1I85A

Crystal structure of the ctla-4/b7-2 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
MLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T LYMPHOCYTE ACTIVATION ANTIGEN CD86
publication title Structural basis for co-stimulation by the human CTLA-4/B7-2 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i85A00
3WIHL 1HYSD 3WXVL 4UBDD 1CGSL 2Z93A 3JWDC 4MCYA 4X5WA 1R5WB 4XCYA 4K9EC 4OD2A 3HR6A 4YGAB 5GSRB 3NIDE 3IDYB 5E94B 4ZUWB 5L7XH 2R0WH 3OV6A 4AL8H 1RY7B 3H9YA 2GJ6A 4BH7B 3U1SL 5DEGB 1FO0B 5HVWA 3O6KL 5I18L 5IB4B 1P7KB 5DD3L 4JZJA 3SE9L 4ELKB 3UTPD 4R7DA 1IM9A 4LU5H 4X6DA 1INDL 3MRLA 5KSAC 3FOMB 4HK0B 4LDEB 4Y4FA 5D96B 4CU7A 2ADIA 3VXRA 1U91A 4UT9L 2MPAL 1HSAA 5MP6L 3ARDD 3SJVA 4OCSH 3H3PL 3I6GB 2BNQD 2ZCKH 4ZDHB 5B3JF 4PRHE 2ERJC 5F9AC 4O51A 3VFUA 2FEEI 3T04D 2C3VB 1RK1B 2E6PA 1UWXH 2KZ1B 1Z0NA 2LAGB 3L9RA 3UTQB 1T7ZA 4NJ9L 5E6ZA 2ADJB 4FQIH 2Q8AL 4GRWE 5A1AA 5DC4B 3ULVC 5IF0B 4Y5XC 4M93C 4XWGH 3RWCA 4NN5C 3IRPX 3QFDB 4CAGA 5HI3D 3EYQC 4HIJA 2C7UA 5FGCE 3MBEC 3C9NB 3GMQA 5E2TH 5F1KC 5TE4H 1XF5B 1OPGH 1FZKB 4HT1H 3CFBA 4TSAL 2YN3A 4FXGA 4RGNB 4J7RA 4PJ7A 2W07A 1GGYA 5IV2B 2VJXA 2X1PA 2Q1EA 4PJCA 2XFXA 1B2WH 4XBGA 1FRGH 5DK3A 4JDTL 2Y6SD 3TNMB 1U8KA 3QUMB 4JRYB 2WMPA 3BD3A 5JNYB 5L9DH 2JELH 3U0WH 4J1UB 1VGEL 2NXYC 2X89A 5IVXA 2IFGA 1PSKH 2OX5A 1NUDA 4O9HL 5J11B 1GZQB 4M8VA 3FQNB 3IXTB 4YK4B 4U6TA 2BDNH 3DSFL 4LLUB 1T22B 1GOGA 4N9GB 5EOTB 3H3KA 4HKBA 2R69H 5JR1L 5IQ9B 1CDBA 1TXKA 3O45B 4NWTH 3ZTJG 2UWEB 5B22A 3SE3C 2BNQE 4OBRA 1D6VH 3GO1L 4LPYA 3BFOA 3FB5A 3OGOE 1NPUA 1NAMB 3QUZD 3GEWB 4LARH 4BSVB 3FQUA 4HWNA 5GISL 3DVFA 3GKWL 3O3DB 4FRWA 1P7QA 4HMEA 1P84K 1KIUA 4JEGB 2AQ1A 4E5XB 3EDDA 2R1WB 4JRXA 5MI0B 3ZMRA 3BZ4A 3AY4A 1P7HL 1JL8A 5HGAB 4LCIH 3WXWH 3DX9B 1DANT 1N8ZA 5D1QB 4NQEA 3SE8L 5D93B 5FGBC 2DS4A 3VFVB 4OZHF 5DC0A 4RAUB 4U7MA 1QLEL 4ERSL 1PGRB 3KLSA 1LQSR 4ZPVA 4Z77B 4KQ4H 1FO0H 1T1XA 3MV7E 1INEH 2A1WL 4M3JA 4GG8A 4JM2F 4JFYB 5GJSL 4G7VH 4QCIB 4LLQA 5ICXA 3GSXB 5IJVA 4O5LL 3NA9L 4JG1H 4O02H 5LKNA 1JTTA 4EUPA 3FT2A 3TVMD 5CSZB 1SJXA 2DMCA 1MRDH 3U30C 3LRGA 1AKJA 3LSOA 2FATH 1WK0A 1SQ2N 4WHCA 2Z8VC 5KOVC 1JZ2A 3QUXA 3QPQC 1SJHB 1JF1B 1PJ9A 5FGSA 3U9PH 3A6BL 1D5IH 4Q9CA 4G9DB 4CU8A 4ELME 3WEXA 2BNRB 4LASL 5J6GB 4HK3J 4NOFA 6CGTA 3R8BB 1MVFA 4KZDL 1MFAH 4KKNA 5J13B 3QO1A 3NFSH 3UBXI 3BRGC 3K3QA 3VFNA 1CLZH 2X4TB 2OTWB 4GXUM 4RDQG 5T1MB 2ZOKA 3C8HA 3QDMA 2R1YA 1IGTA 3DV6B 1UZ6F 5F9OL 2B0SL 2LV4A 5I9QC 4DW2L 3REWB 4A2MA 4U1SB 4POZD 1WBYA 2VLJA 2MCG1 1DFBH 2Y36H 2Q76A 2VDNL 4D0DA 1PEWA 1QO3B 2ARJA 2NY5L 5AEAA 3HNSH 1ADQH 4DGYH 3P4OA 1LD9B 2B5IC 4GSDH 3KGRA 5FA4A 5D7JC 5IMKA 1PZ5A 3WO4B 2DQCL 2IWGA 4ONHB 4R4NC 1S3KH 5ACLA 4OCYL 4BELD 1MCRA 5CJQL 2Q7YA 5EFIB 3QUMH 4JRYD 3VXOA 5C0EA 4MCYB 1CFNA 4W68A 4X5WB 2EDLA 5EULV 2NY6B 2CQVA 5FYKL 4OZ4A 4OD2B 3LKSA 3T3ME 1K4CA 3U79A 4MQXD 5ALCL 2VSDA 1IGYB 2GJ6B 4Y16C 1F58L 1VSCA 1P5VA 4RWHA 5DJXA 4A6YH 3L6FB 3S34L 3MRDA 3UTTB 4JGJA 4R7DB 2W59A 1RJYA 1MI5B 5D9SA 5EOCH 5C1MB 4LLAA 4PJIF 4BZYA 3MRLB 2BVPA 4ZO8A 4PB9H 2FB4H 4NQUA 4KJPD 3MR9A 4Y4FB 2ADIB 3VXRB 1U91B 1NAMH 1HSAB 2QADB 3DBXA 4U7SA 1KCRH 4X9IA 4M6MH 3SJVB 5EUKA 1SMAA 1UXSA 1FZMA 1K5NA 5ESQA 5KOMC 2EDXA 3OTTA 4ODSH 2AAVA 4W4OC 5IGXL 5CJ8A 1IE5A 4Z0XB 3MLUH 3FO1A 1BMGA 3NZHH 4PPTA 1IKNC 2ZJSL 4HJ0C 2FX9L 4OM0L 4AM0A 4YUEL 3RNQA 2VQTA 2V5RA 3RWCB 1UXWA 1MAKA 4ZD3H 3PIQB 5DZNA 4NZUH 1CWVA 1ERNA 4HIJB 1F11A 1XH3B 5HGHB 5LJYH 4DZBA 1JN6A 1S9KC 3CFBB 1LGVA 4FXGB 1LDSA 4JRYE 1Z5LA 4PJ7B 1F6AB 1LO3L 3P0YH 3WS3B 2YD9A 1E4JA 2XFXB 5E2UH 2IFFH 4NJAL 1K8IA 4NQDB 2QQNL 3F7YA 4JB9L 4XBGB 1J1OL 2J6EH 3BP5A 1NUFA 2DF3A 2LU4A 2DLIA 4R8WH 4XHJD 1IC7L 3SO5A 3BAEH 1OHQA 2UWEE 3I50L 2EDBA 4ZNEE 1BBDH 2YUWA 1FYTD 1CD9B 1YC8A 5IP4A 5TDPA 4HKBB 5C0CA 3CUPB 5E08L 4NIKB 4PJBE 2VMFA 3SDCA 1F8TH 25C8L 1IMHC 3VGAC 4J3WA 3G5XB 4XBPA 4XCCH 3FB5B 1T21A 4N0YH 2P24A 5FYLD 3T0DA 4PJFF 4YHPB 5FYLH 5EIQA 3LVEA 1KJ2A 1YA5A 4OB5H 2VIRB 3LPGA 4M7ZC 3UAJD 3S88L 4M1CC 4TRPH 2X10A 1YEGH 3FQUB 4YGVA 3OB0K 3UYOD 1NANI 4U1GC 4ZFFA 4QRUA 1P7QB 4J3UA 1WZKA 3F6IA 4KMTH 4KROB 4NKOA 3UYPA 1S7WA 7CGTA 4QTIL 3WV0A 5DEFA 3BZ4B 2LVEA 2X40A 1MNUH 4LSVH 1Q9OB 2R0LH 2F58L 2W0FA 1G0YR 4FZ8H 2W0KA 1NBVH 2NY6D 3RWGB 4IRSC 4WGVB 3TV3H 1GGBH 5CZVL 3UMTA 5JPMA 1BBJA 3TA3C 1K4DA 5E1AA 2GCYB 2GJ6D 2H8PA 4I5BA 1VESA 3IAQA 3SY0A 3RX7A 5LWYH 4M1DH 3W5NA 4PLKC 5L6YH 2LFGA 2SEBA 4GG8B 3V6OE 1LILA 1IM9D 2BHUA 4LLQB 5ICXB 5IJVB 1OF2A 3T4AA 4LOUD 3TNNA 1F13A 4Y4FD 3FT2B 4KUCF 5EU7C 3VXRD 1RVFL 2QADD 1EJOL 5JW4M 3SJVD 1AKJB 3LSOB 3E3QE 1FLRH 3N1FC 1HDMA 3MFGB 4DZ8A 3MV01 4CJ0A 4P2CG 2Z8WC 3FN3A 4JDVA 3QUXB 2QQLH 3STLA 3WUZA 1EO8L 1H0DA 5DO2C 4PRBA 4JZNA 3ULUC 1P4LB 4M8QA 1F6LL 4GKZB 3WEXB 2AK4B 2E8YA 4R0LC 4IIQA 5FYLE 1HN1A 1CIUA 1QSVA 3H9SA 4TNVF 1FL3B 2EH7H 2RIKA 2AJ3A 1NCBL 3VFNB 4PP1C 1LWRA 4QO1A 2ZOKB 3QDMB 2R1YB 2FGWL 2O5ZH 5JDJA 1AGEB 1XGQA 4JO4H 4K94L 4HIEB 3ORJA 2Q7NA 4XPGH 1IRAY 3KPMA 2D7TH 2BCKA 4HUMB 3NH7H 4QRSA 2BFVH 2EDHA 1WBYB 1UH4A 3Q5YA 4Z76A 4QXTB 2E7LA 1NLDH 4KJWC 4BQ8A 3GMOB 4RNRA 5HI4C 3ARFC 1QLRA 5IMKB 1PZ5B 3ZKNC 1KCVL 1J11A 2GJ6E 4PFEA 4XP9H 1FNAA 4ZG1A 2A77H 4B7IA 1FIEA 3FO0L 3VXOB 5C0EB 2X89D 1CFNB 3EIFA 3EO1A 3WFDH 1MI5E 2EXWD 1A6UH 1EEZA 4U1MA 4KHXH 4X6DE 4RRPA 2DL2A 1JP5A 5T5NG 3VXRE 3BN3B 4OGZA 3QNYB 3BP6B 3SJVE 3R8QA 4NKDB 3DYPA 4JVUA 5JIIA 1QBAA 1KN4H 4EOWL 2FL5A 3QNZA 3VE0B 4AT6B 1RJYB 3VWKC 3RU8H 3O3UN 3EZJB 2GFBA 3MR9B 4UNUA 4HIXL 1Q0YL 3KPSA 3DBXB 3A6CH 3EJYD 3O2VL 2WP3T 3VDCA 3BRDA 1UB6B 2X9YA 5EUKB 1UXSB 2AXGA 1BFTA 3PP4H 1P7QD 1K5NB 3VD3A 3DVGA 5ESQB 3ZT5A 4U6XB 5AG9A 3H0TB 5JHDA 4JRXD 5LBSL 1AFVH 1RUQH 2QHLA 5F9WC 1N3NA 1EFXA 1A21A 4PJHF 3AS1A 4P46C 2AEPH 4XP1H 2OYPA 4NQED 4G8EA 4PJ7E 4CVXA 1T66C 1UXWB 1JGUL 4XWOD 1ZHLA 1SYVA 4UIKL 4XNUL 4KFZC 1BQHB 3HMXA 2VITB 2GTWA 4Z5RA 4DK3A 4HX1B 4DZBB 1JN6B 4LP5A 4JFPA 1G84A 4I18C 4PP2A 1Z5LB 2CPCA 5IVXE 4EUPH 3BEWA 2NW3A 1K8IB 1EX0A 3F7YB 4F8TA 3C5SA 3BP5B 2YK1L 3QHFL 2XPGB 4LLWA 3FTGA 1N2RB 5BVJA 1N59A 4K07A 2DIJA 4YHOL 1S7RA 3CCHB 5GXBB 2Y07L 3NOIA 1C08A 1MELA 2ICWJ 3B83A 5T1DL 1R5VA 1KXQE 1VACA 1VEMA 1KF9B 3CSYA 4GW5A 1U42A 2ITDA 3EW3B 2E27H 4OIIL 4F57H 5F7EH 4CU6A 2ZG1A 3KDMA 3PGFH 5C0CB 1KB5A 1PG7L 5DQDL 3G5YA 3SDCB 1DSFL 2BP3A 1RHHA 3JZ7A 4WFED 5J12C 3TH4T 1T7WA 1MCOH 3QDMD 4XBPB 3C5ZA 3O8XA 2A6DA 1T21B 4M9PA 1A7PL 4M03A 3M8OH 43C9A 5JLZB 1U8OA 4JRXE 4Y2DA 4WUUA 5ETUA 3UO1H 5C3LD 5DD6A 2L7UA 1UKTA 4YGVB 4JY4B 2VLJD 1UZ8B 4WV1B 4NO0A 4QRUB 1MLCA 3LQAC 1AIFA 1U36A 3S5LA 3TIEA 3VCLB 3WDHA 3QDHA 4NQEE 1S7WB 1GGTA 4D9QE 3BEVA 2FRGP 4NQSA 4OFKA 4JGMA 1E27A 5DEFB 2VDLH 4QGTA 3NCYS 1LO2H 1HH6A 1OY3B 4FFVD 1S78C 1F02I 5CBEA 2W0FB 1MHPH 4UDTA 3MACL 1VFAA 2PTUA 2ZUUA 5IB5B 3K1KC 4UILH 3GMLA 4RISH 5KTEH 4JFFA 3HPLA 4BZ1L 3RVTC 5JPMB 1FZOB 1HCVA 4I3SH 1K4DB 5AZEL 5GSVA 5HYSA 2X1OA 4N1EA 4I5BB 4HGKC 1M71A 3F58L 2Z9TA 5C07B 4AEIL 4QHLB 3WHXB 5F7DA 5BV7L 4GO6B 1IL1A 2VRAA 4P0DA 3O3BB 2AJUH 4XPFL 5DJ2B 4C83A 1OF2B 4KGJA 4W4NA 3OQ3B 3BISA 4X4ZA 1IGJA 4RWYL 4RX4A 5HPMA 4TVSa 3U6RA 4NRYA 3ARPA 3WJLC 2AK4E 4FFYL 3Q3GB 4GS7C 3AAZB 4LPTA 1QP1A 5MENB 2NR6D 1NLBH 2A38A 3HHRB 4JDVB 3STLB 4QOKA 5E56A 2PCPA 1FYHB 4YLQT 5I1EL 5DUPH 1H0DB 1WFTA 4PRBB 4JZNB 4WFEE 3QDME 1ZHKA 4J4PA 4WO4A 1U8HA 4L8BA 2BNUA 2XA3A 3SDYL 4WHTB 3GIZH 4I48A 2NQCA 3V52H 3H9SB 2IF7A 3GUTA 1SJVA 4YXKH 4J3VA 2AJ3B 4MQ7A 1T03L 1GGCH 1KENH 1MWAB 3GMNB 3U2SA 4QF1A 2DDQL 2EH8H 5ID0A 1CLCA 1XGQB 5ICZA 1W72B 3QPXH 4DGVH 2ID5A 1MJUL 4PY8J 3VRIA 3HUJB 1KPUB 4X6BA 5DXWA 5C6TH 3DPBA 2BCKB 4NHUA 3STBA 1NCCH 2KBGA 1LO0L 4Z8FH 2H2SC 4OM1H 5B39B 3ARGC 4NN7C 1T83C 1XCQA 2CMRH 3UX9B 4LNRA 4M7LH 1RFDL 4RNRB 4KKCD 3UTSA 4UINH 2RGSA 3MJ8A 1FL6B 2YXFA 1QLRB 2R8SH 2VN4A 1AXIB 4Z7WF 5KG9A 1Z9LA 5KVEL 2HMID 5GS3A 4RIRA 4EDXA 2ZUWA 3VDBA 3VWJC 4U0RC 2XWBA 5I30L 3EO1B 4ONFL 3S9DB 2WK2A 1K9TA 1A02N 4LVNB 2OZ4A 5GGQH 1OVZA 5I0ZA 2RFXA 4F7EB 3ARVA 3DARA 1HHKB 5C0CD 5HVFB 4MVBD 2JIXB 4FFZH 1KCUH 2C9AA 4OCRH 5FA3B 3SDCD 1MJ8H 4KI1A 2FL5B 4GLRH 1CFQA 2W1NA 4H88H 5ABDE 5C0FB 2GFBB 2BHYA 3B43A 3N0PB 4G6AC 1F4YL 2X2YA 3KPSB 1T0PB 3TJHD 2X70A 2W9EH 5DMGD 1MFEL 2GSGA 2AXGB 4QXGL 5CILH 4CMMB 3DVGB 4WU5B 2CUMA 1R3KB 4NNXA 5C0RL 5AWNH 4KPHL 1GYAA 2YC1A 4WY7L 1IZKA 2BMKA 1OL0A 4ZAKC 5GS2D 5GS2H 2VSCA 2DI7A 3T2OA 4PJXB 1EFXB 2MKLC 5I1AA 2BSTA 2G60L 1OTSC 3CGTA 1NFDF 3VMOA 4JHBA 5B8CA 4EI6A 4PJ9C 3CC5B 4OLUL 1NDMA 3CLEH 3BO8B 3CDCA 4G8EB 3HI6L 1NCDL 4M6NH 5TE7H 2DQUL 2OL3A 4YBQC 3QIBC 5IFAL 4N5UA 4ONGH 1SYVB 5C2BH 3OX8A 2R4SL 5KN5B 2O61A 1UCBH 3P2TA 2GTWB 3ZDZF 4Z5RB 3GI9L 2EE2A 2CJUL 4FZEH 4KWUA 4U2YA 2GY5A 4W6XB 3BEWB 1X5JA 2R0KL 3G08A 2ICWA 2NW3B 3GFUA 1VFBB 4OLEA 4KTDH 1OLLA 1MHCA 2EIBA 4LLWB 5C8JA 5BVJB 4R26H 1N59B 3WMSA 4HXAL 4J2XA 4H1LA 5DLMH 5C0CE 2VZ3A 3EO0B 1DJSA 5LCVH 2D0GA 2FWOA 1R5VB 4RMQA 1ZT1A 1VACB 4ZFOA 1UEMA 1T0NA 1KTLA 4GW5B 2HRPL 4F58L 4S1QL 2ITDB 3R1GL 3I75A 3HS0A 1U8JA 3H9SD 4J3OC 1KJVB 4XMPH 5DD1L 3KDMB 5C86A 3G5YB 1JHKL 1H15A 4O58H 5FAAA 1MQKL 4BSJA 4TOYH 5SV3A 1I8MA 1QBLH 2OTUA 3C5ZB 4U1NA 4NZDA 2BOBA 1VB9A 1I1FA 2A6DB 2ED9A 4TTGA 4LCUA 43C9B 3OAYH 4QYOA 4KRPD 1DN0A 2VZTA 4WUUB 5ETUB 5DD6B 1N7MH 5I16A 3OR6A 5JQ6L 1A7RL 1EEUA 1PQZB 3QQ4A 3IAPA 3RIAK 1WF5A 4JN1H 1MLCB 1AIFB 1YMMB 2AVGA 3S5LB 3QG6A 4OGXH 4Z7QE 4KJQC 3ULVF 4NQSB 3BN9D 4JQVC 5T33L 3VXPA 4PREA 1BGXL 1A6VH 4LSDA 3GNMH 5J9PA 1HH6B 4IOFD 1JGVH 2F8XC 3ZE0F 4MDJA 5CBEB 4H26B 4UDTB 5C07E 1EK3A 2AEQL 1MCWW 5BVPH 2WIMA 3DIFA 1VFAB 4P3DA 4X6CB 1DBJH 1I85A 2UY7A 4R6UA 4XVJH 1CG9A 2F54A 2J3SA 4JFFB 3HPLB 4JPWL 3D87B 1ND0B 3RIFK 4YIQA 5GSVB 1K3ZA 1SBSH 1PKQA 2IAMA 1B3JA 2AJVH 4Z6AT 5BW7C 2DQTH 4OZGB 2R2CA 1IL1B 3QBTB 2O5YL 4DN3L 1ZVYA 2DYPA 1A9BA 4K8RC 3E6HA 4GRLA 5HDQL 1IGJB 3HFML 4HIHB 5HPMB 3KPSD 4NRYB 3HZKB 4KVCL 5BQ7A 3KYMA 1D3CA 1HH9A 2DLHA 3P0VL 1QEWA 1MCSA 3MLYL 2BVYA 2NLJA 1A6WL 3H9SE 1MPAH 4L8CA 4QOKB 3BXNB 2XWTA 2PCPB 1OAZH 4EUPG 3K80A 5JHDD 2YD7A 5D5MA 1ZHKB 2GYSA 1GAFL 1U8HB 3PP3H 4L8BB 2BNUB 1IC4H 4UOW0 1H3WM 4WNQB 2BJML 4B5EA 5FIEA 1EFXD 1UM6L 4WU7B 4M4RA 2XKNA 2AGJL 2J1KA 3GUTB 5B38A 2XQBH 4L8DA 4MQ7B 5EH1A 5LG1A 5CWSA 1JPTL 3EYFA 4WFFD 1C7SA 3MLSL 1S9YA 5ID0B 1E4WH 3CX2A 3EZ8A 2PTTA 1K6QH 4IMKA 1PYWA 4NT6A 2R29H 3C5JA 3ZHKA 1U8IA 3HMXH 1I8KB 4NHUB 4YC2C 4OKDA 4LPUA 1YPZA 3TC9A 1XCQB 3IETA 2AJYH 3BWAA 2R9HD 3EGSA 3QDGA 5ICYB 4LNRB 4ZXBA 2XOTA 5T3ZL 4D0BB 2NXZB 3WIFA 3MJ8B 5BRZB 4HXBH 2WUBH 2BY3A 3KPLB 1P5UA 1XIWA 2XQYG 4RA0C 5LAXA 4JAMB 5E2WH 3HC3H 4RGMB 4RIRB 4Y8DC 2FHBA 3L3OA 3N85H 1OQXA 2OXGA 4ORGA 2IQAA 5DVLA 2XWBB 2VWEE 3I2CL 5CCKH 3T2NH 1WGOA 4TNWF 3T0VA 4XPBH 1CIDA 1WAAA 1DBBH 1UM4H 5KVGH 1OD7A 1HYSC 5EA0L 3UYRL 3KPSE 2RFXB 1RZKC 5CHNB 1KB5H 1QVOA 1JUFA 1T89A 3HZVA 4YHYC 3EOBA 1CFSA 4LU5L 3TFKD 1NJ9A 1CFQB 3C5ZD 3O8XD 4APQC 1U8NA 2HT2C 5JHDE 1V3LA 4K7PY 3QCTL 4Y2DD 5KZCB 4G6ML 1ITCA 3WS6A 1CK0L 2X70B 4PJXE 4RMWA 4NO0D 2R0ZH 4WHDA 3MNVA 3MGOA 2VKWA 4NNXB 3TLRA 2F8VA 3ARDC 43CAA 2YC1B 3C6SA 4M7KH 5CS7A 4FP8L 2BMKB 3INUL 4HC1L 4CKVX 4F37K 1J8HB 5I1AB 2BSTB 4CBPA 2HT4D 1TTFA 3BHBA 1G9NC 4Z0BL 5B8CB 1KCSL 4EI6B 1NEZA 1NDMB 4Z7VB 3T8XB 2OR9H 1HK6A 4AEFA 2OL3B 4JFFD 4XWGL 2HLAB 3RJDA 1F00I 2WIIA 3OX8B 4LCYA 2ZKHH 2O61B 1G7HA 1VADA 4KK5D 4P2OC 4UTBH 5DJ0B 5E2TL 5I19H 4HT1L 4Z78A 3SE4C 3K81A 3ALWA 1X5GA 2JE8A 2X7LA 3VFSA 4RX4D 4I0PA 3G08B 3ET9F 2ICWB 4BSWA 4X6EA 1QHPA 1U8MA 4IOIB 2YUXA 1MHCB 1GJIA 4HKZA 2JELL 4QOKD 5DRZA 3M17A 1RD6A 5DJAA 1VFMA 2FWOB 3MRHA 4OI7A 4J4PD 4ZFOB 4WO4D 2BDNL 3CFDA 5CJOH 2Y6SC 1JNLH 1T0NB 1ZHNA 7FABH 1Z6JT 5I1CL 2FLRT 3BYYA 3I75B 3HS0B 1U8JB 2R69L 2XYCA 3T77A 4K3HA 4WUUE 3OMZA 3ESUF 2J2ZA 2NY0C 1H15B 3Q2CA 1GC1L 4P5TB 3O81A 4XPTH 2AK1H 1N0XL 3OKKB 3JXAA 3ZTNL 1D6VL 2V5TA 1YMME 2OTUB 4R3SA 3FONB 3OSKA 5BS0A 1J8KA 4NRZA 4U1NB 4KMLB 2BOBB 1I1FB 2D7PA 4LCUB 3S37H 1SBBA 4DKEH 1REIA 1DN0B 1LP9A 1A6TA 4LARL 4JFDB 2Z31A 5F6IC 5E4IA 5I16B 3OR6B 4H5SA 3KYNA 2AI0H 5TQ0H 2HH0L 3QQ4B 4U3XA 3QG7L 2W65A 3CFCL 4FQ2L 5D7IB 4X6CE 3UTSD 4Y2OA 4PIRF 2R1XB 5F71A 1AR1C 3QB7C 2WUCL 3DETD 4JFFE 4MX7B 3VXPB 4PREB 1T5WB 3R0MA 5ERWA 5ADPL 3C2AL 2FIRT 2QSCH 2ZNXA 3L7FA 4MDJB 3PWNA 4OZGE 4XP5L 3DIFB 1AJ7L 2I24N 4P3DB 5ANMA 3VGEA 1MFNA 2CR6A 5IT2H 1D7FA 3HG1A 2VL4A 2BRRL 2OM5A 4GH7B 4IRZH 5KSBA 5F89A 1HE7A 5DK0A 2OZ4H 1DEEA 4YIQB 2EE6A 1PKQB 2IAMB 3CVHB 2VERN 2W9DL 1INEL 3P9LA 4L5FH 5FOJA 3IDYC 5F72S 4BZ2L 5GHWL 2VYRE 3BPNB 2ILLA 4HS6A 4QOKE 5C0IA 1RAMA 4JG1L 5DMKB 12E8H 4EN3A 3FT4A 4GRLB 3T3PE 5KZCD 1MRDL 1NAKH 2FJGA 4XVTL 4JPKH 1G9MC 5BQ7B 4F15B 3KYMB 4LKCB 4Q6IA 1JHLH 4YDLB 1DQMH 2FEDC 3Q5TA 2NLJB 5D96C 4L8CB 2XWTB 3QJHB 1D5IL 1WSST 2VXQH 4LPXA 3W2DL 5EUOA 5D5MB 5DR5L 5K9OA 1FG9C 1BOGB 1BREA 3HRPA 3MRQA 4WI7A 4YBLB 3DX8A 4YHNA 5GJTH 4EJ1C 1MFAL 3G6DH 1J12A 1MY5A 4S1SH 2XKNB 3NFSL 3PWUA 1NMAH 5TJWK 1CLZL 4NGHL 5CWSB 4KC3B 3EYFB 1KJ3L 1S9YB 1MLBA 2OL3H 5KS9B 4XXDB 5HGBA 4Y5YA 2DD8L 1PYWB 3UTSE 1WZ1H 3EOTH 1J1PH 4NT6B 4NM4H 1U8IB 1KELL 2V2TA 1J10A 4FNLL 5ID1A 1JRHH 1YPZB 4G3YH 2Y36L 3IETB 3QDGB 3EGSB 3TZVA 4F9LC 3ZO0A 3HNSL 3WIFB 1CDYA 4X6FA 1NFKA 5DQJA 4RFNB 4POZC 1HHHB 5D2LB 4ZO6A 4RGNC 1XIWB 1YQ2A 4LSRH 5LAXB 1OSPH 2F74B 1QRKA 1X7QA 4Y4HA 1U6AL 1R3LB 4H1LH 1AGBA 2B8OT 4F9PC 4ACPA 3MXWH 1PD6A 4YHZH 1AP2A 5ADOL 5EO9A 5IHUH 1YQVH 3FN9A 3O0RH 1QFOA 4A6YL 3B2UD 5J11C 1JUFB 4PTUA 1YYMH 4YK4C 3EOBB 3MOAL 1QZ1A 1CFSB 1NJ9B 3CSPA 2YD4A 3ARSA 1U8NB 4YWGH 2F9BT 1BP3B 2HP4A 1G7PA 2WBWB 2ZUTA 3ULUF 2XXCB 1IGML 3EOAA 4P5KA 5CINH 5DTFA 3VI4E 4KJPC 3MNVB 3MGOB 3VXTA 4YXHH 5IESH 43CAB 3M1BA 2V17H 3C6SB 3U7YH 4WI9A 2ATKA 5GRUL 4N0UB 4ZYKB 1WCQA 4F8QA 5LQBL 2BVQA 4XCNA 5DI8B 3BHBB 1XF4A 4PLJD 1BFVH 1NEZB 4G9FA 4YFLF 1RUML 1X5AA 2CDGA 1UWEL 2F54D 2I5YH 4YBHA 1CDUA 5I66A 3RKDC 4BFEA 3ZLQC 5BMFL 1KLGA 2WIIB 4LCYB 5DVOA 4WTXA 1G7HB 5D1QC 4OUOA 5GS1A 5D93C 3TESA 2YD5A 4Z78B 1CICB 2GW5A 2DYPD 2X4QA 1Z2KA 2DQDH 4KTEL 1IC1A 3V8CA 2X7LB 4GRLD 3KPTA 3VFSB 4PJDB 4I0PB 5TH2A 5K9QI 5F1IA 3KYKL 1KC5H 3VGFA 3OB0H 1FH5H 5ITBL 5BOPA 4GMTL 3SGDI 5DRZB 1EO5A 1Z9SA 5E00A 4HJJH 1FDLL 3HNTH 1ZT4A 3GJEA 1CCZA 5C3TA 3MRHB 2QJDA 3CFDB 4XHJC 1ZHNB 2C1OA 1YEDB 4DUVA 2H1PH 5JXEA 4LRNH 3T77B 2YD8A 5JHLL 5KW9H 3PUCA 1F8TL 4HS8H 2VLRA 1XF2A 5FYJU 3TBVA 2ICEA 4H20H 3E3QC 4FXLA 4R3SB 5BS0B 4NRZB 5D7IE 4I1NB 5GGVY 1EDQA 4FMFA 3O9WA 3BKML 3OXSB 4OB5L 1LP9B 3WJJA 3TT1H 5EC1B 5AZ2H 3GBMH 2Z31B 3UPRA 1FNSL 2B7DT 3RUGA 4H5SB 3KYNB 3QDGD 2JJTC 2ADFL 4R97B 4ZXBD 2W65B 1EBPA 4KMTL 2V2WA 5I6XB 3H42H 4YZFF 2F54E 3TJEL 1DQDH 5EBWB 4XXCA 2GQHA 3QXAA 5ERWB 1XIWD 2R0LL 5J3HC 2A9ML 1PKQE 5F3HB 1NCAL 1VFOA 5EU6A 3MA9L 3GSQB 1E0OB 1NBVL 1R0AH 1T2QL 2BZDA 5FO8A 5ANMB 4YEEA 4P2QA 3WO4C 2B1AL 5JUEH 3TV3L 1W2KT 1NGPL 5GGUB 2VQ1A 5F89B 4CGTA 4M6OH 2K1MA 1DEEB 1R3IH 2NY6C 1MEXL 4B50A 1IVLA 3C08L 3P9LB 1UQSA 5DJZA 1KEGL 4PGEA 2IEPA 4HS6B 4OT1H 2W92A 2DKSA 2C4XA 4EN3B 4NSKB 1BECA 3FHAA 4PBXA 2X9WA 5D5ME 1J7VR 5HYSG 2FJGB 4IS6B 2ARWA 2NY2D 2XY1A 3D6GA 5FUZH 2UYLA 4KKBD 4Q6IB 2EDWA 5GGSY 5E6IA 4U7KA 3GJFB 4Y4FC 2A6IA 1DVFB 2QADC 3WHE0 1NH6A 1RQ5A 5FKPA 5GS0D 5GS0H 2ITCA 2UZIH 4ENED 2DKUA 2MQ0A 5K9OB 5KS9E 4CVUA 2GAZA 3CX5K 1CD1A 4YHNB 1HEZA 5DUBA 4ZFGL 2P8MA 3PWUB 4ONOA 4Z9KB 3MRGB 3HE7A 1TFHA 1YPZE 4PV9A 3DUSA 3QDGE 1MLBB 4M6AA 3ZYJA 5HGBB 4Y5YB 2O5ZL 4P5MA 3QI9A 4JO4L 1KJMA 2V2TB 5D2LE 3QSKB 4L9DA 5ID1B 4LK4A 4HW6A 4XAWH 3TN0A 1FBIH 1NLDL 4ZMAT 5IMOA 1URLA 1MFBH 1JPFA 5FO7B 1VPOH 4X6FB 1RJLA 3DI2B 5DQJB 3RY6C 1JWSA 3SEPA 4XP9L 1OAXH 3GMRA 1Q8MA 2VDPH 3BP4A 1JJUA 5J06A 4DKFH 2GHWB 3NIFE 4L1DA 3B2VH 1DQTA 1RHFA 1A7OH 3WFDL 4ZTPH 5IOPA 1A6UL 4FHBD 4P23A 4EQ2A 3RWJA 1KN2H 3U9UA 5L88L 1A3LH 2Z8SA 5EO9B 1WJ3A 1B4JH 4OZIF 5JMOC 1PFCA 1FZJA 2EXWC 5HYQA 1KN4L 1GPOH 4PTUB 2F19H 3RPKA 1ACYL 3ROLA 1J18A 4RMVA 5BS0D 3G6JA 5TDOA 3RI5K 4PJ5A 5EZIL 3NIGE 2Z31D 2X09A 2AXHA 4P5KB 5FM5M 5DTFB 4IDJH 5C08A 3OR7A 4OZFA 3VXTB 3FO2A 2B2XH 5DUMH 3EJYC 3BKCH 1UJ3B 3RTQA 1WC7A 2C5DC 2APVA 2QTEA 3FQTA 1RUQL 4BFGA 1C8PA 1IBGH 4NBYB 1T04B 4NYLA 4U05A 2BVQB 3LQMA 1A8JH 4KROC 2BC4A 4DWHA 2AEPL 4XP1L 1B90A 2DQIH 1XF4B 4ZUSA 3NCJH 1F4XL 4G9FB 5BJTA 2CDGB 3HG1D 1OTUC 3HAEA 3AY4C 2PR4H 4IHOA 3FHQA 1A4JA 5I66B 4NQVB 1KLGB 1IILE 3E6FA 3HRZA 3DX7A 2IG2L 4P59H 1T0MA 4BUHA 3W11D 1TLKA 2BSRA 1QFUH 5I8CB 4EN3D 4JKMA 5FB8A 1K2DB 1WEJH 4X4MA 5F1IB 2P43B 1DLFL 4WVRA 4DTGH 2MCPL 4X8XA 5E00B 1VA9A 1XF1A 3RAJH 4XAKE 4LPCA 5BS0E 2EKSA 3ZE1F 2K3TA 3UROR 1OAQL 2YKLL 5J1AA 4Q9QL 2C1OB 3QUXC 1UWGL 1GHFH 4DEPB 1RJZA 1LP9E 2F5BH 2OJZH 2WP3O 4D9RE 4HLZG 3PGFL 4GKNB 4H1LG 1PAMA 3HC4H 2VDQH 2VLRB 2ICEB 4JN2B 4M1GH 1G0DA 1CFVH 4N8VB 3O9WB 1F4AA 1SVZA 3WFBL 1BVLA 3UPRB 3DJ9A 3RUGB 4DUWA 2FJHB 3TZVD 2XZAH 5ANME 4XNXH 3HG1E 2VZVA 1AC6A 4NWUH 3QXAB 3K0WA 2VDLL 5KSBE 3IVKA 5KVDH 1OCWH 1LO2L 1EMTL 4DGIL 1QFWI 1CVRA 4Y4HD 4NO2A 1MHPL 3ULSA 5EU6B 1HXYB 1HI6B 1TQCB 2M2DA 4UILL 4P2QB 2ZSVA 1UENA 3WD5H 3NBNA 3UJJH 5KTEL 1JNNH 2QSTA 1N0LA 1I9JH 2VQ1B 4FFVC 3MCLH 5DJYA 5IB3A 1PW3A 3WXVH 1J1XH 1NGZA 2GEEA 1CGSH 1Y0LA 2V7NA 2D9QB 3RWFB 1UQSB 5DJZB 4YFDB 2OBGA 4Z95L 1MH5A 4YR6A 3RZCA 5IW1A 4UZGA 1C5BL 3U1SH 3O6KH 3K8MA 5DD3H 3SE9H 5E6IB 4HS3A 5L0QB 1NLBL 1TNMA 3B9KA 1INDH 3CDGA 1FORL 5FKPB 5DGQA 2MPAH 2NZ9C 1HIML 3O2WL 4Y19A 1IFHH 2GAZB 1CD1B 2V6HA 3H3PH 1YUHA 1HEZB 5DUBB 1L0XA 3V52L 1HZHL 4PBWD 3VGGA 3NFNB 5A2IH 2IQ9H 2DQHL 4G9FD 3DUSB 1TVBB 4NKQB 2NY4D 2DTML 1TDQA 3H2WA 4P4KB 4CMHB 5EOQL 3QI9B 1MCHA 1KJMB 3MUHL 3P11H 2Q8AH 5C6TL 2Y7QA 4ALAL 1MCBA 1NCCL 1JI2A 5DHVA 4Z8FL 2BERA 5B38G 4QXUL 4D94A 5JOFB 5A2FA 3QQNA 4X9BA 2DM3A 4M7LL 5IMOB 3FFCA 2COQA 2CO7B 4UINL 3V6ZA 4PJAA 1RJLB 1JWSB 4OIAA 2PTVA 2EC9T 4Y7MA 3C87A 5CKGA 3GMRB 4OLXL 2GUOA 4PJIA 3BP4B 4KKCC 4QWWD 4Z18A 3PQYA 1NL0L 4MQSB 3WBDA 1OP3K 5D1XA 1NCWH 5K93A 4P23B 1T3FA 2YPKA 3U9UB 1PEZA 5JDSA 3I85A 5EU4A 5JXED 3MJ9A 5DJ8A 4FFZL 1IAIL 1KCUL 2FJFA 5HYQB 1MJ8L 2VLRD 2RQ8A 3NIDF 3BJLA 4ZUUA 4E41B 3ROLB 4O9HH 3LN4A 3CX5J 3G6JB 3DSFH 2J88L 3O9WD 2J7LA 4LGSB 4MQTB 1KJ2L 5C9KA 3SDCC 2W9EL 3CU7A 3TPUA 5JOEA 1CE6A 2N7BA 2CUHA 5CD3B 4ZS7H 4OFPA 3OR7B 4QRPA 1E4KA 3FO2B 4WTZA 4G9FE 5EPMA 3RGHA 1XGYL 3RTQB 5DMGC 4TUOA 4WV1C 3WCYA 4OF5A 5IBUB 3HZYA 4NYLB 3GKWH 1T5XB 5CSBA 2BC4B 5EU6D 4WTWA 5AYUL 3NMEA 1RK0B 4ZUSB 5CUSL 5FO9A 3WNOA 2P8PA 4P2QD 5BJTB 5I8KL 4M6NL 2F53A 3HAEB 4IHOB 2PO6A 3CFKA 4K3DL 5C2BL 2DIBA 4GRWF 4M48L 3MV9A 5CGYC 2IADB 3E6FB 3HRZB 1DP0A 1TJIL 3MRIA 3DX7B 3O3EA 1AXTL 1T0MB 3TO2A 1NEZG 2IPTL 2UUDH 4XI5D 3SE8H 2VDML 2HT3D 2C1PA 2BSRB 3P40A 3RHWK 3PJSA 1QLEH 3TBTA 4MJ6A 4P9HL 5IKCA 2A1WH 1R3HA 4OCWL 3KYOA 1AO7A 4R26L 1CGUA 3L3KA 3QWQB 4NPYB 3B5GA 4GAFB 4O5LH 3NA9H 5E8OA 2VLRE 1OD9A 2ATPB 2EKSB 4R90H 4AYFA 4WEUD 2PW1A 1J0KA 5J1AB 1E4XH 2FHCA 3V4VH 3U36A 1U0QA 3HE7D 3RUGE 1CD0A 3A6BH 5DHYB 3QIUA 4R96A 2W0PA 4LASH 4O2EA 1QNZL 3QI9D 4PGCA 3LN9A 4KZDH 1BVLB 1G7MA 2HFGH 4C56A 1G6RA 3BKYH 2AXFB 3NCMA 3TN0D 5EU6E 2XTJB 4P2QE 4ODWA 5F9OH 4OGXL 5FUCE 2EZ0D 3OKEB 3VRLE 4XPHH 1FNLA 3IVKB 3GNML 3K7UA 2CKBL 2E7LC 2VDNH 3BQUA 5TDNA 3KLHC 4G8GA 2NY5H 1SHMA 1X6NA 2IBZY 3OZ9L 1A64A 2ZSVB 4P23D 5KSUA 5E8PB 3SDXA 1R3JA 3F5WA 2DQCH 2EDYA 4MJ2A 1X5IA 4X4XB 1SBSL 3BPOB 4OCYH 5IB3B 3HE6B 2IH3A 2DQTL 1BF8A 4PS4L 1TZIA 4LVNC 5JIHA 4GAGL 2VZOA 3BH8B 4KRNA 1BAFL 3MRPA 5FYJL 2Z35A 2OTPA 4YR6B 4PJ5D 4UDUA 2NW2A 2FIKA 1F58H 2Z92B 2VWEC 3S34H 4I3RL 4PRNA 4HS3B 3GM0A 1WCBA 5C08D 1MPAL 2AV1B 3FAWA 4TQEH 3B9KB 1I7RB 4OZFH 5C0GA 3VFPA 3IJYA 3RTQD 4Y19B 2FECI 4OIBA 3RNKB 1IC4L 4I4WA 1YUHB 1CT8B 5CKAA 2OQJA 4YDJA 2VUOA 4KAQL 5GRJL 4AIZB 5CEXB 5IGXH 4XB7A 4ELMF 3H9HA 3D3VA 5EBGA 3HMWH 3F7VA 4X7EC 1E4WL 3HAEH 5IWLC 3GI8H 2ZJSH 2RBLA 2Y7QB 1I1RA 3MSPA 4RCAA 3G5ZA 1ZLSL 2AJZA 4YUEH 2CKNA 5SWSA 1WT5A 1RMFL 2AJSL 4PJAB 4HD9A 4HXBL 1BIIA 1WITA 1DLHB 2R9HC 3HC3L 5ESAA 3LKNA 3RWEA 4RFOL 2APXA 3N85L 3PQYB 4ETQA 3MRJB 4Y5VA 5D1XB 5IBTL 1OAYL 3MUJA 1T3FB 2YPKB 4JB9H 3G6JE 1DBBL 4GFTB 5KVGL 5EU4B 1A7NL 4YPJA 3LEVH 1M7IA 1KB5L 3I50H 3JTTA 1FNFA 3T3MF 4DQOH 4X4YB 4ZUUB 1LMKA 5C08E 4JFQA 3LN4B 1DDHA 3V95A 2EIZA 1U3HA 3QCVL 4PJHA 1QR1A 3FB6A 2G9HA 2BOCB 5E08H 1L9NA 3ZKMD 3TFKC 3TPUB 3C5ZC 1CE6B 25C8H 2JJVA 5KAQG 2E3VA 4OD3L 4QRPB 2XTJD 5I15H 5BOZG 4Y2DC 2YUZA 4LQFL 1QLFB 5IEKB 4TUOB 2RB8A 1WBZB 2OCFD 3O6LL 4JM2D 2FD6L 3HZYB 4G43B 3D2UA 3QP3A 3C6LA 3MA7A 3QEUA 5FO9B 5IR1A 3RL1B 3PWVA 2F53B 2PO6B 3CFKB 3X3GH 4YXLL 1GGUA 1AY1L 3PL6B 1R24A 3MV9B 1JWUB 1YZZA 4R2GB 2ZKHL 2F58H 3RVUD 4HUVA 4X4ME 1B88A 2PNDA 3MRIB 2CSPA 3O3EB 1QFHA 3OJVC 5I19L 2VKXA 5T5FL 5CZVH 3JVGA 1T6VN 3PJSB 3RZCD 3FCTA 3TBTB 5F21B 4MJ6B 4JR9L 1DBAL 5IKCB 3MCKB 4F7TA 4FQXA 5SWQA 4ZOEA 3L3KB 3MRNA 3B9KD 2XN9A 1CL7L 5E8OB 1QA9B 1AC0A 1RZJC 1I3GL 4I13B 1RVFH 3MNZA 1EJOH 1A4KA 4Y19D 5CJOL 1JNJA 2PW1B 7FABL 4XNMA 4OLZL 2UWEF 5JW4R 1OGAA 5ELIA 3U36B 1GSMA 1G7JA 1RUKL 4J4PC 4XPTL 1EO8H 1KLUA 4WO4C 4J12A 2XTJE 3QIUB 2JCCA 4UQ3A 5I76B 1UB5B 4O2EB 3PNWA 5ENWB 5DHVH 1FCGA 4C56B 1NGQH 1QSZA 1RZIA 1CGYA 3QAZB 4CL7A 3FFCD 1FFOA 2FGWH 3QA3B 1FAIL 5DQ9A 2FHFA 2R23A 1HQRA 4K94H 2YD2A 1LO5B 5LVEA 1FFNB 2QSCL 1CLOL 1E6OH 3L3IA 5L8KB 2NXZC 3ZHDA 3BQUB 4LFHD 5TDNB 1MRCH 3PQYD 4G8GB 4LLMA 1SEBA 5D1XD 1LEGB 3SDXB 1J05B 3T09A 3D18A 4RGMC 4K7PX 3MZGB 1CYGA 2B4CL 5ACZA 3TCLA 3NAAH 3MJ9H 1WICA 2CLZB 1A1NA 4RA3A 2IH3B 2J8UA 1MCQA 4XGZB 1UZ6E 3QFJA 2UZXB 3MRPB 2Z35B 4WWKA 5CD5D 4V1DA 2NW2B 2FIKB 3V0WL 1Q72H 4WI5A 4Y19E 3KPOA 1WBXA 3JV6A 3OPZL 1DQML 4NDMA 5BV7B 3PHSA 4PRNB 4EOWH 5J4MA 3O2DL 2W60A 5GGTL 1WCBB 4QRPD 1FNEA 3UZVB 2Y72A 4QY8A 3VFPB 5C71A 1Q0YH 5C9JA 5C92A 3O2VH 3SHSA 3N1GC 2FZ3B 4S1SL 3QH3A 1NMAL 2OP4H 3ZYZA 1L6XA 4WW1B 3SDAA 2VLMD 1I1CA 2AQ3A 1B0RA 3BPCA 3H9HB 3D3VB 2Q86B 2F53D 3KAAA 3F7VB 3FFCE 1KLFA 2PO6D 5F1SA 1WZ1L 3EOTL 5E1HB 5JW4Q 4PJAE 4R2GD 5B8CC 2A74A 5ESVA 2ADGB 3G5ZB 2FO1A 3CK0L 3NABH 4YJZL 1TTGA 1BWMA 3AREA 3PQYE 4H0GA 1JGUH 2HN7B 4UIKH 3JSSA 2XTLA 4XNUH 4U1KA 3ZL4H 4HKXA 1CI5A 1BIIB 1RIUL 4FQHA 3F7PC 4LSRL 1AO7D 4KH2A 1AD9B 1EUUA 5DC9B 1EO7A 4HMDA 4ZS6C 4GAYB 1EZVY 4Y5VB 3MXWL 3VWJB 5I71B 4KV5E 1X5LA 2WBKA 4CW1A 1AE6H 2YK1H 3QHFH 5IHUL 1S7UA 3O0RL 3OKNA 3PDOA 5HI5D 1FVCB 1M7IB 4NRXA 4YHOH 4X83A 1MF2L 1ZTXL 1JNHB 3JTTB 1JZ3A 1YYML 2Y07H 3NACL 3ZSSA 1PKOA 4JFQB 5T1DH 4QRPE 3QIUD 2EC8A 1YMHB 2H41A 3B2UC 4X98B 4OIIH 4EI5B 1FN4A 1QR1B 1MIML 2AEWA 1PG7H 5DQDH 4LCCB 1ZGLM 4C56D 1G6RH 2JB6A 3VFOA 4KZEH 3SKUD 4KXZH 5T1KA 1JTPA 5IESL 3WUWA 1A7PH 2VLME 1CGVA 2V17L 2F53E 3HI1A 1GOHA 3SQBA 1MCDA 3MV9E 4HAFA 3SKMA 1WFUA 4NC0B 2EKJA 3D2UB 4TYUA 3DUUA 3MA7B 1KT2A 3BQUD 3TWCH 4G8GD 1BFVL 2RHEA 3HI5L 4OZFG 1C5DB 3EO9L 3RY4A 2EE9A 2I5YL 2E6QA 3EDEA 4D0CB 1J5OH 1C12A 2ORBL 3F6LA 1JWMB 2YPLB 3P9MB 4HC1A 3FQWB 1RIVH 3QIBB 5ALBH 1U58A 4HUVB 4MHHG 1TQBB 1U92B 1I85C 2VABA 3LKPB 3MACH 4PJ7F 4MNGA 2DQDL 2IAMC 1XEDA 4BZ1H 3EFFA 2EDFA 5H94B 4R4BB 5IBLD 1RZFL 3FCTB 4ODTH 3ALPA 1FC2D 3MRRB 1XF3A 4OSUL 5CLWA 3F58H 1KC5L 4L8SB 3BPNC 4U1IA 4AEIH 1FH5L 4P4RA 5BV7H 3MJ7A 5CGTA 5SWQB 1QG3A 4OV6F 4XPFH 3UJIL 5I1GH 3MRNB 4GRLC 2XN9B 3NCCB 3TO4A 3GHBL 4L29A 4XCFL 4NZJA 4YDLC 1A4KB 4S1DD 4FFYH 4MD5B 3X13A 4XNMB 1BJ1J 2H1PL 1FCCA 4KI5F 3NN8A 4H8WC 1G7JB 4C56E 5I1EH 1QTYT 4G6KL 4YBLC 1KLUB 4BQ6A 4FFWD 5E2VL 3QJFB 3D3VD 4H20L 2E9IA 3U4BL 2JCCB 4UQ3B 1MY7A 1NQBA 3D1MC 3SDYH 3NZ8A 4NFDA 3DV4A 3MBEA 3TT1L 5D6DA 5AZ2L 1NFIA 1JTOA 4JO3L 4GXVH 4OCNC 2DQJH 1T03H 4HUXB 4PB0L 1ACZA 1WISA 2DDQH 4JPIA 5SWSD 1RZIB 4G8GE 5HJ3A 1AQKH 1FFOB 4ZTOL 5DQ9B 1AGDA 3H42L 1P2CA 1MJUH 1KGCD 4LRIA 2OR8A 4YHIA 3SDXE 1DQDL 1VEOA 2HKFL 5I73B 1A9EA 3GIVA 4LHUA 1LO0H 4GXUN 2NNAA 3BIKA 3QISA 3L3IB 1OB1B 3FQXA 1RZ7L 4PRPA 5JO5A 3ARQA 1RFDH 4G7YL 4LLMB 4MA8H 3E0GA 4RFNC 1SEBB 3T0EB 1XIWC 3ARBA 1BFSA 1Y6KR 3LRHA 4KDWA 3D18B 1CXKA 5IUSA 4M6OL 5TF1L 5KVEH 5ACZB 2KH2B 3L3GA 1ETZA 2YBRA 1A1NB 2J8UB 4JHWH 3ARRA 2IPKA 4I77L 5I30H 3QO0A 1BX2A 3FAXA 4ONFH 3K2UH 4M5YH 3QFJB 5ISZA 1MCFA 4OT1L 4V2BA 2P45B 1LNUA 2E5EA 4WWKB 1U3HD 4V1DB 5C0ND 1T89C 5FUZL 4S2SB 3KPOB 1WBXB 3GK8H 2W60B 4Q9RL 4MXQD 2EDNA 1FNEB 1G7LA 4U1LA 3VH8A 3VI3E 4QY8B 1TJHL 3VG9B 5IW3A 3WS6C 1F4YH 3D3VE 2UZIL 4TTDC 1R5IB 3BOVA 3SKNA 1RZGA 2C3XA 4NFBA 1MFEH 3D2UD 4QXGH 3OB8A 3C6LD 4NM8L 4JLRA 3QH3B 4MA7H 5GS0C 1W8OA 4ENEC 1A7QL 1XMWA 1U95B 1T20A 2C4FT 5C0RH 4KPHH 1B0RB 3BPCB 5FGBA 4WY7H 5SWSE 2XNAA 5SX4H 3S35X 3D39A 1S9VA 5E8NA 4S1RH 3L3DA 4PY7A 4ETYA 5FM4A 4OLUH 3IDGA 1U8QA 4OKVB 3PGDA 5A43C 2EEBA 4WI3A 4XAWL 3HI6H 1NCDH 1H3TA 1HYRC 3AREB 1JGDA 2DQUH 1MFBL 1ZGLB 5IFAH 1FPTL 2DLFH 4KK6C 5AG8A 4U1KB 3S36X 4HKXB 5DSCA 5IW6A 4FQHB 1CICC 1UACH 2YPVL 3GI9H 2CJUH 1F2QA 1OAXL 4LPWA 4FQXD 2D3VA 2VDPL 4UU9A 4DKFL 2XN9D 4K23L 4I0PC 1Z3GL 3B2VL 1S9XB 3VFWA 3FN0L 3GBNH 4N1HB 5FGCB 2X4SA 1S7UB 1GL4B 3OKNB 4PJHE 1B4JL 3B3IB 5BO1L 3V0VA 2NYYD 4UTAL 4HXAH 3STZB 3EYVA 1OGAD 4NRXB 1VFUA 5JQHC 1ZT7A 1GPOL 4GLRI 4JY6A 1IAKA 2F19L 4LSSL 2DQEH 1RULH 1YDPA 5DJDA 3QEHA 3SPVA 5DJCA 2BVUA 1NC4A 2HRPH 5EBLA 4PRIA 4F58H 3BIBX 1FN4B 4NZTL 4HAGA 5DD1H 4N0CC 4MWFA 2VXTL 1F90H 1MQKH 4KKAC 4LLDA 3VFOB 2EYSB 4HWUA 4GQPH 1E28A 4U49A 3SKOB 3EJJX 5T1KB 2B2XL 3BKCL 1DR9A 3H7LA 2YWZA 2Z31C 3JTSB 4GG6A 2Y25A 3HI1B 3UBXG 1OP9A 3X12A 2YPLE 4BQBA 1DQJB 1A7RH 4R97C 5MEOB 1LK2B 4DVRH 5I6XC 2EDEA 1TCRB 2HYMA 4WTZG 3AC0A 4MB5A 3WHE1 1BGXH 1C12B 4F7PB 4GQ9L 2HFEA 4Y16A 3TCXA 4HH9A 3IU4H 4FN0A 5DD5H 2BX5A 4P59L 2AEQH 2XIDA 4XC1L 4MNGB 1KB9K 3QFJD 4NO3B 4ODXA 4PGDA 4U1JA 2XN9E 1QFUL 2NY1B 4JPWH 3EFFB 5D7LA 4V1DD 5HHNA 2Q6WA 2R2EA 1IGIL 3LKRA 4MXVE 4YHMH 4P4RB 3N06B 3MJ7B 2O5YH 4DTGL 5E9DA 4EN3C 1OGAE 32C2A 3RVWD 4TVPL 3TO4B 4W4OA 2HVKA 3ESVF 5HDQH 4OV5B 4Q6IC 3RGVA 4FQJL 2JCCE 3P0VH 4CVZA 3BKJL 5C70A 5IJKC 2OJZL 1CQKA 1A6WH 3PWJB 2PYFA 5H2BA 4HHAB 2VDQL 3SDAD 2BVEA 1BM3H 5HPOA 1IAOB 5JW4N 1IQDA 1U2CA 4M1GL 5F9DC 3REVB 4AZ8A 1ZLWH 5F9JB 3B9EA 2BJMH 1UM6H 3QEQA 3MGTB 1U41A 3VRJA 2AGJH 5L2KA 4LF3A 4DN4L 2VXVL 1JPTH 2J8HA 4Y5YC 4JPIB 3ARED 5HJ3B 3LKQA 1VCAA 2V5YA 4XNXL 3HKFA 2KZWA 3OAUH 1P2CB 4HGWA 2PW2A 3QUZB 4JCLA 4YHIB 1PLGH 5D8JL 3O41B 3WFZA 2VE6A 5KVDL 3GIVB 3KR3L 5CIPA 2QSQA 4JRWA 3BIKB 3VFRB 1HCFX 3FQXB 4PRPB 5GGSA 5TQ2L 2J8UE 5T3ZD 1U2HA 5T3ZH 1T7XA 1EAJA 4AMKL 3WD5L 3S7GA 3QFJE 3ARBB 1I9JL 4JQIH 1ZK9A 3OJ2C 3GHEL 4V1DE 1J1XL 3FFDA 4XBEL 5HHXL 5HHPA 2BSED 3I2CH 4HK3N 3SQOL 2VAAA 1BX2B 4L4TA 3KPNA 5ISZB 2WAHA 3LV3B 2HJLA 1LNUB 5EA0H 2NCMA 3MLWL 3UYRH 1IEBA 5IEHA 5LXGL 3DX6A 2DQGH 1NKRA 2DI9A 3IFNL 1G7LB 3I84A 4U1LB 3BGFB 4EBQH 5T1KD 2Z8RA 4ORZC 4HFWA 4J3SA 3TVMB 4ZODA 2VO5A 3QCTH 1PZUB 4G6MH 3GMMA 5IM7B 1IFHL 3SKNB 1CK0H 5BZDB 4PJGA 2O26U 5F8RC 3JWDH 4PYHA 4JO1L 3WL9A 1UJ3C 4IRSA 4K9EH 2IQ9L 1C16A 1VGKB 1T20B 2P46B 2YWYA 1OP3H 1TPXB 4PJEB 4AJ0A 4FP8H 1C1EH 3INUH 4HC1H 4AG4L 3HUJF 1G1CA 3D39B 3P11L 2N1KA 3ILPA 3L3DB 1J86A 4PY7B 4Z0BH 1KCSH 5EO1B 2I07A 1U8QB 3LEYL 4S0SD 2OMBA 3ARXA 1JGDB 2NY1D 5T3ZE 3QWOA 1Q9KB 3F12B 1ZANH 2XZCL 2ZUYA 4LLYA 2N7AA 5DSCB 4I9WD 5IW6B 4ZQKA 4OTXL 1XGRA 5KJRL 4UU9B 3T1FA 1P1ZA 4LVOB 1HWHB 4U1HB 3TO4D 5K9KA 3CFJB 3TBWA 3DGCR 4ZO9A 5GRYA 3KPQA 1NCWL 4B7LA 3VFWB 5GZOC 2P5ED 5J56B 4JE4B 4R0LA 2X4SB 1UT9A 5F7NC 3RX8A 4QWWC 3PGCA 3ILQC 2H45A 1JK8A 3V0VB 3EYVB 5E8EA 2YD1A 1GGIL 1BLNA 4IRJA 4NOBA 4M02A 3OG6B 1IAKB 3UTPE 3UCRA 1B0GB 2VLLA 1YDPB 4DEPC 1I9EA 5DJCB 3EYQD 5I1CH 4YNYB 4PRIB 5GRVK 3KLDA 3MBED 4HBCH 4A6YB 3AXLA 1JGEB 3HLAB 1GC1H 1DUZB 1N0XH 4ZS7L 4GBXA 3ZTNH 5I1JL 2WINA 1X5XA 2WLZA 3O9WC 2GK0A 1E28B 4LL9A 2H6PB 3UC0H 2CDEA 2FBJL 4LDOB 4GG6B 3X12B 4PJXF 5F44A 4LHUD 4PJBB 1N64H 2HH0H 3HPJA 4PRPD 4XZUA 3QG7H 2NXYD 4WI6A 3FRPG 3CFCH 4FQ2H 3VFMA 5HY9A 4MNGE 2WNGA 3DVIA 4XXCC 4OJFL 3ARBD 2WUCH 2YA2A 2HFEB 5ADPH 3C2AH 4LGPB 1QACA 4G5ZH 4AH2B 1TQCC 4I9WE 2LTQB 4XP5H 5FUCC 1AJ7H 1OW0A 1ZVHA 1EGJA 2BRRH 4ODXB 4Q0XL 4PGDB 4U1JB 1AQDA 3FB7A 5ISZD 2W0LA 2H9GA 5I1LB 3D0VB 5HHNB 3WN5B 1ZS8A 2R2EB 2W9DH 3BIAX 2Q6WB 2HT3C 1M1SA 4BZ2H 5GHWH 3EJZD 4KKLD 1UC6A 4X8JA 1T4KA 1UKQA 32C2B 3BWUC 5C7XL 2XACC 3RGVB 2YRPA 4XVTH 4K2UL 4R90L 5E6IC 5L0QC 4CDHA 3ZE0E 4CVZB 1E4XL 1D5BB 3RWIB 5D72H 5I74B 4OI8A 3V4VL 5IHZA 2PYFB 3V5HB 5H2BB 5C0AA 1U3ZA 3W0WD 4JZOA 1O7SA 4OCLC 3W2DH 4WDIB 1K85A 3IDNB 5DR5H 1JV5B 5DEZA 3UJTH 1FYTB 5TFSL 2QV2A 3GKZA 4MAUL 3D39D 5IB2B 2KUTA 4KJYA 3QEQB 3GSRA 3VRJB 4LQ1A 2DKMA 1W0VA 2HFGL 4JY5L 4NGHH 3BKYL 4P4KC 3MCG1 4PRPE 1KJ3H 5FCSH 4CMHC 4WW2A 3QI9C 1C7TA 2DD8H 5EZLA 4HGWB 4JFZL 4XPHL 1KELH 3C2SA 1CXEA 1R6VA 2VE6B 4HWZA 4LKXA 4FNLH 2MNUA 3L3JB 5CIPB 4XPAL 1KB9J 1RU9L 3QRGH 2VL5A 4X6CF 1W0WA 1EERB 3KJ6L 4C59B 1T1ZA 3RWDA 2Y5TB 2EZ0C 5K33A 2NTFB 5ISZE 4WEBL 3O4LA 4HPYL 2HJKB 1FV1A 3MXVL 2N4IA 1MOEA 5T1LA 3ZSTA 1HNFA 4OZGF 2NY5C 3AUVA 1U6AH 1F45A 3FFDB 2YN5A 2Z93B 2P5WA 3KLAA 4P23C 4XCYB 4XNQA 3O6MH 1A3RL 4G8FA 1CQYA 4L4TB 3MREA 1CN4A 3V7AG 1EFQA 3CZFA 3MPCA 4UT7L 3ZE2F 1NC4D 5DF0A 5ADOH 4PRID 2XI9A 1BEYH 1IEBB 4JZJB 4R4FL 3MOAH 3HTLX 1IM9B 1U8PA 4TQEL 4X6DB 4MXWH 3T3PF 1X5HA 1CDHA 3D69A 3ROOA 4RBPK 4PJEE 3N1QC 4R4ND 2XWJA 1IGMH 3D39E 3MLTA 4PJGB 1JGLL 5TPWL 3WL9B 3RTQC 1FNHA 1UFUA 4O51B 3VFUB 1C16B 3L3HA 1DBML 2MOVA 1Y6NR 3HMWL 3L9RB 3MROA 5GRUH 3HC0A 2HVJA 3SO3C 4Y16D 1WWBX 3GI8L 4FXKA 5LQBH 3K4DA 5FHBL 1I1AA 3FKUS 1JRHI 2I07B 3P4MA 2YZ1A 5CLTA 1RUMH 1UWEH 2MWCA 3DURA 4NUJA 2YMXH 5D7LD 3QWOB 5BMFH 2ICWI 3OKYA 5GGVH 1V7ML 4LLYB 3HCVA 3WJLA 3ES6A 2C7UB 3GMQB 4NKMA 3MLZH 2CIKA 3QXTA 5E9DD 4MA3A 1BJ1H 4EQ3A 4BK5A 3T1FB 3GSWA 1P1ZB 5K9KB 5F1NA 4PJCB 4KTEH 2GITA 3TBWB 5DFVD 4KK8D 3RGVD 4UAOB 1O7VA 3KYKH 3IYLW 4HUNB 1W8NA 2IMNA 4MJIA 3DMMA 5ITBH 1YY8A 3BI9X 3B9VA 3PGCB 4PRIE 1KYOJ 1S5HA 3LEVL 4GMTH 3H8NA 1U8KB 1JK8B 2FEEL 1YY9D 3CMOL 2CIIA 4PJ8A 1BLNB 4IRJB 5D4QA 1FDLH 5IVXB 4DQOL 2HRLA 3IJSA 2VLLB 5MEPA 1LDPH 4PLOB 4YDVA 1JMZA 3LB6D 4GG6E 3QEQD 1MHEA 3MC0A 5EIVA 3AXLB 5L2KD 3PV6A 5JHLH 1X5ZA 3ARGA 4URTB 1CXIA 3JWOL 1I4FA 2AP2A 2IBZX 1QR4A 5I15L 3FZUD 1BQLH 2GK0B 1EHXA 5GRXG 3GSOA 2E9WA 3N50A 5GZND 3ZDYE 2JLLA 1TZGH 5C0DA 4F80A 3BKMH 5FOBA 3ZKMC 4Q58C 2WM0A 2DIAA 5CIPH 1FNSH 3E2HB 1U8LA 1EPFA 2XTJC 4G8IA 3VI4F 3W82A 1DE4A 4YE4H 4Z7VF 2ADFH 2UZYB 3VFMB 3RZWA 3WUWG 1J0IA 4GAJL 4JRXB 3TJEH 4ODBD 3FQRA 3X3GL 3IGAA 3JV0A 3Q1SL 2A9MH 2E7BA 3FOLA 4Q2ZA 2NY7H 1NCAH 1QQDA 3MA9H 2A0LD 1FAKT 1HINL 5IHBA 4F3FA 4WUKL 1N8ZB 1T2QH 4NQEB 2B1AH 5E9DE 4L4TD 1NGPH 1AQDB 3FB7B 5CJ5A 3BPOC 1HSBA 4L4VA 3I6LD 1IAIM 1AGFA 3HE6C 1Q94A 3NTCH 4ZPVB 3AVEA 3CH8A 3SGKC 4CJ1A 1LVEA 3LQZA 1MEXH 1G7QA 1T1XB 4WHYH 1KULA 3C08H 1YEEL 3TH3T 1KEGH 3T0AA 1FSKB 4OF7A 5SWZD 4EUPB 3BVNA 3JV4A 3KPPA 2A6KA 4ZAKA 2VXSL 1FYTE 2P8LA 1MUJA 5HSFA 5DVNA 1JPSH 4FQLL 5HHOA 1KNOA 1JZ8A 3IB4A 1A6ZA 2FNBA 3B9KC 5J6HA 3QEQE 1NCNA 1EAPA 4PY8I 5IHZB 4PJ9A 5C0AB 4IRSD 4AENA 4JZOB 4C57C 1JHTA 3L5XH 3AB0B 1TETL 4KJYB 1FVEA 1KTRL 2Q3ZA 3QO1B 4KK9D 4ZFGH 4PLKD 5E5MA 1KCKA 2V5MA 1B0WA 1W0VB 1NGQL 3WNLA 1FHGA 5D7IF 4UI2A 1KEML 5D7KD 1IGTB 4WW2B 2KPNA 3V0AC 4CVWA 1T6WA 5M94B 2DI8A 3CFIC 1XGUA 4NNYA 4HWZB 3W5MA 1E6OL 2VLJB 2Q76B 2VL5B 4D0DB 1MCWM 1MRCL 5M7QA 3AMKA 4K94C 2VR9A 2ARJB 1T1ZB 3LS5L 3P4OB 3RWDB 2AV7A 3ULUD 3ULUH 2VXUH 4L4TE 5FA4B 3O4LB 4JFXA 1FV1B 5E2JA 3I6LE 5T1LB 2CKBA 4LHUG 3NAAL 2OSLA 2Q7YB 3MJ9L 1NDGA 4IRJD 4OLYH 2P5WB 3KLAB 5D1XC 4JKWA 3VFTA 5FCUL 2Z91A 2X1XR 4OQTA 5JW5A 4OZ4B 4XNQB 3LKSB 3BYTA 1K4CB 3CLFL 5L88H 5F1OB 3CZFB 5LGHL 1IC5L 1DQLL 4JM4H 1Q72L 1OM3L 5DJXB 3MRDB 4MZ3A 1Q9LA 2G5BA 4PJGE 5D9SB 4GBXD 1ACYH 2CLVA 4YH6A 5CD5C 3MODL 2BVPB 3IFPA 5D5MF 3WO3B 1V3KA 3ROOB 2ICES 5I2IA 5EZIH 2X9XA 5AD0A 2XWJB 1JPGA 4OFYA 1FZMB 4J6RH 2FCBA 3MLTB 2WWMD 5E7FA 2OP4L 3VMPA 2Z4QA 3VH8G 1CDGA 5B4MC 3L3HB 4HGMA 5KS9F 4M43L 5D7KE 3THML 1M6OA 3MROB 3FO1B 2H3NA 3BUTA 3HC0B 1DN2A 2HVJB 3WNKA 2GKIA 2V5SA 2CK2A 3CH1A 4DKAA 5F7WC 4BK4A 5BW7A 1I1AB 1YPZF 4HUKB 2GTZA 4G42A 4JFHD 4AM0B 4Z7OF 3NABL 3X11A 1J9CT 1F4XH 2G5RA 1Y6MR 3RNQB 2PO6C 1EGJH 3PL6C 3E1F1 1XFPA 4ESKA 4R2GC 3IJHA 4E0RA 4PJCE 4DFHA 4KQ3H 2OLDA 3ULUE 5D2LF 2Y1VA 3ZL4L 3ES6B 3LY6A 1F11B 1KIQA 1F3JA 2IG2H 3BGMA 4NKMB 2X6MA 2V2XA 1P6FA 3GSWB 5F1NB 5CJXC 5JZ7C 4JANA 2LE9A 4HKJA 4LHJB 3VMNA 3KJ4B 1AD0A 1AE6L 1DLFH 2WV3A 3QZWA 1KIRA 4MJIB 4KY1L 3DMMB 4PG2C 2JJSA 1S5HB 3NIFF 1JVKA 1TVHA 1HHIA 2MCPH 2IBGA 1ZWIA 4PJ8B 5C0AD 1LEIA 1OARH 3QIWA 2DTSA 1L7IH 3CZJA 3IJSB 4DCQA 1T66D 4PRHA 4YDVB 5HI5C 1OAQH 2K7QA 4JFEA 2YKLH 4Q9QH 2QSVA 1UWGH 4TUJA 5TDPB 2MSPA 2D7OA 5F7FA 5C0BA 1KFAH 2VH5L 1SY6L 2ZG3A 3PV6B 2HFFA 4NNPL 3QIUC 1G6RL 4Z7UA 2HA1A 4OUUA 1DL7L 4KZEL 1I4FB 2IH1A 2QR0A 5HYJA 2APWA 2P24B 4HF5L 3NIGF 3U0TA 2OJEA 1LE9A 1KJ2B 4HWEH 1D5MA 2X41A 3WFBH 5DWUL 2EO1A 3S4SA 3QAZC 1U8LB 5FXCH 1DBKL 4ZFFB 4XP4L 4X7CC 3TWCL 4JFHE 4MD4A 1RUAL 3P0GB 4NKOB 2JB5L 4HPOL 3O4LD 4K55A 1J5OL 3N1MC 2B39A 5EZOL 3IGAB 5T1LD 3BQUC 5DRWA 1EMTH 1RIVL 5ALBL 4Q2ZB 4DGIH 5CEZD 5CEZH 1QQDB 2P5WD 2QQQA 4F3FB 4APQA 1L0QA 1FFPA 4PJDF 4L4VB 3RL2A 1BBJB 3S98A 4ODTL 1PDKA 5E1AB 1Q94B 2H8PB 2CH8A 1N26A 2JTDA 3SY0B 4CADA 3N9GL 4AQOA 2IMMA 2SEBB 1ORSA 3LQAH 3TT3L 1KCLA 3IAGC 2KL6A 1HQ4A 5I1GL 5C0AE 4Z95H 3T4AB 3TNNB 4XVUC 4YZFE 1H9VA 3BVNB 1C5BH 2H32A 3KPPB 1FIGL 5BV7C 2P8LB 4XC3H 1KNOB 1HDMB 3NFPA 3QQ3A 1OP5K 4DZ8B 3L1OL 3EFDH 5K9JL 2CD0A 2H26A 1OQOA 4AENB 4RAHA 1FORH 3IXAA 1HIMH 3RVTD 3O2WH 4OFDA 4M8QB 2GT9A 3D0LA 1LP9F 1P4IL 1MFDH 1KIPA 1JHTB 4IIQB 1TNNA 3PXHA 1HZHH 1I1AD 5E5MB 1L0YA 4FFWC 4GXVL 2DQJL 2VLJE 3VXMA 4BKLA 2DQHH 3ECBA 2LAAA 4YDIL 4PYGA 1EZVX 5EIIA 1AQKL 2DTMH 1MVUA 2MQCA 1EVTC 1A5FL 1I8LA 5EOQH 4AEHH 4KRPB 5I17A 3WFCL 3O4LE 4ALAH 3KPMB 2ZSWA 4QRSB 1YEKH 1WT5C 4QXUH 5CEZE 4Z76B 2P5WE 3BUYA 4MA8L 2HJFA 1H3VA 3X3FL 2AV7B 3BE1L 5CBAA 1MJJA 1X44A 4MJID 3DMMD 2HLFD 1MQ8A 1JYVA 2F8OA 2CKBB 4OLXH 2OSLB 1NDGB 4Y5VC 4JHWL 4PJ8D 1IARB 5I71C 2D03H 3VFTB 2Z91B 1NL0H 1JZ6A 5JW5B 1T7YA 1EEZB 3K2UL 1NGWA 4M5YL 4U1MB 2AQ2A 5EZJA 4PUBL 3D85A 4MLSA 2ZUVA 1IAIH 3GK8L 4K7FA 1SM3H 2E8ZA 3ARGD 3PF2A 2G5BB 3VGBA 3QNZB 1S7TA 1RSFA 3G9AB 1M4KA 3RJQB 1YN6A 1AI1H 4EI5C 2J88H 4BFBD 3P4LA 3QXVA 5C0NC 1KJ2H 3FO9A 4LCCC 4X7TA 1N5YL 5AD0B 4C4KT 4QHNA 2EECA 1WFOA 4WHYG 2V9RA 1JPGB 3O2DA 5GGTA 2YRZA 5KVMC 4J23A 4MA7L 2Z4QB 5FHAH 4NC2B 5FKAA 3S3PA 1XGYH 3DO3A 5JHDB 1KG0A 2LVCA 1YN7A 3DROA 1M6OB 4RMRA 4AQ1B 1N3NB 1R5WA 3CH1B 5HVHB 3GSVA 4S1RL 5AYUH 5FDWA 2JKXA 4B0MM 5GSRA 2GTZB 4G42B 5E94A 4X80L 5CUSH 3KYAA 3X11B 1FC1A 5D71H 5I8KH 4BH7A 2YOCA 4HEME 4CVXB 5JIPA 3IJHB 3ME0A 4E0RB 5DEGA 2GK2A 5IB4A 4K3DH 4L4VD 1ZHLB 4G6AD 4YQXL 2DLFL 1TQBC 4M48H 4ELKA 4P9MH 2F5AH 3WFEL 1TJIH 5HD8D 4DK6A 1F3JB 1UACL 3RA7L 4MNQA 1AXTH 2EDJA 4MJIE 4JFPB 3JVGC 2V2XB 4PP2B 1Q0XH 4HK0A 5HTSA 2IPTH 2VDMH 1HKLL 1ITBB 1P4BL 5IIEA 4HKJB 4L8SC 1CGTA 1EHNA 4HWBA 4ZAKD 3C5SB 3GBNL 4P9HH 1ORQA 4ZDHA 2KQMA 4MB4A 1GXEA 1FQ9C 1UCTA 5HHOD 1KIRB 3L5HA 4OCWH 4OD1L 3FTGB 1WTGT 2C3VA 2MMXA 4PJ9D 1S7RB 1ZWIB 3C09B 1OSZA 3QIWB 1IT9L 1C08B 4DCQB 2DQEL 1RULL 4YBQD 3CSYB 2NYYC 1H8SA 4FTVA 1TVDA 3BW9A 3OGCA 3KNBA 5C0BB 5IF0A 1KB5B 1C5CL 3AM8C 4Z7UB 2HFFB 1F90L 1RHHB 1CLYH 2UUDK 3QFDA 2IH1B 3O8XB 2QR0B 5HYJB 5DMJB 1QNZH 4FABH 3U0TB 1U8OB 5GGRA 1NMCB 1XF5A 4Y2DB 3A67H 1YEHL 3S4SB 5IV2A 1OAKL 4NO0B 3IFLL 1BF2A 4DVRL 2HKHL 3TIEB 3OHXA 5I73C 4KDTA 3BEVB 2ZUQB 3IDXL 4Y4KA 5DT1L 1E27B 3TNMA 4L4VE 4AIXA 2CKBH 3IU4L 5DD5L 4LSTH 1GZQA 3T0EC 3FQNA 3OZ9H 4OQTH 4PRAA 5IHLB 4LLUA 2EXYD 1T22A 3GMLB 4MAYA 4N9GA 5EOTA 1FFPB 3WSQL 4H0HB 2UWEA 5HYSB 5DVMA 4JQXA 1M71B 3ISWA 4Y8AA 3G6AA 1ED3A 5GPRA 4YHML 4PS4H 5F7DB 5H8DA 4YDKL 1WV7T 1YNKL 1ORSB 4GAGH 4XX1E 1HQ4B 4WWKC 1BAFH 1NAMA 4C83B 3DLQR 5FYJD 5FYJH 4BSVA 5HYFA 4U2ZA 4CN1A 3U6RB 5EO0A 2H32B 1OTTC 2ZPKH 1YJDL 1E4XI 1CR9H 4I3RH 1T1YA 2PUQT 4OFYD 4E5XA 3RVWC 3QQ3B 3K2MC 3Q48A 1WIUA 3VG9C 2H26B 2AJXH 2XZZA 4O2CA 1BM3L 1FGNH 1O5DT 2EE3A 2VTFA 3I9GH 4WO4B 1DEDA 2GT9B 4LAQL 1ZMYA 1KIPB 3S96A 5D1QA 4I48B 4WJ5A 3F7RA 4KAQH 3E8UL 5GRJH 3G5VA 3HN3A 3VXMB 4RAUA 3U2SB 4K8RD 4K8RH 4QF1B 4Z77A 4MYWB 5EIIB 1QKZH 4QT5A 4N5ED 4XP6L 3MJ6A 2AW2A 2FGZA 5ICZB 3OAUL 3VRIB 4JFOA 2YZ8A 4X6BB 1PLGL 1JZ5A 4UUJA 4K7PL 1IEHA 1ZLSH 3GSXA 1EHAA 3AREC 4JREB 1S5IH 1WIOA 4NBZB 5CSZA 1RMFH 4PGZA 3UTSB 2HJFB 3WDIA 3CMGA 4IM8A 2AJSH 5CAYB 5CBAB 4JQIL 2DLGA 5KG9B 4M5ZH 1JF1A 3ARUA 2APBA 4RFOH 2BXYA 4EDXB 3U7WL 3CVIL 4G9DA 5ACMA 3QIWD 3I02A 4Y88A 5J6GA 1IQWL 2BNRA 5JTWA 5IBTH 1NGWB 1OAYH 3S3JA 4PRHD 5EZJB 5FYJE 1OOAA 3JBG7 4JFED 4N8PA 1YYLH 3O11A 4UBDC 1A7NH 3RVXD 4TULH 2OTWA 5C0BD 2BSSA 4K7FB 3DV6A 3RIAF 2DMBA 4K3GA 1S7TB 2DQGL 3MLXL 4UV7L 4EBQL 5HYJD 3REWA 3QCVH 3FO9B 1X9QA 4QHNB 4MHHI 3LEXA 1QD0A 4JGUA 2GSGB 4LVHB 4NQTA 4OD3H 5F6HJ 4N0FA 3JWDL 1LD9A 1H3GA 4Y0GA 5BZWA 3DRQA 4K9EL 4WFFE 4LQFH 1YN7B 4U6HA 3RIFF 1C1EL 3DROB 5B21A 1H3PL 3O6LH 4YAQA 2FD6H 1L6ZA 1RZKH 3GSVB 5F70A 1UM5L 5FDWB 4LSPL 1IGYA 5CFHA 4APQD 5HHMB 3T4YA 2HT2D 3L6FA 4YXLH 1AY1H 1ZANL 4KHTL 3UTTA 15C8L 1MHHA 3RX5A 4DJMA 1MI5A 1I7TA 4MNQB 2NY1C 4CRPA 4N1CA 2FX7L 3WNNA 3ZDXE 5T5FH 5HI3C 1MCKA 5D1ZA 5IIEB 5E4EB 2H32H 4JR9H 1ORQB 4B41A 1DBAH 4JFEE 3T08A 5C8JB 3TO4C 4P48A 2B20A 4H1LB 5C0BE 1G9NH 3EBAA 4Z0XA 3RPIA 1CL7H 4Z7UE 1OSZB 3ULVL 3G6JF 1I3GH 3BDBA 1ZT1B 3VU2A 4PR5A 4HQQH 5HYJE 4OBSA 3R4DA 2D31A 1KTLB 4WI2A 4FTVB 4OLZH 4KTYA 4JHAL 4P2OD 4HBCL 3BW9B 3OGCB 3KNBB 2VUYA 1EHLL 2MKWA 2PXYA 1RUKH 3VA2C 1F6FB 3VXMD 1S8DA 2VAJA 3PIQA 4TUKL 1I8MB 3I3EA 1XH3A 3UC0L 5HGHA 3RY6A 5D6DC 4QYOB 3V6BR 5GGRB 4TPRL 2E6JA 1NSNH 3CXDH 5CMAA 1GC1C 1CDCA 2YRLA 4DAGL 1F6AA 4PGBA 2UY6A 2XRAL 1N64L 5IROA 3WS3A 4NQDA 4NCDA 4LRIC 1FAIH 3QUZC 1XGPA 2D2OA 3MV7D 3OHXB 3QG6B 1BZ7A 5DJ6A 4Y4KB 2DJUA 5DK2A 1CZ8L 5J9PB 4G5ZL 1CLOH 2X4OA 3S8WA 4BQ9A 2VN7A 2NY0D 3CSBA 4H25A 2NY3B 4P3CL 1ZE3C 3ARBC 4PRAB 1CG9B 2F54B 4MAYB 3MBXL 5IVZA 3MNWA 2B4CH 3CUPA 3D85D 4X5LA 1BIHA 2OMNA 3G6AB 3G5XA 1ED3B 4G6FB 1YNLH 2LU7A 3RDTA 3QCUH 4YHPA 2DYPB 1A9BB 4JKLA 3E6HB 2VIRA 4U3HA 1CU4L 3OF6A 1AR1D 3BT2L 3MOQA 3V0WH 5EO0B 2DLTA 4F37F 1HH9B 2HTKD 3EJZC 4KKLC 3OPZH 1QEWB 1T1YB 5D72L 4PG9A 3O2DH 5BXFA 3BGFC 5GGTH 3TVMC 2J4WH 3Q6FA 4O2CB 3VXME 3RKPA 1Q9OA 3UJTL 3ZKXB 4UOJA 2O93L 2A9NH 3RWGA 3S96B 3OJDA 4U6YA 5DD0H 3NCBB 4L9LA 4WJ5B 2DJSA 4XX1G 5B38B 1TPXC 3G5VB 4L8DB 4HG4J 3T0WA 2CR3A 5FM8A 3IS0X 2GCYA 4NUGL 5HHMD 4QT5B 2Q8BH 2PTTB 3NCFB 2NMSA 3L5WA 3C5JB 2DMKA 1G9MH 4JFOB 2D0HA 1MSPA 4UUJB 4MNQD 1KTKE 2FEDD 4NC1E 3CK0H 2GIYA 3DUHA 3QRGL 3VXUA 5IQ7H 4QRTA 2VDKL 1BOYA 3BWAB 4M00A 4ZXBB 1ZA6A 4MD0A 3QHZH 4RBPH 4HWBH 1CTOA 1IM3A 1RIUH 2ZNWA 1RPQA 3IF1A 4LVOC 3QHTC 4HLZH 4QGYA 3L3OB 4ORGB 2IQAB 3OWEA 8FABA 1P4LA 3I02B 4GKZA 2AK4A 1VDGA 3O6ML 3MYZA 1FVDA 2VR4A 1EXUA 4D9LH 4TSCH 3BZEA 1FL3A 4FTVD 3O11B 4GMSL 1BEYL 2C3WA 2BSSB 1QVOB 1MF2H 1ZTXH 4ISVA 2R4RL 4MQXC 1XZ0A 3HZVB 3NACH 1AGEA 1FJ1A 4Z7NE 1GCFA 4HIEA 4MXWL 1ROWA 3SBWA 3D9AH 4OCXL 1V05A 3IDIA 1MIMH 4K71B 4RGND 2NY2B 5JORA 4QXTA 3S35L 3LEXB 3GMOA 2IGFH 3MRBA 1QBML 4N0FB 5C0JA 5BZWB 3DRQB 2W91A 4YHKH 4DUXA 3UTZA 4Y4KD 2XKSA 5HHME 1ZLUH 4U6HB 3BMWA 3PXJA 2QHRH 4YAQB 3ABZA 5E24E 5IB1A 2FR4A 3S36L 3AS3A 3U82B 5EU5A 4MNQE 2NY3D 1BPVA 3ZYOA 3HI5H 4NKIL 3EO9H 2DM7A 4MAYD 3T4YB 1OT2A 3QNYA 2CK0L 2YMXL 3MUGA 4PJAF 2ORBH 5DS8A 3BP6A 4NKDA 5GGVL 2LTQC 3VE0A 1VADB 4AT6A 1MHHB 1MIEH 2D7NA 1D9KA 5EWIL 4G6FD 3MLZL 1I7TB 4QNPF 4LEXL 1RUPL 1T1WA 3EYSH 1WZLA 4LEOA 4XTRD 3WN5C 1RZFH 5D1ZB 4CN4A 3WFHA 1UB6A 4BSWB 4OSUH 4X6EB 4X9GA 2RAMA 4FOMA 4N9OB 1NUNB 2AERT 1U8MB 5KANI 5HHVL 1BVZA 4FTVE 4OFVA 5F7LB 4HKZB 4U6XA 3U83A 3H0TA 3B8YA 3UJIH 1PX3A 3RPIB 3M17B 5DJAB 3GHBH 4KV5F 4KK8C 5DFVC 5IVOA 3RGVC 1HXMA 1KXTB 3DVNA 4XCFH 2ENYA 1RJCA 2FBOJ 4LSQH 1LDPL 1OAUL 3V6OC 5I74C 4PR5B 3RKDD 3LS4L 2D31B 4QRQA 1YY9C 3QZWG 3BJ91 5D1QD 2M8XA 4RGNE 1UH3A 5SX5K 2Y4SA 3KS0J 2PXYB 3CNKA 1FLTX 4G6KH 2A2QT 1S8DB 5E2VH 4KXZI 4IDLA 3CPLA 3U4BH 1BQLL 1BQHA 1CXHA 4JO2L 3BESR 2VITA 3LB6C 2DBLH 4HX1A 1IGFH 2EIDA 1TZGL 4TNVK 1HHJA 4OGYL 1K8DA 1A6TB 5CMAB 2QQKH 1FG2A 2CXKA 4PGBB 4JO3H 4PB0H 3FZUC 4YE4L 5GZNC 1V7NH 3HZMA 3DYOA 1LHZA 4ZTOH 1XGPB 2DQFA 3UAJC 2DICA 4ZUTA 1BZ7B 1T80A 2XPGA 5DJ6B 1N2RA 2HKFH 3UTOA 1QOKA 4HZLA 3KHOA 3BRFA 5DK2B 3CCHA 3S4SG 5FF6A 3L7FB 2X4OB 5D7SH 3BDYL 4LP4A 2NY7L 1RZ7H 3PWNB 4H25B 2P49B 4G7YH 2BNRD 2BY2A 4XMLH 3HG1B 2HWZL 5KSBB 5IVZB 3MNWB 1S7SA 5DK0B 3NTCL 5TF1H 3T2PA 4LIQL 2A0LC 3T1WA 1H5BA 4HEPG 4I77H 5E0QA 3RDTB 1OGTA 5JLZA 3BH9A 3V4PL 5C0IB 2WSKA 3FT4B 5EDXA 4YX2L 4G6JL 4JZJC 4JY4A 4WV1A 1UZ8A 4LPVA 5D70L 1JPSL 5J3HD 1ZVSA 4NHCH 4PG9B 1HHGA 3VCLA 4LOUC 5BXFB 2R2BA 1FGVL 4Q9RH 3SGJA 1ZKAA 4NCC2 3Q6FB 4ZO7A 1JFQL 1A0QL 1WIPA 4ZOBA 1TJHH 4GKSA 3EDFA 5EUOB 3UZQA 3SDDA 3MRQB 4X0KA 5H37H 3DX8B 3Q6GL 3L5XL 3OJDB 4U6YB 3KHQA 1ZXQA 5IB5A 4L9LB 4NM8H 4ODUA 4JKPH 2E9JA 4WCYL 1A7QH 1FZOA 1G0XA