DKUA 1WF5A 2CUMA 4FNLH 5C70A 1B9ZA 2O61A 4OLWL 1KXQE 4QHUA 2VLKA 4Y2DD 3TVMC 4ODXB 2V7HA 3OQ3B 1NANI 3KDMA 4FTVE 1H3VA 4G3YH 3T8XB 3Q48A 5HD8C 5IBUG 3U2SB 1JYVA 4N0CC 1INQB 3V4PL 4C4KO 5C6PB 3WEXA 4UI2A 1G6RB 2V9QA 4X7EC 2X9WA 2DQJL 12E8H 1HKLH 4WFHE 1FRGL 2Z31D 4LVNB 3S96B 3FB7B 3HZYB 2OJZH 1PZUB 4S2SB 4F15C 2VAAA 4YBHA 1DQLH 5E8OB 3I9GH 5AG8A 1P6FA 4LRIA 3OR6B 1MREL 2YXFA 1CXFA 2VDRH 4DZ8A 4H0GA 1HHGB 4HIXH 4M93B 3S37H 4RRPG 3DTXA 5IESL 4YBLC 2BVQA 2EE2A 5E2TL 3DV4B 4QTIL 4LLMB 2KZ1B 1NAKH 4LLQB 4KUCF 3RU8H 1VHPA 1H15B 3BQUA 4ZO9A 1TZHA 5IB5B 5HHOB 2OTUB 1J12A 5K9QI 2EEBA 4AL8H 4BH8A 3BZFA 3P9MB 2YZ1A 4ZQKB 3IU4L 1ULVA 1CZ8L 3STLB 1M7DA 1E4XL 4JPIB 3D18B 4XMKL 3DYPA 4AENA 4U7KA 2YSSB 4DAGH 3MCKB 3P0YL 1D7FA 2FHFA 3BD5A 4CMMA 1IC5L 5JUEL 1FCGA 2VDNH 4PJBF 3B4NA 3GMLA 1KEGL 2IQAB 5ESVA 5FHBH 1RIVH 4JDZB 3RX5A 1ZHLB 4BQBA 5DWUL 2D0HA 1PEZA 3DLQR 3MRRA 4UT6H 3LIZL 4QHNB 2ATPA 4GMSL 1Z0MA 4FZ8H 3KS0H 2FIRT 1XH3B 2AXJA 1N64L 2AJVH 2Q8BL 3KWWB 1C16B 1RD6A 2G5BA 5FYLL 3ZT5A 1T7ZA 8CGTA 1MJ8L 2EC8A 3KXFA 3GMNA 5L2KD 2Y7QA 5I1LA 1UYWH 4X7FC 1KBGH 1UH2A 5IFHL 1Q9KA 4NUGL 4M02A 4PGDB 4AY0A 2XKUA 4NPYB 4XHJD 3PWPB 1VERA 4K94L 2AABL 5CZVL 4J4PA 5ISZA 4ZO6A 4F8QA 5GZOC 4HKJB 1FVDA 1KUMA 3JV4B 2KPNA 2F5BL 4GKNB 4CU6A 1YEHH 4PJBB 3H0TB 2EDHA 4JM2D 4EN3D 2IAMC 3TZVC 2LV4A 3T4AA 3X14B 4M6AA 4W68A 5TQ2H 5IROA 3VH8A 1CBVH 3WNLA 3T2NL 1K8DB 2I25N 1A1OB 1TVHA 5E8NA 3EOBB 4D94A 4X9BA 5EU4A 2GK0B 2I60L 5DMJB 1TQBB 5JHDE 2BFVH 5FYKE 1A2YB 4FQCH 3CDFA 3HLAB 2E7MA 4WY7L 2OM5A 3IDJB 4LGSB 5JO5A 1NGYB 2QJDA 3BFOA 2YOCA 4XX1G 2DTML 1OSPH 2LTQC 4R2GB 5CSZB 2V2TB 4Y16C 3WFCL 4KGJA 2O5ZL 3T0EB 1BVLB 3P77B 1K4DA 4QRPD 1F3JA 1IKFH 1CDCA 3SE3C 4WRLA 4D9QE 1HXYB 1LP9B 4RX4D 4HFWB 1F8TH 4QNPF 2DQGL 2C1PB 4I0KA 1F90L 4YBQD 5I18H 4PY8J 3GJFB 4M43L 3WIIH 3VDCA 2Z91B 4XBEL 1M71A 5E5RB 3MCG1 4QOKB 5E94B 1S7WB 4Q9RH 1C1EH 1RU9H 3BUYA 4XC1L 4E5XA 2X4OB 4S10A 1NUFA 2FWOB 3B83A 5KBNC 1PKQE 1SY6L 4RA3A 1DQDL 4KHTH 1WCQA 4BQ8A 3D3VA 3OXRB 2AK4A 1E27B 5ESAA 5B3JE 3SDAB 1J0ZA 1HHJB 4NQSB 4RWHA 4WFFD 2BXZA 4HIIB 3BWAA 3VWKB 4UTAL 1UH3A 2IG2H 4LFHD 3ARGC 5D1XB 4FFWC 2P8LA 3AUVA 1D5BB 2J88L 4IBLT 3WKMH 4I13B 1I1AB 4QHLB 1RUPL 2X1XR 3QFJE 1DZBA 4NN7B 4XCNB 4NYLB 4OTXH 1MLCB 4LLWA 2OMNA 5FCSH 1OCWL 2VN7A 3ZTJH 3CFIC 3FO9A 3CFEA 1BREA 4PRDA 1NGQH 1IAOA 4YDIL 3CH1A 3MRGB 4O2FA 4WO4D 3H9SE 5I9QC 4HAGA 4EI6B 3CXHK 3EOTH 3VA2C 4ZUSA 2R29L 4KGLA 3MV8E 1CGSL 1NUGA 3G04A 3C5ZC 5C0DA 1V7ML 2DIAA 4JRYB 3LMJH 3ARFC 4MCZA 4AH2B 3K8LA 3S97C 3QULB 3UO1L 4YDKL 1CFQA 4JO3L 5IMOA 5D7IF 4JFFE 1MWAH 1CLYL 4OIIH 1K5NB 4ENEC 1CD8A 3THML 3S35X 1IE5A 3D25A 4MZ2A 4YDLC 5D93B 3VJ6B 3BEVB 2BY2A 3SBWA 4CBPA 4RBPH 4HH8A 4A6YA 3FOLB 3W9EB 5I0DA 1W72B 1ZGLB 3MGTA 5BVPL 3ARRA 4CN6A 1S7UB 1WEJL 2APVA 4RAUA 5C07E 3VXMA 5GGTH 3QPQD 5J56B 5T1KD 2QR0B 4RFOH 5FO7B 5CIPH 2F5AH 3KAAA 1GZQB 4KKAD 1JTOA 1A0QL 2UZIH 4QXUH 4J12A 3GMPB 3TA3B 5F7DA 5L6YH 1R5VB 2X4SA 4JZNA 1VACB 1KFAH 2B39A 2Y6SC 3MLVL 1J0HA 1FL6A 4LOUD 1MFAH 4WEBL 2DQIH 4FP8H 2P7TB 2IEPA 4APQC 4D8PB 3UZEA 4Y88A 4MJIA 4LNVA 4BSJA 3IVKA 1LNUB 4I1NB 4ERSL 4KRMB 3ESUF 4UV4L 2AK1H 3ETBF 5I1JH 4NQCB 1SJEB 1YY8A 1C5CH 1F4YL 4Z95H 1OM3H 1QRKA 5MEOA 1H8OA 1NSNL 4ZAKB 4G9FA 1EEQA 1BZ9A 1MFBL 1T1WA 4X0KB 9CGTA 3MREA 4JY4B 3MRJA 1A3RH 3UTSB 1OWWA 2JJVA 4KI5F 1KB9J 4KRPB 3QWRA 5BS0E 1FO0B 1YZZA 2P1YA 3ILPB 2FHBA 1DANT 5IHLB 1BF2A 2CXGA 5JW3H 1SJXA 4RGOH 3RWIB 4NN6B 3MCLL 5ICXB 4I48A 3SCMD 1F02I 4NHUA 3CPLB 4LFHG 1FORH 4PB9H 2HMIC 3QJHA 3KPNA 2MKLC 3L1OL 4M1DH 2FJFB 2UUDH 5TDPA 2CDGB 1CXLA 2JIXA 4QWWD 5E6IB 5JW5A 4XP5H 4RDQG 4YXKL 5T3ZL 5ENWB 5GRUL 3QNXB 2H9GB 2J8UA 4N0FA 1A6AB 5C0BA 5DA4A 3VXSB 4WU5B 3QCUL 2OR7A 4HEPG 4XNQB 3CH8A 4N90D 4C83A 3PQYB 4H88L 4OGZA 5I16A 2VL4A 3FQWA 5AWNH 1HYSD 1XAUA 4YHOH 5C7XH 5IHUH 3HPJB 2GY7B 4J8RB 1IQDB 1PYWB 2ILLA 2KL6A 3RHWK 1OAQL 3DVGB 3FT3A 3IT8D 3UPAA 1V3KA 1DVFB 5CUSL 2IQ9L 1DUZB 4JCLA 3B8YA 4YHML 3MLXH 2J6EL 1T0MB 1ZK9A 2EDTA 1FPTL 4ZPTA 2ZPKH 2P24B 4JN2A 4IRJB 4WW2F 4WVRA 4CVXB 1WV7T 43CAA 2ARJB 5D2NA 1KCSL 3UCRA 4LSSL 1GRWA 4MMZC 4OZHB 5C0FB 5F9JA 3WFEL 3UBXA 1U93A 5DLML 1GZPB 1ZHNB 1CD1A 3SDDA 3Q5YA 1FYTD 2HRPH 2H2PD 3SJVA 5TE6L 1EVUA 4KTYA 3BPNB 5FB8B 3O2DH 4GQ9H 1T0NB 3KJ4B 3KPRA 1RZ8A 4Y5YB 1J18A 3P9LB 3BGMB 1QR1A 1MCBA 2FNBA 1AXTH 3U0TB 3NH7H 3O45A 1AO7A 3RKDD 1KTLB 5EU3B 5IWLC 3F62A 1RMFL 5JNYA 1E6OL 1JHLL 1U6AL 1CLOL 2HFEB 2ZKHH 5INCA 5A2LH 1AGCA 4WW2B 3V6ZB 3MFFB 3AAZA 4PLNC 4NM4L 2A6JB 3LDBC 2YWYA 2VLRB 2EIEA 4AQ1B 5D2LE 5DRWA 3QHFH 4N0UA 3IDNB 5F1IB 1T22B 1UWXH 3EO1A 1JHTA 1DLFH 1OGTA 3CVHL 4JG1H 4KK5C 5FF6A 1XR9B 3C6LC 3NFPB 2JB6B 2CLZA 2QHRL 2HG5A 3H7LA 3F58H 3D2UA 3OKLB 4HPYL 3WUZA 3ALWA 3CSYA 5GSVA 1TFHA 2HTKD 3W5NA 4FXGA 1M05A 4UQ2A 5CAYB 3R0MA 4DCQB 3JWDC 3D6GA 2RFXA 5EOCJ 4OZFH 1PG7H 2P46B 4U6TA 2AJZB 1T20A 4DKFH 3RVTC 3BIKA 2OJEA 5D8JL 4F33A 1DE4A 5MEQA 1R6VA 3D39A 1X4ZA 4LP4A 1NDGA 3M07A 1MRCH 2J4WL 4ALAH 3MJ8A 3O6LH 3L5XL 4RFNC 5I1IL 4HS8L 2FGZA 2AJUL 4ZUUA 3PHSA 1F3DH 3BO8B 4G9DB 2KH2B 1WGOA 3FQRB 4WI3A 3RWJA 2KUTA 4JKPL 1FGNH 5EO0A 5SWSE 3G08B 1BD2E 1KLUB 3D69B 4WCYH 4WNQB 5HTSA 1PQZB 5EC2B 4Z77B 3QDGA 4NNXA 3GIVB 2F54D 4DKEL 5BVJA 3L7FB 1FNEB 1IM9B 4YHZH 2NXYC 1HIML 1N2RB 1U8HA 2LE9A 4WFGD 1TTUA 1NCDH 5DDHB 5GISL 1ZA3B 4GAYA 4Y19D 1FFOB 4JQIH 5EC1B 3E3QE 3OV6A 5D1QC 4ODHH 3T0BA 2XTJB 2IPTH 5GJSL 4F9LC 3EYFB 3JVGA 4ZUTB 1S9YB 3ZHLA 4XVUC 1KV3A 3OAUH 1K85A 5EUKB 1FNLA 3B6SA 1LK2A 4H8WL 1R3IL 3P0GB 1HOCA 2NCMA 4LHUD 1OTTC 5GRZA 3MLUL 5JW4N 2HA1A 3BH9A 5E8DL 2KDGA 3GMMB 3F5WB 3ULUC 5FCUL 1ED3B 5FECB 4OCMC 4CN4A 3QDJA 1TMCB 1Q8MA 1FQ9C 3A67H 5D5MA 4OM0H 4NQDA 5ILTL 4PJFE 5EO1A 5D7LE 3ZDXE 4P2QE 4U3HA 1WIPA 3I6LE 3V4VL 3FO1B 1E6JH 4ZFZA 5EU6D 5EZLB 3TPUB 3GM0A 2DKSA 5DJZB 3HFMH 4JDVA 2DDQL 3DHJA 3MRNB 3RWCA 1FBIL 4ZUWA 1OAXH 4L4JA 3X11B 3QDME 4J1UB 2OQJB 4XPFH 1DSFL 1S7TB 3DXAE 3GI9L 2Q76A 2DMKA 4UV7L 2VN4A 1AE6L 1K4CB 4Z7OF 1BX2A 2I07B 5GRYA 1U41A 5F7EL 5F96L 2K7PA 2E27L 2NNAB 3WV0A 5BO1L 3MROA 5DQJA 2Z4QA 4BUHA 3VE0B 4OM1L 2X4RA 3VFRB 3OKEB 2N1KA 5FYJU 3T04D 1MHPL 3W0WD 4ODXA 2DWDB 4OLXH 2H1PH 1AKJD 2OTPA 2P48B 1T2JA 4TSCH 4PJIE 5DT1H 4Y2DC 2IPUK 5MI0C 1LE5B 1QBMH 5F9OL 2QADB 2O5YH 1QSEA 5F3HA 1NGWB 1MFDL 1KCRH 2YD2A 1LHZA 1LVEA 4TUKL 1UWGH 4XNUH 1Q1JH 3WD5L 4U7SA 1ZLWK 5IQ9B 2IJ0C 3RBGA 4EKXA 4K71C 4RWYL 4ZFFB 1IM3A 3G6JA 4X6BB 4LARL 5KW9L 1DBJL 2Z31C 3OR6A 2VDMH 2L4OA 1RURH 4BK5A 2BSRA 2WP3O 3K1DA 2CIKB 3NAAH 4L3CA 3OJVC 3WLBA 1A9EB 1BJ1J 4JY5L 4LLMA 4JZJC 4PGEA 1NCAH 1OT2A 5FOBB 1UXSB 2YKLH 1CCZA 3Q3GA 4XP1H 4HS6B 4BUGA 5MP6H 2IBZX 3JUZA 5IB5A 2WUCH 1ZWIB 3R1GH 5HHOA 3DUUB 4LHUG 4DFIA 2LFGA 1KB5B 3O4OB 3ZE2F 4ZQKA 5CZXC 2VXVL 2DLFH 4LSQH 5F1NB 3S3PA 5C0RH 3QNZA 2WIMA 3MV7E 3UJJL 4WTZA 1CU4L 2LAAA 4GUPB 1DFBL 3D18A 5FYJH 4P59L 2YSSA 5DSCA 2IFFL 5F44A 4K3DL 1YMHA 2FBJL 5IB1A 1F4WL 1U95B 3MV9D 3PL6D 1B90A 4GRLB 4AQOA 3IDIB 5EN2A 5GGRB 1RUQL 4JDZA 4I0PD 1MVUB 3DGGA 3FB5B 4EI5D 5TGBB 1DEDA 4E41E 5IHZA 1CFTB 3EZ8A 3EBAA 1JNNL 1D5IL 3ZKND 4HIHB 3AXLA 3O2VH 1XZ0A 4NP4L 3T4YA 1YPZF 2JCCB 4OAWB 3FQTB 2APBA 2DQFB 2NW2B 4ZFOB 4HJJH 5EZIL 1ZLUH 3NCJL 2XQYG 1RJYA 3IU3B 1A64A 2APTA 3QUXB 4LKCB 3VXRB 1A47A 4HX1B 2QQKL 3V8CA 5E7BA 1LK3H 3WHXB 1UACH 1I1YB 2EE9A 5HI4D 4P2OA 4Y4HA 1CT8A 3MLZH 3S5LG 4J7RA 3JV4A 1QR4A 3U6RB 5DFTA 1GJIA 1A7QL 4ODBD 3QUML 3GRWA 4XHJC 4G8GA 5EBWB 4PJGA 1RZIB 3OKMA 1KTDA 1F6FB 4OT1H 2WW8A 5IW6B 4DW2H 4HEME 3OG6B 1N0LA 1T0PB 4JM2C 4EN3C 1U3HB 1KPRB 1PZ5A 2XG4A 4NJ9L 3ULVL 5DJ0A 3DUSB 5TDNB 1YPZB 2Y4SA 3AU1A 1ZVSB 5A3IC 5CBAB 1A2YA 3FL7A 3IFPB 3FFCB 1KIPB 1YQVH 3FN0L 4JFZH 5DUPL 4OLVH 2D4FA 4PJ5D 2X9XA 1AXIB 1NFIA 1NGYA 2AGJL 4PJ9A 1KB9K 1M7IB 1R3JB 1K8IA 3L7EB 5IEHA 3WIHA 4PJ8D 4RQQA 4UU9A 4PJEA 5CSZA 4C54A 4IHOA 2F74A 4KQ3L 3P77A 2NX5D 2EIDA 3AC0A 3O3BA 1A5FL 1NGPH 4R26H 1VFAA 2GSGA 5DVOA 4ODTH 4ONFL 3ZE0E 4PUBL 3QUKB 4Z9KB 1G7LA 2JELL 4MHHG 5DRXB 3GHEL 5KVEH 5I71C 1OP3K 2A6IB 5SWZB 5F6IB 4M7LT 3QQ9D 3TO2A 1I3RA 3S36H 1G7MB 1R24A 3G6DH 4Q6IC 4WJ5B 5D70L 3IAGC 5E94A 5K59F 4YBQC 2JJSC 5GJTH 1X5ZA 1OWRM 3HR6A 2BSTA 2YXMA 1R5WA 4WHDA 4MDJB 5D1ZD 3DUHA 3JWDH 3Q6FB 2MHAB 2X1WL 3OXRA 1E27A 4PFEA 4CDHA 5D6DC 1WIUA 1S9KC 4OCRH 3SDAA 4P23D 1YDPB 2A9MH 4NQSA 5TH2A 3RRQA 3L9RA 4HUWB 3EDFA 4D2NA 2AXGB 1E0OB 1P9MA 4P5TC 5TF1H 3VWKA 1MHHA 1JCKA 4U1LB 1UG9A 3CX5J 3U7YL 3VG9B 4F58H 2BMKB 4CU7A 4WU7B 3V4UL 3ZTNH 2CIIB 4XP9H 1MQKL 2ZCLL 4KK8D 1I1AA 3QIBA 5EOQH 3TT1H 1FH5H 1NEZG 4UIMB 4HWBL 2PYEE 5BJTA 4ZUVB 3LQMA 3QQ4A 1ZLVK 1YN7B 1A6WL 3MRHB 4BFIB 1AD9A 2F53B 1BQSA 3BKCL 1AGFB 2XQYK 4ZOAA 3GSRB 3QI9D 4IRSA 4WO4C 1I3GL 4YHPA 3OKDA 3CMGA 2UWEE 3QULA 3GUTB 1KCUL 2SEBA 1JPGB 2H8PB 3CLFL 1WISA 2DBLL 4Y5XC 4TTGA 4B0MM 3NOIA 4O00A 1J8HB 3KR3L 4OGAD 5IP4A 2X6MA 1QRNE 4X6CE 3B9VA 3VXQA 3W9EA 3O6FB 3HE7D 4TULH 3LKSA 1P7QA 1BZ7A 4XMLL 1GGIH 4FQJH 3P73B 3DSFH 1R3HB 5FO7A 2EIZA 2MNUA 2XWTB 3F7VB 3ULUH 4C56D 1T1YB 1G9MC 1I1CA 4FTVB 1NAMB 4RSVA 3GMPA 4KMLB 3U4AA 2VLKD 1JHKH 4RAVB 4Y5VA 5E8PB 1KIQA 3BP6A 3RY5A 5H2BA 3WN5C 2ENYA 4PLOB 4PJHA 2RR3A 3MLRH 4PRPE 4D8PA 2W59A 4IMKC 2WWKO 4PLKD 2XXMB 2CKBL 4LOUC 1KTRL 1E28A 1N5AA 5I76A 4TVPH 2Q3ZA 2JB5H 4Y4KB 4MWFB 3SKUD 4NQCA 3QA3B 1SJEA 3OKOB 5HGGS 4LPXA 3SDXE 4Y4FB 5FYJE 1W8OA 5J4MA 5D5MF 4N8VG 5B8CB 1BBJB 5KSVA 1MIMH 3I3DA 4ZAKA 5DHVB 5GGSA 2CGRL 5MENA 4KH2A 3KYKH 3OHXB 1QFWH 4MA3B 1I7RA 3HMXL 2DJ4A 1T7VA 3U0WH 3RUGA 2XG5A 4YFLI 2A6KB 2XZZA 4J3XA 4LPYA 4U1HA 4KZDH 5EO9B 5JPNA 3VGEA 3PWVA 5HJ3A 4IDJL 3VD7A 1NMCB 4ELME 3CD4A 3FOMA 1MCFA 5ICXA 2FR4B 3B9AA 3ARWA 4ELKB 4OF5A 3BQUD 2DL2A 4MA7L 5T1DH 5IVNA 4OGYH 1A3LH 1TITA 5HSFA 2O26U 5TE4H 1IEBA 1OB1B 4L29A 2FJFA 3TBVA 1AH1A 4NO3B 1OHQA 4J6RH 3SCMC 1DEEA 5ENWA 3IJYA 3QNXA 1A6AA 5J3HD 2LABA 3I75B 3VXSA 4QO1A 4XNQA 3O3AA 1BEYH 1Z9LA 4ZTOL 2XT1B 5F21B 3HNSL 4QWWC 4K55A 5TQ0L 2GJ6E 1UA6H 3M45A 5HYQB 1NKOA 3WNMA 4BKLA 3HPJA 1XR8A 1XF5A 1IQDA 5J1AB 5FUZL 3DVFA 3PWNB 4NT6B 4NUJB 5DHXB 4OCWH 2R0ZH 4P5KA 5IVOA 1S7VB 4KJPD 3SOBH 1DUZA 2Z9TA 4HXAL 5DJDB 3TJHD 4ZMAT 2BY3A 4JJ5A 1HYSC 3MJ9H 3UAJD 3VU2A 1LO2H 1OARH 3FRUB 3S4SB 1JGUL 3MBXL 4FRWA 2DQEH 3U4BH 4M1GH 5I75B 3LKPB 3GSVA 1T2QH 2VE6A 4P2RA 5KSAB 4MA1C 5TE7L 1I1RA 5H37G 2FX8H 4MB3A 3KXFD 4K3HA 3TEUA 4LLUB 2ESVA 1OSZA 3RVUD 5C0FA 4KK6D 1T89C 4OZHA 3VA6A 3RVVD 5IMMB 3OAZK 2XZQH 2PYFA 1RIHL 4JGUA 4JDTH 1Y0LB 4HKXA 5KANI 4WV1B 4KHXH 4NQEA 1JFQL 3AS0A 4UZGA 1F58H 4LU5H 5JR1H 5B38G 4J4PD 3KYOB 5ISZD 3U0PA 3EYQD 3IKCA 4Q9CA 2CLRB 2AS5M 2P8PB 3S9DB 3BGMA 1SYVB 2ORBH 3QXAA 4NZDA 2NZIA 4I8DA 3CCHB 4K3JH 4LSPL 3QXTA 3U7WH 1CF8H 3KPQA 4M6MH 3U0TA 2R56H 2FX9L 1EHLL 1ODAA 2ADIA 4KY1L 5JHDB 4OLZL 1KTLA 5EU3A 5HYJE 2PXYB 3LN5B 4FQLL 1EGJH 2CRYA 1G84A 2AEQH 5E2UL 1NL0H 1FNAA 5C71A 1D6VL 3V6ZA 3MFFA 5ITBL 5B3JF 2F8XC 4FQIH 3RKDC 5HPMB 2A6JA 1FIGH 2VLRA 3LD8B 3QR2A 2VLMD 5DJYB 4I3RL 1MLBB 3NA9L 5DEZA 1S7QA 5B3NA 2JB6A 5JLZB 4IJ3B 5IBTH 3O11A 2CUHA 1CFNB 3P0VH 5CFHA 4QKXB 4ETQB 1LE9B 3FHAA 1IC4H 4HPOL 3EYUH 1KT2A 3KYNB 5D7KE 2BHUA 3EAKA 3D0LA 5FUOL 2D4DA 1AHWC 2YK1H 2XA8L 1JZ8A 2HTKC 1INDL 1XCQB 2HFGH 2VDKH 5ALCH 3BXNB 3DO7B 3PP4H 4X4MA 5IW1B 3BGAA 3QUYB 3RWEA 1PKQB 3E6FB 2DLIA 5KJRH 3FO0H 1U9KA 3WL9A 2BVYA 4YIQB 1YEJH 2BVUA 3GJEB 3FQRA 3I84A 3VFMB 2NY4B 5CHNA 5IJKA 2R1WB 3UYOD 4FABH 4GXVL 4D0CB 4PJGF 3G08A 5DHYA 3D3VD 2AK4D 1LDPL 4XC3L 1EBPA 4LCCB 5E5UB 4KTDL 1ZS8A 4EDWH 4NZRL 1FNEA 4OV5A 3EJJX 4Z0XB 4IIQC 5C6TH 3DWTA 4MD0B 3QFJB 1AJ7H 4XPAL 5B4MD 4KMTH 2CMRH 5T5NF 2R0KL 5IUSA 4K7PH 5CLWA 1A6ZB 4BZ1H 3PHQB 5HHVH 5FGCB 4HIEA 3H9SB 2I27N 3TBWB 1WBXB 3FQXB 2X9YA 1ND0A 4PRNA 4JRXE 1BFVH 3MV8B 1QEWB 1FZKB 4DUXA 4R8WL 3CLEH 2Y23A 3TO4C 1WZ1H 2EDXA 3V95A 4HCRA 2CPCA 3RI5K 1TLKA 2GTWB 4UNUA 4GG6A 4XWGH 2GUOB 4G6FD 4K7FA 4L3EE 1QLRB 5DEFB 4CVZA 1MOEA 2J3SA 3PHOB 4HWZA 4JPWL 4XGZB 3BGFC 3MODL 4U1KB 5C0CA 1JK8B 1IAKA 3P3YA 4TVPE 1FVEB 3G5XB 3QO0B 2OL3H 2C7UB 5C07B 4PJCE 3VH8G 3SY0B 3DETD 3T77B 3PP3H 1QACA 4YAQB 2C1OB 1KJ3L 3EO0B 4EXKA 3MLYL 4UB0L 1NMAL 1FJ1B 4ONGL 3ZYJA 1RI8A 3VXMD 1H5BB 3MRNA 5BZWB 4Z78B 1A7RH 2R69H 4HC1A 5LXGL 4J1UA 4X7TB 3IDXL 3HC3L 3T0DA 2NY1B 2VR4A 5F7FA 1FG2A 1YECH 5E95B 3NIFE 4JO2H 3S8WA 2VO5A 2QQQA 2L7JA 3HS0A 3T1WA 4OCSH 4U1GB 3TZVA 3VGGA 3PABB 3UJTL 5KG9B 2H6PB 5C0AA 3IAPA 4MD5B 2NNAA 3QG6B 1SM3L 2X05A 1IAIH 4MJID 3LEXB 1KN4H 4EOWL 1MFEH 1HQ4A 5BXFA 2B1HL 1LEIA 1K3ZA 3BAEH 5FK9A 1KELL 5DK0B 3B43A 4I18C 4JKKA 1YEEL 3JV5A 3FCTB 5E7FA 2H32H 3M1BB 3HCVB 1QD0A 5BS0B 4G9FD 4U0RC 1JP5A 1EPFA 5FUCC 1YMMA 1NGWA 4MLSA 1L6ZA 2PW2B 3QWRD 1AGBB 3I50H 5DS8A 1D5MB 4XX1E 1G9MH 4KU1A 3WE6B 2DQUH 1IT9H 3F7PC 5T3XD 2ED9A 1JPSL 4LL9A 1J1OL 5HYSA 4AEHH 1ETZA 5F88B 1P4IL 3QUZC 5LGJB 4OJFL 5ANME 3VMOA 4ZYKB 4JN1L 5JMOC 1O7SA 3ZDZE 1HEZB 3I2CH 1BQLH 4MS8D 2VITB 3ARSA 3CX5K 3MRKB 2JIXD 4L4TB 4YEEA 2Z8SA 4NKOB 3SE4C 5C0BD 2R1XA 1CFVL 3LKQB 2VSCA 5FOBA 3T3PE 1UXSA 2OSLA 1L4IA 1UFUA 1ZSDB 5I30H 3ZYIA 1ZWIA 5IV2B 1SQ2N 1GGTA 1J1PH 1AGEB 2VIRA 2VTFA 1KB5A 4EBQL 1W72L 4RMTA 3BT2L 2FBOJ 2W1NA 4L5FH 4GBXD 1OL0A 2WWMD 1JF1A 3TT3L 4GUPA 3ARGA 4RIRB 1LD9B 2Q7YA 1CICB 3ILQD 1BAFH 1I1FA 1OAUH 5D2LF 4GRLA 1ZAGA 4PB0L 3CDCA 5EA0H 3MXVL 6FABH 1R0AH 1I7ZA 3IDYB 1ZGLM 1FNSH 3S88H 3ZL4H 1Q0YH 1CFTA 1HXMB 2IBZY 4HXBL 4R4BB 4XCYA 5F6HI 4HIHA 3WNKA 3VXPA 2R23A 2J8HA 4I0PC 4ODWA 1BOYA 3GB7A 3SDDD 1RULH 3RGVB 2JCCA 1Z6JT 2DQFA 1EXUB 5L2KE 2NW2A 2YRZA 3E6HA 4ZFOA 5CINH 3SJVD 1HZHH 3ZKNC 3W39B 5IM7A 2YUWA 3G5VA 2OYPA 3OZ9H 3KPRD 1NLBH 3BDYL 5DK3A 3NABH 3RNQA 5IQ7L 1DLHA 3BH8B 2JK5A 5LAXA 3X13A 4XNYH 3WHXA 2IH1A 4DVBA 1AO7D 5CILL 2QQNL 3ZE1E 2HTLD 5D2LB 1FO0L 1L7TL 2Z0BA 2MFNA 4IS6B 2Q8AH 1EH9A 3X3GH 1UB6B 2Q86B 2W07A 3HI6L 3MXWH 1CLCA 4R0LA 5SWQB 5HI4C 1JF6A 4NKQB 5DC9B 3MUZ1 4NZUL 2YRPA 5IW6A 3TIDB 2EC9T 1KPRA 4RISL 4KMQA 1DUYB 5FDWA 3D2UD 4ODVL 4OUUB 5CBAA 3IFPA 5DD6A 4TUOB 1A7OL 3KPTA 1A6UL 3VMNA 1KIPA 2X40A 2BZDA 3KLAA 5CP3H 5DMGD 4APQA 1HILB 3FO2B 3CXDL 5I15H 2NY2B 1R3JA 4ZXBC 4H25B 5E00B 1TJIL 4M62H 5DRNB 1NPUA 5JDSA 1OPGL 1WSST 4G7VH 1YJDC 4UOW0 3LEVL 3D39D 3WO4C 5KZCB 4XCFH 1RZJL 1XF3A 3A6CH 3AMKA 1EEZA 2DQHH 4JRWA 3LEYH 4YX2L 4AMKL 3U7AA 1G7IA 1BD2B 3P4NB 4PJ8C 3S34H 3LQZB 4HGMA 5CGYD 3QUKA 1R3KA 3TLRA 1MWAB 1FVCA 5HI5D 2E7BA 2ICWI 3MGOB 1QSFA 2X4UB 2A6IA 4KROD 5SWZA 3OJDB 4AEFA 5JQHC 4AYFA 1MUJA 1X5JA 4Z7WA 4KV5E 1N0XL 3QDGD 4CAGA 2YWZA 1GC1L 2NY3D 4R7DA 1KIRB 4XRCB 2ENSA 5E4EB 1YNKL 3QQ9C 3UYRH 3SDYL 4QRUB 2X41A 4WFFE 2XWJB 4HUWA 5D1ZC 2HVKB 3VFTA 1MH5B 4U1LA 2RAMA 4Z7UA 4WUUA 1G9NL 4NO5A 4TPRL 2DQCH 5GS1C 2CIIA 3HI1B 3SKOB 3DX6B 3UBXG 4M5ZL 4X6FB 1FFQA 1Q94B 1WCBB 4H0IA 2X4TA 4NO2B 3L3IB 1YYML 1DN0B 1A4KB 4KK8C 4PJFB 3HE6B 5D7LB 1F2QA 3QDJD 4ODUB 4P2QB 3TBSA 4FQQB 4HD9A 4HBCH 2OZ4L 2ITDA 3GSXA 4PJXA 2DLGA 3S98A 4U1IB 4XCEB 4NQDD 4MNGE 4ZODA 5DJXA 1RK0B 3U79A 3QCTH 4WHTB 3QDMB 1MF2H 1X5YA 4D9RD 4LPCA 5FXCH 3DXAB 3V4PH 5D7SH 3FB6B 2BSED 2QKIB 3QSKB 5KVFH 2WV3A 4MDIA 3EYSH 4H1LA 3D5OF 4OZGE 4KDVA 4MNHA 2IMMA 2E5EA 3BYYA 1SEBB 4G5ZH 4JFDA 3ROLA 4OGAC 43C9B 3GBML 2WLZA 1IKNA 1HH9A 3P73A 4X4YA 5C09A 4JJHA 3U1SH 1MREH 1VFBA 3HE7C 2VXUL 2VC2H 4JREB 4KAQL 3AY4A 2HLAA 4U3CA 4PJIB 5E70A 4F15B 3CSGA 2DIBA 3GMQA 5E2TH 1GIGL 5I1CL 2A0LD 1GL4B 4QTIH 5DMIH 4F37F 4GG6F 2DICA 3OGCB 5IKCA 1MY7A 2GT9A 2VR5A 1TZIB 5J6GB 2I9LA 3HRZB 4OZIE 4YUEL 4HAFA 4PG9A 3FT4A 3C6LA 4O58H 1GCFA 4X9HA 5IBLD 3KPPB 4OLEA 2AXFA 4CW1B 3DV6A 3VXTA 4FHBD 4CGTA 3SEPA 1IGTB 4XMPL 2GW5A 4DVRH 3IU4H 3F7YA 4PLKC 1ZLVH 1IL1B 1E4XH 1BBJA 5BQ7B 1P7HL 4MXQD 5F7NC 1MCJA 3V6OA 5IB3A 1TCRA 3OHXA 2MCPL 1J0YA 4ZNEE 2G9HB 4NNPH 2FZ3B 1A1MA 3INUH 2W9EL 4RZCB 2A6KA 2IPKB 1EERB 1H3XA 2AVGA 1K3IA 4PGCB 2R0LH 3MNZB 3ZSTA 2VQUA 5JDJA 1KG0A 3H2WA 4LRIC 4F3FB 4FFZH 2A1WL 4GMSH 4BH7A 5I1DB 2YPLA 2FR4A 3KS0J 2M26A 5J13C 3MYZA 2FH6A 1CXHA 1FE8H 2GJJA 1XGTA 1N64H 2Q8BH 1K6QH 4XI5D 3MV7B 1F42A 5IVXA 4CU8A 5CJOL 5HHOD 2Q20A 2C3VB 2VISB 4UTBL 3QDHA 3SGEH 5T1LA 1CXEA 5IMLB 4N90E 3BQUC 4NUGH 2DF3A 3PXHA 3LPWA 4UT7H 2EH8H 3SN6N 1CK0L 3DBXB 1MJJB 4X80H 2AJYH 2B5IB 4HUVB 1JI1A 1UADC 3E8UH 1KACB 1MCRA 1JWMA 5HYQA 3L3OA 1GGBL 3CFKA 5J3HC 3REVA 1LO4H 3PWNA 1TJHH 4JGJA 4PG2C 5GSRB 3JSSA 3DURB 3WS3B 5FDYA 2JKXA 1K9TA 4R3SB 1AGDA 4P46A 2PTTB 3CIQA 3RPKA 4OZFB 3FRUA 4OCYL 3QEHA 4MAYB 3S4SA 2IAMB 5J06A 3DX8B 3QIWB 3TJHC 3C5JA 3UAJC 4NJAH 3C09C 3SE8H 1U91B 5IGXH 5KSBE 3V79C 4H20H 2E9IA 1FYTE 1YEFH 3GK8L 1Y0LA 1ZEAH 2I9TA 3TCXA 5D72L 2LVEA 4X7SL 3ZE0F 3BESR 3KYOA 4JG0H 1I9EA 4P2OD 4Y4HD 3RVUC 3RVVC 2CLRA 3MMEB 4PGBA 5IG7A 5EPMB 4U6XB 3EFDL 1SYVA 5I1HL 4G8GD 2OTWA 1MHCB 3WFHB 3U9PL 4J4PC 3EYQC 5IVZB 4PJ7A 4Y16B 4M43H 4P0DA 3CFBA 3RWFA 4E42B 3DPBA 3PDGA 3X3FL 5J57B 2OS7A 4GQPH 4NWTL 4QHKJ 5AAWA 2DWEA 4MQ7B 2VZOA 3U83A 3IF1A 3L3GB 4GJTB 3QWOB 1MLBA 2CK0L 2VL5B 4PY8I 3WUWB 3JTTB 5HHNB 3K4AA 1RZKL 1CFNA 1CGVA 4AIXA 1LE9A 4FXLA 1NC4B 3DI2B 5A43C 3C9NB 1LDSA 3RJDA 4EEEA 3KYNA 1EFXA 5GGQL 3N50A 3OWEA 2EXWD 3FKUS 3WLWD 4JGMA 1UM4L 2VERN 4NSKB 2HFTA 1P1ZA 4WI6A 5ACMA 3I6KA 1JZ3A 2WIIB 3BN9D 4EUPB 5FHAH 4WDIB 4AJ0A 1MCCA 3E6FA 2Y36L 3BPOB 5FEBA 1WAAE 3T65A 3U30C 1JBJA 1FAKT 1OTSD 3FONA 5DR5L 5AZEL 3OAZH 1CG9A 2P5WE 2R2BB 4D0CA 4WTZG 3M8OH 1CE1H 2QQLH 1QUNA 4LCYA 3BZDA 5SX5K 1ZVYA 1F11B 2OR9H 4G6ML 5C0ND 3SDAD 3UO1H 4PR5B 4LCCA 4LVEA 4X6CF 1CLYH 1YJDH 3NZ8B 4WFGE 5ADPH 3IYLW 5I1EL 3MRFA 3VWKD 1M1SA 4JZJA 3C5ZB 2PYEB 4NQXA 3ARFB 5DJCB 3BKYH 3MBEC 4NDMB 1ADQL 1I1AD 1J87A 3PHQA 3VFPA 3OMZA 5BVPH 1B4JH 1WBXA 5FGBA 1FL3B 3TH4T 4YDLB 3UROR 5IB4B 1MCIA 3RIAF 1DBBL 1MJUL 3UC0L 4GT7A 1OAZL 4TUJB 1BGXH 1KPUB 1XFPA 2UWEB 2VOTA 2Z8RA 3MA9L 4IOIB 4IRSD 3BE1L 4LASL 5DTFB 2ADJA 4GW5B 2PO6C 1CGWA 3GFUA 4XBGB 2XN9B 2CK2A 3J8F7 4WEBH 1J5OL 5F7YC 4K8RD 1TDQA 1QRNB 1I75A 1SJVA 4XGZA 3VFGL 3SDXF 5EBLB 3QRFM 3MA7B 4U1KA 4U1JA 1UC6A 1HDMA 1T6VN 3RIFF 1FL5A 1W0YT 3L5WB 1FVEA 3L95B 4M6NL 3HZVB 5GS0D 2ZSWB 1G7HB 3CVIL 3EDJA 3JUYA 3SY0A 2FEEI 3T77A 1BJ1H 1Q72L 4OLYH 4NRYA 4OLUH 1QHOA 2VDLL 2C9AA 32C2A 5F9WC 1P7QD 1FJ1A 3QRGH 1MFBH 3PWLB 5BZWA 3SBWC 5TPWH 3DETC 5A40E 3U46B 1CFSA 4ELMF 1YEIL 4KXZH 1JMZA 3FZUD 5IIEA 1YEGH 4PRPB 4Z7UF 4D9LH 4NRXA 4D0BB 4YNYB 4M61A 1A6VH 3M17B 3QEUB 4M7ZB 4BQ6A 3MCLH 8FABB 4LLDB 5F7UA 3QG6A 4ZOBA 4LBEB 2EZ0C 1I9JH 1F97A 3W0WE 5FUCE 3SDXB 4B7LA 2YA2A 3VI4F 5A16B 4KKBC 2ZUQC 3MUHL 1HWHB 4NQCD 1S5IL 3VD4A 2B2XH 5ALBH 4PJXF 1B0RB 3FCTA 1F6AA 5GRUH 5T3ZH 2X42A 3M1BA 1WQVT 4DKAA 3HCVA 3QCUH 4ZAKD 2B1AL 3N1GC 1P4LA 2F8VA 1U8LB 3HUJE 4G8FB 5MEND 1WTGT 4O5LH 1UXWA 5H37H 3QNYB 2ZUWA 3WE6A 4KUZL 1CDYA 3QQ3A 1RVFH 5HY9A 3L3KA 3UDWA 1TNNA 3STZA 2UVFA 4PY7A 5F88A 2J6EH 1FPTH 2XXCB 4S0SD 4G80B 1B6DA 3NA4A 1UT9A 3U4EA 4EVNA 5C0JB 2PR4H 3X17A 3BIBX 1BWMA 4S1SL 4F7EA 3SQOL 2OK0H 4UILL 4NKMB 1C5BL 4PJAE 1KCSH 3C8KA 2VITA 3MRKA 4X5XB 1VKXA 4LEOB 4LSSH 2JJSA 4L4TA 4UQ3A 2GJ6B 4Q58C 1G0YR 5HHQB 1NC2B 3MRPA 2YD7A 3VXSD 4JCMA 3UZQA 4MS8C 5K9OB 1NDMB 1QPPA 5SX4I 3WIFA 2PN5A 2VAJA 1TTGA 3CMOH 1VGKA 1JWSB 4P5TA 4P4KB 1TQCC 1UJ3B 3SGKA 3QAZB 2XKNB 4JFXA 3MJ7B 3LS5L 3QPXH 3MV9E 4BZ2H 3BP7B 1KC5L 2PTVA 3OGOE 1GGCH 4AIOA 1EO8H 2YBRA 3TYFA 4GBXC 2WWMC 3LKRA 1CLOH 2JJTA 1NAML 3AB0C 4HV8B 5LGKA 4F7MB 4P2RD 2HWZH 2CD0A 3ILQC 2EE6A 2ESVD 2P4AB 1TENA 3RA7H 3CVHH 4R4BA 5HVWA 3BVNA 3OX8B 1A9BB 2QHRH 5SV3A 1Q9WA 3H8NA 3GHBL 4KDTA 4NQED 3VD3A 4QNPE 2NY5C 4KI1A 3AREB 2ZZUT 2JJUA 4OB5L 3HR5B 15C8H 3GBNH 1FN4B 4W6YB 2H2SD 4U1NA 4ORZC 4JFYA 3WO3B 1WICA 3SGEI 5HYJB 1G0DA 3SDDC 2ZCKH 1RAMA 1X5KA 3BH8A 1OLLA 3H3KA 3MFGB 1U8OB 4Y8DC 3WJJA 1RUAL 5I1GH 2A2QT 1AY1L 4Q9QH 5ADOL 1C5DB 2HVJB 1CDHA 2ZUTA 3EJZD 4L9DA 2VXQL 1T3FA 2KBGA 3RWGA 3UP1A 1IFHH 3MOAL 3L5XH 1V3LA 4X4ZA 3V5KB 3N9GL 1N3NB 4HS8H 5CLTA 1R3LB 4GAFB 5HHMD 1F3DJ 2Q86A 1GAFL 4V2CB 5A2JH 2VLRD 5SWQA 2X89A 1J7VR 1DQJA 2HTLC 3KGRA 5CD3B 1ACYH 3TIDA 1NJ9B 2UYLA 4RFNB 1DUYA 1XGQA 3VWJB 4C4KT 5CSGA 3RDTC 3VGDA 5I8KL 3QFDA 2DJUA 4TUOA 2E9WA 2J2ZA 5IBUB 3WN5A 1HIMH 1FZMA 1KOAA 4IMKA 2B8OT 1N6QL 4MHHI 5GISH 1ZT7B 4QHMB 3G5ZA 5E00A 3ULUF 5DRNA 5CBEA 4L9LC 3KPLA 3EFFA 4WWKB 4QRQB 2FB4L 3BKJL 5EUOA 5EULV 1BQUA 1J1XL 2NXYB 1DANU 4M5YL 1TETL 2NY7H 2VQTA 3TV3L 3O2WH 3ZTJG 3QCVL 2XI9A 4L1HA 3C5SB 3P4NA 3PE9A 4YR6B 3N1MC 2D7TH 4MYWB 4X8JB 5D1QB 5D9SB 3CFJA 4JANB 4FFVD 4X98A 3OJDA 4E9LA 5CGYC 1DDHA 1MCWW 2X1OA 2V5SA 5HI5C 3MO1A 4YXHL 4WW1B 3B9KB 3TP4A 3OTTA 5KAQG 4KROC 1PSKH 3SGJA 3WDHA 3GNMH 3QXVA 1NCCL 5E2VL 1PX3A 4DTGL 1XCTB 2AV1A 4G6KL 1N5YL 3RL2B 1J05A 3QZWA 4MD4B 3K80A 2X4QB 3OXSB 3UJIH 2WBJB 1NCBL 5IW3A 4WGWB 3PDDA 4JZOB 4FQ2L 1W0VB 4XVSL 2A73A 4BSWA 1G7JB 1DSFH 4L3EB 3RZWA 2FX7H 3MC0A 3SKOA 5FYKL 4UV7H 4LSRH 3DX6A 1CLZL 3P4OB 4X4XA 4FQXA 4QRRB 3LQAL 5IOPB 3GO1L 1VDGA 2A6DB 2V7NB 5F7EH 1DN0A 3F12B 4LF3B 2X1PA 4L4VA 4PJCB 3GMOB 4P2QA 4FQQA 5J6HA 4OM1H 5DD1L 3P30L 5C0CD 1S3KL 2ZSVA 3P4MA 4XCEA 5D71L 1RK0A 1Q9LB 4WI2A 2HLFD 2EXYD 2GITB 1A02N 1T89A 1D9KA 2FO4A 3I02A 5LGHH 5KS9E 3FB6A 1IGJA 3LOWA 4M48L 4DGYH 4LCWA 1MFDH 2FRGP 5HHXL 2GTZB 2KQMA 4TUKH 4F9PA 3WD5H 5DEGA 5CP3A 1HQRB 3HAEH 4Y2DB 1KENH 1GGUA 2BNUB 1WWWX 3ZDZF 4WUKL 1F5WA 4C56E 4LARH 1CTOA 5C0AD 2XZAH 4RNRA 1WWAX 2DMCA 2MQ3A 1QLEL 2BNRB 4Z6AT 4HIJA 2VUYA 3T3PF 1T66D 2Z35A 4K71B 1CXKA 2G60L 3HA0A 4JY5H 5D6CA 5FO9A 4K3GA 4JO1L 5INDB 2BP3A 4JFOB 4X6EA 1NEUA 4NNYB 5ICYB 1EFQA 1SYSA 4DZBA 3WXWL 2R39A 4Z7NF 2ICEA 1YMMD 2A0LC 1IGTA 5JQ6L 3BUTA 4R96A 4FNLL 5TJWK 1IL1A 3W2DH 4BJLA 4Z76A 5ANMB 4P59H 4OQTA 4OCXH 2X09A 1CIDA 4J3SA 2DL9A 3SE9H 4P57B 3EO9H 4Z8FH 4LVNC 4RZCA 4XVTH 3E2HC 1SMAA 3KPSA 4MXQC 4Q7DA 3T1FA 3RPIB 1VA9A 5CP7A 4NKDA 4PGCA 1WC7B 4WENB 4RBPK 12E8L 4K07A 1HKLL 4MSWB 3ZHDA 1XGPA 2OJZL 4M93C 4Z5RB 4XP4H 3PGCB 1HI6A 1CVSC 1HSAB 3O6MH 3IJHB 4LSUL 1FDLL 2C3VA 3NCJH 5ID1B 2R15A 3I9GL 4S1RH 3PWUB 2P8MB 4JM2F 2IADA 3DROB 2VDRL 3ZE1F 4IIQA 4YDVB 5AD0A 4HIXL 4XI5C 3S37L 1WZKA 2AJXH 2W0FB 2E7LA 3V9FA 3B5HA 4F57H 4HUVA 3MYJA 4LVOB 2CR3A 2HJLB 3BEWB 4R4FH 3WNOA 1NAKL 4GRLD 3RU8L 1KLFA 3SQBA 5T3XH 5SV4A 2ZCHH 3BW9B 3MV01 1B2WH 5GSRA 3MV11 4OI9A 3WS3A 5F89B 4MB4A 4Y19A 3O41A 1NBZA 4AL8L 3TO4A 1ACZA 5L8LB 4XCCL 5GRJH 4QRSB 2XWBA 5T1MA 2VLLB 2VZSA 3NFSH 1MSPA 3V5HB 4UT9H 1P69B 5CEZD 3KXFE 3NGBC 2P5EA 1X4YA 4LRNH 2VDNL 3LKOA 2E9BA 4O02H 4ENED 1U8NB 3BZ4A 4JM2B 1RIVL 5ISZE 1T1XA 1BIHA 4ACPA 4PRIE 3DX7B 4UT6L 1BOGB 3MRMA 4HGWB 4FZ8L 3MMEA 4OF7A 4EDXA 4U6XA 1YEDB 2AJVL 4ONFH 4AT6A 3WFHA 5GRWA 1D5ZA 2J5LB 4KV5F 4P2OC 4Y4HC 1UWEH 2X4NB 2JELH 2UUDK 3GHEH 1MCOL