1OPGH

Opg2 fab fragment
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
227
Chain Sequence
b'EVQLVQSGGGLVNPGRSLKLSCAASGFTFSSYGMSWVRQTPEKRLEWVAAISGGGTYIHYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYYCTRHPFYRYDGGNYYAMDHWGQGTSVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OPG2 FAB (LIGHT CHAIN)
publication title Crystal structure of the OPG2 Fab. An antireceptor antibody that mimics an RGD cell adhesion site.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 39
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 1995-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgH01
4LKXA 5D8JL 2RGSA 3VXRD 3VXUA 2C3GA 3DSNA 1MHCA 3RUGF 4CDGC 5EOCL 2Z35B 3WJLC 1UKQA 2V9QA 3IFOA 1CIDA 5A2KH 1NGYB 2J8UE 1XF5B 1DVFB 4MAUL 1AXIB 4JPWL 1ADQA 2JELL 4APQC 2BVEA 3TVMB 4J4PC 1A4JB 5DQ9A 4X5XA 3P0VL 3QJFA 1QYGL 5GHWH 3U2SA 2C5DC 3WNMA 3W5NA 2MWCA 3KPMA 2VE6A 4WENB 4ZS6D 3NA4A 5D2NA 3S96A 4PP1D 4K8RC 4B53A 1MCWM 2NY4D 4OLYL 5D7SL 2GK0B 2AW2A 3N50A 1V7MH 3O81A 1WT5C 5D7KE 1HXMB 3DV4B 1K8IA 1N5YL 3CDFA 1NKRA 3Q6GL 2NY7L 5JO5B 2OI9B 2FGWL 1EBPA 4XCCH 3MGTA 1RU9L 3WE6B 1UQSA 3P4OA 5D6CA 3QDJB 4AG4H 5GZND 4KK9C 1QBLH 4Y0GA 5DMIL 1OSZB 1INQB 3OHXB 1K4DA 4NJAH 3VXPB 4B50A 5HDQL 3VXSE 1H0DB 3R1GL 3KNBB 2OLDA 4KJQC 5IK3A 1URLA 4YXHL 1A6UH 1U8QA 4OCLC 4HLJA 1KTKE 4H1LA 3W11D 3X14B 1T2QH 4OCWH 4PBVC 3ILQD 3VFWA 5EOTA 3QHTC 2EO9A 1AO7B 3GJFA 4U1GC 1T2JA 4PRIB 3SEPA 5JW4Q 3T0EA 3QUKB 1IM9A 3UO1L 1HN1A 4F9LC 3BPCA 3GSOB 1QBBA 3I84A 1KGCE 2XACC 1CT8A 3RU8L 1H3VA 1JGLH 1EXUB 1HOCB 3KPSB 3WHE1 4LP5A 4P2RE 4TSCH 43C9B 4NBZB 4AY0A 5FYKH 4YHLL 1NJ9A 4PJFE 1FIEA 5FHAH 4Z7QE 1A1MA 3GIVA 1KJ2B 2VUYA 2ED7A 4WTXA 5IT2H 3FRUA 5ADPH 4M48H 3UTSA 2ZG2A 3V6BR 4KK8D 3DRQA 1LK3L 5D7LE 3BEVB 3CVHA 1GGBH 1PGRB 5FO7A 2ZUTA 1A3RL 5D7IB 2APXA 2P24B 2PW1B 3QZWB 4NQCA 2V2WA 4G80A 4R90H 3FB5A 4NUJA 2IADB 3PABA 3VMOA 5CJXA 2FHFA 4DK3A 4MXWH 4M9PA 1QP1A 3MRJB 5TQ2H 4ZDHA 5DUPL 1PW3A 4AEIH 1DUZA 5CWSA 5HYJD 4NQVB 4HUXA 4G7YL 4WGWB 1S9VB 4LOUD 3O6KL 4TQEH 4JM2A 4JR9H 3JTSA 2IBZY 3JWDL 1JFQH 2DJSA 3EO1B 3MXVL 4JFFA 2DQIH 4UIKL 2ILLA 5GJSL 1OAUL 1WFNA 5DXWA 1QFWL 3OR7A 4APQB 3CC5A 4H26B 4PY7A 2AJZA 3QCUL 4KZDL 2DM3A 4M9OA 5F1IA 2W38A 2KL6A 5C08A 3ZKQD 1DR9A 2VDLH 1XH3A 3MC0A 5IW3A 3L5XL 5D5MB 1SJVA 3NN8A 1BIIA 4F9PC 4XP9L 2CLVB 4RX4A 5D1QC 1WBZB 1DVFD 3ZHKA 5C6WH 4ZXBC 3DXAD 3A6CH 2OL3L 4DUWA 4L8SB 3T0DA 1U8JB 4PR5A 2UYLA 3WXWL 5GGRB 1FC2D 3V0VA 1IGFL 1ZLUK 1F4YH 1F2QA 1JF5A 2ZZUT 1OP3K 4I2XA 4NNYA 2WBJA 1PKQB 4ELKB 4PRNA 2X9YA 1AIFB 4O51B 2BCKA 1OHQA 3DX9B 1TVBB 3MJ9H 1CFNB 5LJYH 1FHGA 3L3DB 2Z4QA 3LV3A 3VFTB 4XZUA 4L4TE 4UUJA 4WW2C 2VDNH 3VDAA 2VITA 3EO9H 4JO3L 2YEZB 4PG2C 3GRWA 1KIRA 4CMMA 5JNYB 1HYSC 4WO4B 4X6DB 3N1PC 4ZUUB 1LO2H 3V4VH 4ONOA 1N59A 2CO6B 2R0WH 1P1ZA 4PJBF 3DYPA 2HT3D 3QDJD 1RVFL 1WZ1L 4QXUH 1VENA 2VN4A 3T1WA 1U8PA 4AENB 1ERNA 4FXGB 1CCZA 1NBYA 4U2YA 1CXLA 2AV7A 3H8NA 3WSQH 1DQTA 4IRJD 1T1YB 3U0PA 4Q6YA 4O5LH 5HGAA 4ELMF 1CDYA 3SDAD 3OZ9L 4YXLL 2VAJA 3T08A 3RDTB 5H2BB 3OKMB 2PYEE 5BZWA 3IYLW 3X13A 2HTLD 2YD9A 4DKAA 4KTEL 4UT6L 2UWEA 4I77H 4PRID 5C0BD 2GJ6A 1OP3H 3DETD 4KKNA 5E8OA 5B38A 3GK8L 2VZ3A 5C86A 3MRDB 4QXTB 3IVKA 1NEUA 3HG1A 3FO2A 1NMCB 2WLYA 5D2NC 8FABA 5J4MA 3KPSD 1ZGLA 3BI9X 2X4OA 2XV6B 4NRZA 1MVUB 4RGOH 2Z92B 2C7UA 2DQGL 1OF2A 3HMXH 3BKJL 1MFDH 4QKXB 2Y7QA 3MLRL 3BESR 4XNMB 4KKCD 5DD1L 5IVXE 4LPCA 4DFIA 4BZ1H 2CDEA 1MWAL 1T5XB 4GXVL 1XCQA 12E8L 2HP4A 1BFOA 1S5IL 4M7JL 4LRIC 5BVPL 3DHMA 2CMRL 1BQLL 2FBOJ 3LH2L 4IRZH 4U33A 1S7TA 3QEUB 5GS2D 2ID5A 3PXJA 4HUUA 3QEQB 2H1PL 4TNWK 4L3EE 4E0RB 2FIKA 4HJ0C 4WNQA 3KLAB 2N4IA 4WFED 4DVBA 2GSIB 4HPOL 2CKNA 3PP4H 4IIQA 4HWUA 4WV1A 2ERJC 4JO4L 4NWUH 1RMFL 1TQBB 2I9LB 7FABL 3GHEH 3HC4L 2NY5H 1G7LA 4F57L 4MA7H 4N0YL 2WZPD 4O4YL 4UOW1 2J6EH 5JW5B 2R9HC 4NQXB 2P5ED 5FKAA 2AXGA 2FSEB 2R4RH 3V95A 1HHKB 4S10A 5D1QB 1A4KA 4ETYA 1KACB 3L3KB 4F7CB 4NKDA 4U1KA 4WI6A 4S1QH 1VGEH 5C6TL 1EHLH 4K3EH 1J12A 1ZS8A 2VLKD 4XP1H 5DRZA 3QCVL 5IOPB 3K8LA 1RUAH 3C87A 4EDXA 1OM3L 2PYFA 5DJCB 1MQKH 4KU1A 1TPXB 3TJHD 3DUSB 2Y07L 4U2ZA 3EDDA 1ZA3A 3MOQA 3NPSB 1KCKA 2AJSL 2AJYH 4FQXA 2D03L 2DQUH 3BDXA 4H5SA 4K9EC 3LEXA 4XP4H 2FD6L 1XCTA 4KRPB 3AB0B 1H3XA 4DW2H 1YQVH 5CJXC 2E8ZA 2Q6WB 1LEKA 4CJ1A 1C12B 3VE0B 5CP7B 5GGTL 3MLZL 4OZ4B 5DK3A 4PGBA 3I75B 4OQTH 2X6MA 3CLFL 5DK0A 1BVLB 4PRPE 2LAAA 4FQPA 4YXKL 4LKXB 3VXUB 1S78C 2Y06H 1MHCB 4X6CA 2X4PA 5T5FL 5D2LA 5KVGL 3O0RH 3IFOB 3TNMA 4QRUA 5ID0A 5KVFH 4WO4D 2G5RA 5F6IB 3O11A 2ZOLA 2F54E 3AM8A 4X5XB 2HMIC 3VWKA 2B1AH 3QJFB 3OX8A 3U2SB 3KPMB 3X11A 4EI5C 3DJ9A 3L95A 1CLYL 2VE6B 5F7WC 4ZFGL 4XI5C 4U1IA 2HT4D 5D2NB 3S96B 1NFIA 5J12B 2M1KA 4Q9RL 1S9YA 2RFXA 3A0OA 4WHDA 4FRWA 4TULL 4O2FA 2D31A 3RDTD 2MSPA 1P2CA 1NFDA 5F93C 3HLAA 4XWGL 5I1IH 5FUOH 1F2XK 1ROWA 5MENA 3LKOB 1K8IB 5CGMA 4LL9A 3UJIH 1YQ2A 3MGTB 2A9MH 5GRWA 1QLEH 1EVUA 3B43A 3BP4A 1UQSB 5D4QA 5D6CB 1HHGA 3B9KA 4G8FA 4K07A 2GSGA 5H94A 1K4DB 5HI4C 5EN2A 5TE6H 1AC6A 4WFGD 3PL6D 5IK3B 3T2NH 1U8QB 2QQNH 2AP2A 5FGRA 3W9EA 4H1LB 3J8F7 4P3WA 5I1KH 5SWSA 3VFWB 5EOTB 5CUSH 4EUPA 5D1ZD 3GJFB 4HWBA 2R69L 3T0EB 4TVSa 1AXSA 1IM9B 1LO0L 5HYSA 4Z9KB 3BPCB 3EOYG 1ZANL 4TRPH 3SKJH 1CT8B 3IAGC 1VESA 4DVRL 3ZDYE 4JN2A 3I2CL 3F58H 3P30L 3TZVA 3PQYA 3CSPA 3NIFE 5HI5C 3HE6C 1MJ7L 4RFEA 2X70A 1XGQA 3IDMA 5FYKE 2WWMD 1NJ9B 3GIZL 3BGMB 1A1MB 2XA8H 3GIVB 3FB8A 3H9SE 1MJ8H 4NJ9L 1YYMH 3FRUB 2EEAA 2ED9A 3UTSB 1YPZF 5F7MC 2Q7YA 5JR1H 1VKXA 3NABH 3DRQB 5JQ6H 5DJAA 5D71L 2A83A 2ZP0T 3CVHB 5KJRH 3ZYJA 1MAJA 5FO7B 1JIBA 2F58H 3HAEA 3SQOH 5DQDL 1SEQH 3OSKA 4OCYH 4P48A 1HH9A 2Z91A 4NQCB 2V2WB 4G80B 3IDXH 4M7LL 4V1DE 4NUJB 4XBPB 4HIXH 3PABB 4DGIL 2WP3O 4LSTH 1OTTC 5TH2A 3G6DH 4ZDHB 1XGRA 1X5HA 5E1AA 1GSMA 4OIIL 1DUZB 5CWSB 3IAQA 5CEZH 3GMNA 4LAQL 4HUXB 1UEMA 1X5ZA 2I24N 3UDWA 1B90A 4JM2B 1MI5A 4KRPD 3JTSB 5FF6A 4RA3A 2YPVL 3ZLQC 4JFFB 1JHKL 5T1DH 4PJHE 3BH8A 4IIQC 1BOGA 3OR7B 4NZTL 3CC5B 4PY7B 5MEPA 2AJZB 3KPPA 5TF1H 5F1IB 1IC7H 5CZKA 3VXUD 1UJ3C 4P3CH 5C08B 1IKNC 2VLJA 1XH3B 5J0BA 2FB4L 4GKNA 3NN8B 1BIIB 1T6VN 3E6HA 1EJOL 3FZUD 4P49A 4KI5D 5DVNA 4JG1L 4V2BA 2DJ4A 3VGHA 2AKRA 3RKDC 1JRHH 4TPRH 3U83A 3H3PL 2HG5A 1OW0C 4XVUC 4PR5B 2DMBA 2UYLB 3WN5A 5JMRA 1CVRA 5IM7A 1C5BL 3V0VB 1X5GA 4CRPA 2DM7A 5ILTH 3PGDA 2ZNXA 1GPOL 4I2XB 4NNYB 2WBJB 4P23D 5FYJU 4HBCH 5EUOE 4PRNB 3ARDD 2BCKB 4QT5A 3UYRH 3TP4A 1UYWL 1WWBX 3V8OA 2Z4QB 4R7NA 2OXGA 3E1F1 3LV3B 4XZUB 4OD1H 1UVQA 2MCG1 3BSZH 1OGAD 2A73B 2VITB 2FYYA 1WLHA 1FSKC 1FCGA 1KIRB 4CMMB 1EX0A 5LKNA 1BFSA 3NZ8A 1VB9A 3HMWL 4OI8A 1CBVH 1XAUA 4LCWE 1P1ZB 4JQXA 4LEXH 5GRUH 4Q0XL 4RWYL 1U8PB 1PG7L 2ESVA 2ATPA 2AV7B 1IC4L 1P7HL 4S11A 4MCYA 1IGML 2X09A 1GVIA 1KCVH 2DBLH 3U0PB 4Z7UA 3QFDA 5HGAB 5BW7A 3ARED 4PRHA 3PV7A 3CMOL 3RIFF 1LE9A 5BZWB 4LNRA 3VWKC 3X13B 4K23L 4QGTA 2UWEB 3T0ED 2QEJA 3PGFH 2GJ6B 4GRLA 5BZDA 5E8OB 4QTHB 5B38B 2APBA 4XB8A 2QLVB 1N4XL 3IVKB 4IHOA 3HG1B 3FO2B 4ODTH 1P4LA 4V2CB 8FABB 3CFCL 1UXSA 4N68A 1ZGLB 3OKKA 1TZGH 2X4OB 3P4MA 3IDUA 4NRZB 4TUJA 1EHAA 2C7UB 3AAZA 2DQEH 1OF2B 3TO4D 2Y7QB 5DO2C 1DQLH 2GTZA 3CMGA 4OF6A 2CDEB 4PJXF 4H8WL 1ZHNA 1XCQB 1BFOB 3ULVD 3D3VD 1CE6A 4XC1L 4XMPH 3ORJA 1MEXL 4I48A 4PTUA 3VXTA 1S7TB 4PJDE 1IGCL 5IBUG 4HUUB 4FFYH 4XBGA 4F8TA 2WBWB 2FIKB 4LHQB 4DVBB 1HZHH 1RFDL 1F3JA 4IIQB 4OZFB 5HHVH 4WV1B 1NC4A 2WIIA 4Y5XA 4OCRL 5I19L 1G7LB 5IV2A 3ULVL 2Q87A 1MQ8A 4KXZH 1W0YT 1EEYA 1VEMA 5AZEH 5FKAB 2V9TA 2I27N 2ARJQ 1C7TA 2AXGB 4LARH 2O61A 2UZXB 4WHTA 2F74A 3AMKA 1OPGL 4HZAA 2E9BA 4CVUA 1A4KB 1H15A 4ZTPH 3H42L 4NKDB 2BZDA 4U1KB 4Q7DA 1CDCA 4HWEL 4DZBA 1DQML 3GSNH 1ZS8B 4LLDA 3HR6A 3P73A 2VLME 2GW5A 3N85L 3JZ7A 4EDXB 2PYFB 4JRYA 2CLRA 1ZA3B 4N0CC 4YGVA 4RX4D 4FQXB 1RZKH 3L5WA 3W81A 4H5SB 3LEXB 3KPLA 2WUCH 1XCTB 2UZYB 5DD5L 3HI5H 3N9GL 5GS0H 1LEKB 1D9KA 1DBBH 3GMQA 1ODAA 3E2HC 5DEGB 1MPAL 5CZVH 5EC1A 2FBJH 2IPKB 5I76A 1NCDL 1V7NL 4PGBB 3L7EA 4ACPA 4UNVA 3MLUH 1FV1A 3QFJA 2NR6D 4EBQH 1NAKL 4GG6A 3SDXF 1T0MA 3BUYA 4LCCA 4UV4L 2OJEA 3RZWA 4X4YA 2VDRL 4X6CB 5F9OH 2X4PB 3TN0D 3I6LE 5D2LB 5A16A 3BXNA 5AYUL 5CFHA 4JKMA 3TNMB 4QRUB 2HKFH 1E0OB 3G6JE 4UT7H 5ID0B 3QXWA 3O11B 1S7QA 4LMQE 2ZOLB 3VWKB 2HTKD 2CXKA 3MLSL 3OX8B 4G8EA 4P4RA 2W0LA 1E4KA 2AJUL 3X11B 1V3JA 3L95B 2OR8A 1QYGH 4JZNA 4U1IB 1MFEH 1NFIB 3QDAA 3CU7A 1S9YB 5MHSD 2RFXB 4O2FB 1P2CB 1NFDB 4PJHB 3HLAB 3TV3H 2BFVL 5I6XB 3ET9F 3WN5C 5MENB 5ECJE 3U0TA 4TVPD 2NY5C 2ORBL 2DLGA 2ZUYA 3BP4B 4NP4L 1KXVC 4ERSL 1HHGB 3B9KB 4G8FB 4OCXH 5ADOL 4HKZA 2EXYC 4MJ4A 4OTXL 1F90L 1RU9H 2GSGB 5H94B 4U1NA 3AU1A 4QXGL 5EN2B 2QL1A 1A3LH 3WFZA 2PNDA 4DKEL 1GHFL 5FK9A 5JXEA 3PF2A 4XVJL 5HDQH 4WU7A 2L0DA 4LHUA 5DD3H 4JAMA 3W9EB 2AGJL 1QFOA 5SWSB 4KQ4L 3QDME 1KUMA 2HVJA 4TVPL 2C4XA 2IAMA 4EUPB 3HB3C 3QHFL 1KIUA 2NTSP 1AXSB 3OG6B 3CSBA 4NZJA 5HYSB 2APVA 5DZLA 2YA1A 2NQCA 4JN2B 1IT9L 1T80A 1IZKA 5BW7C 3RU8H 3TZVB 3PQYB 5JPNA 1GIGH 1L7TL 3DBXA 4RFEB 5DHYA 2X70B 1XGQB 3IDMB 1DQJA 1H5BA 4LLYA 4GQPH 3JV4A 2E6PA 4L9DA 1RJCA 5HVHC 3FB8B 4PJEA 4PB9L 3BPOB 3BVNA 3VGAC 1I9RH 2Q7YB 3NCYP 1VKXB 4CMHC 4JPKL 5DJAB 4R4BA 2A83B 3Q48A 4HT1L 2D3VA 4M7ZC 4G6ML 5CGYD 3HAEB 4EEEA 4ELME 3HE7A 4GRWH 1HH9B 2OJZL 2KZ1B 3B5HA 2P49B 3OJDA 4JKPH 3PNWA 1RQ5A 5DT1L 5TH2B 3S36X 4Z7NF 1FGVH 5HHOE 4H88H 3IDNA 1XGRB 3TIEA 5E1AB 1BZ7A 3LEVL 3Q1SL 3PWVA 3GMNB 4P46C 5JZ7D 1KEGL 5CEZE 4IBLT 5CJQH 4DK6A 3ECBA 5F9WB 4YR6A 5E2VL 3O2VL 2VH5H 1MI5B 5FF6B 3VG9C 1NBZA 2EH7L 2ZCKH 3WKMH 3RWFA 2P8PA 1CFVL 1NCAL 5F7LB 5TQ0L 1XGUA 4L5FH 2I25N 4KQ3H 1U8MA 3BH8B 3QI9A 1BOGB 3S37X 1EO8H 1RZJL 1KEML 5MEPB 2BSTA 3KPPB 2CRYA 1QFWH 4R7DA 1RURL 1PLGH 3OAYK 2VLJB 4NKIL 2MOVA 3EYUL 3QQ3A 4GKNB 3E6HB 1WJ3A 3LAFA 2AKRB 2VL5A 3D39E 3MA9H 4X6BA 3TFKC 2HG5B 4LGRB 3WN5B 5DEFA 5IM7B 3SDCC 5GRVL 1ZLVH 3T0WA 4D9QE 1CR9H 3PGDB 5HDBF 3BN9D 4BZYA 1ZGLM 5KS9E 4M62L 5E8NA 3LRGA 4QT5B 1EIBA 3VMPA 2VOTA 2O5ZL 2YR3A 4R7NB 3WIFA 1UVQB 3ZTJG 5CD5D 1EAJA 3IDYB 2FYYB 2CK0L 4QLRA 4Y19E 4X99A 1D9KC 3TA3A 1GGYA 3DVNA 3VH8G 1HE7A 1GYAA 3NZ8B 2EDDA 4OZIF 2W07A 1OD9A 1J8KA 1A9EA 1HH6A 1WEJL 3V7MA 3B9KD 3OAYH 2DLTA 1L6ZA 2ESVB 4O02L 2ATPB 4X80L 5F89A 4MCYB 3O4OC 2K9UA 3LKQA 3O2WL 4Z7UB 2HLFC 3QFDB 3RTQA 1F42A 2D2OA 1AQDA 3GDBA 3BH9A 1LE9B 1E27A 4LNRB 3GI9L 3DI3B 4JRXD 4LP4A 4GW5A 2Y1VA 3ZKMD 1HSBA 3ARUA 5C07A 5HVHB 4GRLB 5BZDB 3SOBL 4XPHH 4ZUTA 1FFNA 4QF1A 4IHOB 1P4LB 4HULB 4HMCA 3GK8H 4CMHB 1UXSB 2CGRH 4X98A 3EJZD 1S7RA 2DYPA 3OKKB 3BT2H 3GJEA 3P4MB 4DQOH 3PQYD 1I7UA 5FM5M 5E6YA 3AAZB 3UPCA 1XF2A 4JFDE 4XNZB 2GTZB 5DF0A 4PJ8D 5IJVA 2W9LA 2VR5A 1ZHNB 2XRAH 4LU5L 4YHZL 1FE8L 3LN5A 5DD1H 1CE6B 2XN9E 3UTPE 1DLHA 3RVUD 3B9EA 3CPLA 2CLZA 3NIGF 4U31A 1UM4L 4I48B 1GOGA 12E8H 4PTUB 1R6VA 2EC9U 5EIQA 3VXTB 4U6TA 5BVPH 3NFNA 5DRXA 2HJLA 3WIIH 3KJ4B 1I3RA 4XBGB 4IEFB 4X8JA 1CZ8L 3W82A 3VG9B 1A64A 3O3AA 4M6AA 2WWKT 4YHKH 4AMKL 2H1PH 3LCYA 1F3JB 3JV5A 4Z7WA 5FUZL 2WLZA 1NC4B 2WIIB 5F88A 5T3ZE 2IAMC 4LVHB 4Y5XB 4P2OA 1KPRA 4FNLL 2B4CC 1W72H 5IV2B 3EHBD 4FTVA 2YPLD 1RMFH 4HS3A 4M4RA 5D6DC 2W9EL 1MI5D 5GGVL 1EEYB 3QISA 5EA0H 3OKOA 2F19L 2O61B 4WHTB 2F74B 4ODSL 2VSDA 4TUKL 1H15B 1J0KA 1FNHA 4J3VA 5I8KL 2DI8A 1FL5A 5HPOA 1C5CL 5IB1A 4DZBB 1H5BC 1R3KA 4LLDB 5SWQA 4PB0L 3P73B 2KQNA 4DGVL 2CKBH 2QTEA 2R0ZH 3LIZH 1WFTA 4KI5F 5C6TH 3SDCB 4ALAH 5F3BA 1EAPA 1YZZA 3ZHLA 2CLRB 4NFBA 4XPFL 3MV9A 1X5JA 1T66D 1OM3H 1F58L 2L7JA 1KJ3H 1FGNH 3L5WB 2Y07H 4KJWD 2ICES 3KPLB 1MCFA 1M1SA 4KK5C 3OKYA 1H8SA 3G04A 3ZE0E 35C8H 1KENH 2JIXA 1D9KB 3O6FD 3TH4T 4FABH 1CF8H 3GMQB 2R23A 3NCCB 3KPRD 4JY6A 5EC1B 5I76B 2FX7L 4LSQL 1I3GH 2DLFH 3VXMA 3L7EB 4C4KT 4X6EA 5GGTH 1FV1B 3QFJB 5SWZD 1VFMA 4M6OL 4GG6B 1DBML 3EFFA 1T0MB 2P47B 4LRNH 3BUYB 4LCCB 3M07A 2OJEB 3QUYA 4GSDL 4X4YB 1JGEA 4WUKL 5ALBH 5A16B 3NH7H 3BXNB 4XMKL 3O4OB 1QRNA 3QDGE 5T5FH 3UZQA 2DQHH 3QI9C 5C0JA 3FN0L 1EGJL 1S7QB 1RAMA 2BSRA 3BPLC 1INEL 3NCMA 4UZGA 4XHJC 4QRPA 1FL6A 4G8EB 4P4RB 3WS6C 4M02A 3IDJA 1BECA 2A38A 1KT2A 1VERA 2DDQH 4RZCB 4G5ZL 1QSFA 4ORGA 5JQHC 4JHZA 1W8OA 2JJVA 5T3XD 2QSCL 4PRHD 1LK2A 4FQCL 4XCNA 4EDWL 4YNYA 3KYMA 2JCCA 5E70A 2FECI 4LBEA 3CXDH 3P3YA 1N6VA 1MIML 4ONHA 3WCYA 4OCSL 5FCSH 5CINL 3U0TB 4XWGH 1REIA 4A6YA 1A6WL 4MWFA 1EFXA 3ARBA 3BIKA 4N90E 3MGOA 1KIPA 3B2UC 3L5HA 3F12A 4HKZB 5I1HH 2DTSA 4TNVK 4U1NB 2YXFA 3AU1B 5T3XL 5HDLA 3ULVF 4PS4H 2OK0L 4F3FA 2UVEA 1I1AA 5FK9B 2NYYC 1DSFH 1AI1L 4WU7B 1A7PL 4BQCA 1T0PB 4JAMB 4TTDC 1GJIA 4NHUA 2HVJB 2IAMB 2YD7A 4LSRH 3ZKXC 1RUQH 5IMMA 5KW9L 1OVZA 4K7PL 1J0IA 1VFAA 4G8GD 1UGNA 2R69H 1PAMA 2E6QA 1BF8A 4M5YL 1F4XL 4G3YH 2CUMA 5I15H 4Y19B 5FECA 5SX4I 1HNFA 1JI1A 3H7LA 3JWNC 5JPNB 2E8YA 2GUOA 1NC4D 3DBXB 5DHYB 1N7ML 1DQJB 3ISWA 1H5BB 3WYRA 4LLYB 1JMZA 5DVKA 3JV4B 3K2UH 4L4JA 3VU2A 5KN5A 3VFSA 5LQBH 4JPIA 3N1MC 4PJEB 2YUZA 5BMFL 3BVNB 4ENED 1AXTH 5DUML 1DL7H 1KTLB 4ZG1A 2VXTH 5DHVA 2AK1L 4R4BB 4YUEH 3MRPA 2DQJL 1MCPL 1U2HA 2Q76A 3HE7B 5FCUL 3D9AL 5D71H 3I9GL 5DK2A 4GRWE 4LIQH 3RBGA 1G7JA 3OJDB 1L0YA 3PNWB 4JCMA 5KSBA 1CTOA 3SO5A 2EYRA 4HX1A 4DOHE 2HH0L 3O45A 3DMMA 4JRYD 1DCLA 3IDNB 1SEBA 3TIEB 1BZ7B 2G60H 3PWVB 5I8CB 5J06A 3ZTJH 1J86A 3C09C 2A6JA 3DOSA 3ECBB 4YR6B 4OIIH 1JTTA 4LAQH 2IBBA 1WICA 1NBZB 3Q3GA 4JGJA 1P9MC 2P8PB 4KH2A 2AJVH 1XGUB 5C09A 1MIEH 2ZCHH 2DQDL 3QI9B 4KTDL 3EYOA 3HZVA 3U1SH 5ISZE 5IB2A 2BSTB 1HYRC 2IQ9H 4R7DB 2BVPA 3BO8A 3VI3E 3QQ3B 4ESKA 3NIDF 1FZKA 3OWEA 4EOWH 4YE4H 1TJHL 3LOWA 1MY5A 1NSNL 3RWDB 1B3JA 1DUYA 4XPGH 4QRRA 2VL5B 4X6BB 1EJOH 5GGUA 1ZLSL 4UINH 3B2VH 4FMKA 5IHBA 5EBLB 1CICC 2XYCA 4XP6L 3BDYL 3H3PH 1ZVSA 4FZ8H 3MBXH 3NZHL 1CGXA 1MFCL 4OI7A 5E8NB 3OR6A 4C56A 1I7ZA 4MJID 5KSUA 3WIFB 5IFAH 4J3WA 3NGBB 4YHIA 2R0KL 4AEHL 5E2TL 4X99B 3TA3B 1QACA 3DVNB 5CZXD 2P46B 1A9EB 1HH6B 3MV7A 4M7KL 3B6SA 1YEIL 3ZKNC 1OARL 3BKCL 1CG9A 4ZNCD 3QJHA 3ZKXB 2UVFA 5T1KA 3C08L 4D3CL 4OZHA 5F89B 4YK4C 4J3TA 1YMMA 1D5BA 3LKQB 5JXED 3RTQB 4ONGH 1V05A 1J0HA 4LHUD 2EDOA 1AQDB 3TBSA 3U36A 3BH9B 15C8L 3PWPE 1E27B 3VFPA 4WEBL 4M5ZH 1DTUA 1WBYA 3EYSL 2R8SL 4GW5B 3WFCL 1HSBB 3EFDL 4NFCA 5E2JA 5C07B 2HT2D 5IJKA 3IETA 5CAYB 4U6VH 4ZUTB 2F53A 1FFNB 4QF1B 4LSDA 2ICWA 2VO5A 2DIJA 4X98B 1S7RB 2DYPB 3QG6A 3NCJL 4LVOC 4OV6F 3GJEB 5JDJA 1I7UB 3BGAA 2HN7A 2WQRA 3ZO0A 3MLXH 1MCQA 1XF2B 1PEZA 5ICXA 1QA9A 5DQJA 2Y23A 4NQTA 3H0TA 1EBAA 5DFWH 4C55A 5IJVB 4W68A 4GFTB 4GUPA 3DO3A 3ARBC 5FYJE 3CSYA 1A22B 4F2MA 3OJVC 3LN5B 4GXUN 1NH6A 5ICZA 1DLHB 3MXWL 5CEXA 3CPLB 2CLZB 3HPLA 1U36A 3MLVL 3C09B 3ZE1E 4KVNL 3NFNB 5DRXB 5I73B 3HE7D 3WIHA 1I3RB 3SGJC 4X8JB 5HHPA 3BZEA 3O3AB 4YZFF 3MRRA 4U6XA 3HUJF 1I1AC 2CDGA 3ZSTA 4GKOA 4KRNA 5TPWH 2FWOA 3KYKL 5B39G 4YFLI 4Z7WB 4CVWA 5EU6A 4JFYA 4YBQD 1YEEH 5F88B 5EU3A 3LPWA 4OB5H 4P2OB 1KPRB 4FTVB 4HS3B 1AE6L 5ACMA 3JWOL 2NPLX 3WJJA 3GO1H 3OKOB 4FFZH 3L7FA 1RUPL 3W0WA 4Y88A 4PJCE 3HTLX 1YEHH 1NC2A 1KLGA 2EDWA 4NQEA 1FL5B 4OFDA 1J1PL 1MCIA 5IB1B 1R3KB 3ES6A 5SWQB 1JL8A 2W9DL 4OKDA 5D96C 4KHTL 3V6OA 2OCFD 5AYQA 3GHBL 4ZD3H 1UWGL 1EAPB 5F3BB 2A1WL 5L2KA 4IDJH 3VRIA 3MV9B 5ETUA 4KMLB 4UOJA 3O4LA 1CK0L 4KHXL 3IJSA 2M8XA 2VXQH 2H2PD 3G04B 5DJ6A 4XVSH 2JIXB 3BWAA 3VCLA 2P7TA 4CVXA 3OV6A 4G6FD 5DD5H 2R23B 3PGCA 2IJ0C 3N9GH 4JY6B 3VXMB 3WHE0 4X6EB 2V2TA 3MCLL 2JB5H 3C6LC 4QHNA 5M95B 3O2DA 2F5BL 3EFFB 1QBML 1L0XA 3OF6D 1I8IA 1J8HA 3QUYB 3WLBA 1BEYH 1JZ7A 1JGEB 2AK4A 1PZUB 1WISA 3X3GL 4UV4H 4WWKA 2NY6C 3QUZA 4DAGL 1QRNB 2VDRH 4NO5A 1FAIL 5ITFA 5C0JB 2BSRB 2AXHA 1X7QA 2B0SH 4JHWL 4UBDD 3ZDXF 3T1FA 4JN1H 4EVNA 2FCBA 1I8MA 2AS5M 4QRPB 1FL6B 4QTIL 3RX7A 1OTUD 3B8SA 1JGDA 3UEZA 3IDJB 1T5WA 3VXSD 1KT2B 3F8UB 1INDL 3QNZA 5F96L 3TJEL 4MHHG 5FGCB 1QSFB 3WDJA 5BV7H 1NGQL 4LVOB 4OBRA 5JOPE 1LK2B 4XCNB 2PETA 1MCOL 3DECA 1JWSA 3MRFA 3TT3L 3WHXA 4YNYB 2ZPKL 3KYMB 5IQ7H 2JCCB 4LBEB 3BE1H 3LRHA 4ONHB 1A7OH 4OM1L 5TDOA 4AL8L 4UIMA 1DBAL 4A6YB 4MWFB 1C8PA 1EFXB 3ARBB 3BIKB 3RUGA 4NNPL 3DI2B 1LP9A 2E9JA 1T21A 3MGOB 5A43C 4XPAH 1KIPB 1P5UA 4P2RD 4KRMB 1S8DA 3T0VA 3F12B 1T83A 1KELH 2ITCA 1QEWA 4NM4H 3V8CA 4R26L 1GGIL 1BVKA 5ADOH 4RMSA 1OSPH 4OLVH 1J1XL 3P4LA 4F3FB 1I1AB 3H9YA 4FQLL 2VDPL 2AEQL 4DKEH 3IU4L 3EYVA 5I1CL 4NHUB 3V52L 1FO0L 2X9WA 4K2UL 5IMMB 4G6JH 4OZGF 3ULUH 4KQ4H 5FKPA 4PJGF 4Y2DA 1VFAB 5D7JC 1JGUL 3SY0A 5D9SA 1JK8A 2FX8H 4YQXL 4E41E 1BWMA 3QG7L 5EZIL 5FECB 1KCUL 1NGPL 4WY7L 3FT3A 5E6ID 1LEIA 2ZJSH 2GUOB 1S9KC 2V5TA 3TWCL 2E7BA 3D1MC 4P2OD 5KN5B 3VFSB 4FTVD 4JPIB 5L8KB 2W0PA 2X2YA 4QNPF 4G9FA 1IQWH 4KROB 1I9JL 1QTYT 1CD8A 4HK3N 5DHVB 1IGYA 4GAJL 3UJTH 5DGRA 3MRPB 3DUUA 1SYVA 2Q76B 4NCC1 2VUOA 5DK2B 1YJDL 4JO2L 1R3LA 2GYSA 1OAYL 3TNNA 4G6MH 3BMVA 1G7JB 5DMYA 1LE5A 4LIQE 4KWUA 1YEGL 5KSBB 2EYRB 2FHBA 4HX1B 1R3HA 2OJZH 3F6IA 3DMMB 3O45B 1SEBB 4C4KO 3MUHL 3MV9D 3C6LB 4FP8H 3QIWC 4NQDA 4Z8FH 1OCWL 2A6JB 3LEVH 4XNUH 4OGAD 1XIWA 1BBJA 1YEFL 4HUWA 3Q3GB 2DQTL 4O2CA 5E9DA 5E2VH 5IB4A 1RULH 3G9AB 1RD6A 5C09B 3LKNA 1RIVL 3EYOB 1NCAH 3HZVB 4TTGA 5IB2B 3BW9A 1Q38A 4OQTA 3MRIA 3UJJL 3MROA 4MQTB 1RZFL 1RIHL 5HYEA 1MRFH 2BVPB 1BREA 1G9NC 3BO8B 4NZUH 3TT1H 1Z5LA 3WJJC 1NUGA 3SN6N 4LEOA 2KKQA 4NT6A 2XTJE 1FZKB 2VDKH 3S3JA 2OZ4L 3V4UH 5HPMA 4KKAD 3GM0A 1DUYB 4QRRB 1IL1A 1GH7A 4PPTA 5GGUB 4J7RA 2KZWA 1JPSL 3C6SA 5EBWA 4QRPD 3QUMH 4K7FA 5MP6H 1ZVSB 1H3PH 5JDSB 5EDXA 3X3FH 3HZYA 3BGFC 1QNZH 4ODVL 4M6NL 3OR6B 4W4OA 4C56B 1QSFD 1I7ZB 1KXTB 5KSUB 2XQBH 1WZLA 4PJCB 5K93A 1A47A 1JHLH 2PYED 3QNYB 2FNBA 1F8TH 3I02A 4YHIB 5BS0E 2Z31D 4UOW0 4G6AD 1HKLH 4X7SH 1NCWL 4OGXH 3WDIA 2JF1A 1KULA 3MV7B 3QPXL 3B6SB 2NNAA 1CG9B 4PJAF 1KB5H 3QJHB 2K7PA 5KZCB 1WWCA 5T1KB 1U42A 2X40A 4JHAL 4MMXC 1WEJH 5C2BL 4KC3B 4AIZB 4JPVL 4OZHB 4K9EL 5D7JB 4I5BA 3MOAH 2D9CA 1YMMB 1D5BB 5JOFA 3RWCA 1JTOA 3RJQB 4L9LA 3U4EA 3U36B 1F6LL 3TBSB 2HMID 4K3DL 1BBDH 3H7BA 4A6YL 4HV8A 5DTFA 4UQ2A 3IETB 3OPZH 4M6MH 1X9QA 2F53B 4L3ED 4PLOB 3RA7H 3SJVE 1MCEA 1F97A 2ICWB 4LASH 3KS0J 3QG6B 3HNVL 2P5WE 1EFQA 3KS0H 4PUBH 1CGSL 5E99L 1P4IL 1IAIH 2HN7B 5CBEB 3GBNL 3MOBL 5FM8A 4WHCA 1QA9B 5DQJB 4PJBA 1L6XA 3H0TB 5E2UL 4QGYA 4Y4KA 1CE1H 2FECL 4DUXA 4GUPB 2O5YH 3LZFH 3CSYB 3SGEH 5JHLL 4F2MB 2BVUA 5DJXA 5ICZB 5CEYA 4RIRA 4QHKJ 5CEXB 3HPLB 3V6ZA 1T83C 2C4FU 2WAHA 4GH7B 4NPYA 4P2QA 1RUKH 4K3HA 4P9HC 1UM5L 3I6KA 5J1AA 3SPVA 3RIAK 5LVEA 5HHPB 3BZEB 1QLFA 4U6XB 2CDGB 5FYLE 4GBXC 2FWOB 2GY7B 2XA3A 4WU5A 3RVWC 4D9RE 5EU6B 1MRDL 3DMMD 4JFYB 3RVXC 4PGJA 4JZJA 4NKOA 3LS5L 5EU3B 4AMKH 4L8BA 3MACH 3QZWG 4OUUA 1NGWA 1CGYA 4NWTL 1DBKH 1PSKH 1JRHI 1JYXA 3L7FB 3W0WB 3NFPA 5IW6A 3HE6D 1QHOA 1NC2B 2VB5A 2XOTA 5C09D 3WO4C 3U6RA 1JP5A 3SE4C 1KLGB 4TUKH 5C9JA 2MQCA 2QBWA 3ES6B 5J1TC 2YZ8A 4NN5B 4PRPD 1MFAH 3VXQA 5LGHH 1H9VA 5GGQH 5L2KB 5HHXH 2JLLA 3VRIB 1ACYL 2E7CA 4DGVH 1L0QA 3N0PB 4WEMB 2DAVA 5ETUB 3O4LB 3IJSB 5F1OB 5KTEL 3S35L 3TYGH 4QYOB 4Z7VF 1XZ0A 5DJ6B 3O3EA 1HHJA 3BWAB 4MA8L 3VCLB 3LEYH 4CVXB 1EH9A 5D7IF 2ZUQB 3PGCB 1TETL 4BUHA 3M8OL 4FZEL 2VDML 2V2TB 1X4ZA 4QHNB 4C56D 1X5FA 4RMQA 4KY1H 4CBPA 1FZJA 1I8IB 1J8HB 1RIUL 1XIWC 1FYTA 2EC8A 3WLBB 4Z5RA 3GFUA 5I66A 2AK4B 3LPFA 3KLHD 4WWKB 1V3KA 1JNLH 4MQXD 3QUZB 4GSDH 2ADIA 4NO5B 4ZUSA 1A7RH 1VPOH 2IQAA 2YD3A 2IEPA 4N0UA 5ITFB 5TDNA 1LQSR 1X7QB 1YNTA 4RISL 5GHWL 3T1FB 2CD0A 3BP5A 4EVNB 5F3HA 3TIDB 1I8MB 5KZCD 3QRFM 1JGDB 4XTRD 1CQYA 5EO1A 1T5WB 4H20L 1CXEA 2J4WL 1H3TA 3QNZB 1I8LA 5DVMA 1Z3GH 1CFSA 1HQ4A 2BNRE 4ZAKD 2V9RA 2B1HH 2P8MA 2GIYA 1JWSB 3MRFB 3CZFA 3QRGH 3WHXB 3ZL4H 2QSCH 2VC2H 1LILA 3LRSA 5KSAA 3REWA 2J88L 4FQCH 4XCCL 5TDOB 2NY0C 5J7CC 4UIMB 4G42A 3SBWA 4YC2B 5GRYA 2F53D 3RUGB 4AG4L 1LP9B 1QKZL 1T21B 1QBLL 1NAMH 4W4OC 1YY9C 1S8DB 1BJMA 1XR9B 4NJAL 2ITCB 1QEWB 2NZIA 4KK6C 4RGNE 5FYKD 1BVKB 3UBXG 1PQZA 1UZ6F 3UYPA 1A6UL 4M4PA 3T3PE 4KKLC 5BRZE 3H9SD 4YO0A 1GZPA 1T2QL 3EDKA 5E5RB 3SKMA 5DR5L 4KXZI 5DJDA 3EYVB 2JK5A 4LDEB 4P0DA 3VWJC 1A7PH 3RVVC 5FKPB 1FVCA 3ULUE 4Y2DB 1JGLL 5HDOA 3SY0B 5D9SB 1JK8B 2AI0L 4MNGE 5FYKL 3NCFB 3ZSSA 3RNKA 1U95A 3FT3B 3WO4B 4TSBH 1LEIB 1J05A 5E5MA 5EU6D 5FHAL 5C92A 1BP3B 4KMTL 2CPCA 5IT2L 4PD4K 5ADPL 4M48L 3KYOA 1M6OA 1OOAA 4BZ2H 3TC9A 4G9FB 1N7MH 2NX5A 3VFOA 5CKAA 4QHLA 2YS4A 1IGYB 2CDFA 2GHWB 2FJFA 3CH1A 3PG2A 4CN4A 4D2NA 1SYVB 5KANG 1S7VA 2AK1H 4R90L 4NQED 1R3LB 2DQJH 3HI1A 5JIHA 4MXWL 5DEZA 3TNNB 3T2PA 1LE5B 3QPQC 4R97C 2B7DT 2J8UF 5I1EH 4AEIL 3UAJC 1NLDH 1R3HB 5D1XA 5FFLA 1V5JA 5L2KD 3MJGX 2Q1EA 3O4LD 4I3GA 4TQEL 4JR9L 2ED8A 4NQDB 1JFQL 3FMGH 1XIWB 2DQIL 4TSAH 1BBJB 2V5RA 4HUWB 1EZVX 2VSCA 4B7IA 4O2CB 5E9DB 3PWNA 5IB4B 2EKJA 1FRGH 2ICEA 2R4SH 1NUNB 4U4BA 3LKNB 4J6RH 1ZV5A 1YPZA 4JZJC 3UTTA 4PD4J 4ZSOE 3BW9B 3O6LL 3HZMA 4GS7B 2VDLL 3TPKA 3MROB 3QXDA 4L1HA 3VFRA 1Z5LB 2IH3A 2VL4A 3AUVA 3G9VA 2RAMA 4LEOB 4NT6B 4RGNC 1IAOA 1JYWA 4IRSA 5J11C 3QUZD 1L9MA 3A6CL 1KFAH 5E7FA 2Y4SA 2PR4H 4X9FA 1IL1B 1CGWA 4LCWD 4DEPC 2KDGA 1UM6H 2DM4A 5B3JE 1F4YL 5EBWB 1UXWA 3DX6A 1Q1JL 3VA2C 4K7FB 1T89A 2NY0B 4N0CD 3ULUC 3HZYB 4XAWH 3BDYH 3MJ9L 1QFUH 2XKSA 5TFSH 1LDPH 3MBEA 1D7FA 5HHME 2VDNL 1AD9A 3KPOA 3EO9L 3RWHA 3P9LA 4WRLA 2ZUWA 4ZOBA 4JG0H 5IVNA 4BUGA 5AUMA 4AT6A 3VFNA 3T65A 2KPNA 1LO2L 4PLKC 3V4VL 2DD8H 4WW2F 1KJVA 2R0WL 3IKKA 5I1LA 5IHUH 3QIBC 3VRLE 5A2IH 2J5LC 1Q9LA 1UG9A 2NNAB 4QXUL 1Z9SA 3HA0A 3QQ4A 4PJFF 4Y5VA 4OIAA 4Z7QF 1SQ2N 3WSQL 3U4BH 1OARH 1ZT1A 1RJZA 2D0HA 4ZFFB 3CLEL 4I5BB 4F7EA 4O5LL 2W60A 1UA6H 4D3CH 5JOFB 4HS8L 3CDYA 5FDYA 4IMKC 5IROC 5IESH 3U4EB 4MNQE 2MFNA 1NL0L 2FR4A 5HI3D 1JPFA 2NY2D 1JF6A 2QV2A 4MVBC 2DQFA 3H7BB 5KOVC 4HV8B 4FQQB 4UQ2B 5DTFB 1F00I 4Y89A 1CFTA 1UCBL 4Y2DD 4Z78A 1I8LC 2BRRH 2XT1B 2D7TH 3TCXA 5EIIA 4RGOL 5KVEH 1EUUA 3HMXL 2XWBA 3BIAX 4GMSH 3FQNA 5TDPA 3LS4H 2UY7A 1NBVL 4BZ1L 4PJBB 4NO0D 1RZIA 3U30C 5IVZA 4Y4KB 1X44A 4R97B 2YC1A 5CILL 4R2GB 6FABL 4I0CC 4U1HA 2VISA 4FMFA 4G7VL 5DJXB 4IRZL 4RIRB 1PFCA 4NYLA 5CGTA 3MSPA 1TDQA 2Z0BA 1PZ5A 4NPYB 5EWIH 4P2QB 2FATH 2NCMA 5A3IC 3UZVB 3SGDH 3U0WH 3I6KB 5J1AB 3SPVB 2VLMD 2QR0A 2XQYG 3HNSH 4LGPB 1QLFB 3L3HB 4K8RH 3PP4L 4W6WB 1QFWI 5TE7H 4WU5B 4NWUL 4Z0BH 3GHEL 1BJ8A 2D4FA 2NY5L 5CSGA 1HQRA 4JZJB 4NKOB 1CU4H 4MA7L 4L8BB 2O93L 5T1MA 2J6EL 2YXMA 3NVQA 4OUUB 5EULV 1NGWB 4M1GH 3WXVH 5GSRA 3ARTA 5B4MC 2R4RL 4QRTA 1G9MC 3X12A 2VDOH 1IKFH 5K59F 5C0AA 5MI0C 3ILPA 4RAVA 2F8VA 5E9DD 1J7VR 3NFPB 4LFHG 5IW6B 5J11B 1WZKA 3VXRE 5IIEA 1VGEL 4MZ2A 4PJXA 1ZGLP 1EHLL 5L7XL 4K3EL 3U6RB 3GSUA 5DYOA 1U8HA 4XP1L 5TE4L 5C9JB 4DEPB 3DROA 4HCRH 4LSSH 3VXQB 3TBWA 3WNNA 5EORH 2UY6A 1JZ4A 4PJGE 3I6LD 3BHBA 2DQUL 2WMPA 4XP4L 5HVFB 3LDBB 2KBGA 1ED3A 2DTML 3HPJA 4DW2L 1WZMA 3S36H 1YQVL 4LLVA 1XZ0B 5CIPA 1L4IA 1KTRL 4OSUH 3HFMH 1QQDA 3O3EB 1HHJB 2OL3A 3BP6A 3JTTA 4W6XB 4HFUH 3BKYH 4HLZH 4XC3L 2J5LB 3BPNB 5ELIA 2PXYA 3FO0H 1C08B 2Y06L 4JFZL 5BQ7A 4H25B 1FZJB 1FYTB 3O0RL 3S37H 1AJ7H 2E7HA 5IF0B 2VERN 4XBEH 2EDHA 2ADIB 4ZUSB 2D7PA 2IQAB 5C0CA 4N0UB 2JJSA 5TDNB 2B1AL 1SY6L 1YNTB 3MV8E 3BP5B 1P6FA 1YYLH 3ABZA 4PTTA 2ZUSA 3QHZH 4NOFA 5IVXF 2A0LD 4AIXA 3C60A 3SDDA 4AQOA 1U8LA 1R5IA 3OXRA 1EO5A 3WL9A 3JV6A 2P45B 5EO1B 3QWQB 1NPUA 1K9TA 3TBYA 1K5NA 4IRSC 4XRCA 1BZ9A 1IGTA 3G08A 1CFSB 1HQ4B 1N0XH 1UACH 1O5DT 3TJEH 3I50H 3RVTC 2P8MB 5EZOH 3QDMD 5FM4A 5FUOL 3CZFB 5SX5K 5DS8A 4HG4K 3LRSB 5KSAB 3REWB 1C16A 2QQLH 3UJIL 4N1HB 3E8UH 1ZT7A 3U30B 3SDXA 4HGWA 1FBIH 1UFUA 2A9ML 4G42B 3ARFA 1IQDA 3EGSA 1WIOA 1LMKA 1HI6A 5JHDE 5LWYH 3GMPA 4JDZA 2Y6SD 2G9HA 4OM0L 1PQZB 4Z6AT 1W8NA 4IRJA 4LHJB 3SDYH 3T2NL 1MCHA 1U41A 2QQNL 4BH7A 2NW2A 3AS3A 4YO0B 4Y4KD 5CHNA 5I1KL 3GEWB 2NW3A 2Y5TA 1GZPB 4HC1H 3K0WA 3SKMB 3SDAA 5CUSL 2D7OA 5DJDB 5DLMH 4KPHH 2JK5B 4Y5VC 1MWAA 1AC0A 5HSFA 4MS8D 3D0LB 4TRPL 1FVCB 3SKJL 4P2QD 5C0BA 4K2UH 3D85A 2ZKHH 4JKLA 2KQMA 3B3IA 4ZS6C 5MI0B 5HYJE 4PP1C 3KAAA 5FM5O 3T0BA 5HHOD 2VXUH 1CXKA 4HG4J 3VD9A 5C9KA 5SX5H 2NY4C 3RNKB 1NMBH 1U95B 5ESQB 1J05B 5E5MB 5IGXH 5MEOA 2XA8L 4S0SD 1MJ8L 3CCHA 2DKSA 5EOQH 4JREB 4WY7H 5CEZD 3KYOB 4J3SA 1M6OB 2RBLA 2X5PA 5JR1L 5ANME 4Y16D 2B20A 3NABL 3TWCH 2FDBP 2NX5B 3MNZA 4DKDC 5JQ6L 3VFOB 5DMGC 1TQCC 4NKMA 4QHLB 1KCSH 3QB7C 4OZFG 2C3VA 2F58L 2CDFB 3SQOL 1X5KA 2BVYA 5C0FA 1SEQL 2FJFB 3CH1B 4CADA 4OCYL 1OLLA 3P0GB 1S7VB 2VR4A 1N26A 3IDXL 5CKGA 1FG2A 3RNQA 5HGBA 1II4E 4HIXL 1N3NA 2Q8BH 1OGTA 3HI1B 4JZOA 4LSTL 1J1OH 5DSCA 1ZEAH 2E27L 3ELAT 3G6DL 1AGFB 1ADQH 3GSQA 3HC3L 1F45A 1HHIA 3DXAE 5D1XB 2VZOA 5CEZL 3W11C 3K4ZA 3ILQC 3GJFK 5F6HJ 3D39D 2BVQA 3MNVA 5ABDE 3QEHA 2P5EA 5T1DL 3PWNB 4IJ3C 4KJPD 3RGVC 4D9QD 3W2DH 2DWEA 3WLWD 2ICEB 2DQTH 3UTTB 1YPZB 1IC7L 3FQRA 2EDYA 3BISA 2D0FA 3HZMB 5GGTA 2VLKA 4P3CL 4EXPX 2BNQA 2YD4A 3QXDB 4PJ5A 3VFRB 2R0LH 2IH3B 4DTGH 1FYTD 3RQ3A 4KK8C 1IAOB 3QO1A 2ATKA 4IRSB 3QDJE 1TJIH 1CD1A 2GITA 5J8OA 2K3TA 1JRHL 4TPRL 3JWDC 1JUFA 4LDLB 2RB8A 2EH8L 3TBTA 5ILTL 1UXWB 3DX6B 3EO0A 4ODHH 1GZQA 2B4CL 4KTYA 5E00A 4HBCL 1JPSH 3UYRL 1VCAA 1AO7E 4CNIA 1O0VA 4OD1L 4PRIE 3MBEB 3BSZL 5C6PB 4FXKA 1AD9B 1YA5A 3KPOB 4LOUC 4ODVH 4M6NH 2XXCB 3P9LB 1MHEA 5M94B 3L5IA 4JVWA 2X4UA 5AUMB 5KSAD 3VFNB 3KPSE 3ZDYF 4AT6B 1BQUA 4UTBL 1XGPA 1JZ8A 4OD2A 3T09A 3NIFF 4XH2A 1KJVB 5I1LB 4LEXL 1Q9LB 5GRUL 3QQ4B 5IB3A 4Y5VB 3KXFA 5E4IA 4OF8A 2EE9A 2Y5EA 1FZMA 4HJJL 1ZT1B 3C2AL 1GOFA 1KCVL 1CXFA 5DJYA 2DBLL 4JEGB 1P84K 4JFDD 4F7EB 1ZVYA 2W60B 3EYQD 4U1JA 5E5UB 2CRMA 1IBGL 3EYFA 4LSPL 1DVFC 3ALXA 2JJSC 5D7IE 2FR4B 1CYGA 2NY4B 3DNKA 4BH8A 2XN9D 1TLKA 2R1WA 2BDNL 4QOKA 1JPFB 4P3DA 2OR7A 3TVMC 3UMTA 3PGFL 4C54A 4OV5A 1FH5H 2DQFB 5F1SA 5CJBA 2NXYB 3A67H 4ODTL 1CXIA 1CFTB 2PKDA 3C9NA 4Z78B 4N8VG 3CU1A 1TZGL 2C9AA 4WI7A 2DQEL 1P7KA 1QG3A 4W81A 2XWBB 4OZIA 3FOLA 3FQNB 4HFWA 1CFQA 4MDJA 3TCLA 3U82B 1OP9A 5TDPB 3IAPA 4ZMAT 3QT2A 1CGSH 1UB6A 1RZIB 5E99H 5IVZB 1W2KT 3ZDZE 2YC1B 4PJHF 2EICA 4U1HB 2VISB 1O7SA 2AQ3A 4NYLB 2HT3C 5D1ZA 1PZ5B 4NN7C 4FFYL 1P84J 2P44B 4YFLF 5D5ME 1V3MA 5FA4A 4IRJC 1HZHL 4MD4B 1JJUA 2QR0B 3JXAA 1X5AA 2BY1A 5GGRY 1F3DJ 1TENA 2YOCA 4WI8A 4KDWA 5HHVL 5T3ZL 1BPVA 4JFQA 4JDVA 1U92A 3CX2A 3SDAC 5M7QA 4OKVA 3HAEG 1A2YA 1HQRB 1TZIA 1XR8A 3RAJH 1C7SA 1ZKAA 5T1MB 2HTLC 1MRDH 2VDQH 4ZO9A 3AY4A 3DETC 5AZEL 5GSRB 4F80A 4LARL 3VH8A 4NQUA 1PKQE 3X12B 5C0AB 1QOKA 5EUOF 3ILPB 3W39A 2R39A 4RAVB 5GS0D 5LCVH 1UZ6E 5GJTL 2QHRH 3SGKA 5IIEB 5IFHH 4IMLA 4PJXB 3GSNL 3GSUB 5DYOB 1U8HB 3UTTD 3GRWH 5HXMA 3ARGA 3DROB 3SO3B 4W70A 4KKCC 3TBWB 4X6DE 2DN7A 1WAAE 4WW1A 4CVZA 2HAZA 3BHBB 4ZQKA 1WIPA 2H8PA 4RAHA 1FNEA 2W91A 5FOJA 2WUCL 3QDGD 2CRZA 4ZNEE 1QSEA 1ED3B 3HPJB 2DICA 4Q9CA 2AXFA 2XZAH 3HI5L 1EEZA 3VFGH 5GS0L 4LLVB 5DRWB 1DBBL 5CIPB 1KB9K 3LMJH 3FHQA 1QQDB 2Y72A 5CZVL 2FBJL 2OL3B 3BP6B 3JTTB 3T8XA 2WP3T 2BY0A 3VRJA 5IHLB 4KV5E 4EBQL 4DCQA 4F8QA 1O7VA 4N9GA 2PXYB 4JFOB 4LAJH 3U7WH 4HIIA 5BQ7B 4JDTH 4HEME 3MBED 3STBA 4FZEH 1GGCL 2HKFL 2CUHA 1H3GA 2Z8SA 4UT7L 5JTWA 1I85A 5T5NG 4GQ9H 4UAOC 1RIUH 4YFDB 1I9IH 2N7BA 2B39A 2BOCA 3FL7A 1MCNA 3DXAB 4WFGE 3N1FC 1G0YR 4PTTB 5IBUB 1JBJA 1A1OA 1A5FH 3SDDB 4RISH 1U8LB 1R5IB 3OXRB 3WL9B 3JV6B 1MFEL 3RX5A 2F8OA 5DHXB 5DWUH 3C8KB 3TJHC 4Y4FA 2Z9TA 3QIUD 1K5NB 4XRCB 4P23A 1BZ9B 1IGTB 3G08B 3ARDA 4H20H 2J4WH 1DQQA 4NM8H 3TV3L 4PJDF 32C2A 3QEQE 5DS8B 1CICD 3VFMA 1A8JH 4L8SC 4OT1H 1OGAA 1C16B 3MMEB 3GB7A 3KDMA 3OAZH 3SDXB 1K6QH 2IWGA 2NXYD 4HGWB 4OZFH 1U3JA 3UPRA 2F9BT 5F7KC 2J88H 3ARFB 1IQDB 3DYMA 1AFVL 3EGSB 4OCXL 1HI6B 3S4SG 1KIQA 3GMPB 2FH6A 1CN4A 4Z0XA 3RWIA 2HFFA 1QKZH 4NN7B 1A3LL 3R4DA 1RHHA 5T5NF 4UDUA 4OFKA 5IBTH 3RWJA 2G9HB 1FCCA 4EN3A 4EXKA 4IRJB 4BH7B 5DD3L 2NW2B 1U3HA 4LVNC 4PJ7A 5CHNB 2NW3B 4BK4A 2Y5TB 4WO4C 3OKLA 1ZAGA 4YHMH 3AREA 3SDAB 1HCFX 5J9PA 3FQTA 3PWJA 3P9MA 1MVFA 3SE3A 1MWAB 5DR5H 5EC2A 2CQVA 5B3NA 4EI6A 5C0BB 1G7MB 3D85B 5I16B 3GM8A 1IAIM 2DQCH 3EJYD 2HT4C 4OF3A 1GIGL 4OBSA 4ZPTA 1AY1H 2AI0H 2XNAA 3RDTC 3OJMB 4TNWF 4YBLB 3MPCA 5MEOB 2NY3B 4Z7UF 4HGMA 2DL9A 3CCHB 3DVGA 3TO4A 1QVOA 1KXQE 1I9RL 3VFUA 4PJIA 4KMTH 3K8MA 3MNZB 4NKMB 5C0AD 2C3VB 1FDLL 1NMCC 3D3VA 2VR9A 1TJGH 3O6MH 5C0FB 1L9NA 3VXUE 4CADB 3BWUC 4OFIA 1FG2B 5B22A 3RNQB 1P4BH 1N3NB 5IEHA 4JKPL 5LBSL 1OGTB 4JZOB 1FGVL 3PL6C 5DSCB 1A6VH 3EKCA 3G6JF 2YBRA 3GSQB 4H88L 4PLJD 1HHIB 2E6JA 3F7YA 3DARA 5CJQL 1VEPA 2DLHA 5GISH 5D1ZC 2VH5L 5IBLC 3AC0A 2ZCKL 3WKML 2PO6A 1EA9C 3GMOA 2BVQB 3MNVB 4Y1AA 4EZMA 5D2NE 5E08H 4L5FL 5IEKA 2P5EB 4KQ3L 4UAOB 2NMSA 2DWEB 1EO8L 3GNMH 4NDMA 4AIOA 3EDJA 3DSFH 1BD2A 1D5IH 4C83A 1JNNH 1UZ8A 4FA8A 1TTUA 3FQRB 1TQBC 2HRPH 1G7IA 2WWMC 4PYGA 1PLGL 2PXYD 2VLKB 3SCMD 1E6JH 2B5IC 2BNQB 3FFCA 1CLCA 1MNUH 4PJ5B 4GAGH 3NCBB 4L4VA 3O6LH 3DHJA 1E6OH 1BM3H 3V79C 3QO1B 2ATKB 4YX2H 1CD1B 2GITB 2X1PA 3QUXA 2ENSA 3MYZA 3MA9L 1JUFB 5C0CD 1NCBH 1TCRA 3D2UA 2BXZA 1M05A 5J3HC 3TBTB 2AJXH 1CR9L 3EO0B 4DUVA 3L6FA 1XGTA 3C60D 1GZQB 4LLQB 3P2TA 3SDDD 5E00B 1T1ZA 4EUPH 1LNUB 3G5XA 1Q1JH 1TPXC 4I9WD 5K59E 3RZCA 3FT4B 2AAVA 3NPSC 3T0EE 4CNIB 5GXBB 3ROOA 1QPXA 4FXKB 3QH3A 3U9UA 1MHEB 4GKZA 3IU3A 4KRPC 3FAWA 3AB0C 1J0ZA 3TN0A 2E7LA 1CD9B 2FEEI 4OD2B 2AQ2A 4LVNB 4XH2B 4I3RH 1ZHLA 3ARFD 1J18A 3GSWA 3BJ91 3BAEH 3GI8H 4X4MA 1GC1H 3ESVF 5IB3B 4GO6B 4ZUWA 3KXFB 3QWOA 1T7WA 5IFJA 1A21A 1Z0NA 3UTSE 2HFEB 4ODWA 5DJYB 3ZE2E 4Y2OA 4U1JB 3V5KA 3HAEH 3FZUC 3EYFB 3CLEH 4HZLA 5CJ5A 1X6LA 2R29H 5F6IC 1YY8A 4R8WH 4BH8B 1DQDL 2R1WB 4HS8H 4NQCE 1E28A 1JMXA 4P3DB 4QOKB 4I0PD 5E03A 5FIEA 4OV5B 2IANA 1L7IH 4XPHL 1NL0H 2X7LA 1ZLUH 1OQOA 3C9NB 2I5YH 3D85D 5BJTA 2CGRL 2I07B 2D9QB 4P23C 3BT2L 4DQOL 3ARDC 1UCBH 2KH2B 5D93C 5J12C 1U6AH 3VGDA 1CGVA 5GS1A 1P7KB 2YK1H 2OMNA 3FQXA 4OZIB 3FOLB 5L6YH 4HFWB 1CFQB 4MDJB 3TCLB 3VFVA 4OLZH 2NY3D 4I18A 1AR1D 1UB6B 3FB6A 4JFFE 2Q20A 3KPNA 2XRAL 3BN3B 3QAZB 3PL6B 2EIEA 2DF3A 2GK2A 1NBVH 2J7LA 3IDGA 1CL7H 5CILH 6FABH 3WIIL 3Q5YA 5D1ZB 4LQFL 3M17A 4G7VH 5C08E 1FJ1A 4MB5A 2VXSH 5FA4B 2MNUA 4YHKL 2I60L 4FFVD 4GW1A 1HHHA 3JSSA 1XGYH 1BGXH 1U2CA 4JFQB 4JDVB 3AREC 1U92B 2GTWA 1JNHA 1R0AL 4OKVB 3TM6A 1A2YB 1W72L 2BY2A 4ZO8A 1TZIB 1XR8B 5CLTA 1HEZA 4H8WC 3LD8B 1MCCA 2B5IB 3T0EC 5CSZA 5EA0L 4UU9A 2Q86A 5FV2A 3VH8B 1GGUA 4I2XE 2V17L 5KS9F 3W39B 3V7AE 3VGGA 4WUUA 4X8XA 2ADFH 4IMLB 5JXAH 1ZVHA 2F5AL 4W6YB 2CKBL 4ZODA 3ARGB 2C4FT 3TO4C 2R0ZL 3LIZL 2G5BA 4P9MH 2IPTH 5L7XH 4X7EC 5CCKL 4ALAL 3BIBX 4MXQD 2X89D 1DLFL 2BNQD 5TE4H 3T3ME 4PJ5D 1T7VA 2DJUA 4WW1B 4Q97A 4FOMA 4LCUA 1KJ3L 4MGXA 1FGNL 4Y4HA 4CVZB 3ULVC 2OTWB 1MFBH 4ZQKB 1AGBA 2H8PB 3HUJA 1FNEB 2EO1A 3ARQA 1QSEB 4X7TA 43CAA 2AXFB 1EEZB 35C8L 1KENL 4G6KH 4LK4A 4FABL 1MY7A 5C0NC 1CF8L 2DTMH 1MF2H 5MHSE 3T8XB 1I3GL 2DLFL 4WJ5B 1EEUA 3VRJB 4U6YA 3VJ6A 3EUUA 1CLZH 4DCQB 1G6RL 4LRNL 4N9GB 4EKXA 2DL2A 4XC3H 2UWEE 4HIIB 2GJ6E 3QYCA 1AHWA 1FP5A 5ALBL 4PY8J 4O9HH 3NH7L 1HIMH 4JFZH 3HG1E 4JM2C 2W0KA 4UB0H 1PY9A 3P0YL 2DQHL 4POZD 2EDXA 3UXFA 3VGBA 4M7LT 4LSUL 4U1LA 2BOCB 4LVEA 4QHMA 5HGHA 3ARSA 4JANA 1NMAH 1J5OH 5DQ9B 3KXFD 5ALCH 1A1OB 1SY6H 3MRMA 2BXYA 2DDQL 4BSWA 2VLLA 3CVIH 1IAII 3K3QA 5EZJA 1Q9KA 4Y4FB 5B39A 4P23B 5DRNA 3ARDB 5D93B 1DQQB 4A2LA 32C2B 1S9WA 1CDJA 3CXDL 3SGEI 4QOKD 2GCYA 1OGAB 4NHCH 3FAXA 2XKUA 4QHKI 3GB7B 3KDMB 4YH6A 1A3QA 3UPRB 3WFDH 2QQQA 5GZOD 2WBJC 5I1HL 1KIQB 2YA2A 4Z0XB 3RWIB 3P4OB 4GRMA 1UB5A 3F62A 3U9PH 1RHHB 1NCTA 4J3OC 4UDUB 3RWJB 4PS4L 4JY5L 2W59A 3NAAH 4EN3B 1MJJA 1DSFL 1KBGH 1U3HB 4YLQT 3OMZA 4PJ7B 4OM0H 3VGFA 3IF1A 3OKLB 2X42A 3L1OH 3AREB 4LSRL 1RUQL 3FQTB 3PWJB 3P9MB 2HTKC 4JRXA 5EC2B 4EI6B 3DX7A 3IRPX 4G3YL 4UT9H 3DGGA 5I15L 5L9DH 4GG8A 1M7XA 4YEEA 1ES0A 3HS0A 2H3NA 3CSGA 4ZPTB 4MHHI 2WV3A 2XNAB 2XY1A 3V4PH 3K2UL 5LQBL 4NCC2 3ZE0F 4YHNA 4I3SH 1R5WA 5L0QC 3DVGB 1UH3A 3TO4B 1QVOB 5GRXG 1AXTL 3O41A 1DL7L 4PJ8A 3VFUB 5IG7A 2VXTL 4PJIB 3S3SA 5C3LD 4YPGA 1SBSH 3LKSA 1BHGA 4YUEL 3D3VB 3CJJA 3S5LG 3LQAH 5A2LH 5ITBH 4LIQL 4X6CE 2LU3A 3BD3A 2P43B 1MCLA 2IFFH 5IEHB 5D2LE 1T7ZA 3ARGD 1BQHA 3GSVA 1NCNA 2HWZH 1NANH 3FB5B 4OZGA 1PJ9A 2YBRB 2YMXH 3F7YB 4LLAA 2G60L 4X83A 3FQWA 1FVEA 3ARVA 4KDVA 3S3PA 2E27H 2XTJD 3HC3H 1QSED 5EU7C 1G1CA 4KZEH 5JIPA 2YPLA 2PO6B 3GMOB 2FGZA 4JJHA 4Y1AB 2AJVL 3U7YH 1Y18A 5IEKB 1MIEL 2DMCA 2ZCHL 4NDMB 1C1EH 3U1SL 1BD2B 1NFDE 4C83B 2IQ9L 1UZ8B 1YEJH 4U0QB 4WV1C 5CMAA 5GS3A 1G9EA 1RJYA 1G7IB 2XY2A 4CJ0A 2NZ9D 5MENE 4Z7WF 3FFCB 2AJ3A 3GBMH 3GKZA 4L4VB 5HVGB 2MCPH 3NTCH 5ICYA 1U91A 4KVCH 5F7EH 5BS0D 4TN9A 4P9HL 4EOWL 4YE4L 1MCRA 1P7QD 1G7QA 4JJ5A 1WCQA 4XPGL 3QUXB 2EE3A 4PJ9A 1CDHA 4UINL 3B2VL 1TCRB 1PG7W 3ZMRA 3IJYA 3D2UB 2HA1A 1M05B 2H9GA 4FQ1L 1EVTC 1OTSD 5IWLA 2COQA 1IGIL 1EGJA 4FZ8L 3MBXL 1HCVA 1XGTB 3L6FB 3O6FA 1LO5A 4DGYH 4XB7A 4PGZA 2EH8H 4CU7A 5SWSE 1T1ZB 3KPRA 4JFEA 3G5XB 1S3KH 5ID1A 4OFPA 2B4CH 4ONFH 4Y4FD 4CGTA 2FX9H 5GQBA 4GKSA 3RZCB 4D0DA 5JZ7C 5ERWA 3ROOB 4FQXC 5SWZA 5IFAL 3QH3B 1Y0LA 4K71C 4PV8A 3U9UB 4GKZB 3IU3B 1BZQK 4UUJB 3GUTA 3TN0B 5K9KA 3QA3A 3PQYE 1SHMA 2A77H 3RWGA 3SJVD 1ZHLB 4UTBH 3GSWB 1NCUA 1OWWA 4U0RB 2BP3A 5I74B 1N59B 5DC9B 4LPVA 4M1DH 5MERA 3SE8H 4ZUWB 3QWOB 4JHBA 5IFJB 5FUCE 1CFBA 1HINH 1KCRH 5JW3H 4KAQH 3IT8D 4ODWB 1NBYB 2LU7A 2XWTA 5INDA 4EN3D 4ZFOL 4ONGL 2FEDD 4HJJH 3C2AH 3V5KB 1U3HD 1RY7B 4HZLB 1PDKA 4M5ZL 1YY8B 1J9CT 1E28B 1IBGH 4LSPH 4GRWF 2IANB 3AM8C 3ALPA 4U6VL 4XWOD 5L0QB 2XXMB 2X7LB 1I75A 1PEWA 1D5XA 2BDNH 2EDEA 1GOHA 3RWEA 4BFBD 2EECA 5BJTB 3MODL 3BN9C 5DJ2A 3DRTA 4R4FH 3O9WA 3MLXL 2EXWC 2CXGA 2IG2H 3C8HA 3FQXB 4HF5H 4IOFD 4X5WA 4D9RD 1MI5E 5CD5C 3VFVB 3QEGH 4HWNA 4I18B 4PJAA 1X5YA 3FB6B 5TJWK 5I6XC 3KPNB 1ETZA 4BSJA 1A7QH 3UYOD 1YY9D 3IDGB 3LB6D 2P42B 4XVTL 2VLRA 4P5MA 2KUTA 2VWEE 3B9KC 3MZTA 4MX7A 4P4KA 5EU4A 2OP4H 3M17B 5JUEH 2VLJE 1FJ1B 3VI3F 4G8GA 2CR3A 4XPTL 5TPWL 4KKBD 4GW1B 1HHHB 4WNQB 3BKMH 1YEEL 2GTWB 1JNHB 4OB5L 3D87B 5T3ZH 5FYKU 4NZDA 1PVHA 3CFIC 5J6GA 1BF2A 1I1CA 5FB8A 2C1OA 3ZKMC 4R9HA 4BQ8A 1OAXH 3GO1L 5CSZB 3DPBA 4UU9B 4NZRH 2PO6D 2Q86B 4FFZL 3RY6A 1MLCA 2ITDA 2YKLH 1G1YA 4Y1AD 3R8QA 3VDCA 4HMEA 1YEHL 2ADJA 2DMKA 3L3GA 4WUUB 2CK2A 3EJZC 2CJUH 1DANT 1HDMA 2GK0A 4JRWA 4FS0A 2OYPA 3TZVC 1BD2D 1UENA 1BWWA 2VKWA 5GJTH 1FNLA 4B0MM 3DV4A 1MJUH 2G5BB 4ZD3L 4PJ8C 1GC1C 3CFJA 4NGHH 2ZOKA 3FFCD 4MA3A 4IDJL 5DRZB 2C26A 4L4VD 4OLEA 5FUCC 3BPOC 4LCUB 1WIUA 4Y4HB 2PCPA 2VXQL 1AGBB 3RVUC 5C0GA 3HUJB 2EYSA 2L7UA 5D72L 4X7TB 3QUXD 43CAB 2ESVE 1MOEA 4XVSL 4K71B 3ZHDA 1YEKH 3D2UD 3QPQD 3UAJD 4Z7UE 1HKFA 1R3IH 2W65A 4PRHE 4YHOL 1OLZA 3X14A 4U6YB 3VJ6B 1YNKH 2JB5L 4BQ6A 4ZOCA 2DRUA 3QUKA 2BNRD 4XHQA 1JWMA 1I7RA 3C5ZA 3FRPA 3RZCD 2CIIA 3FJTA 1BEYL 3EHBC 1HILA 4UNTA 5DK0B 1AHWB 3UDWC 5F9WC 4JQIH 3CAFA 5GPRA 3HZKA 1Z9OA 3BYTA 3EOBA 5GSVA 4HS6A 1GGCH 1ZTXL 5DVLA 4P5TA 4R3SA 4N0FA 2B0SL 4WCYH 1KYOK 4JN1L 4U1LB 4MZ3A 4QHMB 5E4EB 1A0QH 2WBKA 3MRMB 2ZUVA 4TUOA 2VWEC 4BSWB 2NY1D 3K1DA 2VLLB 3IFNH 4RGND 2LVCA 5IQ9A 5BV7L 4Z7VA 1Q9KB 5B39B 1Y6MR 3BQUA 5I1GH 1UWXK 5DRNB 5F7FA 1T66C 2Z8RA 3ZE1F 3H9HA 3OTTA 5IQ7L 4MJIA 2PW1A 3QZWA 4KJWC 1S9WB 4WEUD 3BE1L 4U3CA 2D31B 1A7OL 5L8LB 2GCYB 2IAND 3O6FC 4N8CL 1BFVH 4UQ3A 4MLIA 1U8NA 4XPAL 4E42A 4RQQA 3SGDI 1E4XH 4XPBH 1KELL 4Y8AA 1AKJD 4NM4L 5KAQG 1AFVH 4GRMB 1UB5B 1OSPL 4OLVL 2EE2A 5CJOH 2ZCLH 3WJLA 2XTLA 3B9VA 3IDYC 1MJJB 1KYOJ 4PJCF 2BRQA 4ZYKA 4BFGA 3IF1B 2VTFA 4J4PA 2DIAA 4XCFH 5DFVD 1NUFA 4G6JL 2FEEL 3ULUL 3MRCA 5I0ZA 4BSVA 4JRXB 4JQXC 4K94C 1IEBA 1JHTA 1VFBA 2FX8L 3PDDA 4JRYE 3DX7B 1YNLH 1RZ7H 3DGGB 4GG8B 1HK6A 3V2AR 4A2MA 5KSVA 4PFEA 1ES0B 1CDIA 3HS0B 5D70H 1R5VA 2ZJSL 5EG6C 2FZ3A 4NCDA 4L3AA 5LAXA 5C0RL 1WT5A 1WK0A 4BM7A 4YHNB 1R5WB 1CVSC 1IQWL 2JE8A 3QXVA 4WGVB 3O41B 5I17A 4PJ8B 1AR2A 4GRLC 2IBGA 4RRPG 5IG7B 4YPGB 5KAQF 3A6BH 3LKSB 3UJTL 3CFKA 2J1KA 3QFJE 4X7DC 3VFTA 4GG6E 4WUUD 4NUGH 3HCVA 4JFHD 1MREH 1FDLH 4X4ZA 4XNZC 1BQHB 2Z91B 3GSVB 1KNOA 2LE9A 3RL1A 4EJ1C 1EDQA 5LBSH 3UBXI 4JM4H 1KLFA 3FQWB 1FVEB 3GMRA 4FP8L 4Y4HD 2BERA 1U3YA 5KG9A 4Z8FL 1EMTH 4XNUL 4F9LA 4X4XA 2YPLB 1WBXA 2R15A 3FO1A 4N8PA 5BVJA 3KJ4C 2YN5A 3UROR 5F21B 1RULL 1HNGA 1EEQA 3FKUS 3FONA 3MREA 5HYQA 2D4DA 4NC1C 1VFUA 4HSQA 4M3JA 1WGOA 5CMAB 2AABH 2J2ZA 1RJYB 1X4XA 4LVHC 4Y5XC 1MRFL 3RHWK 3TT1L 4NZUL 5HHMD 4C57C 3LVEA 5B4MD 1MCWW 3UBXA 1LO4H 2AJ3B 4R4NC 5FO9A 4R0LA 4ENEC 2L4OA 3MCKA 4M1CD 5ICYB 2VDKL 1U91B 2YD2A 2D7NA 3V4UL 1WQVT 1G7QB 4JJ5B 3MNWA 2J8UA 2YRZA 1MVUA 3MV11 3WUWG 4PJ9B 3K7UA 3WBDA 3IJYB 3QUML 3TPUA 1G84A 2H9GB 5MP6L 5KANI 5MEQA 1TXKA 4HKJA 1H3PL 3X3FL 2E3VA 3O6FB 1LO5B 3OAUH 1QNZL 3F7RA 2WANA 3KPRB 2RJMA 5LXGL 4JFEB 5C3TA 5ID1B 1G9ML 2XQBL 4UV7H 4D0DB 4BYHA 1JHLL 5ERWB 4MNQD 5SWZB 1FLRH 2ARJA 1F8TL 1Q0YL 4WI9A 2IMNA 1Y0LB 4PV8B 4CN6A 3OF6A 2YUXA 4YAQA 1F4WL 4PBWD 3GUTB 4YWGL 4XMLH 1HKLL 2ZUUA 4X7SL 4OGXL 4EIZC 5K9KB 1WFUA 3QA3B 3W5MA 5HD8D 1D5ZA 5DD6A 5CP3H 1KB5L 1IRAY 3HI6L 1SM3H 1MUJA 5MERB 4PJEE 3MOAL 4LCCC 4UDTA 4DN3H 3UC0H 3LQAC 5DHVH 4F9PA 2G75A 2XWTB 5INDB 2MKLC 3VXSA 3ZYIA 4DJMA 1KC5H 1BBDL 4TNVF 4ZXBA 5K9JH 4NBYB 4PRHB 1T22A 4OIBA 3OPZL 4M6ML 3CFDA 5BXFA 1D5XB 1DQDH 5DJCA 3RA7L 4LPYA 3RWEB 1FO0A 3CNKA 3REVA 1E4KC 4LASL 1RJLA 3O8XD 1TMCB 5DA0B 5H8DA 3NFSL 5DJ2B 4F37K 4PUBL 4LLUA 3DRTB 5F7DA 2FH8A 3O9WB 3RVTD 2K7QA 4P2RA 1IAIL 1YDPA 4X5WB 4XNXH 4WW2A 2ZG1A 2YPKA 1FNSH 3OXSA 4TUJB 4FQ2H 4PG2A 4HHAA 5CD3A 4PJAB 1CE1L 4PJFA 4U3XA 2C3XA 2O5YL 3LZFL 1ETZB 5CZXC 5A2FA 2OBGA 1ZK9A 4HQQH 5FYJH 1AP2A 1JF1A 5F6HI 4Z95H 2G2RA 1TZHA 2VLRB 4P5MB 5D7LA 5FGSA 4PGDA 1RUKL 1U8OA 4MX7B 4P4KB 5EU4B 1LP9F 3TGXA 4G8GB 5GRJH 4U49A 4FHBD 2VKXA 4LQFH 4N0RA 3IFPA 3Q5OA 4MXVE 5JXEC 1JE6A 5I8OH 1AGDA 3RI5K 1PG7X 2I60H 5EBGA 3MACL 5E6IA 4U7KA 2H32H 3OB0K 2OQJA 4KGLA 5J6GB 3VDBA 3MLYH 1DBKL 1QBAA 1R0AH 4F58H 2GKIA 5FB8B 2C1OB 1ZWIA 1PSKL 3QDHA 2HT2C 2DM2A 3L3JA 2QADB 1MLCB 2ITDB 2YD8A 4PGCA 2ADJB 2IC2A 1CIUA 1IJ9A 3L3GB 4WIQA 4BKLA 4NC2B 2V17H 1HDMB 3U7AA 4JFXA 4O00A 1MFAL 1FZOA 3LKOA 4YDJA 3P11H 5JA9A 5LGHL 5GGQL 4H0HB 3CFJB 1BJ1J 5DMGD 4MAYD 1YMHA 2F5AH 1BJ1H 2ZOKB 3PE9A 4MA3B 5HHXL 3IB4A 4JVUA 3GMMA 3P4NA 4LRIA 5CCKH 1OB1A 4JRYB 3UP1A 1T2XA 1DLFH 2PCPB 2YA0A 2VMFA 5IR1A 5C0GB 1GCFA 3TYGL 2EYSB 4P59H 3JWOC 4YGVB 4PJ9D 1FPTH 3HE7C 3MV8D 3LEYL 2OZ4A 3KJ6H 2Y36L 4B5EA 1SMAA 1EZVY 4P57A 2W65B 1ZMYA 1TIUA 3MLWL 3WFEH 3OB0H 4GW4A 2NXZD 4JFED 4YBQC 4LSVH 2QSVA 2E5EA 3PDGA 4KY1L 1JWMB 1I7RB 3C5ZB 4KJYA 3H6JA 5C07E 2CIIB 1J0JA 1HILB 5HBBA 2A6DA 1G6RH 4L4TA 2ICWJ 3GBLA 1JNLL 3HZKB 3EOBB 3RGVD 5GSVB 4HS6B 1DBJL 1A7RL 1KPVA 1VPOL 2A74A 4HH8A 4P5TB 4R3SB 3RRQA 3VG0L 4HUMB 4N0FB 3VD5A 4RMRA 5F8RC 3P0YH 1VHPA 3LSOA 4G8IA 3OBAA 5JHDD 4DN4H 3BGMA 3DVFA 3IS0X 4LSUH 5E8DH 4NFDA 1X3DA 2HRLA 3MRGA 4TUOB 3K81A 4R0LC 4Q58C 1Z3GL 5IQ9B 4Z7VB 3BQUB 4JZNB 2B1HL 5DD0H 3WIHH 3QRGL 3H9HB 3ZL4L 2VC2L 2HFGH 4MJIB 1S9XA 2IMMA 2PYEA 1CD0A 4XBPA 1J87A 2H2PC 4S1RH 2IFGA 1IZJA 1LO3L 2Z31A 3IRZA 4UQ3B 2DWDA 3J7HA 4Z7WE 1NAML 1U8NB 4E42B 4RQQB 3U4AA 3MQIA 1N6QH 2BY3A 1FFRA 4O58H 5JIKA 4FTVE 3O9WD 1G9NH 4TYUA 4NKQB 1JPGA 3NGBC 2CUIA 1VA9A 3TA3C 3VI4E 5IVXA 4JY5H 4ZYKB 2OSLA 2FO4A 3WO3B 4LHUB 4UBDC 1Q94A 3MRCB 4BFIA 2VLRD 3S98A 4BSVB 4LPXA 1TITA 3DUHA 4HXAL 4P4KD 1OTUC 3FN9A 3JUZA 3KR3H 1IEBB 4EI5A 1JHTB 1VFBB 2XZCH 5F44A 4S1DC 3S88H 4L3EA 3MV9E 5KSVB 1TFHA 1R5VB 4TSBL 1F6AA 4OLWH 3RTQC 4AEEA 1S7UA 3TVMD 2FZ3B 3BJLA 1N8ZA 4WI5A 4U05A 4AJ0A 1H8NA 5LAXB 3NACH 4NNXA 4BZ2L 4QWWD 5BO1H 3KHQA 5I17B 2RCSH 3EW3B 1A14H 4XNQA 3VXME 2QADD 3O2DH 1JVKA 3CFKB 4PYHA 2EZ0C 3HCVB 3MLPA 1NEZA 1T1WA 2A73A 4WFFE 5I1EL 2DI9A 1NLDL 4UNUA 1KNOB 1QRNE 3RL1B 1M7DA 2X1XR 1DFBH 5KVDH 4Z7OF 2DLIA 3GMRB 5GIRA 1DN2A 1JGVH 5KG9B 4U1GB 1QLRA 4QRPE 3QWRD 3INUH 3FMGL 4TSAL 4X4XB 3RL2A 1N64L 4HH9A 4D0CA 1WBXB 3FO1B 5BVJB 4FG6D 5I73C 1BAFH 3WFBH 5FGCE 4HEPG 1FRGL 1QSFE 4M93C 2R4SL 3RWFB 3FONB 2IGFH 1YJDC 3MREB 4J6RL 1B0RA 3HE6A 3G5ZA 5HYQB 3QQ9D 3I3BA 2Q8AL 1U8MB 2ENYA 5E6IC 2GAZA 2JCCE 1AO7D 4OJFH 4QTHA 3C5ZD 4P2OC 2RHEA 5E94A 4PRPA 1QUNA 3UBXB 3VD3A 2YZ1A 5FO9B 4R0LB 3MCKB 1W0VA 1MELA 1KFAL 1ZXQA 3CD4A 4P5TD 2PR4L 3MNWB 2J8UB 1IILE 4P9HH 4RMUA 1UM6L 4POUB 4M3KB 2F54A 3TPUB 3T3PF 3H3KA 5MEQB 2E9IA 4HKJB 1WUNT 4XAWL 1QFHA 3IXTA 5DEFB 4I1NB 1BVZA 4FQ1H 4G6FB 1QFUL 1D6EA 1DEEA 1IGIH 2B2XH 5TFSL 1LDPL 4XXCA 3BQUD 2OX5A 4AYFA 1CDBA 2ARJB 3ULUF 3D6GA 4JG0L 5DZNA 3CXHK 4OGAC 5DC0A 4YAQB 2DD8L 3UPAA 5IHUL 3ZZ1A 4KUCF 1D5ZB 4OZFA 5DD6B 1OAQL 4JVPA 1IFHH 1KJ2L 3UX9B 4S2SA 1IEHA 3U4BL 2ZSWA 1MUJB 3AMLA 3S34H 1UJ3A 1D3CA 3LHPH 1IKNA 3R06A 4UDTB 4GLRH 1UA6L 3QUYC 4F33A 2G75B 3VXSB 4GMTH 4AEFA 5IESL 1FNGA 5F1KC 4ZXBB 4ZAKA 3T0XA 4APQD 4KKAC 1T22B 4J4PD 1OW0A 4JKWA 5KSBE 2XZQL 3CFDB 1B4JH 2Y9RT 5BXFB 2LVEA 4PRAA 1FO0B 2BRRL 3REVB 2D7TL 1RJLB 1KV3A 1ZA6A 4HD9A 5KVEL 4LLUB 2EIZA 4GMSL 4L8CA 5F7DB 4K8RD 1UKTA 4P2RB 3MODH 3TO2A 4MA1C 1YDPB 3CXHJ 2V5YA 5IVOA 3LS4L 4WW2B 2YPKB 2C3WA 3OXSB 5CD3B 4HHAB 3B5TA 2D7QA 2DOCA 4PJFB 1N6UA 2Z31C 1YECH 5DEGA 2R2CA 3L3OA 3H9SA 2IPKA 4G6AC 4JB9H 5C09E 4JGMA 3JUYA 2QHLA 1AP2B 1JF1B 2G2RB 2W1NA 1QHPA 1TZHB 5EWIL 5D7LB 2FATL 4PGDB 4KK9D 1U8OB 4PREA 3U0WL 3T04D 4XVTH 3HNSL 4K8RL 2HJLB 1OAKL 2JTDA 4KJQD 5TE7L 4V1DA 1RZ8A 4Z0BL 4Q9QL 4M93B 5FYLH 4I4WA 3IFPB 4NC0B 4M03A 1CU4L 1AGDB 4XPTH 4QRRE 4OLUH 5E6IB 4M1GL 3WXVL 3PDOA 2OQJB 5B3JF 4NIKB 1ZWIB 2VDOL 1IKFL