1J8HD

Crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
201
structure length
198
Chain Sequence
b'QSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVSESPFGNEKLTFGTGTRLTIIPNIQNPDPAVYQLRSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Structure of a complex of the human alpha/beta T cell receptor (TCR) HA1.7, influenza hemagglutinin peptide, and major histocompatibility complex class II molecule, HLA-DR4 (DRA*0101 and DRB1*0401): insight into TCR cross-restriction and alloreactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 198
sequence length 201
ec nomenclature
pdb deposition date 2001-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j8hD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j8hD01
4DKAA 2Z93B 3U0PA 4UIMA 3UBXI 5IP4A 2K7PA 1NC2A 3IS0X 2KL6A 1AIFB 4IRSA 5JIKA 1AXTL 5MP6L 2Y5EA 4WTZG 3ARVA 1YEJH 4AM0B 4QY8A 4A6YH 5ACZB 5F7WC 3RTQA 5I8OH 4Q9BA 1S7SB 4HG4K 4R8WH 3VE0B 1VGKA 5EZIH 1YQ2A 1ZA3A 1F42A 1P7KB 5FDWA 2NY1D 4OFPA 4HGWA 2PW2B 1FZJB 1G7QB 3V7MA 3DI2B 4Z7NF 5KAQF 2IAMA 5CKGA 2ICEA 2V5RA 3TCLB 2DI9A 2PO6A 3KYMB 1N2RB 1NCWL 1YEKH 4PUBH 2F54E 5BV7L 1YN7A 5IMOB 3BUYA 1UENA 1H3WM 2VE6B 4RGND 5C0CB 1CL7L 3BN9C 4IMKC 1GPOH 2VOTA 4PG2A 3HG1E 3HAEH 4JY6A 5TFSL 1IEAB 4NKOA 1YNTB 3GK8L 5FGBC 2FHFA 4OM1L 3W11D 4J3XA 4PGJA 2R1YA 3LZFH 4OZ4A 1OP3H 1CK0L 4I18A 2DIAA 1NUFA 3KPSE 3O0RH 4Z0BL 5EOCH 2W65A 5EBMB 3TA3C 4X6CB 2X70B 2XV6B 1IGMH 1JBJA 2LV4A 5JUEL 5JOEA 4TUOB 1FL6B 1Z9SA 2IGFH 4LARL 3FFDA 3Q1SH 3ZE1F 4GBXD 3GIVA 4HLZG 1A0QH 1IM3A 5SWSA 3EFDL 1G9ML 3DWTA 3VFWA 5C07E 5C7XL 3ARBD 2PTUA 3U4EA 1CT8A 3GMOA 4FXKA 2J7LA 2UWEB 1HHIB 1XR9B 3JWDH 2M8XA 2VLRB 2Q7YA 3LRSB 4PJ8B 4ZTPH 4KKLD 4NRXA 5KG9A 2PYEB 4ZSOB 2VABA 5MEND 4Y89A 1AO7E 1TPXC 1CGVA 1WTLA 3AS0A 5CMAB 4HKZA 4RDQF 1KPRA 4HK3J 2HYMA 2RB8A 3CDGB 2AEQH 3V4PL 3MR9A 2D7TL 2VLJD 3QDGA 4ODVL 2ZUWA 4U1GC 1QA9A 3O2WL 4Q58C 4X6CF 4Z5RB 4CKVX 2DYPB 2CLVA 1A3QA 4JY5L 4Q9QL 3BDBA 4KMTH 3M8OL 2PW1B 1EH9A 1R3IH 1ACYL 4K94H 5JW5B 5E8DL 2YA1A 5JXED 3RUGB 4WFHD 1TTFA 3L95A 3FFCD 15C8H 4KUZH 1HHJB 5GGSB 3NA9L 2UWEF 3MCG1 4ZFZA 5L88L 2CH8A 4M61A 1TQBC 1QLFB 2H32A 5C6PB 4PLJD 4PGCB 4EI5D 5DJ2B 1NKOA 3ARRA 3KPPA 5IHZA 4U1GB 1X5GA 3DIFB 1UCBL 3MJ7B 4HJ0D 1ORSB 4RNRA 2D4FA 4JDZB 4FQPA 5IUSA 4FQCH 5E99H 4NQDE 3DMMC 1SVZA 2Q7NA 4RGNB 4HF5H 1I1AC 4XCFL 5CLTA 2Y36H 2QQLH 1A7NH 2NX5E 5JNYA 5TQ2H 1QSVA 4XC3H 1VFBA 4HEME 3JWNC 3RWIA 1XGUA 1QYGL 5BOZG 4QHNB 1IGCL 3TO4A 4JQXA 5DD6A 3CVHL 4OFVA 5I1DA 1YN6B 1S9XB 1SM3H 1ZLWH 1VCAA 5DJDB 4K2UH 2I60H 4JFHE 4YHPA 3UTTE 4XNXL 2EO9A 4LSTH 3G08B 3O3BB 3WFCH 5TE7L 3DMMB 2DLEA 4XPAL 5IQ7L 3RKPA 3VFSA 4HS6B 1ZA6A 1MFCH 1U6AL 3QUYA 3VXSE 4OB5L 4N8VG 4QOKB 3VWKA 2V7HB 1K3ZA 3FQTA 3QXAB 3ILQC 4LOUC 3AS3A 3GSVA 3V5DA 1ETZA 4HK3N 4Z7NE 3ARGD 4LRNL 3G9AB 3WDJA 5L2JA 5C2UB 1CGTA 4Y4FA 4JM4H 4K3GA 4NZRL 1P1ZA 4D9RE 1ADQL 2HLAA 3Q5YA 3BZDA 3EYUL 5FCUL 5AD0A 5AZEL 1LD9B 3QRFM 5HJ3A 3WIIH 3FO9B 3C8KA 3IFPA 1DN0A 4NGHH 4PJXB 5FAAA 5DJ0A 3FT3B 3BYYA 3X3FL 1EHLH 1NAMB 4MZ3A 3DTXA 1X5HA 2E9JA 2QSVA 3BP4A 4LLVA 1JI2A 3IDUA 3D85D 3PXJA 4YIQA 4NNPL 1RIUH 3INUH 3QHFL 1FQ9C 5T5FH 2MCG1 3WCYA 1PG7X 3QP3A 4F7MB 1CICD 2BHZA 5F7NC 5J56B 5DK0A 2VZSA 5KSAA 4P2QA 1QNZL 4I8DA 5JOPE 1A4KB 3HI5L 5JW3H 4EI5B 1JN6A 12E8L 3Q6GL 1NCBL 4WNQA 3U4AA 5I30L 1A6ZB 3QWRD 2X40A 5FGCB 2OL3A 3RL1B 1NBZA 2D03L 3UTOA 2Q8AH 3JWDC 3BYTA 3ZHKA 5FYKU 3QO0A 1RJCA 4K7PL 2VH5L 3RWEB 3E6HA 1G6RB 3NCBB 1NDMA 4Q9RH 2O61B 5B39G 3ARYA 2RCSH 5E03A 3OBAA 4IIQC 4PJXF 5EBLB 3PJSA 1D9KD 5GSRA 1KT2B 2J6EL 1TVBA 1AGEB 5GS2D 4MNHB 4YDKH 2A9NL 5EZOL 5L2KB 1CVRA 1XGTA 4JVPA 3KPSA 2WUCL 4X83A 4HX1A 1G7PB 5EO0B 3LMJH 5FYKL 8CGTA 3EDEA 5FFLA 5F21B 3LS5L 5EC2B 1XF2A 4UQ3B 3VD3A 1S7WA 1LDPH 4K94C 5HI5D 4JHAH 1M71A 4U33A 1KXVC 1S9YB 2NY6D 1C16A 4OGYH 4PFEA 2X4PB 3KYKL 3OJDA 3MUZ1 1S7VB 3FB5B 5FKAB 2FX8H 4LCIL 1HHGB 4YWGH 4IIQB 4NM8L 5LXGH 3K8LA 4HPOL 3F7QA 2BVTA 5K9KB 2JCCE 1HIMH 1TJGL 4LLWB 2EDRA 4GXUM 3ECBA 3BPLC 1AP2A 1NEUA 4N0CC 4QHUB 4YHLH 3V7AE 1AO7A 3FB6B 3HZMA 2BCKA 1I3GH 4CJ1A 3LSOA 1F45A 1PSKH 1JWUA 3I6GA 4FG6D 4LSVH 5IVZB 3CPLA 2F19L 2ICWA 4XMPH 4M62H 3SHSA 5D7IB 1D5ZA 1HOCB 5E2JA 5IOPA 1QVOA 1C08B 3SDDD 4XXDA 1LO4L 1KJ3H 4JZJA 3VFGL 4AH2B 1CQKA 3LQAH 1FVDB 3PWUB 3FO2A 4NZUH 5GSVB 4GQ9L 3D9AL 4PS4H 2R29H 5MEOA 3TBVB 1R3LB 5FYJH 5M95B 4O2EA 3BPLB 3HI1A 2ESVA 3MZTA 1CICB 3WDHA 3E3QC 3P11L 3SDAD 4BUHA 4Y0GA 5C8JA 4F2MB 4KDVA 4NQXA 3S3PA 4XVJL 5CZVL 1CFQB 1T1WA 2GI7A 2FO4B 4KJQC 4OGAC 4HS8L 4NKDA 2HJKA 1UC6A 3LS4L 4NZDA 4RRPG 5ALCL 1XGQA 2VLMD 2F8OA 1JPTL 3EJZC 4ISVA 4NKMA 1UACH 1MFDH 2HVJA 4PB9L 5IWLA 1T66D 1EVTC 3LD8C 5D7IF 4XCYA 5CEYA 5GIRA 2X9YA 2NY6C 3MV7E 43CAB 2R0KH 3BX7C 3SGKA 1BIIB 1OAXL 4YHKH 1M05A 5BOPA 5CJXC 1DUYB 1D9KB 1GGTA 3CCHA 4OF0A 4BQBA 4MAUH 1XCQA 1CF8H 1DBBL 4OV5A 4M6NL 4B7LA 1M7DA 4NO0A 3QQNA 1P69B 2ICWJ 1FHGA 4X4YA 1OGTB 4AEFA 1K2DB 4CGTA 4YDLC 5DF0A 4XNMB 1S9VB 3G04B 3DX6A 2PCPA 4JN1H 4L8BB 1OY3B 3LD8B 5I18H 2NY6B 4G9FD 4OCWH 3H9SD 2VDRH 2JJVA 3QFJE 1S5HA 5DJZB 1L0XA 2FH8A 4WWKA 1XMWA 4GW5A 4LRIC 3PWLA 4JAMB 2IAND 4MHHG 3KJ6H 1LK3H 3VXSA 1A02N 1FV1A 2HT3C 3S4SB 4HPYL 1QFWI 2XXCB 4HKJA 4KTEH 5H35B 4ACPA 5ISZB 4J6RL 2FX7H 4GSDH 1JGLL 3MJ9L 1G7MA 1I9IL 4YX2H 4YDLB 4TULL 5TE6L 1D5XB 4H25B 1PQZA 3IFOB 1N5AB 1NFIB 2BFVL 3P3YA 4XVSL 5ID0B 1BQSA 1TZGL 1U3HD 4EIZC 2JK5B 3V8OA 2CDGB 1EA9C 3F5WB 1AIFA 1HNGA 1EIBA 5I1JL 4Z7WB 3DGCR 1IKNC 3CUPB 1MELA 2FZ3B 3UDWC 4AM0A 4DGIH 1QR4A 1LO2H 2EC8A 2EDQA 2VKXA 3E2HB 5ACZA 1MCOL 5LGKA 5C0ND 1M6OB 4FZ8L 1S7SA 2C4FU 2DQTL 3VE0A 1T83C 2ICWI 3HRPA 5I8CB 3MRNB 1DUZB 3MMEB 2IFFH 1KJ2B 3CH1A 5GRYA 2AQ3A 1P7KA 4X80L 4U3CA 1IQWH 2PW2A 5LJYH 2JB5H 3ZYOA 4U1MA 3OL2A 1W0YT 3TCLA 3BGFC 3KYMA 5FGCE 1N2RA 1LO0H 4DGYL 2BMKB 4KMLB 3WHE1 2R56L 1MFEH 1I7RB 5HYJB 4JB9H 3MLRL 4WIQA 3GGWA 4BQ6A 5CBEB 2VE6A 3WLBB 2OJZH 3H3PL 4KTDH 1ZS8B 2XZAH 3TNMB 3BT2H 4Z7WF 3X14B 5E0QA 1AFVH 1N64L 4YGAB 1YNTA 1EEUA 2FCBA 4E0RB 3E8UL 4MXVF 1DL7L 5L2KE 2AVGA 4P23C 4OI7A 2OMBA 4LCCC 4UT9H 4OCSH 2CO6B 4U3XA 1QPPA 4R2GD 3G5XB 5EBGA 5IJKC 4X6CA 3QAZC 3BGFB 3LQAC 3B5HA 4LHUD 5IEKB 3MOBH 2H8PA 1FL6A 3R1GH 4LSRL 4S1RL 4UTBH 3RA7H 4CMHC 5ADPH 2BNQD 1P7QD 1HYSD 4K55A 2QQNL 1C12B 3OKDB 3D18B 3PQYE 4G9FB 4MHHI 1Z9OA 3QG7H 4AZ8A 1RVFH 4IMKA 4I0KA 4AENA 3FOMA 3MLVL 5C9KA 1D5IH 5E00A 5FGBA 2QADC 1HHIA 5EO9B 5IIEA 2I9LA 2IALA 1OL0A 3RWJA 4P23B 2XACC 1RZJL 1QSFE 3LRSA 3N50A 2Y1VA 4LCCB 1S78D 4QTHA 2B2XH 3U9PL 1FL3B 1KJVB 5E94B 5C6WH 1AD9B 4Z78A 1TJIH 1ORQB 4PJAE 3TA3A 3QAZB 4WW2C 4Y5VC 3SCMD 4UUJB 2OYPA 2A9MH 3CDGA 4OLUH 2D9QB 4UZGA 3MJGX 2QQKL 4ZOBA 1BOGB 1U3HB 5B22A 1U8KA 2ATKB 5B3JE 5EN2B 2DYPA 3QQ9D 1UYWH 1MPAH 2HLFD 5KVGL 1E27B 2A73B 3V52L 3O3AB 2QADB 4R7DB 2HKHL 5JW5A 4OZIB 3D3VE 1JNLL 5JQHC 2XN9D 1RURH 4NCDA 3WJJC 4JRYD 1LVEA 3V7AG 2NXZC 4UMGA 3BHBA 1HHJA 5GGSA 4LAJH 1F02I 2J8UE 3A0OA 4APQD 3BIAX 1WT5C 4FRWA 2VTFA 1H15B 3ETBF 4WW2B 2JB6B 5EO1A 2VDMH 3REVA 1QLFA 4U2YA 5E8OA 4PGCA 2R8SL 1NLBH 5GZND 5HGDB 3LOWA 5DJ2A 2CQVA 3QPXH 3QULA 3AXLB 3KR3H 4PV8A 2FDBP 3F6IA 4NOBA 4JDZA 3LIZL 1N6UA 4LVHC 2HJFA 2C1OB 1SMAA 2R1XB 2NZ9D 3TJEL 1CU4L 5ALBL 1GXEA 4KI1A 1TJHL 3CFBB 2NXZB 2ZUQB 2MWCA 4KI5D 3WUWG 4EUPH 2NXYC 4QHNA 5FXCH 3S36X 4UT7L 3GDBA 1FNLA 1RZGA 4TNWK 4OZIF 4HWNA 4K9EC 1YN6A 5AZ2L 1KPVB 1T21A 4E41D 5JOFB 5FHBH 1JNNH 1PX4A 4OJFL 1CDHA 5DRNB 4Y19B 2BJMH 1WV7T 5ICXB 2AEPH 2OZ4A 1T03H 3ROLB 1BVKB 4W81A 4WW2F 2BHUA 1K5NB 4KROD 1W8OA 3NFNA 4FXGB 5IF0A 4XCNB 3DMMA 2I07B 3DV4B 5GRUH 4LVHB 2DI8A 1I1AA 4OD3L 4AG4H 4NZTL 4CADA 5ABDE 1RSFA 2CKBL 1HK6A 4PYGA 4C56D 4P5KB 1XIWC 4QOKA 5J12C 4KVCH 5JPMB 3QXAA 4HC1A 5D1XD 1PG7H 1U0QA 4FQJL 2WP3T 1BBDL 5ISZE 3C2AL 3HNTL 4EOWL 2CK2A 2FD6H 1K4CA 4YXKL 2E6QA 2G5RA 3V0WH 1FG2B 2X4SB 4PIRF 4ZS6C 3OSKA 2OX5A 4QF1A 4YXHL 3X3GL 4A6YA 3K7UA 3RAJH 5D7SH 2NMSA 1LD9A 3QI9D 2NY4C 3G5VB 2RR3A 3FO9A 2ZSWB 4JDTL 4PJXA 1IC5L 4QWWD 3FT3A 4MXVE 2V2TB 3CMOL 1NAMA 5J12B 3WO4B 5CZXD 3V9FA 4JRYB 3T2NL 1QBLH 5F8QC 5F88B 1VFOA 5CD3A 4OCYH 5E6YA 2IQ9H 3HC3L 1MREH 4RGMC 4FHBD 1MJ8L 3CFJA 5I0ZA 1MFNA 1REIA 3WE6A 4LFHD 1NAKH 2CGRL 4H5SB 3U48A 3VRLF 3IYLW 4PJ5E 3V0AC 4UU9B 1KACB 3IDJA 2ZNWA 5IHUL 5SWQA 4EI5A 4OZHB 3SE4C 4HKXA 3HAEA 5E2VL 2MCPL 4U1JB 4HQQH 5D93C 2NY4B 2BSTB 4K71C 4M6OH 1T0PB 5HYJE 1NMCC 1A8JH 4OF8A 5DR5H 3RWEA 1GGCL 4JHBA 2O61A 2L7UA 1U3ZA 5ITBH 3MA7A 1OWWA 1GHFL 1INQB 5EBLA 3MX0A 3PGDB 5GISL 3W9DB 1KT2A 4N8CH 1AGEA 1BJ1J 4RBPH 5L2KA 5J6HB 4HXAL 4NHCH 1UKTA 2R0LL 2BXZA 4OF5A 1G7PA 5EO0A 1NCTA 4RSVA 1CGSH 3PDOB 2KH2B 5T1KD 3C6SA 3DUUB 5A1AA 1NL0H 2OK0H 4DVRL 4GAGH 4UQ3A 1MHPH 4NKIH 4KK8C 4N1HB 3JBG7 4XPBL 1NMCB 3WFZA 4FQLL 3L3DB 3RHWF 4Q9CA 2XKSA 3PQYA 4OZHF 1S9YA 2X4PA 4DFHA 1NJ9B 1R5VB 3GJEB 1A3LH 1S7VA 3FB5A 4G8IB 4C56B 3RFZC 4IIQA 1IEBA 3AMLA 4GKNB 4LPUA 5K9KA 1M7XA 5DQ9B 1QSFA 5D1XB 4UINH 1EEZB 2W38A 4LLWA 1S9WB 3HC4H 4NNXB 4QHUA 1C8PA 1GC1H 1N4XL 3FB6A 3OX8B 2XQBL 2E27H 4UBDC 5T3XH 5IVZA 3FT4A 1DQLL 1UJ3B 2CUMA 5D7IA 4HCRH 1HOCA 4OQTL 1ZHLA 3UTSD 2H1PL 4F7TA 1C08A 2O5XH 4JPWL 1F3DJ 5FYJE 3QI9B 3VI4F 4KQ4L 1N59B 2P8MB 1QBMH 4JM2D 4PJBF 5EOCJ 5B8CC 3P40A 3NPSC 3FN0L 1FVDA 4X0KB 1WCBB 3FB8B 3PWUA 5GSVA 4IRJC 4M5YL 4NKQB 3CVIL 1KCRH 2Z31D 4OZFH 3TBVA 4K7FB 3DHMA 3GMRB 1UVQB 3CFCL 4XPHH 5KOVC 3VRIB 2J8UA 1I9EA 1WGOA 3LH2L 3TT3H 3VXRE 4P2CG 2CXKA 5HDQL 3B2VH 5J0BA 2VSCA 1DQMH 3C5SB 3C60C 2ZCKH 5J13C 4PRBA 1F6FB 1B9ZA 1H3XA 2FO4A 4KJWD 3RPKA 2YRZA 5E5MB 1Q0XH 4UV7L 4JFDB 4TN9A 5B8CB 3MV9D 4KPHL 2R69L 3NPSB 4HK0B 1UM5L 5TQ0H 4NN7C 1RZKH 5KZCD 4IRJB 43CAA 3M45A 1VPOL 4DN3H 5D2NE 2EXWC 5T1MB 4YEFA 2FWOA 5EC1B 4NFDA 5TPWH 3VMOA 4JFOB 1J1OH 2XTJD 1MJ7L 2J4WL 4KVNL 2CIIB 5DGRA 2P46B 2EDWA 3V6ZA 3B43A 3C60B 4Z76B 1ZLVK 4U1SA 1VSCA 5E5UB 5CUSH 2Y5TB 1K2DA 5T1KB 2NY5C 3GSXB 4U6VL 3A6CH 2QHRH 5DC4B 1H9VA 1HXMB 4LCWE 4XNMA 3G04A 4LASL 5DDHB 3HNVL 4L8BA 3NMEA 4QTIH 4ODWB 4NN7B 1HXYA 4GRMB 4U7SA 2OTUB 1K6QL 1MJUH 5DJZA 5GXBB 1VA9A 3GSUB 5CP7B 5CJXA 5KN5A 5IBLC 3S4SA 1HHHA 2QSQA 4LEXH 1G7IA 2DAVA 4TYUA 5H35A 4HBCL 2AXGA 4HKBB 3U36A 5ISZA 1FFQA 4GRLD 1OF2B 1S7UB 1R0AH 5IM7B 4JPVL 5EU7E 2VJXA 4RMUA 3IFOA 4OCRL 2PUQT 2CDGA 2G5BA 3NCJL 4OFYD 2EDEA 4Z7WA 5T1LD 4X7CC 5CD5C 1KCVL 2FZ3A 4ZNCD 1C1EH 1JGUH 1YQVL 4LRIA 4JO4H 1VENA 4NZJA 4R90L 3R8QA 1NGYB 5E6ID 4U1HB 3JZ7A 2Z31B 3P4OB 3IFNH 2NR6C 4LBEB 5E8EB 1BOYA 3MACH 2HFTA 2OXHA 5I8CA 3BIBX 4EIGB 4HHAA 3MRNA 1DUZA 3KJ4C 4AYFA 4BM7A 1IMHC 4XTRD 1QACA 4HH9B 3GKZA 2LE9A 5CILH 2B20A 2HN7B 5J8OA 4PJ5A 2YK1H 1CE1L 4RGOL 1ITBB 2EDFA 1MLBA 2BC4B 3EYFB 4WVRA 2Y6SC 1IKNA 1E6OH 3MV9B 4UV4L 4GUPB 3ME0A 4JREC 3UDWA 4ODUB 5HYJA 1FE8L 1G1YA 3PGFH 5CBEA 5KZCB 4EDWH 5FIEA 2E5EA 1FIGL 4NQED 4W6XB 1ZS8A 4OZGF 3TH3T 5KJRL 3X14A 3A6BH 1T2JA 1A6WL 1EPFA 1GC1C 2DLFL 1T83A 3KJ4B 2XTJB 1EGJA 5J1SC 4E0RA 2DKMA 1FZKA 4Z7OE 1T89C 4MJID 4YDVB 3W5MA 1IC7L 3VI4E 4LK4A 4PJBE 3MTRA 5DVKA 2Q76B 3QUKA 5DD3L 5EG6C 1EJOH 5IEKA 3WNNA 2COQA 5C0GB 4GG6B 4U4BA 3MV8D 4PJCB 3FQUB 4JREB 1AY1H 1C12A 3R06B 3OKDA 2YBRB 2FEEI 1OAQH 3D18A 3JV5A 1D6VH 2B0SL 4JKWA 3MV01 3IAGC 4N5UA 5BS0D 3T2OA 1N7ML 1T1ZB 4KKBC 3ZKXC 1HKFA 1DBMH 4ZXBC 1KUMA 1RUKL 4P23A 1MH5B 1VADA 4LCCA 5CSBA 4H1LG 3ISWA 4HMDA 4GRLB 1A21A 1FL3A 1KJVA 4JLRB 5E94A 3MGOA 1QLRA 1AD9A 3VXUB 4ZPTB 5IJKA 1ORQA 4HUMB 1ZLSH 4LPTA 5AEAA 3K2UH 5C86A 3EDDA 4O5LH 4NUJA 4WI8A 3ZKMD 4QRPE 5GGVL 2ATKA 1ZHKB 4KHXH 4BFIA 4L3ED 4P46C 5T1LB 1B0GA 4MA7H 1A1OA 4GG6F 5L8KB 2L4OA 1E27A 2GY7B 3BQUD 2DQGH 3G6JB 4R7DA 4ZXBB 2A77H 3WKML 1P53A 1MIEH 2R23B 1EUTA 3CLEH 1OAUH 2L0DA 3S36H 4KJYB 1QZ1A 4XAWH 1B0WA 2EIDA 1HH6B 1S7TB 4M7LH 4BELD 2P5WB 1EXUA 2ZUTA 2D0HA 5TE4H 4WUKL 1H15A 3CLFL 4WW2A 4Y5VA 2JB6A 2HT2C 5DYOB 2X42A 1CGWA 4KK9C 3OWEA 2AXJA 1TFHA 5H37G 5MHSE 1O5DT 4P46B 4ZQKB 4HFUL 4JFDE 3CC5B 1U8JB 4YHIB 1UB5B 2HMID 3WS6C 2WK2A 2E7CA 4V2CB 1J1PH 2A6JB 3U4BH 2R1XA 1MFBL 3KAAA 4J3SA 2K1MA 3ZL4H 3WJJA 4PLKC 3O6FD 3GMQB 2XZQH 3G6JF 1U2CA 3SOBL 5DUML 1WT5A 3IU3B 3AAZA 5C0IA 4O2CA 3BKML 1V7ML 3IDMB 3KG5A 2CO7B 5JOFA 4IS6B 1KB5L 1J87A 1FNHA 5DFVD 5BVPL 5DRNA 1U92B 3O45B 4Y19A 5ICXA 3HE7D 3V5KA 1KNOB 1BVKA 3TV3L 1K5NA 4ALAH 5SX5K 4HUVA 3ZYIA 4XCNA 3DV4A 2I07A 3ZT5A 1NLDH 1WWAX 5IW6A 1W8NA 1TZHB 1I7TB 2ZUVA 2YA0A 4FFWD 1WZMA 5BS0B 2LVEA 3U30C 5I19H 3GSNB 3HZVB 4PR5A 4JG1H 4P3CH 5IFHL 4WRLA 5I71B 4ZS7H 1W72B 3HPJA 3EW3B 2DM4A 3PNWA 3QDMB 3UTQA 7CGTA 4GXUN 1EAPB 4LLMB 2X4SA 1MRFL 3MRRA 3EDFA 1CLYL 4UIKL 1TVHA 4HJJH 4X4ME 5I75C 5HI4D 4OZGE 3VRJB 1WBXB 3G5VA 2CUHA 4I3RL 4P2RE 2ZSWA 2X4OB 3OAUH 3MO1B 3OKEA 4QO1A 2V2TA 1XIWA 2EYTB 5ESAA 2AEWA 4JRYA 2Z8RA 1I1YB 5EUKB 1MWAH 1QRNE 2APVA 2X4QB 4H5SA 3S35L 3VG0H 5IGXL 1BQHG 4BK4A 4UU9A 3TPKA 5JA9A 3OHXB 1Z3GL 5DMKB 2EICA 4OZHA 3MSPA 5KVFH 4QHMA 3OG6B 3VH8G 5CJQH 5I75B 3RI5K 5JA8B 2BSTA 2N1KA 1JPST 1RULL 2OI9C 4IOFC 3IAPA 4Z7UB 4PJDB 2F58H 4WCYL 1LEKB 5C09D 2ZUUA 1U42A 4DZBB 1FH5H 1OPGL 3DURA 4ZFOA 4XX1E 4LNRB 3STZB 2QKIA 3D0VB 1INQA 2VQTA 4HUXB 2A0LC 3U0WL 4D94A 1A3RH 3PGDA 3W9DA 3GMLB 1FP5A 2CXGA 5J6HA 2C3XA 5EORH 1U8LB 3ARDD 4DKFL 4KJPC 4JY4B 1T5WB 2FB4L 3LY6A 4U6HB 1MRDH 5IMKB 4P4KC 3FL7A 3SE4A 1C5BH 3ARSA 4PJBA 4J3WA 1DQDH 2VITB 1SQ2N 5D7LB 4O2FA 4CDGC 4XI5D 4EZMA 3L3DA 3AMKA 3ZLQC 1UWXH 3P4NB 4I77L 4B53A 5I1CH 1RJLB 1NJ9A 5J6GA 1O7VA 1WUNT 1FBIH 4JGJA 3FN9A 4Z7UF 2OP4L 1AGBA 2J88L 5T3XE 4GKNA 4PJDF 2XYCA 4TPRH 1MHHB 2C5DC 5DQ9A 1EEZA 3OB0H 2UZYB 1BGXL 2F5AH 2O93L 2BY0A 3QDJE 4JFQA 2V17H 1BVLB 2XKNB 3OX8A 3QUML 1LP9B 2BRRL 4YO0B 4U1LB 4MD0B 2EYRB 1CYGA 4ZFGH 2MQCA 3SDCC 5C0AE 3W2DH 3H3KA 3MNWB 3V0VB 2V2XB 3QI9A 3WXWH 1N59A 2P8MA 3P77B 3K46A 1T2XA 3VWJD 1LEGB 3S5LB 1WCBA 4JFEE 4XHJD 5D70H 3CSYA 4HJGB 5GJTH 2YUWA 2ICES 3VFNA 3MC0A 2BVEA 1PW3A 5HGAA 1K4DB 2XPGB 5HHVL 1UVQA 3FQXA 1F4WH 3Q48A 1GZPB 1F6AA 1YY8B 3F58L 5L7XL 1KENH 3WUZA 3C5SA 1EEQA 5EU6D 3SGEH 3SDCB 5T3ZL 3HMXA 2EXYD 4HUNB 5C0RL 2ADFH 2R9HD 5EUOB 1NGXA 4M7JH 5E5MA 1LP9F 3EOAB 1T7XA 3MGTB 4JFDA 1QD0A 3OAZK 5B8CA 4JO3H 3WDIA 3T8XB 3BWAB 4QXUL 4XWGH 1A14L 4IRJA 2KQNA 4WI7A 3EYQC 1YJDC 5DUPH 4ERSH 5T1MA 3C9NB 1IJ9A 2DBLL 5EC1A 3REWA 5DJXA 5DA4A 4U1KA 1YMMD 5I1EH 4UDUA 1OSZA 4NJ9L 2CIIA 4FN0A 3GRWH 1VGEH 3ARDB 4IRZL 3C60A 4Z76A 4MAYD 4B50A 4XNQA 1T5XB 5L8LB 4N68A 3GJFH 4R0LB 2DQFA 4YHNB 1SYSB 2JJUA 4OT1L 5T1KA 4X99B 1AQKH 3S9DB 1HXMA 3L7EB 3EYSH 1OTTD 4U2ZA 4EUPG 5F6IC 4Y16C 5DDHA 5GGTH 5I16B 1TNMA 1IT9L 4ODWA 3WD5H 2H3NA 2DLTA 2GJZB 2OTUA 1HKLL 4DGVH 5EUOF 4HWZA 4C55A 3O3DA 1Q9KA 5CP3A 5SWZD 5CP7A 1U8NB 3TIEB 4LIQL 1A2YB 3P9MB 5GGSY 3KPRD 3KWWB 4PB0L 3WN5C 3UC0H 4HKBA 4YHZH 3MXVH 4G6MH 1OF2A 2P43B 1KB9K 2OMNA 3QDME 1T7YA 1Y0LB 2C3WA 2VRAA 4UB0H 3ZZ1A 3VXTA 1IGTB 1EEYB 4Z8FL 3SGJA 4Y16B 2W9DL 2R1WA 2X89D 1R3KB 3NIGF 4TVPD 3RJDA 3P0YL 5E2WL 5JHLL 4BFEA 4OZGA 3P0GB 2AJVL 4QKXB 3ZTJG 3LKNB 4P2RA 3WIHA 4GRWB 5D72H 1NCCL 4PP1C 3BN3B 3B9KD 1NGYA 3FRPA 2VLLB 4U1HA 1EK3A 4J4PC 4PRIE 4O4YH 3VFVB 1YC7A 3OZ9L 3P4OA 4G6AD 5AAWA 2FX9H 4LBEA 4PLOB 5E8EA 3WN5B 4XBEH 4UTAH 1KLUB 1X4ZA 2BNUA 4X5LA 1QRNA 4XAKD 3OXSB 1RJYA 3EIFA 3FMGL 4HH9A 1UADC 5I8KL 1FO0H 5IEHA 3TJHC 3OJMB 3C5ZD 1DR9A 3RX5A 1B6UA 4NO3B 2BC4A 1C5CL 3EYFA 43C9A 4CMMB 4AJ0A 4RFOL 2VXTH 1KULA 5I1LB 5JR1H 2VXSH 3ILPA 3VCLB 2B4CH 3T0AA 3I02B 2R4RL 3RVTD 4GUPA 2WM0A 4ODUA 2IG2L 5DD0H 5HTSA 2VLJE 2ORBL 4TSAH 5B4MC 1JFQH 4S1SL 4O9HL 3T2QA 1BQLL 1O7SA 4GRWF 1KC5H 3ARTA 4ELMB 4P9HL 5J3HC 2A74B 4CAGA 3MBXL 5GS1C 5D7JC 1XF5B 5C2BL 1JK8B 1AXTH 3HPLB 3LEYL 4MAYB 4M1DH 1WFTA 5CSGA 2DN7A 3FFCE 3PXHA 1NMAH 3GMPB 3KHQA 1SEQL 1OGAB 3HB3C 1RZFH 5C0GA 4GG6A 3FQUA 1FNEA 1JZ5A 3R06A 3O4LB 5CIPB 2O5ZL 4XX1G 3KXFD 5SWZB 4DTGL 4WO4C 4XNUL 4BH8A 4S11A 1JF6A 5TDNB 1I1RA 1I3UA 1MH5A 5GS1B 3PHSA 3UTZB 3TCXA 5INDB 1NCWH 4R4NC 1CDUA 3QDJA 4JLRA 1T89A 5BV7H 4ELMF 3VXUA 2ARJQ 2GFBB 4X8JB 5T5NG 1LP9E 2R0WL 2AGJH 2F5BL 2GSGB 2NY3D 4BUGA 3S6CA 5TFSH 4M6ML 1EZVX 5C0AA 3GK8H 1U8OB 4KXZH 4OM1H 2PXYD 1CBVH 5T1LA 1YC8A 1CK0H 4Z0BH 2HRPL 1T4KA 3VXMD 3B9KB 1TETL 3G6JA 1QFOA 1IGFL 1WK0A 5TJWK 2AV1A 1BFTA 4ZXBA 1KF9B 2CK0L 4MLSA 4CNIB 3FONB 2XTLA 5JUEH 4KJYA 1UCTA 4LARH 1WFNA 2W92A 1HH6A 1S7TA 2HVKB 2P5WA 4NN5C 4TTGA 2I5YL 2LU3A 4PJEB 1YYML 3PP3K 3C5ZB 3L5WB 3EFDH 3H42L 5DYOA 1G9MH 5JW4N 1U58A 4ELKB 3QCTL 4OZFG 4PRHD 3BE1L 4P46A 1HWHB 4POYA 2AEIT 3CC5A 4XRCA 2GTWB 4M8VA 4YHIA 1IAMA 3FQRB 4XP4L 3MUGB 2WIMA 2A6JA 5C3TA 4BH7A 4CU7A 4WJ5B 4AIZB 2VDQL 2PYFB 5HBBA 4R4FH 1QEWA 4EBQL 1UM4L 4UILL 2D7TH 2VIRB 1DBKH 4NN5B 4ODVH 4OCXL 4XP5L 4O00A 3IU3A 3EKCA 1MNUL 1FFPB 3O2WH 1JZ8A 3IDMA 2IJ0C 4W70A 4IS6A 4JY5H 3NIGE 4PJ9D 4Q9QH 3GM8A 4Y4KD 1U92A 3M8OH 4M4RA 3O45A 4ODTL 1ACYH 4Y1AE 1KNOA 1L4IA 4PJEF 5E8DH 2DM3A 1ZTXL 1WEJL 3MFFB 5GGUB 3WS6A 4PRPD 2ID5A 4J1UA 4JFXB 4WI2A 5I73B 3NCYS 4U6XB 3NA9H 3WSQL 1I7TA 5L88H 4RX4A 3KPMB 4UI2A 1MCCA 3GSNA 1E4XL 5IBUB 1QSZA 3IJHB 3L7FB 1GOHA 4I48A 2NW2B 4F9LC 1J8HB 4LGPB 1BZ9A 3TWCL 2YPKB 1YEFH 5D6DC 4OLZL 4JVUA 1EBAA 5I15L 1F4AA 1ZGLB 1DCLA 2B4CC 3DNKA 3QDMA 5F9AC 4XCFH 4PLNC 3BKYL 3RVWC 3B5TA 1EAPA 3S37X 4XPFL 1MAML 2AP2A 2NY3B 5CHNB 4LLMA 1IE5A 2NTFB 3GIZL 2ILLA 1QYGH 1IGCH 2VZVA 1WBXA 4IDLA 4BJLA 5DEGB 3CVHH 3SJVD 4X6FA 2X4OA 4JFFE 4ZD3L 3VXMB 3WYRA 4AL8L 4PRIA 4POZC 2EYTA 1CWVA 2VN4A 3FZUC 4XNXH 1I1YA 3TYGL 5EUKA 1KXQE 3OKNB 4LLYB 5TE7H 3WFEL 4NDMB 1QLEL 4M1GL 2RJMA 1Q9WA 2WLYA 3DX8B 4XPAH 4XMLH 4NWUL 2VL5B 4I13B 3OHXA 1OLLA 5DMKA 4PRHB 1U6AH 1TZIB 4HG4J 4OB5H 1KCUL 4AT6B 2X1WL 4JO2L 2N4IA 4ZYKB 4Z7UA 3VFRB 3DX7A 3O2DH 4P5TC 4PJDA 4GMSL 2IBBA 4JZNB 4LRNH 1LEKA 4DZBA 2FHCA 1RHHB 4LNRA 3STZA 1ZKAA 4N9OB 2CDEB 4NZRH 3NVQA 5FDYA 4G8EA 4HUXA 4FZEL 1BP3B 2IADB 1IM9B 2NYYD 1R5WB 3IKCB 3EYUH 4ONHA 5FCUH 5AZEH 1U8LA 1JWSB 2R4SL 1OWRM 4JY4A 1T5WA 4V1DD 4U6HA 5IMKA 2P24B 3X3FH 3JTTB 1VFMA 3VGEA 4PJGB 5ETUB 4HULB 2VITA 4S2SA 1FC1A 5D7LA 3I3DA 4KDWA 1FCCA 3SDXB 1P4LB 4L4TB 1A7OL 1T7VA 3OQ3B 5GS3A 1BECA 4NNPH 4CVXB 4P5TB 5DZNA 1Y6NR 4W4OC 5HI3C 1WWCA 1HWGB 2HH0L 3O6LL 5AYQA 4N90D 1H3TA 4OCNC 1QNZH 3HI5H 1JHTB 4OLXL 12E8H 1NCBH 3SQBA 1G9MC 5I30H 3UTPE 5BZDB 1R24B 5E70A 2AV7B 3ULUC 2ZUSA 5K9OA 2YN5A 1BVLA 3V6BR 4P4KA 3DJ9A 1Q72L 1LP9A 2VH5H 2Q20A 3WS3A 4U1LA 3CK0L 3JTSA 4I0PC 4MD0A 2GJJA 5K9QI 3UAJD 3IETA 4XWOD 5TDPB 3V0VA 2V2XA 2J6EH 2A9NH 3P77A 5EZOH 4PJGF 1IAIL 2V5TA 3QXWA 1LEGA 2P7TB 4WV1C 2WUCH 3SDXF 3MRGB 4MX7B 5FYKH 1B4JL 2G2RB 1UH3A 5FM4A 4FABH 1L6ZA 2V7NA 7FABL 4CDHA 4JFZH 3LS5H 3P73B 1K4DA 4DOHE 2XPGA 3DRTA 4L5FL 5F89B 3F65A 2ENSA 3WNMA 4BSJA 4PJEE 4OBSA 1ZLWK 3KYKH 4I0PB 5D7KD 4MQ7A 3RBSA 1B3JA 4ODBD 5A2JH 1R5IB 3SDCA 5DJ8B 3S98A 1YZZA 4LCIH 4G80B 2CMRH 2F15A 2VERN 2WINB 5EUOA 2JLLA 2EE3A 4HPOH 1NUGA 3SY0B 3EOAA 3QJHB 3MGTA 4MXQC 4NN6B 3ZO0A 4F37K 4WV1B 3T8XA 4QRTB 3BWAA 5FF6A 1ZANL 3DXAD 4XPGL 3K1DA 4MNQD 4N5ED 1GRWA 4DVBB 2P8LB 1QSEE 5J9PB 2F19H 3DX9A 3OKKA 1T1YB 4TNWF 5JXAL 3FOLB 1X5ZA 4X7TB 2XOTA 1KLGA 3QHZL 1OB1B 2X09A 1LO4H 1JGVL 4WW1B 2NY2D 5HGBB 4PY7A 1EHAA 4X4XB 3VFGH 3ULUF 1T5XA 4YHNA 1SYSA 4X99A 2EDTA 4GQ9H 2APWA 3D9AH 3L7EA 3HE6D 4Y1AA 5MI0C 1BWMA 3QO1B 1FNSL 4NO5B 2VC2L 1FNFA 4MS8D 5I16A 4PRNB 1MCQA 2GJZA 2W60B 3DECA 3IU4L 3P11H 3DETD 5F96L 1U8NA 4XGZB 3TIEA 5IMMB 3P9MA 3BW9A 4XVJH 2W07A 1KN4H 4HS8H 3FCTA 1KIPA 3RWCA 3KWWA 3LS4H 4LPCA 2EDNA 1JPTH 2Q86A 2EZ0C 3CZFB 2XZZA 3HN3A 2VAAB 4L4VD 5GHWL 2E6JA 4PB9H 3QQ4B 2HTLD 2ADIB 3FO1B 1Y0LA 3FJTA 1YDPB 4HLZH 5MI0B 1IGTA 2XG5A 1OAXH 4Y16A 3GB7B 4FFZL 1R3KA 4WHCA 4YDIL 5BJTB 2R39A 2BNRB 2HP4A 2GITB 5HYIA 2RFXB 4JN2A 2A2QT 1DBBH 4M6NH 3E6FB 2YRPA 2BNQE 3RGVD 4JFFA 4M48L 3V4UL 2E7BA 4KGJA 1U93B 5ESVB 2VLLA 3UBXB 3VFVA 4AIOA 3P9LB 1AE6L 3ZKQD 2WV3A 4U1NA 1S8DA 3WN5A 3UEZA 1KXTB 3QNYB 2VLKB 5E8NB 1KLUA 1HQ4B 2H26B 5BRZD 4YH6A 3OXSA 4JFPA 1ED3B 3QRGL 4K8RH 3MNZB 3T2PA 1NGZA 2HWZL 3ARFD 4HS3A 1RD6A 5B38B 2GYSA 4GO6B 4NO3A 5ANMB 1MJJB 5ESQB 3WO3B 3HFML 4PGEB 3N1QC 5I1LA 4ZTOL 4HPYH 3I02A 1BM3H 1EFXA 2X4RB 5HDBF 4MCYB 4HIXL 1NC2D 2I27N 4IRSD 4J6RH 3OKLB 4CW1B 1JGLH 3QFDB 1I9IH 4MB4A 4TULH 1KN2L 2BFVH 5LAXB 1SEBA 1GGBL 3JV0A 4ELMA 4XVSH 2J5LC 5BVJA 3RTQD 1TZGH 2A74A 3N0PB 2FEDD 1SJHB 3L9RB 3QT2A 1P7HL 1FLTX 5I1JH 1XF5A 1KV3A 2XN9E 2NY2B 2QSTA 1JK8A 5ID1B 3GMPA 3BRDA 3V5HA 3HE6B 1MCOH 3AFLA 1OGAA 3QZWB 4TTDD 4FS0A 2HFGH 1OTSC 3EFFA 4FZ8H 2IAMD 5FGRA 2DQTH 2PO6D 4RMWA 4BQ9A 2AJZB 3BP7A 3BO8B 3O4LA 3O11B 1V3LA 4X80H 1NCUA 3CD4A 1W0WB 5TDNA 3E1F1 1MCHA 1V3MA 1AGFB 1I8LC 5GS1A 5D7JA 3UTZA 5INDA 3ULVC 4DGYH 1PKQB 4L4VB 5C9JB 3H9HB 2R56H 2PR4L 1J0ZA 3G9VA 5CJBA 5DVMA 3MLRH 4KI5E 4F7EB 1CIUA 2GFBA 4X8JA 1H5BC 5IB2B 1VESA 1BIHA 1T22B 5LGJB 3H3PH 3TGXA 4GOSA 3L3JB 4E41E 2LU4A 1DE4A 2X89A 3BESR 3D39E 5GS0C 3E8UH 1DL7H 3QCVH 3GKWL 4LCYA 3B2UD 1U3JA 3W0WB 5EULV 4OIAA 4WO4A 3RGVB 3KLDA 1FORL 2YD4A 4NRYB 5SWSD 3LPWA 2Z4QB 4CNIA 1HEZB 4ZUWB 2P8PB 3RWGB 3HLAA 4KAQL 3ULUE 5AAMA 1A7PL 1UGNA 4FFYL 5BRZB 2HVKA 2QQNH 1TCRB 1H5BB 3FT2B 4HC1L 4YC2B 4PJEA 1A7QL 2DL9A 1M7IB 3MLVH 1Q9OB 1IQDB 5IB3A 4ELKA 3DVGA 1X7QB 2P48B 1RZ7H 5E7FA 4Y8AA 3QDGD 3FQRA 1NC2B 3U9PH 4EN3C 3GRWA 4F7CA 5I8OL 1DANT 3MUGA 3UPCA 2P47B 4QY8B 2IMNA 3VA2C 4Y5XC 1QSEA 3MGAA 4WJ5A 4AIZA 2PYFA 3LKRB 4EI6B 3BZ4B 2VIRA 1NAML 5BZWB 1WJ3A 5LGHH 4P2OC 5TF0A 5IFAL 4NJAL 5H8DA 3TN0C 1VGKB 1FFPA 2HTKC 3N85L 3ULVF 1ZEAL 2AK1L 5KVGH 3EOBB 5FDWB 3V52H 4LDEB 1FZMB 2HKHH 3OF6A 2IAMB 3WFBL 5L0QB 4HZLB 4DUXA 2OQJB 4LSSL 5GGUA 4JFXA 2C4FT 1AHWB 2Y7QB 4U6XA 3AM8C 4MZ2A 1QG3A 4OI9A 1HILB 2IBGA 4P0DA 1YN7B 3ET9F 3BUYB 3KPMA 4P57B 3EO9H 4K8RC 4J8RB 3IJHA 4PJHB 3R0NA 2NW2A 4P2OB 1G6RL 1J8HA 3JUYA 5E08H 4NKOB 3JWOL 5DT1L 4GS7C 1UZ6F 1T2QL 4OZ4B 3TO4D 4I18B 1UXSB 3LIZH 3S3SA 4WEUD 3PE9A 4U7KA 3H8NA 1PY4A 3CX2A 2EDLA 2CJUL 1G7LA 5CHNA 5HDBE 3TJEH 4LLQB 1OARL 4GKOA 5ALBH 1YNKL 3MNVA 4FFVD 1TJHH 1IC4L 2VZ3A 3BGMB 2A83A 5JHDE 4UT7H 3FFDB 5DEGA 4N0UE 3GIVB 5AZ2H 5CS7A 2ITCB 4NM4L 3UJJH 5SWSB 4OJFH 5MEQB 3W82A 4X7SH 4KKAD 4F9LA 3U4EB 4YE4L 1CT8B 2X2YA 4R26L 3QUYD 4RWYL 1A9BB 1WSST 5D6DA 5HVGB 3VWKD 3OKNA 5CFHA 4RMTA 1MI5B 1MSPA 2W9LA 4M93C 4PJHF 1L9NA 4NDMA 4P48A 5KG9B 2IMMA 2ZNXA 3WHE0 3T77A 4OD3H 2FHBA 4NZTH 1UT9A 2CKBH 1OT1A 3NIDE 2P5EE 2XWTB 1LE9A 1FLRH 4HKZB 4Y4FD 5ANME 1TZIA 3EHBD 35C8L 4LHUG 3MUJA 4AT6A 5FK9A 3SGEI 3T0EC 4ZYKA 3FAWA 4FQJH 1BBDH 3HNTH 2CLVB 3GMNB 3U46A 1RHHA 4S1QL 4GFTB 1Z9LA 5D96B 4YXKH 5C6TL 5I2IB 4YXHH 2XA8L 3X3GH 3UJIL 3NPZB 3RVVC 2IADA 1BBJB 1IM9A 4M93B 1R5WA 4XCCL 5FYLL 3IDGB 1JWSA 1DBAL 1MCLA 4ZFZB 1G0XA 4GMTL 4JDTH 1IC5H 3VXQA 2P24A 3LV3B 3HC0A 4M61B 3CMOH 5FM5M 3JTTA 1X9QA 5D1QC 5KSAD 1GH7A 1CXFA 5ETUA 4P2QD 1U8QB 4FQCL 1VB9A 3QPQC 4HIIB 3SDXA 1P4LA 1F58L 2K7QA 4L4TA 5I76B 3T2NH 1BWWA 2YZ8A 3KPPB 4CVXA 4P5TA 3HC3H 3BGAA 3GI8L 1QFHA 1MJ8H 1CGUA 3MLWL 3ULSB 1ZVHA 2CGRH 1LILA 4NQSA 3GFUA 4MA1C 2JKXA 4MDIA 2E6PA 3UO1L 4KGLA 5D2LE 3BWUC 5IHUH 3CGTA 1JHTA 3PHOB 3SKNA 4IOIB 2P49B 4KRPC 5E2VH 2MCPH 4HAFA 3RWIB 3EAKA 1A1MB 2AV7A 4H88L 1LE5B 4N8VB 5DD6B 1WQVT 3NACL 2RHEA 5I1DB 3K4AA 2DQIL 3KPSD 5L9DL 5D1QB 4NCC2 1GGCH 4HIJB 1OAKL 4YHYC 5FYKE 1GHFH 2DWDB 5C08B 3OJ2C 3NTCL 4G5ZL 3DSFL 4N9GB 1ROWA 1MY7A 3NZ8A 5TDPA 5GISH 1BVZA 4W4OA 3CFKB 2HFEA 3MLXL 2R2HA 4HXAH 3W0WE 4MA1B 2R0LH 5H94A 2P7TA 4MWFA 4PTUB 4YHML 2YXMA 1OW0C 4MX7A 5A40E 2G2RA 3I6KB 4LLUA 4WI4A 3UZVB 3KYNA 4LGRB 1ZA6B 5DURD 4A2LA 4KRPB 3QUYB 3P73A 4DVRH 3VWKB 1GVIA 4H0HB 5IJVB 4XPBH 4JM4L 3PP4H 3GSVB 4FQLH 4FMKA 1A6AB 4LP5A 3OGCA 1RZ8B 4I0PA 2EE6A 2FATL 5INCB 4YHYB 1AO7D 1JHLL 2CLZB 2WNGA 3GSRA 5DJ8A 4QRQB 3ZHDA 3GI9L 3RVXC 2DIJA 1P1ZB 4M7KL 2OR9L 1B2WL 3SY0A 3QJHA 3AGVA 2VWEC 1NC4A 3QH3B 5ENWB 3CMGA 5DMGD 2EEAA 4WV1A 5IB4B 1KCSL 2VXQL 5HJ3B 1N4XH 1RFDL 3ZE0E 4JJ5A 1UZ6E 3IKKA 1T1YA 1DQLH 3NCFB 4HBQA 3DTXB 3BP4B 4LLVB 3FOLA 3MRMA 4OQTH 4X7TA 2H1PH 3ZDXF 4XB7A 5KOMC 4YIQB 4JPWH 1OB1A 2GTZB 2XRAL 4KQ4H 5HGBA 4MMXC 2ESVD 1NCAH 2BXYA 4X4XA 1AXSB 3FN0H 4HW6A 1KJ2L 4L9LC 2DF3A 3TZVC 2R2BB 3NAAL 4M5YH 3QO1A 5I66B 4KKCD 5DEFA 3OV6A 4PRNA 2DJ4A 2OL3B 5LKNA 2RCSL 2WQRA 2F54B 3UYRL 2W60A 4CBPA 3LH2H 5HDQH 1CCZA 1HH9B 5HYSG 1IBGH 4YDKL 3DYMA 1FFRA 3E6HB 1SY6A 4PJHE 3HG1B 1QFPA 4NQEE 5DZLA 3PJSB 4LVNB 3PGCB 4UV7H 1I4FA 3CZFA 4KPHH 3H2WA 1CN4A 1EGJL 2R69H 1XGTB 4KFZC 4LFHG 3RPIB 1UM5H 3KPSB 1OP5H 1VFUA 2ADIA 1F6LL 3FO1A 1OD9A 5HD8C 4NO0D 1YDPA 1F8TL 1VPOH 3J8F7 4TQEL 1J11A 4YGVB 5CLWA 1I1FB 32C2A 3LB6C 2EH8L 3GB7A 4AMKL 4MVBD 2YPLE 5BJTA 2BNRA 5T33L 1MJ7H 2GITA 1CL7I 3H0TB 5JHDA 3GSWA 3BJ91 2RFXA 3I3BA 2J4WH 4KVNH 1SHMA 3PDDA 1BLNA 2KUTA 1M71B 2Y9RT 2AS5M 1C16B 3TLRA 1P4BL 4KXZI 4NFBA 5GRVK 1U93A 5ESVA 3UBXA 3ZDYE 3P9LA 4ZG1A 4WWKD 4U6VH 1FL5B 5C07B 1GYAA 1NFDB 3TIDB 3VXSD 4LASH 3QNYA 2VLKA 5E8NA 1HQ4A 1MI5E 3HNVH 5JQ6H 4Z95L 1UXWB 3NN8B 4XMPL 1ED3A 4QYOA 2YC1A 4QRUA 3MNZA 5DRZB 3Q0HA 3ECBB 3QNZB 1K6QH 3O2DA 1AO7B 5F7KC 2BCKB 2P5EA 4JFYA 5B38A 5ANMA 2BVYA 1JWUB 5EWIH 5ESQA 2ICWB 1YEHL 1FGNL 2IH1B 2DQCL 1D5ZB 4RAUB 2SEBB 1D7FA 4ODSL 4HBCH 2R29L 1IZJA 3OKLA 4L3EE 4JPVH 5GQBA 4D0DA 4J23A 3FO2B 1VEOA 1OTUC 8FABB 4QNPE 3V6OE 4U3HA 3BPCA 4X5WB 4OCRH 3KLAB 5CBAA 1BJ8A 1NDGA 3BUTA 1AJ7L 1SJHA 1IKFL 3NCJH 1XGYL 2OTPA 1FPTL 1NFDF 5DWUL 4L8DA 5SV3A 4W68A 1KCVH 4H8WL 4OGZA 4WENB 1YQVH 4ZNEE 1WIPA 4I3GA 4MYWB 5HPMA 4R90H 5ID1A 4QXWA 4BQ8A 5C8JB 4QGYA 3MA9L 5JDSB 2QJDA 3T0EE 1YEIL 4NKDB 1E0OB 2ATPA 2HJKB 2R0KL 5KVEL 4ZAKD 2AJZA 5F97E 1XGQB 2JJSC 3BO8A 1N0XL 2H9GB 6FABH 3AS1A 4ISVB 5GRJL 4NKMB 3HRZB 1XF3B 4B0MM 5I6XB 5JO5B 4NQDB 2O26U 4DKDC 5ICZB 4KMQA 4JJHA 1CE1H 3TT1H 4RGOH 4KK6C 1W0WA 5E4EC 5GZOC 3STBA 1I9JL 2NX5B 1NGPL 5J1TC 1FFOB 2VXVL 2M26A 2EEBA 1M05B 5I74C 3WKNA 2YUZA 4CJ0A 1IC1A 1PKQA 2V5SA 2YWYA 5C9JA 3H9HA 4UV4H 4X9GA 2WBJC 1XCQB 3I50L 4ETYA 4F7EA 2CLRB 1FE8H 5IB2A 3STLB 3C6LC 2XNAB 1FIGH 1JTTA 1T22A 4DW2L 3QUZC 2WWMC 5EPMB 5KJRH 1DJSA 5DD1H 1A6WH 2DLFH 3UTTB 1ZGLP 2PCPB 2GY5A 4CN6A 4L29B 5F7YC 4PY8J 3W0WA 4AQ1B 1ONQB 4XVUC 5DA0B 3RVUC 1X5FA 1JZ7A 2YD7A 5FCSH 1S5HB 3BN9D 3GBLA 3BAEL 3ZDXE 4KRMB 4NRYA 3FRUA 1IC7H 3F7RA 4X7EC 5F7EL 4WTZA 1I8LA 5I74B 3S7GA 1HEZA 2P8PA 5DD3H 3RWGA 3VXSB 4YDJB 4D2NA 4N0RA 2VAJA 3VDAA 1H5BA 3FHQA 2B0SH 3MYZA 1I8KB 3OG4B 4K9EL 3WFDL 3P4MB 4JG0L 5A16B 4G6KL 3IJYA 1M7IA 1IQDA 1Q9OA 3SO3C 5IR1B 3IDXL 1OM3L 3TA3D 1N7MH 2LQRA 3O8XC 1JUFA 1PQZB 3V95A 4DGIL 1J1XH 1RUKH 4NYLB 2ARJB 3O9WC 4ZAKC 2GQHA 3UROR 4L3AA 5J89A 1JZ6A 4RQQB 2DYPD 3EZJB 2Z91B 3BKCL 5E5RB 4M03A 1LO3L 2ZWLT 2IFFL 4L1DA 1NSNH 2V5MA 2BOCB 3LKRA 4EI6A 2YRLA 3BZ4A 1U91A 2BVUA 4AIXA 2MTPA 5GGVH 5BZWA 3TEUA 4LMQE 2QR0A 3KLHC 3ALPA 2FIKA 2VMFA 5HYQB 3CH1B 3SO3B 3Q5TA 4DZ8A 3EOBA 3LDBB 3KYAA 1MRCL 1GGIL 4C59B 1FZMA 3IDIB 1MFEL 2QTEA 4B41A 3WKMH 4PY8I 1VDGA 3EUUA 4U1MB 2VWEE 4HZLA 2OQJA 1K8DB 4KDTA 4ZAKB 3T0XA 4GXVL 1AHWA 1CVSC 2Y7QA 2J8OA 1HILA 2B7DT 5IBTL 3GGWB 2WAHA 4Y5XA 4WUKH 2ENYA 2GKIA 4P57A 4DKEH 2HRLA 4J8RA 4PJHA 4RISH 2Z35B 3HKFA 4UT9L 5C09E 4P2OA 2VNCA 2VR5A 2YD1A 3TN0A 3BZEB 3DLQR 4HFUH 1DQTA 3QIBC 3VMNA 1WF5A 2DTSA 1UXSA 1R6VA 1CDIA 4YNYA 4XXCC 5KW9L 2H2PC 3O3EB 2D2OA 1G7JB 3N1FC 3HMWL 1NMBH 1MFBH 4LLQA 4MSWB 3HHRB 1OQXA 3GMMA 2YPLA 5EOQL 5KANI 2H8PB 3BGMA 3AM8A 3L1OL 2EYSB 3BRFA 5DUMH 2AERT 5HHQB 2ITCA 3DMMD 3G5ZB 3BKMH 1V7MH 2DMBA 4DWHA 1JPGB 1I1AD 1KB5H 4AENB 5BVPH 5MEQA 3FOMB 1FCGA 3MQIA 1NFDE 2VDLL 4XCEB 3VFUB 4P5MA 3I2CL 5D1ZC 5E00B 5FKPB 1A9BA 4QOKD 3QIBB 2YHGA 5IIEB 2I9LB 2IALB 3TV3H 1MI5A 3RWJB 2JCCB 1E28B 3G6AB 1S3KL 4QRSB 4QTHB 2JELL 3MLSL 3P30L 4G43B 3DV6B 4YFEA 4Z78B 3DYOA 2XWTA 2RQ8A 3TA3B 1NEZG 2NY0C 1MQ8A 4ODXB 4D8PA 1T6WA 5GGQL 3CXHK 5IFHH 1TNNA 2KBGA 1U8KB 4HWBA 1ZV5A 5E7BA 1RAMA 3IJSB 3S34L 2Z9TA 4JQIH 5DJAA 3GMNA 3EYVB 3KVQA 5I2IA 5D1ZB 4CVWA 1MRFH 2EE2A 4K23H 2DOCA 4UNUA 1CLYH 4UIKH 3ILQD 1BBJA 2MNUA 3BVNB 4LOUD 1WWBX 4MB5A 1BFVH 2HT4C 3IDGA 5FECA 3BHBB 1DLHB 3WUWB 4I3RH 4YBQC 4RA3A 4WDIB 1HINL 2YUVA 1TPXB 4GW1A 3LV3A 5A3IC 2JCCF 2DLIA 5EO1B 3REVB 3WLWC 5F7FA 4O51A 2UZXB 1U8QA 1MCJA 5E8OB 4HIIA 3T0EA 5I76A 5EU6E 3K0WA 3HMXL 2IH3B 3WBDA 4IOSD 2PNDA 5J4MA 4FQHB 1ZE3C 5D8JL 3QULB 1INDH 4PV8B 3ULSA 4K3EH 5IGXH 4PJFE 3S8WA 4Y8DC 3D1MC 2HJFB 1OCWL 3MV7B 2Z8SA 1ZSDA 1Z3GH 3BD4A 3PHOA 4Y4HC 4IOIA 1JNNL 3MLZL 3PV6A 3SE9L 1A1MA 1LE5A 1SBBA 4N8VA 5L2KD 3VGFA 1RZGB 4IMLB 5DVNA 1T21B 3A67L 1EO8L 4WCYH 5D1QA 1TQBB 3CDFA 1OPGH 5DI8A 4HIJA 5CGYC 2VQ1B 5DC9B 4WFED 2DWDA 3PV7A 1U8HA 1LEIB 3BH9B 5C08A 1WCQA 5HHOE 4N9GA 4WHYG 1UQSB 3CFKA 5LG1A 5F93C 3NFNB 2F74B 5IF0B 4DKFH 4PTUA 3PQYD 1I1AB 4YXLL 4CADB 3QFJB 1VHPA 3I6KA 1JYWA 1JWMB 2BY3A 4GLRH 4NPYB 5IJVA 1S7XB 2IPTL 5JLZB 3CFDB 1QSFD 1OT2A 1A6AA 1P5VA 3KPRE 4TRPL 1RZ8A 2IFGA 4I77H 3RAJL 5INCA 2CLZA 5F7MC 4YPGA 4QRQA 1K4CB 5I1KL 2OP4H 2NY5L 2J88H 4ZFFB 4QF1B 4A6YB 3MCLL 1CFSB 1CD1B 1GOGA 4JRXE 3QH3A 1I75A 5ENWA 4D0CA 1BGXH 5IB4A 1OW0A 4KK5C 3CH8A 3QUMH 5J7CC 2BRRH 3VDBA 1MREL 3WIHL 3OB8A 1NAKL 1M1SA 4IBLT 1RU9L 5E95B 3D3VD 5FYLD 1AR1C 1BD2E 2C7UB 5B39A 2GTZA 5CD3B 1DQJB 3NFSL 3CFJB 3MV11 4N0CD 3W39B 3WE6B 1AXSA 3PL6C 4HQQL 5HHMB 3ZE2F 1WAAE 5DQDL 4MQXC 3OKMA 2R2BA 3IDJB 5HXMA 3PWVB 1GGYA 5I66A 5SWQB 3U1SL 4HKXB 5DR5L 5HHVH 4WWID 3HAEB 2ZCLL 1W0VB 4OSUL 2F54A 1PBYA 3GZKA 3TH2T 1FZOB 1HH9A 4NQCE 3VXPB 4BQCA 5L7XH 1BX2B 3S5LG 3T0DA 5T3ZH 4S10A 3HG1A 3MA7B 5C0RH 1ES0B 4XT1C 3GNMH 4DK6A 3PGCA 1J0JA 5JW4R 1MCDA 3LHPH 3PL6B 3J7HA 3RPIA 2OK0L 4QXUH 4L9LA 2VZ1A 4G7YL 1A14H 3KS0J 3OKOB 4Z9KB 4YGVA 4KWUA 1I1FA 4KJQD 4OGAD 2DBLH 3C6SB 4ZOEA 2OXGA 2EH7L 2DDQL 3BISA 2D7NA 2ZKHL 3H0TA 1NCDL 3EJZD 1A6VH 4OAWA 4NJ9H 4IRZH 3PQYB 1ZVYA 4H1LH 3TM6A 3H9ZA 4OT1H 1PEZA 1NANH 5C70A 5C07A 1FL5A 3KXFE 4OM0H 1NFDA 1XT5A 1XEDA 1IEBB 4FQ1L 3TIDA 4Y2DC 2E27L 3DSNA 1JIBA 1TITA 4KHTL 3ZT7A 1JRHL 1QSFB 1IT9H 1UXWA 1ZXQA 3NN8A 3NABL 3V4VL 4WU7A 1AGCB 1U41A 5DRZA 1HKLH 1XH3A 5DRXB 4Z0XA 3QNZA 5ISZD 3EZ8A 4NT6B 1L7IL 4PJAB 1JYXA 4LIQH 3FT4B 2IH1A 5GPRA 3PIQA 4RAUA 1ZHLB 2SEBA 4F7TB 5IVXE 3L5IA 1G7HB 3N1PC 1DQQA 4RRPA 4F58L 1UWXK 3WFHB 4NHUB 3MLPA 4POUB 1AKJB 1URLA 1D5BA 8FABA 4X5WA 2HT3D 4LPYA 4Y2DB 3TT3L 4Z8FH 3D3VB 3KLAA 2W9DH 3P0VL 4CU6A 1B4RA 5I1AB 4XBPA 5JZ7C 3P0YH 4GH7B 5E2WH 4RAVA 3BFOA 5H37H 3OB0K 2AJVH 2J8UB 1BF2A 5I8EB 2VUYA 4PJ5D 1SJVA 2UY6A 3CXDL 5E56A 3OZ9H 4F7PA 4PRBB 5JDSA 4LF3A 3QIUC 2APBA 3EOTH 1DZBA 4PJAF 2H9GA 3PABA 5I1GH 3HRZA 1XF3A 4LMQI 2Z92B 5HYJD 5JO5A 4PJFA 4NQDA 5ICZA 2WANA 3QWOA 5CAYB 1YNLL 5F3BB 1FGVL 2NX5A 5B3JF 1FFOA 2FWOB 1C5CH 2BSRB 5MEPA 4RFOH 1KPUA 2UVFA 2R4RH 4S0TD 3A6CL 3NZHL 2IG2H 2CLRA 2ORBH 4PJIE 4HUUA 3V6ZB 4N0FB 4OD1H 4PJ7E 3STLA 2I25N 2XNAA 4I5BA 4U1SB 1WITA 4XPTL 5EPMA 4LDLB 4O9HH 2UYLB 4RFNC 1BQLH 2J8UF 5DMIL 5HHOA 3RKDC 3UTTA 1MVUA 2JJSA 4P9HH 1YMHA 5J11C 3FAXA 4L29A 3MBXH 4C4KO 1ONQA 5C2BH 1HXYB 3LEYH 3RIAK 3C08L 5EB9A 3FQNA 2D7PA 1P6AB 2Y25A 5FO9A 1SEQH 1XGRB 5GJSL 2DQEL 5FB8A 5DQJA 5BO1L 2A6IB 4YDJA 5KN5B 3ZE2E 3GSNL 2WBJA 2H32H 3UJTL 4P23D 4ZUSA 1HHHB 1HN1A 1G7IB 3HZYB 2AXGB 3LPFA 3C6LA 2O5ZH 4PYHA 1I8KA 1W72L 2BERA 4YEEA 3P4MA 3U36B 4OKDA 5A16A 3QUZA 4M5ZH 5IR1A 4HUKB 2RGSA 4BFBD 4RFNB 3GJFK 1CS6A 4OIBA 5D5ME 1BZQK 4F37F 4Q97A 4OF6A 5J11B 1INEL 4JRXA 1RIHL 2ARJA 4NYLA 4XB8A 1U8MA 4JCMA 1CFTB 1Z9MA 1J0YA 2G5BB 5FYJD 4OFIA 4X7FC 5DHVH 3BEWB 5IW3A 2EO1A 4RQQA 2CKNA 4AK1A 2Z91A 5HYFA 2R0WH 2YD8A 2X4TA 3SJVE 2BOCA 1C7TA 2QADD 3VDCA 4M6MH 2EDBA 1BD2A 1JPFA 4HHAB 4U49A 3R8BB 5HYQA 3ORJA 4NUGL 4U0QB 1Y18A 1NGQH 1CFNA 2HRPH 4F8TA 5HHME 1UZ8B 5HSFA 4NWTL 1TETH 4PJ5B 3IDIA 1IGFH 3O8XA 4I2XE 5BMFL 2CK0H 1PAMA 4C57C 1MLBB 3P4LA 4MJ6B 3D2UA 5EFIB 1Q94B 1K8DA 4ZAKA 3JV4B 2UZIL 2EDXA 5IV2A 5D71L 3V8CA 1YYMH 3EOYG 4NQCA 4F15C 4YJZL 1E6JL 1QQDB 2YD9A 4J3TA 1UWEL 3QCTH 2Z35A 4DN4L 3QXVA 3LEXA 3ZDZE 3BE1H 2BHYA 4JCLA 2BY2A 1LGVA 4B7IA 3BZEA 1ZOXA 2NXZD 1J05B 1L0QA 2ZOLB 1MLCB 1MHEA 1SBSL 2ADGB 2HKFH 3DO7B 1FZKB 4XP4H 3O3EA 1ZHBB 1FJ1B 1G7JA 2G75B 4PTTA 2H2SC 4MSWA 4Y19D 4V1DE 1UM4H 3QUKB 4OKVA 4UILH 5F9JA 1MQKL 2H6PB 4OCXH 4XP5H 2EYSA 5AWNH 1YYLL 5KSUA 1RJZB 1MNUH 1KB9J 5HHQA 3G5ZA 1JPGA 1DFBL 2ADJB 5FUCC 4ZUUA 5DSCA 1UJTA 5KSBB 1J86A 1HSBA 4XCEA 3VFUA 2CRZA 5FKPA 1LNUA 3QIBA 2NXYD 1ZTXH 1WEJH 1K85A 2JCCA 1E28A 4M43L 4O5LL 3G6AA 1VADB 2DQHL 3RZCC 4QRSA 4XXCA 1RUQL 3WSQH 3MGOB 1PEWA 3DV6A 1QLRB 3MLYL 4G43A 5C0FB 3ES6A 4FTVE 1E4XH 1MCRA 4ODXA 3MBEC 3BEVB 4ENEC 4CMHB 4NUJB 3S97C 5FM5O 3TWCH 4BFIB 3IJSA 3U0TB 1TQCC 4OLZH 5IVXA 3CLEL 4WI5A 2AJYL 1B0GB 3MOAL 1A1OB 3EYVA 4UT6L 4WY7L 1F97A 1S5IL 3BKYH 4D3CH 4XPFH 1MAMH 5D1ZA 1XIWD 2BSSB 4O02L 3AU1B 5IBUG 5D2NC 3GIZH 3BVNA 2J2ZA 3QJFA 3IB4A 1XZ0B 3L5XL 5KSBF 1DLHA 3WUWA 4MCZB 4BSWB 1EXUB 4P9HC 4WDIA 3ARWA 3QG6B 3VXRB 2VQUA 3QR2A 4ZD3H 2DIBA 5AUMB 4Y5VB 4AL8H 2X10A 2XFXB 25C8H 4ZS6D 3SQOL 4NBXB 2VDOL 4P9ML 4OIIH 2IH3A 1MCEA 1NCNA 3TYGH 4FQHA 1TQCB 4KKNA 4M3KB 5ACLA 2NY4D 4K3HA 1QLEH 4M1GH 3LQZB 1JPSL 2EIZB 3CX5K 4Z77A 4NWUH 3MV7A 4JZOB 3DXAE 5D2NB 4S1DC 1KCUH 4LCUB 2EC9T 4JO2H 5CEXB 4PGBA 1QKZL 1P4IL 4IMLA 3AAZB 5C0IB 4O2CB 4GMSH 4AY0A 4PJ7A 2Y07H 1Q0YL 4ALAL 4XVTL 1DLFL 2VQ1A 4L3CB 4YAQB 3LKQA 2X1QA 1DEDA 1LEIA 2HG5A 2R15A 3BH9A 5EU7C 1PJ9A 3V5KB 1PD6A 4LCWB 4FZEH 1EMTL 1UQSA 1U9KA 3TESA 3MLUL 3B3IA 4HUVB 2F74A 1UM6L 4XNZC 3HA0A 1S9KC 5IW6B 2EIBA 3OAYK 1IEHA 3QFJA 4Y4HA 4ZODA 5E9DE 2XZCL 3OKYA 1JWMA 1YJDL 2CRYA 2VR4A 4LPVA 4DK3A 1G1CA 2NXYB 4NPYA 3WIFB 3QWQB 4PR5B 1F90L 1S7XA 4GAFB 1LO5B 1A7OH 3MFGB 1UKSA 5JLZA 3CFDA 4MXWH 3HPJB 3IFLL 4RMQA 3PNWB 2HH0H 3O6LH 3ZTJH 1AI1H 3IXAB 3UTQB 3BMVA 4WFGD 5D5MA 4FP8L 4ZFFA 3QIWC 3AY4C 3MRRB 4OLXH 3UZQA 4KK8D 1CFSA 1CD1A 1TVHB 4XNZB 1YUHB 1ZHNB 3NCYP 4HWEL 4EDXB 3VH8B 4Y5YC 4OI8A 2R2EA 3MRFB 1Q72H 2LVCA 3OKEB 2X1XR 1XIWB 4RFEA 2APFA 3HZKA 2AK4B 4JHWL 3IRZA 5ESAB 2C7UA 1A4JB 1RQ5A 4XHQA 4KY1L 2I9TB 1DQJA 4HT1L 4OGXL 1ULVA 3W39A 4DQOH 1IAIH 4R7NA 2QL1A 4YQXH 3WHXB 4G8GE 4UBDD 1DN2A 1B4JH 3KDMB 4WTWA 3QIWB 4I2XA 7FABH 3PWVA 5T3ZE 4TOYL 2VDKL 4QHMB 3D48R 4L5FH 5I17B 5FO8B 4PBWD 1W0VA 3PDGA 4Y5YB 4JFDD 1CXHA 2MQ0A 1YY9C 1UH2A 3RZWA 1I1CA 1A3RL 3T3MF 1FZOA 3VXPA 5JIPA 1KG0B 3TO4C 1BX2A 1MCWW 4I9WD 4PGZA 4IRJD 1YA5A 3DURB 4ZFOB 3M1BA 3U7AA 2QKIB 1Q8MA 1ES0A 3PWPE 5E6ZA 3RU8L 1IGIL 2LTQC 4RGMB 2G60L 1C5BL 1HI6A 1DQDL 3PL6A 5LVEA 1XCTA 1ZANH 1IAIM 1CD0A 2HJLA 4XPGH 4DAGL 3THML 4DCQB 4FQQB 2BOBB 3C60D 3X13A 1A6UL 3OKOA 1EV2E 1PY9A 1RK0A 2P45B 2OSLB 4PJBB 5JXAH 1T1XA 5D93B 2C4XA 2O5YL 4O2FB 4K71B 3QHZH 4RMVA 1JGVH 1IAKA 3CJJA 3BXNB 3JXAA 2DQUL 5J6GB 2EXWD 1I9RL 5HHXL 5KSBE 1AGBB 4M1CC 4Z7VF 1FNSH 4LIQE 1QO3A 1A22B 2VC2H 1VERA 3ZSSA 2ZJSH 4ZFGL 4JDVA 1AGCA 2AABH 4JFQB 5DRXA 3CFIC 4IDJL 5HYEA 3IU4H 4M4PA 4NT6A 5FUZL 4PJAA 5F96H 5IVOA 4FTVA 1N3NB 2OR7A 4LLAA 1IILE 4Z7OF 4FXLA 5D70L 3VG9C 4QRPB 1R3HB 2R0ZL 1A64A 4TVPL 4EQ2A 1G7HA 1F4YL 1VEMA 2OTWB 1JE6A 2BVOB 3DARA 3GBML 5FUCE 4O58L 3WFHA 4NHUA 4OLWL 4P2RD 4JKPH 1AKJA 1U8PB 4P4RB 3L3GA 3CSYB 4NQVA 5BQ7B 2ZUXA 3VFNB 4Y2DA 5IBLD 3LEVL 3D3VA 5HGAB 4FFZH 5I1AA 3BZFA 4YDIH 1B6DA 4JANA 3FQXB 4C54A 3SBWC 4LHJB 3LCYA 1QRND 5I8EA 3TFKC 1F6AB 4M48H 3V4UH 2VXUL 5IMLB 1OAZL 5E2UL 3VG9B 1GL4B 1U2HA 3EJYC 2YD5A 1NGXB 3UP1A 5CD5D 1NUDA 4EUPB 2C1PB 3DVNB 4ONGL 3QRGH 3QYCA 2Z92A 3MREB 3LN4B 3QDGE 1PDKA 5F3BA 4NC0B 2HWZH 1DVFC 1MCFA 3UBXG 2NR6D 2APTA 4WTXA 3WEXB 3REWB 2BSRA 4OTXH 3HFMH 5DJXB 2FR4B 4U1KB 2GJ6E 4ZTOH 3KNBA 4UDUB 2D4DA 1OSZB 1CD9B 4HIXH 3EYSL 2DQJL 4N0FA 2MMXA 3QXDB 2AXHA 5J13B 4XNQB 5ADOL 3RIFF 2DQFB 1FYTE 4YLQT 3WD5L 1KN2H 2UYLA 3LKSB 4NNYB 1GGBH 3PWNB 2Y6SD 5DJYB 4FQXC 4KQ3H 3Q3GB 4QRRE 3B9DA 1G0DA 2H3NB 2BSED 4UNTA 4UOW1 4HWZB 1YEGL 1DVFB 3O3DB 5LQBL 1Q9KB 3F7VA 4IHOA 1YPZB 5E9DA 2A1WL 3BKJL 4GAJL 2PTVA 1XGRA 4I1NB 3RDTC 1JZ4A 1EZVY 2A6IA 5T3XD 1A7BA 4K07A 5GGRA 2ZPKL 3MXWL 4HXBL 5CJ8A 3HZYA 4EKXA 3QDJD 4OLEA 5DJ6A 4FNLL 1DP0A 1AD0A 4UOJA 3VXUD 1KEML 4G9DB 3QUMA 5IESL 1LK2B 3VXTB 4FQXB 1VFAB 3QZWG 5D72L 1TVDA 3T3ME 3ZKNC 2R1WB 1WIUA 5C0AD 1CFTA 1RI8A 5FHAL 4X5XB 4OZGB 1FVEA 3BEWA 2PR4H 4NBZB 4W4NA 3SGDH 5D6CA 2E7LC 4TUKL 1BAFL 4P2RB 1FNGB 2B39A 3QEQE 4LKXA 3RDTB 5A2FA 3U2SB 3HNSL 3BP6A 1J10A 4KKBD 4ZPVB 4ZXBD 3QUXC 1KCLA 2AK4E 5J1AA 4MNGE 1H3PL 1JF1B 4YZFE 5HGGS 1YPZF 3BDYL 3GKWH 1D3CA 2BNUB 4MDJB 1CDGA 1QRNB 2P5WD 1RJYB 1MCNA 5IEHB 3OPZH 2VXTL 1UZ8A 4QHKI 3UMTA 4I0CC 1CXEA 3N06B 1FORH 5E4IA 2Y23A 3ESVF 5FOJA 4MJ6A 5EFIA 1Q94A 4LSDA 43C9B 4KAQH 4JHZA 1A7PH 3JV4A 4FFYH 4P46D 3ILPB 2GAZB 4XP1L 4ESKA 5JPNB 4HC1H 2DLGA 2CUIA 1KC5L 4Z7VE 5CINL 2X4UB 1A7QH 3MZGB 3OR6B 2MJWA 2FNBA 1T0MB 3QUXB 3HCVB 1BJ1H 1QQDA 5B21A 1N5YL 4M1DL 3PWPA 3QCUL 2E7HA 1NMAL 1J05A 2ZOLA 5DO2C 1KFAL 1MLCA 5JIIA 2ADGA 1RZFL 3DO7A 2C9AA 2GT9B 3MJ6A 5IHBA 1ZHBA 2HT2D 1FJ1A 2G75A 4E5XB 4H1LA 3GSOB 3U82B 3U9UB 2BP3A 4KK9D 1IGYA 4TNVK 1P9MC 2GUOB 1NAMH 2H6PA 2KQMA 5IFAH 1FNEB 4WUUE 1N0LA 4NJAH 3L3IB 4P2QE 1RJZA 1BPVA 2FBJL 1FAKT 3N85H 2X44D 2ADJA 5C0DA 1ZEAH 2YD6A 2AK1H 2XWBB 1U8IB 1AR2A 2VDPL 1ZT7B 2W9EL 4RX4D 3VXOA 4F3FB 4TSCH 4PLKD 4BH8B 5KSBA 2Z8VC 1I8MB 2OCFD 3TVMC 4JPKL 3WFBH 1K8IA 3BIKB 3B4NA 3ZHLA 4XP6L 5IQ9B 5EIIB 3U7WL 2AGJL 4LSSH 4WU5B 2XQYG 5FM8A 4GLRI 2A6KB 3F7PC 2F53E 3QDJB 1DBJL 3RP1A 4KU1A 4UDTA 3MRIB 5C0FA 2X9WA 3QDMD 4NCC1 1CBVL 1F3DH 1ZWIB 4H20L 1RZKC 2XWJB 3BEVA 4PJ8C 4YR6A 1TTUA 1G6RH 4I4WB 4XC1L 1TCMA 3JWOH 4LQFL 4OZFB 2N7AA 2XT1B 5DT1H 5C0AB 5I1IL 5EU5B 3U0TA 1T2QH 3MRCB 2E9WA 5T5NF 1BFOB 1T4KB 1FC2D 4JFEB 1S7RB 2CJUH 2YKLL 4EVNB 3TVMB 2BSSA 3ZKXB 2AV1B 1OARH 1CQYA 4G42B 5A2IH 4PRID 3AU1A 1YNKH 1GIGH 1FN4B 3T1FA 2PETA 3RQ3A 3RZCA 1IC4H 1XZ0A 4Q2ZB 2QV2A 1U95B 4WFFE 3K1KC 1NBVL 4G7VH 3ULUL 4MCZA 4BSWA 3QG6A 3VXRA 4NM4H 5AUMA 2XFXA 3MBEA 4OCMC 3GO1L 2JIXA 4ONFL 1JHKL 1U58B 4YE4H 5CWSB 4R26H 5ACMA 2OJEA 1DDHA 4RWYH 3B9VA 1PYWA 3O6KL 3C8HA 3QDAA 2NY1C 2WUBL 3X11A 4XRCB 1RV6X 4R4FL 1FVCA 5DS8A 3LQZA 3CSGA 2EIZA 5F3HB 1DBKL 5EU4A 1TMCB 3QHTC 4JZOA 3LQMA 4BH7B 5D2NA 2WW8A 1Q9LB 35C8H 1QEWB 3X12A 2FECL 2GJ6A 4LCUA 3U6RB 4YUEL 4RGNC 2FJGB 5CEXA 2N7BA 2ED8A 3N1MC 1RZIA 2UVEA 3F7YB 2WQ8A 4S1QH 1HSAB 3PHQB 4L3CA 4YAQA 3W11C 2D7QA 1FYTA 2ESVE 5C6TH 2DD8L 3IS1X 1HQRB 4LCWA 3HUJB 2A38A 2XA8H 3KGRA 3UJIH 4LSUL 2NY1B 5D7LD 4IOFD 4XCCH 5FYLH 3O41B 4QRRA 4J1UB 1DBAH 3K4ZA 3MODL 4GMTH 4HEPG 5MERA 1YPZE 1HCVA 1YEFL 4X6BA 5LCVL 4GBXC 3SKMB 2A0LD 4I48B 3WIFA 3RY6C 1SY6L 1F58H 5F9OL 1LO5A 2FYYA 1CFBA 1GZQA 1BZ9B 4QXGL 1NANI 3GI8H 3ARBC 1X4XA 3MLWH 4KJPD 2YMXL 5CEZL 5DHVA 2GK2A 4F33A 4P4KD 1EO7A 3UO1H 3IXAA 5C0BE 1IZKA 4KC3B 1BQHA 4MLIA 4KKLC 3TPUA 1JJUA 3ABZA 3RUGF 2W0LA 2N56A 4MJ2A 2YD3A 1YUHA 1ZHNA 4HAGA 4H88H 4EDXA 1SJEB 3VH8A 3NACH 1ERNA 4M7LT 3HUJF 3BSZH 5GS2H 4X6FB 3MRFA 2DQIH 3U30B 2FGWL 1UA6H 5L9DH 5FA3B 4GBXB 3QEQA 4R96B 1OAKH 1V7NL 4PRIB 4X9FA 1KELL 2AK4A 4HIHB 3NTCH 4MNGA 4XMLL 4BSVA 4G5ZH 3DSFH 4Y88A 4RIRA 1A4JA 4MJ4A 1GOFA 1J0IA 3ARBB 1I85C 5GRWA 3DRQA 2UUDH 2I9TA 1PKOA 3MLXH 3QA3A 5KTEL 4YHMH 2AJUH 3WHXA 1Q9WB 5JXEC 4G3YL 3KDMA 3QIWA 1MEXL 2H45A 3AY4A 3SDCD 5MENB 3O2DL 1RK1B 2NQCA 5I17A 5FO8A 5DRWB 1MF2L 4Y5YA 5C0EA 2B5IC 5TDOB 1J18A 4Z7VA 2VLJB 3DX7B 4PLJC 3VFMB 1WZLA 4EI5C 1KG0A 2FATH 1JHLH 3TBYB 1T20B 2NNAA 4HJ0C 4MA8L 3ZT6A 3GI9H 4G8EB 1HZHL 4M7KH 2OR9H 1B2WH 5F72S 1QBAA 3IF1A 4ONHB 3DO3A 1KCSH 2VXQH 1L7TL 4DCQA 1F11B 3JWOC 1FIEA 4FQQA 1ODAA 2BOBA 3HTLX 4NP4H 1RFDH 4OF3A 3FFCB 4PRDB 5F9DC 5F1NB 2OSLA 4Y1AD 2Z8WC 5K9JL 1F4XL 4S2SB 5DMJB 2OI9B 2B5IB 5C92A 1J0KA 3ZE1E 4WUUA 2XRAH 1ITCA 2D7MA 2I26N 3IAQA 3K8MA 3BXNA 3EYQD 1KJ2H 1R3JA 4HZAA 5FV2A 1H8NA 4XBGB 3NAAH 3CDCA 4ZMAT 2Q3AA 3N1GC 5C0CE 4G8FB 3GUTB 4E9LA 4I3SL 1T3FA 3UYRH 2F53A 1KYOK 3TBSB 5K9OB 4P4KB 1CTNA 4X4ZA 1WZ1L 3WS3B 3E0GA 1N3NA 3JTSB 3SKJL 4KZEH 4BZ2L 3ARGC 4YHOH 2VDNL 3IETB 4Y16D 4QRPA 2BX5A 4OLVH 4FABL 5IK3B 1R3HA 5E8PB 3BI9X 4JFZL 4X6CE 1EGJH 2OTWA 4TSBL 3RWDB 2BVOA 1FYHB 2GEEA 2MPAL 1U8PA 4P4RA 4JFFD 1F8TH 4TQEH 5BQ7A 2V7NB 3TBWB 3RX8A 2EH8H 4AMKH 1J12A 1JMZA 1RUPL 3DRTB 3ARXA 5T33H 3KYOB 3ULVL 2CMRL 3O2VH 2UWEE 4JKMA 5GRXG 2FL5B 2VLRE 1P4BH 3L3HA 4K7PX 4MQ7B 1KIRB 3O4OC 3SPVB 5IMLA 2PYEE 4ZSOE 3ARGB 3I9GL 1OHQA 4QGTA 4F9PC 1CICC 2PKDA 5IW1B 5GS0L 4Z95H 4EUPA 3RNKA 1AH1A 2C1PA 1EFXD 3DVNA 5FF6B 3MREA 4PP1D 3LN4A 4X6EB 4ODHH 3MROB 4J4PD 2ITDA 4CU8A 1P6FA 4ZUTB 3WEXA 3DX9B 2AJXL 3OKKB 3T65B 4LU5L 2FR4A 1YEHH 1FGNH 2DQCH 3SBWA 4NRZB 1XF4B 5DZOA 1KLGB 4ODSH 2EDOA 4Z7QF 3VW3L 3TJHD 3D85B 4PY7B 3QXDA 3RUGE 3UZEA 3O4OB 1JZ2A 5E1HB 1D9KC 4LPXA 3LKSA 4Y7MA 2YPVL 2CR3A 4Y1AB 4NNYA 3HUJE 1OGAD 3PWNA 5DJYA 3Q3GA 1AJ7H 1IKFH 3Q2CA 1XGYH 1FPTH 1NBYB 5DWUH 1KN4L 3O4LD 5B4MD 4H8WH 4M6AA 3BPNC 5DXWA 3I6LD 5KVMC 1DVFA 1YPZA 2CRIA 1ZMYA 1KTDA 5HI5C 4M8QB 3MA9H 3BW9B 4RGNE 1A5FL 1H0DB 1YEIH 3FCTB 5J3HD 1KIPB 3RWCB 1MOEA 5KVEH 5EZJB 3UTPD 5CCKL 1T7WA 5D7JD 1N0XH 2Q86B 5GRJH 1O0VA 1VKXA 4ZOCA 2QQQA 3ARPA 3Q5OA 1PLGL 4G9DA 5C0BA 4D9QD 5IB1A 3B6SA 1LK2A 2B1AL 1A7RL 4ORGA 1I9JH 3HB3D 4FQXA 1NGPH 1VFAA 2VXVH 5F6IB 3FTGB 2FH6A 3GHBL 3UPAA 4X4MA 3GHEL 1T7ZA 4X5XA 3BPNB 1RUAH 1E4XI 5CSZA 1MWAB 2GHWB 4FG6C 4JN2B 3I50H 3G6DL 2X4NA 1G9NL 4WO4D 4JKLA 1AC0A 1KEGH 4D9LL 4JFFB 1FNGA 4WGWB 4AEHH 4DW2H 3RDTA 3U2SA 3SDDC 3VU2A 4ZPVA 4K8RL 4G6JL 4U1NB 1S8DB 1J