1I85A

Crystal structure of the ctla-4/b7-2 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
MLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for co-stimulation by the human CTLA-4/B7-2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T LYMPHOCYTE ACTIVATION ANTIGEN CD86
total genus 18
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i85A00
4X8JB 1KB9K 4KI5D 1CGTA 3VFGH 5JQHC 3CDCA 1T7VA 2XZZA 1LO2H 1QBAA 3GMQB 4OB5H 1RFDL 1BBJA 1VCAA 3MRKA 3OKNB 3OJDB 5FECA 3IFNH 5IM7B 3GMOA 5FEBA 1C5BH 4JPVL 1DUZA 3UJJH 4Q0XL 2AV1B 3Q0HA 5DGQA 2A0LC 4GG8A 2VL4A 5AEAA 3SE9H 4GG8B 4HJGB 4XHQA 3QO1A 2A6IA 5CJXC 3U7YL 1NL0H 4QOKE 3SPVB 3RWFB 3VD7A 1NLDL 4KRPB 1AKJD 4Y0GA 1IBGL 5GSVA 4R4NC 1DLFH 1TJHL 1FFNA 5SX5K 1YPZE 1NSNH 3LS4L 3OJ2C 1BFOA 4K7PY 1J1PL 3UYRL 2CGRL 3CSPA 4HDIB 4P3DA 3K7UA 5T1DL 2R4SH 4XP5L 4K3JH 1WFTA 5CEZE 4KUCD 5I76B 1Y6MR 1J05B 5CJQH 3F7RA 2VLJE 4AENB 1FBIL 2BCKB 2DQCL 3E6FB 3NAAL 2CIKB 4EVNA 2VLLB 2EDJA 5TDNA 1OTSC 4R7DA 4HWEH 2NXYB 3DI2B 2X7LA 4AIOA 3VGHA 2FDBP 4PRID 3VH8G 2XXMB 2FHCA 5DMGC 3I6GA 4KRNA 2I60H 4JCMA 1K6QH 5C07D 3RY6C 1GIGL 1EERB 3QXUA 1AIFA 2C3VA 4J4PD 2BNQA 5EOCL 3WNKA 4OUUB 4F7CA 4F8QA 2UYLB 3LS4H 1KLFA 3OHXB 5GRWA 1T2JA 3ROOB 5KSVB 2G2RA 3OG6B 2ARWA 1FG2B 4L4TB 2E6JA 1FG2A 4L4TA 4YZFE 4L1HA 3NN8B 3QQ9C 4RCAA 4KZDL 4RIRB 3OAZH 3HE6C 5HPOA 1WZ1H 5TE6H 1A6AB 3SE9L 4Y4KD 5KN5A 3RVWC 3OJMB 4JFYB 5ITFB 3DX6B 4F7TB 4X4XA 2XN9D 4HIIB 1HI6A 5DTFB 3QWOB 1PGRB 2FCBA 4U0RB 1FO0H 2VQ1A 5I9QB 5MEOA 1LP9A 3A6BH 3HC4L 4N0FB 5DHVA 3EDJA 1BQUA 3FO0L 1IAIM 5GZND 4LSTL 3F58L 1QSFD 4IMKC 2G75B 1H3GA 5E00B 5LQBL 5IJKA 1WZMA 1Y0LB 1XH3B 1YJDC 3D39D 1XT5A 4ZMAT 3UJTH 1IEAB 2BERA 4FZ8L 4NYLA 1A1NB 4R0LC 4Y4HC 3VRLF 3QIWA 3L3DB 3MUJA 5TF0A 2QKIA 1DQQA 3EO9L 2PTTB 5DWUH 1AP2B 3F12B 2AK4A 1TJIH 4XNYL 3GSVB 1MRCH 3QFJB 3PWJB 3QPXH 3VXPA 4CMHC 1CG9A 2NX5A 3L3HA 1A1OB 4X6EA 1Q9WB 5I17B 32C2A 1LGVA 4MB5A 3X12A 5HYEA 4XC3L 4W6XB 3EIFA 2FEDC 2ICWJ 1AD0A 4HIEB 4E0RB 1A22B 1XF1A 3AXLB 7CGTA 5JOFB 3B2UD 5E9DD 1F3RB 4I0PB 5KOVC 5TE4L 2OL3L 3MLXH 1R5VB 5GGTH 1KC5H 4WO4A 3DV6A 5L2KA 2I07A 1A1MB 5DD1H 1F13A 1IZKA 3VGEA 4XI5D 1M7IA 4XVSH 3TWCH 1FZMB 2YUXA 1YEDB 3H9ZA 1Q8MA 2JF1A 2DMCA 1K4DA 3VG9B 2YMXL 4I3RH 1DL7L 4KHTL 4OGYL 5CGTA 3IU3B 4YE4L 5EUOF 3T8XB 2A2QT 5HGHA 2M8XA 5J1SC 5LVEA 3QZWG 1MNUL 2R0LL 4UDUA 1ZS8B 3OWEA 1BD2A 3E6FA 4LSRH 1XGYL 1FVDB 1MLBB 4F15B 1IKFL 1T89A 1OTUC 2FO4B 5J9PA 3MRGA 3WLWD 1A9BB 1LP9E 2NY4C 3P9WB 3C5SA 1FHGA 1YYLL 2ICWA 3ZYJA 4YAQA 3NMEA 1MRCL 4NYLB 4HKJA 1EMTL 1UZ8B 3BQUA 2QQQA 4XH2B 4TSAL 1MEXH 3S37X 3EOTL 4P4RA 5D2LE 1T0NA 1T21B 1XZ0B 4M6AA 4JPVH 4WU5A 3TN0A 4MD4A 1S7QB 3LQZA 4ZS7L 2PR4H 4PJAE 3T3ME 2VIRB 3CFCH 3S96B 3CH1A 3DUHA 4K9EH 1G9MH 1OAXH 3WHE0 1Q9WA 4PJAB 5I17A 2OL3H 3MLXL 3PP4L 2FX9L 1WCQA 3GO1L 3V4UH 1AGBB 1DANU 3O8XC 3PF2A 2IADA 3MYZA 5CUSL 4BUHA 2I9TA 4WW1A 3OJDA 2VKWA 5B3JE 1BFVH 1ZTXL 5ALBL 3SCMA 1KIPB 3O0RL 4ZAKA 1HN1A 3NTCH 4U3XA 1AGCA 3NPSB 3VE0A 4DOHE 3D69B 4H1LB 3S36H 1TCMA 4K3HA 4P2OD 1DBJH 3CLEL 2MHAB 1IAII 5ACZB 1JNLH 4F7PB 4MD0A 1M7IB 3DUSA 1A8JH 3UYOD 1FNAA 4NOBA 1G0DA 1H15B 4GG6B 3QNXA 3FFCB 1XIWB 3VFMB 4L29A 2H8PB 4RISH 3B3IB 5FGCB 5LBSL 4NUGL 4P4KB 4BSWA 4P4KA 4GW1B 4A6YL 1IKNC 3NFNB 2Z31D 3U0TA 1MIML 1JI2A 4KWUA 4QTIL 1IC7H 4KGLA 2Q8BL 3VA6A 4BFGA 4P5KA 1GGUA 5GGRB 2DL2A 2VWEE 2HT2C 3WBDA 1ZK9A 3ARBB 3CVIL 3BIKA 2X1XR 3AXLA 3H2WA 5JOFA 3CPLA 4RGMB 3IDYC 3QRFM 1OCWH 5FF6B 2NXZB 1T22B 4NSKB 1MPAL 4O4YL 3RIFK 5IJVB 2DQJL 5ACLA 3U4AA 4FG6D 3RUGB 4OZGB 5HDQH 3RX8A 5JR1H 3BW9A 5HYSG 3LRGA 5D2NB 1X5HA 1FSKB 2X4RB 3N06B 4H88H 5KOMC 3P9MA 1GSMA 1XH3A 4BFIA 4JPKL 4AG4L 5EU3A 1F8TH 1PZ5B 3WL9A 1OAQH 1KIRB 5BMFH 1QR1B 2DN7A 1JNNH 5HGAB 1A6AA 5KJRH 3WS3A 5T5FL 5I19L 1QSED 4OCMC 1HI6B 3VGAC 3T1WA 4P48A 5FHBL 4PD4J 1NGZA 3MZTA 2VDQL 1AGDB 5TE7L 3IJYB 2FJFA 1KENL 2Z8SA 2BK8A 5IHZB 4XAKD 4YDLC 1KN4L 2X4TA 4WVRA 3W0WD 5IVXB 4MXQD 1QFUL 2V2XB 5I1GH 1NCDH 3FB5B 2BJML 4I0PD 2XWBA 4DGIH 5ACZA 4ZG1A 4EI5B 4R9HA 4DVBB 4N5UA 2JIXB 3V6OA 1E0OB 5HHMD 4APQB 4NNYB 2VXUH 2JIXA 4APQA 5ESQB 1P84J 3KDMA 1IC7L 4I5BB 5FV1L 2Y06H 1IAKB 4HIHA 3HG1E 3BP7B 4EEEA 2OL3A 5JW4M 1ZGLP 1MFEH 1ERNA 2EDXA 1VHPA 3EYOB 5E8NB 3QXTA 1IGML 5DXWA 5ANMB 5I6XB 1G7IA 1T2XA 1V5JA 4M03A 4XMKL 3S37L 1J1OL 1XMWA 1Q0XH 2VISB 3F7VB 3QCTH 1CG9B 2OTWA 1H3XA 4F2MA 1LD9B 1EXUA 1CFVL 1S9VB 4JM4L 1FL6B 3VMPA 1MPAH 5JLZB 5HD8C 4MA7H 3JWNC 3GBNL 3MRBB 3ZTNH 1FZOB 2VRAA 4OUOA 2J5LC 4D0BB 3MUY1 5EIIB 2OK0L 4LCWA 4FMFA 3VFGL 5EC2B 2EXYD 3VRIB 1ZE3C 1MCKA 2BNRA 3MRLB 2AK1H 3BESR 2D31A 5T1DH 2E7BA 1FORL 4XVJH 4U6XA 1J8KA 2CMRH 4KXZI 1BWMA 2HLFC 1QFPA 1PEWA 2GFBA 2KZ1B 3IDIB 5EA0H 3CU1A 5E2UL 5JOPD 2WLZA 3CFDA 4JFQA 1BZ7B 3E2HB 1VACA 4WUUB 2LVCA 3BQUB 4ZODA 4EOWH 4MJIA 43CAB 5IFAH 4XCYA 4APQC 2BHYA 4KJQC 4YHMH 3KHOA 2ICEB 3T08A 2XTJE 5CEYA 3ARBA 1HWHB 4XP1H 2VLRB 5MEPB 1JNHA 5E03A 4Z8FH 4Z7OE 3HA0A 4IJ3C 5DVNA 4Z7QF 1WSST 4ZFFA 1JYNA 4QHMA 3C5SB 4DZBB 2EIDA 2R0LH 4CJ1A 3VXSD 2C4XA 2E9IA 3MODL 2P49B 3ARDD 4MA7L 2AJSL 4P2OB 3S8WA 1MH5A 2VDOH 3PL6C 4JZJC 5F7HA 5E95B 3L95B 4MAUH 4OZHB 1RZKL 4HJ0D 4OLWH 1A4JA 2FLBT 3JV4B 4U1SA 5FKAB 5I1HL 2P5WB 1UKQA 3PGFH 1YPZA 4DN3L 5JXAL 1Z5LB 3NABH 2HTLC 4KQ4H 4GKOA 1E6JH 4HH9B 4G3YH 1WICA 3HNVH 1U8JB 2LVEA 1GVIA 3FB7A 1N0LA 6CGTA 1PY4A 5MP6L 4OCXL 4RISL 4KZDH 2Q86B 2D0HA 1YMHA 5D1ZC 5ID0A 2DIBA 2V9QA 4X5WB 5KG9B 4LDOB 3GO1H 4YC2C 4YBQC 2BCKA 5MEND 4P5KB 3RJQB 2MQ0A 4D9LH 2XZCH 3MCLL 1AXTH 5L2KD 1HH9A 1Z9OA 2EDEA 2MCG1 4UDTA 4UAOC 1IFHL 4ONHB 5D2NC 4NZTL 3R8QA 4GW1A 1S7SA 5IB1A 5HGBA 4IJ3B 4J3SA 3PNWA 3CX2A 1C5DA 5T3ZH 2A9ML 5EIQA 4P2CG 4EIZC 5T3ZD 4ZFZB 3GSQB 5I8OL 2XFXA 2OTWB 1U3HB 1I85C 5HHME 3C2AL 4Z5RB 4PB0H 1X5YA 2BVPB 2IPTL 3BUTA 4R26H 5HYFA 3HAEB 2CDGB 4FABH 5D6DA 1RUPH 3P11H 4CL7A 2UUDK 5JHLL 1JPTL 1U92B 5MI0B 4R97C 1A7PL 1QFWI 2QSQA 1CE6A 2JK5A 4TVSa 4GKNA 1NC2B 5FO9B 2WBJD 2OSLB 2OTUB 3B9VA 2NZ9D 4YBLB 4O58L 1XGPB 2BC4B 4M43H 4B0MM 2YXFA 3CFKB 1BQSA 4AH2A 4PB9H 1R5IA 4P9ML 4YHZH 3RJDA 2OXHA 1PBYA 1U8KB 4Y19D 2GY5A 5F7WC 3D0LA 4AEHH 4O2FB 1HHHA 5J1AA 4LHQB 1W72H 1JZ2A 1IAMA 4I3SH 5E2VL 1QLRA 3FO1B 3CFBA 3PABB 1EH9A 5JW4Q 1CZ8H 3QIUA 4YIQB 1T5XB 3RTQD 1H5BC 2PETA 2APVA 3DETD 2B1AH 2CQVA 1BEYH 3AM8C 5L8JB 4LAQH 2WZPD 5HYJD 4PBWD 2V7NB 3UTSE 1Q0XL 3HZYA 5IM7A 1RUKH 4NNYA 4QNPF 2YEZA 1TQBB 4M1DL 5J1TC 3GBLA 4LCWB 5ALCH 4PJ9C 4UNTA 3PP4H 3S3JA 1C5DB 5IT2H 3ZLQC 3ZL4L 4Y8DC 5J6HB 1H8OA 2QHRL 4OZFH 3IETA 2QSVA 4K8RH 2H32A 2AXFA 5LG1A 1LDPL 3WUZA 4H20H 1OB1A 1U3HA 4TQEL 5GGTA 2K1MA 4MMZC 4NN5B 3TBTA 1AQKL 2ARJQ 2F54E 1FNHA 1PEZA 2AJVH 2BOBB 3FQTA 4CUCA 1ED3A 5BW7A 2J3SA 3I2CL 3D3VA 3EFFB 4KUZL 3S36L 1DANT 3FFDA 5IKCB 5SWZA 5D5MF 1DUYA 3ARXA 4GKZB 4HSQA 3SE8H 4B41A 5GZOD 5H94B 1F58H 3W11C 4GSDH 4WEBH 4CADA 1G7QA 4XP6H 4X6CB 3CH8A 3FKUS 5MENA 3LQAL 1EVUA 2VXQL 4X7FC 5CILH 5E2UH 5SWSE 4K3DL 3NH7H 4YUEH 1KTLB 1WF5A 1G9EA 2EYRA 4CMMA 1VGKB 3VMNA 4WHYG 1U8KA 2AAVA 1AO7A 3C60C 3KPSB 5D7JC 4QXUL 2BVQB 1UCTA 3IB4A 2YD1A 4L3EA 5I1KH 3REVB 3ROOA 5KSVA 4KTYA 5BZDA 5JW3H 5IB2B 4P46C 4Z5RA 1ZHNB 4ODXA 1G7LA 2P5ED 4NFBA 3WS6A 5ERWB 1IGYB 2EXWD 1RZ7H 4TVPH 1EHXA 4NKDB 4MX7B 4G8FA 1F3JB 1KFAL 1BGXL 1I3UA 5A2FA 4XC1L 4Z7UF 1LO4L 1BQLL 3FAWA 2NY7H 3VCLB 3ME0A 2HAZA 3T2PA 4W81A 4CNIB 2HFEB 4OZIF 5HI3C 1BPVA 2IGFH 3RGVA 4WDIB 4HXBL 3IS1X 2I9LB 5K9QG 3VFSB 3C09B 2BY0A 3BOVA 3U30B 2J5LB 1NUNB 5I1JL 1SY6A 1ZHKA 2O93L 3LHPH 3O3DA 2PW1A 4PTUB 3ET9F 5BV7C 5ANME 3JV4A 4M48L 3ES6B 5FKAA 1J88A 5D72L 5ICXB 3NIDF 5F96H 3ULUD 4JAMA 3HKFA 2WUBL 4JRYD 2UZXB 1VDGA 2BXYA 4LMQI 2P8PB 4U1KA 4KRPD 5FYLL 2NW2A 4IIQA 2A6DB 2EDYA 3O9WB 1UXSA 5ANMA 4G6MH 3S4SG 1L0YA 4H5SB 2X1QA 4PY7B 4W68A 1LO2L 5IHLB 3QEQB 1EIBA 1PDKA 1UQSB 1WUNT 4IRSA 3UTSA 3BH9A 2E6QA 3BQUC 5EWIL 2IFGA 4YDJA 3C8KB 4OD2A 3V7AG 1E28B 1N64H 1NC4A 2CLRB 4Z0XB 3RZCD 1OP3K 1UJ3A 2XWTA 1JMXA 3MV7B 2IMNA 4M3KB 3ULSB 3QFDA 5ETUA 4LCCA 4GBXB 2ORBH 2JJVA 1Q0YL 1KJ2L 2D0GA 3MJ9A 2MQ3A 1QRNB 4N8CL 2R56L 4ORGB 5B39A 4OLYH 1UG9A 3L3KB 2N4IA 2OK0H 1TJGH 3VXNA 3DYPA 1QQDB 4NWUL 4YHPA 5HDBF 3MR9B 4JHZA 5CD3A 4KUCF 5BVJA 1K4CB 1RMFH 3QDJD 1RVFH 2MFNA 2D7MA 3OAUH 4MXVF 5EZLB 4QGYA 4JANB 1CLOL 2PNDA 5T3ZE 1UH2A 2J12B 1DBBL 1J1OH 1U8IB 1DBAH 1QP1A 5EBMB 2UVFA 3HE6B 3U46A 1UA6L 3IJYA 3VH8B 3M8OH 1JJUA 2VR5A 3VFSA 2ZOKB 1YEJL 2JCCF 1HXYB 1S7UB 5CEYB 4HF5H 1YMMA 3G04B 5B4MD 1A64A 2DICA 5IVXA 5FO8A 2Z92A 2NYYC 4AJ0A 1CLZL 4M7JL 2NQCA 1Q0YH 4PG2C 5J11C 1BOYA 1D6EA 3MV8B 2CDEA 1R0AL 3H7BB 4JFXA 1NFKA 4ZTOH 5BQ7A 3R8BB 5FCUL 4M6NH 2ZG2A 3QCUL 3ZE0F 1CICB 1J8HB 3QUXB 4X4ZA 4NJAL 1G6RB 3H9SA 3MA7A 4JR9H 2CMRL 1SJXA 4U6VL 2NW2B 5TFSL 2DQUL 1VEMA 2JJSC 3BWUC 3V5KA 3MQIA 4ZPVB 3ZDZF 2XICA 2VISA 3F7VA 3SJVE 4DKEL 2D7QA 4P2RE 2NY1B 5J13B 5I16A 1NPUA 2HT4D 1MELA 3L7FB 1QO3B 2FH8A 5DJCB 1G9MC 2YZ1A 4ZFGL 2CK0L 3D2UD 5C2BL 5F21B 1U6AH 3WS6C 4XRCB 5LWYL 3VG0L 4XVTH 1V3JA 4UTAH 3OSKA 3B9EA 3B9KB 4XP4H 5CEZD 4PP1C 3TESA 3RVVD 2CH8A 4S1DC 4QCIB 3NA9H 3MJ6A 3WJJA 3AS0A 5FKPA 3UTTB 4GUPA 4OCWL 4EXKA 4BZYA 3H7LA 4JDZB 1E27B 2J2ZA 4PJEE 1F58L 4HZLB 3G08B 2BOBA 1Z3GH 3KPSD 4HF5L 1P2CA 4NQDD 1MWAB 1KN2L 2YWZA 3KPRE 1G7JB 3QCVL 4M6MH 1OTTC 5IK3A 3U48A 2PW2B 4WW2A 1BF2A 1VADA 4JJ5B 2AI0L 4U1IA 5J7CC 2BFVL 3BH8B 1EK3A 1I9IH 1ZA6A 4JPIA 1SJHB 4HUUA 3AREA 5GGUB 1M7DA 4NKQB 1JZ4A 2FL5B 3U4BL 4GRLB 1ES0B 5GGSY 1JZ7A 5F7UA 4GOSA 1DDHB 3IT8D 3PDGA 1S7XB 3SDCD 4X7SL 3GIVA 5I8EA 3MV9A 3NVQA 5F9WC 4LHUG 4OD3L 2R4RL 2LFGA 1DQLL 1T1WA 3RVXC 4G6KH 5DJ6A 5FM4A 4EN3B 3WNLA 2WUCL 5F1IB 3ARGD 5JQ6L 2X70A 4YHPB 5EO0A 4XBPA 3UTQA 4HWEL 1U8HB 3S6CA 1YEHH 3QQ3B 2DS4A 2V2WA 3EYQC 4JRYB 4EBQH 4M6OH 4M7KL 1YPZB 4EDXB 1NCBH 1J0YA 3X13A 4KVCL 1RUQH 1JWSB 4KZEH 1JWSA 3PHQA 3DX8B 3GK8L 2P8LB 1Q9OA 2IH1B 4KROD 2EC9U 5D6CB 5DVMA 5KSAB 1HSAA 5GIRB 1MCQA 3TPUB 1CTNA 2W65B 1BFVL 4M7LT 3V6OC 4XCFH 5E94B 1IL1A 3MREA 2RHEA 5CGYD 2VN4A 4O2EB 4LLWA 3VW3H 1DQLH 4O2EA 1EV2E 5I1JH 4JDZA 3TGXA 5ESQA 1HYSD 1FP5A 2BX5A 5DD5L 3V7AE 4DUXA 4UT9L 4JN1H 5ETUB 5DD6B 4U1KB 4RX4D 1F11A 3QEHA 1N2RB 3MNZA 3CFJA 4XCNA 4ZFZA 5DRWB 1JNLL 3IGAB 4LVOB 3TA3A 5BS0D 4RGND 2GKIA 4WUKH 5F9WB 4PJ7F 1I1AD 2BVEA 4PBVC 4PTTA 3WFBH 1XAUA 4RAHA 3UTSB 4UILL 1JHTB 4RBPH 1MFCL 4HX1A 3MRNA 2EE3A 3MRBA 4U33A 5FUCE 4E5XB 1R6VA 4M1CD 1WCBB 2AABL 4FTVA 4AYFA 3TWCL 5C09B 4FQXA 3GSNL 4WWKC 4XGZA 2YPLD 3T0EA 1S78C 4LAQL 4OF0A 5C0CD 1KSRA 1OY3B 5I30L 4WY7H 4D0DA 4DCQA 1EUUA 2O5XL 5F88B 4L9DA 1H0DA 4N0UB 2R23B 2WBWB 2X4NB 1FIEA 1FFPA 3LVEA 2Y23A 3G6AB 4JHWL 3TJHC 1KJMA 4ZDHA 1HDMB 1X4ZA 3MLTA 4KQ3H 2OLDA 4O51A 2DJSA 2W60A 5IIEA 1RK1B 3QIUD 1RUML 1M4KA 1RQ5A 4ODWA 1HZHH 1XF3B 1DVFA 3NZ8B 5HDBE 1QOKA 3O6KL 2QL1A 5DEFB 4OQTH 5L7XL 5IVXE 1T5XA 3ARED 3AU1B 3ZKQD 5DQJA 4LDEB 1FCGA 1B3JA 5BS0E 1P9MA 3F7YB 4OZ4A 2QHLA 3W0WA 3WKNA 4S11A 5DHVH 3FT2A 1NMAH 1BJMA 1R3LB 5F3HB 4KHXL 3QYCA 4WO4C 2EYSB 3IYLW 4F9LC 1DFBH 3DX6A 4F7TA 3U7YH 2CUHA 2AXGA 2UWEB 1JGVL 1LO4H 5E8OB 2O61B 3INUH 3KJ4C 5DRWA 4AMKL 5F7MC 5A2LH 1OGTB 1MCSA 4MDJA 2XYCA 1D5BA 1OB1B 2DQFA 4JFEA 5T3ZL 1KCSL 5I9QC 3BWAA 4J4PA 3QB7C 3HI1B 4I18B 3TN0C 3BKYH 3ULVD 1A0QL 1N5YH 3ZKMC 5HVWA 5IWLA 5IMKA 3MLSL 2I5YH 4NQCB 3OF6D 3ISWA 3L5WA 4KKCC 2BY1A 2VUYA 4WEUD 4HW6A 4YXKL 2HP4A 1S3KL 3EJZC 4HQQL 2A74A 2E27L 4KV5E 2OJEB 3GJFB 1QYGL 3MOQA 2AI0H 4WI9A 3SGKA 1H0DB 1Z2KA 4YHIA 5IVOA 1I3VA 4BJLA 3HTLX 4HD9A 2ZUQC 1MRFH 3MNWB 4NC2B 3ARTA 1I7UB 4XMPL 1T0MB 4JKPL 4PJHE 5HYSB 4K2UL 3ESUF 4QRUB 3JV0A 3REVA 2N56A 3F6IA 2DBLH 4XTRD 1MVUB 4KKCD 3IDYB 4YX2L 5DURD 2VSCA 1CU4L 2VH5H 2ZKHL 1JCKA 3QO1B 3R1GL 4LKXA 3H0TA 5K9OB 1FG9C 3AS2A 3MRDB 5CBAA 2ZJSH 4KRMB 1A6PA 1UT9A 5LQBH 1BQHG 2ITDB 2R1WA 1N3NA 3PHQB 1RJLB 4H0HB 3DX7B 3TF7C 1RIVH 3WHXB 1ZLSH 1X5GA 5L9DH 1G0XA 1WAAA 4NC1E 2YUWA 5HVHC 4MB4A 1ZT7A 5E94A 4C55A 5EO0B 1DQDL 4KVCH 2NY5C 4WI4A 4WO4D 5EO9B 3PGCB 4RWYH 3ZE2E 3I3EA 4NQXA 5JR1L 2VDQH 1YQVL 3WNOA 1HHIA 3MUZ1 1IC4L 2VLKD 4IOFC 5KVFH 5I1EH 3C5JA 5F7EL 3KJ6L 2W9DH 3MSPA 3DGGB 2HFGH 3ILQD 3ARFC 5GHWL 4E41B 3T0EE 3MRMA 1CLZH 4M7JH 4TSCL 4LFHD 4X9FA 4FQJH 5HJ3A 2G5RA 3LN5A 3QIWC 2VLKA 3DIFA 1RIUL 1XIWC 3QR2A 1LP9F 3QEQA 4LRIA 1BLNB 3PGFL 4Y4HA 2A1WL 5DC9B 3LMJL 3L3JB 3SGJC 2JB5H 4AQOA 1SEBB 1KELL 3BPCB 4AEFA 4JY4B 2B39A 5D7LD 4KK8D 1J5OL 2X4SB 2GK2A 2EEBA 4OF7A 4LK4A 3MNWA 3NIFE 3C9NA 5CWSB 4PGJA 4Z78A 2V6HA 3BEWB 4D3CL 3F62A 5BV7L 3CZJA 3O6FD 4DGIL 5FM5M 3MRHA 4G80A 3GSUA 3QWOA 5AZEL 1Z9SA 5DEGA 4Y5YA 4P23D 1R0AH 4RGMC 5F7LB 1NSNL 3L5XH 3VI3F 1OM3H 3QDAA 4JFED 1FL5B 4G43A 4KMTL 3ULVE 3P4NB 1X5ZA 3DPBA 2E9WA 3UBXB 3EO0A 3MRIA 4HWZB 2YRZA 4MD0B 2FNBA 3QNZA 4L8DA 1FSKC 4X6BB 4X4MA 5JW3L 1GGTA 4BSVB 4Z7VA 4J6RL 4Z7WA 1T2QH 2H8PA 3JUZA 5HHOD 4OAWB 5KVFL 5GS1C 4KPHH 2R2BB 1CBVL 5CCKL 2Y6SC 2C3XA 3E3QC 5JDSB 5I18L 1U8QA 3QIBC 1VENA 2YWYA 3UYPA 7FABH 5CEXA 2AEPH 1FGNL 5F3HA 4HUXA 1LNUB 5DJAB 5CHNA 5J56B 5DJYB 5C08B 4Y19A 1LE5A 5D1QA 2HN7A 3STBA 1ZLWK 5JA8B 1M7XA 3M1BA 3QI9D 1AGEB 2NTFB 4KTEL 5BOZG 2XKNB 4G8EA 1KEGL 1KB5B 3CX5K 5BJTB 5LGJB 5FYJL 4HGWB 1TNMA 5KW9L 3TPKA 4X6FB 1DSFH 2VXTL 3MJ9H 4X6DB 2XZQL 4TUKL 1OWWA 2ATKA 3CX5J 5GS2D 4OV6F 1LHZA 4HKZA 4A2MA 3QI9A 3RDTD 2VDMH 4W4NA 1JZ8A 4OIIH 1CFTA 3W5MA 5DT1L 1UH3A 4IRSC 3P9LA 3I6LE 4RWHA 5TF1L 2HJFA 1QEWB 2FATL 2GSGA 4L8CB 4MJ5B 3UTTE 2P5EB 1KGCD 3BP4A 4IIQC 1BM3L 3RNQB 5GRJH 3QFJE 3JTTB 5F93C 1K3ZA 3HE7B 4PJEA 2VO5A 1HHIB 5DEZA 1FC1A 1IM3B 4V1DA 1K85A 2HLAB 4HQQH 5TPWL 5LGHL 25C8L 3ZYIA 2EDFA 1HOCB 4RFNC 4YXKH 5EBLA 1G7JA 3EKCA 4U6HA 3BMVA 3BXNB 3BDBA 3CD4A 4JY5H 5IW6A 3K1KC 4Z0BL 3L3GA 1UZ6E 1YY9D 3WFEH 5KJRL 4LL9A 3RWIA 4ERSH 1JRHL 4I2XB 2GAZA 2W0LA 4Y5VC 3WV0A 4YDJB 1OGAE 2R2BA 3D1MC 1JHTA 2WLYA 2XG5A 5D5ME 4GS7C 1NC4B 5K9OA 1AE6H 5HTSA 1NCCL 5CJQL 4TNWF 3QFDB 1N3NB 4MYWB 4NRYA 4XCCH 5JPMA 3QNYA 1SM3L 4BFBD 4FQXD 4HIEA 2WANA 3ULVF 4H20L 3WHXA 4Y19B 1TETH 4QRUA 1HHJB 3RVVC 1JHKL 4L4TE 4WO4B 4PP1D 3QEQD 4PLKD 4UMGA 2D2OA 2GJ6D 1YNLL 1E4XH 4U3CA 1MQKH 4IRSD 4FQIL 4PJHF 2P48B 1BIIB 4JFFD 4OGAC 2EYTA 3D0VB 4QRTB 3QDGE 4E41D 2BDNH 3GIZH 3DGCR 5GSVB 3C5JB 1WFOA 2HT4C 1NGPH 4PJ9A 2OR9L 3MTRA 8FABA 5GGVL 4YDVB 3RWDA 3IS0X 4PRIE 3IVKB 4YFDB 3R1GH 4RFEA 4CVZB 1GYAA 1FNFA 5T1LA 1BLNA 3EZJB 2Y5EA 4JZOA 4ZAKD 5JW5A 1ZVSA 5JW5B 1MREH 3HS0B 3IFPB 1XCTB 1DR9A 2CDEB 4YHKL 3NZHL 4MJIE 2AKRB 2AVGA 4K94C 3QHTC 5FGCE 1MLBA 1YEKH 4FQ2H 5EU6E 2B5IB 4XBGB 5TGBB 4JRXD 1K6QL 1EAPB 2Z31B 1D7FA 4AK1A 3QIBD 5J9PB 43C9B 1AFVH 1RZIB 4ZFFB 4X0KA 1I3GL 4NSKA 4LLDB 3ZE2F 3ILPB 2GK0B 2DIJA 2LAGB 3SGKC 5J89A 2A77L 4Y2DC 4QOKB 3ZKMD 3LKQA 4QOKA 1OAYL 4JO2H 3RUGE 2ADGA 5F96L 3NCEB 4JQIH 4I2XA 3HMXH 1JBJA 2FEEL 4MAYA 1HE7A 3LKNA 3U6RB 4D9RE 4MAYB 2H41A 3KPRD 3O2VL 3GSRB 1L6XA 3UBXA 4I4WA 5CZXC 4IMKA 5IJKC 1H3TA 2R2HA 5CJ8A 1WIOA 3X3FL 5L0QB 1A21A 4XT1C 3WS3B 3MJ7B 1L7TH 2GTZA 3HUJF 1QZ1A 3QUMB 4IBLT 4POYA 3L3OA 3QPQC 4LBEB 3EBAA 2J8OA 4GRMA 5D7IF 5D7SL 1JGLL 1Z9LA 2H45A 3HRZA 1J05A 1RUKL 3VE0B 5EUKA 4MA8H 1QRND 2QQLL 4KK8C 4E0RA 4X83A 4WI5A 3AY4C 4YBLC 1R3JB 1OT2A 1FE8H 3ZL4H 3AUVA 5BW7C 1GC1L 2ZOLA 4G6FD 1XIWD 4F57H 3IDXH 4OLVL 2XNAA 4ELKB 2WIIA 1CE1L 1MCOH 2Y07L 3QFJA 1IRAY 5BJTA 1R5WB 4TNWK 5E1AA 1RJZA 4R3SA 1J0KA 2AJUL 1PLGL 3EFDH 4CKVX 3C60A 3TJHD 4TSBH 2HKFL 3THML 2ZUUA 3GUTA 1VPOL 4RIRA 2VQTA 4PR5B 4U1GB 1A9EB 1H9VA 2WP3T 3VFPA 5FF6A 1MFCH 2NY2D 3ZYZA 2HJFB 2BJMH 1CD1A 4PRPB 4B50A 4WWKD 2Z4QA 4U0QB 5B38G 1FNSH 3I85A 4U3HA 2DTMH 1WBYA 1NBYB 4Y4FC 4KC3B 2W38A 3D85A 4LNRA 1T6WA 3VJ6B 1FZMA 3ZSTA 3EOBB 4KVNL 2PTUA 3E2HC 4PJ9B 2YD4A 3I6KB 4ODBD 3GSNH 3G6DL 1DEDA 2FJHA 5A2JH 3F5WB 4AH2B 1CR9L 1G7MB 1IEBA 4PB0L 4RGNC 3T04D 3TBYA 4Y2DD 2IQ9L 4RRPA 3L5WB 5IW6B 5KSAA 3LN5B 1N26A 4NKMB 3VI3E 5E1HB 5F7NC 5KANI 1ZV5A 2YBRA 3MRQB 1NC4D 2DB8A 4WU5B 1XCQA 4M9PA 4JQVC 3GMNA 3RL2B 5DJ2B 4W6WB 3RVUC 1JPGB 3VDBA 4XP4L 5IB5B 4NIKB 4ZUTA 1A7NL 4NM4L 2YC1B 2XQBH 1T80A 4UINL 5DJ8B 1XGUA 2FGWH 1XF5A 1OP5K 1B0GB 3LKQB 1CDJA 2VLRD 2PTVA 2YRLA 1B0RB 1MHHB 1UVQA 2X09A 3BGFC 5HGDA 4AIXA 1JVKA 5IP4A 3UTOA 2VJXA 3QHFH 2ZSVA 3PJSA 1Y0LA 4LFHG 3DMMA 1I9RH 4OGXL 2F53E 2C1OB 3EYQD 5H37G 1OQOA 4Y16B 5KAQF 1UWGL 4O2CA 4A6YH 4IRZL 4L9LA 4K3EL 4RA0C 3TZVC 3WFEL 2BNUB 4HWNA 1EVTC 3HMXA 2VERN 1D6VH 4X99B 4X7SH 1ZMYA 3EOAB 3S5LA 2ARJA 3M07A 4NKIL 3EYFA 1CDUA 1IZJA 3BP5B 1CVRA 5EC2A 4NT6B 3DRTA 4R4BB 4U4BA 3O4LA 5KSBA 1YEEL 1U2HA 2IALA 4I77L 2OR9H 3G5ZB 4PJIE 3TT3L 4M8QA 5KS9A 4PRHB 4TN9A 4LVHC 1UACL 3DETC 4MAUL 2PYFA 4M5YH 5MERA 5GJSL 1C12A 1RMFL 1RVFL 3L1OL 1AGEA 2NTFA 3VXQA 5TQ0H 1CS6A 2EDHA 4JB9H 4L8BA 3W39A 4E41E 3W0WB 5C8JB 3QUYC 2IG2L 2VDPL 3RAJH 3C60B 4K7FB 5JPNA 2XACC 1A3LH 1G7LB 5KSAC 2IANA 4R90L 4IRJA 1D5IH 2Z91B 1P4LA 3DRQB 3UZVB 1SYVB 4KFZC 1JPGA 1W0WA 1BZ9B 1TTGA 4TPRL 2NZ9C 3QH3B 4OFPA 2C7UA 1EEZB 3IXTB 4JO1H 4LLDA 4MJ5A 5MENE 1OGAA 5FXCH 2I9TB 1G9NC 1AGDA 4ZSOE 3T77B 1UM4H 3F6LA 1BVZA 1KTDB 3MV11 1F45A 1IFHH 2BVOA 4OBSA 2MKLC 3VRLE 4G8IA 4G9FB 3QQ4B 3SDAA 3D18A 2EECA 1HCVA 4P59H 1Q94B 3BFOA 1OGAD 3QP3A 4M1CC 5CZVL 5EOCH 4HWZA 1KBGL 3T0XA 4EI6A 4WHYH 2YD9A 3V4VL 1ORSA 3WDJA 4MA8L 4HMEA 3VWJD 4O2FA 1BFOB 3SQBA 2CXGA 2QKIB 1BIHA 2DD8H 1F6AA 5D1XD 3K8MA 4LCYA 5DDHA 4QXUH 1S9XB 4WW2C 5AYUH 3SKJL 3LZFH 1TQCC 1N8ZB 4LGSB 2VXUL 4NO5A 2SEBB 1TCRB 4HAGA 2DI7A 4FQ1H 5JLZA 4EUPA 1I1FA 3GBMH 3NA9L 4UU9A 3TH4T 3KYMA 3KYKH 4JO4H 4NBZB 1I7TB 3GKWH 2ADFL 1FPTH 1X5LA 1IGMH 4JFZH 3EYUL 1JWMB 3K8LA 4CBPA 3IRZA 4HLZH 4QF1A 2IFFL 1C16A 4HUVA 2H26B 4FFVD 3REWA 3ULSA 4KROC 4J7RA 3GRWL 4OZGA 1QLEL 4MWFB 4ELMF 4GJTB 3FAXA 1QACA 4NP4L 3JVGA 1YEDA 2O5YL 4Y2DB 5EU7E 3HC0B 1YUHB 3LRSB 2BVPA 5JXEA 1DQMH 3G9VA 4EXPX 4KRLB 2VDLL 1BAFL 4UB0L 3RUGF 1ZA3B 1U36A 4WW2F 1CXIA 5EWIH 3P4MA 2EZ0C 5IGXL 1L7IH 3FCTB 5DURB 4J6RH 1AQDB 4CADB 2KQMA 5GRUH 4G6ML 4R7DB 1FVDA 2OTUA 4LSQH 4X4ME 1U9KA 4G9DA 1XR9A 2R0ZL 4R7NB 1K5NA 1ZHBA 3SDCC 5I1CL 1DN0A 4U6HB 3GHEL 4YXHL 1BF8A 1G7MA 1IEBB 3MRKB 3OKNA 1DEEA 2Z35A 1MFDL 5E99L 4YLQT 1YNKH 3HNTL 2IF7A 3BW9B 3L3DA 2AERT 2AJVL 2EH8L 1UWEH 3JTSB 3BZDA 5IBTH 2RCSH 4JG0L 5CINL 1KB5L 3ILQC 4AIZA 2KQNA 3O4LD 4O4YH 2DQDL 5LAXA 1WBXB 3TZVB 1WAAF 2JE8A 2Y25A 4HGMA 4IRJB 4FQQA 4M62H 4OKVA 1IM9B 5T1MA 1FFRA 3BZ4A 1IGIH 1GOFA 3SQOH 1KT2B 5CGMA 1AGBA 4E9LA 1D9KB 1Z5LA 3SDYH 1NUGA 2JKXA 2BNUA 3J7HA 3VCLA 2XWJB 4C57C 2LE9A 4UV7H 2YD5A 3HZYB 1F4YH 4U31A 4N0FA 3L3OB 4I0PA 1AKJA 2X1WL 3BJ91 1DUZB 4XNZC 1AKJB 2EXYC 4GRWH 1C8PA 4ZUUA 1T66D 3B9KA 4XPTH 2FD6H 2V5YA 4ISVB 4RGOL 3BRDA 5HGDB 3RI5F 4WTWA 4QGTA 2BXZA 3T2QA 3MLZL 4MWFA 3ECBA 4HUNB 2WSKA 3S35X 2X41A 1XIWA 5IBLD 2BSRB 5C9JA 1H15A 4GG6A 4PRHA 1EUTA 3BMWA 1E27A 1K4DB 4ZSOB 1CK0L 1SBSH 1DQQB 4LRNL 4HH9A 1NBZB 3D5OF 4JDTH 1CD8A 1BM3H 3C60D 2VR4A 1OSZB 3HPLB 3TBSA 2NW3B 4KJPD 2PW2A 1GHFH 4L8BB 3BP5A 3HR5B 3OHXA 2ZZUT 1IAIL 2JELL 1FV1A 3QFJD 4HUWA 3PIQA 4NDMA 4U1LA 3RWEA 3GUTB 2IH3B 1S7TB 1BVKA 1M6OB 2LU3A 3KYMB 2IAMD 4TTDD 4PP2A 5DFTA 2FYYB 2DQHL 4PJCA 4JR9L 2DDQL 1CF8L 2DWEA 2X7LB 1FLTX 4KI1A 4KDVA 3IFLH 5F44A 1ZLVH 1CFVH 3MGTB 2ZUXA 4LPYA 3EOTH 5F6HJ 3RAJL 1K2DB 5BV7B 2OP4L 1D9KC 5CSZB 5E24E 3DNKA 2H2SC 2NY7L 2XZAH 3QDME 25C8H 2QSTA 4L3EB 3ULVC 5DS8B 3P40A 1AHWB 3TN0D 3QQ4A 3SDAB 1FO0L 3D18B 4OCNC 1P7HL 1T0NB 1XZ0A 3OPZH 1W72A 2IBGA 2P8MA 1W72B 1FNEA 3GMLB 4BFIB 4RMWA 4WFED 4K71C 1KELH 1RURH 4NUJB 1B2WL 4OZHE 4OCYH 5CD3B 3RKPA 5IHUH 5I1IH 2JCCE 4WUUA 4GRWF 1LWRA 4YXLH 1J1XL 4S1QL 4XPBH 1E4XL 3PV6A 3I9GL 2HJLB 3BPLC 3RPKA 4FZ8H 3LKSB 4PJEF 4F3FA 5J11B 3GSVA 1RZJH 4BH7B 5AWNH 1FGVH 5JXEC 3HI6H 4HPYH 2I5YL 2IPUG 2VDRH 4RFOL 5GGQL 5D7KD 2LV4A 4OI8A 1ZHKB 1ULVA 4LVEA 2DL9A 3DHMA 1Z0NA 3RY6A 4QEGA 3BN3B 3LRHA 2ZUVA 3FRPG 2J88H 1VESA 4WHCA 2PUQT 3RWIB 4PJCE 4F15C 4PJIF 1B2WH 2GI7A 1WIUA 3KR3L 3O9WA 5TE4H 2AXJA 1KCLA 1P4IL 1LO5A 3V5KB 3SPVA 4O02L 2B1HL 3DMMD 3PHSA 1A0QH 1SJVA 4HUWB 1BOGB 1G6RH 1PG7L 4JFZL 4IOIA 5AYQA 4OI9A 1H3VA 3MODH 2ZNWA 4J2XA 1FO0A 3QNYB 4KPHL 4MNGE 1I8MB 2G60H 3WO4B 1J0IA 4GW4A 1I9JH 5T3XE 3EOAA 4MD5A 4HKXB 3N9GH 1JWMA 1L6ZA 1HNGA 1NGQL 3VRIA 3DVGA 4JPWL 4P3CH 5DD5H 4WV1B 5DUMH 3T0EB 4XWOC 4HEME 1L0QA 3O8XB 4FZEL 4LNRB 1NAMB 1QKZH 4FXKA 3GI8H 4N0UA 3IFNL 5JUEH 1F4WH 4BZ2H 4PJDB 3FQRA 4HIJB 2JB6B 4KMQA 4XMLL 4F33B 4UNUA 4XVSL 2V9TA 1MWAA 4QRRD 4PJ5E 4WTZG 5DFWH 2DQIL 5E6IC 1DLHB 5F1NB 1MFNA 3NPSC 4WJ5A 1KEGH 4P46D 3AB0B 3CXHK 1PG7H 3TT3H 3RDTB 1T7XA 1IGCL 1J8HE 2YD6A 3RIAK 1MWAH 2H2PC 1BWWA 5D7JD 4OF6A 1HYSC 2MNUA 2DMKA 2A38A 4NZRL 4WGVB 2C26A 4S1SH 5CGYC 2D3VA 1DBKL 1VB9A 4RMQA 1K3IA 1KB9J 4Y88A 1NDGB 1IQDA 5C0CE 3O2DA 4PJGA 1A6UL 3LQAC 1NKOA 4N9OB 1WVZA 4OCLC 1EFQA 3AS1A 4ENED 2EYSA 5F7EH 2OSLA 5C0IA 4ZO8A 4ZAKB 2ERJB 5E00A 5EU6B 3JWOC 5DA4A 1MH5B 1KJVA 4DGYL 2DLTA 5E8OA 4MJ6A 3S7GA 4HJ0C 3GKZA 4Y16A 2BSTA 2J4WH 4HC1A 2BSRA 4PJ5B 5C9JB 3VFMA 3DHJA 1UWEL 1KUMA 3RY5A 1N6QH 3H9SE 1YEIL 3H6JA 2GTZB 2ED8A 3C5ZC 1JWUA 4BSWB 3C8DA 2H1PH 3U0WL 1FH5L 4ELME 4OM0L 4XRCA 5C08D 1CDGA 2VC2L 3WEXA 2HVJB 1Z3GL 3IDNA 1MRDL 1CFBA 1KIUA 4BELD 5GJTL 5I74B 1T3FA 4OI7A 2E7LC 4QHLB 1A14L 4H1LA 2BY3A 5JNYB 2XN9E 1E28A 1UKTA 2DTML 4I8DA 4JO3H 4Z7WF 1IC5H 3BIKB 2AJYL 2V17L 2D31B 2WWKT 5IEKA 3WNPA 4UDTB 3KPQA 4MB3A 5IROC 2JIXD 4APQD 3TH3T 4O9HL 4Z95H 3BE1L 3OKDB 4Z8FL 2PXYA 4JKKA 5FYKE 1A4KB 2P44B 4X6CF 3IDMA 5F72S 5DS8A 3WUWG 2F54B 3TO4C 1R3KB 3RNKA 1FL6A 2NY6D 3CMOH 5CKAA 3VFTB 1HINL 1QG3A 3HUJE 1W72L 3BPLB 3IU4L 5EIIA 2AJ3B 5BS0B 1JZ5A 5FM8A 4ZXBD 6FABL 5IFHL 4YWGH 3VWJA 4H26B 1ADQA 1TVBA 1O5DT 3MJ9L 2PO6C 4LCCB 1FZJA 3BPNC 4DJMA 3VH8A 2GITA 3QSKB 5DD3H 1RURL 5A3IC 5L6YH 1N6QL 2YPLA 4MJ2A 5GS1B 4ZD3L 2YPLB 4G7VH 3ZE1F 3GMRA 4NRXA 3HZVB 4OZIB 1K4CA 1I1YA 1M71B 5HHNB 5E2JA 1RZ8A 1N0XH 3QDMD 3QZWB 1MRDH 1PW3A 4HS3B 4HIHB 1XF3A 4XPFL 4NCC2 2IC2A 4NQTA 4LCYB 4EI5C 3WD5L 2B4CH 2FJFB 4X8XA 4J23A 3O2WL 1DLFL 3O6LH 5JHDD 1TQBC 1JZ6A 4I0PC 2F9BT 2P1YA 1ZOXA 2V2XA 4IRSB 2EH8H 4EUPB 3MRRA 1B4JL 4RZCB 2HFEA 1TVHB 5HVFB 3BP6B 3KPPB 1TVHA 4GSDL 3SGDI 2ZUWA 1PG7W 4XPGH 2Y4SA 4QRQA 4NN5C 3NCYP 3T1FA 3RWCB 3LKOB 3GBNH 3QRGL 2BNRB 3SKMA 2EDDA 2VDKL 2GJZB 2I60L 4OLVH 3KLAA 2HTLD 3FFCA 5ENWA 5C07B 3LH2H 2OZ4H 1MIEH 3GI8L 4XB8A 3PL6B 4KV5F 3IU3A 2ARJB 4GQ9L 1OAZH 3K81A 1BZ7A 1T1XB 5D8JL 5EBGA 4FG6C 2MCPL 4L3CB 2AK1L 1EJ6A 5ID0B 2Y9RT 3LEVH 3RU8H 3FRUB 4DQOL 3ZTJH 4BSVA 2EIZA 4U1JB 3TFKD 1A6WH 3ARDC 4YQXH 1AQDA 3A6OA 4M9OA 2XV6B 1W8OA 1S7TA 2FIRT 3GM0A 5AZEH 3MACL 3TP4A 5L2KE 3BQUD 4TSCH 5BV7H 1INDL 3FHQA 2QEJA 5EZIL 5A43C 5LXGH 4MA3B 4NBYB 3SDXF 3JSSA 3AC0A 1WEJL 4YC2B 3O4LE 2XQYK 3GIZL 4KJQD 5C08E 1HHHB 5BZDB 43CAA 4L4VE 1CDYA 1OPGL 3D9AL 4DGVH 5DK3A 2AGJL 1FDLL 3ULUC 1MCNA 1GGCL 5F6IC 5SX5H 4QHUB 3UPAA 2APBA 3ZSSA 1IM9A 5T1MB 5T3XL 2CIIB 1A4JB 4OFDA 4P2OC 4BZ1L 4BKLB 4EOWL 3L3IA 1KC5L 1RI8A 3RWHA 2FH6A 4QYOA 2YEZB 3GJFK 4BH7A 1A7NH 3P30L 2GEEA 1DQJB 3ARYA 1I1AB 1TTUA 3T1FB 1UB5A 5I66B 1K8IA 4PGBB 4WCYH 1D6EB 5C7XH 3BP4B 4H8WL 2H32B 3MBEC 1IEAA 3WFDL 5FKPB 1U93A 4Z18A 3EUUA 5H2BA 3MBXL 3CVHH 1GGIL 3QIWB 3BT2L 5CIPA 2HKHH 4MVBD 4ZPTB 2A9NL 4ZOEA 5I73C 1WITA 4HS3A 1YEJH 3IJSA 4C83A 2C9AA 4LSPH 3DWTA 3GSWB 4XB7A 1TZIB 4ONGL 5IK3B 1FFOB 1WC7A 5EFIB 2Y7QA 5FCUH 1S9WA 1J10A 3MRJA 2VLKB 3DIFB 2NY4D 1IT9H 4NDMB 2DLFL 1LEIB 5F3BA 4UT7H 2YD3A 3P4OB 1X5IA 2ESVB 1H3PL 4DAGL 5C0AB 2PO6B 4LCCC 1ZVYA 1CDHA 4H1LG 2XWTB 4ZUWB 3VWJB 3QHFL 1C16B 4H0GA 4P57B 2IAND 4GBXA 2RR3A 3JZ7A 2EKJA 4GXUM 2KZWA 1GGBH 4ORGA 2R0ZH 3HFML 1Q72L 5ICZA 4JG1H 1G9ML 3V0VA 5EORL 2I24N 1QSEA 2NPLX 1J0HA 4BFEA 5IMLB 2BVTA 2Q3ZA 3DECA 1PQZA 3EHBC 3QDMB 3CFDB 2F53A 5CBAB 2LTQB 4IM8A 3CC5A 4YPGB 4HUMB 5JZ7D 3B2VH 1W0VA 2F5BH 3EW3B 3QUKB 3S34H 1YC8A 1DQDH 4XPTL 4MS8D 4BZ2L 1L9MA 2YK1L 3HG1D 3B2UC 2ZG1A 5HHVH 2GJ6E 3EDKA 3NIFF 5C0NC 1UJ3C 4LRNH 1I1AA 5F9DC 3U7WL 1ZTXH 5ALBH 1RD6A 2VWEC 5F89B 5C6WH 5EPMB 2D4FA 5F89A 3CSYA 5ESVB 2XWBB 2Q20A 1MIMH 5HHOB 5CEXB 5GSRA 2QSCH 3SDDB 1JGEA 5HI5C 3TYGL 4JRXA 2FSEB 1RAMA 5H2BB 4LQFH 1OP5H 1S9KC 2Q1EA 1I8IB 2FD6L 1FRGL 5E6YA 5HI4D 4LSDA 1IGJB 4HKBB 3AMKA 2VKXA 1JK8B 3ZMRA 2Z31C 4ZO9A 3BUYB 2O61A 5ERWA 3EDDA 3VXUA 5ADPH 4RRPG 5EA0L 3H42H 3V4PH 3W5NA 5C3TA 8CGTA 3UJIL 5ABDE 1MHCB 4P0DA 2BNRE 1MCWM 3UPRB 1EXUB 3B9KC 3QEUA 4GH7B 4U2YA 4X6FA 4XPGL 4F58H 1P7KA 5FB8B 4HMCA 5ISZB 1VSCA 1X5JA 3WIFA 4F37K 3FB7B 1A7RL 2VLKE 1K9TA 3SBWA 5C3LD 3HNSL 4JVWA 3HRPA 3WIHL 1HSAB 5F7DA 5F7DB 5KG9A 3M17A 1WIPA 4LDLB 5E6ZA 3V0WH 4Y16C 3IFLL 4M1DH 1YEKL 4Y4KC 3T2NL 3UTTA 5E6IA 5E8EB 4QHNA 2XA8L 4QWWC 2G9HA 3V0VB 1X5KA 3NBNA 5ICYB 3MROA 3JV5A 2ZSWA 1JGUH 3SO3C 4LASL 1BVLB 1VGKA 3HN3A 3D3VB 1RSFA 1WAAE 1I7ZA 5HYSA 1VACB 4DEPC 1DVFD 3QAZB 9CGTA 2OM5A 2UV3A 4HT1L 1YA5A 2AJYH 2V17H 3MMEB 4N8PA 2V9RA 4GAJH 4XWGH 1NFDB 5J57B 2KL6A 3V79C 2KPNA 4ONOA 4NQVB 5DHXB 3BJLA 3MX0A 4GG6E 3VXTB 2V5MA 3VXRE 4LVHB 1DQML 2HA1A 2NY3C 2WIIB 3KXFE 3X3FH 4MX7A 4UIKH 2MMXA 4P5TD 4X98B 1WWBX 5DQJB 1MNUH 4X98A 1KTKE 2FJGB 5DVLA 4UQ2A 1FRGH 2ILLA 2QR0B 4LRIC 3BO8A 3K0WA 1J12A 4PJ7E 4QYOB 4PGDA 4L4VB 1AO7B 3S4SA 1F3DH 3CSGA 5HDLA 3MXVL 3TEUA 1NLBL 1DQJA 1AHWA 5TE6L 3PWPB 4J3OC 1F90H 3VXNB 3M1BB 1ZSDB 1RIHL 2P5EE 1I7RA 3B8YA 1SHMA 1I7RB 4NKDA 3RGVC 1I9JL 4FFZH 3UAJD 4U0RC 1I8LC 1W0VB 5I1AB 2CLVB 4OLZH 1KB5H 2UWEF 3QA3B 4N9GB 1YQVH 1P4IH 1OW0A 3MRFA 1VA9A 1CQYA 4DW2L 2Q86A 2Z92B 5GIRA 4AL8H 4JFOA 1T3FB 5C0AD 1ZT7B 3MRPA 2JJTA 3FB5A 5IVNA 3UEZA 1AJ7L 3CFEA 1CGSH 5ITBH 5FHAH 1YDPB 3X14A 4GMSL 3O9WC 4OTXL 2ESVA 1XCQB 3I50H 4QHNB 2D7TH 4G42B 2X2YA 4G42A 4YDKH 1GPOH 3FTGA 4N68A 3DVIA 5A2IH 5F7YC 5CBEA 1NH6A 3PUCA 1NBVH 4ORZC 4M62L 4MAYC 2PR4L 1FVEB 12E8H 3U4BH 1F4WL 3VXMA 3E8UL 4ZNEA 2DAVA 5FYLH 2AQ1A 1SEQH 4ZYKA 4WFEE 4PJXA 3KPLB 5DJCA 1N0XL 3TVMD 4G43B 5FM5O 4GRLA 1TJIL 1P6FA 4PGEB 3SE3A 4W4OA 4PGEA 3TA3D 5BS0A 1KG0B 2CDGA 1QLEH 3K1DA 3VFVB 1Q9KB 3V52H 1P9MC 5HHPA 4FQXB 5HHXH 3LY6A 3HE6A 1EJOL 2EH7H 4Y2OA 3KPRB 5ACMA 3BGMA 3OR6B 4QTHB 2X4UB 5D6DC 2QBWA 1YMMB 4LBEA 3QBTB 4LLVA 4JVPA 3CU7A 4LLVB 3GBML 3OKMB 3VFUB 3VA2C 4JQXC 5HY9A 3CSYB 4F33A 1QNZL 1MI5D 5F9AC 4N0CC 5C0DA 4JFHD 1JUFB 3FQNA 3MR9A 4HUXB 4Y5YC 1OAKL 1DLHA 1AJ7H 5DJDB 1GH7A 5HHVL 3VI4F 1OF2A 5JHDA 2F8OA 1MRFL 3PGDB 4AL8L 5I2IA 4OCYL 3TCLA 5I1IL 4HG4K 2MTPA 3FN0L 5EBMA 5IB2A 5DMKB 2BSED 3NACH 4JDVB 1NMCC 3MRFB 4NBXB 5FFLA 5DT1H 4NM4H 1OARL 1CICD 3QUXD 5I30H 2OQJA 1KYOJ 4RAVB 1ND0B 5E5MA 4WV1C 4J3VA 3VXUD 4XP5H 1X3DA 4BYHA 3U2SB 3WMSA 4Q9CA 5KW9H 3S36X 3W2DH 4Z7UA 1P4LB 2V2TB 1WTLA 3N0PB 4Y4FB 3VRJA 3EJYD 4P2OA 2VB5A 4Y4FA 2UY6A 3BSZL 3LKOA 3OKLB 4M5ZH 2R69L 4LAJH 1NLDH 3LD8B 3RHWF 3MRHB 4LOUD 3LAFA 3OB0K 1FJ1A 1F4YL 1U93B 1TZHA 5GS0L 4HH8A 4NZTH 1UYWL 2ATPB 5L8LB 1V3MA 4IEFB 1NFIA 1HIMH 2VH5L 3TIDA 1YC7A 5DYOA 5HHPB 4QHKI 2GT9A 1PAMA 5IB3A 4Y5XC 3BDYL 4NQDA 3KVQA 4TUJA 2P5EA 4WWID 4JY4A 5JNYA 1F6AB 1CDBA 4DCQB 2ITCA 1FCCA 4WI2A 3TBWB 1S9YB 2ITCB 3SN6N 2EDBA 2HT2D 4MNQB 2DQTL 2OMNA 2K7PA 4YHIB 4F9LA 1SQ2N 2YOCA 4JFDD 5EZJB 4CDHA 3E1F1 3O6LL 2NXYD 2Q8AH 1T6VN 1Y6KR 2F5AH 5GGVY 1FNLA 1CXEA 2DLHA 3FFCE 4LASH 1CDCA 4F9PC 3U7AA 2AV7A 4JPIB 4BM7A 3Q5OA 3QUZB 5K59F 1GZPB 5CJ5A 5DMKA 4JKWA 4LLYA 2DLIA 3MRNB 1MJUH 1DZBA 4UNVA 1ORQB 1KXTB 4PYGA 1EPFA 2PYEB 2BFVH 2R4RH 3F58H 5DK0B 4HFWB 2CLVA 4QY8B 3TLRA 4HLJA 3PHOB 5E70A 3GB7B 3PHOA 4FNLH 1NMBL 3SDAC 1MI5E 1QFWL 1ZLWH 1FLRH 5AYUL 5FO9A 1T1WB 2NR6C 1ETZA 3OKLA 2B8OT 3DBXB 4NHUA 4QXTB 3EYUH 3B2VL 1WBYB 4X6DF 4OCSL 1QVOA 1UB6A 3TVMA 1G1YA 2E6PA 4F9PA 4WWKB 5DMIH 5EN2A 5ILTL 3TJEH 2V2WB 3JTTA 4XBGA 2X4QA 5TGBA 2F15A 4MA1B 3K2MC 4NPYA 1CT8B 3X13B 3U7WH 1MAKA 1FVCA 5CJOL 4EDWL 3B9AA 4PJ5D 3RKDC 3SKJH 2AJZA 3ARBC 4YEFA 1S9WB 3FQUA 5F7KC 3WIIL 4X4YB 4E42A 3RTQA 2XOTA 1RZGB 3AS3A 4X9BA 5BMFL 3IFPA 1OTUD 3NIGF 1T21A 5IGXH 2YPKB 5FYJU 3IFOB 2EO1A 1UWXK 2YK1H 4D2NA 4DGVL 4FQQB 2VIRA 1P7QD 3C9NB 3EYVB 1JV5A 1RZFL 2Y5TB 4FP8H 4PGCB 1F42A 3NPZB 3QJFA 5DMYA 2ENSA 4GXVL 1MAMH 1CLCA 2EC9T 3FHAA 2BSSA 1MI5B 2BSSB 1BAFH 4UB0H 1TZHB 2UY7A 2VMFA 3P0VH 1YEIH 5E56A 1N7MH 2W9EL 3MLYH 4ZYKB 3MROB 1XGTA 3R0MA 3L7EB 4Y7MA 3W82A 3B4NA 5E99H 3KXFA 3CXDH 2VLMD 3T0EC 3N85L 4X6DE 3QXAB 2XN9B 4MNHA 2DIAA 2H6PA 4I77H 1T04A 4OAWA 3OB0H 1TFHA 4GKSA 5KVDH 5DQ9A 5IOPB 2MQCA 3CXHJ 5E8DH 4LPVA 1CLYH 4PJHB 4HWBL 3SO5A 3F7YA 4OZ4B 2RFXB 5D1QD 5KSBB 5JDSA 4PJ8A 3NACL 4AENA 3MV8A 3UMTA 2QR0A 4WY7L 3G5VA 2Q87A 2X4OB 5EO1B 4U6YB 4L5FH 5IMOB 1HHGB 4HPOL 3FB8B 4GFTB 4EJ1C 1T22A 5CZVH 4M43L 3VXRD 1LILA 4QF1B 3KS0J 3A6CH 4Y4HD 3TNMA 4I18C 4WHTA 3H3PH 3HAEH 4JRYA 5AUMA 3UPRA 4JCLA 5D7LA 4HFUL 4WRLA 1IGCH 1SEBA 5I1AA 3BPCA 2EDRA 2AJSH 2L7JA 1KIQA 3F5WA 4WEMB 2ORBL 4JG1L 4FFYL 5ADOH 2MPAL 2ADJA 3V6FB 2F58H 4HJJH 5IV2A 3ULUL 1CVSC 1W0WB 3O3BA 2EDQA 4Q9RL 4TNVK 3B6SA 1KEMH 1EEZA 3IXTA 2OR7A 4OZHF 4RMUA 4PGBA 4Q58C 1B4JH 4R4FL 5H8DA 4L8CA 3RVWD 3E3QE 2OJEA 1NGZB 4KMTH 3DLQR 1OGTA 1T20A 4UIMB 4NQXB 2WAHA 4FOMA 3OG4B 5FUOL 4NZJA 4RQQA 2F5BL 3I02B 1JPFA 3S34L 3ZKSD 4MJID 5HGGS 4WU7A 5A16A 5KZCB 3MZGB 1XF2A 4Z76B 1A9BA 4P5TC 5DO2C 5DJ8A 2C5DC 4EI6B 4PJDE 4NNXB 5DSCB 3GMOB 5BRZB 5J13C 1VGEL 2CLZB 4P2RD 4TUOB 5D7IB 2D7TL 4A6YB 2VTFA 3MRQA 3MLSH 5BCAA 1IAKA 4Q7DA 4MXVE 3DUUB 2CO7B 4GW5A 5LJYH 1OTSD 1U2CA 3ARFB 1WBZA 3GMNB 5IVZA 3V6ZA 3EYOA 1KOAA 3KLHC 1NFDE 2DWDA 1N8ZA 4GAGH 3IDJB 3ESVF 1U95A 4NO2A 2NY0C 2VDRL 4RFOH 2CKBL 3QJFB 4PV9B 5GGQH 4DTGL 5FYJH 4UU9B 2VDKH 5D2LB 1HKFA 3DX7A 5SWSD 2VDNL 2IBZY 4IRZH 2YXMA 1MI5A 4YHKH 4YO0A 5T33H 1X7QA 3WFZA 2NY4B 1ZT1A 1CD1B 4PRPA 1FL5A 4MA1C 4ZTPH 1R3HB 2J7LA 1EA9C 4V2BA 1F3DJ 5FGBC 4KXZH 2Q8AL 5A40E 3L1OH 1JYWA 5AUMB 1B9ZA 4U49A 4FXKB 3CC5B 1CFQA 4JG0H 1IE5A 3DARA 2VXVH 2Z9TA 3NCJH 4NO0A 5I74C 4J12A 1OPGH 1FVCB 4XPAH 4HULB 5DFVC 4FQHB 4R90H 4M8VA 4JQXA 4ZQKA 4BSJA 5F1NA 3FQUB 3D2UB 4MGXA 3N50A 2HJKA 3D2UA 2DM7A 2ZJSL 5T1LB 3LKRA 3O3EB 4R4BA 2YUZA 4YWGL 5ESVA 4CU6A 1OP3H 2ZG3A 1NCWH 1QRNE 1WT5A 3AB0C 5FOBA 1A5FH 4TULL 4XP9L 2PF6A 1NGXA 1QA9A 4FABL 1KJ3H 4P9HL 4CVXB 1T4KB 5IB4A 1EAPA 2Z31A 4IS6B 3FTGB 1XR9B 4FTVD 4JFYA 4WIQA 2H3NB 1U3HC 4TOYL 1KGCE 2AXGB 5FK9B 1AE6L 3GMQA 5EB9A 4YJZL 2VQ1B 4V1DD 1G7HA 4JEGB 3TO2B 1MHEB 2EE6A 4D3CH 3D85B 5E4IA 2XKUA 1BQHB 1MVFA 3LV3B 1KJVB 1A6VL 1MQ8A 3KWWB 1RUAL 3G5YB 3RX7A 4F57L 2BSTB 4BK5A 4U1SB 3HC3H 1PD6A 4JN2A 1WT5C 5CWSA 3OKOB 1IM9D 2EEAA 5DQ9B 1IGFL 3JV6A 5C0RH 1INQA 3CVIH 1RIHH 1CD0A 3CVHA 1UEYA 1BEYL 5F88A 3UTZB 1T03L 2ZCLH 1S9YA 2A83A 2JLLA 3BKML 2A83B 2UWEE 5CSBA 5B3JF 3MXVH 3SGEH 1HDMA 5CFHA 1XGTB 4PREB 2BRRL 1XF2B 2W92A 2BP3A 2GSIA 4I0KA 5D5MB 3OXRA 5IEHB 5FECB 1F6LL 3O4OB 4YR6B 3DJ9A 1X5FA 2Y36H 5I2IB 4D9QE 8FABB 1AQKH 2VXQH 5CILL 1B4RA 4X7TA 4Z7WE 1A7BA 5B21A 3EGSB 3HZMA 3FT4A 4NZDA 2C3HA 5H37H 1PYWA 4HJGA 1ES0A 2XKNA 2VZVA 4GRWE 2VNCA 1EEYB 3IDMB 1AXIB 2VLME 3QDGD 4LIQL 5DLML 5FHBH 4MVBC 2WMPA 2G2RB 1A6TB 2A77H 3RNKB 2VXSL 4XCFL 1X6NA 3X12B 1KF9B 3G6JB 4G8GB 1QFOA 2ZPKL 3MBED 5HHMB 4KTDL 5GRUL 4PJCB 3S3SA 5KBNC 4QRSA 3WFHB 1UM6H 5DJ6B 2IAMB 3WCYA 2VZTA 3RHWK 2R0WH 2P45B 3WLBB 4DK6A 3WJLC 3ZHDA 2CJUL 1BIIA 1SY6L 1JYVA 1TJHH 3SDAD 3PG2A 4P5TB 4ZTOL 3EOBA 3GSOB 3I02A 1NGYA 4JLRA 5I71C 1XGPA 3VFWA 5B39G 3C09C 4P2RB 4NCC1 3QWRD 2RAMA 3HZVA 4NGHH 1PG7X 5E5UB 3MJ7A 3VFRA 2XZCL 3BAEH 3LB6C 5TH2A 3GJFA 1ZS8A 2HT3D 2QQNH 3O41A 3N1GC 3IFOA 5K9QI 3RNQA 1T4KA 1BBDH 5IB4B 3ZO0A 1H3WM 3VXPB 5E2WH 5EU5A 1IC1A 4L3EE 3OKYA 5KN5B 4RQQB 1W2KT 4NQEA 4CN1A 3NFPA 1U8PA 4XBEH 2YUVA 2CUMA 1NDGA 3BISA 2RCSL 3C8HA 3QIBA 5E9DA 5HYJE 1G7HB 3GSUB 3T3PF 3BXNA 1AD0B 1PKQA 4YGVB 4KKBD 3U0PA 4U2ZA 4O58H 1UZ8A 1VFAA 4CGTA 3TFKC 4U1HB 5F8QC 3FQXB 1EO5A 5JA9A 5HYJB 3FT4B 4QOKD 3V5DA 2N7AA 1LO3L 1C1EH 1MOEA 3V5DB 4D9RD 2X89D 5BZWB 3DMMB 3O0RH 4JREC 5EOQH 3UAJC 3F8UB 4ERSL 3B43A 1KG0A 1S7RB 2R8SH 5IFAL 4Y19E 3R4DA 1WTGT 2VUOA 4X5XA 4CW1A 3SDXA 1UM5H 2L0DA 4X99A 4ZNEE 2WIMA 1YNLH 4LPCA 3CJJA 3BGMB 3OR6A 3O2WH 4LOUC 3T65B 1NAKH 1CF8H 1OD7A 2W0FA 4L3ED 2AJXL 5I76A 3I75A 4NO0D 1K8DB 3IDNB 4F7MA 3TVMB 1T2QL 4WI3A 2J8UF 2CRYA 3PGCA 2M26A 2MHAA 4OBRA 1KJ2H 2HFFB 3KLHD 2XRAH 5CHNB 5IEHA 2WUCH 3FB6A 5KS9B 4PRIB 3EO9H 1XEDA 4G6KL 4S1RL 4L29B 1LO3H 2R69H 3MXWH 4XXCC 5I18H 4OCRL 4HUVB 3L5XL 3SGJA 4HK0B 3SJVB 3P0YH 5H35A 3GFUA 4FFZL 2NW3A 2BVQA 3B83A 1FAKT 1NDMA 5E08H 4Y2DA 4F37F 3H9HB 2L7UA 2OYPA 3SE4C 2BMKA 3ZDXF 2BMKB 5GGVH 4JKPH 2VR9A 1QBML 1I3RA 4IS6A 1HXMB 5FHAL 1EGJH 3MCG1 2WQRA 4PJAA 1IAOB 1LEGB 4LEXL 4Z77B 3QEGH 2OTPA 3CNKA 3HCVA 3BPOB 3UROR 2NNAB 5BXFB 1FGNH 4LF3A 3K80A 3NA4A 4PJ7A 5D8JH 5FDYA 1CXFA 4PJBF 4OIIL 1FN4A 2CGRH 4KZEL 5FDWB 4NHCL 2J1KA 1BQHA 2WWKO 3HC3L 1CFSA 3MV01 4HC1L 5C0CA 5GGTL 1KXQE 5C1MB 3TA3C 1EHNA 4Y5XA 4KAQH 1KPUB 3RWFA 3I3DA 3TVMC 4CW1B 2CLZA 4XP6L 5IW1B 1OQXA 4GO6B 4R8WL 3X3GL 2EDNA 1ZHLA 5HI4C 3BP7A 1FYHB 1RU9H 3V52L 1YYMH 4NJ9H 5I73B 1OVZA 5E7BA 4J1UA 2QQLH 4FFYH 3WSQL 5CIPH 1FFOA 4MNQA 4MZ3A 4X8JA 3TV3L 4R3SB 4NO5B 3HR5A 3HRZB 1TZGH 4FQLH 4I13B 1CCZA 1A6TA 1AY1L 4G6FB 4N0UE 4EZMA 5E9DB 1C08A 4LIQH 5J12B 1IKNA 3E8UH 3O9WD 4PRIA 3AAZB 2ESVE 3SE4A 1H5BA 4MQTB 5FA3B 1G6RL 3J8F7 3QUZA 4ALAL 3DO3A 2B1HH 3EOYG 5E2TL 3U36B 3WNNA 5JZ7C 2IPTH 5J6GB 1JHLH 5H35B 5E8NA 5GS2H 3PXHA 3EHBD 4WFFD 1HEZB 4XXCA 3GSOA 4PS4L 1RIUH 4F2MB 4K7FA 4QRRE 2FECI 1IEHA 1P69B 2HWZH 3PQYA 2CRZA 4NZRH 1HQRA 3NCFB 4MCZB 1DJSA 3HPLA 4AZ8A 3FFCD 2ZUYA 4L3CA 4LSUL 3MGAA 5DI8A 5L0QC 2X9YA 1NBYA 1YPZF 5F7FA 1SM3H 4LSPL 5MEPA 4QTIH 2DQIH 5I1LB 4M7ZC 4AY0A 1UM6L 5GISL 2X4TB 2BVYA 5HBBA 2GYSA 4G9DB 4CN4A 1KACB 1DEEB 4I9WE 4Y5VB 1C12B 2NY3D 5BRZA 1I85A 4WJ5B 5M95B 2VITA 1RY7B 2AEPL 3ARBD 3TO2A 2VITB 3BZEB 5DRNB 3SDDC 2E8ZA 35C8H 4AEEA 1BMGA 2XQBL 1G6RA 1HK6A 1WBXA 3TZVA 1AP2A 4OLWL 2ADFH 4AIZB 1DVFC 2X40A 1FNEB 4KKLD 3CFBB 3CDFA 3T0VA 2C1OA 5BVPH 1SYVA 1ADQH 4OKVB 2VDOL 4BKLA 4NQEB 2RBLA 5D2LA 4ZFOA 5E2WL 3E0GA 4QWWD 2KDGA 4PJGB 4HK3N 2E7LA 4LLUB 4U6TA 2NR6D 4JFDB 4GW4B 2P24A 3KYAA 4PJ7B 1UYWH 1VFAB 4PRHE 1MJ8L 1SBBA 3FJTA 3I50L 3I2CH 4PRBA 5IG7A 3C5ZA 1QLFB 3FL7A 2ID5A 3OKEB 4K3JL 2EEDA 3DUSB 4EUPG 4FN0A 3QUZD 1E4XI 1C5BL 1A6ZB 4NOFA 3MCKB 4MHHI 3CZFB 3VGFA 3B9KD 1YQ2A 1OW0C 2GCYB 1DSFL 2VXTH 1P1ZB 5F9JB 3ZDZE 2E9JA 5I8OH 5JIIA 2O26U 5J0BA 5I71B 2UZIL 2J6EL 5CLWA 2XTLA 3EYFB 3IDGA 2NXYC 4PG2A 1IJ9A 3F65A 5LGHH 3L3HB 5E8PB 4PJDF 3MRCB 3VXSE 1NQBA 4YXLL 1NGXB 3U1SL 3UBXG 3BE1H 3NGBB 2DWEB 1I7TA 2EDOA 2H3NA 1JTPA 1Q1JL 5C0GB 1T0PB 3REWB 1D5XB 4K9EL 5C0ND 2PYEE 1NCCH 4N8VB 4GRLD 2W1NA 2AK4D 1GAFL 3RVTD 4WFHD 3UXFA 5GXBB 5CD5D 4G8IB 1IARB 1B90A 1HWGB 3PWLA 2BOCA 1CGYA 1JGVH 3DYOA 4MD4B 1MJ8H 1PZUB 1B88A 1T1YB 3WKMH 4Z0BH 3FN9A 4WI8A 4QRRA 4YDIL 3FMGL 5J1AB 4NNPL 3DOSA 3PWNB 4R2GB 2H2SD 4Z7UE 4W4OC 3MV7E 3WFDH 3TNNB 1II4E 3A0OA 4XVUC 3KPNB 3W2DL 2ZOKA 3C6LD 5I1LA 1YMHB 2HG5B 1X5AA 3SCMC 1N5AB 4C56A 2DQGL 2BC4A 1SBSL 3NFPB 4DK3A 3S9DB 1Q94A 4ODSL 5DA0B 4Y1AD 2P46B 3JBG7 3GMRB 1LDSA 1V3KA 3HFMH 4KROB 1YYML 4NJ9L 5IMMA 3SKNB 4EI5D 3IAGC 1MCFA 3LEYL 3UJTL 1IAIH 3RX5A 4HK3J 2OL3B 2ADIB 5LAXB 1ZGLA 2QTEA 3GMPB 1OAZL 2NZIA 3GMPA 4K7PH 3GK8H 3BN9C 5JIHA 4X80L 1U58B 2SEBA 1FFQA 1J7VR 2XTJC 3HHRB 5IBLC 3B5HA 1MREL 1P7KB 5FB8A 4Y1AE 4JM2D 1GGBL 2ERJC 1OHQA 4N8CH 3QJHA 5D93B 5BRZD 4FQ1L 4OIBA 4J8RB 2PO6D 7FABL 3K3QA 3GSXA 2VQUA 3H8NA 1QLFA 3H9YA 3T0AA 3JWOH 1LVEA 5JXAH 4F7PA 4QTHA 1NMBH 2YPVL 4LP5A 4OM1L 4M8QB 4TOYH 2JB6A 4HIJA 1NGYB 1JHLL 1QSEB 5EIVA 3KPQB 1JPSL 2NY6C 1RULH 3PWLB 5C07A 5C09D 4N0RA 3G6AA 5EDXA 1AXSB 2X05A 3WFBL 1SVZA 2APWA 1EAJA 4WUUD 2GFBB 3IDIA 4PBXA 4WUKL 4HS6A 4MAYD 3S97C 4KKAC 5EOQL 3RBGA 4QRPD 4YX2H 4XXDA 1G7PB 1H8NA 2JJUA 1ZA6B 1BJ1H 3MRCA 4S1RH 2ZCKL 3MOAH 4ODXB 3U9PL 4NQDE 4YDKL 5GGRA 2DJ4A 4NQVA 1EHLL 4X6CA 1EMTH 3Q5TA 1MSPA 5I75C 3LQZB 2FL5A 2FYYA 3N9GL 3WHE1 3I3BA 2FX8L 1F3JA 1Q9LB 4M1GL 3LCYA 5D7SH 3VWKC 4X4XB 1F5WA 2YC1A 1ND0A 1R3LA 4OCWH 1T03H 5CJXA 1LP9B 3C87A 1CE1H 1MCOL 4XNQB 2XTJB 1G84A 4PJFF 4N8VG 2EZ0D 3SDCA 4QRPE 3TIEA 5F9OL 4UI2A 5T1LD 4LKCA 3FT3B 1VGEH 1AGFA 1AGFB 3CIQA 3RGVD 3ALPA 5FYJE 3QEUB 1MCEA 3BYYA 4PIRF 2AJUH 4IOIB 2QADC 2P5WD 1KULA 3MV9D 5DD3L 4I0CC 3BRGC 1KCVH 3T65A 4OLUL 4N9GA 4FZEH 1OSZA 2P8LA 5EFIA 3EFDL 3BVNB 5D1XA 4BUGA 4WI7A 4NQCE 2XY2A 4MDIA 3MBEA 3T09A 5J3HD 1ONQA 4P5MB 1LEIA 1CWVA 5KVDL 5J06A 5DGRA 4RAUB 3VGAB 5IEKB 2OBGA 1YY8B 4P3WA 5FA3A 3GNMH 5K9JL 5ICXA 3BEVB 4ONHA 3EGSA 3BKCL 1G7IB 1VADB 4CDGC 1RJZB 2BDNL 4YHNA 4C54A 1JTOA 3RDTA 4KK6D 5L8KB 2NXZC 1NFDA 3KNBA 1MFAH 4PG9B 5GQBA 3UJJL 3BDYH 5DZOA 1GXEA 1UZ6F 1PZ5A 1YN7B 2VN7A 3DTXA 3WL9B 4AMKH 1IGYA 4QRPA 1MFBL 2FGWL 1IMHC 5EZLA 1QRKA 4R2GC 4LKXB 5CCKH 1HQRB 4KTEH 4HKXA 4BQ8A 4ZTPL 3QH3A 4X9HA 2EE9A 5A3ID 1U8IA 3MPCA 1IQDB 1NUFA 3P4MB 5C0JB 5FYKU 3BO8B 1QPPA 2NNAA 5BXFA 3RL1A 1AY1H 5AD0B 2VZ3A 5T5FH 1RK0A 2NMSA 4YFEA 1KXVC 4G3YL 5ICZB 3QDGB 2HG5A 3I6KA 3UTSD 2Z93A 4Q0XH 2WBJB 3NABL 1U3JA 4AM0A 4L5FL 4U6VH 4H25A 4MA3A 3PWPD 1HQ4A 1JIBA 3SOBL 1HQ4B 3DO7A 2HRPH 2Q76A 3RQ3A 4O00A 4MXWH 3ZHKA 4EDXA 3B5TA 5DJDA 4HXAL 4FXLA 2DM2A 4GXUN 1IGJA 4HKBA 1YEEH 2AK4E 5GS0C 3GI9H 3KPSE 1E4WH 2CD0A 5C6PB 4JRWA 5D7JA 3TYGH 4F58L 1ZANL 3GRWA 3G04A 5HI5D 3BZ4B 1KT2A 1OOAA 3UZQA 4U7SA 3HNTH 5J8OA 2YA2A 1EEQA 2X1OA 1MCRA 5LWYH 2C3WA 3H42L 3PDOB 3V4PL 4EKXA 4NQSB 5JXED 1PKQB 5EOCJ 1EO8L 1GOGA 5IMMB 3NAAH 3O6FA 1MJUL 2H26A 1TPXC 2FHFA 1J8HA 3DVGB 4GS7B 4GAGL 3BEWA 4FMKA 3H9SB 1IKFH 4MS8C 4ISVA 2UWEA 3RWCA 2YD2A 3WXWH 4HXBH 4XCCL 5I1EL 1MCIA 4PJ5A 3C5ZD 2VAJA 1MHCA 4Q6IB 1U58A 3O6KH 3ZHLA 1QFHA 3WD5H 3B3IA 3LMJH 3K4ZA 1BVLA 2D03L 3NTCL 1GIGH 4L4VD 1FIGH 3MLZH 4PPTA 4FTVB 1ZA3A 5D72H 1D5IL 2ZPKH 2EIZB 4U1JA 3MBEB 3FRUA 5E0QA 4ENEC 2QLVB 4XCEB 5F71A 3SY0A 1UCBH 1P5UA 3DVNA 1YMMD 4Y8AA 2ICEA 2EDTA 4PYHA 2G60L 4PRDB 3ZTNL 3T3PE 3OGCA 5IHBA 3VFOA 2YR3A 3ARUA 4YPJA 2VABB 1KJMB 2R0WL 4ZDHB 1A7OH 1P2CB 5CP3H 2CRMA 4DZBA 4KVNH 5C2UB 1JPSH 4NQCD 2I27N 2Q76B 1ZXQA 3MJGX 1NBQA 2CK2A 4KK5C 4OM1H 5B38B 4YHNB 4GQPH 5T1KB 3S88H 2R2EA 1A6UH 1PX4A 2AV7B 4P4RB 4EBQL 1Q1JH 3BYTA 4OT1H 5E6ID 3VI4E 3DRQA 3WDIA 1U3YA 4ETQA 4PV8A 1JNHB 3EJJX 1MAML 2FJGA 3VD9A 4J3WA 4KDTC 4ZOAA 1TVBB 1T66C 4ZXBA 4Y4FD 3LKSA 4PJFA 2J8UE 4JM2F 4XAWH 4F3FB 4XWOD 4K3DH 5E5RB 5K33A 4G9FA 5D93C 3U4EA 5IG7B 5EUOA 3B6SB 4HV8A 2IQAA 5J6HA 4RNRB 4RSVA 1CLYL 2PN5A 3IETB 5C0BB 1IGTB 4WFGE 4TYUA 2DQFB 3WN5A 1C1EL 1RHHB 1NEZB 2VC2H 4ODUA 2VL5B 4OF8A 3DMMC 4JREB 4NP4H 5F70A 4OFKA 4LARH 3F12A 2DQGH 1U8JA 3FO1A 1HYRC 3WE6A 3WEXB 3GSQA 5JOPE 4U1IB 1S5IL 3BH8A 2OCFD 4XBEL 4NJAH 4L9LC 1BREA 3GNML 3PDDA 1M7DB 4XX1G 4HPOH 2BHUA 1MEXL 4FTVE 2FIKB 4FXGA 4IHOB 4LVOC 1R24A 2CLRA 4Z0XA 1PSKH 1KEML 4NWTH 4J8RA 2I07B 2P4AB 1XGRB 5KTEH 4ONFH 4MCYA 1KFAH 1NFDF 5J6GA 4JY6A 3RL1B 5AD0A 1EDQA 4NRYB 5C2BH 1LMKA 3QPQD 4KDTA 2NY0B 3P77B 3KPSA 1NC2A 3UC0H 3GDBA 4ACPA 1RK0B 5E8EA 2BNRD 1A7PH 2Z8RA 5K9JH 3FQRB 1DE4B 3EYSH 4NO3B 4JFFA 1ED3B 5EU4B 1AXSA 4M5YL 1YN7A 2OMBA 2R4SL 5JORA 3QQ3A 1F4XH 1RK1A 1SY6H 4MCZA 1O7SA 3KR3H 3TO4A 1HNFA 3FN3A 1QNZH 1S7VB 1U92A 4YHLL 3IU4H 2HJLA 1FORH 3MO1B 4JZJA 4XVJL 2RGSA 4HUUB 4BQCA 5C0JA 4KJWC 5SWQB 1CGXA 1C5CL 1D9KD 3QDJA 3KYNA 5IROA 1N6VA 4G6AC 2UZIH 1VPOH 1CL7I 4UTBL 3HS0A 1DN0B 3MOBL 3DROA 3QUMH 3BIBX 4OSUH 1PFCA 1S7WA 2E7CA 3H7BA 3N1PC 3VMOA 3KPPA 3BX7C 1EHLH 2R15A 3QO0B 4QO1A 4OFIA 4UT7L 5D1XC 5E08L 5BQ7B 3JTSA 4P9MH 3IJSB 4C83B 5D1QB 3BKYL 4KJPC 3OAUL 3T4YA 2VE6A 2DQHH 4M6ML 1F2QA 1D5BB 3T0DA 4TPRH 3KHQA 2R39A 4LHUA 3Q6FA 4M5ZL 1NCAH 2R0KH 1YJDH 4JFPA 1QO3A 3RWHB 3QPXL 3INUL 4CNIA 2EIEA 3HI1A 5KTEL 2JELH 1KIQB 1P7QA 1JWUB 4D8PB 4WW1B 1P7QB 3QJHB 3VFNB 4OV5A 3LPFA 3MOAL 1GHFL 4OZGE 2FIKA 4FXGB 4MD5B 4ZFOL 5I8CA 1CD9B 5DR5H 2NLJA 1F2XK 4FQIH 2NLJB 4I48A 5FO7A 3NIGE 1U8NA 2B1AL 4JFOB 1XGRA 1A5FL 4TULH 3BDXA 3KG5A 4XCEA 4XP9H 4ZXBC 5J12C 3SY0B 3D69A 4H8WC 1NCBL 1GGYA 3FMGH 3KYKL 4JO4L 3BD5A 1L4IA 3QNXB 5KSAD 2B20A 4YQXL 5MP6H 3S98A 1KPRB 3HI5L 1KPRA 1SVCP 3KAAA 3TO4D 1VFOA 5HVGB 3ROLA 5T1KD 3GSWA 4GMSH 4OTXH 5JO5B 4JFQB 3GRWH 3O45A 4G5ZH 4XHJD 2V5TA 1KPVB 2DQEH 4XXDB 2D03H 1ITCA 2OZ4L 1VEPA 5D7IA 2NY5L 4M7LH 1YY9C 2ZCHH 4WFGD 5H94A 1AR2A 4M6NL 4M93B 4YK4B 1TTFA 2YMXH 3VFTA 2YHGA 3VXOA 4PJIA 5EZOH 3V6OE 4UQ3B 1DDHA 5AWNL 3VFOB 4QHKJ 4HAFA 4KI5E 1B0WA 4LLQB 2WP3O 4XGZB 4JRXB 5SWZE 4GLRI 5SX4I 3QO0A 4PUBH 1HSBA 3BGAA 1Z9MA 3UJIH 4WNQA 5T3XD 1A3QA 3U4EB 1QUNA 5EUOB 2RQ8A 2Z4QB 2P8MB 5I66A 3O3DB 3RZWA 1AR1D 5BVJB 2O5ZL 4DUWA 1KB5A 5LGJA 3RDTC 5B8CB 4POUB 3D0VA 4QRTA 2A73A 1I1YB 1M71A 1QD0A 5GJSH 5FUCC 3MFGB 5HVHB 4TVPD 3B9DA 2F74B 5DC4B 1JP5A 5I0ZA 3TYFA 1I8LA 3QI9C 3QEQE 3SOBH 1N59A 3QIUB 4YIQA 5ESAA 1T5WB 4JZNB 4P2QE 1HH6A 1OLZA 4FFVC 1RJYB 5D6CA 3ZKXB 4DVRH 3OR7A 3MUHL 2CKBH 1HZHL 3L9RB 3Q6GL 3CFEB 3MLVH 1GGIH 3BT2H 3PWVA 4QNPE 5IQ7L 5L7XH 2DF3A 1EZVX 3WIIH 4K9EC 3WO3B 4X7CC 3SKNA 4M3JA 5ICYA 2H2PD 2DYPB 2Y5TA 2ADIA 1WZKA 4HC1H 4PJAF 2Y6SD 5DRZB