3VH8G

Kir3dl1 in complex with hla-b*5701
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
286
structure length
281
Chain Sequence
KPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGGTYRCFGSFRHSPYEWSDPSDPLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Killer cell immunoglobulin-like receptor 3DL1-mediated recognition of human leukocyte antigen B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
total genus 53
structure length 281
sequence length 286
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vh8G03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vh8G02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vh8G01
3VWKB 5TE7L 3ARFB 5ISZB 3IU4H 1WF5A 1FGNH 3U83A 1DSFH 1KLGA 3LRSB 3LKSB 1MIEL 1HI6B 3NCYS 5I18L 3WIFB 3DVNB 5ID1B 5JHLL 2EIEA 5C9JB 3VFUA 1CFNB 4P49A 4EUPH 5GRYA 2VZUA 3W5MA 5CEYB 3LHPH 4F37K 3STBA 5DR5L 2DTSA 3GBML 4CU7A 5J6GB 1E4WL 1TQBC 2D9CA 3VD9A 4JFDB 2AK1H 4KJQD 3P4MB 5F8QC 3C6LA 1AC6A 1FCCA 1FN4A 4G8GE 3S5LB 1AXTL 4HULB 4HCRA 4G7YH 3C5ZA 2CR6A 1MRDL 5IQ7L 1KEGL 2HLAA 1AKJB 2GKIA 3H9YA 3BZFA 4DAGH 3T0EC 4UZGA 3TC9A 3DHMA 3QJHB 5C9JA 3GO1H 2VLLB 1OAQH 1F4AA 2CO7B 4UIKH 4ENEC 2FJHA 3UYPA 4G6FB 5H37H 4NWTH 3QFJA 1XZ0A 3B9DA 2F54D 3D2UA 1N4XH 4UQ3B 4C58B 3G6DH 3P73A 4LCYB 3HR5B 3S37H 3WN5A 5F97E 4LSPL 1PEZA 1I8KB 2RBLA 3MO1B 4PJDF 2W59A 1AGCB 3VMPA 3GMQA 5KSBE 4Y5VA 4I0PC 3IETB 3VXQA 4EI6A 4JFFA 2ITCB 1ZLSL 2AABL 2HFTA 5K9KB 5DMKA 5EBLA 1MCLA 3GMQB 1JHTB 1NC2A 1A4JA 5JW5B 4CMMA 1ETZB 1E4KA 2D7TH 1IEBA 6FABH 1OT2A 1OGAA 2DWEB 3IDIB 5HGHB 3ULVF 3GKWH 4LHJB 4JM2B 4HUUA 3C60D 2LAGB 3K4ZA 2ICWA 3M8OL 3TLRA 3O9WD 4KTDL 5FB8A 4FFZL 1Y0LA 2G2RB 4QXWA 1JN6A 1KEML 1ZWIA 1KC5H 3BJ91 1EH9A 1FP5A 3UTTB 4OCXL 3T65B 1MCBA 4H1LA 5CD5C 1U95B 1I1FA 1LO0L 2NYYD 5BO1L 1EA9C 4U3HA 1ZS8B 5KSBB 4QRPE 5D2NE 2PXYC 3WDJA 4IDJH 2DD8H 1WZMA 3KXFD 2PO6A 1ZT7A 5FB8B 3RAJL 4JHZA 3AREB 3C6LD 2WQRA 1J0HA 4LLDB 5FHAL 2DOCA 3JWDC 3UZEA 5BZWB 4Y16A 2PYED 4IIQB 1UM5L 3UTZB 5DD1L 1HK6A 5DUMH 1CTNA 3L5XL 3PGCA 4YK4C 5HHNB 3AB0C 3WJJA 2B7DT 1RV6X 5IV2A 1HIMH 3GSRA 1LP9F 3VWJB 1CS6A 4PJEF 2DYPD 1CGXA 4UT6H 4KMTL 3QIBA 4FQLL 3BHBA 3WDIA 4MS8D 1KPVA 3D39A 5C0BE 4JN2A 1MFAH 3OKOB 4KVCH 4JZOA 3VMOA 2R9HC 5JW3H 1A02N 4HLZG 1RHHA 2PW2B 3ARGB 1AY1L 5KSAA 3IF1B 4X8JA 1LK2A 5EFIA 3VFSA 4W70A 3QEUA 3ARRA 4NKDB 5F9AC 2G60L 1Y0LB 2X09A 4QXGL 4F7TB 1S7TB 3MSPA 3KPQB 3RHWF 4R4NC 4RRPG 5IB5B 1A1OA 3L7FA 3WKML 4HEME 1J0ZA 5HGHA 1HKLL 2MPAL 1MJUL 4CNIA 3SQOL 5C6PB 1NEZA 4AL8H 3S4SB 3SE8L 1YYLH 1E4XL 4OLWL 2J6EL 4OKVA 4YDIH 3OKLA 2VDPH 3OR6A 3PWJA 2YUWA 4KKBD 5CHNB 1RQ5A 1PSKL 3MPCA 4LSRL 3WFEL 3RWIA 2VRAA 3ZT5A 3AUVA 2IADB 1CE1L 1NC4A 3DNKA 4NUGH 1JHLL 3F58H 5EDXA 4RGMC 4XMKL 3IFPA 3QEGH 4C83B 1FNGA 2YPVL 1H5BA 4P57A 4AENA 4EZMA 4PJGB 5ADOH 1OWWA 1UGNA 4KMQA 1SVCP 4HBCH 3TA3C 4MMZC 2ZCHH 1J8HA 3GMRB 3R1GL 4FQJL 2BVOB 1MNUH 1A6VL 3F58L 4ORGB 1EGJH 5CHNA 2VL4A 1P7QA 2R2EA 1ZTXH 5IJVA 3LMJH 1JF1B 5GGUB 4KZDL 1V3MA 2OTUA 3HE6D 1RZJL 3FONB 1OTUD 4QT5A 4MQSB 3MUHL 3CFEB 3TBTB 3EYUH 5JOFB 3CX5J 3JWDH 5DD6A 5GGTA 2ATPA 2F8XC 5A16A 4HJGB 2WUBH 3EYVA 1KFAL 1BLNA 5DHXB 1EBAA 1R24B 5D72L 4O2EB 1FLTX 4P9HL 4R97B 1Y6MR 1TVHA 3DV4B 3EUUA 5EUKB 3VXMA 3I3DA 2BVOA 5IF0A 1WTGT 2OXHA 5DRNB 4MNGE 1CG9B 3IRPX 1IC7L 3K8LA 1EO7A 3BMWA 4NKMA 1YEIL 1FLRL 5DRXB 4JG0H 2WUBL 4JZNB 5IROA 1UVQA 1VPOH 3C5ZD 4YQXL 3F7QA 3UBXI 3R4DA 2F53B 8CGTA 4GMSL 5E7FA 1CGSH 2W65A 4NQTA 4MXWL 5EZOH 5F8RC 3I6GB 1IKNA 1NGZB 1IAMA 2AXJA 3EDFA 4IRSC 4LRIA 1DLHB 1UWGL 4BH7B 1FORL 5H35A 3JV6B 1OAYL 1A22B 1FYTB 1DDHA 1AXIB 5GJTL 5DVMA 4D0DA 3MBXL 3PL6A 4JQVA 5GISL 2R0WL 1PX4A 4S1QL 3GSOB 1T0MB 2J1KA 1K2DB 4LLAA 2JF1A 5FYJU 5JXED 4H8WH 4A6YH 2EDWA 2EDNA 4K8RD 2WWMD 4L29B 4F8QA 1ZA3B 2Y07L 4KTEL 5AAWA 2RB8A 1KPRB 4F3FB 4IHOA 1MLCA 5IT2L 5GJTH 1ZLSH 3ROOB 2H45A 5FYKE 3TA3B 4JO4L 1I85C 4U6YB 4MDJA 1A6WH 1MPAL 1T1WB 4JO1H 1RJYB 1GL4B 1K8IA 1KBGH 3WNLA 4L4VE 1F6AB 2NR6C 5IBLC 2A77L 4DEPC 4OCNC 3P73B 3TBTA 2VDNH 4MJIA 4J6RL 1KEMH 1T7YA 3MRRA 3D1MC 1T7VA 4NDMB 1LILA 1S7RA 1DBBH 5EC1B 4DAGL 5C08E 1DVFA 5FYJD 2MCG1 3H9ZA 4U6YA 4QHMA 3I02A 3Q3GA 2QHRL 1DQDL 4PY7A 3RHWK 1QFWM 3EJYD 4IS6A 3QUKA 5BW7A 3O6KL 2P5EB 3OZ9H 1I1YA 5GS1A 5IHZB 5FV1L 3B8YA 2QQKL 2HH0H 5C09E 1FAIL 25C8L 2F8OA 3VFTA 1A6AB 3TA3D 1AR1D 1L4IA 4AK1A 1G7LB 3HTLX 3ZKMC 5JDSA 3O6ML 5JDJA 4YFEA 3RWDB 4D0CB 4NZRH 1ZHBA 3OZ9L 1MHHA 1NGQH 1A0QL 3VFUB 3L5XH 5I1CL 3GB7B 1YMMD 1C8PA 4Y4HC 5D6DA 4ODWB 1ES0A 4KU1A 2JELH 4N68A 1B4RA 2EXYC 5ILTL 4NQCD 1IFHH 1C5DA 2MQCA 3E6HA 4XZUB 1G7MA 2R0KL 7CGTA 5C08B 1AQKL 4MCZA 1EEZA 3I3BA 3P11L 4Q9CA 1ZEAL 2EDRA 4U1LA 2O61A 3FZUD 1T1ZB 2ZOKB 2AW2A 4HS3B 4YNYB 4LCCA 3SKMA 4YHIB 1Q9KB 2YRZA 5C0AE 1BFVH 3FTGA 4IOIA 1KC5L 4K23H 1II4E 4F9PC 3PP4L 2ITCA 3LQAL 2ED7A 4GBXC 4OZGB 1NAKH 3VXRD 4I1NB 3L9RB 5EU5B 3W9DB 1YEFH 2ZJSL 3SQOH 5HVWA 5J9PA 1I1AD 2Z93B 4M7LH 5CGMA 3UPRB 5FXCH 1UH2A 4NHCH 3HR6A 1BF2A 4MAYA 3X13B 3FQNB 5I74B 1AQDA 2VLMD 2AEQL 2R23A 3OKMA 3DXAD 4PJHF 4V1DE 4KGJA 3SDDB 2CK0L 1NANH 4WWKD 1G7IB 4PP1C 1MCHA 2EDEA 5FYKL 1FJ1A 5HI3C 3SE9H 1TCMA 3WIIH 5HHVL 1TZIA 1I85A 1X5GA 1N5YH 3FB5B 4K7PH 3JUYA 3NABH 5EIVA 4I77L 1PX3A 5DUML 2D0GA 2LU7A 1CGWA 2BVTA 3MCKA 4RFOH 5F96H 4PJGF 1NSNH 4MNQD 2QADC 5K9KA 4HWBA 5D5MB 5DJ8A 3R0NA 2GFBB 2UWEB 4HUWB 5FGBC 5IR1A 2PXYA 3P30H 4WFED 2NQCA 5HHMD 4CL7A 2IG2L 1JGDB 4I5BA 4AH2A 3O4OC 2VQ1B 4IRJB 2R1WA 3GJFA 4K71C 1I3RA 3T77A 5GHWH 5CUSH 4LF3B 4RFEB 2GJ6A 4L3CA 1N59B 1RVFL 1ZVHA 2R15A 3P4NA 4Y4KB 1F13A 2ZNXA 3I2CH 3JV5A 2P4AB 4ZAKD 5FO7B 1SMAA 2W0PA 3EFFA 4K8RL 4OFDA 5EU4A 1X5FA 1CICA 2GITA 1BM3L 1A6TB 4ZSOE 4LSUH 3RA7L 3MV8B 3D39D 4GRMA 4GRWF 5IVXA 5EO0B 5L0QB 4XRCB 3TH2T 1NFDA 4MNQA 3TO4B 1JGDA 3DIFA 4IOIB 2E9WA 3F12B 2K9UA 5HYJE 2AJXH 5H94A 4HPYH 4EDWH 4G9FD 5FGBA 2FGZA 5CSGA 1LO2L 4NO3B 5CZXC 5CJOL 4BH8B 1MREH 5KS9A 4RQQB 4B5EA 3JVGC 1SVZA 4NM8L 3C5SA 3QNXB 5EWIH 4XP6L 3OGCA 4O00A 4WEBL 4BELD 1A7NH 2OM5A 4M7ZB 5F89B 3FQTA 3MRRB 3QCUH 1MQKL 2AJXL 4H88L 4GXUN 2NXZC 4WFFE 4P2RE 4XRCA 2ZZUT 3PWPA 4HFWB 5E9DE 2Q8AH 4U33A 1KIRA 4Y5XB 1BIHA 1Z0MA 2FSEB 2W60A 1WWBX 4WUUE 5L2KE 3ZKQD 3UTSE 5F3BB 4U3XA 3UMTA 1R6VA 4PJAE 2PYEB 1A7QH 2Y07H 5K59E 4WNQB 3DX7A 1NAML 5E8PA 1WITA 3RY6A 1Z9MA 3VG9B 3C6LB 2EYTA 5F7EH 2D4FA 2X2YA 1EJOL 1I8IA 3ALWA 1GOFA 1GJIA 1NQBA 2QSTA 1KFAH 5T1LA 5DEZA 1I7TA 5D2NA 4S1RL 4BFEA 5HGBA 4TSBH 4JFPA 3MZTA 5I19H 3UTSB 5IEKB 3O3EA 2YN5A 3TBYB 1D5ZB 3TZVD 5HTSA 1S7XA 1T83A 3PF2A 4ERSH 1K3ZA 3QQ3A 4N9OB 2VOTA 4IMLB 1TTUA 3ARBD 3KJ6H 1HN1A 1AO7E 1F42A 4KDVA 3RVUC 5ICZB 1X7QB 2F19L 3RUGF 5L9DH 3CUPB 5C09A 4X9IA 3QZWA 4NJAH 3RWFB 4OFVA 4PREB 3CZFB 4C54A 3MACH 1TJHL 4WI3A 1FHGA 3QULA 4R0LC 1HOCA 5EU6B 3FN3A 3BZEA 2W9DL 5E0QA 3VFSB 4MJ6A 4NC1E 4P4KC 2A38A 4X9BA 2BVEA 3AY4C 4KKAD 1C5BL 1J05A 3MV7E 4Z0XB 5CZVL 3TV3H 1N3NB 2AGJL 5ANMA 5GZND 3LCYA 1F11A 3ECBA 4PJ8D 3MLUL 4ZG1A 3G6JE 4FXGB 4M43L 4O02H 1C12A 3BSZH 2GW5A 3BEVA 4L8BA 4P0DA 3QUZA 3DBXB 5E9DA 3VRJA 1NFDE 3FAXA 3BXNB 3ARDD 3RUGB 3U30B 4PJDA 1T3FB 4KRMB 1NKRA 4NQDA 2Z31A 1FFPA 4F9LC 3WIHH 5IT2H 3O2VL 3EDDA 3TV3L 3UYOD 3VFVB 5F7NC 4EDXB 4FFWD 5IBUB 3NACL 2C26A 4NNXA 3RIAF 5I1KH 3P0YH 2FL5A 3ARYA 4G6FD 4ZO8A 5ITBL 3T4AA 5JW4Q 3RUGE 3V4VH 3WIHL 2DQHL 1T1YB 2BNQB 3O4LA 3RDTB 1GSMA 4QWWC 2Z8SA 5MI0C 1T04B 5LBSL 3QRGH 2FJFA 3HNTH 5D7JB 2H32A 3GSUB 1TJIH 4LLYB 4LCUA 1FV1B 3TYFA 1CLOL 4C4KT 1ACYH 1MY7A 1IBGH 1UB6A 1U8IB 5ESVB 3RGVC 1TFHA 3QZWB 5HVHB 2G9HA 1RZFL 3RWEA 4RMWA 1Z5LB 5LBSH 1R3JB 1RZ7L 2FEDC 1FZJB 4JRXB 3ARDB 3CLFL 2HLAB 1FYTA 4ZMAT 2VH5L 2AK4D 3GZKA 1FG9C 5E8NA 1CBVL 2GYSA 4PJ8B 3V7AE 3PWPD 1G6RH 1FO0A 4LCUB 2YD4A 5CJQH 2AEPL 1CU4L 2VUYA 1W0VA 3HPLA 4NKIL 5GGVH 1B2WL 4GKOA 3PP3K 1BFOA 5DC0A 4RAHA 4QHKI 4WHTA 5IB1A 4RMRA 4NJ9H 2DM7A 4RWHA 4KAQL 4QTHB 2VH5H 4KRNA 2DLFL 5IIEB 3I6KA 2FBOJ 5L2KD 4Y1AD 5IB1B 4BKLA 4DGIL 1IGJA 1F3DH 4YHKL 5CEXA 4H8WC 1ZEAH 5JHDB 3T08A 3V52H 5FGSA 3B3IA 1QQDA 4U1JB 1JUFB 2Y23A 5GGVY 1D5XB 1BQHA 2YSSA 2E7MA 4EDXA 2VDRH 1KTLB 2IF7A 3EHBD 1Z3GL 2FB4H 5HI4C 5GIRA 2AJ3A 2BY0A 4NKQB 3VGGA 4NZUH 2DQUH 3E0GA 3OX8A 4GS7C 2GTWA 2BCKB 3P0VH 3MCLH 3SCMB 3V4UL 1QG3A 1CGUA 3U9UA 1ORSA 4PJ7F 4N8VB 3CSBA 4NSKA 1UB6B 3TPUB 1ED3A 3FJTA 1TITA 3LS4H 4GKZA 2YBRB 3OAZH 2Y06L 4UU9B 5H2BA 4EDWL 2AJUL 1NCWL 4LLYA 4OCSL 5BVPL 2CK0H 4ACPA 2Z31C 2KQMA 2DKUA 4P57B 1AH1A 4ONFH 4GJTB 2R2BB 2XTJE 5EWIL 3NA4A 3BRGC 4DUWA 3P9WB 3DO3A 3KPLA 4NFBA 5H8DA 1NC4B 1BVKB 1YEKH 4G42B 1YJDH 1P9MA 2PR4L 2IGFH 1VACB 3UDWC 5E2JA 4Y4KA 1ZXQA 3W11D 3MXWH 4LVEA 3EYFB 1E6JH 4JEGB 3VFPB 2I9TA 2VLJA 5TDPA 3M1BA 4WENB 1VEOA 2CDGA 3ZE2F 3ES6B 4WWKA 4X7TA 3WL9B 3R8BB 3AAZA 2YUXA 1TCRB 4TTGA 2FHBA 4LLMA 1FIGL 1RULH 5D1XA 1EVUA 5JMRA 3QXDA 5I71C 2JK5A 4XP4H 3GSRB 5SX4H 3ZYOA 2KZWA 3QUMA 1M7DA 1OAKH 3IETA 3UJTH 2CLZB 4K3GA 5AD0B 5F1NB 2A6KA 4R8WH 4RNRB 4TOYH 4DFHA 3K81A 5T3ZL 5D1QB 2F74A 4CADA 1HHHB 4V1DB 3U46B 4BSWB 4K7PX 2FEDD 2Q3AA 4U7SA 5F6HI 4HKXB 4GG6A 3TNNA 3NAAH 4XP1L 1I9RL 2CUIA 4Y4KD 1AO7B 1OAKL 3BEWB 1J88A 4PGCB 1MRFL 3BUYB 3FQNA 4QNPE 4N8VA 3HB3D 4U1SB 1T21B 5D96C 4L4TD 1NGYB 4YUEL 2L0DA 4RIRA 4DVBA 2YPKA 2MFNA 2Z8RA 3TWCH 2HJKB 2YD5A 4KI5F 4J3OC 4PG2A 3KYKL 2CMRL 3DETD 4M8QB 5FO8A 3L3DB 3QPQD 1N6VA 5HHXH 3HG1A 3FN9A 5KOVC 3M17B 4E0RB 1FL3B 4K3EH 3U0TB 4DFIA 3HZMA 5DURB 4F7PA 2CR3A 4GQPH 3BP5B 3MREB 4XPFL 3SDAA 1M05B 4UT9H 5DA0B 3X12A 4ZQKB 3O3DB 1BGXL 2E3VA 5HDLA 5JIIA 5E6IA 3O81A 4M6ML 3SDXE 4I0PB 4ZUUB 4M1DH 1P9MC 4APQD 4H0GA 5HDBF 1JRHH 3DX8A 5EULV 2APBA 5B8CA 4TUKH 2X70B 4HXAL 4NZDA 4ZTOH 4YPGA 1MLBB 1S5HB 4WFGE 3CK0L 5T3XD 1F4HA 3WL9A 2PYFA 2VAAB 3BP7A 4JLRB 1G0XA 3JTSB 4ETQB 3QFJD 4YWGL 4TSBL 4CVZA 3CVHH 4JANB 4BFIB 1JWMB 3QHTC 3O3DA 4J23A 4OCMC 1OAXH 4NFDA 1EERB 4OCWL 1QLRA 3X3FH 2XTJC 4ZTOL 1GGUA 4TVPE 1X5AA 2X4SB 1E28A 1KCSH 1U3HD 5E2UL 1MCQA 2XNAA 3QUYA 2G5BB 5EZLA 2R8SL 1CD8A 1TJIL 2RIKA 1IJ9A 4KK6D 4Q9RH 4K9EC 5D71L 4F7EB 1AD9B 3TBWA 1I8IB 3C08L 5ESQA 4P2OC 4EN3D 4LEOA 3GSNL 1DBJL 4P2OA 1I8KA 3OMZA 3O4OB 3OKMB 5DC9B 5EORL 4Z7UA 1MHPH 4PIRF 3UYRH 5DEGA 4BFBD 3MRHA 4P46D 1IGTA 3OKLB 1FVDB 3GHEL 1QLRB 3KYNB 3RL2B 1UJ3A 2R1YA 4NQEE 4Z78B 2OL3H 5C70A 1BWMA 3O2DA 1CBVH 1MAML 1QFPA 1MCIA 3G6AA 1OCWH 4EXKA 8FABA 4PRDB 2NY0C 2LU4A 2YOCA 1Q0XL 2PN5A 1LO4H 3N9GL 4U6HA 3L3HB 3KLSA 1HHJB 2IPUG 1T7XA 5GQBA 5TJWK 1YEJH 4QO1A 2MSPA 3S35L 3ZO0A 4PRHA 1ZGLM 4O51B 3HC0B 2KZ1B 2ADGB 3THML 5LGJA 3SE4A 5GZOC 4EN3A 2I9LB 4I0PA 2Q8BH 1IGFL 5L6YL 4G6KL 5FGCB 2WWKO 4QOKA 1IAII 3FZUC 3KXFE 4U1LB 5J3HC 1GZPA 5HGDA 2O61B 2DQCH 4XNXH 2R56H 5D6CA 4Y5VB 4FQXD 2DQDH 2ZPKH 4FFVC 4WV1C 4I4WB 4L5FL 1YY8B 1NL0H 2EXYD 1CE6A 4LHQB 1KULA 5I66A 3KS0H 1BEYL 5CJXA 4P5MA 1A3LH 5D1ZB 3V5KA 1AC0A 4EVNA 3IKKA 1CIDA 2Y36H 3AU1A 4Y8AA 4ZUWB 4KKLD 1E4XI 4GSDH 4FNLL 5HHOE 1AJ7H 5MENA 1BZ9B 4HWNA 2X42A 4PRID 5LKNA 3ZKXB 2AJUH 2FX7H 2LTQC 1IM9B 3PGFH 3E3QC 4LEXL 4RGND 3QIUD 2V2WB 3BGFC 3UAJC 1VSCA 3ZTNH 5E1AA 5ESQB 1I7TB 5D2NB 1FZKA 3HS0A 4ZFOA 2BSTB 2DTMH 4DZBB 4OZIE 5EA0L 1XGYH 4XCYA 4HHAA 1VDGA 2K7PA 1TQCC 2AEPH 4MNHB 5IFAL 1GGIH 3QO0B 3FQXA 3GK8H 3L3GB 5FYLH 3KHOA 1OW0C 1IKFL 1Q9OA 1JNJA 3C8KB 3GDBA 2B1HL 3AS3A 3HRZA 5SV4A 4GUPA 1JNNH 1MHHB 3MUGB 3P9MB 5DJYB 4RGOH 5LG1A 2R0ZH 5JZ7C 1F3JB 3DURB 3I6GA 1FNLA 4HGKC 3NH7L 3B5HA 3VI4F 3HZKA 1UC6A 5T3ZH 1BQHG 1BVKA 4G42A 5F9OH 1G84A 1R5IA 1BBDH 1QBLH 3QI9A 1EMTL 2CLVA 2IADA 1HQ4A 1KJVB 3TBSB 4L3EA 5BZDB 1JZ3A 5T1MA 1L0YA 3LS4L 3T0VA 1MLCB 4TUOA 4S0SD 4O2EA 4GBXD 3LD8B 1XCTB 4QLRA 4PREA 1JWSA 3I9GH 3WXWH 5I1IH 2HRLA 3QHFH 4QXUH 4BK4A 4P23C 2DYPA 5CEZD 1T6WA 5JLZA 5MENE 1HZHL 1DTUA 4NP4L 3S36H 3GMRA 2D0HA 1WEJL 2AQ1A 5D8JH 3LN4B 4U6VH 4L1HA 2UY7A 5F72S 3SE8H 1RJZB 4JFZH 1FPTL 5IJVB 4ZXBC 1PGRB 3LB6D 2XYCA 2Q3ZA 3W11C 1DN2A 1NDMB 5CP7B 1KJ2A 4N0YL 4POUB 1KXQE 1X5HA 4K3JL 3LH2L 1FV1A 3TYFB 4I48B 3DV4A 4WI5A 1MCOH 4PB0H 1QLFA 3F7YB 4JCLA 5E56A 1J18A 1GPOH 2VXTL 1M7IB 4Y4HD 4L8DB 2IEPA 4HJGA 2ATKA 1MI5E 3LRHA 1CE1H 3V0VA 4ZUVA 2H2PD 1XGUA 2JIXD 1CLCA 1FNSH 1QSED 4LOUC 1SHMA 1FO0L 3UJTL 3ARDA 3QEGL 4JQXA 5CEZH 2F54A 1D5BA 1YN6A 5B3NA 3ARXA 1EVTC 1OGAE 4A2LA 2I25N 5J4MA 3HE6C 1FSKC 4P2QA 5DFVC 5IK3B 2XKSA 1QLFB 2CDEA 3HFML 5I1JL 2E9BA 3BVNB 4PJGA 2YMXL 3SKOA 3HZVA 3K4DA 4MZ2A 4PJAA 5I30L 3L7EB 2UZXB 5GGSY 1ZANH 4XVUD 4J3WA 2NY5H 1J8KA 5EN2B 3GGWA 4ZO9A 1R5IB 4NFCA 4ZUUA 2DM2A 3TWCL 1N3NA 5D71H 5IMMA 3RQ3A 1QPXA 1ZKAA 2CKBB 1MCSA 4W6YB 2DICA 1OB1B 3C08H 2BNRB 4K71B 1M71A 1UEMA 4PJHA 4X6CA 3ZTJH 1R5WB 2EO9A 1JGUH 2X9WA 2DYPB 5H94B 1XIWC 4X6FA 3DRQB 4X80L 1JI1A 1FNGB 4HH9A 3HNSH 5JHLH 4PS4H 4KXZI 1P4BL 1BIIB 3KVQA 1XR8A 3BZ4B 1T0PB 3ULSA 4G6JL 1Q94A 1Q9LA 2Q76A 5JZ7D 4M1DL 2R4SH 4Y88A 1HXYA 1K4DB 3CAFA 1WZKA 2A6IB 4LP5A 1KYOJ 3GMMB 1KIUA 1T89A 1S8DB 3FB8B 3OKDA 2BZDA 5IVXE 4HXAH 2O5XH 4O58L 3RI5F 1T2JA 4P4KA 4R7DA 4W6XB 4D0CA 1EHLH 3EJZD 3QUXB 4NQSA 2IH1B 2X05A 4WUKL 1LK3H 5J6HA 1LEIB 1HHGA 3B2VL 5FYKU 4GW4A 1L0XA 3RGVD 2GEEA 5BOPA 1L7TL 2VR4A 2ADIA 1H8OA 4PJFF 1T7WA 4MX7A 4XPBL 3HMXH 4FP8L 4JRWA 2VIRA 4JFDE 4PRBA 1LDPL 1YPZE 3STZB 4X6DE 4BZYA 1IGIL 1F4WH 5CCKH 3C60B 2VJXA 3DX6B 3QXTA 2C3VB 3NCBB 3T65A 1KCLA 4PJ5A 3IAPA 2WBKA 5JUEH 4ZNEE 2XWJB 2QSVA 3QXAA 1H3GA 4HS6B 5IBTH 2J12B 4WFHD 4OZ4B 1CFQA 4HD9A 2Y36L 5JQ6L 3OPZH 4F58H 1JRHI 5HVHC 4E41B 5JR1H 1KTDA 3FL7A 5JO5A 4P2QD 4OLVH 2MJWA 4RAUA 2XZAH 4LEXH 4PPTA 3D2UD 5IBTL 3VXSE 4KRPC 2Z0BA 4PGDA 3MGTA 5K9OA 4PJ5B 1E27A 2NW2A 2X4NB 4P99A 5C0BB 4ZOAA 5C07B 4NT6A 2F5AH 3TJEL 4V2CB 3TM6A 1QSEE 1MCFA 2NYYC 4QF1B 2Y4SA 3JV4B 3RWJA 4JY5H 4GG6F 4KY1H 3O6KH 1KPRA 4F3FA 1CI5A 1BJ1J 1UM5H 1A9EA 1P6FA 3DROA 1HCFX 3QPXH 3MBEB 3MJ9A 5MERB 1YPZF 2EDDA 2XN9B 1A2YB 2L7UA 3O2WL 1Q94B 1IT9L 4OCLC 5CAYB 3MLSL 5KTEH 1JZ6A 3KS0J 1FE8L 2X4PA 3MV9D 4LSTL 5CSBA 4D9LL 3BPLB 2UUDH 5EZIH 4A6YB 2K3TA 2UY6A 4XB7A 4M9PA 4NRXB 4XNXL 4YZFE 5D1XD 3RVVD 5CMAB 3KPSD 3AFLA 5C0FB 1Y18B 4P5TB 4OZFB 5T1KB 2H8PA 4AMKH 5F1KC 4PY8I 4LEOB 4LSSH 5TQ0L 3UJIH 1F2QA 2YN3A 1JPFA 2BY2A 4PJ7B 4PRPB 4MXVF 2GCYA 4DEPB 1QNZL 4XGZB 4QXGH 2PF6A 2R2BA 1YMHA 4FQIH 5MEQA 5GGTH 5C08A 4WTZG 3V6FB 4XP5H 2AS5M 5JOPE 3H3PL 3BFOA 4NN7B 35C8H 3VJ6B 3QCTL 3WS3A 2FX9H 1MAKA 4X4XA 3MRBB 4L3ED 4RIRB 5FOBB 3BMVA 1FVDA 1M7XA 1RUAL 4N0RA 3T0DA 5IHBA 2QV2A 3MYJB 3I9GL 3WXWL 3Q48A 3ZDYE 4ODXA 4WRLA 2EH8H 2AV1A 3QBTB 2DTML 2FECL 5IW1B 5J12C 1XGYL 1LVEA 5EIIB 3MRDA 1JZ2A 1INEL 4TRPH 3FT4A 2XN9D 4D3CH 1RIHH 3MXVL 1AXSB 2Z93A 5D2NC 1AKJA 3QUYC 3HUJE 4JR9L 3S8WA 4JO2H 4S0TD 3GRWA 3T77B 2VABA 5IGXL 5D7KE 2GIYA 4FTVA 2R2EB 4DCQA 4PJGE 3W0WA 4UTAL 2IAND 2IBGA 1ZT4A 4MCZB 4IM8A 1KCRL 1ITCA 4K7PL 5HPMB 3F5WA 3NH7H 3SKMB 4UV7H 2J88H 3FKUS 3F7PC 3MOBH 1UFUA 4QRTB 3BI9X 4UIMB 3E8UH 4A6YA 4XPHL 4YE4L 1J11A 1NMAH 1U58A 4UBDC 4X6EB 1HXMA 4JFYA 5HGAA 3BJLA 3FO2A 4U7MA 1MFEL 4YHNB 2DLHA 5DRWA 4RSVA 4L8CB 2BVYA 5INDA 3S7GA 1A21A 3FRPA 5FEBA 1ZWIB 1A6AA 4XPAH 4S1SL 1DBAH 2DDQH 1HI6A 5IQ9A 3AM8A 2ORBH 5I1HH 2BSRA 1WISA 2OQJB 1WBZB 1SYVA 5KSBF 2IANA 2ADIB 2DWDB 4FQCH 4FQJH 1KN2L 3IXAA 3KPSA 3E6FB 4WU7A 5C6TL 3FCTB 1CFTA 2JKXA 3V2AR 3RGVB 3N50A 4PBWD 3HLAA 3GBMH 3QUXD 4D0DB 1JGLH 3D0LA 1CICC 5EZOL 3G5XA 5GRUL 3F12A 3O8XC 1BHGA 5C0JA 1LE9B 3HLAB 1B4JH 2YPVH 4IDLA 5DGRA 4HS3A 4YNYA 5DVOA 3SEPA 3DVNA 2BFVH 3MV8A 1HYSC 4TN9A 3AXLA 3CXHK 3OJDA 2VZOA 3UC0L 1JJUA 1AGBA 3NIDE 2NY3B 3O8XD 4YX2H 3T3PE 5F7UA 4YXKH 4P23A 2MHAB 5FUZL 4JB9H 2Z8VC 2DQJL 3ARWA 2FATL 2DQFB 3BKJH 1HEZA 1JF1A 5GGUA 3WN5C 4U6XB 1WICA 1BOGB 2R69L 3WFDL 4ZS6D 1FNEB 4ZXBA 2M2DA 3WKNA 3UROR 5E08L 1I1AC 4G5ZH 1GOHA 4ETYA 4OZIF 3L3IB 4X6EA 3HHRB 4GRLA 3RPKA 2NZ9C 4DN4L 1JV5B 1QSFB 3QISA 1BLNB 4R97C 5LCVH 1FC1A 1J05B 3TIDA 4HW6A 3BOVA 1PZ5B 1R3KB 2ZUXA 4XXDA 1SBSL 1SJVA 4HV8A 4ONOA 3WCYA 2DQFA 4LSVH 3MBXH 4KDTC 3V9FA 5HYJB 5TE7H 5SWSB 4GUPB 2ERJC 1ONQA 2V5RA 3DVGA 5F9WC 4AIZB 2VQUA 3NMEA 1DBBL 1HH6B 2BERA 4KKCC 2ZSVA 5JQ6H 4NQCA 1AP2A 1CXKA 1XEDA 4TQEH 5M94B 4OBRA 4Q6IC 2W65B 3RUGA 4ONHB 1S7XB 5LGKA 1IGTB 2WP3O 5MEQB 4XPGH 4J1UA 5FYLE 2JIXB 1JTTA 3BKCL 1G6VK 3UTSA 2XQBL 5D7LB 1NBZA 4JKWA 4MA7H 3IFNH 4JO1L 2FZ3A 1P6AB 3PQYD 4M48L 1I8MB 3P3YA 4BFGA 2WINA 3AY4A 4H26B 1FNFA 4MA1C 2E9JA 2OX5A 2X4UA 5DJ6B 4RMQA 4WNQA 4J6RH 1KT2B 4IRZL 5IW6B 2O5XL 3QDJB 1U8OA 1HQRB 2EIBA 3RVXD 1NFDB 4R4ND 2XQBH 1LK3L 4KGLA 3U2SA 3IS0X 1W72H 1AXSA 4Y16C 4I8DA 4PJFB 3CJJA 1IFHL 1U92B 2XWBA 2OLDA 1QLEL 3BX7C 4Z95H 1RZ8B 3QHZH 1A6WL 4HWZB 4P5MB 3RWHB 3OKNB 4QRPA 3CDYA 5FOJA 4JRXA 2IMMA 1C12B 4NYLB 3QUXC 3GKZA 1OT1A 5EZIL 4U1NB 4MA3B 4RBPK 1QBAA 1UM4H 4WW1B 1MEXH 5F93C 3DRTA 4PV8B 3W82A 4AY0A 2OK0L 1AIFB 3TIDB 4XBPA 3K2UL 4PLKC 5IBLD 4N8VG 3BEVB 1WVZA 2CRIA 1LO5A 4RX4A 4PV9A 5EUKA 4IMKA 3O6MH 1IKNC 3RU8H 12E8H 3LKQA 1NAKL 4M62L 2D7TL 4PJ8A 1K5NA 3ILQD 1BP3B 3HE7C 2VISB 3REVA 4LLVA 1QP1A 5T3ZD 3QFDB 3OJMB 2OSLA 2J8UE 5IV2B 4HZLB 4U1GC 2OTUB 2VUOA 4YDKL 1DQQA 3KPMA 1BBJB 4NWUL 2D7OA 2OCFD 1X5JA 2LVEA 5JPNA 3L95B 1PW3A 2WUCL 1P7QD 3SE4C 1UKQA 2DLEA 1DLHA 4ISVB 3MODH 4OF0A 5EBMA 4L9LA 5IVXF 1HKLH 1G9NL 1FSKB 2G2RA 1J5OH 5F1OB 1YYLL 3WUWB 3HAEA 3KJ4C 3B9AA 3BQUA 4GAJL 2YXFA 1UVQB 1HH9A 3PHSA 4FZ8L 1SYSB 3MV7D 3FN0H 5ETUB 5I17A 3ZTJG 4OTXH 5BS0A 1CFBA 4ZFGL 4I18C 5KSBA 3ARDC 2GQHA 4JZJA 1S9VA 3EOTL 1JFQH 5DD3H 1GAFH 5I1AA 2MTPA 4Q58C 4XAWH 2HFEA 4LK4A 3CSGA 3FQWA 1IAIL 3VFWB 4JGUA 1U42A 5FYKD 4MDIA 3S36X 5KVDL 1R5VA 5D1QC 4FZ8H 3P77B 3P4OA 4ZYKB 5JHDE 4LCCB 3GSNA 5T5NG 1K4CB 4AYFA 4TVPH 2MHAA 5IHUH 4DGIH 1RMFL 3D18A 1A6VH 4RMVA 4NM4L 2H26A 2A73B 1K4CA 3IT8D 1WQVT 1IGYB 1XIWA 4L4TB 2P43B 3LQMA 4NQVA 3HI5H 4PLJC 4OJFL 5IMLB 1BREA 3SDDC 2IG2H 3FO0H 3NCFB 1V7MH 4U1SA 3TBWB 5F1IA 3MROB 2VISA 3V8CA 1VKXA 5MENB 5D1QA 2AJYL 1P7KB 3GMLA 3HI5L 4AG4L 3KAAA 1DL7L 4O2CA 3FQUB 1U2HA 1FAKT 4P4RB 1KLFA 1I3VA 3T09A 3HG1B 3FO0L 3KDMB 3O41A 4AL8L 2VLJD 2NY6C 4ISVA 1IEBB 1ORSB 4ODTH 4Y16D 4WU5B 3G6AB 1NKOA 4OZ4A 4PYHA 5A16B 4HBQA 5IW1A 1MJ7L 4CU6A 4X6BA 2QQNL 4G8GA 1NGYA 1HH9B 3BQUD 3NIFE 2NCMA 2NXYB 3I75B 1NEZG 5CJOH 5F3HB 2GUOA 4Y2OA 1NMAL 4POZD 1CVRA 3FO9A 3JSSA 2KDGA 3ELAT 4XC3L 5SWZB 4EN3B 3ZE1E 2NY2B 4NT6B 1HKFA 2QQNH 3A6OA 1FIGH 3VFTB 1TXKA 2JJSC 3PNWB 2E7LC 5SWZA 3P77A 2WANA 3Q0HA 5E70A 3PE9A 3M17A 2WMPA 1UCTA 2QR0A 1NAMB 2AVGA 2HFFB 1P5UA 1GHFH 3G04A 4OLYL 4UINH 3UPRA 2R4RL 4OB5L 4OZGE 3QFJB 4OAWA 3SKUD 1JPGA 3QDMD 2YZ1A 4JPKH 4XBPB 1YECL 1MLBA 4NQVB 3VCLA 1HXYB 1K4DA 2H2PC 4NC1C 4M7LT 1WTLA 3L6FB 4DN3L 1JUFA 3FQUA 2XOTA 2NX5B 1Q9KA 4M3KB 3D9AL 1KB5H 4LLVB 3DGGB 1J12A 5CEYA 5EOCL 1D6VH 5I9QB 5L2KB 4BZ2L 5DWUL 4WJ5A 3VFOB 4ZXBD 2AXFB 3VXRA 4UDUA 4TULL 4OSUH 1I1YB 3VXME 3VDAA 1FL3A 3QUZD 1TDQA 1K85A 4HSQA 2AJSH 3D85A 4K3HA 1KB5L 3L5WA 4M8VA 4P23D 1O0VA 2YWYA 3CNKA 4V2BA 3ARUA 4Y8DC 4OLUH 4BZ2H 2E7CA 4PJHE 2JB5L 3SDDA 5CD5D 4TULH 2AK4B 2ZG3A 1KB9K 3T2NH 3TJHD 4NZRL 4NGHL 2AJVH 5A2JH 3L3GA 2EDHA 2FX8L 1KCVL 3NFNB 3ILPB 4TTDD 3HC4L 4MA8L 5HYIA 4P3DA 4ERSL 2HKFH 4P5KB 5KANG 3PL6C 4JQVC 1OAZL 4XPTH 5F6IC 3GJFB 2GAZB 3BSZL 2V9TA 4TPRH 4XVUC 3MGTB 3P11H 2AJZB 2XKNB 3GRWL 5D7JD 5HHOD 2JCCE 1IAOA 1TPXB 5HYFA 2VDKL 4X7TB 2YPLB 4WGVB 3N1PC 3OJ2C 2C5DC 5DMJB 3QXDB 5E2UH 4NO2B 4L8SC 2DL9A 3T3PF 1YNKL 2W92A 4AEHH 4F57L 5GPRA 1YYMH 1UZ8A 2N7BA 1U8LA 4F7CB 3CU7A 1KGCE 5DF0A 4OM0L 4MQXC 2VDNL 4XCNB 2B1AL 3H9SA 4G80A 1SJHB 4PJCE 1BF8A 3W39A 2CJUH 2NY1C 4H20L 3S96B 1AQDB 1OGTA 4PTUB 4PJ5E 3KYMA 3FQXB 1R3KA 5I73C 4OF7A 3FCTA 1NLDH 3K0WA 2EYSB 4G8FA 1HHIA 3SDCB 5HYSG 1PYWB 3O6LH 4NO5B 5HY9B 5DD3L 1WAAA 3L9RA 4F7MB 2CJUL 1W2KT 4KDWA 4FFYL 5AG9A 5ITBH 4D9RD 1IZKA 1YEJL 2BC4A 2P5WB 3BZDA 4X4ME 3A6BL 1T03L 9CGTA 2H8PB 1OL0A 1MCCA 1BVLA 1JNLL 4XNMA 3W9EA 1T1YA 1A6ZB 4DW2H 2JCCF 4KJQC 2F53E 3N85L 4YHPB 3JVGA 3DJ9A 5KSUA 5E4IA 3ARQA 4P2CG 3RWCA 4HIIB 4FG6D 3BPOC 4WY7L 1R3LA 5CINL 2JELL 2NY1D 2DI9A 4B0MM 2PKDA 4OD2B 5J56B 5D93B 5KOMC 3RWCB 5BMFL 4YXLL 5K9QG 3IAGC 4Y2DC 4D9QE 5L7XL 5F7LB 4DW2L 3RWEB 2M8XA 3PNWA 4GRWE 2VLRB 3C2AH 1YNTB 3O2DH 2EKSB 4DTGL 4Y1AB 1G6RL 1T80A 4Z76B 2DLGA 5IVOA 2VWEE 3C5SB 3LSOB 3QNXA 4OI9A 4XWOD 5C0JB 1JHKL 1YC7A 4W4OC 2YD9A 2G75A 4NHCL 3EDJA 1WK0A 4JY6B 5LGJB 2IMNA 4OGYL 2NY6D 3ARFC 3OGOE 2EZ0D 3QULB 3P4LA 1U0QA 4LLWB 4NM8H 5EU7E 4ZUTA 3WHE0 3QG7H 4K3DH 1U8KA 3ULVE 2ZOLB 5EA0H 3WLWD 3H9SB 4G80B 2CQVA 1WSST 4YHKH 5ICZA 2NY7H 1B90A 2AEQH 3A0OA 3ALXA 5E99H 1GGIL 3G6JA 3FONA 4MXQD 2WLYA 3C09C 3CFJA 4DOHE 4NO0A 1NCAL 1WC7A 2XN9A 1FFNB 2QSQA 1MVUA 4WTZA 5F7WC 3WNKA 4QHNA 1DQTA 3MLZH 2QJDA 4KHXH 4U1HB 2XRAH 3K8MA 4R6UA 3FFDA 3RNQA 2GI7A 2NTFA 3VW3H 3CFDA 3MXWL 5CS7A 5IF0B 2RR3A 3O11B 3VH8A 2BVPB 5TPWL 1S9XB 5IM7A 1UQSA 5HHOB 1FH5H 1KG0B 2PO6C 2Z31B 1GHFL 4OLYH 1XF4B 3SPVB 1X9QA 4HWZA 3RWHA 3WFCH 5IB3A 5DJ0B 5FUOL 4C4KO 4LHUA 4R3SA 4YHYB 3QQ9D 3TN0B 1A1NB 4PFEA 1BX2A 3MRIA 3MJ6A 4DGVL 2AAVA 1LO2H 1KJ3H 4LSUL 3RA7H 4TNWF 4GAGL 3TEUA 4JQIH 4HZAA 5GZOD 3QHFL 1OAUL 4U1KA 5KVGH 1NBYB 3SO3B 5K9OB 4NJAL 1HZHH 5GRVL 1MJ7H 1WEJH 5D8JL 5ANMB 3D3VA 5D70H 4LSQH 3RY6C 1CR9L 3Q5TA 1Z9SA 4NQEA 2V2XB 1KTDB 1YEGH 4NBZB 1DFBL 2DMKA 5FHBH 3HZYA 3NA9L 4BSVB 1J10A 2JK5B 4E42A 5BOZG 2ZNWA 2QQQA 5E94B 1S7VA 3AB0B 3WFBL 1TLKA 1QSVA 3T0ED 1ZT4B 2EEDA 2Z9TA 4KJWD 1B0GA 1G9NC 4OM1L 1E27B 5FM8A 4DGYL 3ZMRA 4MAYD 3CDCA 2JB5H 1KNOB 1WGOA 2X4SA 4HQQL 3BPLC 1J1OH 3BQUC 3VXUB 1FFRA 4K3EL 3WMSA 3S3PA 3IFLL 4NQDB 4G8GB 1XGPB 2FX8H 1Y18A 2Z4QA 2ZP0T 3TZVB 3GUTA 4MX7B 3LN5A 2HJFA 5D96B 4NRZB 5GS0D 1DQLL 5E6ID 3RRQA 3KYAA 1C1EH 2R8SH 1IGCL 1INQB 3AS1A 3DYMA 3RPIA 2ESVE 4HWEL 2XWJA 4P48A 1JNHA 4HUNB 1SM3L 4UNTA 4P4KB 4NN7C 4R7DB 5DRZA 4FHBD 5HHPB 4DUVA 5D5MA 2DQHH 4I2XA 1Q1JH 1NANI 4RBPH 3U7WH 3BH8A 3GMMA 5T1LD 4NIKB 5HGGS 1X5YA 3U0PB 1D9KC 1H3TA 3CK0H 4MB4A 4HIHB 3CGTA 3PIQA 1T5XB 4DQOL 3GGWB 4XC1H 5DI8A 2NY4D 4RA0C 2OL3L 4LHUB 4R3SB 3VWJC 3FT3A 5FGCE 4R4BA 3LHPL 4OM0H 4PJAB 1CFVL 1OAXL 5SWZD 1BX2B 3MRIB 2J5LB 1GGTA 1LO4L 2VL5B 3OKYA 3M1BB 2A1WL 1EIBA 3QDJA 1U8NB 4AZ8A 1A4KA 4ELKB 4ODSH 4Y1AE 1J87A 1IC5L 5HGDB 1M71B 2IPTL 4UT7H 5FF6A 3QDME 5C0RH 1S7VB 2AV7B 4XBEL 3I6KB 4LPWA 5DZLA 1UB5A 5SV3A 4X83A 2VKWA 5E8DH 3LS5L 2F74B 4OZHF 1MHCB 4KKCD 4G9FB 2ZUQC 4HC1A 3O2VH 4WW2B 1IC5H 2R56L 1EHAA 1QRNB 2Q1EA 3AC0A 4HKXA 4KAQH 4KVNH 1EHLL 5C07A 3QZWG 4PJ9D 2C1PB 2NY3C 4YJZL 4NQED 5AWNH 3MFFA 3CFCL 5EO1A 4MJID 4JZOB 3LKPB 1MJJA 2BJMH 1J7VR 2VXSH 3KPRE 4G8IB 4X4ZA 4ZAKB 4PJBF 2VXUL 1WC7B 4ZPTB 5FF6B 1MJ8L 2CDGB 1YQVL 2ED8A 3AMLA 3CXDH 4GRWB 3R06A 4G7VH 3NIFF 1FDLH 5B3JF 1WWAX 4HV8B 1ES0B 4PJIE 4LLMB 1P5VA 5I1KL 3GMOA 2AABH 4JJ5A 1NCDL 1XR9A 1TJGL 3MRPB 4D9RE 1PY9A 3B5GA 1YA5A 5JPNB 4ZFFB 5HHMB 2FO4A 2VMFA 4LLQA 3OL2A 4XI5D 5CEXB 5C2BL 1QR1B 4HUWA 2C3VA 3ILQC 3MREA 2ZSWB 3A67L 1M1SA 5EO9A 5L88L 3QH3A 4MNQB 2IJ0C 1NMBL 3W0WE 2X4QB 4CUCA 4JRYA 4EUPG 4WIQA 1G1YA 1U8IA 5AZEL 4GW4B 2UWEF 3L7EA 1F6LL 2ENSA 1XF3A 4JJHA 1N7MH 1UM6L 1QEWB 1X5IA 4JFQB 5C2BH 1I1FB 5MHSD 4P5KA 3MNVB 4GSDL 5BO1H 2CPCA 1S5HA 1HSBA 5JIHA 3MR9B 2JCCB 1FFOA 3BWAB 1NCAH 4RZCB 4X4XB 1K6QH 2ITDB 1UADC 3TBSA 3ET9F 1IEAA 4YHOH 1U8MA 3ROLA 4XNUL 3DGCR 4GLRI 3QP3A 4KHXL 1BEYH 1P7QB 4JGMA 5D1ZC 5DMIH 4IOFD 1RHFA 1HHIB 3D0VA 2HKHL 2XZQL 3B2UC 1B6DA 3LEVH 1MFBL 4XWOC 1JTOA 5FYLL 1BQLH 4KI5D 3SDXF 1QRNA 3KGRA 3ZE1F 5AD0A 3O3BB 4RDQG 1LO5B 5T1KA 3CC5A 5TQ0H 1V3KA 1EUTA 2FJHB 2XPGB 3FOLA 3V52L 4CN6A 1QSEA 3MUY1 5D93C 3E1F1 1QZ1A 4JAMB 3H3BC 1F2XK 4JE4B 4KUCD 4QXUL 2IBZX 5C0AD 5CKAA 3VGAC 4LPVA 1QYGL 4YXHH 2YPKB 3OG4B 3AS2A 1ZT1A 4NQCB 3S88H 1KCUL 1FFNA 1Z3GH 4W4OA 5E5RB 1WFOA 1OP3K 3HE6B 5LJYH 1PLGL 5J3HD 4QRTA 1FN4B 4JVUA 5LXGH 3OAUL 1F4XL 2SEBB 1T4KB 1ONQB 3DVGB 4NBXB 3UPAA 1J9CT 1EEYB 1EFXD 1B6UA 3ULUH 2EYTB 2MPAH 1KENH 4HGWA 2ZUWA 4MA1B 4OCSH 2IPKA 5GRXG 2IGFL 1XT5A 1T5XA 3MXVH 1YJDC 2CRYA 1CZ8L 5BS0D 1FNSL 1E6JL 5C07E 5D7IE 4JO2L 2I9LA 4PBVC 2CIIB 3Q6FA 1YEKL 1S7WB 3IDGA 3I85A 4LRIC 3RVUD 1FZOB 4YBHA 5DZNA 5GSVA 5HDBE 2A9ML 1JE6A 4M5YH 3WNNA 1FNEA 1OWRM 2VAAA 2EIZA 4FQ1H 2ZUUA 3GI8L 4XCFL 5ALBH 4L1DA 3KNBA 1N5AA 5GRZA 2EDXA 4HPOL 4YE4H 1JP5A 4LDLB 4TOYL 1INDH 1BZQK 1N6UA 3O3BA 4LGRB 3TIEB 2ICEA 4ZFZB 5I18H 4P9HC 4KI5C 2AI0L 2JTDA 1IC4H 2KL6A 5HY9A 3RVWD 1GXEA 4YDLC 4CW1B 3HUJF 5DJ2B 3S36L 4KROD 1OLLA 3AREA 4I4WA 4LLWA 4QTHA 4GW5B 1DBAL 1U8PB 1W72A 3LQZA 1CD1B 3GBNL 1GZPB 1V3LA 3W0WB 4QHLA 4U6XA 1VHPA 4M7JH 2GTZA 4MLIA 4AEIH 4B41A 5I0DA 1DLFH 3PQYE 2B2XH 3PDDA 4X7DC 3IB4A 4TTDC 4J1UB 1RURL 4Y4FA 4QKXB 2NXZD 4ZS6C 1UJTA 4J2XA 4YUEH 3OKKB 2OQJA 3NIDF 3GO1L 4YR6B 1GGBL 1OPGH 2EDKA 5EPMA 2A1WH 3MJ9H 3QQ3B 3QSKB 3MJ7A 2CMRH 3KYKH 1LE9A 4JVWA 4PJAF 3NOIA 4R2GC 2HT3D 2EH7L 5E2WH 2IFFL 3HC3H 3DX9A 3O8XB 5DRWB 3O4LE 2WM0A 3OJDB 3QUZC 1ZHKA 4P4KD 4N0FA 4FRWA 3G9AB 3MA9L 3KPQA 4LLUB 3UX9B 2H32B 3GSUA 4X80H 3A6CL 1T22A 4RISL 1PFCA 4B50A 4JHAL 1YN7B 5FM5M 1YEHL 4FMFA 4KRLB 3VH8B 2DBJA 1FGNL 3GJFH 3TYGH 2WP3T 4YK4B 3CIQA 3QI9C 4UI2A 5ANME 4X99B 2VYRE 3GFUA 4NQDD 5EOQH 1K8DB 2UVFA 1OF2B 3QIBB 2YA2A 2RJMA 4YPGB 1L0QA 4J4PC 3VA6A 1VGEL 2J4WH 3EYOA 4W68A 1FDLL 4RGMB 2DQDL 1XGPA 2ZPKL 5F9JB 2F5BH 2E7HA 3SGKC 3V95A 4H25B 5DJXB 5E5MA 1CTOA 2X4RA 1PKQA 1H5BB 1DN0B 3LKRB 5DK0A 3U36B 5EOQL 3LPGA 4WUUB 3H6JA 3GIZL 2IBBA 3P40A 1S7TA 4XPBH 4MCYA 1HXMB 1QKZL 1KBGL 5DYOA 1AGEB 2WIMA 5DHYB 3ULVL 3QEUB 5EBGA 1MHPL 4PGBB 1P7KA 1QUNA 2A77H 4FNLH 3HZYB 1S7QB 4Q9RL 1FL6A 4EXPX 4FXKB 4B7IA 4NQDE 3VRIA 4ZUSA 3U46A 2HJLA 3MRFA 1IVLA 4OCYL 2WBJB 5F9DC 1R24A 3BGAA 3X3GH 3BKCH 3GIZH 3MOQA 5TF1L 1CL7I 5C0RL 2NW3A 3MLPA 3TN0D 3VRIB 2ICWI 2YUVA 1QKZH 1AD0A 2IANB 1RZKC 4F58L 3FT3B 5KTEL 1MH5B 2ESVB 2BHYA 2QHRH 7FABH 4YHZH 3C2SA 3V5DA 3MJ7B 2OZ4A 1A9BB 2A6JA 2JJTA 5KW9H 4U1MB 3UP1A 4QHUA 1H3UA 5TH2A 3VG9C 4UT6L 5IB5A 2JJVA 1AKJD 2FRGP 4HIIA 2VXUH 1FFQA 3OF6A 3S37X 5LAXB 4Y5YA 3PWNA 5TGBA 5B4MC 3KLHD 5DA4A 4P5TC 1UB5B 3ZHLA 2P7TB 2GUOB 1C08A 3H7LA 3RVWC 3QCTH 5I1DB 15C8H 2BOCB 2H2SD 5ADPH 2FD6H 1LE5B 4APQA 2CDEB 5JIPA 5I1LA 3RZCA 3NGBB 4QXTA 3BIBX 1BBDL 3VXUA 2Q7YA 3KPPA 4MYWB 3OR7B 2KPNA 2VL5A 3A67H 4L4VD 1KCUH 5FDWB 4LQFH 3K1DA 3R0MA 3FRUA 4HKJA 4P5TD 2ZUSA 3QDMA 2NY6B 4IDJL 4YBLC 5D1XB 1VFBB 2ZUYA 3QPXL 5J11B 3DROB 3MV9B 4XCNA 2HWZL 4FQIL 4DVBB 1LE5A 1E4JA 4YC2C 1LQSR 3GEWB 3SDXB 4AEFA 1FZMB 1PDKA 3QUXA 5IMLA 4BSWA 3W81A 4N9GA 3M45A 3WD5H 1OB1A 4X6CB 3JWOC 4ODVH 2NX5E 3TH3T 4XMKH 3QH3B 1F5WA 4Z18A 3S9DB 5B39B 3LPWA 5IFAH 3OX8B 3IU3A 1INEH 1M05A 4HBCL 4KMTH 3OKDB 5DMIL 2A9MH 4NNXB 1GAFL 5JLZB 1IILE 4FN0A 5INCB 4M93C 1J86A 3LEVL 1FBIH 3EYQC 3PV6B 1C5CL 3HMWH 4FZEH 5H2BB 4LVHC 3QWRD 3HI6L 1GZQA 5ICXB 5IP4A 1BD2E 2MMXA 2DKMA 3TN0A 2RHEA 3SY0A 1JPTH 3TVMC 1EEZB 4JM4L 1KLGB 4R0LB 2A6IA 5MEPA 1JZ8A 2GTWB 5ISZE 1A1MA 4M4PA 3OB8A 3T04D 2G60H 3LV3B 3ZL4H 2ZKHH 4NQXA 2O26U 3BAEL 1QYGH 4YXHL 1R5VB 3BKYL 4WI7A 3WHE1 2Q6WB 3S88L 3WE6A 4K9EH 3X12B 4J3VA 3GI9L 3RWDA 4YBQD 3IAQA 2C4FT 3STZA 1NC2D 1KLUA 4OQTA 3T4YA 1B4JL 3KPLB 1T1XA 1U41A 2DS4A 3BAEH 4KPHH 2ED9A 3RGHA 1IARB 5KAQG 5C0EA 4LCYA 5KSVB 1S7RB 5JOFA 1C5DB 3K4AA 4JQXC 5C0AA 2X40A 5DT1H 4FQXA 3ZDZE 1G7IA 5K9JL 2P8PA 4XX1G 3QUMB 2H1PH 4GXUM 2QADB 4DVRH 4QHMB 4YPJA 2EZ0C 1MF2H 1T20B 1IM3B 1TVHB 3SDAC 2YD7A 4CU8A 1MY5A 2ZG1A 4U6VL 1Q8MA 2R69H 2BX5A 3VXTA 1P4BH 1KJMA 3SBWC 1FPTH 5MI0B 3RVXC 1JWUA 4M03A 2CKBL 1KLUB 4BQCA 2MOVA 1NUGA 4G5ZL 5KSAD 1DQQB 3KPMB 3EJYC 5CP7A 1F6AA 1UCBL 1ZTXL 4RISH 2IH3A 1A5FL 4S10A 1CDYA 4Z77A 3G08A 4I2XB 2BFVL 1R3IL 3UC0H 2AI0H 4F2MA 2FL5B 3IGAB 3JWDL 5CIPB 1CDBA 3DUHA 3BIAX 4C59B 1I9EA 1RI8A 1F6FB 2A6JB 1UXSA 5C0CD 4FG6C 4U1MA 5F88A 1LDPH 5EC2B 5HYSB 4HKBB 1MWAL 4OF3A 2MCPL 4LCIL 1A6ZA 2GJZA 1T0MA 2P8MB 5GRUH 2XI9A 3DUSB 5D6CB 3VWKA 3WV0A 1DQJB 2R4RH 5JDSB 5JA9A 4CGTA 2P8MA 3Q5OA 3GJFK 1NDGB 1MIEH 2IQ9H 1I7RA 2FECI 1ERNA 2YD3A 3RDTC 2AK1L 3SHSA 1U8HA 2B4CC 4JHWL 3BGFB 3BD3A 4JPWH 4R4FH 4OV6F 2ZCLL 3G04B 4LSVL 2IFGA 1N2RB 1UWGH 2C7UB 1OTSC 4G6AC 4JRYE 3S35X 2BNRA 1QSEB 3QDGB 5DR5H 3WNMA 1YNTA 1TTFA 1FAIH 25C8H 2XWTB 1CGSL 1NGXB 3DYOA 5FO7A 3QDMB 1QHPA 5DHVB 1QFHA 3QHZL 1X6LA 1XF2B 2ITDA 5CILL 5LCVL 4QRRA 4MD5B 1NJ9A 4MJ6B 5M7QA 2W60B 3S3SA 1KIQB 1T2QL 2A83A 2YD8A 3QO0A 4JN1L 2VN7A 2AQ3A 4L8CA 2FR4B 4WHCA 3BN3B 5IB2B 1XR9B 2YUZA 3C8KA 2FJGB 3G5VB 2YWZA 4PB9H 5HVGB 3VFNB 1QRKA 5E9DB 5CILH 2Z92A 2BNRE 2VLKB 3L3OB 3G6DL 5HPOA 5B39A 4Z77B 1UXSB 5B38A 3PL6D 3D3VD 5EO9B 3D25B 3PQYA 4KXZH 2HKFL 1DBKH 1U95A 5HDOA 2NXYD 3T0XA 3KYMB 4YDKH 5CFHA 2BSTA 4EI5D 3P0YL 5L8JB 5HI5D 3L5HA 2VZTA 3EZJB 4UOJA 1MCWM 1I1RA 3NBNA 3ZE0F 4I3RH 3VDCA 1F02I 1K3IA 4KJWC 3B2UD 4E5XA 4LP4A 2EC8A 4D8PA 2EH8L 1YYML 2V5MA 3T0WA 1W72L 3QQ4A 3UTZA 4N5UA 1DQDH 1OLZA 3FHAA 2Y9RT 1NMCB 1QLEH 2PXYD 3C09B 3QEQE 3KG5A 2ADGA 4KV5F 3WJLC 2CRZA 4MGXA 1EAPA 1AGEA 3WD5L 2FGWL 1PY4A 5HVFB 1U6AH 3WFHB 3NCMA 1HQ4B 5F70A 4G9DB 2GAZA 4I2XE 1CK0L 3LSOA 2E6PA 3HB3C 5GGRA 1ZHNA 3VXSA 4G6MH 1DBML 2GSGA 2FH8A 3C9NB 1MHCA 1C7SA 5HGAB 5C86A 2P1YA 3BE1L 4JDZB 4PRIB 1IT9H 1BJ8A 5ACZA 1IQWH 4ONGH 3NCJL 1AQKH 1UWEL 5LQBL 4M6AA 4PJCF 5KVFL 3HRZB 3ZE0E 4Q97A 1Z9LA 1AD9A 3BD4A 3QA3B 3U1SH 4JZNA 3QDHA 4NHUA 4P2OB 4GH7B 3V5HA 1KYOK 1CDJA 4GW1B 4TVPL 3FRPG 4XGZA 3RKDD 5KJRL 2VQ1A 4IRJA 2B8OT 5FCUL 3CFBA 1ZGLP 2NW3B 2DMBA 4OTXL 1MRCH 4XP5L 5E6YA 2SEBA 1W0WB 3WUZA 3UBXA 3IDYC 3DO7B 4P3DB 1H9VA 4DTGH 4Z7QF 2PXYB 1ZHLA 4W6WB 5HHVH 3FO9B 1EK3A 4S1DC 1J0IA 3QIBC 4RGNE 1TVBA 5DVKA 3QA3A 2J6EH 4OFIA 4DVRL 5DJZB 4UILH 4IMLA 4PG2C 5LGHH 4QRQA 5IVXB 5KANI 5E6IC 2PTTB 3MRCB 5KZCD 3PGCB 5CJBA 3PHQA 2V9QA 4JRXE 1J0JA 3V6BR 1QR4A 4DWHA 5CLTA 1D5MA 1CL7H 3TESA 1FBIL 1YJDL 2PR4H 4J7RA 4XMLH 5IBUG 5LGHL 2LQRA 1KNOA 3E8UL 3KPPB 3N1MC 1G7HB 1ZA3A 1AGDA 1A7QL 3MRGA 5F89A 1GIGL 2HYMA 1S8DA 3FB8A 4HG4J 3D3VB 2ZCHL 3GHBH 3F7YA 3MLZL 4J8RA 3U9PH 3HNVH 1FRGH 1NBYA 3MRGB 5H37G 5E9DD 3VXQB 3IJHB 4JKKA 1LMKA 4HGMA 5B22A 4KZDH 1H3PL 5C0NC 1WZLA 3BO8A 1MWAH 3H42L 3H9HA 1UWXK 2PO6D 2Q76B 4U1HA 5B39G 4WUUA 4LFHG 1QSFE 4XPAL 1KN2H 43CAA 2X4PB 1HYRC 1Q9WB 1A7BA 3WFCL 1XF4A 3D9AH 5LWYH 5KN5A 1VEPA 3PQYB 4HPYL 1AO7A 3BEWA 3CVIL 1CXLA 2VLRE 5E24E 4JHWH 1JBJA 4F80A 4G3YL 3QDGD 3E2HB 3EOAA 1U8JA 5JXEC 1ZA6B 5IFJB 4JFFD 1MI5A 1YEIH 1FLRH 3J7HA 3UBXB 3DO7A 1EEYA 3LZFL 1OAUH 5K33A 1A6PA 5HD8C 4UOW1 4MA7L 5LWYL 4JPKL 1H3WM 3MLUH 4PGDB 4LSQL 2R2HA 3H7BB 4L8SB 3DUSA 4QY8B 1T22B 4N1EA 3T2NL 1IGML 2OI9C 1D5BB 4GAYA 4MQXD 2Q8AL 4KKNA 4NGHH 3AAZB 3WSQL 3FOMB 3LZFH 4IRSB 4RAVA 1D5ZA 4MA8H 5DD5H 4PUBH 2EIZB 3MC0A 4M6MH 1HEZB 1A2YA 3MRJA 2J6EA 5I19L 2W0KA 4YFLI 4F15C 4P9ML 5JPMB 4KTEH 4OZIA 3OKEA 2ADJB 5A2LH 4NRYA 3CVHA 2XWTA 1AGFB 1KXVC 4JDVB 1QBBA 3CSPA 2CKNA 3QRGL 4HDIA 4A6YL 4NCDA 1Q9LB 1KTKE 5E95B 5CBAB 1MCJA 2NW2B 2X4NA 3DTXB 3DXAE 4V1DD 3D85D 4G9FE 2DB8A 1ORQA 1B3JA 3HN3A 2JLLA 4R26H 3Q1SL 3SY0B 3WXVH 2O93L 1S7UA 2VDOH 5JW4M 1ED3B 2EE2A 3HE6A 4GKSA 5GIRB 1WIPA 3OAYK 4PJDB 4QRRD 3QXVA 1BZ7B 4Y2DD 2BY1A 4M43H 2CLRA 1L6XA 2FHFA 3NCCB 1QQDB 4U1JA 3PXHA 5BCAA 4FFYH 3GIVB 3S6CA 4UDTA 1C5BH 5CZVH 1NGPH 1JZ5A 1JF6A 3IDMB 4DZ8B 2FO4B 3ZZ1A 1JNLH 5J6GA 5F71A 1NC4D 1S7WA 1TZGH 3UZVB 1PEWA 1T1ZA 2ZOKA 1NBVH 5DMYA 1WFUA 5FECB 1HHKA 1KV3A 3TZVC 1ADQA 3GMPB 3HAEH 4HUVB 3MOAL 3MNWB 1NGPL 2D7NA 1BJ1H 4R0LA 1P69B 1XCQB 3D0VB 5FO9B 3QRFM 1XGQA 4KVNL 1T6VN 4TVPD 5I71B 2P48B 4PJIF 2CH8A 2GSIB 3CFCH 1YNKH 1UM4L 3SCMD 3VH8G 2H26B 3R8QA 5L6YH 1JYWA 4JFYB 4PJ7E 2VXSL 3NGBC 4PRPE 3WJJC 3GSQB 1NCUA 3MRMA 4WO4A 4BKLB 2EE9A 2NPLX 4ZSOB 3N85H 5HPMA 3B3IB 1NL0L 4HC1L 3B43A 1NCWH 4GRLB 2XXCB 2J8HA 3KPSE 4ONFL 4D9QD 5FV2A 4ZTPL 2EDQA 5KSAC 4X7EC 1BFVL 2PCPA 1YPZB 5F7KC 4YXLH 3CLFH 3SBWA 2V5SA 1CU4H 4NWUH 3AROA 4LKXA 5GS2D 4HC1H 4OLZH 4OQTL 4FFWC 5CKGA 3V6ZB 1G9NH 1OGAB 2DWEA 3IDIA 4HMEA 3KR3L 5CZXD 4M6OH 2UUDK 3GMNB 1ZGLB 4HJJH 4L4VB 1DUYB 2X1OA 3MMEB 4N0CC 4ZPTA 3DECA 1S9XA 5C0CB 3NABL 3RP1A 1UQSB 2X1QA 3B9EA 1CVSC 5INCA 5TQ2L 2HRPH 5L8LB 4OKVB 3IXAB 1T89C 3H2WA 4JFPB 3ZHDA 4OLZL 1AHWB 1V7NL 3WIIL 3PWLA 1GIGH 1P53A 4JZJB 2EDLA 3CCHB 5T1KD 4LHUG 4MD4B 3GHBL 3WEXA 3KPSB 3L3HA 2IWGA 4G9DA 4R96A 3C2AL 3QO1A 1A47A 1TMCB 2HFGL 2HKHH 8FABB 4RAVB 4WFHE 2YD1A 5ESAB 3EO9H 3FB6A 2E9IA 4P2RD 1X5KA 4XT1C 1QOKA 4A2MA 5ALCL 4PJXB 1MCPL 3VCLB 3TVMA 5F6HJ 1FO0B 1N8ZA 2YA1A 1IGYA 3CD4A 2XTJB 2QADD 4I18A 5T3ZE 4MD0A 3CUPA 4YZFF 5CGTA 1HNFA 1HSAA 3EZ8A 2R2CA 3AGVA 3EGSB 3OXRA 5TF0A 4UIMA 1RZIB 3KHQA 3BKML 4MB5A 1V7ML 1JV5A 4MXVE 3V5HB 2O5YH 5LXGL 1NC2B 1AE6L 4XVJH 4J3TA 4ELMA 3MLVL 4U1IA 4X6DA 3AU1B 4ZUWA 2X4TA 4BUGA 5EOCH 4OIBA 4POYA 1NBZB 5BJTB 1MCDA 1T2XA 5CEZE 1CYGA 2Y6SD 5IKCA 1JIBA 1ZOXA 4M7ZC 1IM9A 4NN5C 1D6EA 3QWOA 2ICWB 4XP4L 1WAAE 1V05A 4ENED 1KJ3L 5EUOA 4XVJL 4XP6H 4WI9A 4OF6A 3X14B 4TUKL 1HHGB 5DJCB 5I8OL 4X6BB 3IS1X 2A9NL 4M61B 4POZC 3K46A 5CWSB 2P46B 4RFEA 4P46C 5GGQH 4M5YL 3QIBD 3ARBC 5ENWB 4EOWL 4JPIB 4NZTL 3WFHA 2IC2A 1A3RH 4R4BB 2EEAA 4K94C 4KV5E 3E6FA 3T2PA 3U0TA 1CGVA 4R96B 3O4LD 1ADQL 3UTSD 2W07A 4K2UH 1K2DA 2BNQE 3QDGA 3F6LA 4S1RH 1J1OL 4K94L 1ZLWH 4MDIB 2J8OA 3EO0A 5GXBB 1OOAA 4K55A 4LAJH 1C08B 1RHHB 3JV0A 2WBJC 1DFBH 5EORH 4CVZB 2NY5L 1JMZA 5HHQB 1MIML 2A6DA 1EXUA 3ZKXC 2NXZB 2LTQB 4FQPA 1KIRB 4OFYA 5EOTA 3B6SB 1SEQH 1KPUB 1BJMA 4CADB 2EXWC 4KRPD 5DVLA 1IAOB 5E8DL 3QDGE 1JRHL 5I15H 2YPLA 3HNSL 1QA9B 4TNWK 2AJSL 2EIDA 1MH5A 2ESVA 4Z7OF 5FKPB 1JPSL 4LQ1A 1GCFA 1URLA 1WT5C 3DTXA 3B9KB 4Y19E 3SJVA 3LEYL 1T0NA 3CU1A 5E00B 4N0UB 2IFFH 3HC3L 2DQTL 4HT1L 3RZWA 2OR8A 3K74B 5F7MC 4CW1A 4CVXB 1KF9B 3HRPA 3QFDA 5EU6E 1MCWW 1OP3H 3BISA 3C6LC 1J1XL 5I15L 1N6QH 3N1FC 1Q72H 4NZJA 1J8HD 5IW3A 3X14A 3KWWA 3HC4H 2CIKA 5T5FH 4O02L 3WNOA 1UXWA 4YAQA 1X5LA 1XF1A 4ZO7A 4WUKH 3RZCD 4JG1H 3DYPA 3MV8D 3IXTA 3MLTA 2ZSVB 3NACH 4J4PA 2W9EL 1WBYA 3ZT6A 5F7DA 4DUXA 1GGYA 2BRQA 3CCHA 3BGMB 4XBGB 5K59F 1IGIH 4AENB 1YDPB 2WBJD 4AIXA 1NMBH 1N0XL 4WTXA 1VESA 3GRWH 4IRJD 3NTCH 4O4YL 1TZHB 3STLA 5IWLA 3QQ4B 3RKPA 4KWUA 1U9KA 1YDPA 4ZS7H 5E2VL 4DKFH 4BSVA 2X4UB 3CXDL 1CWVA 1IEAB 3OPZL 1PD6A 3HNTL 2OZ4L 2G75B 1JHKH 4Q9QL 1KIPA 4PRNA 3EFDH 4AEHL 4F57H 2VABB 1RZ7H 1TJGH 3O6FB 1KPUA 4OLVL 1A1NA 5DJDA 2GJJA 5GGSA 3KPNB 3WN5B 1Y6NR 3WBDA 4DKFL 4YHOL 1B0RA 4HJJL 4H20H 3U7AA 3DRTB 4PV8A 1RK0A 4Y2DA 3SGEH 5BXFA 5I66B 5CJQL 5GGSB 4N1CA 5SX5H 1B2WH 3X13A 3QIWD 1MCKA 2NLJB 4WWID 4PJEA 1JK8A 1G7JA 4JDTH 1P7HL 4M1GL 4Z0BL 5TE6H 2IAMB 3EBAA 4ODHL 4N0UA 1S3KH 1SJEB 4OD3H 1N7ML 3MLXH 3MV7A 1JNHB 2QBWA 3TNMB 5ICYB 1VADB 1I7UB 5IM7B 1JPST 2XRAL 4P2RA 3BN9C 4ZNCD 1BVLB 4XNMB 3C5JA 5ICYA 2RFXA 2IBZY 3LN5B 5DQ9B 4PJXF 1X5ZA 3V6ZA 1W8NA 1A7OH 1Z2KA 4ODHH 5IHLB 3CFJB 4LPYA 1IRAY 1OSPH 4XNQA 5KAQF 3MQIA 3D69A 1G7QA 1CFSB 3PHQB 2EDYA 5ESVA 4X98A 2X6MA 3V0VB 3K3QA 4XNQB 2L7JA 5FM4A 1V3JA 4KC3B 5FYJL 3ARZA 4HK3J 3H3PH 1KB9J 5TDPB 1SY6A 4JFZL 4XWGH 4OV5A 3ZTNL 2Y5TB 4MB3A 1OTTC 3S5LA 1KIPB 4PRNB 4XH2A 1K6QL 1HWHB 1MFCH 2HWZH 4IMKC 1RAMA 2AJZA 2XKNA 1GVIA 4XNUH 1OSZA 5BRZD 5IWLC 4U05A 5D5MF 3O0RH 5FFLA 3T3MF 2WQ8A 3MV9E 3DMMC 4XHQA 5D1ZD 4LMQE 4JFHD 2DQIL 4XCCL 1I9IH 4GKSB 5FO9A 2IANE 2X4OA 2FBJH 3LN4A 1F4XH 3PJSA 1UEYA 4TUOB 1BZ7A 1HSAB 5AAMA 4FQXB 2A9NH 2IALB 3ULUD 5HXMA 2HTLC 3PHOA 1IGJB 2OR9L 3JTSA 3UBXG 4ETQA 4BJLA 4YO0A 2N4IA 1CZ8H 4PRIA 3DRQA 5FUCE 2PTUA 4MJIB 4QOKE 2FBJL 4PD4J 3BIKB 4GRLC 4PJ9B 1SY6L 2ATKB 3PG2A 1M4KA 3UZQA 2MKWA 1PLGH 1QRND 3FFDB 3OF6D 1RJYA 4XMPH 3HAEG 3K2MC 4AM0A 4KK9C 4ZDHB 1KJ2B 1KJMB 4XP1H 3T0EE 5FUOH 5JOPD 3BPCA 4R8WL 2P24B 5IEHB 5GS1B 4WVRA 5IHZA 3GI9H 1FH5L 4JY4B 5B3JE 3HI1B 5IQ9B 2IPKB 3BKMH 4F33B 2N1KA 4X8XA 2YKLL 3EO1A 1UA6L 4P5TA 3MLVH 2YEZA 1DVFB 4NP4H 5H35B 5C7XL 4XXCA 4D8PB 2WNGA 4LVNC 1T1XB 2ENYA 3EO1B 2AJ3B 4KK8D 1LGVA 1RZGA 3QYCA 3PABB 3W2DL 4EBQL 5K9JH 2BVQB 3MRKB 4PRHD 5C0AB 4QY8A 4UNUA 3NZHL 2H32H 4PBXA 3NA9H 4C83A 3OB0H 2XY1A 4XH2B 2Q7YB 4JLRA 4H0HB 1OF2A 1SQ2N 4N8PA 4HF5H 1XFPA 3S98A 1T1WA 4TNVK 5D70L 1F8TL 4X6FB 1RUQH 3EO0B 3FFCD 3V7MA 2F53D 3CH1B 4Z5RA 5C1MB 2DQTH 4HT1H 4GXVH 4OZHE 4XBEH 3HUJA 1G7PB 3FQRA 4JREC 5FAAA 3WE6B 4H1LG 1UCBH 2DQJH 5IIEA 5I1JH 3MCKB 1A5FH 5E6IB 2HVKA 2IH3B 5F44A 5I30H 2VTFA 1RU9H 3S4SG 3WFZA 1NCBL 2VLKA 3JWOL 3LPFA 2IAMD 5D7SL 3IFOB 3ZDZF 2EYRB 1HCVA 3U82B 4Z7VA 1DCLA 3QIWB 2UZIL 4HWEH 3UDWA 5KSUB 1SM3H 2E27L 1T3FA 2OBGA 1Q38A 1YQVH 1ORQB 4MAYB 4PTTB 5T3XE 1C1EL 3IF1A 4X8JB 2W0FA 4LCIH 3MLWL 2P8LB 4K7FB 4GG8B 3S3JA 4JFEE 2XV6B 1D9KD 1OY3B 1XAUA 1YMHB 3MCG1 4OCYH 4WJ5B 3VFOA 3X3GL 1JGUL 1HHJA 2CGRL 5B4MD 2XQYG 4S2SB 3TO2B 3WS3B 3SDAB 4GG6E 3CMGA 3KLAA 2ZG2A 1SEQL 4HS8H 2BHZA 1OAQL 3UYRL 1U8HB 4HKZA 1D9KA 3U0WH 2YRLA 3DURA 4JHAH 4MS8C 1WWCA 3RX7A 1S9WA 2RQ8A 4O58H 2HTKD 2IPTH 4UT7L 1NDGA 1VGKA 5DMGD 5E2TL 1MAMH 5CWSA 1XF5A 1U8LB 1ZHLB 2WWKT 3O2WH 3PV7A 4HS8L 1PKQE 2DL2A 1NPUA 1VGKB 1HSBB 1FE8H 3MNWA 3N1GC 3U0WL 4X5LA 1E4KC 5T5FL 4JDTL 4O5LH 5D7IF 5E8OA 1KTRL 4XHJC 3BPNB 3PDOA 1IEHA 3Q6GH 1J8HB 2OJZH 5E6ZA 3LN9A 1IGFH 3B9KA 4U6TA 3DOSA 2BRRH 1Q0YH 5C9KA 3PDOB 4EI5A 3DI3B 5MEOA 6FABL 2DQCL 1WAAF 3RWGB 3WHXB 1FVCA 4MLSA 4ZOBA 4MVBC 3RKDC 1NCDH 2EDJA 2YPLE 3EFFB 4Q2ZB 4PTTA 4FFZH 5GSRB 4YGVB 1MJ8H 4IBLT 5C6WH 5EC1A 3U4EB 5FYLD 2PW1B 4PRAB 4WI8A 2PYFB 4ZS7L 3RY5A 3GMNA 3QQ9C 2ICES 3OR6B 4LOUD 3JTTA 4L5FH 4HMCA 4NO3A 4LHUD 2NY4B 4XNZC 5SWQB 4GQ9L 5DO2D 1A14H 15C8L 2M26A 5FA4A 3OGCB 2DD8L 2KKQA 5I6XC 2R1XB 3SGDI 1A1OB 3L7FB 5IGXH 5IR1B 3V0WL 4UTAH 5D6DC 3ARED 3DX6A 4KY1L 2Y25A 1ZT7B 4PJ7A 4PRPA 2HG5B 2ADFL 3O0RL 2NY5C 5E1AB 1K9TA 5AZEH 3KXFB 5E8PB 3L3JA 4GAJH 1I8LC 5FIEA 1AP2B 1UM6H 2APTA 3O4LB 1MOEA 4Y5YB 3RDTA 5TE6L 2KBGA 5EU4B 3GJEB 4BM7A 5DUPL 3PWVB 3RTQB 2OL3A 4WEUD 3WDHA 1R3LB 4Q0XL 3P4NB 4LSTH 4D9LH 4MXQC 6CGTA 3UTTA 1P84K 4Y4KC 2BXYA 2HN7B 4WI2A 4LASH 5DFWH 3UTTD 5L2JB 3T1WA 3EOBB 5JHDD 1IKFH 3TT1H 3FO1B 3GI8H 1WUNT 4LVHB 3EKCA 5KVDH 4S1SH 35C8L 1FFPB 4JM2D 2DDQL 5EZJA 1RUAH 5I1HL 5E00A 2NY2C 1JI2A 1IL1B 5BV7C 1F3RB 4X6DB 4PRIE 2D3VA 4XNYL 2HVKB 2OSLB 4Z7QE 4HCRH 4KJPC 3UPCA 4HUXA 2JB6B 4QYOA 4M7KL 4W81A 4LIQL 3SDCD 1S9YA 1CLZL 4OCRL 1PAMA 1AGFA 4OT1H 4OLWH 1FZMA 1UYWL 4NN6C 5I1GH 4ELMF 1N5AB 1I3UA 1YUHB 5D7JA 5I8KL 3WKMH 5EU3A 4CRPA 3LVEA 3ZL4L 4Y4FC 1T5WB 2V7NB 1MFCL 5L8KB 4HCRL 3EDKA 4P2YA 2W1NA 5CZKA 5I73B 1CFSA 2VZSA 3SGJC 3OKKA 2CKBH 3GM8A 4OCRH 3CFKB 4JR9H 1GC1H 3OAUH 2F54B 1CT8A 5FKAB 1NBQA 4HZLA 3KYNA 3RL2A 4UILL 5HJ3B 1C5CH 3HMWL 4P4RA 1R3JA 4RRPA 2Z31D 5DJZA 4DKAA 2C1OA 4PRBB 1WCQA 3L95A 5CBEB 1ULVA 3B4NA 1F00I 3O3EB 3NN8A 1RZKL 1UACL 2CK2A 1GPOL 2VXTH 4P2RB 2BY3A 2DJUA 3TCLB 2K1MA 3IYLW 2BCKA 2W91A 4YHLL 5A3IC 5I1DA 1L9NA 4K3JH 2P45B 3VXNA 3DVIA 3TPUA 1F97A 1YEHH 4L8DA 2Q6WA 4ODWA 3P4MA 4OIIH 4PLNC 3DSFL 2QQLL 3TYGL 4HIXL 2Q7NA 1U91A 2D4DA 4OUOA 1OHQA 4H1LH 4XZUA 4QHUB 1BOGA 2WLZA 5CEZL 2VKXA 4E9LA 4PJBB 1E6OL 5DT1L 3GSNB 4YO0B 1F3JA 4NNPH 4WHYH 1U8OB 1N64L 4QF1A 4P23B 4J12A 4KJPD 1ROWA 5DDHB 3RWJB 1NLBL 2WSKA 3QUZB 3Q3GB 1YMME 3LKOB 2ARJB 5C0GA 2YS4A 2FNBA 2EEBA 3GSVA 4JFXA 3ROOA 2A6KB 1LEGA 4RNRA 5TFSH 1CDHA 1RZIA 4JDVA 4M48H 1EGJA 2NXYC 1S7QA 3ULVH 4NSKB 1KJVA 4C56D 1QR1A 1QSFA 3CFKA 2NX5D 3ARBB 3IKCB 4XX1E 1FZKB 3EYSH 3HS0B 4ZFOB 5BV7H 5HJ3A 3UCRA 5C2UB 1PKOA 4G8FB 5KN5B 3DPBA 1E4WH 2OXGA 5DK2A 3U36A 4G8EB 3QCVH 5AZ2L 3MTRA 4KK5D 1RUKL 5HYJA 1QFWH 2Z4QB 4PS4L 4GFTB 1OP9A 1PG7L 2CDFA 2AERT 1BD2A 1FORH 2EC9T 2VR9A 1UJ3C 5IQ7H 1IGMH 1PG7X 3H9HB 4G8EA 1RU9L 3V6FA 2CIKB 3C5ZC 3GMLB 4MSWA 4L29A 3ULUE 3L5WB 2OMBA 5D7SH 2LE9A 1MUJB 4DN4H 1DBKL 1RIVL 5HGBB 3RY4A 4X5WB 5ACLA 1MHEA 4HFUL 4ZFFA 3ROLB 1AFVH 3T3ME 1BAFH 5J12B 4CJ0A 2YBRA 4LARH 4WO4D 2NY2D 1WWWX 2XN9E 3B2VH 5D4QA 5CD3A 1A7RH 3OXSA 3D87B 1KCKA 2R29H 5GS0H 2V5YA 4OZFH 1L7TH 3IDNA 4XPGL 1DDHB 4N8CL 3FO1A 2P8PB 4GMTH 1F3DJ 2CGRH 2EKJA 4DCQB 3X11B 5C3LD 4APQC 4X4MA 3T4YB 4Y2DB 5HHME 4CN1A 4LBEA 5GZNC 5KVEH 2VLJB 3M8OH 4UOW0 4UBDD 2BMKB 2GJ6E 3HG1D 1DQML 4QRRB 4MNGB 2CRMA 5E2TH 5DJDB 5HSFA 3VXMB 2F15A 1FYTE 2H41A 3DSNA 3NZ8A 2Z35A 2FIRT 1P4IL 2YPLD 2F5AL 5CJ8A 3D85B 1KPVB 3D39B 3TFKD 4Z95L 1VFAA 4XB8A 2B0SH 5DVNA 4OZIB 5DS8B 1EPFA 2NX5A 3SKJL 4QRSA 5A2KH 4ONGL 1P4IH 3Q6GL 2MNUA 4NRZA 4Z7VB 4MJ5B 1MFNA 1GGCL 4D0BB 1YY9C 3HCVA 3R06B 1BBJA 2DLIA 4LU5L 4HUKB 4Z7UE 3DXAA 2UZYB 1TZIB 1U6AL 3HI6H 2JCCA 5DEGB 3TBVA 1JPTL 1I75A 2C3GA 3ALPA 1OD7A 2H3NB 4RCAA 2FHCA 3KDMA 2GY7B 3JXAA 4I5BB 3QG6B 1D9KB 1DBMH 4HKZB 3TGXA 1LEIA 5ACMA 3VFGL 1DZBA 3P9LA 4WY7H 4PJDE 2CIIA 2XXMB 5E5UB 3BKYH 5C0DB 1YY9D 3GIVA 4J3XA 5ADPL 1KXTB 3VFRA 2FD6L 4FTVB 1NCCH 4PRHE 5MEOB 5JORA 1HWGB 1YEEL 4LVOB 3LDBC 2EE3A 4ODBD 3DXAB 3SDDD 1HILB 3MX0A 4ZQKA 2YR3A 2G5BA 5EZLB 4JFED 2VLRA 1U3HC 4PJBE 1LD9B 5B21A 4LQFL 1I9JL 3VWJA 1I1AB 3BH9A 4Z7WE 3OWEA 2B4CL 4PRAA 4U49A 1VCAA 5EOTB 4OLEA 1XGTA 4LKCB 1IAIH 1LD9A 1T20A 5GRVK 4MZ3A 5EIIA 3MRNB 3TVMD 2DQGL 1MRCL 4U7KA 4CMHB 5DHVA 3EOTH 2PUQT 1VENA 4XAWL 3RJDA 3ULVC 5KVFH 1KCRH 3UXFA 5KS9B 4HAFA 1G9EA 3U9PL 3KYOA 4WEMB 5C08D 3MRMB 5DTFA 1WBZA 2DRUA 5I1EL 4RDQF 3MOBL 5HYQA 5BRZA 4LSRH 3NFSL 1G7LA 5FHAH 1X44A 1KSRA 3KYOB 5ENWA 1DUYA 3MMEA 4HMDA 3SDCA 3P2TA 2FIKB 1G1CA 4D0BA 3TBVB 1O5DT 1NCNA 4PRDA 4FZEL 3IXTB 3MLTB 2ZKHL