1I85A

Crystal structure of the ctla-4/b7-2 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
MLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T LYMPHOCYTE ACTIVATION ANTIGEN CD86
publication title Structural basis for co-stimulation by the human CTLA-4/B7-2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1i85A00
4NJAH 4KDWA 1MAML 1U8LB 3QUXD 4D9LH 1JRHI 5GS2H 1FFPA 1HQRB 1NBYB 2AJSH 3L3DA 4YX2L 5CGYD 2VLMD 1ACYH 4NO3B 2Y23A 2IGFL 3EJJX 4KJYA 4NZUH 1X4XA 5FUOH 2WBJB 3PWLB 1MIEH 3D1MC 1YY8B 3ARDA 1UQSB 5BV7C 3P0VH 1WT5C 2PN5A 3MJ8B 5IHUL 5I16A 3L9RA 3MC0A 2XWBB 3P4MA 2R69L 3RWEA 1IILE 1IM3B 4FTVE 4ZUUA 4NQCA 3VG0H 1AQKH 4GAFB 3MV01 4JZOB 4NRZA 4YFLF 3TT1H 3FO2B 1NUDA 3IDYB 1EK3A 5FA4A 1HHJB 2GJ6A 1FZJB 2P48B 4NFCA 1FFNA 2FIRT 3C9NB 4WFHD 3VFPA 3WNPA 1XGUB 3BN9C 2ZCLL 1FVEB 2MNUA 5D7SL 2E8ZA 1KCSL 4OM0L 1KEML 4U1IB 4QRSB 1WWAX 5FK9A 4E9LA 5T1LB 2LVCA 5F6IC 1EEYB 4WDIA 4PJBF 4ZYKB 1RIHH 2C1PB 1P4BH 3MOBL 5F21B 4U7KA 1WWWX 2MFNA 3WFZA 1D5IH 2YD8A 5T3XL 3HAEG 5I18H 4UDUA 5C0BE 2VDML 4PREB 2OYPA 5BRZB 3QCUH 4DCQA 3PHQA 5HHPA 4EDXA 1I1YB 4G8GA 3DVNB 1JJUA 1FDLL 3SGJC 4Y16A 4N0UE 3WDJA 3R06B 4UNVA 2YEZB 5T1KA 1QEWA 4KZDL 4EJ1C 2DS4A 3FOMA 1IAII 4KK6D 1A1OA 3L3GA 3WO4B 1EHLL 2FGWH 4L5FL 5L7XL 3WNNA 5ID0B 3DI2B 2D9QB 4X6FA 3UTTD 4N0YL 4N0UB 1FORH 4QHUA 4MA3A 5B39B 4XPHL 4KHXH 5SV3A 3MJ9L 4NUJA 3VWKD 3ZYOA 3MYJB 4KGLA 5HGBB 1Q8MA 4LHJB 3DRTB 3DUUB 2P24A 3OB0H 2AERT 2BSED 5BQ7A 1CK0L 2BSTA 4ZS7H 4DEPB 3ULUE 5DUMH 1JZ5A 1DE4B 4PY7A 3DI3B 3PDDA 2OSLA 3CD4A 3BXNA 2QQKL 3ARFC 4NRYA 5SWQA 2QSTA 3EO9L 2R0LL 4ZOCA 2K9UA 1TZGH 1MFAL 4W6WB 2UWEE 3FN9A 4V2CB 3VD9A 3B4NA 1QBLL 3V8CA 3JTTB 2ENSA 1RJLA 4L3AA 5E6IB 5BZWA 1MIML 2H41A 5H2BB 1OAUH 1MCFA 3U4AA 3LRSA 2M2DA 1I7ZB 3HR6A 2VL5A 5F3HA 3CVIH 4OD2B 5H94A 3FO0L 4ODBD 3AM8A 1T1ZA 2UWEB 1GOHA 2QADB 1L0YA 2DQTL 1UM4L 3ARRA 1T1YA 1C1EH 4XGZA 4Y5VA 4D0BB 1KIQB 3WKML 1HILA 4S2SA 3BPLB 2DQUH 1JF1B 2VWEC 1QRNA 3GJFB 5D6DA 1T6VN 5DJYA 2NY7L 1P7QA 1B4RA 5IROA 4RAVA 4MJ6A 2BOCA 1KCKA 2YN3A 4ONHB 3TZVD 3U36A 1IAOA 2BXYA 3ARGD 4HIHA 3QJFA 2DDQL 1N4XL 1MCOH 1UJ3A 2YRPA 3FB6A 5FO7B 2UUDK 2H1PH 2A6DB 3MRGB 2NZIA 1NGZB 5C6WH 4IMLB 4X98B 4YDJB 3MNWB 5GGVH 5ESAA 4I18A 5ICYA 1CR9H 3GHBH 1MHCB 2NY6B 1G7HB 3IGAA 3FAWA 3QEQD 4WHYG 3WFDL 5ANME 1MCIA 3CFCH 2NMSA 3BIBX 3HB3C 2IPKB 4AYFA 4EI5D 1W0VA 3GSQB 3LIZL 3OAUH 4X6CF 4Z0XA 3MNZA 5DHYA 1TFHA 3TVMD 1FC2D 2XT1B 4X9IA 5ANMB 4WI6A 5D8JH 3RVTD 43C9B 5KAQF 2O61B 3N06B 3QEGH 5IWLC 4RX4A 3LH2H 4G9FD 1JNNL 2BNUB 4P2OA 1A14H 4GKZB 1RK0A 4XP4H 1B0WA 2JJTC 3OKLA 4JFDD 4LSVL 5MI0C 1RJYA 1RJZB 4U1GB 4HMDA 4ZO6A 3F58L 1AGEB 5E8EB 4DVBA 1AY1H 3KPSD 15C8H 4X6EA 2DQCL 2VKWA 1EMTH 5IVNA 3RKPA 3U7AA 3H9HB 4LASH 4XP9L 1F4YH 4HXBL 4HUNB 1ODAA 1NLDL 2XZCL 2DQEL 3JUZA 4ODUB 1BFVH 3DMMA 4JVWA 1JZ2A 3EZJB 3UTSA 1R5WA 2J2ZA 3PL6A 1ZLVK 3OZ9L 1MF2L 4JHWH 3VW3L 2FH6A 3SDDD 1PX3A 4MXQC 4WO4B 3ZE2E 1I3RB 2R9HD 4PJ9B 5C2BH 5E7FA 2A6IA 4GW5B 1FV1A 1F58L 4O2EA 2Q8AH 5DQJA 4UT6H 4UAOB 4POYA 1I8KA 4HC1H 4ERSL 2G5RA 1ZWIB 2ZCKH 4OUOA 5D9SA 3D0LA 1VACB 4YHNB 4GXVL 1S7XB 5GGUA 3RX8A 1KNOB 4FQQB 1UWXH 1RURH 2BSRA 3DV4B 1JPFB 3OKKA 1T20A 3SQBA 1E28A 1YN6B 3EYFB 5I1LB 4MA8L 1HHHB 2OK0L 1FGNL 2EC8A 4D94A 3GBNL 2YRLA 4NP4H 3O0RH 2Y7QB 4HWEH 3GSOA 1XH3A 4M02A 3GB7A 4K23L 3MRHB 4X8XA 1J0HA 2CK2A 4R3SB 3HZVB 1T22A 3G5YB 4K07A 3EYQC 1IEBA 4U6XA 5BVPL 2V5RA 4HIIB 4LHUG 1WAAE 3E6HB 1UB5B 3UAJC 4OCWL 4G8EB 1SVCP 2BC4B 4GBXB 4KXZH 4M1GH 1RHFA 4Y1AD 3DBXA 2ZCHL 1U93B 4Z7NF 3O3BA 5DEZA 5DDHB 1C8PA 2P5EA 3C5ZD 3O4LA 2DLFH 4OB5H 3OBAA 3ZT7A 3SDYL 2IAMA 4RMQA 4I0PD 1K4CA 2R2BB 5A2JH 1KULA 5FCUH 4EN3C 5TF1L 4CMHC 4U7SA 4QXGH 3MRDB 1F11A 5I1CL 3QH3B 4KZEH 4HUUB 2YBRA 4QYOB 4M5ZL 5ICXB 1C5CH 4G3YH 1T2QL 3CSYA 2B2XL 3TYFA 2AXFA 2FYYA 4L4VA 5LXGL 3I50H 4BFBD 1J18A 3HG1A 4ETQB 4KRPC 2AV7B 4G6ML 4WJ5A 1YNTB 2C1OB 1KB9K 3BD5A 1RZIA 4G6JH 1A7PL 3HZMB 4NKOB 1Q72H 5IOPA 5FGCE 1IQDB 3V6OE 1WWBX 2X40A 1Q1JH 3PDGA 1MCNA 2Q8BH 1QFHA 2DL9A 4F15C 1RUMH 2DQDL 2ZOKB 5FYLE 3HC4H 4PJFA 5C86A 2X10A 4X80H 1YY9D 5FGCB 2HRPL 2IBGA 3MLWH 1ZA3B 1BWMA 3RUGF 2HJLA 5K9OB 3P73B 1BQHA 3QI9B 1ONQA 2VIRB 1LK3L 4P5TA 1ORSA 5FFLA 3QUKA 1HYRC 3O4OB 2F8OA 5CHNA 4HWBH 4PJAE 3VG9C 1G7MB 1JV5A 4TSAH 4P23D 4JKWA 1DVFD 2PETA 4K8RH 4XWOD 5CAYB 1XCTA 2DBLL 3HMXL 4JLRA 5JLZB 5F6HI 5GRYA 3DV6A 1IGML 1N7ML 2EDEA 5DMKA 2EXYC 1RZGB 1LE5A 4PJAB 4M62H 3D18B 1RUQH 4YDVB 4DZ8B 3MRBA 1R5VA 2JB6B 1EZVY 5IBUB 2X89D 3OJDA 4DGIL 3MCLH 4TNWF 4Z7OF 4MB5A 3CXDH 4XPAL 2CDEA 1F4AA 5EUKA 3RIAK 4AMKL 3W9DA 3SKUD 3FRUA 2EE2A 1Y6KR 4PRNA 1KTDA 1T3FA 3C08L 5TQ0L 4YWGH 5GZNC 3EFDH 7FABH 1ND0B 2GFBB 3TN0C 4KK8C 3BOVA 1XGTB 1QSEA 3VXTB 3QDGA 3BH8B 5D7KD 5C0RL 1KLGA 3GMQB 1GHFH 2P8MB 4U6TA 2PYFB 2XZQH 1N59B 4UBDC 5D1QA 4OCSL 5DJCA 1MAMH 2BXZA 1VPOL 1FO0A 4HMEA 4YX2H 1VFAB 4LCIL 1X6NA 5FGSA 1J10A 1ED3B 2F74A 5DUBA 4G6KL 2IGFH 5ESQB 1C7SA 1KBGL 1Z9SA 1EGJA 4PG2A 4TVSa 4JANA 1SJXA 3WNMA 2EYSB 4LARL 3QXVA 1CDCA 3N50A 4MJ2A 1DQLH 2VDKL 4KKLD 5DC4B 1AIFA 5IHUH 43CAA 2VDOL 4S1RL 3X13A 1U8KA 3O6FC 3NPSB 2R69H 1MRFL 4LIQL 3IT8D 3JVGA 1GOFA 4M43L 1AD0A 3ECBA 2WM0A 2E8YA 4MWFA 4HFUL 4CJ0A 4GUPA 4LLDB 4U3XA 4RA0C 3JZ7A 4X0KA 5CSBA 4X7TB 2I25N 2ZCLH 4CMMB 1MELA 3DRQB 5D7SH 5IMKA 1GH7A 1KCSH 4Z76B 4OM0H 1KEMH 2CJUH 4AIOA 1F00I 3HKFA 5DGRA 4GW4B 4HG4J 5DRWA 1AD9B 4A6YA 4PJ7E 3S37X 3MOBH 2X4SA 2XFXA 3SKOB 1A64A 1X5KA 4F7EA 3IFNL 5T3XH 1IEAB 3D39E 5E9DA 4S10A 1P2CB 2VDMH 2JJUA 5F96L 2RCSL 4L9LC 3W5NA 4GXUM 1FDLH 1NGWA 1GYAA 3VXSD 3MRCA 1TVHB 5I66A 4KZDH 3B2UD 4MAYC 3D39B 5EUOE 3TYGL 5I30L 1T80A 1P4LB 3ZYJA 1CL7I 1EHLH 1AGDA 4C59B 4L5FH 3KPNA 1CWVA 2VLJA 5L7XH 1EFXB 3VFSB 4N0YH 4JVUA 5HSFA 3IXAA 2VDQL 5H37H 4XPHH 3MJ9H 2PXYC 1YEKL 5FDYA 1EBAA 1PZ5A 3CFIC 4PLKC 5EUOB 4R0LC 2QSCL 4Z9KB 3S96A 3RP1A 5JQHC 3GO1L 3ULVE 1FZKB 1CK0H 1A21A 4LDLB 4NDMA 3C8KA 3TBWB 2QQKH 3KAAA 3L5WB 3VXNB 4ISVB 4X6DE 4QOKB 2OL3A 4Y4FD 3V6FB 3EO9H 1GIGL 2R0LH 5CIPB 4TOYL 1MFAH 1QBLH 5HDBF 5SWZD 4L4TD 1NCUA 5DJ8B 2HJFA 5CZXC 2R0WL 4P0DA 3GSXB 1UADC 2NCMA 4Z7WE 5EBMA 1MIMH 2FWOB 1KJVB 4RFNB 4QRPB 1NC2B 5AG9A 5IQ9B 1O7VA 4X6DB 1NGQL 4L8DB 2V7NB 35C8L 3FO0H 4LOUC 3AS2A 1DDHB 4LCCB 4W6XB 5DSCB 4ZXBB 2I26N 2DQTH 1UM4H 2NY3B 2B20A 4X8JA 1ITCA 3WKMH 3B9AA 2DM3A 5ISZD 3RWCA 2R2EA 4ODXA 4RNRA 4OD3L 3VFWA 3L95A 4NQDA 1FZOA 2NY7H 2AJ3B 2MOVA 1B88A 5J7CC 5ELIA 3GEWB 4NKDA 2QKIB 2YD1A 5DVMA 4PRAA 3C8HA 4OFIA 4OF3A 2BMKB 3MBEA 3V79C 4LKXB 2DDQH 4YLQT 2FHCA 1N4XH 4C55A 2XN9E 5F70A 5F6HJ 3MV9D 1WISA 3UTOA 4S0SD 2A77L 1AR1C 3FFCD 5HYSA 4R96A 2QTEA 1UT9A 3D3VA 1BQLL 2XACC 3HZKB 3BN9D 3QDJE 3VFOB 1A6TB 3WFDH 3U4EA 2XN9B 5E94A 1CFSB 3K81A 1XR8A 2NPLX 1NANI 1MCBA 4NN6C 1CGTA 1TTGA 1JWSA 4JFEB 4QY8A 3LIZH 4BH8B 4HH9B 5DD6B 1KPUB 2ADIB 1DANT 3G6JA 3T0XA 3QDJB 5E8OB 3V2AR 1LVEA 5GS0C 5IKCB 3VGEA 3W39A 4I2XA 1KJ3L 2AQ2A 1JNNH 1A1MB 4NHUB 5IMMA 4D9RD 3BHBB 3IFOB 3KXFD 4RAUA 3REWA 1AGFB 4PRHE 4LSVH 3BP5A 4Z7VE 3OR7B 5EOTA 2ZKHL 3F58H 3GMLA 1MCQA 4OLXL 3QULA 5A16A 4Q9QL 2DQCH 2AEIT 3JV6B 3V4VL 3LKSA 4JEGB 4XP9H 2W59A 3VD3A 4UIKL 3IU3B 4HXBH 3VXRE 5JPNB 1NLDH 2RHEA 2W65A 4MJIE 2KQNA 3O6ML 2XZCH 4PRHB 5KSAC 2DQEH 4GRLA 1K8IA 4Z7VB 1X5YA 4PRIA 3NN8B 2IJ0C 3OZ9H 3X3FL 1MF2H 3VW3H 4LNRA 5IR1B 1ZS8A 4M7KL 5F9JA 3ARFD 3VXRB 4NNXA 2MPAL 4UI2A 1MJJB 2Y5TB 4MJIB 5H37G 4CN1A 4NFDA 3N1GC 1I8MA 3CK0L 4R7NB 1E27A 1YEFL 5C07B 3S4SA 3FRPA 1OPGH 1F58H 5JXAL 4AZ8A 3M07A 3E2HB 4HQQL 4U6HA 1G1CA 4EUPB 4E42A 4GW1A 4ZSOA 2XKNA 1U95B 2XG4A 1FL5A 3ARZA 2AV1A 2Q76B 4FTVD 5AEAA 4HS3A 1INQA 4GXVH 5D1XA 1NC4A 4JFYA 5DYOA 2G5BB 3AXLB 2X4OB 2NY1C 2HTKC 5IFAL 1S9WA 1R24A 4KUZL 2OR7A 5FUZL 2YXFA 3PWPA 4MA8H 3Q1SL 5JW5A 1GVIA 2OK0H 4Q9BA 1FN4A 2G75A 1FGNH 4I77L 3GBNH 4IOFC 3G9AB 3VE0B 4OQ1A 4MA7L 4P3DA 1ZT4A 2ZJSL 1PKQE 4I4WA 4K23H 4RIRB 1BFSA 3IYLW 4UNTA 4NZRL 3K80A 1Y18A 5KTEL 5BVPH 1CXLA 3MLZL 2VUOA 5TDPB 3GFUA 2GJ6B 4LQ1A 5FA4B 4XRCA 3RPIB 1FFNB 4HUMB 5C0BD 4OCWH 4PJXE 3I9GL 4FXKA 3QNXA 3D48R 1PKQB 4QTHA 2NY2C 3STZB 2VDNL 2ZCHH 2VE6B 4WDIB 5DZLA 2OMBA 1T83C 5FYKU 4LVOC 5JMOC 2EDLA 3S36L 2HP4A 2WIIA 4V1DD 3SDYH 3SDCB 4PJXB 4OF8A 3ALWA 4JFXA 4UQ2B 3E6FA 1RJCA 5TF1H 3RZCC 5J12C 3HB3D 2EDWA 5I1CH 2ESVD 1FIEA 4M5ZH 4M03A 3TWCL 1T2QH 2B2XH 3VWJC 5T1KB 4FG6C 5LXGH 3HS0B 3TO2A 3BRFA 1JZ6A 2EH7L 1A8JH 2F8XC 4G6MH 3O8XC 3OB8A 1A7PH 4X5XB 1LDSA 1D3CA 4PGDB 4IRJB 3REVA 4OFPA 1MVUB 2IPUK 4X6FB 3BEWB 2AXGB 5FGRA 5EIQA 4TUOB 4ZAKD 5I1AB 4NUJB 2DQDH 2BSSA 4HFWA 4PP2A 4HUVA 2D7PA 1FL6B 2RGSA 3VDCA 3ILQC 2BSTB 5F89A 2A6KB 4U1JA 3BXNB 1LK3H 4Q6YA 1DBAL 2BY0A 4BH7B 3SDXF 4AENB 2HVKB 4DKDC 3VA2C 3LKRA 5AWNL 1AGBA 4MXQD 5F93C 4OCMC 2LQRA 1I7TB 1IRAY 1OTUC 3RX7A 3IJHB 2X6MA 1KN4L 1YUHA 1CDIA 1D6EA 2DBLH 1T0MA 2HYMA 3HMXH 1BZQK 3OKDA 4J8RA 5IB3B 1MFDL 1EX0A 1IGMH 1N7MH 5H94B 1C5BL 2CIKA 2F19L 1UVQA 2OR8A 1TQCC 5F72S 4Q2ZA 4DGIH 5AD0B 1HILB 1T03L 3TH3T 3OJVC 5KS9A 5HVWA 1X5JA 4XPAH 4Z7UA 3GNML 2E5EA 4AMKH 4C83A 2NW3A 4P46B 5AYQA 4RAVB 4MJ4A 4E41E 4ELME 5TQ0H 3C08H 2BOCB 4QHNB 4KRMB 5HHVL 1N0LA 5HYJE 3QIBB 3AVEA 1QLFA 5D7LE 3LDBB 4Y4HB 1NGXA 3QJFB 5F3BA 4OZIF 1UJ3B 3E1F1 3HI1A 4GOSA 1BD2D 5C0RH 1NPUA 4WFGD 4LCWE 3PWVB 1A9BA 1WC7A 3NCMA 4E41B 2K3TA 3T4AB 4OCSH 1J86A 1TVDA 2UVEA 3EYQD 4MD4A 3EIFA 1CDGA 1VPOH 5D7LB 5KSVA 3PG2A 5A40E 4YHPA 3BVNB 4S0TD 3UAJD 4LCIH 1RUPL 4ZUWB 5DWUL 3IGAB 3V5KB 4QRTA 4TNVK 4LCWB 1KBGH 2ATKA 2HT4C 4ZUVA 2HWZL 4U1LB 1L0XA 1A7QL 4LARH 2KH2B 2DAVA 1H5BB 2VDKH 1Y0LB 3QZWG 4WUKL 2VDOH 3QQ9C 4S1RH 4WW2A 4EN3D 2EYTB 3VXQB 1KJ2B 1MRFH 4LIQH 3RY4A 3MXWL 4UU9B 1B90A 5E70A 4X9FA 4M43H 3IRZA 2C26A 1IAIL 3BGAA 3RZWA 4YFEA 3SGEH 1YNKL 5C0AA 1PSKL 3FT4A 4KRPD 4OTXL 4HFUH 3QFJD 1RJYB 3N1MC 5IMOB 4P99A 2E9JA 5GRWA 4GG6A 1OARL 1HHKA 3C8DA 4KI5E 4X6EB 5FIEA 5FOBB 2X05A 5JIPA 5I71B 3DPBA 1UB6A 4HIJB 5F7EL 5GS3A 3IF1B 4HG4K 5GS1C 4NC1E 4OCNC 3DMMB 3SGKA 4LGSB 3U7WL 3UTSB 1A4KA 3IFNH 2YSSA 3PL6B 4FQCL 5F96H 3MRRA 5CSZA 2LV4A 2F5AL 2RCSH 2W0PA 5F71A 3FKUS 3QA3B 1KELL 3H7BB 4BJLA 4JREB 2EICA 1XR9A 1OGAB 1U92A 4UQ3B 3WBDA 2RBLA 1KPVB 3FO9A 4G42B 4QRUA 2WUBL 2IALA 1CVRA 1PD6A 2YS4A 3TYGH 4TVPL 1SM3L 5I30H 1U8PA 3VXUE 1G0YR 1XF3A 1KIRA 1EO8L 1W8NA 2VDQH 5C92A 1LEKB 2EXYD 2A1WL 2P7TA 1GGBL 1YEKH 1REIA 1DQQB 4PJ8A 2QSCH 4Y2DC 2FO4B 4WIQA 3OKKB 2YZ1A 4OFDA 2YPLE 32C2B 1E28B 4HJGA 1D9KA 5JXEC 4Q74A 3HR5B 3KHOA 1JUFA 3PABA 1HXYA 1QBML 5A2KH 2V9TA 1GIGH 2G2RA 3GB7B 5GZND 4TOYH 5TJWK 4GSDL 3F7PC 3TN0D 3KJ4B 4KK8D 5F44A 4RISL 4WUUA 1IEBB 4U6XB 2R0WH 3TBYB 4ZG1A 2PTTB 3IJYB 1V5JA 4LMQE 4UBDD 4MD5B 1NGQH 4NKMA 1QFWL 1YQ2A 3CZFA 35C8H 4O5LL 4OUUB 3UJTL 1OQOA 1NGYB 5T5NG 3DUHA 5C0IA 2JIXB 3VI4F 3ES6A 4NSKA 5DMGC 1VEOA 4JM2C 3BRDA 3C87A 3V8OA 2Z92A 4MJ5A 4N9OB 4CKVX 4JHZA 3KPRE 5EO0A 4OD3H 3R8QA 1QP1A 1F11B 2AK4D 3NIDE 4KK5C 1T1WB 2YBRB 3QIUA 4HKXA 1MH5B 4LPCA 2R1XA 5DFTA 3S5LG 2NXZB 2Y6SC 4L4VB 3WFHA 4XNMB 3AFLA 3O6FD 5DJ2B 5IB1B 1KF9B 5KN5B 5E2JA 4NC1C 3RTQC 2FX7L 2IBBA 3KPRB 1NKOA 1U42A 2Z8RA 3VRLF 4Y19D 2A77H 4ZTPL 4PJEE 2WINA 3QWQB 1BQLH 4NO5B 4AIZB 4LGPB 2HAZA 1KENL 2Z93B 4OFKA 3S9DB 1G7QA 4F9PA 1PJ9A 1DN0B 4PJCE 1SEBA 2HJLB 2IANA 5KG9B 1GZQA 2QL1A 4PJEB 1NEZB 3GSNB 1R0AL 2NYYC 4IJ3C 5I73B 4Y5XA 4KGJA 4HZAA 4L3CA 4X6CA 3RDTA 3VMPA 2Q3AA 1VKXB 1JV5B 1B3JA 3RVVC 3VFTA 4XMLH 2ZUUA 4LSRL 1KJ3H 3AC0A 1LP9F 2MQ3A 2VLKE 4K8RC 4YQXL 4G6AC 2W9LA 3HUJE 4MAYD 2EKSA 5EU5A 2OTWB 4PRBA 5TDNA 2ZKHH 3WIFA 4OLXH 2W07A 4Q9QH 5FYJU 1U3HA 5J57B 4U1KA 2H8PA 3V4VH 1O7SA 2PXYD 4MCZB 4OCYL 3BZEA 4UIKH 3HUJB 3O6MH 4H1LB 1BVKA 5ADOL 2R1YA 4TUJA 5FM4A 4TSBL 1FO0L 3MLTB 3ZO0A 3X3FH 2ZG2A 2B4CC 4JRXD 1WBZB 4WI9A 9CGTA 1SBSL 3GMMA 2O93L 5EOCJ 2JJSC 5D72L 4M7KH 4HKBB 1EGJL 4BK5A 2MPAH 2WBJC 5EIIB 1RY7B 3CK0H 1KLGB 3P11L 2GW5A 3V0VB 1YEFH 5IK3A 1VERA 1J5OL 5JXAH 1FPTL 4HWUA 3PGDA 5CZXD 4NQEA 1R3KA 4HQQH 3R4DA 4DK3A 1A6PA 1X7QA 1U6AL 4HKZB 1NMAL 1K5NA 5E5UB 1H8NA 5JA9A 3OAZH 1TNMA 5EC1B 4JY6B 5D2LE 4XCEB 4JANB 4LOUD 1QO3A 5E2TL 3SCMB 5I8EB 5FB8A 1K2DA 5IFAH 1T21B 3FQXB 1JIBA 4G8FA 4KUZH 5FUZH 5IW3A 3V4UL 4XNYL 1D5BB 4NM8L 1P7KA 43CAB 2C3VA 3Q1SH 2E27L 4CNIB 1AR2A 1S7UA 3HZYA 4I77H 3OPZL 2EYRB 2H9GA 4MA7H 4A6YL 2ZJSH 2DWEA 1A4JB 1FJ1A 2F54E 1HH9A 2RQ8A 3ARQA 4NZRH 4JY5L 5DVNA 4K7PY 1PQZB 1AJ7L 5KTEH 1ETZB 1CD0A 3MLZH 3IDMB 1B0GA 4JQXC 1SJVA 1JMXA 4JY4B 5HHXL 5FYJL 5ITFB 4W6YB 3VFUA 3I9GH 3P9WB 2EE9A 1AR1D 3FQNB 1TMCB 2F54B 2PW2B 3M45A 2HFEA 2A9NL 2VDNH 3GSWB 1DQML 5IEKA 2GEEA 1XF4B 1C16B 3LKNA 2E7LA 4KMTL 2X4SB 2XFXB 3S36H 1ITBB 3QP3A 5INDB 2HFFB 3G6AA 5GSVB 3LPFA 4XCFL 4ZFGL 3OXSB 1AQDB 3PQYA 3S97C 1MWAB 5AAWA 2FCBA 5L2KD 1AXTL 3IDNA 3MRCB 3TWCH 4XNZC 5DMJB 5DS8B 4CN4A 2FHBA 5GS0D 2EH7H 3KYMB 2B0SL 4LLQA 2FL5A 1Z9OA 4E5XA 2VQ1A 2P43B 3VDBA 3TBSA 1HK6A 2OL3L 2OM5A 5ERWA 5FA3A 2DYPD 1YMME 1YPZE 3ZTJH 3F7VA 2GUOA 3S96B 2PYED 1H0DA 4LSUL 4KY1L 5C0DA 2OXHA 2I07A 1T6WA 5KSAD 2R23A 5D1ZB 1YMMB 1YPZB 1DBAH 2I5YL 2C3HA 2NXYB 5GGRY 5GRVL 2EC9U 5AWNH 2BVYA 5E2UL 3QB7C 4K3JL 2ADFL 5C9JB 1KN4H 2YPKB 3MOQA 2CKBL 4LP4A 1LNUA 1SMAA 4YHYB 1MFDH 1KPRA 2IH1B 3CFJB 3HFML 1C5BH 2F19H 4EVNA 2X1QA 5B4MC 2CLRA 5GS2D 1WSST 1NCWL 1KTRL 3BDBA 4P2QA 2RJMA 1F3JA 1HWHB 4X8JB 3MUY1 4P49A 5IMLB 1T03H 1NH6A 3WE6A 2P49B 3WJLA 5BO1L 5HHOA 2NY1D 2CKBB 2Z31B 2HTKD 3GNMH 4M00A 3RWHB 3V5HA 3BESR 4DKFL 3KG5A 1RZFL 3V7AG 4R7DA 4NKDB 3EDEA 5HHVH 4P2YA 1KLUB 3FCTA 1NFKA 4ELKA 5F88B 2XY2A 4IOFD 2QHRL 2BNQA 3BKML 2CIIA 3K8MA 1J8HA 4ZD3L 2VQUA 1IE5A 4RSVA 5IJKA 3VI3F 3VH8A 5L9DL 3D3VB 2FX8L 5D2NE 3VFRA 2HFGL 2ZG3A 5BVJA 4PJ5A 2X9WA 1YA5A 1I1AC 1RUPH 1FVDB 2XV6B 3U0PB 5DWUH 4Z7QE 3MLXL 1XR8B 2NY2D 1DBML 2HWZH 3UPAA 2QHLA 5D6CA 1FFRA 3GMRA 1A7QH 4ZOAA 2YN5A 5D2NB 3KWWB 4M6OL 5BS0E 2X5PA 4YIQA 5FF6B 1QR4A 3G6JB 4WU7A 2LAAA 4WUKH 2VDLL 3LMJL 2R15A 3EOAA 5CJXC 3L1OL 3RZCD 1YDPB 2UYLA 4XP6L 1T5XB 3MRFB 3WXWH 3CPLA 3MXWH 1UH3A 3QPXL 2C7UA 3W39B 4BA8A 2P8LB 2IG2L 4OLYL 1TVBA 1W72L 4K9EL 1IAIH 3VWJD 3RY6C 4FXGB 4YK4B 3T0EC 1F6FB 4FG6D 1CL7L 5MENA 5EPMA 1YNKH 1YEJL 4MHHG 1PSKH 1A6AA 3D85A 1KYOK 4OTXH 5BS0B 2E7HA 3O8XD 4X7FC 4HGKC 4JKLA 2GIYA 5JZ7C 1T7YA 4JFOB 3ZYIA 3QULB 1OARH 5A16B 2FBJL 1TPXC 2HN7B 3UDWA 3V6ZA 4WEBL 4RMRA 5F7EH 1S9XA 4WV1A 3MTRA 1W72B 5B8CB 3P40A 3U7WH 5LAXB 4FQCH 3ILQD 1KGCE 3D2UB 4LNRB 2FIKA 2F5AH 1W0WA 1ZS8B 3C6LA 3T2PA 3FB5A 1KELH 4HS6B 3NCEB 3O3DA 2HH0L 4RWYL 1CZ8H 3RL2B 1Q9LA 5K9QI 2WUBH 3G04A 3AMLA 3TZVA 4TVPH 1SM3H 1WIOA 5C09D 1OTUD 3VXMA 4E42B 4ZSOB 2R0ZL 3IDGA 4RFOL 2BOBA 3ELAT 4QF1A 3Q6GL 1EO8H 4PUBL 1UENA 1GCFA 3T8XA 2A1WH 1GGBH 4HS3B 1BREA 4JFYB 4G80A 3UBXB 1X5GA 3H0TA 1QFPA 4PRPD 4UOW0 4DUWA 5TH2A 3OXRA 3IKCB 1W2KT 4PJAF 4LHUD 4L29A 3WIHA 2FGZA 1FN4B 3BYTA 1N6QL 2R1WA 2J5LB 4I4WB 1LE9A 3SKNA 5SX5K 5F9WC 4GSDH 4ACPA 3RWJB 4I48B 3J7HA 3MZGB 4RISH 2MHAA 1N3NA 1MCKA 1MCHA 4GRMA 4X6BA 1QNZL 3HTLX 2GTZA 2OJEB 3LN9A 3QNXB 2VZVA 3GZKA 1QFWH 4O5LH 1TDQA 2GK2A 1G6RA 2GTWA 1QQDA 3TA3C 4WI2A 2VQTA 3D25A 2XOTA 1HDMA 5GPRA 1NGPL 4OF7A 1U8HA 3BZ4A 4XHQA 1Z0NA 5CP7B 3ZHDA 4HF5L 2HT4D 4APQC 1OD9A 1A9EB 3MV7A 5KSBA 4Y4KC 4LF3B 3MODL 3E6FB 5E00A 4U1SA 3LZFL 1FNGB 4PV9B 5IF0B 2UZIL 1QSVA 5AAMA 4H5SA 3OMZA 4M8QA 5KOVC 1OP3K 3FT3A 3QQ9D 4L8SC 2FX7H 1D5ZB 5CEXA 3REVB 4K3HA 1L7TL 2XNAA 2UY6A 2VISA 3C60B 4ZTPH 4JFFE 4YHLL 2NNAA 5C0FA 4WW1A 4YZFE 2DJUA 4HFWB 4PP2B 1ZHNB 4HGMA 1KENH 3U46A 3CSGA 3U1SL 3F7YA 3K2MC 4POUB 5DEFA 1FC1A 4U1JB 4JFFB 5I6XC 4QXTB 3FN0L 1GC1C 1R0AH 5FUCE 1XGYL 1DBBL 5MP6L 1CICA 1YEIL 4NC2B 1HKLL 4ZPVA 3DSFL 1DR9A 1KCRL 1OP5H 3DSNA 4OCXL 3CUPB 5AUMB 2WIMA 3C09C 4XWGL 3EAKA 1L7IL 5HYFA 4LSRH 4FQXC 1YUHB 5DURB 4YQXH 3QNZA 1G6VK 4J8RB 3BAEL 3MRKA 5HBBA 3QQ4B 3RGVC 2YR3A 1PY4A 5F1OB 1LEGB 5JDSA 2WWKO 5E5MB 3VRJA 1BZ9A 5J13B 5HYJD 3O11B 4Q2ZB 2HKHL 1I9JL 3TO4C 5JR1L 4FMFA 1CXFA 2Z0BA 4NPYA 4OCYH 1UXSA 2B39A 3ILPA 5KS9B 3JTSA 2BNRE 1M4KA 2R2CA 5ADOH 4Y2DD 3QIWD 4OFVA 4C83B 4M93B 4TSBH 1FO0H 5JXED 3MA7B 4PTUB 2ZSWB 1SBSH 5D72H 4I0PA 5F3BB 1EGJH 1BOGB 1IBGL 3P11H 3P9MA 1A9BB 1J5OH 1I8LC 1BIIB 4LCYB 5JPMB 1MJ8L 1WVZA 1FPTH 3RY5A 5IFHL 1EXUA 3K4AA 1KACB 1PW3A 4F7MA 5DD5L 1NMAH 5ALBL 1A7NL 4RAHA 3L5XL 1V7NL 1BLNA 5E2TH 5C9KA 4X6DF 5GRZA 1Q0YL 1U8OA 1JHTB 2YHGA 3HPLA 4QCIA 5DMGD 4JM2D 1KEGL 5C6TL 3V4UH 4EOWL 4XNYH 3N1FC 4GS7B 4NM8H 1KIPA 4WU5A 1NCTA 4WW2B 2E27H 3MJGX 3QXDB 2G9HB 4P2RD 3OPZH 4KK5D 3MRNA 2BVQB 4A6YH 4MLSA 3AREB 2VB5A 2Y6SD 1ZVSA 3UPRA 4FZ8L 4GG8B 1MRCL 3WDIA 2WWKT 1WV7T 4JY5H 1AJ7H 3HE6A 3RTQD 2V2XB 5HHXH 2X4UA 5SWSE 5FYJH 1CT8A 1J88A 1XIWC 3KPMA 1U91B 2A9NH 2XWJA 1DQMH 4HK3N 3EOBB 1R3HA 5CFHA 5C08D 1CGSL 2VC2L 4DWHA 4KMTH 4NNYB 1F97A 2YSSB 3GSRB 2EO1A 3MRRB 5SWSB 4ENEC 3F6LA 1BQHG 4IIQB 5EU7E 1JTOA 2BFVL 1KC5L 3TNNB 2Z4QA 4C56A 3VGFA 2NYYD 3JWOL 4XP5L 4XCFH 1U3YA 3MXVL 4M7ZC 3OJ2C 3FO1A 4P4KA 5GGQL 5HHNA 1AXTH 3QRGL 1CLZL 2XQYK 2DOCA 2IALB 3U30B 5D4QA 1TQBB 4FNLL 1S7TB 3RVVD 1FNSL 1OL0A 4MNGA 2EKJA 2B0SH 1U8PB 1WCBA 1JNLL 4K8RD 3SE3C 1SJEA 1IZJA 4G6AD 3KPPA 2D7NA 3HPJA 2VXQL 1DCLA 3FTGB 3IFPB 4OIIL 2OL3H 5IV2A 3K0WA 2R56L 4WWKB 2Y36L 2P7TB 1JF5A 3TGXA 1NAMB 1U2CA 3T0WA 1SEQL 5BCAA 1M05A 4IRSA 3EYSL 4PYGA 5JHDE 4N1HB 4HLZH 4LSUH 4ZO7A 4KY1H 3B6SA 4PJDF 4EXKA 5AZ2L 2BY2A 1F3RB 1QTYT 4PG9A 5EU6E 3O6LL 4MGXA 3U82B 5ENWA 2XG5A 4JAMA 3AMKA 3QDMD 2I5YH 1DUYA 3CX2A 3U9UB 2VZTA 4LPXA 5D70L 4U0QB 5JHDB 2ZUVA 1UKSA 5E2UH 4BM7A 4E0RA 4F7PA 4K3JH 4J4PA 2M26A 4Z5RB 2WBJD 2ADFH 4HSQA 4UTBL 1ZHLB 2CKBH 4KTDL 4IOSD 5CJOL 4RGOL 4O2CA 1A0QL 1DJSA 2GSGA 3HFMH 3CZFB 4OLVL 4D8PB 2ADJA 1NCWH 5J11C 4LLVB 4GAYA 3F65A 1G84A 1LWRA 1KSRA 4ZUTB 1I4FA 2XIDA 1IGYA 4MJ5B 5DXWA 5EO0B 4IDLA 2VITA 1IKFL 5BO1H 3V7AE 4OLZL 4M4RA 2EDRA 4CJ1A 3QIUB 4DKFH 1RZFH 1IL1A 5EOCL 5EDXA 5GIRA 3N1PC 1OF2A 2PO6C 2V5MA 4CVWA 2C3WA 1Q94A 1KB5B 3ARBA 1N2RB 4B53A 3R8BB 3NA4A 5BW7A 5GGRA 2QHRH 3BKMH 3DARA 4BUGA 4ZD3H 5FOJA 3W0WE 5E99L 3KPQB 4OZIA 4NQTA 1FYTE 3CFBB 5I1GL 2FJGA 5BRZD 4F7TB 5L9DH 2FX8H 5CD3A 2HFGH 2ZUTA 4NRXA 2EIDA 2C4FU 3F5WB 4PD4K 1II4E 4PR5A 1IGFL 2BVTA 3MLXH 3RVWC 1LD9B 5IVXE 4LVNC 3W0WB 1OW0C 1FYTB 3ZDYE 3UXFA 1B6UA 3V5DB 4URTB 2VLKD 1QVOB 5T1MB 1Z5LB 1ZEAL 2OI9B 5T3XD 4M6OH 5IEHA 3RAJL 1TTUA 3K46A 4L3CB 3IS1X 2VDLH 3LMJH 3RDTB 4LRIA 3L1OH 4XP6H 3OKYA 1SMOA 4Q9CA 3H9SE 4PJXF 1RU9L 5KVDL 2IG2H 4OLYH 1W72H 4K9EH 3BEVA 3OGCA 1CL7H 2YA2A 1MPAL 1YEJH 4MNQA 4XXCA 4Y4FA 5CEYB 5HY9A 2DQHL 4TNWK 2ED8A 1M6OB 2X4NB 1EJ6A 3QUYB 3HC0B 5EN2B 3WIFB 3WN5A 3NCYP 2GHWB 4L4TA 2H32B 2FBJH 2M1KA 3H9SB 4KDTC 5LG1A 4U1KB 1S7VA 2X1XR 4WEBH 5C0JB 1HSBA 4HUWA 4PTTA 2E9BA 4HV8B 4OZHE 3TPUA 4ZODA 3EJZC 3X14B 4HWZA 1CVSC 4BSVA 1C5DA 1AC0A 2GT9B 1OTSC 3MFGB 1OAXL 1U8NB 1NJ9B 4OGAC 4U2YA 5T3ZE 1F45A 4R90L 1UGNA 2ITDB 1OAZL 1EUUA 4OZHB 2EDDA 5I1DB 4RWYH 2HH0H 2GSIA 2D2OA 4LLMB 1VFOA 3GKZA 4L8BA 5B3NA 5FV2A 5ABDE 3ARDC 2FLRT 2VAAB 1HHGA 3S35L 3CNKA 4XXDA 3CCHA 4HLZG 4BFGA 1BFTA 1S7SA 2R0ZH 3JV0A 3TF7C 4RFOH 1OD7A 3Q6GH 2FATL 1IAKA 4PUBH 4F58L 3IU4L 5D7JB 2KL6A 4MQ7A 5B4MD 3GSUB 1QO3B 1NCNA 4XAKD 1J0JA 3DGGB 4G8FB 3R1GL 4QO1A 2FJFB 2X4QA 1JK8B 2GI7A 2C3VB 2MCG1 1YJDL 4AG4L 2YRZA 3P4OA 3HZYB 4Q0XL 5LWYL 3OHXA 5CEZE 5CJ8A 3MRLA 2H26B 4R4BB 4HXAL 5FYKE 5L2JA 1N6QH 5DTFA 2W0FA 2DWEB 1EEZB 1FIGL 1HH9B 3JV4A 5JMRA 1S7QA 4GRWE 2BVOB 1BX2B 1F4WH 5JOFB 3ULSA 1B0GB 3OAYK 1QNZH 4IBLT 4YGVA 1MLBA 1MCSA 4Y16C 5BZDA 5HYSG 2ICWA 3MROB 2BVUA 1MQKL 3KXFA 4MD0B 1CF8L 1H3TA 1G9NC 4NYLA 4GRWB 1EO7A 3BQUB 1I1AD 1CFQB 3DVGA 4HKJB 5DQDL 1NGPH 3DXAE 1A6VL 3BUYA 3ZDXF 4QNPE 4JHAL 2MCPL 1INDL 4HF5H 3OQ3B 4J3OC 1U8LA 3MODH 1HQRA 1NBYA 3LZFH 3G6AB 3T09A 2VLRD 3SDAB 5A2LH 1F2XK 5HVHC 2UZIH 3PF2A 3QUZB 2P5WE 4NO3A 3BPOC 3NOIA 4L3EE 3PWLA 1VEPA 4KV5F 1YY8A 4Q7DA 1LO2L 3V6BR 1NFIB 2DIBA 3U2SB 3A67L 1EDQA 2FL5B 3T0ED 3MJ8A 2LFGA 2VQ1B 2VLME 1U0QA 2XWBA 5DA0B 4JZJB 1T7VA 4YHLH 3CXHJ 5FA3B 4PGZA 1KJMA 1IM3A 1PVHA 4L3EB 5JZ7D 5DHVA 5EZLA 4MXWL 5K59E 5CLTA 2EXWC 5EC2B 3X17A 4JZOA 3QUXB 3H9ZA 3U1SH 5E8PB 4F2MB 1HHJA 3ZT5A 1FZJA 3AGVA 5L8KB 3FN0H 4RQQA 1XGYH 4FTVA 1DBBH 5ID1A 5MP6H 3RHWK 3AM8C 3PGFL 1YEIH 2IH3B 3MYZA 1HKLH 4NQVB 4U1IA 4QRSA 3DNKA 2MQ0A 3DSFH 1KCRH 5T1LA 2XZAH 1EEYA 2H3NA 1JMZA 4K71C 4FFWC 1CFBA 4OCXH 3G5VB 4Y5VC 2C1PA 4XWGH 1L7IH 4NBYB 3CLFL 4QRQB 4KI5F 4WFHE 5D6DC 3FRPG 3CFDB 3S4SG 3SE9L 1LNUB 5IROC 3BAEH 1CDYA 4YR6B 1I1YA 1NMCC 3L3IB 3DVNA 1I7UB 3DX9A 3O3UN 3R06A 2YEZA 2I27N 3QUMB 5FXCH 1ACZA 1UJ3C 2AKRB 2B1AL 2HKHH 1I9JH 3CVHB 5JR1H 4JGMA 4QRRE 3WUWA 1JNJA 3D5OF 5CUSL 5J1SC 2FJHB 2DTML 1NFDE 3WO3B 5ID0A 3KYAA 3AB0B 2VZOA 4N0UA 5B39A 4I18C 3QT2A 5F7HA 4HJJH 3MYJA 5HGBA 3FQWA 5I17A 3AS3A 3DUUA 3DRTA 2CIIB 4BKLB 1IBGH 1KIUA 3VRIB 2F53D 1NFDB 3OKEB 3UTTE 3H3BC 4UV7L 1DE4A 4LSSL 2JCCE 1MJ8H 3VH8B 5IFHH 1AE6L 5BVJB 1MSPA 3WIIL 5DD5H 2VR4A 2QSQA 1TZIB 5ALBH 1RQ5A 1A7NH 1N8ZB 1UYWL 3UTTB 4PB9L 4P2OC 3ARTA 1ZLSL 2O5YL 3L5XH 1V7NH 3TA3D 5E6IA 3ZDZE 2JCCB 3GMRB 1Q0YH 5H2BA 1FNEB 4A2MA 4PFEA 3VWKB 4RGNB 5GJSL 1I7ZA 1KEGH 5C6TH 4BQCA 4YIQB 4OD2A 4APQD 4PLNC 4Y4KD 4NZJA 4X7EC 2UWEA 4ZQKA 4LVHC 4D0BA 1KIQA 1SYSB 4UT9L 3DHJA 4FZ8H 3CSBA 4MAUL 4MA1B 1MRCH 3PL6C 3GJFA 3F6IA 3UTPD 2E7MA 4ONHA 4DOHE 4U1MB 5TE7L 5EZJB 3IJSB 2H2PC 4KROB 1S9XB 3NZ8B 4NQSA 5E1AB 5FO7A 2ED7A 1P84J 1CGSH 3MNVB 3MRGA 1NGZA 2L7UA 4Y88A 4OZFB 1M7DB 1P5VA 1FVCB 4IMLA 4DOHB 3MV8D 4X98A 4YDJA 2BFVH 1KC5H 3MNWA 3O9WA 3C6LB 3FB5B 3JWOH 3A6CL 4XP5H 3BPNB 4NM4H 1MHCA 3MXVH 3O3DB 3O6KL 5GGQH 4OZ4B 2BERA 2PCPA 3QRGH 4PJEF 1CLZH 4N8PA 4TYUA 1VGEL 3EDDA 1JF6A 3OB0K 1A7BA 3TZVB 4U33A 4FNLH 2IPKA 1FNSH 3R0MA 3WIHL 4OI8A 3ARGB 1JNLH 2QV2A 4I5BB 1K8DB 3VGHA 3IDGB 4NQXB 3QEQE 3GM0A 2VXQH 2ZUXA 4OIIH 3RGVD 4Z8FL 5ANMA 2R56H 2Y36H 4JB9L 1N6UA 43C9A 2O61A 1SEQH 4G80B 1OCWL 3EYSH 5DRZB 3H0TB 4GKZA 3TO4D 4DZBA 3OXRB 1RJZA 5DI8B 5AZ2H 3QEQB 1TCRB 3O6LH 1RK1B 3TC9A 5E8EA 1DLHB 4CW1B 1G6RL 4C54A 4G9FE 4U4BA 4EI5B 5D70H 1NMBL 3SKNB 2E3VA 3CFEB 4JFDE 2IAMC 1N0XL 2MHAB 1N3NB 5IESL 1AGCB 3DHMA 3PJSB 4X6BB 4UTBH 3HI5L 3KPSE 4KTDH 5CJOH 4G9FB 4RGOH 1A0QH 4WO4A 3R0NA 4OLVH 3BZDA 1G6RB 4R6UA 5DJDB 3ZKXC 4JFDB 2IWGA 4F57L 4GW5A 1MREL 1U8HB 1IM9D 4Q97A 2B5IC 1IKFH 4OLZH 4M6NL 4C58B 1ZWIA 3ARWA 4OFYA 5EOCH 2FEDC 4J3TA 3MRJA 1VACA 4YHNA 2NY0C 1ZOXA 1S7XA 1Z2KA 4PIRF 4FQ2H 1X9QA 1KNOA 4NKQB 4FQQA 3L3HA 1IGIL 4P9HL 2J8HA 1HZHL 3SDDB 3DV4A 1JPFA 1VFUA 1OLZA 4Y0GA 5T33L 1YN6A 4P5TC 5E99H 5C0CD 1HHHA 5I1GH 2JKXA 4PPTA 5D7IE 2J88L 2VDPL 4TQEL 4D0DB 4K7FB 4Y89A 2Y7QA 2PR4L 1IGFH 1I8IB 3HLAB 4R3SA 1XIWD 3X12B 3RJQB 1FG9C 3G5YA 5DEFB 5F9DC 4HIIA 4J6RL 3HE7A 5D7IB 2CMRL 3E6HA 1UB5A 1HNGA 1S7RB 3U6RB 4LLWB 1WGOA 1ZEAH 4G43B 2EDQA 2BC4A 4GBXA 3LEXB 3FONA 3MJ7B 3RAJH 4ENED 4ZPVB 2VN4A 4PRDB 5DDHA 3JUYA 1CD9B 5J6HB 3MMEA 2FDBP 1RU9H 5KVDH 3DX8B 3KR3L 1WAAA 3QNZB 1EERB 1P69B 3D69B 2R2BA 1LO0L 3QDAA 1GGCL 1MPAH 4HZLB 3CIQA 5FGBA 3MRKB 2DQHH 4Y1AE 2FB4L 3GMOB 3MRDA 3QH3A 3IRPX 4HUUA 4OZGE 4QYOA 5ICXA 3MUZ1 4P3CL 1RZKL 4LPYA 3EZ8A 3CH1A 2IFFL 2BRRL 2R4SL 3SJVD 4ETQA 1YNTA 2C1OA 4L1DA 4NKOA 4NPYB 3HZMA 2F15A 1LGVA 3PHOB 5LGKA 1IQDA 5D1QC 4Y1AB 2L7JA 4HCRA 1QFWM 4N0CC 4AM0A 4OZGB 1S5IL 3DX6B 3L5IA 1OAXH 3C5ZB 3QWRD 1U8MB 2P42B 2ZOKA 4QRPD 4XH2B 4B7IA 4R90H 4I0PB 1OAZH 3LN5B 2JJVA 4CL7A 4PG2C 1ZA3A 2APVA 2Q7NA 3X3GL 3V6OA 1UWXK 4HDIB 3P73A 3B9EA 4OI9A 1YPZF 1NUGA 2VIRA 3S35H 4Z77A 2HA1A 3T3ME 1GZPB 4XMKL 3JVGC 4F7MB 5HHMD 2FATH 1G7MA 3HHRB 3MUHL 4F58H 2DLEA 3IU4H 1BLNB 3DUSA 4PJHB 5JLZA 1U8OB 4QCIB 3BIKB 5CKAA 3P30L 3R1GH 3BYYA 2LTQC 3DJ9A 4K2UL 1WFUA 1U36A 4LK4A 4PJAA 1YJDH 3D18A 4AG4H 3PV6A 4Q0XH 2P1YA 2KZWA 5LWYH 4HXAH 2CK0L 5J89A 4XBGB 2CDGA 2AP2A 1FIGH 2PO6D 3KS0H 3UPRB 4U49A 4MSWB 2EDOA 5L0QB 3VXPB 1OM3L 2DD8L 4P23B 4IDJL 1DVFB 2I24N 2YXMA 1NKRA 4LPTA 1MQKH 1CF8H 1XGTA 2XWJB 3VXTA 3BH8A 3QFDA 1CYGA 3TLRA 3GMQA 4ZFZA 4OSUL 2P8MA 5I8CB 4J3WA 2PYFA 1J0IA 5DQDH 5JW4R 3RVWD 1A6VH 4LSPL 4JHAH 2MCPH 1INDH 4K7PL 2YWZA 2ZUQB 1M71B 2VUYA 2Z4QB 1F6AB 1PKOA 5LCVL 4XX1E 1JPSL 1OAQL 4DGYL 2YUWA 4RA3A 5HHNB 5LKNA 4M5YL 4LEXL 1ED3A 5ESQA 2V7HA 1Q0XL 3OR6B 5I75C 2EYSA 3G6JF 4JRYD 1LO2H 1WCBB 4Z0BL 4C4KO 4Z7QF 5KAQG 2X1WL 3A67H 1F90L 3KPPB 3ZKNC 5I1KL 2RIKA 4D2NA 4LQFL 5TPWL 2VZ3A 4X7DC 2R8SL 4YEFA 1F5WA 4MXWH 3P0YL 2I60L 2XKSA 3NIGE 4BFIA 5IHZB 4LLDA 3P9LB 3EJZD 4PG9B 4Y5YC 3BJ91 1BM3L 2CD0A 4I3RL 4DGVL 4HGWB 4X7TA 1MOEA 5ENWB 2AEPL 4CMMA 3DRQA 3TESA 1OTSD 3PGFH 4U7MA 4Z76A 3VXOA 1RZJL 4OGAD 1JGVL 1AD9A 1KXVC 3VGAB 4I3SL 4E0RB 4FZEL 4XVSL 3TBVB 1B9ZA 1MCWM 3SKOA 3CLFH 1IEAA 1P2CA 3ARDD 3SE9H 4KFZC 1BMGA 1QUNA 4N8VA 4QHKI 1XT5A 5DJ6B 4PJ7A 3MBEC 3HAEA 1TVHA 1T7WA 3ARXA 1IEHA 4NQCD 2FH8A 2B1AH 4FQ1L 3D39A 5H35B 3LV3B 1P4LA 2XI9A 1SVZA 4UILL 5CUSH 2DTMH 1EFXA 3VFSA 3G5XB 2GJ6D 3VCLB 4WHDA 3VXSE 1L9NA 3L5HA 1V3LA 4C4KT 5EUOA 4J1UB 4O51B 1DTUA 1QHOA 3IDJB 1T04A 2CXKA 4OM1L 5FKAA 1WUNT 4UV7H 5TQ2L 4LSSH 2EZ0C 3L5WA 3ZT6A 1TLKA 4YC2B 3VXNA 2Y9RT 1AE6H 4XVJL 3AAZA 1IKNC 4G8GD 5CIPA 2HKFL 3SE4A 4PR5B 1HKFA 1I9IL 3JWDL 3WIIH 4Y16D 1G7IB 1UYWH 2LE9A 3ARUA 3WJJA 1BQSA 4PB9H 5DJ8A 4WI8A 1ZLSH 5GSRB 2O5YH 2DQJL 4DW2L 3GSXA 3G6DL 3OF6A 2FWOA 1V05A 1WIPA 1KJVA 1NC2A 5IQ9A 4CADB 2CDFA 4X6DA 5GJSH 3FQUB 3MPCA 4L8DA 4QWWC 3BSZL 4BQ9A 3KVQA 3SBWC 1C12B 1DDHA 4LCCA 5DSCA 4YDLC 4ZXBA 5SWZE 5GGSY 1EUTA 3LKOA 1E4WL 3S3JA 4GRLC 4K9EC 4Q6IB 1PAMA 4UT9H 4RBPH 4WCYL 4MAUH 4NFBA 4Y4FB 4M61B 4UB0L 5CKGA 1MHHB 3FB7B 5SWZB 2QKIA 4L4TB 4JRWA 2B8OT 5TE7H 1BBJB 2BMKA 1C08A 3Q6FA 1T0NB 2YD2A 2Z91A 4K94L 5K33A 3Q2CA 5ISZE 1RSFA 3FOLB 4HWZB 2ZUSA 4ZOBA 2EXWD 3UC0L 1C5DB 4DJMA 2ICCA 1ORQB 4YUEL 3GMNB 1HE7A 5C1MB 1UWGL 3HZKA 3RU8L 4LPVA 3RI5K 3A6CH 3VFOA 5ISZB 1A6TA 3O6KH 2XN9A 5D1XC 1GGYA 4MHHI 5MEPB 1QR1B 3MV9E 1HQ4B 3LPWA 5BV7B 1NCDL 1VGEH 4FFWD 4YNYB 3FFCE 2BK8A 4JFEA 1FBIL 4U6VL 3WIHH 4BH8A 4HH9A 5DD6A 1QRND 3P77B 2ADIA 4AH2B 7CGTA 1NSNL 1S7SB 3QDJA 2C3XA 5E8OA 1P7QD 3MREB 4Z8FH 1J0ZA 3MV9B 4U6YB 4JB9H 4W81A 4MQ7B 5FYKD 3FFCB 2BVPA 4NHUA 3BHBA 3WNOA 1OCWH 2HJKB 1AGFA 1VFMA 3DECA 3BMVA 3B5GA 3OR7A 4CVXB 5GXBB 1G0DA 4RMWA 3P4OB 5F6IB 1G6RH 5L2JB 4H26A 3MUGB 4ODHL 2YZ8A 5KS9F 2WUCL 2DKSA 3JV6A 5E8NA 1NMBH 5JPNA 2ZPKL 1S7QB 4PRHA 1JWUB 4I0CC 1N0XH 1KXTB 4Z7VA 5DLML 4XCNB 5IESH 3NN8A 3ULSB 3DXAD 5AZEL 4FQIL 5D5ME 3MACL 1JN6B 3HI5H 1VESA 3IETB 5IR1A 5KZCD 5EU4B 1KV3A 3VWJA 3KXFB 3QHFL 3VXRA 3BPCB 1MJJA 2Y5TA 4MJIA 5CGTA 1EBPA 3HMWL 3WXVL 5JW3H 4R7NA 3O8XA 3QDHA 1P9MA 5C07A 4F57H 3DVGB 1MREH 4RX4D 1FL3B 5F7WC 3BKYL 4P2OD 2NX5E 5D5MB 1ZHBB 2X42A 5C8JB 4EUPA 1BWWA 4JG0L 4P9ML 4M6NH 1U95A 1XF2A 4UUJB 2J8OA 1DSFL 2Q76A 2XICA 1MUJA 4KKBC 5EULV 2G5BA 5BJTB 3AXLA 2X4OA 3LSOA 1IGIH 4P9HH 1HZHH 3LKQB 4WW2F 2CLVA 5M94B 1ZGLP 5T33H 3DMMD 1F2QA 5GRXG 3ARFB 2OJZL 4QHKJ 2J88H 2VDPH 3BGFC 3PL6D 4TQEH 4Z18A 1KJMB 4LBEB 3VE0A 5DHVB 5EZLB 1Q9OA 1UXWA 2E9WA 4CU6A 2PR4H 4EXPX 4RIRA 5B38B 4RZCB 1UA6L 2H2PD 1RPQA 5K9KB 4GG6F 2DQIL 3PP3H 3B9DA 4PJBE 2DLHA 2EDNA 1WEJL 5TDPA 2VWEE 4J6RH 3RPIA 1HH6B 2CMRH 4RQQB 5ID1B 4FTVB 4R2GC 2IMMA 1PKQA 3OKMB 3STZA 4N9GB 3RIAF 1CGUA 2VE6A 4ORZC 4DUXA 2H3NB 1ZA6B 2KPNA 2FZ3B 1UH2A 1OAYL 3IDIA 1JI1A 1K9TA 3QQ3A 2EDTA 1CLYL 1MHPL 1JP5A 1H9VA 2APWA 3KR3H 3SDCA 1MY7A 4QRRD 3CU1A 1BOYA 4PJXA 1LO0H 4UQ2A 3QNYB 4OQTA 4N1CA 4WEUD 4TVPD 2BY3A 2FB4H 4ZNEE 3MLUL 3C5SB 5FM5M 3WEXB 3DX9B 1E6OL 3KPLB 4PGJA 5C2UB 4P3CH 1RZKH 4JFZL 4X7CC 1GL4B 3HS0A 2AJVL 2BRRH 2R4SH 4S11A 4V1DE 4D9QD 4DN4L 5E4EC 5C0BB 5GISL 4MDIB 2YC1B 4X5XA 3WUWB 4PGDA 4IRJA 5CILL 1MVUA 3BEWA 2ESVE 2AXGA 4TTGA 4TUOA 1S5IH 5I1AA 2ENYA 5IT2L 2IC2A 4RGMC 2ADGB 4UT7L 1HYSC 4V1DB 2UZYB 4JVPA 1JWMB 3FQWB 5I17B 1FL6A 3ULUL 1F3DJ 3X3GH 5J3HC 2P5ED 3KYNA 3O4LD 2ESVB 1CTOA 4R9HA 2A6KA 2IAMD 3OGOE 2KQMA 3UMTA 1F8TL 4WW2C 4BH7A 1WZKA 4AENA 2HVKA 2KZ1B 4XMKH 1CDUA 2FLBT 3TEUA 1TETL 2ED9A 2GCYB 1I7TA 1WFNA 4L4VD 4G7YL 3IJHA 3HG1D 1I1FB 1S78C 3EYVA 3OX8B 3RNKA 3DYMA 1U9KA 4HAFA 4YHML 3WCYA 2AS5M 5IB3A 1JGLL 3P30H 2DIJA 1UZ8A 2R29L 4FQLL 3B2VL 3TCLA 4K2UH 5KBNC 4ZQKB 4D3CL 1QKZL 1PG7L 4CVZB 2DKMA 2J8UE 2CK0H 5I9QC 4C57C 5AD0A 5CP3H 2FEDD 3SGKC 2NY0D 2D31B 1H8SA 4LLUB 1N5AB 1YNLL 5JHLL 3MLSL 4P46A 2GAZB 4P5TD 1TZHB 4QHNA 1OM3H 2DD8H 3TH2T 3QIBA 4IDJH 2J8UB 1D6VL 3OKOB 4Y4HA 5J4MA 4NQSB 1G9ML 2BX5A 2VYRE 2XXCB 1UZ6E 3PWVA 4OSUH 1LHZA 2X4RB 3VFMB 4ELMA 4E41A 4LMQI 3T4AA 1QOKA 4LSPH 3L3KB 4K7PH 5HYJA 5D7LA 3UCRA 3O9WB 4BSJA 5EZIL 5IQ7L 3BVNA 1QFWI 3JWOC 4ZUWA 1JPSH 1OAQH 4DGYH 3V5KA 4M5YH 1BD2E 4PJ8C 4LEXH 5EO1A 2PCPB 1HI6B 4WFGE 4LCWA 1T89A 1Q0XH 1ZGLA 4O9HL 4U1LA 3L3OB 1D9KC 1MFBL 4RFEB 2Q86B 5KVGL 1H5BA 4Z0BH 1Y0LA 3RNQB 4WEMB 1F90H 3CFKB 3NH7L 2EYTA 3QRFM 1BD2B 3VXQA 4LQFH 4BQ6A 1KJ2A 5TPWH 2VN7A 2R8SH 1OSZB 4UU9A 5IP4A 4X99B 3P0YH 3Q3GB 1QSED 2I60H 3QDGD 4DZBB 3AUVA 4ZAKC 5K9QG 4CVUA 5IMOA 1BM3H 3H3PL 4I3RH 4KQ3L 5D1QD 4DGVH 1XF5A 4HUXB 4N0CD 4U31A 5INCB 2AEPH 1YYLL 5FOBA 3IXTB 4AL8L 1AC6A 3WFEL 1ZLWH 4HIJA 1WZ1L 3IF1A 1RZJH 1JGVH 5FHBL 2W0LA 3QFJE 4I3SH 4OIAA 4FZEH 4XVSH 3MGOB 1G0XA 4EN3B 4CMHB 3RWGB 1G7PB 1RV6X 2BZDA 1RMFL 4NZDA 4OZHF 3QIUC 3BW9B 1HXMB 3GMPB 3QA3A 4YAQB 3NAAL 3H7BA 4KRPB 1OGAA 3QFJB 4PJIE 2VXVL 3WS6A 4AY0A 4UQ3A 1JE6A 4G42A 1KPVA 4TTDC 4FQ1H 1I3VA 1E6JL 4UILH 1YQVL 5HPOA 4F15B 1EA9C 4PJIB 1LEKA 4JGJA 3MRJB 1CN4A 1DQQA 4F9PC 3F12A 3L3HB 4JO4L 2FO4A 1DANU 3T2QA 3VXUA 1HCVA 3BDYL 3PIQB 32C2A 4OM1H 3BE1L 3HR5A 4XPGL 4JN2B 4Y5XC 3TIDB 5ACMA 5E9DD 5TQ2H 4ZNCD 1LILA 4WTZA 5JDJA 5IBTL 3CGTA 3VG9B 4XVJH 5BMFL 3QBTB 2HKFH 5FYJD 2CGRL 1I9IH 3JWDH 1EEUA 1GGTA 5CZKA 4WFFD 2YPLA 3GGWB 1N6VA 4Z7NE 1X5LA 2DQJH 3HE7B 4DW2H 3TBYA 1QYGL 1QG3A 3G6DH 4KTEL 2PTTA 1UCTA 3IJYA 1ZT1B 3FONB 4MD5A 3MBXL 3BSZH 2VLJD 3A6BL 4OUUA 5HGAB 1JPTL 1U3HC 1NGYA 2VAJA 4S1DC 5HGDA 2JIXA 3G5ZB 3MMEB 4J7RA 1E4WH 4GKNB 1I1CA 4HCRL 3BD4A 2ZSVA 4WCYH 2GITB 4X9BA 4UB0H 5IUSA 1T1WA 4LDOB 1MH5A 1PGRB 3QPQC 2NR6C 4HBQA 3TN0B 3F8UB 1G1YA 3GUTB 2X7LB 3ZKND 3CH1B 1CFNB 2VNCA 4XNMA 2ERJC 1KCLA 5DJ2A 1EVUA 5IB1A 4K94H 5KN5A 2VABB 3W9EA 3KPRA 2G60L 3CDGB 3UC0H 3WNKA 2AK4E 1GAFL 4AM0B 5FYLL 2CPCA 1XFPA 3RUGE 4XAWL 4QTIL 3SY0B 2KUTA 3HI6L 4YUEH 3QR2A 5F8QC 4NO5A 3MGTB 3TM6A 1WLHA 4AIZA 1UWGH 5HYQB 3RU8H 4AIXA 2RAMA 2HVJB 2Z93A 3H7LA 1DN0A 4HWNA 1R5IB 2AK4B 1NCDH 4Y19E 5GGSA 5DD0L 2EECA 5EOQL 5KG9A 4PJEA 1NEZA 3GSNA 4LDEB 3RUGB 4Z77B 3LHPL 2X1OA 4U6VH 1FBIH 2D0GA 3O6FB 5F7MC 3RIFK 1PZUB 4NQDD 1NSNH 1VKXA 3RWFA 5F7DA 1GOGA 1OT2A 4Y19B 3MBED 3DUSB 1MCDA 1K4DA 3K8LA 4Z7OE 2OTWA 4XNQA 3UO1L 2GJJA 3CX5J 2PUQT 1YJDC 1LDPL 3PV6B 1BPVA 4IRZL 3D3VD 3ALXA 4PB0L 1SYVB 4ODHH 2H6PA 2CDGB 2WUCH 2E7LC 4MCZA 4JPIB 2FD6L 2ZPKH 3HUJA 1DQJB 4H1LA 5SX4H 1DUZB 5DLMH 1A1NA 3MLVL 4L9LB 3VJ6B 3ZSSA 3MLTA 3UZEA 5AZEH 4FQIH 3MACH 1WBZA 3U0WL 3V0AC 8CGTA 1XZ0B 2EZ0D 4HKBA 3QHFH 1NFDF 2FX9L 4WWID 5EIIA 4L1HA 4MAYB 2VR9A 3QFDB 2R2HA 3HMWH 3QEUB 3WXVH 5HTSA 3V0VA 4ZFZB 1T1XB 4KWUA 3DYPA 4FQHB 3BKYH 3WHXB 5KSUB 4MZ3A 4JRXE 2BP3A 2N4IA 5HVGB 4JG0H 1DEEB 5J1AA 1T5WB 2C4XA 4P9MH 2PXYB 1Q9WB 5E95B 5DHVH 4HKZA 1NUNB 4QWWD 1DSFH 3N9GL 4R0LB 2JCCF 5EC1A 2V7HB 5FKPA 4JY6A 4XCEA 2CUMA 1YN7B 3SCMA 3FT2B 5I8EA 1BFOB 3PWUB 1T21A 3FQXA 4JRXB 4M1CC 4MQTB 1QZ1A 2QBWA 4GRLD 1D5BA 3U48A 3ZZ1A 4R97C 2OJZH 4PRID 4FQPA 4CNIA 4ZMAT 4EBQL 3ZDZF 5SX5H 2EYRA 5D2LA 1A4JA 2XWTA 1UA6H 4BFIB 3ZMRA 1PQZA 2DQIH 1ETZA 4LEOA 3IDMA 1WEJH 1JZ7A 2YMXL 4JY4A 4YXKL 5ITFA 3WYRA 3FQNA 2EE6A 2F54A 2PW2A 3VXOB 3GSWA 4FFYL 1M7IB 5EBWB 4MVBC 1OAYH 1XF4A 1C16A 4P5MA 4XBPA 1CLYH 1MHPH 1T2JA 1XGPB 5D1XD 1BQUA 1NC4D 2VZSA 3MRPB 4FP8L 3C5JB 5INDA 2AK1L 3AB0C 4HH8A 2HFFA 4N8VB 2LU4A 1I85A 4WFED 3PWPD 1SQ2N 5GSVA 3MLUH 5DJXA 3OXSA 1AQDA 5CMAB 1E6OH 1MWAA 4PJ7B 3MCKA 3HAEB 4JFZH 2GQHA 3BIAX 5DS8A 1CQKA 2AJVH 4DN4H 2X70B 4KHTL 3KYMA 4YO0B 5GISH 3PE9A 2CLZB 5IJKC 5CILH 4TNVF 2FO1A 3A0OA 2C9AA 4LSTL 3NFSL 3NCCB 5L2KE 4NOFA 3G9VA 5CJQL 4JPWL 1SBBA 5IT2H 2JELL 4UT7H 3ULVL 1PBYA 1OHQA 2CO6B 2X4PB 3OAZK 4NN6B 5DRXB 3ULUH 3PGCB 1JYVA 2C4FT 1T04B 4WHCA 1EIBA 4HAGA 1TNNA 5IVOA 3SN6N 5FKAB 5L2KB 5HDBE 4YH6A 4XNUL 1F8TH 5D1ZA 1YMMA 2QQQA 1YPZA 2WANA 1J9CT 2DB8A 3AAZB 4H88L 4RMVA 5GZOC 1TETH 2PYEE 3HNVL 3UBXI 4G7YH 5C9JA 1EZVX 2YPKA 3P2TA 4MDJB 3GJFH 4WI4A 2DYPB 5F7LB 2MWCA 4YHMH 1JGLH 2CDFB 2R29H 2IH1A 3CFJA 4FQLH 3B2VH 1FE8L 4U0RC 2BCKA 2PYEB 3UDWC 4D3CH 4JDVB 4KROC 1QKZH 5J6GB 1PG7H 4WV1C 4EDWL 3LKOB 5KSAB 5KSBF 4ZFOB 4Z7WB 5IMLA 4D9LL 4A2LA 4KKBD 3HCVA 5C0NC 3LD8B 2CKBA 2Z31A 3RWHA 1YNLH 2VSDA 5JHLH 1GGIL 3MLSH 5I0ZA 2D0HA 1ZAGA 3C6LC 4L8CB 3MR9B 1KLUA 1MIEL 1WICA 5I1IL 1D6VH 1C08B 3Q6FB 3EOTL 2Z91B 5F88A 1CTNA 1BECA 1G9MH 1UEMA 2RB8A 5EZOL 3J8F7 3MFFB 3EKCA 5IQ7H 5EZIH 4R2GD 1FVDA 3U0PA 2NY1B 5D7IF 3QXTA 5GRJL 4XP1L 4O9HH 2J7LA 1MFBH 1XAUA 5D2NA 5GQBA 3KWWA 5KVGH 4G5ZL 5FF6A 4RMUA 4JQVA 3O81A 4MQSB 3NH7H 3PDOB 1YDPA 1T5XA 3KPTA 3MRFA 4HK0B 4MCYB 3GHEL 4OV5A 2P8LA 2BVPB 2AEWA 2YUXA 3LN4B 4FXGA 1CE6A 1AP2B 5BS0A 1IQWL 2WBWB 4BFEA 4JFOA 2XA8L 3H3PH 2NY2B 4KQ3H 1HWGB 2HN7A 4H26B 4LVOB 5B39G 4AL8H 4CGTA 2CO7B 3WFEH 5E8NB 1WZ1H 2HG5A 4QXUL 1HYSD 5FHBH 2IQAB 1W72A 5B3JE 5B8CA 4Y4KA 2LU7A 2CSPA 3RZCB 5LAXA 3KDMB 5J12B 5J3HD 4YHKL 3D2UA 1RMFH 2NX5D 3WDHA 4WGVB 1J87A 1D7FA 3VWJB 3NAAH 4HS6A 2MKWA 5EO9B 5DHXB 4HT1L 2VXVH 3O8XB 4FMKA 3RL2A 5E08L 4DTGL 3ME0A 4IHOA 3UX9B 3I6GB 3SQOL 4HX1B 2RR3A 1E6JH 4X4YA 1YQVH 5C0AD 1S78D 1SJHB 4ERSH 3NABL 2XTJC 2COQA 1XF2B 4MS8C 4PJHF 1AO7E 1MUJB 4QGTA 4X4ZA 3LSOB 3C2SA 3UBXA 4JO4H 5C09E 4P9HC 3K8KA 1G7LA 2CLVB 3IKCA 3BDYH 3CDCA 4PJGE 3UTQB 3BE1H 4XPGH 1CICC 3BP7A 3BKJL 3K4DA 4ONOA 4JO2L 5IBTH 1Q9OB 2NLJB 1UXWB 4LSDA 5BMFH 5C09B 4PRPE 2CGRH 1BVLA 3RWJA 4FQXA 4I48A 1A7OL 1KXQE 1FG2B 1TJIL 4PJGB 4NO2B 3ZE1E 3VD7A 3PXJA 1WZMA 5EU3B 4NJ9L 1FSKC 3BT2L 4OQTL 1RD6A 4M6AA 5CBAA 1QYGH 2VH5L 2VZUA 4FS0A 4KTEH 1BJ8A 2OJEA 2GJZB 4GLRH 4KJQC 2Y5EA 4M3JA 5KVFL 3MBXH 3SPVB 3A6BH 4PRPB 5FO8B 1JPTH 2DQFB 4LHUB 1I3GL 3IDIB 3QQ3B 1CFVL 3B83A 4WHTA 1J1XL 3LQAL 3UEZA 3I6LE 4PJ8D 4AEHL 4OCRL 4G8IB 5CP7A 4HCRH 3RVXC 3EYUL 1A9EA 4XPTL 3T0BA 4LF3A 1A7RL 4UTAL 2W38A 1FLTX 1D9KD 1FNGA 4PV9A 5TDOB 5IF0A 1FNHA 4NT6B 5L88L 1F6LL 1RZKC 2OTUB 4IOIB 1DL7L 1ZVHA 3KNBA 2EDXA 5E1HB 1DZBA 3GIVA 3T3PE 1D5ZA 4ODWB 2G60H 4ZUSB 2WP3O 4NCC2 4JGUA 3HNSL 4WUUD 1GAFH 4YHIB 5FYLH 3C60A 4XAWH 4QTIH 4NN7C 3HI6H 3LKPA 3FL7A 1MAJA 2HTLC 1UACL 3P3YA 1V7ML 2ZG1A 5HHQB 1ZHNA 4XP4L 3M1BB 3SDXE 3PNWA 4LCUB 2HRPH 4JDZB 3KYNB 5D96C 5DD0H 3BGMB 5EOQH 4JFFA 4M6ML 4QXTA 3L5JA 3LHPH 4CN6A 4LKCA 3NIGF 3SDXB 3QIUD 3CUPA 5I74C 5IFJB 5AUMA 1NAKL 2KKQA 3G08B 5CJ5A 3JBG7 2W60B 3EYVB 1TJHL 3RNKB 1AHWA 2J4WL 3L7FA 1KTLA 4TTDD 3HE6C 5HDQL 1N26A 3QQ4A 1UZ8B 3S35X 3W2DL 3TCLB 3UO1H 1LEGA 2D4DA 1JYNA 1OWWA 3H3KA 5E5MA 5C2BL 1LDPH 4IRZH 5IB2A 4DK6A 4PB0H 3O11A 5GS1B 4BSWB 4XCCL 4Z78B 4LHQB 2FD6H 1N5YL 4L4JA 1LEIB 4PLJC 3IB4A 5DJ0B 4X4XB 2IAND 3MLVH 3VFGL 2ORBL 3VFVA 3MA7A 4PTUA 5L6YL 1OGTA 2NY4C 4XHJC 2ZSWA 3U0WH 4P4KC 1NBVL 5DD3L 2WP3T 3KLAB 4Z6AT 2FX9H 1AKJD 1BOGA 2BNRA 1FNAA 3BP4B 3WUZA 1BIIA 3SE3A 4ELMB 4LCYA 5JPMA 5E8DL 3AS1A 3H42L 4N1EA 5HYJB 3STLB 1KJ2L 5EO1B 1RVFL 3HRZB 4YBLC 3N9GH 4IRSC 4G6KH 4Y2DB 1U3HD 4LGRB 1KFAL 4S1DD 1ZGLB 5D93C 1IGJB 1HSAB 1JHTA 3QWRA 5DZNA 3Q5YA 5JIHA 4PBXA 4AT6A 1QSFE 1XGQB 3WFBL 3QXDA 2BHYA 4JFHD 2H45A 4EBQH 2G9HA 5HPMA 4OAWB 4XMPL 4OB5L 1OP5K 2BVQA 4AQ1B 3QPQD 2NR6D 4F3FB 3AREA 4J4PC 4GG8A 1C7TA 3KPOB 2VERN 3WLWC 3Q0HA 2V2XA 2YMXH 4P2RE 4YXKH 1XF5B 3BN3B 2SEBB 1WBXB 1K6QL 1XGRB 4NQED 1FFQA 1KB9J 1XCQB 4PGCB 3HAEH 1FFOB 4WTWA 3HC3L 1U91A 4EEEA 4FFYH 1RZJC 3EOBA 5I8OL 4JM2B 4F9LA 4MMZC 3ZL4L 2NW2B 1N64L 4NNYA 5CCKL 2I9TB 3GSRA 4P2RB 4FP8H 5SWSA 4IIQA 2AK1H 1U8IA 3TNNA 1KCVL 1D5XB 2EEBA 3BP6B 1QPPA 4CBPA 1H3PL 3ARBC 1CG9B 5C08E 3SEPA 4QLRA 3C6SB 5BW7C 3RTQB 5JW4Q 5FM8A 4IMKA 4KHTH 1S7TA 3T4YA 1MAKA 4W70A 3NBNA 3B9KC 1S8DB 3EJYC 1HEZB 3NFNA 4HWBL 4LSTH 3NFSH 3FTGA 3IFPA 5C08B 1MI5E 4WWKA 5CIPH 5CJQH 2ZOLB 4JPWH 1NAMA 2JELH 4K8RL 3ULVH 3OV6A 3VA6A 3F12B 2EDKA 2APBA 5J0BA 3UROR 3QIWC 5IBUG 3GO1H 3VXUB 2IADB 4N5EC 4IJ3B 4DN3L 1MHEB 5HXMA 4K3EL 2A73B 4B7LA 4XNUH 3MOAL 1ROWA 2NY5L 4LRIC 2HFTA 2RFXB 3U9UA 2ATPB 1CD1B 4H88H 4GAJL 5JHDA 3PQYD 3CXDL 5I19L 1UM6L 3HNVH 2YPLB 3Q48A 5JUEL 4Z5RA 1JFQL 4XXCC 4LLYA 5EU6A 3VI4E 5J06A 1H3GA 1ZHLA 2B4CL 3QDME 4WVRA 2OQJA 4S1QL 3WN5C 4U1HA 1LO4L 1FE8H 4D8PA 1WFOA 2VDRL 5HGDB 4LLVA 5ICZB 2Q1EA 1V3KA 4EDWH 3PWJB 4U3HA 3EDKA 4XPBL 5JIKA 5TGBB 4ZUTA 3NACL 2O5XL 3QDMB 2ZSVB 1NUFA 3IVKB 2WW8A 1RUKL 4M1CD 1CGVA 1GGIH 2FBOJ 1VCAA 4NBXB 3VRLE 3BWUC 1KB5A 4F7CA 1N2RA 5I1IH 3EOTH 4K94C 1DQLL 5DR5L 2F5BL 4YGAB 3W9EB 3O45A 3GSNL 5EZOH 1JPST 3KPQA 2H2SC 1WCQA 3CFBA 3SO3B 4WHYH 4WGWB 4F7TA 4M1DL 3RGHA 5E6YA 3B3IB 3F7QA 4NN5C 4H20L 4HLJA 1MCWW 3F5WA 3MRQB 1UM5L 1H3UA 3IDUA 1LD9A 3W0WA 4P2QD 5HI3C 3AY4A 3QAZC 5GGSB 2XY1A 1FYTA 4KAQL 3W11C 4MVBD 3V5DA 5C70A 5GRJH 4XP1H 5BRZE 1QVOA 5T1MA 3K1DA 1Z5LA 3Q5OA 2DLIA 1LP9E 5HHOD 2CJUL 2WLYA 4G5ZH 1JGEB 5EBLB 1PYWB 3MRIB 4N8VG 3EGSB 4W68A 3RWFB 3EO0B 4XZUB 4PJCB 5IVXA 4F37F 4JJ5A 4XI5C 3GHEH 5F7DB 5GRVK 3EOYG 2APXA 2DQGL 5GHWL 2EIZB 2VXTL 4FOMA 3NCYS 1LP9B 2BNQD 5T3XE 5CEYA 1K4DB 1J8HD 1IQWH 4GJTB 5EFIB 1CI5A 3DO7B 1M6OA 4XNQB 2X4NA 3QUYA 3HC0A 5DRNB 5EN2A 2XA8H 3NTCL 3WLBB 4M7LL 1ZV5A 2H32A 3H9SA 2H6PB 2VLKB 5C0JA 1EAJA 4PJ5D 3H2WA 4WRLA 4QXUH 4HV8A 5DEGB 5LQBL 4YXHL 3X14A 2Z9TA 2MQCA 1L9MA 2IQ9L 2PTUA 12E8L 2GT9A 1A1NB 1IGCL 4P5KB 2E6PA 4EUPH 5C0GB 1U8NA 3TJHC 3U4BL 2EO9A 4YHKH 1NJ9A 5CWSB 4RGND 5IVZB 4XNZB 3N1QC 2ITDA 4OZHA 4XB7A 5I1DA 1RZ8B 4LLMA 2R2HB 4NCDA 4HT1H 1TJGL 4TPRL 1JCKA 5GZOD 5E08H 4DTGH 1S9KC 1GSMA 1JTPA 2VAAA 5FECB 3SQOH 2F8VA 5MEND 4ZS6C 1ZHKB 3D85D 1EFQA 4M9OA 5J1AB 4ALAL 3JXAA 3NABH 3ULUF 3EYOB 5LVEA 5D7JA 1U58B 4N0FB 5FKPB 1Q38A 1LK2A 1F3DH 1YECL 3GSUA 3OTTA 4KROD 3DGGA 3IDYC 5GJTL 3UTZA 5FHAL 2UWEF 2FJFA 5HI4C 1INEL 1JK8A 1UG9A 3O2VL 1QHPA 3DURB 3W5MA 3EBAA 4N90D 3BKJH 4GXUN 5C0ND 3I02A 2CKNA 1JGDB 4JO2H 2H26A 4R4BA 5D2LB 2XTLA 5DMIL 3BD3A 4XAKE 3C6LD 1EEZA 2QLVB 3U9PL 2XWTB 5DJZA 3I3DA 2WZPD 4OD1L 2LU3A 1PDKA 1A7OH 2BVOA 1BX2A 3T0AA 1TJIH 4LEOB 4O2FB 4NJ9H 5JOFA 3BT2H 2J8UF 4OQTH 4EQ3A 2VH5H 2V2TB 3RL1A 1AXSB 1MWAL 5KVFH 3MROA 3VXMD 5CZVL 4MD0A 5EIVA 2EIEA 3IKKA 2Y4SA 5CGMA 5EH1A 5HGHB 1GRWA 1I3GH 4P5MB 1CFVH 3BQUA 3NCBB 5DF0A 4XBPB 3WO4C 1CFQA 1J1XH 3H6JA 3LQAH 5KVEL 2X2YA 4HKJA 4AEHH 4OCRH 2I9LA 3EYUH 3P4NB 4XPTH 1CCZA 2P4AB 1A7RH 4B41A 4UTAH 1JNHB 3SDAA 3QWOB 5DJXB 5HDOA 1UZ6F 5F1NB 5BOZG 4JZNB 5L88H 3QUZA 3MCKB 2A9ML 2EDBA 1DL7H 3DXAA 1AFVL 4J3XA 2B1HL 4DEPC 1NFIA 4PV8B 3U2SA 5HI5C 1GGUA 3BO8B 2VLRE 4TULL 3HNSH 3QO1B 2V2WB 3K2UL 4JZJA 2P5WA 1CD8A 1I1AB 1YEDB 4L3EA 1PEZA 2YUZA 5F7KC 3T65B 1QD0A 5EC2A 1UACH 1V7MH 4WY7L 3ULUC 3QUXA 5E6IC 5E8PA 3RBGA 4F2MA 3T0EE 2VLRB 3I6KA 1R3IL 2LVEA 2FEEI 4M6MH 3MV7D 1P4IL 3ZE0E 2IH3A 4NQVA 2QADC 1ZE3C 3L3JB 4O58L 3G5VA 4P3WA 3T0EB 3KS0J 1NAKH 2PNDA 3WMSA 4QEGA 2AW2A 3BPLC 1J0YA 4QRQA 2VMFA 1TJHH 4JFPB 4BQ8A 3CFDA 2J4WH 1WWCA 2WAHA 5I2IB 3OWEA 5HDQH 4YR6A 5JORB 3L3IA 3W2DH 1I7UA 1TPXB 4UV4L 2BCKB 4EUPG 1OQXA 4KVNL 3QUMA 1OPGL 2AKRA 2XTJD 4NUGL 4N68A 4MS8D 3CVHA 4XCCH 4JFQB 5D71L 3ZE2F 2ARJB 1N5YH 2EDFA 1AH1A 1ADQA 3HCVB 2FJHA 5F8RC 4PJIF 4LRNL 1RI8A 1MLCA 3KLHC 2MTPA 3O9WC 2GK0B 3VFGH 2ORBH 5MEQB 1QACA 5L6YH 4IS6B 3VI3E 1CICD 2NY6C 4LU5L 1NBVH 5DD3H 5I76B 5L8LB 4QRRA 1G9MC 2YD6A 4BZ1L 4KMQA 4BKLA 3FAXA 3VRIA 3FFDB 1NFDA 3OKEA 4NHCL 4RMTA 1Q9KB 2APFA 2VOTA 2BRQA 1NDGB 5E8DH 3BWAB 3H42H 2ICEB 2BDNL 3DIFA 5FO9B 1KJ2H 3VFNB 2NTFB 4KJQD 1BBDL 2XPGB 1TZIA 2F53E 1E4XL 1N8ZA 1RVFH 3FHAA 3UTTA 5IB4B 1KFAH 4MXVE 2JCCA 4KI1A 4U1GC 1EHXA 1FNEA 5CLWA 3VWKA 2A74B 1S5HB 3QXUA 4XBEL 4K7PX 3RVXD 4NO0D 3WFBH 5BOPA 2F53B 1F13A 1WAAF 4XMPH 5F9WB 4OV5B 1SYSA 3QZWB 1MCPL 1CE6B 2UY7A 1IZKA 3SOBL 5A2IH 2WQRA 5DA4A 5DO2C 2V9QA 3TJEL 2AJUL 4OGYL 3HNTL 4WO4C 1CGXA 3WV0A 1VADB 4U1MA 1K6QH 4PJ9C 3TA3B 5EZJA 3IJSA 1DBKL 1GXEA 4HPOL 4XPFL 3HC3H 3NZ8A 2HT2C 2HG5B 3KGRA 5E1AA 5IIEB 5I8OH 3O41B 4ODTL 2HTLD 3B5TA 4APQB 3UTPE 3MNVA 4Y4KB 3ZL4H 1N64H 2PW1B 4UAOC 1CLCA 4OZFA 5CCKH 4ZPTB 1M7DA 1FVCA 3CLEL 1RAMA 8FABB 4PGBB 1KCVH 4OF0A 5HYIA 1T0PB 1H3PH 4L8SB 1I7RB 4KC3B 4OZ4A 1S9VB 5DT1L 3ZTJG 1AO7D 3VU2A 4IHOB 5DK2B 1GC1L 3MV8E 4X4YB 3ARGA 4I5BA 5E7BA 1K8DA 2WV3A 2HT3C 3HE6D 4NQXA 3RPKA 2VXUL 4NCC1 2N7BA 3FQTB 4XB8A 4ORGB 3GIZL 5DRZA 3MV8B 5I6XB 1G7LB 3HE7C 5DI8A 5DUPL 2QQLL 4DN3H 4K3EH 3QEQA 4GBXC 3BP7B 1TCRA 4PLJD 1QBMH 1RK1A 1DLHA 4CW1A 1H15B 3MOAH 2YPVL 2NY5H 1X5IA 4W4OA 3C09B 4C56D 4GAJH 4EI5A 2NY4D 1BVLB 1A6UL 3CFEA 4XHJD 4CU8A 4P4KD 5I19H 4FQXB 1UM6H 5FDWB 5JUEH 1ZSDB 3RJDA 3TVMA 1JFQH 2VJXA 5FGBC 3RGVB 1A6ZB 1AGCA 1BEYL 3I6LD 3PJSA 5E5RB 5CBAB 2B4CH 4YXLL 4G9FA 4QT5B