5EBGA

Crystal structure of bovine cd8aa homodimer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD8 alpha chain
publication title The structural basis of chicken, swine and bovine CD8 alpha alpha dimers provides insight into the co-evolution with MHC I in endotherm species.
pubmed doi rcsb
source organism Bos taurus
total genus 19
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ebgA00
4Z8FL 4U0QB 4DQOL 3F58L 4GRWE 4LLAA 3W11D 4GBXC 1QBLL 2P5WD 2XPGB 4PRNA 1EEQA 3QUKB 1MFDH 5IJKC 1IGJB 4TN9A 1PFCA 5IVXE 3HZYA 1FC2D 1AO7B 2HLAB 5JHLH 2ZCLH 2P8PB 5TJWK 3CK0H 4L9DA 3QSKB 3MGOB 2N1KA 3UO1H 1NEZA 1UC6A 4GAYA 4V2BA 5TQ2H 1BBDH 5GGQL 4ZPTB 2JJUA 4N0CD 5DVLA 1T5WB 5FYJU 5HYSA 2D7NA 1AXSB 3ZE0F 3WJJA 1BX2A 3U1SL 1LGVA 1P2CB 3I75A 5B3NA 5HGHB 4IRJB 4YGVA 4WFGE 5IW3A 4KVCH 1ORQB 4Y2DD 4BZ1H 3RHWK 3LEYH 2Z93B 1WAAE 1YUHA 3FCTA 1S7VB 4PTTA 2OSLB 5JW4M 4KUCF 2F19H 4QXUH 5F3HA 3VFOA 3L3IA 4NBZB 4CU8A 3NTCL 3MJ9L 1G6RA 4A6YB 4MD4A 4OM1L 2XN9E 5CEZL 4I4WA 1JZ3A 3MJ7B 4WWID 3DX6B 4QRRE 4BFIB 5DI8A 4JO1L 3WIFB 4OCLC 3QO1A 4YDJA 2EIZB 4HZLB 2AJVH 3ETBF 2DLFH 2K3TA 5GS3A 5EFIA 5JO5A 1WFOA 3BMWA 1IGIL 4GW1A 3CUPB 1YC8A 2QHRL 1QOKA 1YPZE 4WU5A 3O0RH 5D5MB 1KGCE 3L3KA 1EMTH 2KH2B 3C08H 1Z9LA 3NVQA 5K9OA 4Q2ZA 1FBIL 1ZGLM 2H1PH 1C16B 3MOBH 5F9JB 1OARH 5J9PB 5FUCC 3N1GC 2JCCA 3WIIL 4M03A 2P4AB 2DQJL 4NHUB 3EDJA 1KULA 1IILE 2FEDD 1PKOA 2V6HA 3S88H 1E4WH 3PUCA 4U7MA 2IPTH 4YHIA 3AM8C 3SE8L 4GMSL 1EZVY 3MLTA 1OY3B 1NQBA 4MAYC 1FFRA 2JF1A 4JPWH 3WN5C 4PJEE 5EC1A 5F6IB 5JPNA 3GHBH 2ZOLB 1ZGLA 3FT2B 4P57B 5FYKL 3TCXA 4NKDB 4M7LT 3PHOB 3QJHB 3GSXB 3Q5OA 1OF2A 1XF1A 3NCJL 1A6AA 3CVHA 3UPAA 1KCKA 5IESL 1JPFB 1RJYA 3SDCC 3REVB 3ARBB 4LGSB 4XNMB 2BSRB 2JK5A 4CNIB 1V7NL 4NQDD 3F6LA 1KEMH 4R7NA 3EFDH 4DN4L 1P4IL 1RZIB 1OAQH 3F8UB 4PB0H 2EH8L 3ULUH 3ARDA 1FN4A 1KJMA 3A0OA 2ZUQB 4GAGL 4H26B 2OL3B 3MRRA 1CZ8L 4LL9A 1H3WM 4LCIL 3X12A 2EDJA 1HHHA 3ILQD 3QI9A 5DS8A 3P77A 5JW5A 4L5FL 3UTZB 2JJSC 4Y19D 3TFKD 1KNOB 4LLYB 2Y5EA 1YEEH 3K1DA 3WFHB 1OP3K 2WQRA 4MCZB 2DQHL 2XZQL 3BZEB 2XPGA 4O9HH 3QUKA 5LG1A 1A7PL 3HC4H 1IGJA 5EOCH 4PG2A 4PJBE 1AO7A 2VXUL 2HLAA 3NZHL 5CP7A 3QDMD 2NR6D 4MQXC 2P8PA 5C0IB 3DMMD 3CFKB 1BWWA 3V2AR 5GISL 5IBTL 3MGOA 4ZS7H 1HQRB 2J8UE 2NXZB 4JJHA 5EBMB 4LPTA 4ZPTA 2NY7H 1GHFL 4KMQA 3ZYZA 3UYPA 4M6OL 2B4CC 2G60L 3PHSA 1KB9J 1IGMH 1T5WA 1T04B 4X6CB 1AXSA 5C0EB 2C3VB 3OR7B 4UAOC 3F7QA 3ALWA 5HGHA 4XAKE 1ORQA 3ZDYF 2P5EE 4U2YA 2WANA 2Z93A 3BO8B 2P48B 1KN2H 3E0GA 1S7VA 1UM6H 2OSLA 4P5MB 2GJ6D 2I27N 2JIXD 3RDTC 5FUZL 1JNLH 4LEOB 4X6DE 4A6YA 3CLEL 3CU7A 3SGKC 1KJVB 3OKEB 4P2RD 1V3KA 1T20B 1QSED 2NPLX 3MJ7A 3DX6A 2W65B 2KKQA 1LVEA 4BFIA 2NXYC 2EIZA 4HZLA 2X4SB 4XB7A 4RFNC 5IGXL 4P9HC 2BJML 5D5MA 5A43C 2HMID 3VFRB 4PFEA 1FAIL 1PBYA 3T65B 3IAGC 4JREC 4X9IA 1C16A 5F9JA 1CXHA 5J9PA 3OF6A 5KVEH 4U3CA 4RAHA 4QEGA 3C8KB 4NHUA 5FUOH 3RWDB 1TVDA 3EZJB 2Q8BH 2XA8H 4RDQF 1CGVA 4X6EB 3BGFB 3D3VE 3ZDXE 1M1SA 1NSNH 2YN3A 4JQXC 2YUXA 4HS6B 2ZOLA 3FT2A 4P57A 1K8DB 3SCMD 3SKMB 3IFNH 4GRWH 2IMNA 4MMXC 2VXTL 4NKDA 3PHOA 3QJHA 2R2HB 3GSXA 4ZDHB 3TBYB 3GMNB 5CZXD 1IAKB 5F6HJ 5HDQH 2YC1B 3WJJC 2H2PD 1CXLA 1JPFA 1M05B 2J4WH 2GT9B 5DTFB 5JQ6L 3REVA 3ARBA 3GSRB 2BSRA 4XNMA 4TNWK 4EOWH 4CNIA 2R29L 4OFPA 4KJPC 1K8IB 4MDIB 4PLJD 2WQ8A 4WW1B 2C3XA 3MRKA 2AGJH 2F54B 1ZOXA 4HULB 2Y07H 3HZMB 1CL7I 3BPLB 4BQBA 1RZIA 1JGUH 3AAZB 3P73B 2A0LC 2ATKB 4PGZA 4H26A 3HKFA 2OL3A 5IHLB 3P0YL 1AR1D 4JM2F 5C07E 2EZ0C 3KJ6H 1ADQH 3Q2CA 4LVEA 5AWNH 5JIKA 2H32H 3UTZA 4FP8L 5CEZE 4K94H 4HGKC 1KT2B 1KNOA 4LLYA 2AJYH 3QFDB 5F96H 2OMBA 3VXUB 5CFHA 5CEYB 3WFHA 5C0CD 5JXAL 4MCZA 4KUZH 5E08L 3BZEA 1IAOB 4ZS6C 2D03L 5HHNB 1JWSB 1WK0A 4U3HA 1BGXH 5TE4L 1E6JH 3R06B 4NM4L 5IG7B 5C0IA 4PJDF 3CFKA 2XT1B 1AP2B 5K33A 4Z5RB 1XF4A 5F7LB 2WZPD 1LO4H 1X7QB 2VXSH 3PGFH 4JANB 2VTFA 4FQ2L 5EBMA 2F53E 5HYFA 1T04A 4X6CA 5C0EA 4OQTL 2C3VA 3OR7A 4P46C 4WEMB 1T5XB 5C6WH 1X9QA 5F1SA 5TQ0H 3QQNA 1CDIA 2VKWA 3U7YL 2BZDA 3MRNB 3BO8A 4YJZL 3MJGX 2FO1A 4LVHC 4WO4D 3QUML 1TZIB 4P5MA 5TE7H 1D6VL 5GZOC 3NACL 3KNBB 5FFLA 4LEOA 1TTUA 3OKEA 5IQ9B 4LOUD 1EHLL 2W65A 32C2B 1A14L 4Y2DB 1IC5L 3QIWC 2DYPD 3V6ZB 3ARDC 2X4SA 4LF3B 1SM3L 1QSFB 2IANE 3BRFA 3AXLB 3QI9C 3UTTD 2H9GB 4CMMB 4NQCB 2YEZB 1MCSA 3VFRA 4R6UA 4Y4KD 4U6VL 3O6LH 1DVFB 3T65A 2R2CA 5BZWB 1YNLH 5D2NE 1RUAH 3C8KA 1RUQH 3VI4F 3RWDA 4LMQE 4S1QL 4U1LB 1KCRH 3OJ2C 2GK0B 1C12B 4PG2C 5FDYA 5FGCE 4X6EA 2IFGA 1FFPB 2VDKH 4XVSL 4YH6A 5F7YC 4MNGE 2J3SA 4EBQH 3DWTA 4HS6A 5DJAA 4K3GA 2F5AL 4LQ1A 1A6ZB 5K9JH 4JHAL 1K8DA 2O5XH 3SKMA 1B0WA 1JNJA 2R2HA 4ZDHA 3WNKA 3TBYA 3NABH 3GMNA 5BRZB 1IAKA 2YC1A 1I3VA 2Z91B 3SO3B 1M05A 1T80A 4IRJC 5DTFA 3A6CL 1PGRB 1WICA 1I1AA 3GSRA 3V8OA 1K8IA 4MDIA 4H88H 1R3HB 2F54A 2P24B 3IS0X 2EEBA 3HZMA 2ZKHH 3QRGL 4GLRI 3AAZA 3P73A 3U9PL 1NBVL 3J7HA 3H9HB 2ATKA 1N64L 5DA4A 3WIHA 1JJUA 1UWEH 2YHGA 3X3FH 3W82A 4HWEH 5AAMA 3H3KA 4MNQB 1A6WH 5HD8D 5I1EL 1KT2A 1OOAA 4XHQA 4BUGA 3QFDA 3VCLB 5LCVH 3VXUA 3CFCH 4GXVH 2Y9RT 2HT3D 4Y16B 4JRWA 2Q3AA 3T4YB 4ZTPL 3VD9A 1MEXL 4K3EL 3LIZH 1HK6A 4DKEL 4CAGA 1IAOA 1FGVL 4G80B 1JWSA 5HHNA 2J2ZA 3L6FB 3ULVD 4I9WE 1JN6B 5DFTA 3R06A 5IG7A 5MEOB 1L6XA 1T1ZB 2VQUA 5DEGB 1AP2A 3SDXE 2NQCA 3LSOB 4Z5RA 4KUCD 5DD5L 1X7QA 5DJZB 1U58A 4JANA 3PP4H 3TBWB 1DN2A 1JI2A 5F6IC 5J11B 4HWBH 4IDLA 1NC4B 1IEHA 3IVKA 3CVHL 1T5XA 3W5MA 3LMJL 1DANU 4MSWB 5BS0B 2H2SD 4I18B 3S9DB 4GAJL 4Z8FH 3F58H 3VXRD 1INEL 2E7BA 2XYCA 1TZIA 3BD5A 5C09D 1KG0A 1QBLH 3ARBC 5SWSB 1D5MB 4IJ3C 4OFDA 3KNBA 4HC1A 4NQED 4PJFB 3TIDA 3O2DL 2F15A 3QH3B 1ZEAL 5IQ9A 3UDWA 4MS8C 1DQJB 32C2A 1KACB 3VDCA 4TSBL 1OAXL 3IXTB 3V6ZA 4LF3A 2DRUA 2ZUQC 1H15B 1QSFA 3T3MF 4Y4FD 4U33A 5GGQH 2ZCKH 3AXLA 4KK6C 4OZFB 2H9GA 4YK4B 4CMMA 2P49B 2YEZA 4NQCA 3UTPE 1MH5B 3G04B 4MHHG 2P47B 2VSCA 1DVFA 5CLWA 3M1BA 4FQPA 5JW4R 5E9DD 5BZWA 3HG1E 2R2BA 3QEHA 4WHDA 3QO0B 4BZ2L 1K6QH 5JDSB 3B8SA 5C0AA 4U1LA 1FNGB 2CD0A 2GK0A 2VH5L 3EGSB 1C12A 3S3JA 2AKRB 3NTCH 2BNRB 5B3JF 1Z6JT 1EPFA 4OM1H 1DUZB 2OI9C 1A6ZA 4JO1H 2CKBH 2NXZC 5C3TA 3MLRL 5DD0H 1H5BB 3QHZL 3VH8G 1IGIH 5HDLA 3UZQA 4L3ED 5EU6B 2QHRH 1OW0A 5BRZA 2VISB 2R1XB 4L4TB 2NY1B 3GKWL 1S7TB 1HKLL 2Z91A 1N5YL 5FYLL 3EOAA 1CDBA 3IFLH 3MFGB 3LS5L 2Q86A 1J9CT 5JA9A 1FBIH 3DOSA 4M9PA 1GPOL 1AGBB 2P24A 4U0RB 4EVNB 2V17L 4LHUB 4NHCL 5D93B 3QP3A 1KN4L 1Q0XL 3H9HA 4X4XB 4GMSH 4RRPA 4LLQB 4LSPH 1WCBB 4X7SL 3FKUS 1AGDB 4PGCB 1ZLWH 5BCAA 2YR3A 2DBLL 4MNQA 5FYKH 1DTUA 5C2BL 2K7PA 4UUJB 5FYJL 4Y16A 5J06A 3U9UB 5DEZA 3NCJH 3T4YA 3ROLB 1NEUA 4NZRH 5IESH 3QIBA 2X09A 2BHYA 3HAEB 3O3DB 3SEPA 1KIUA 4G80A 5DJ8B 3L6FA 4WTZA 3OJMB 1GXEA 4ZOCA 1JN6A 1V7NH 3PDOB 5MEOA 4MLIA 1T1ZA 1AGEB 2A9ML 4JAMB 5DEGA 1GGCL 1K85A 3LSOA 1GJIA 4F7PB 3BGFC 5DJZA 1ZA3B 2YSSB 5FM5O 3TBWA 1CZ8H 1Q1JH 2HYMA 4HGWB 3GI9L 1NC4A 5GGSA 4NGHL 4U7SA 5ALCL 4MD0B 4L5FH 4MSWA 1IM3B 5BS0A 2HFFB 4I18A 2VDQH 1RVFL 4HX1B 4Z77B 3MUJA 2R0KL 3KXFB 3I85A 2NYYC 5HYEA 5SWSA 2DQHH 4OTXH 1D5MA 2XZQH 4PJFA 3GJFK 3QH3A 4O2CB 2HTLD 4DK3A 4ONGL 1OQXA 2VXQL 3IETA 4UOJA 3NZHH 2VXUH 3R1GL 2CJUL 4Y4HD 4WTWA 1DQJA 3BPLC 1N3NB 2PKDA 1MNUL 5I19H 4FRWA 3IXTA 5IBTH 3FHAA 5I1CL 1VSCA 1QKZH 1DP0A 1GHFH 1B0GB 4OZFA 1WGOA 4M6OH 2G60H 2XNAB 1MH5A 1NBQA 3G04A 1HWGB 3ARSA 1M6OB 1FL3A 3T8XB 3MBED 1NANH 2V9RA 3TZVB 3QO0A 3FT4B 4HMCA 4KAQL 4LKCA 1I8LA 2YUZA 1MY5A 4IRSB 5MERB 5FHBH 5JDSA 3VI3F 5D7LD 1FNGA 2EH7L 3EGSA 3ZKQD 2AKRA 2BNRA 2NTSP 3BZ4B 5FUZH 1KPUB 3CLEH 3OL2A 5KZCD 4G8GB 1DUZA 4YZFF 3RA7L 2B0SH 3IJYB 1LNUB 3W11C 3RWCB 1H5BA 4M7ZC 3ISWA 5EU6A 4L4VE 2VISA 5EZOL 2R1XA 2BJMH 1MCOL 2HG5B 2PCPB 4L4TA 1S7TA 2QQNL 4X6FB 2GKIA 2XG4A 4KRPD 1FAIH 1MRFH 5E56A 3OG6B 4I1NB 1JYXA 4U6YB 4UB0L 4YR6B 5JOFB 3RY4A 2IEPA 1AGBA 4EVNA 4LHUA 3FOLB 3CX5J 1RZKL 1H3PL 4X4XA 3DXAB 5ISZB 3UDWC 1WCBA 5MP6H 3CFDB 3JWOC 4JHBA 4GMTL 3GI8L 1AGDA 2YMXL 3UJTL 4Y2DC 4Q9BA 4QXGL 3C60B 4NYLA 3RX5A 3BGAA 1BFOB 4ZQKB 1KLGB 4ZAKD 5HHMB 1IGFL 3U9UA 3EYOB 3ROLA 1DVFC 3PL6D 3HAEA 3O3DA 1JPSL 5JQ6H 4XPHL 4F58L 2R29H 1X4XA 2D9CA 3PDOA 3S36L 3B4NA 3MLXH 1AGEA 4JAMA 3ET9F 3VXMB 4ELME 3B83A 2SEBB 4F7PA 3DTXB 1JWUB 4HV8B 2FWOB 1ZA3A 2YSSA 1IGCL 1OAYH 3MNVB 5ADPL 4HGWA 2BNQE 4D9QE 1GGBH 5I1AB 1RHHB 3QA3B 5ADOL 4MD0A 2ZSWB 3DROA 1MFCL 1IM3A 4FP8H 4IMLB 3JWDC 4MXVF 2HFFA 5FGBA 2ERJB 1OW0C 1F02I 5JW3L 3QEGL 4HX1A 4Z77A 4LIQL 3SO3C 4KHXL 1CQKA 1S78C 3KXFA 4G9FB 4AZ8A 5IB4B 4CDHA 1DJSA 2DLTA 3VXSD 4HKJA 1LQSR 1P7QD 4O2CA 3V7MA 3B9KD 4QXTB 4GXUN 2MHAA 1UXSB 5E8NA 3WIHL 4H8WL 5F44A 5TE4H 4IHOB 5FM5M 1N3NA 4NM4H 2L7UA 4MB3A 4HT1L 2B4CH 4KKAD 4PRDB 5CJQL 3I6LD 1BJ1H 4FQ2H 3SDAB 1B0GA 2GY5A 1OAZL 1H0DB 1FYTB 1QLEH 2XNAA 3AUVA 4NOFA 5K9QI 1AKJB 1Q72L 1M6OA 4OQTH 2KUTA 3T8XA 4YC2C 3ARFD 2V2XB 3TZVA 4UV4L 3QJFA 4Y16C 3IKKA 4Z18A 3FT4A 1UJTA 4WHYG 3HCVB 2V5TA 4IRSA 5MERA 1N26A 3WNLA 3QUMH 3ULUF 1D6VH 4LLDB 3BPOB 3KS0H 4CVUA 1AE6L 4F3FB 1WIPA 3BZ4A 5AZ2L 1KPUA 2PYFB 4OCWH 4G8GA 1EHLH 1E27B 1V7ML 2R15A 3IJYA 3TBVB 1T03L 1LNUA 4PRHA 2AW2A 3O41B 3RWCA 5HBBA 5KANG 1SM3H 5JOPE 1IKNA 2YBRB 5J11C 3FFDB 3PXHA 2HG5A 2PCPA 4PJXF 4X6FA 3RVTC 3BZFB 3LAFA 2UZIL 5CZKA 4XC1L 5C08A 4YHML 4I18C 4HC1L 5D2LB 4U6YA 1ZKAA 4YR6A 3EYSL 3CDGA 3FQRB 3MLWL 4YEFA 5DMGD 4XNYL 2I26N 2VLJD 4HAGA 4EQ2A 3VU2A 1DL7L 3MLSL 5IT2L 3FOLA 4S1QH 5EBLB 1IL1B 1DBKL 4FFVD 3DXAA 5ISZA 2HWZH 3CFDA 4QRSB 1NAMB 1C7SA 4JFDD 2CMRL 4J2XA 3ZYIA 5E6YA 4PJHF 4J3WA 3X13B 1OCWL 4C58B 2HA1A 5DJDA 5A3IC 3C60A 4WI2A 1P84K 4HFWB 4M1CD 3THMH 4WCYH 2DQIL 4YK4C 4ZQKA 1KLUB 1KLGA 4OCSL 5DQ9B 3EYOA 1KC5L 4WFEE 1YJDC 4WUUB 4TUOB 1RK0B 4U05A 3L5XL 4HGMA 4D0DB 3A6CH 2XXMB 5A1AA 4W4OA 3LQAL 5ID1B 2WP3T 2UYLB 1I8LC 3EJZD 2BX5A 3DSFL 4V1DD 5T3ZH 1MQKL 3VXMA 3KPSB 4XCEB 2SEBA 3QRGH 3ARUA 3DTXA 1JWUA 1NBVH 2HMIC 4XXDA 2OM5A 3OR6B 1N64H 5EIVA 5DZLA 5GRVL 3M8OH 5C0BB 4BQ8A 3QWRD 2LTQB 4Y5VB 1F3JB 3MNVA 3TCLB 4Q74A 5I1AA 1RHHA 2AK4B 3NIDE 3QA3A 5ANME 5CWSB 2ZSWA 2OZ4A 1H5BC 2CR6A 4IMLA 5I1EH 4X4YB 1VEOA 1YMME 4M6AA 1GVIA 4OFIA 4G9FA 2IBGA 5IB4A 2EEDA 4ZTPH 1BREA 2OTWB 3DRTB 3HI5L 3DX8B 4DKEH 7FABL 4QXTA 5KG9B 4P2OD 1UXSA 5ALBL 4U0RC 5E8OB 5BQ7B 4OLZL 4ZNCD 1OLZA 4IHOA 4FTVD 2DQGL 3VG9B 2IG2H 4S1DD 1J8HD 2HKFL 3GJFB 4GRWF 2AJZB 1YECH 3HC3L 2GIYA 4PRDA 2H2PC 5DD5H 3MJ8B 4M62L 3SDAA 1TTFA 3T2NH 1H0DA 1FYTA 2DLIA 1AKJA 4HZAA 4GH7B 4Y1AB 1D3CA 4PLJC 3CVHH 4ODBD 2FBJL 3UXFA 2DWEB 4GKZB 4E41E 4ODWB 5GSRB 4Y4HB 2V2XA 3DETD 4NKMA 1NMBL 1QR1A 4JFZL 1DUYB 3HCVA 3QDGE 3VRJB 1INEH 1AR1C 2NX5D 4LLDA 2DWDB 2CRIA 2IH3B 3CH1B 4F3FA 1NGXB 5LXGL 1OGTB 1ZEAH 1LHZA 1T21B 2PYFA 3IFOB 1E27A 1KTDB 3TBVA 1WAAF 4HXAL 5IUSA 1OAXH 3QDJB 3O41A 3WSQH 3C2AL 3AGVA 3TA3D 2YBRA 4OCMC 3LKNB 1MFNA 3IRPX 2HP4A 4RFOH 1SVCP 2GEEA 1KYOJ 2EDRA 5FIEA 1K5NB 4P3CL 3BZFA 4L3AA 1QD0A 4M6ML 3D48R 4PR5B 3TLRA 4M93B 4NZUH 5D2LA 5FGBC 2RR3A 4KI5F 4LGPB 3RZWA 3BE1H 3S35X 3FQRA 4G8EB 1U8IB 4B0MM 1U3YA 4BZ2H 1YQVH 4NO2B 1YPZF 1R0AH 5EBLA 1IL1A 2UV3A 4MVBD 1OGAB 1GAFL 5I30L 5HHOE 4LIQE 5I9QB 4S0TD 3KYAA 2FHBA 1D9KB 2QQQA 4QRSA 5KOMC 1NAMA 4JM2B 2AEQL 1G0XA 1RULL 2ICCA 3IDJA 3X13A 1CICB 2ADFL 3QDAA 1OP5K 3GUTB 3OXRB 4JFQB 5HPOA 5C6PB 3WJLA 4HFWA 4KDTA 2FECI 3QHZH 1KLUA 5DQ9A 3TYGL 4Q97A 5ABDE 2QQKL 4P4KD 3GKWH 1BP3B 4PJEF 4WUUA 1HKLH 1PEWA 2PYEE 5FYLH 3MOAL 3BUTA 5I75B 1WISA 3LS5H 4FQ1H 1FFOB 4D0DA 3TZVC 2EECA 5ID1A 5J3HC 2UYLA 1GPOH 3RKDD 1BJMA 4IRSC 4POZC 1XCQB 2A38A 2V17H 4NHCH 2Q20A 3ZTJG 3KPSA 4XCEA 1KN4H 1FNHA 4GXUM 4IDJH 4K55A 5CJXA 2HRLA 1Q0XH 5DJ6B 3OR6A 4X98B 5C0BA 2DTML 4P23B 4OGXL 1RZ8B 1F3JA 4Y5VA 1TTGA 5ERWB 4RGMB 1VB9A 3CIQA 2AK4A 3JZ7A 2DBLH 4X80L 5CWSA 3SQOL 1T3FB 1N4XL 1U8QB 1UZ8B 1IKNC 4X4YA 3OAYH 4G43B 1DE4B 2ID5A 2D0FA 5FYJH 1WIUA 5IMKA 1MFAH 4JVPA 4LKXB 4JY5L 3TNNB 1S3KH 3IYLW 3DX8A 1HNFA 4EUPB 1MFBH 4RX4A 3TGXA 1INDL 5LBSL 4DUVA 2XTJD 1FIGL 5KG9A 4F7TB 1I9IL 5BQ7A 1U9KA 4HDIB 4Z7VF 4IOFC 3F7RA 3GJFA 5DD1L 2AJZA 1PW3A 5TDOB 1R3JB 2X89D 1QYGH 1FDLL 4X4ZA 2ESVB 4FFWC 3GI9H 3UCRA 3LVEA 4TQEL 4Y1AA 4I8DA 4CVWA 4NGHH 3C60C 2DWEA 3HI6H 4GKZA 5EO0B 3DYOA 1ITBB 1QLFA 2V9QA 4ODWA 5ALCH 5GSRA 2AQ1A 3VXPB 2EXYC 4P5KB 5IBUG 1ITCA 5D1XD 1I3GH 2J8UF 2YWYA 1DUYA 1H8SA 1V05A 1C5BL 1QVOB 2Z8WC 5SX5K 5MENE 1T66C 1MJ8L 4PRIB 4PG9B 1A4JB 1S5HB 3EDDA 2IH3A 3HA0A 3CH1A 5SX4I 4W4OC 1NGXA 4HKBB 1OGTA 3V0VB 5DLML 4NN6B 1YDPB 3KJ4B 4OD3L 4ONGH 1FH5L 2FSEB 2Z92B 2OL3H 2Y4SA 3R1GH 3IFOA 4L9LB 5C0AE 3T0DA 1KTDA 1MNUH 4KJWD 4LBEA 4OLUH 2HT3C 2WBJD 3X3GL 2V9TA 3HFML 4NC2B 3LKNA 4OB5H 1RUPL 2PR4H 5IKCB 5DZNA 1EHNA 2R56L 5F70A 3L7EB 3FQTB 5IQ7L 4M5ZL 1K5NA 5A2JH 1K2DB 4QRPE 5C71A 3RPIB 4PR5A 3RZCD 2FH6A 2ERJC 4G8EA 1FO0L 1U8IA 3LD8B 1CFBA 1A7QH 1NCCH 1YNKL 4NO2A 1S9YB 3D25B 1CLZL 4NQUA 1OGAA 5JHDE 5IMOB 1OTUC 1FLTX 5CIPB 1Z0NA 3DARA 1D9KA 2AXJA 3BMVA 1KXVC 4MX7B 4JM2A 1UB6B 1A1OB 1IKFL 4NO0D 4N0RA 3ARVA 3CU1A 4U31A 4HCRA 1I8MB 3K0WA 1CICA 3BAEL 3LKOB 3OXRA 4JFQA 4RWHA 3WUWB 3RWIB 2ORBL 4ZFZB 4LRNL 3DIFB 1U3HB 3K8KA 5HI5D 3SDAC 4JPVH 2YZ1A 2R8SL 3UTSB 4MNQE 3ZDXF 5EZOH 1CGSL 4Y2OA 1MCOH 5EUOE 4M8VA 3E3QE 1FFOA 3FFCD 3WNOA 1CF8L 3RX7A 4CVXB 5K59E 4OCXL 2QADD 1XCQA 3UZEA 5E5RB 4TNVF 3QUXD 4N0UB 1BFVL 3BPOC 1ZLSH 1OSPH 5EOTA 5F1IB 4X83A 4XVJH 1FFQA 5ILTL 4I5BB 1RZKH 3RGVD 5DJ6A 3V95A 3BQUD 4X98A 5DT1L 4P23A 5GRWA 1IAIM 1CL7L 3U4AA 3GI8H 4OUUB 5KSUA 1P6FA 1T7WA 2Y23A 3KPRD 1QP1A 2KL6A 1U8QA 1UZ8A 4HSQA 3RVXD 4ZPVB 4QXGH 4G43A 1UGNA 4UIKL 4QOKB 1IGFH 2YUWA 4YBQC 2B1AL 4LKXA 1X5AA 3TNNA 2EXWC 3BKCL 4EUPA 4O5LH 1HI6B 4ZD3L 1C1EL 5JQHC 2IPKA 1CE6B 2GITB 4F58H 5E7BA 3DO7B 3F7VB 1ZANL 3S36H 3T0EB 1VFOA 5DK3A 3DHJA 3MRIB 2WNGA 3S5LG 1ZHKB 4WWKA 1YNTB 5TDOA 3VXNB 4NNPL 8CGTA 1R3JA 5F9OL 4J3UA 3TH3T 3ULUD 3KLAB 1UVQB 2CO7B 3U2SB 2ESVA 3N1FC 4ZOEA 1RURL 2YPLD 4P2OB 3WJLC 2CKNA 4LSTL 5EO0A 3VXPA 4KDTC 2AJSL 1MFCH 2EYRB 4P5KA 3RX8A 5F97E 1B3JA 3DV4B 4FFYH 3ARZA 5DJCB 1W8OA 1EUTA 5JW3H 3QEGH 1RV6X 1CLYH 1JPST 3GFUA 4KHXH 2E27H 5HPMA 1N0LA 4PG9A 4PRIA 1A4JA 1KCVL 1MIML 1S5HA 5EBGA 4UQ3B 2VO5A 4HKBA 3ECBB 3V0VA 4ZFFB 1YDPA 3I84A 2X7LB 2FSEA 2Z92A 3WIHH 4L9LA 4LCUB 2A6JB 2D4DA 2DQDH 2HH0H 3VG0H 4DK6A 2FGWL 5CJXC 4H20L 4JPKL 2LTQC 4Y5VC 5CJQH 1J7VR 5IKCA 3EYQD 4YHLL 1YN7B 4G3YL 4C54A 8FABB 3L7EA 3FQTA 4ENED 1K2DA 2VDRL 3O2WL 5D8JH 3RPIA 5I76B 3O6KH 2OXHA 1T0MA 3G6DH 3HB3D 1O7VA 2FO4A 4KTEL 3OKOB 1N5AB 3IGAB 3V5KB 1BD2D 3O4LE 5GGSY 5DHVH 4QYOB 2VL4A 5DZOA 1S9YA 2RCSL 3D25A 5DK0B 3WDHA 2FEEI 5IMOA 5C0FB 4H0GA 5CIPA 5ITBL 4MX7A 4LVNC 5JOEA 1UB6A 5F1NB 4ACPA 3VG9C 3P2TA 3SJVE 4RGOL 4GG6B 1G1YA 1UEYA 4EXPX 5F7FA 1OD9A 2QEJA 1I8MA 3HE7B 1V7MH 5T5NG 3LKOA 3WFDL 5T5FL 1T03H 3WUWA 3RWIA 2E3VA 1AH1A 4ZFZA 3DIFA 1U3HA 4LHQB 4KGJA 3HUJB 3UTSA 5CGYC 2HTLC 3RJDA 3MQIA 5GJTH 4TULL 4KJQD 1ZT7B 4Y4HC 2LABA 4UNUA 5DD6B 3FRUB 4CVXA 2Z8SA 4HC1H 4XNXH 1RPQA 4I0CC 3EYSH 3MLWH 4W4NA 2E9JA 4IS6B 1FV1A 1KIRB 4N0UA 3PWNB 3JWOH 1DL7H 5IT2H 2DI8A 5EDXA 2O5ZL 1DBKH 3PABB 2GJJA 4I5BA 4MJID 5E94B 4F7EB 3I6KB 3P40A 5I71B 3O3BB 1ZV5A 4OUUA 4P5TB 4DOHE 4J1UB 4JG1H 3ZT6A 5F88B 1UJ3A 4ZPVA 5CS7A 1NDGB 1L4IA 5IBLC 3NIGF 3P30L 2VITB 4QOKA 4KMTL 4OCSH 1JHLL 1J0JA 1FCCA 3GKZA 3ILPB 3QUZB 4LARL 4S10A 2W59A 2IH1B 2JLLA 4M93C 1FZMB 1U36A 4YHKL 5DMJB 3OB8A 1PG7X 1CE6A 3DI2B 2GITA 3LQAH 4PJIF 1WFNA 1NAML 3F7VA 3HPJB 1VERA 3T0EA 1JI1A 3DSFH 5I1HH 3MRIA 1C5DB 1MQKH 4FZ8L 1ZHKA 1YNTA 4A2MA 3VXNA 3KG5A 4DCQB 1OPGL 5CCKL 4X9BA 1D9KC 5D6DA 4JM2C 2J6EA 3NCEB 3M17B 4DZBA 5EZLB 3U2SA 3IF1B 1CS6A 1FNAA 1Q38A 5FOBB 4NZTL 2V7NB 2PO6D 3V5DB 3PDGA 3S97C 4G7VL 2EYRA 3SDXF 3WEXB 1URLA 1WV7T 3EDKA 5I75C 2ZNXA 4F7MB 4UQ3A 3R0MA 5F6HI 3ECBA 2VE6B 7FABH 5EOQL 1A5FL 4FQXA 4Q7DA 2X7LA 5KVDL 2I07B 5ALBH 5HI3D 2G5BB 3REWB 4LCUA 3KLHD 4KI5D 1RIVL 2A6JA 4OLZH 2DQGH 4CJ1A 1UM5H 4P9ML 1IC4H 1I1YB 2HKFH 1CR9L 5JIHA 4TRPL 5D1XB 4P23C 3HC3H 1I9JH 1WWAX 4M62H 4RGMC 1YN7A 4FA8A 1C08B 4FABL 2DM3A 2HT2D 4PRHE 5I76A 3ZLQC 3D87B 1X4ZA 2R9HC 3L5IA 4WUKL 1A4KB 1DLHB 2FBJH 1BQHB 5EU7C 4N5ED 3H9SD 2ZWLT 1J05B 5CJOL 1FNFA 1N5AA 4R7DB 1NMBH 2VDLL 2YRZA 1B6UA 3V5KA 12E8H 4JFZH 2P44B 2WBJB 3SDDA 4KKLD 5DK0A 5C08E 1WZMA 4MWFB 5F7KC 5IHZB 4XNUL 3SDYL 3AU1B 3B5HA 5MI0B 5C0FA 1WC7A 4OSUL 4EEEA 5LXGH 3ARQA 2OXGA 5F1NA 4GG6A 2XG5A 3HE7A 3DXAE 4OF5A 5FA3B 5ISZE 4L1DA 3WHXB 1FE8L 3HUJA 1R5IB 5IB2B 5E8DL 5DJXB 4RA3A 3NPZB 1NMCB 1ZT7A 5T3XD 4M6MH 3TN0B 2FB4L 4JY6B 1W0YT 4GW5A 5E2TH 1FP5A 1OT2A 4FXLA 5D72L 1HXMB 4IS6A 4QY8A 4AENB 1KIRA 3PWNA 2VN4A 5GIRB 1CD1B 2HTKC 4AQ1B 5E94A 3DX9B 3PABA 4NN6C 4F7EA 2Q8AL 4HUKB 1GAFH 5I30H 3I6KA 3K2UH 1SEBB 4L9LC 3O3BA 4P5TA 3EFFA 1F6AB 3ARFC 4J1UA 4OZFH 1BQLH 2EE6A 1P7KB 4WJ5B 4JFYB 5F88A 1AD9B 2OS7A 2PTTB 2NZIA 3MREB 1YJDH 3QUXB 4QTIH 1ES0B 1NDGA 5HGGS 4HG4J 1TVHB 2VITA 1TNMA 1KPVB 4XPFL 3ILPA 3QUZA 2IH1A 4NJAL 5KVFL 5ENWB 2QQKH 1FZMA 3KVQA 1GH7A 4ONHB 5DDHB 4KGLA 3LD8C 1IBGL 2R0ZL 3UAJC 2UWEB 3HPJA 3WL9B 1LO2L 4JFFD 2OJZL 2XACC 4HCRL 1C5DA 2CXGA 5ICYB 3NFSL 4DCQA 5ITFB 4YDKH 4OZHB 2BCKB 3QFJD 3M17A 3B9AA 1RUML 2DTMH 3D5OF 4LSDA 4OGXH 3IF1A 5FOBA 5L0QB 2V7NA 3VFVA 4M5YL 3V5DA 3TWCL 4X80H 1U3HC 3SQOH 5HHQA 1A7BA 2FIRT 2HN7B 3UX9B 1JZ4A 3WEXA 3EIFA 2A6IB 2ED7A 2DM4A 2BP3A 2EO9A 5EN2B 3BP7B 4F7MA 4RMUA 1INDH 2VE6A 1F4XL 3K46A 2I07A 3O8XB 2WM0A 3SN6N 2G5BA 3REWA 2CLVB 3UJIL 4TVSa 4OZGE 3GGWB 1ZSDB 3BDBA 4RGNB 1EZVX 1B9ZA 1N6QL 1IARB 2CIIB 1C08A 3IDXL 4PJXB 3MZTA 4J3TA 4GOSA 4JO3L 6FABL 4GAFB 1F2XK 2PNDA 4TQEH 3OKDB 1A4KA 1DLHA 2WUBL 1BQHA 2MFNA 4P0DA 5HYJD 1J05A 2VLRB 3HAEH 3O6ML 1IAIL 1NCWL 4MJ4A 3CSPA 3IJHA 4R2GD 1TZGL 4R7DA 2OR9H 3G5ZB 1C5BH 4M9OA 3G6JE 1K3ZA 1MJ8H 3FMGL 5D2LE 3MRFB 4MWFA 5IHZA 5LQBH 3AU1A 4FQLL 1GZPB 2P42B 1CFSB 4B7IA 1BJ1J 2RB8A 4NFDA 5DLMH 5KVGL 1JF6A 1FH5H 3T0EC 1JTPA 1T22B 5IHUL 3QHTC 5FA3A 3OPZH 1DCLA 5I1DB 1EAJA 5D6DC 1QRNA 4HFUL 1R5IA 3S34H 5IB2A 1RUPH 3ZYJA 2JCCF 3W0WD 4KK8D 1SBSL 5DJXA 3T2QA 1I1RA 2EDWA 4P2OC 4XB8A 1XR8B 4TNVK 5T1KD 4YX2H 1CGWA 4JN2A 5IOPB 4PD4K 1HINH 3TN0A 4JRXD 1PZ5B 3MOQA 1EA9C 3VWKB 3EDEA 4LMQI 5IB5A 4YQXL 2N7AA 5EU5B 1HXMA 4AIZA 4DJMA 4LCWD 4AENA 3BGMB 1HYSC 3RUGB 4RAVB 5GIRA 5L2KB 1CD1A 4JFED 4HMEA 1TITA 3DX9A 4J3XA 4D94A 1SEBA 3NCYP 1F6AA 1FZJB 3WS6A 3DJ9A 1ZT4B 1JGLH 1JHKL 4O2EB 4HJ0D 5HHXL 4JFYA 1WSST 4U7KA 1AD9A 3BAEH 2PTTA 4WNQB 1NGWB 3MREA 1P9MA 2ORBH 4LRNH 4K7PY 1TVHA 1HQ4B 1KPVA 3QCUL 2R8SH 2OJEB 1A7NH 1ETZB 1CGYA 3MUHL 4KK9D 5ENWA 2Z8VC 4PLNC 4FG6D 4ONHA 5DDHA 2NZ9D 1CF8H 1QFUL 1CFTB 3PQYD 4M8QB 2XY1A 3BP6B 4OCXH 2UWEA 3PGDB 3WL9A 3HPLB 5DFVC 4ZUVB 3TA3C 1ZVYA 5FV2A 4M00A 4GRWB 4LPUA 3WKNA 1BFVH 1JZ5A 5ICYA 5TF1L 5ITFA 2Q1EA 5BVPL 4OZHA 2BCKA 3RTQD 2DMKA 5DT1H 3O11B 1QFWM 5IVXB 1F00I 1I7TB 1B4RA 4S1SL 1CL7H 2QR0B 2DL9A 1I85A 2HN7A 1OT1A 5FYKD 4D9LL 5TPWL 4OI8A 2A6IA 3GSOB 3TEUA 3CGTA 4XXCA 3PV7A 3ZT7A 4UIKH 4GKNB 3OAZH 5EN2A 3JV5A 3BP7A 2B1AH 1IC7L 1NMAL 1XR9B 4LLUB 3TVMB 3WFBL 5C9KA 3KPLB 4ZD3H 1FVCB 3CZFB 3QCVL 3O8XA 4K3JH 5E2WL 2PO6B 2CLVA 3DVFA 4NKIL 4PUBH 1G9NC 3ESVF 4QHUA 3GGWA 1ZANH 5A40E 1NUDA 1OP9A 1TIUA 1ZSDA 3EAKA 1NLDL 1VESA 4RA0C 3ZHKA 1I9RH 5F9OH 2ZUVA 3VGHA 5I71C 4NQTA 2H26B 4P5TC 1RU9L 2CIIA 4PJXA 4PJAE 4FZEL 2M8XA 2D7PA 2ZG1A 4YE4L 4YBLB 2UVFA 2XN9B 5JDJA 1CXKA 4OFKA 2P8LB 4TTDD 4M3JA 2IBZY 3OKDA 4QRRB 4Z7UB 1L7IH 4XVUC 3X11B 2VLRA 2AJSH 4GBXD 2BVYA 2KBGA 2OLDA 2P45B 1U8KB 3QUZC 4Z7WE 3FRPG 4XCCL 3D18B 1QZ1A 3D2UB 3BT2L 3ZL4L 1YPZB 2ICES 3MRFA 1KCVH 4RMVA 1GZPA 1CFSA 3MRDB 3BSZH 4N5UA 1I4FB 4NKQB 1T22A 5SV3A 1W8NA 2WBKA 5CSGA 1NGPL 3DUSA 2Y7QB 5I1DA 4OIIL 4KMLB 2V5YA 5DEFB 5D71L 5I1LB 2OZ4H 1MVUB 4JPKH 4UT7L 5CP3H 4YHLH 1OM3L 4AEEA 1XR8A 4PJEB 1RQ5A 4M48L 3C5SA 3O2WH 5DGQA 2VABB 1NFIB 1UWGH 1PZ5A 5JR1L 4LNRA 4O02L 5E4EB 4KTEH 3VWKA 4EUPG 1XZ0B 2CSPA 5EU5A 3U4EB 3BGMA 4XMKH 3RUGA 4RAVA 5L2KA 3MV9E 3BRDA 5EA0L 3B9VA 4I2XE 1MLCB 1MCEA 4PRPD 2BDNH 2BRQA 3KPMB 4P2YA 4ZFGL 1FZJA 2ICWJ 1ZT4A 4O2EA 4X8XA 5D1XC 4DTGL 4QHLB 3WFDH 5T5FH 4WNQA 1NGWA 1LO3H 1UKSA 3UBXG 4AEFA 1LE5B 1HQ4A 3DV6B 1MCRA 2OJEA 4X9GA 1ETZA 1NC2D 4KZEL 5HDOA 4HD9A 4TULH 4KHTL 3ZHLA 2R4SH 1CDCA 3ZHDA 3MXWL 2VLKE 4YFLI 1CFTA 4M8QA 1NGQL 5IP4A 3PWUB 2WBJC 4XP9H 2BOCB 5M7QA 2AS5M 4G9DB 1CN4A 4ZUVA 4K7PH 3QQ9C 1AR2A 5MI0C 3N1MC 3BHBB 3V0AC 4JE4B 2O5ZH 1A1NB 4ZUUB 3L95B 3SOBH 3AROA 5IVXA 2N7BA 1I7TA 1WQVT 4NQVB 4PJBB 4GLRH 2QR0A 3CMOL 3SKJL 1MWAA 3IU4L 1YEHH 4TPRL 3BI9X 3GSOA 2J8UB 1BECA 1CWVA 1R6VA 1JV5B 1OHQA 1NMCC 3P30H 4GKNA 4KMTH 1HN1A 3TN0C 1DQQB 4LLUA 3TVMA 3V4PL 1QFPA 3T09A 3KPLA 4JKWA 1EFXB 3NIDF 3CZFA 2P5EB 4ZTOL 5KSAB 1TNNA 1NAMH 1J87A 1G0DA 3QPXL 5HI5C 1WAAA 1BBJB 3TH2T 3OJVC 1SMOA 4FZ8H 1IT9L 2A1WL 5CCKH 2DAVA 3MA9H 1C5CH 2H26A 3MV7E 1XMWA 3S37L 1OAUH 4X6DB 1S7RA 4GRLB 4KVNL 4KROB 5AYUL 5IFJB 4HMDA 2XN9A 2X6MA 2YS4A 3WE6A 2P8LA 2RBLA 4NZTH 4IMKA 1Y6NR 4QRRA 2X5PA 1U8NB 2DQUL 1P9MC 4Z7UA 3I3DA 3QUXC 3X11A 5I1IL 1A3RH 5JIIA 3OKYA 2O5YH 1U8KA 1H3VA 3D18A 3D2UA 1CDJA 1ZA6B 2B7DT 1YPZA 3MBXH 1EHXA 1F13A 1RJZB 3RWJB 3NA9L 4MQXD 2VXVH 1KTKE 3FB5B 3RIAF 3MRDA 5T33L 4FXKA 5I74B 4PJ5D 1I4FA 1NBYB 1A5FH 2D0HA 3GMOB 3LZFL 5KVDH 3PWPD 4LLMB 1QPXA 2GQHA 3QIUD 2X4QB 3TBSB 2Y7QA 1MCQA 5F8RC 5FO7B 3VD7A 1CIDA 1CR9H 1N6VA 4TRPH 5DEFA 5FO9B 1R5VB 1MVUA 3D3VB 5L0QC 2RAMA 1I85C 4PJEA 5GZNC 2VABA 1NFIA 1JTTA 2C4FT 4JFXB 1GL4B 2CDEB 3I2CH 4R97B 4XXCC 3NH7L 1XZ0A 2BMKB 5CJOH 3U4EA 5JXEA 3ULUC 4JN1H 4JHWL 3FAWA 3OZ9L 3CZJA 3GJFH 3BFOA 3SDYH 4C56E 5F7UA 3O8XC 5JPMB 3T0WA 2NW2B 2PW2A 4OLXH 4OSUH 2NXYD 5CSBA 1MLCA 1YEFL 3VA2C 4LEXL 3KPMA 2HRPL 5EU3A 4RGNC 4ZFOL 4QHLA 2W0LA 1S5IH 1L7TL 5CD5C 1FE8H 1T0PB 3MRPB 5GJSH 5IW1B 3W9DB 1FVEA 1LE5A 3DV6A 1J1PH 5DO2C 5C07B 2R4RL 3H3BC 2Z31B 1XF5B 3PWUA 2FB4H 5GS2D 2BOCA 4Q9QL 4G9DA 3H6JA 3HNSL 3NCYS 3P4LA 1CI5A 5D72H 5D70H 1TXKA 1QNZL 1DBML 4PJGE 3BHBA 4F80A 1JHTB 4K3HA 3TF7C 4DW2L 4IOSD 1A1NA 4ZUUA 3L95A 5CINL 4PJBA 1IM9A 3QQ4B 1RJCA 3A67H 4EDWL 2BVTA 5E2VL 1UH4A 1MSPA 3BP4A 5IMLB 2BVOA 4PYHA 2F53B 1JV5A 3R4DA 4WW2F 5KS9A 4XPFH 4TVPL 4HJGB 2BY3A 3L3HB 5E5UB 4KJPD 1P4BH 2FX7L 4JY4B 4HJJL 4KK5C 3VWKC 1EFXA 4DZ8B 2VDML 4BKLB 1MI5E 2R1YB 2P5EA 2FLBT 2A0LD 2BC4B 2R0ZH 1N6UA 5KSAA 3ULSB 1LO2H 1P5VA 1EHAA 1EO8L 5T3ZD 1BBJA 2OJZH 3B6SB 4D8PB 2HAZA 4HCRH 1PKQE 2IALB 3NFSH 3QCTL 1ZK9A 3MCLL 2PXYA 1NFDE 4X6DA 2P5WE 4GRLA 3I02B 4UDUB 5IFJA 4MA8L 5DHXB 5LGHH 1DZBA 4HQQL 4M5YH 1U8NA 4N1HB 3TWCH 1AQKH 4Y89A 3RHWF 2LU7A 4DVRH 2IANB 1EVUA 4ZS6D 2WMPA 5I66B 1ZA6A 1CLOL 4M1GL 5DWUL 1RJZA 1J18A 5E8PB 3FB5A 4PJCE 3Q6GL 1F4XH 1NBYA 3GMOA 3FO2B 4LLMA 3T04D 4ODVL 3V6FA 5D2NB 3HR6A 2X4QA 3RU8L 4Z7QE 3EBAA 4LP4A 4BJLA 2FNBA 5FO7A 2IQAB 3RVVC 5DVOA 5FO9A 1R5VA 5EO1B 5IHBA 5FGCB 4LPVA 1BZQK 4OGYL 4JEGB 4UT9L 3D3VA 1N6QH 3IDXH 3E8UL 1E28B 2NY3B 4MNGB 4K8RL 4JO3H 1ED3B 6FABH 4Z7OE 2VWEE 1CT8B 2WUBH 4JFXA 2CDEA 3T1FB 4EUPH 4DGYL 1A3LL 5GZOD 1QFWL 3O6MH 4R3SB 2BMKA 1NCWH 3AY4A 4OCNC 4NC0B 4FS0A 3FMGH 2WLYA 3O2VH 2GTZB 3ME0A 1VDGA 1UKTA 5JPMA 1PG7W 2OR8A 2PO6C 5KVGH 2ZJSH 3ARDD 3RL2B 1HIML 5IHUH 3RWHB 3GSUB 5D9SA 4QNPE 1IVLA 3FAXA 3QI9D 5D1QB 2YPVH 1AGFB 1BFTA 3V7AG 4HFUH 3MRPA 2AI0L 3W9DA 5IW1A 3QNXB 3QUYB 4QHKJ 4YBLC 2DL2A 4BM7A 2ADJA 1ZLVK 4N8VG 2X4NB 5C07A 5L6YL 3MJ9A 1KEGL 4R4BB 4UINL 1ULVA 5IV2B 3CVIL 4HWZB 1GGIL 1YYML 2YA0A 2Z31A 1XF5A 1GZQB 4YQXH 1AO7D 3OTTA 1IGYB 4RWYH 1JHTA 5HI4D 1NJ9B 5EUOF 4WEUD 5E5MB 5CILL 1UFUA 3F7PC 2W9LA 1JUFB 4BUHA 1NC2B 2JB5L 3ARPA 2ATPB 3QQ4A 4N5EC 3MRLB 5K59F 2VL5B 2PW1B 3CDYA 1SJEB 2KZ1B 5HHXH 4NQDE 1R24B 1WWWX 1Z5LB 3SDXB 4CN1A 5D7JB 5IMLA 4YWGH 3SGJA 3V7AE 2F53A 4YDIH 4G7YL 3L3DB 4WIQA 5E6IB 1PEZA 2XOTA 4HJGA 3L3HA 4YIQB 5DURB 3VRIA 1VKXB 4M43L 4JY4A 4XP5H 5FYLD 5E4EC 5C9JA 1D5BB 3C9NB 3H7BB 4DZ8A 2ZNWA 1F3DH 1MJ7L 3MV8A 2R1YA 1J0ZA 1QFUH 4NT6B 5JXEC 5CIPH 3RBGA 3U7WL 2Q7YB 2CPCA 3O45B 4AYFA 1LP9E 2JTDA 4Y19E 3ULSA 3C6SB 2E9WA 4Y8DC 3R8BB 3B6SA 4D8PA 1G9ML 3PE9A 2IALA 4DGIL 4NKOB 4F8QA 5TF1H 1B4JL 1DQML 3G08B 4H0IA 5BVPH 5CJ5A 3Q5YA 5H37H 3I02A 1UXWB 3GBLA 2APBA 2EDNA 4UDUA 4QKXB 4S1SH 3H3PL 1KIQB 4PJFF 4YAQA 1GIGL 3LN4B 4D9LH 3DUUB 2IANA 3JVGA 2GI7A 1IC1A 3OF6D 1CK0H 4FN0A 5FYJD 5I66A 2QSCL 4MXWL 2C3GA 3GMMB 4U2ZA 1VFAB 1NUNB 3GMQB 3I6GB 1O0VA 5JZ7C 1IC7H 3MR9B 4LSRL 5E8PA 1NMAH 4UZGA 1GGYA 1WF5A 2VOTA 3WFBH 1QRKA 3ZE2E 2DQEL 3FO2A 3HG1B 5D2NA 4RQQB 4NWUL 1GRWA 1BPVA 4NKIH 2VDNL 5GSVB 2YKLL 4D0BB 1MWAL 2IQAA 1NGYB 2AERT 3ALXA 1MIEL 4GKSB 2GUOB 4WGWB 3AMLA 1RU9H 2GJ6E 2O26U 3FB8B 1PLGL 2CRZA 4MNGA 4N0YL 1W72L 4XNQB 5HTSA 4NRYB 1QRNE 3VFPB 1ED3A 1FPTL 1CT8A 3LEVL 2BXZA 4P2RE 3UROR 1QSEE 2KDGA 3EJJX 3QIUB 4X6BB 4R3SA 3ARBD 2EKSB 3MRJB 2D7QA 1MUJB 3ARTA 3BUYB 4YHPB 3SQBA 3ZL4H 2VDOL 2GTZA 3MX0A 1FZKB 2XIDA 3ULVL 1D5XB 1A1MB 3QEUB 5KSAC 5E70A 2J6EH 3RL2A 1TVBB 5AZEL 3GSUA 4CU7A 2FEEL 1NGPH 2AVGA 4D2NA 3UEZA 5I17B 1U93B 1CFVL 4KK6D 5D1QA 5EWIL 4LSUH 1AGFA 1DBJH 1UG9A 2QTEA 3KYKL 3E6FB 2FATL 3QNXA 3QUYA 4GRLC 5D71H 4KROC 1Z3GH 4UT7H 1DQDL 3AS1A 2D7OA 3FO0H 2X4NA 1HH6B 2MKLC 3RWGB 4R4BA 5SWZA 5IV2A 2WWMC 4HWZA 1G0YR 5GRJL 5JR1H 4NRXB 4S1RH 3OAUH 5F3BB 2NCMA 5DR5L 1GZQA 2RFXB 3P4OB 5D7IE 2X70B 2UUDH 2FD6H 1BM3H 3VH8B 4ERSH 1NJ9A 5I74C 2MCG1 5E5MA 1Z9MA 1JUFA 5BMFH 2NXZD 2ATPA 3NIFF 3MRLA 4LLWA 4ZO7A 4NCDA 2VL5A 2PW1A 2BK8A 4MQSB 1QTYT 1SJEA 3BWAB 4U1NB 1R24A 2W9EL 2H6PB 1Z5LA 3SDXA 5D7JA 2ZG3A 2YD3A 3RWFB 2GAZB 1YEIL 3L3DA 5E6IA 2GJZA 3CNKA 3LN5B 4NN5B 3VFNB 2XKNB 4YIQA 1VKXA 4KZEH 4GAYB 4R97C 1G1CA 3HZKB 4KHTH 1D5BA 3C9NA 2F5BL 3NZ8B 1J5OH 3MXWH 3WO4B 3NOIA 4NT6A 1NGQH 3AY4C 2Q7YA 3O45A 5TFSH 4NUGH 2H3NB 4K9EL 3MODL 4NKOA 5F1KC 2G75B 5KTEL 4YDLB 4XI5C 5C0CE 3G08A 1GGTA 1VHPA 3HE6B 3FHQA 5B8CA 1UXWA 3D6GA 4ZUTB 4RMSA 4YLQT 2EICA 4P2CG 3S4SG 5EIIA 3L3IB 1MCPL 1A6VH 1IRAY 1KIQA 5E99L 4BK5A 1EH9A 3W2DH 3LN4A 3DUUA 4TPRH 2C3WA 4XCNA 2I60H 2XFXB 3GMMA 5DI8B 1T2QL 1VFAA 1YN6B 3I6GA 2EE9A 3MR9A 5EFIB 1G9NH 3V4PH 1FG2B 4HIIB 4I48B 4ODTL 3BEWB 3HG1A 4RQQA 2PN5A 1RSFA 3AMKA 3QPXH 5GSVA 1JFQL 3L3KB 4Y5XB 4D0BA 3OKMB 4Z6AT 5ICXB 2APTA 2WK2A 4HWUA 1IT9H 3V4UL 3I50L 2HKHH 4GKSA 3K1KC 4FG6C 3S37H 3FB8A 3WNPA 4HBQA 5DUPL 5AYUH 4NQSA 4XNQA 1UZ6E 4NRYA 1XGQB 3VFPA 1WBZB 2YD9A 4E9LA 1MCLA 4IEFB 3G9AB 3U7AA 2AQ2A 2DMBA 3SGJC 1OSZB 3W81A 4YHYB 2NYYD 4G5ZL 4OD1L 1I1AD 2EKSA 3MRJA 5EC1B 2FL5B 1G84A 1KLFA 1MUJA 4L4VB 4PY7A 1ZGLB 2F54D 5FM8A 5KSBE 3NA9H 5HY9A 5C1MB 2A77H 3UTTE 1D5XA 1A1MA 3QEUA 1ZLUK 4L1HA 4NSKA 3EOTL 3IU3A 4LPCA 1A9BB 1OF2B 3LZFH 4FXGA 4K23H 1TVBA 3S3SA 1AHWB 5I16B 5I17A 2B2XH 3VD5A 1TJIL 1EUUA 1U93A 1QSZA 1NPUA 4DN3H 2X1QA 2GK2A 3E6FA 5I8OL 1ZTXL 2CO6B 3K8MA 5JTWA 3U4BL 1X4YA 4R7NB 4E42B 3VXUD 3VA6A 4K3DL 1HH6A 3RWGA 5ELIA 4JPIB 4O58L 4R4NC 3UTQB 1ODAA 4NRXA 3LRHA 5F3BA 3QISA 3BPCB 2RFXA 1W0VB 3NH7H 3P4OA 1EEZB 2X70A 5SX5H 1FHGA 3L3OB 4AG4L 3VH8A 3P9MB 4JHWH 2H41A 2WV3A 1JYVA 1AXTL 4FQJL 2FRGP 4TTDC 5D2NC 4FQIL 3GHEH 1FLRH 1F5WA 1YEFH 4YNYA 4LEXH 4OFVA 2HRPH 4PBXA 3SGDI 3BWAA 4U1NA 3DLQR 1MRCH 2H6PA 2XWTB 3EOYG 1L7TH 2YK1L 3D9AH 4XMLH 4ELMB 3IDMB 5F7HA 1BIHA 5CP7B 5FF6B 3RWFA 4U6XB 1ZAGA 4HXBH 2GAZA 2NY3C 2DF3A 3LN5A 4OIAA 3VFNA 2XKNA 5D1ZB 2BNQB 4HH9B 2R4RH 1S7XB 3HZKA 4F9PA 3FQNB 2VC2L 3NZ8A 4JG0L 3IDUA 4Y0GA 5CEXA 3LCYA 4MAUH 3HNSH 2P46B 2H3NA 4F33B 1YA5A 1QNZH 2HT4C 2M26A 2G75A 5DMYA 4C83B 2DN7A 5CKAA 3HE6A 1QSFD 3BKMH 1FORL 4ZUTA 2ZUUA 5CINH 4I77H 3ULVE 3HC0B 5D1QC 4UDTB 3TNMB 1KUMA 4NQCD 4EDWH 1LO0H 2DTSA 3QUYC 4JKLA 1DVFD 3L1OL 2D2OA 5DA0B 2W38A 2XFXA 2I24N 1G7JB 2F58H 1YN6A 4Z7UE 4TVPH 3ZE1F 5I1KL 5I18L 1TJGL 5C0JB 3WDJA 2FX7H 3WV0A 4HJJH 1FG2A 3I3EA 5C0AD 2OP4H 4HIIA 4I48A 2VDMH 1CYGA 1XGUB 3BEWA 3IT8D 4HW6A 4AL8L 2XY2A 4M7LH 5AD0B 4Y5XA 3OKMA 5ICXA 1F90H 4FHBD 1EVTC 5FOJA 5DMKB 3VXRE 3GO1L 1H3UA 4WI4A 1RZJL 5C09E 3MCLH 2CGRH 4NQEE 1DANT 4MA8H 1XGQA 5I6XB 1WBZA 1LDPH 5BRZD 1XGRB 5D7JC 5JMOC 1LWRA 1S78D 1OSZA 1T1WB 4PP1D 5GRVK 1HXYB 4HF5L 5E6IC 2FL5A 2WIIB 2UZYB 2QQLL 2DKMA 4L4VA 1CLOH 1Q94B 4BFBD 5DWUH 3CDCA 1G7LB 3TT3H 1CDUA 1SJVA 5H35A 3Q6GH 2BVEA 1A9BA 1G7HB 4UOW1 3K3QA 4MB5A 3LHPL 4ODVH 1AHWA 5I16A 5E9DE 3RU8H 5SX4H 1EBAA 3RVWD 1RFDL 2X1XR 3VDAA 5TDNB 5D2LF 1CTOA 3P9WB 3KDMB 4MNQD 3BYTA 3U48A 1AGCB 3O6FB 3A6BL 1A8JH 4OGYH 4UT9H 3MRKB 4E42A 5DD3H 3E8UH 3MLZL 4MA1B 1NDMB 3O2DA 4Y16D 2YD8A 4K8RH 4JPIA 4K2UL 3UTQA 2QLVB 3H8NA 5GS0L 3JBG7 3QIBD 3N85L 2VZOA 4DGYH 3JUZA 3BPCA 1W0VA 1EEZA 3L3OA 5E00B 3P9MA 1I8IB 5T1DL 4L3EE 2Q3ZA 2IPUK 5EC2B 2BY0A 1DSFL 1H8NA 1NUGA 3HMWH 5FKAA 2LFGA 4WHCA 4M4RA 1W2KT 3MNWA 3VXQB 1BOYA 4MJ2A 3S35L 4I3SH 1NC4D 2XWTA 4ELMA 4HH8A 4YXLH 3IDMA 3RVTD 1WZLA 5FF6A 2AI0H 4U6XA 2BVPB 2D7TH 3ZTNH 3Q5TA 5BS0D 5AG8A 5D1ZA 2BNQA 1YEDB 4HH9A 3QIUC 1XF4B 1KEGH 1S7XA 1LK2B 3FQNA 3QEQA 5ESVB 5ANMB 5SWSD 3PP3K 5KVMC 3DBXB 1GGIH 5KS9E 2WW8A 5FB8B 1N2RB 3EO0B 1YMMB 4EQ3A 4F33A 3UTOA 3DUHA 3N06B 4C83A 1R5WB 4LNVA 1V3LA 5CILH 2ZPKH 4XWGL 1VA9A 5A3ID 1NLBH 1FVDB 4YFEA 1E4KA 3HC0A 4QWWC 4EDXB 4UDTA 3TNMA 1UWXH 1WUNT 1OWWA 3ZDYE 3CXHK 4RAUB 4DAGH 4P59L 2X4UB 1TJHL 2LV4A 4G7YH 2Y06L 4RDQG 4RMWA 1G7JA 3VJ6B 1SBBA 5C0JA 5FCSH 5HGDB 4RZCB 4QCIB 4E41B 1I9EA 1NL0L 1XGUA 1MJ7H 2BNRD 1MF2L 3QB7C 3U7WH 3DX7B 2JELH 5AD0A 1KSRA 4LU5L 3ZKXB 3QDGB 1YY9C 5DMKA 5DUML 1OD7A 3KPNA 4UT6L 1DQMH 2B39A 2EO1A 3FOMB 3SY0B 5EU6D 1EAPB 4L4TD 2NY1D 1XGRA 3H3PH 1T1WA 3BX7C 4NJ9L 1BFSA 5KW9L 1GIGH 1HXYA 4KQ3L 2WIIA 2B5IB 4NN5C 5DJAB 4BSVB 3BOVA 3UJJH 1GC1L 3OBAA 1Q94A 2QSCH 4P2QB 1A21A 4PP2B 3HMXL 4F9PC 4LHUD 1G7LA 2HVKA 3MLUL 2DD8L 3WO4C 4LSRH 3D39A 4ODXB 4G6FB 4YEEA 2FHFA 5F93C 1G7HA 2DQEH 5C6TL 4NWUH 2GHWB 3C2SA 35C8L 4YDLC 1MWAH 1I1AB 2FDBP 3MC0A 5TDNA 3HE6C 2WINB 3KDMA 4HIXL 1MIEH 1AGCA 3O6FA 5HHOB 5F9AC 5D7LE 4NCC2 2VAJA 1LK3L 1PLGH 2E8ZA 1NDMA 4N0YH 1JE6A 4BELD 1FPTH 4FQQB 3TO4B 3EO9L 1IQWH 3C09B 3MUY1 3S98A 5E00A 1IGTB 3RI5K 3MRMA 1I8IA 3CLFL 4UV7L 2VDOH 1A7RL 1NCAL 2HFGL 2X4OB 2PYEB 4LAQL 5EC2A 4G6KL 5JIPA 4Y5XC 1OB1B 4Q6IB 4Y8AA 3VXQA 2NY4B 4L8SB 2KQMA 4LRIA 1CFVH 5ESQB 5EWIH 5BZDB 1TQBB 2G2RB 2VN7A 5TDPB 3KYKH 2BVPA 5DHVB 4KPHL 4KKBC 2FATH 3TP4A 1AJ7L 4WW2B 4X9HA 4KXZI 1E6OL 3LPFA 3VE0B 5M94B 1BHGA 1F2QA 1IJ9A 1YEDA 3KXFD 1Q9WB 1LK2A 1XF3B 2E5EA 5ESVA 4YHYC 1U58B 1S9WB 1HYRC 5ANMA 1HHIB 2X10A 3CJJA 3DBXA 4UBDD 4AMKL 5C3LD 5GRJH 4JM4H 5FB8A 5DR5H 5HVGB 1N2RA 3EO0A 1YMMA 2UZXB 4PJDE 2I9TB 3CSYB 3IVKB 2QV2A 1FL6A 3MV8E 2AK1L 1R5WA 5IK3A 1RZGA 3CH8A 4UILL 4WHTB 5GHWL 2H8PB 3FQXB 1AHWC 4FOMA 4OZ4B 1KXTB 3GRWA 1FVDA 4D9RD 3ZMRA 4EDXA 1KG0B 3TIDB 1TFHA 2W9EH 4RAUA 5HVWA 1FGNL 1H3XA 3ZKMC 3ARXA 2R2EB 2X4UA 2ZUSA 3JV4A 3H9YA 3TZVD 1D5IL 1MCWM 3VJ6A 1T89A 5J3HD 1EO7A 5HGDA 4IRSD 4RZCA 4POZD 1U0QA 4QCIA 4WRLA 4MB4A 4E41A 4XH2B 3MRHB 3DX7A 4H0HB 3MO1B 3P0VL 2Q6WB 2Q87A 4XP4H 4NO3B 5MENB 3QDGA 1AI1H 4G8GD 4HEPG 4K9EH 3M1BB 3MODH 4KI1A 1JZ6A 5IF0B 4MLSA 2BRRL 5KTEH 1S9VB 2R2BB 5HJ3B 3BDYH 1RD6A 3QEHB 4PRHD 4AEHL 1MCBA 4O2FB 1N0XL 2EDHA 3JTSB 3X17A 3GMLB 3VXSE 3FOMA 3SY0A 1EAPA 5J1SC 1BZ9B 5C0AB 1MOEA 5F7EL 5AG9A 4MA7L 1E4XI 5E99H 3V6OE 3F7YB 5C08D 5HI4C 3IB4A 5D1ZC 4BSVA 1EEYB 5IFHH 2EDOA 15C8L 4P2QA 3I6LE 4PP2A 1T2QH 3KYOB 4QRPB 4W6XB 4ODXA 3FO1B 1L0QA 3ZDZF 4IOFD 1LEKA 3RKPA 1A6TB 3DXAD 4GFTB 5ISZD 1FQ9C 1EERB 1BVLB 3OAZK 4HLJA 4MQ7B 5IBUB 3EOAB 3PWJB 3R8QA 1JFQH 2Q86B 3VGEA 2NY2B 3C6LB 2WINA 4FFWD 4ZMAT 3V4UH 5JHDB 3I50H 5HHOA 1LD9B 3BD3A 3C60D 3B2VL 2NY5L 2IGFL 2EXYD 4XPBL 5DUPH 4J4PA 5HHMD 3V0WL 2EDQA 2ZP0T 3AFLA 1T66D 4FQQA 2A73B 3TO4A 3FL7A 4FFZL 5TE6H 1UACH 3GBMH 1GOGA 1IGTA 3C8DA 5SWZE 5IFAH 5LJYH 1CDHA 3LH2L 3TM6A 5EUOB 4AH2B 2X4OA 4CJ0A 2PYEA 3C5JB 3VXMD 1J8KA 3EOTH 4AEIH 4LPXA 5FV1L 1OB1A 4JFHD 4Q6IA 1VACB 3QIBB 4L8SA 2BVUA 1TJIH 2F8VA 2AEWA 5ESQA 1HILB 5BZDA 2G2RA 2VLJE 5TDPA 1LEGB 5DHVA 5I8OH 4N8CL 1ZTXH 4WW2A 5ID0B 3VE0A 3U4BH 4CN4A 4K3DH 4OFYA 1Q9WA 4G9FD 1TQCB 1XF3A 4JFDE 1S9WA 1HHIA 4O58H 1X5XA 3BISA 1A6UL 1INQB 4ISVA 2GSGA 4G42B 1UYWH 6CGTA 4S0SD 2I9TA 1OTUD 3CSYA 4R26L 5GGSB 4ALAL 1QA9B 5BW7A 5D4QA 3KPTA 4WHTA 5D96B 2H8PA 3FQXA 3EUUA 4OZ4A 4DQOH 5F7WC 3T4AB 1K4DB 2ZCLL 3SDAD 5GGUB 1F4WL 3ESUF 7CGTA 1PQZA 3IAPA 1FYTD 3FTGB 1AKJD 1EJOL 3Q1SL 1UEMA 2YK1H 3MXVL 3O6FC 2R2EA 3IETB 3PWVB 5F9WB 4V1DE 1VCAA 4YXHL 2HVJB 4MA1C 2MWCA 5T1LB 3WLWC 4J3SA 1NCBL 1RZ7L 2VC2H 4KVCL 4JG0H 4XH2A 3MRHA 1CXIA 3CCHB 1KIPB 2OCFD 2Q6WA 3MO1A 4NO3A 1FL5B 2QSTA 5MENA 1FSKB 1FL3B 2EC9T 5FDWB 3U1SH 1MPAL 2F19L 4WTXA 5IF0A 2AP2A 1S9VA 5HJ3A 3T0AA 1WFUA 3BH8B 4O2FA 2V5SA 3JTSA 1SYSB 4ORGB 3GMLA 4LKCB 1FORH 1BZ9A 1PG7L 4CL7A 5L9DL 4L29B 2AJVL 3MJ9H 2ICWI 4YBQD 4FTVE 3F7YA 4W70A 2EXWD 1J8HE 3QXVA 4EIZC 3L1OH 4NZJA 3S5LB 4LDEB 5CEZH 1EEYA 2E6PA 3MCKA 1NFDF 4U6HB 3KYOA 5I1KH 1CXFA 4B5EA 3L7FB 5I18H 4QRPA 5B3JE 1CD9B 2EC8A 3FO1A 1JWMB 4CDGC 4Z7NE 3C5ZB 4JZOB 1A6TA 3MV11 1X5YA 4PV8B 2FCBA 4WFHD 5IWLA 1BVLA 4OF8A 4MQ7A 1NAKL 1JIBA 3PWJA 3O4LB 3C6LA 3WNNA 4Z76B 4FQCL 3OKLB 1P84J 5JHDA 1LD9A 3GO1H 4JPWL 3WIIH 2NX5E 2DQJH 2VQ1B 5I73B 1X44A 4KU1A 3V52L 3SJVB 1CG9B 1HH9B 4Z7QF 4Z0XB 3SE8H 4R90L 3T0VA 4WUUD 4CADA 4PLKC 2A73A 2BHUA 4HF5H 5KAQF 4G8FB 2X2YA 1RZKC 1T89C 4GG6F 3MLYL 2QQLH 5EUOA 4AH2A 3RBSA 1XIWB 3C5JA 4NYLB 3KPSD 2AV1B 3HUJF 4MQTB 3ZKXC 5C0BD 2J1KA 3P9LB 1VACA 1Q0YL 4XPGL 4RIRB 3NN8B 1RFDH 2AK4D 1CIUA 1HILA 1OAQL 1MLBB 1CVSC 1LEGA 3BIKB 4JRYA 1DEDA 5ID0A 4NBYB 2YUVA 4NZDA 3LRSB 1REIA 3U0PB 4JZNB 4DN4H 5JORA 4DOHB 3MLZH 3QZWG 2CLRB 4DFIA 1P4IH 2EH8H 4HIHB 4Y5YB 1UH2A 5GS0H 1INQA 3LB6D 1YY8B 4GAGH 4RX4D 2B5IC 3K8LA 1KBGL 3N85H 2ENYA 2R0LL 4G42A 1S7WB 3PXJA 4LCYB 4P48A 4LCIH 1QA9A 1QFOA 1ND0B 3BJLA 3DROB 2NW3B 3HC4L 2VR5A 3T4AA 1QUNA 1K4DA 4HEME 5GGUA 1I1AC 3FTGA 4HKJB 2R23B 3S35H 5CGYD 1A7PH 4Y1AD 2MHAB 3PWVA 1FO0B 2Y6SC 1CGXA 5E8NB 2NY7L 1JYNA 4PJ8B 4BH7A 4F57L 2HVJA 4OQ1A 4J4PC 1MHHB 1IGML 5GISH 3UPCA 1W0WB 5T1LA 3TO4C 4H8WC 5E95B 1Y6MR 3C09C 2ZCHL 2E8YA 3CCHA 5C0GB 5LKNA 4KKNA 1KIPA 1IAII 5F89B 1KN2L 3J8F7 1U3ZA 4MNHB 1FL5A 5FDWA 5I1JL 5HVFB 4YFDB 4N1EA 1UADC 4MJ5B 3QDJD 3QJFB 5DJYB 3BH8A 2AJUL 1SYSA 4ORGA 2NY4C 2P7TA 4XWGH 2XTJE 4L8SC 3WD5L 2L4OA 5GRUL 5IBLD 1GOFA 4L29A 1TQBC 3INUL 4WW2C 2HJLB 3UBXI 3S5LA 1TJHH 3RIFK 3GEWB 5EBWA 2Y06H 4U6HA 3L7FA 1QR4A 2VLME 4PRHB 1AD0B 1T83A 1JWMA 1OGAD 3C5ZA 4JZOA 5IGXH 4NUJB 4PV8A 4XWOC 4RSVA 1D9KD 1MF2H 4JM2D 5FUOL 3GRWL 1TETL 5FA4B 3O4LA 5BW7C 1UA6L 2Q8BL 5DJ0B 4Z76A 1FJ1B 5C08B 3OKLA 5DUMH 1CICD 4PV9B 3CDGB 1T2XA 4UT6H 3ZE2F 2VQ1A 1NSNL 5BV7L 3SJVA 1CG9A 1HH9A 2IQ9L 4Z0XA 4UNVA 3R0NA 1B88A 2WWKO 4NJ9H 4K7PX 4ZOBA 3JV0A 5J8OA 1M4KA 4G8FA 3SO5A 1R3LB 4K71B 2FJFB 1XIWA 2J4WL 5DJDB 1F45A 4EI6A 1KJ2B 5JW4N 2DD8H 2IAMB 2AV1A 3X14B 2VXTH 3DVGB 4HKZB 4P23D 5J4MA 2JKXA 4N90D 3P9LA 5IVOA 1GSMA 4RIRA 1MJUL 1BZ7B 3NN8A 1T7YA 4E5XB 1Y0LB 1UQSB 3H9ZA 1MLBA 3BIKA 3GMRB 2YN5A 3TV3L 1L9MA 2R9HD 2KQNA 2MQ0A 4ETYA 3S6CA 2LQRA 3LRSA 3U0PA 4JZNA 4JGMA 3KJ6L 1LK3H 1ADQL 1M7DB 2CLRA 3LQAC 4PIRF 5AWNL 4HIHA 4Y5YA 2YD1A 4XXDB 1YY8A 4WY7L 5H94B 1S7WA 4LCYA 3P0YH 3EO9H 4AIXA 3HI1B 1ND0A 3QEQE 5CBEB 3CLFH 4UV7H 2NW3A 1A7RH 1NCAH 1X5IA 2IWGA 2ZUWA 4WWKD 3MFFA 4G6KH 1BGXL 3FZUC 1X5FA 3FFCE 5JXAH 4PP1C 5IM7A 3OKKB 2NY2C 3C6LC 9CGTA 5E08H 4PBVC 2ESVD 2HLFC 1WZ1L 2R23A 1Z0MA 3SPVB 2D03H 3LV3B 3QWQB 1FO0A 2OYPA 3GM8A 2D31B 4JDZB 4PJ8A 1HHGB 2UWEF 2O61B 1AJ7H 1MHHA 1SEQL 3SE4A 1FRGL 4CKVX 5EZJB 1W0WA 4Z78B 4PRID 3NBNA 2DICA 3GBNL 4OZHF 1QACA 3RVWC 2HTKD 4AMKH 5C0GA 3L3JB 3KPRE 2ZUXA 5F89A 3CC5B 4MNHA 3TO2B 3VGGA 3VMPA 2YA1A 3E3QC 2AK1H 3BIBX 4MJ5A 3VRLF 4NKMB 2X4TB 5DJYA 3AM8A 1QR1B 3U7YH 4P3DA 4MAYA 1YZZA 3QIBC 1YQ2A 2VRAA 3NACH 4YPGB 4OZGB 2CRMA 4OGAC 3VFUB 1KJ3L 3MYZA 2HJLA 3FJTA 4GKOA 1A14H 2FYYB 2EKJA 4XHJC 1IC5H 5T3XL 3UAJD 3H42L 1AD0A 3L5WB 5J57B 1TPXB 2X4PA 1GOHA 5CJ8A 4XGZB 4NRZB 4NUJA 1YNLL 3SDCA 1RUAL 2YPLE 2C4FU 3EYVB 1RAMA 4DEPB 4PJ9B 5FA4A 4AK1A 2HJFB 2AABL 3D39E 4U6VH 2BOBB 3G6JB 5DJ0A 1FJ1A 3LY6A 2BRRH 5D96C 4PV9A 4YPJA 1U8HB 3BESR 1U3HD 4AEHH 1N0XH 3ARGB 3E6HB 3OHXB 4ZSOE 3UTSD 4S2SB 5K9JL 3N9GL 5GQBA 3FB6B 2O5XL 5F9WC 4MA7H 5J1TC 5E0QA 1H3TA 3GSWB 3O9WB 4HLZG 4XVSH 2GTWB 2VR4A 4X5XB 3NABL 1R3LA 4LP5A 2FJFA 2F5AH 3IDJB 2I25N 4JHAH 4JZJB 1KJ2A 2IAMA 3X14A 3DVGA 4HKZA 2D0GA 1ZMYA 4NP4L 4PJHE 4H88L 1FSKC 4X5LA 2W1NA 3MA7B 1BZ7A 4KRNA 2C4XA 2J8HA 4E5XA 4U6TA 1Y0LA 1UQSA 1T2JA 1BD2E 1L9NA 3GMRA 2APWA 2LVCA 3EHBC 1FIEA 3B2VH 4JR9L 2IGFH 3RUGF 4XPBH 1M7DA 2LAGB 4QOKD 2IMMA 3KGRA 3U9PH 3V0WH 4HWNA 4KH2A 5F7DA 3NCCB 5H94A 3T0BA 4FFZH 2FR4B 3HI1A 3EOBB 2ENSA 4OZIE 3JV6B 5D7KD 5CBEA 4M02A 5EB9A 5DSCB 3LIZL 1T83C 1UB5B 1EEUA 3T0ED 4HUXB 4JGUA 4YO0B 3LH2H 5CP3A 3C5ZC 4EI5B 1ACYL 2NY1C 3RDTA 5IMKB 3U6RB 1B6DA 3OKKA 1MEXH 4K3EH 1U95A 3D0LB 3ABZA 1WLHA 3SPVA 1FGVH 3L9RB 3LV3A 1HCVA 1YEGL 2D31A 4JDZA 4OI9A 1HHGA 5D93C 5I73C 3VWJB 4I0PB 2O61A 5B38A 1NFKA 4XMPL 4MJIE 4HWBL 1KB5B 5EZJA 4Z78A 5HYQB 3G5YB 1HYSD 3AREB 5FGRA 1MAML 1CE1L 1A6UH 2Y25A 2XQYG 3L3JA 3PHQB 5IVXF 3CC5A 4FQXD 5F21B 2ICWB 5D6CB 3TO2A 1G7MB 4R26H 1XIWC 3OMZA 4ALAH 4OUOA 3LMJH 1QLFB 5EOCJ 4APQB 2X4TA 4GAJH 5DRXB 5H2BB 4J3VA 2UUDK 2W92A 5HXMA 1A2YA 3QG6B 1F4WH 3D85B 4YPGA 4JQXA 4OZGA 1VGEL 3O2DH 1EJOH 3VFUA 1X5LA 3Q1SH 3MXVH 2YZ8A 2APXA 2ZCKL 4YXHH 4Q9CA 1MCCA 1ZLVH 2FYYA 4PJAB 4TSBH 4LBEB 4HUUB 3MLPA 3SDDD 3L5WA 4Y5YC 4PS4L 3ULVF 5DFVD 1LE9B 4XGZA 1AY1L 1NCBH 1RZ7H 4NRZA 4P99A 4URTB 3EYVA 4P2QE 4PJ9A 4Z7WB 2HJFA 4PRBB 1K6QL 5C0ND 4OLEA 2BOBA 3G6JA 1MPAH 3HE7D 4Z7UF 1U8HA 4HBCL 1RZFL 3EW3B 2L7JA 3ARGA 4UBDC 3E6HA 3OHXA 4Z0BL 1PG7H 4S2SA 3T1WA 1R3IL 2CKBL 3FB6A 4RMRA 1QBAA 5GGRA 2VH5H 5L9DH 5DD0L 4KI5E 1ZVSB 4PJ8C 3GSWA 3O9WA 2GTWA 3SE4C 4X5XA 5HYIA 5I8KL 2VQTA 4DKFL 3IFLL 1WTGT 4JZJA 1A6PA 3MLRH 5DJ2B 2Y36L 2F74B 1BIIB 3U83A 3MCG1 4AY0A 4JFPB 2Y5TB 3OX8A 4WENB 4ZXBB 2K7QA 2VKXA 2OBGA 3SKOB 3H9SE 1NAKH 3MA7A 1N5YH 4P5TD 5MHSD 1MCKA 4CGTA 3MV9B 4FQCH 5TGBB 4EN3B 4LSPL 4I2XB 3JTTA 5HSFA 4XVUD 3TYFB 1FC1A 3QXAB 25C8L 5EOTB 3V52H 3QUZD 1QHPA 4R90H 4M4PA 4P46A 4U1IB 1ZHBB 4X7SH 3ARWA 5BJTB 2FR4A 3EOBA 5KSUB 3JV6A 3MLYH 5DSCA 4NZRL 1UB5A 4HUXA 4YO0A 1A0QL 3BD4A 2M1KA 4EI5A 1N7ML 5C2BH 4IJ3B 5T3XE 2VLKB 4OF0A 5F7MC 3U6RA 4EJ1C 1KPRB 5HGBB 2OMNA 3VGDA 1Q0YH 3D0LA 4XPGH 4ETQB 5GGTA 2EIEA 3L9RA 3QIWA 2IPKB 3NMEA 3VWJA 3K4ZA 4I0PA 3O4OB 1EO5A 1Q1JL 3VFGL 3F5WB 2AV7B 1KB5A 2A9MH 4M6NL 1GGCH 4WWKB 2BVQB 2DJ4A 4FMKA 3G5YA 5HYQA 4X7CC 1EX0A 3AREA 3K4DA 4RMTA 5ACLA 4Z7VE 3PHQA 1KBGH 2R0LH 4PJBF 4K71C 2VDQL 1MJJB 4MGXA 5HDBE 2ICWA 5D6CA 1G7MA 3UBXB 4NWTL 4G6AC 3ZZ1A 2IAMC 4OTXL 2ED8A 3G5XB 1U2CA 4APQA 4WHYH 5DRXA 5H2BA 3D1MC 1RVFH 5F71A 3QG6A 5KS9F 2R0KH 1RI8A 5HPMB 2FJGB 1MAKA 3D85A 3TH4T 5I19L 3W5NA 1NH6A 2OI9B 2VLLB 1QKZL 4JFFE 2VXQH 2CJUH 1JNNL 3MV7B 4F57H 4NM8L 1JPGB 2YD4A 1ZT1B 4PJAA 4GO6B 1K9TA 3QFJE 4HUUA 1QQDB 4JVWA 2XA3A 5I1CH 1P2CA 1LE9A 4IRJA 3QQ9D 1OTSC 2ZCHH 4X6DF 3KLDA 1QFWI 3T2OA 4Z7WA 4PRBA 3QYCA 5FHBL 5I1JH 3EKCA 2AXGB 1T0MB 2FO4B 5CSZB 2E7CA 4HK3N 4B50A 4PJ7E 1XF2B 1QRND 3LS4L 2AJUH 4KAQH 1KTRL 2VZTA 4FNLL 2MSPA 1MCDA 2W0PA 4POUB 3WIFA 3WD5H 2B0SL 2EH7H 5GRUH 2GFBB 4HLZH 1ZVSA 5CUSL 4MA3B 3INUH 3TN0D 3CUPA 1LDSA 5B39G 2VB5A 3ZKSD 1JK8B 4TVPD 3RA7H 1P69B 1MRFL 5DJ2A 2F74A 1BIIA 4JFPA 2Y5TA 1UENA 4ZXBA 3SKOA 5DFWH 2QQNH 5HYJE 3GRWH 4G6ML 1TETH 1UA6H 2CK2A 3FRPA 2XTLA 1NKRA 2VUYA 3MV9A 5TGBA 4EN3A 5MP6L 4I2XA 4UB0H 4C56B 1MCNA 2XXCB 1FV1B 3TYFA 5BV7H 3DGCR 3QXAA 3ORJA 4R0LB 5FHAL 3RNKB 3OB0H 2K1MA 3TJHC 2IQ9H 1H3PH 3QWOB 3EYUL 4JRYE 4U1IA 4UU9B 1ZHBA 3SE9L 2N56A 5BJTA 4GMTH 3MUGB 2YMXH 2D3VA 3UJTH 2W07A 2EE2A 3QHFL 4KY1L 1T1XB 4OLVL 2NY0D 1TPXC 1UJ3B 3WFZA 3W0WE 4ZOAA 3ZKNC 3WS3B 2A83B 2OTUB 4DEPC 2VLKA 4PJ9C 3BW9B 1KPRA 2XI9A 4JRXE 3MLXL 5HGBA 3FQUB 2JJWA 4XPTL 4ETQA 4N1CA 1MJUH 4UOW0 1JPSH 4WFFD 4PJGB 4LCWE 4XPHH 5GZND 3VMOA 3WCYA 3TV3H 3GDBA 1OAYL 2JE8A 4JFEE 3ARGC 3VGAB 3F5WA 2AV7A 3GJEB 4WI6A 3BKJL 1GGBL 2X1PA 2BVQA 4KKCC 4K8RD 3VFSB 2ITDB 5J89A 1BEYL 1XFPA 3O9WC 1ZXQA 1KJ2L 4OBRA 4DZBB 3AB0B 4WY7H 1IGCH 1MJJA 5ADPH 1JBJA 3O8XD 1T7XA 4JZJC 3UBXA 4NC1E 3G5XA 5ADOH 3S37X 4TSAL 5MEQB 3D0VB 1DLFL 5J7CC 4RGND 1ZLUH 4ODHL 5CD5D 1MI5B 2Q7NA 4LIQH 5CLTA 3E2HB 2FJGA 1T6VN 2ZZUT 3AVEA 5CZVL 1DQLL 3PQYE 2B4CL 2UY7A 4XTRC 5IVZB 2VLLA 1HQRA 1WZ1H 3N1PC 1WJ3A 4FQXB 5DO2D 4GQ9L 1PKQB 2Z4QB 3HNVL 3LOWA 4LQFL 4YHNB 4OM0L 2VLRD 4H8WH 3MV7A 4O00A 1JPGA 1XEDA 1QLEL 1NFDB 1SEQH 1ZT1A 2P5WB 4M7ZB 1FRGH 4HT1H 1QQDA 2MNUA 2FGZA 1HEZB 4QO1A 3GBNH 4WEBL 2EDBA 3WLBB 1OAZH 2BSSB 3IRZA 5FYKE 1Q72H 2AXGA 3BRGC 5CSZA 4EI5C 2FBOJ 4GUPB 2AXHA 4UV4H 1XF2A 4PJCB 5EH1A 1J0HA 2NY6D 1KJVA 2YD5A 3SDDB 1L0XA 4OCWL 1T20A 4GJTB 3LB6C 4ONOA 2EDLA 4ZO6A 4P9HL 3STBA 4PD4J 1JMZA 2GFBA 1AE6H 1WC7B 1KV3A 3VWJC 5AZ2H 4I0PC 4MA3A 1KJ3H 4QT5B 5IMMB 4LFHG 3CPLB 4KK5D 1CDYA 3VWKD 3MRQB 1ZS8B 1E4XL 1UWXK 1JK8A 3HHRB 4HUWB 2V2WB 1MVFA 2YRLA 5T3XH 1F4HA 2CIKB 3AREC 3H42H 5L2KD 2CDFB