1OPGH

Opg2 fab fragment
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
227
Chain Sequence
b'EVQLVQSGGGLVNPGRSLKLSCAASGFTFSSYGMSWVRQTPEKRLEWVAAISGGGTYIHYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYYCTRHPFYRYDGGNYYAMDHWGQGTSVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OPG2 FAB (LIGHT CHAIN)
molecule tags Immunoglobulin
publication title Crystal structure of the OPG2 Fab. An antireceptor antibody that mimics an RGD cell adhesion site.
pubmed doi rcsb
total genus 39
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 1995-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgH01
3NACH 3K4AA 4F3FB 1M7DB 1BQHB 1MCSA 4LDOB 4HX1B 2V9QA 3GUTB 5HGGS 2P5WB 1NCTA 2I60H 3T0EA 4LPTA 5AD0B 1U3HB 6FABL 2YN3A 2ADGA 4NWUH 5GGVH 2FRGP 3HI6L 1K8DB 2DRUA 4Z9KB 2Y36H 4UDTB 1A0QH 2H3NB 5FGCE 1RZIB 2E8ZA 2WQRA 4G9FB 4CJ1A 2VITB 2YN5A 4WWKA 4MD4B 3ZSSA 2XKNA 5C0CA 3LD8B 4Y4HA 4PJ7F 4WDIA 1ZTXL 1Q8MA 2RCSH 3MBXL 4OFYD 1UA6L 3HZKB 3HNTL 1DBAH 4GKSA 4LCUB 3RDTB 3BP5A 3TH4T 5KSAC 5DURD 3S88H 3QNZA 3I6GB 3UZQA 4Y16A 5F1IA 1YPZB 2JCCA 4MAYB 4ZTOL 2X7LA 5EDXA 5IFJA 3M8OL 5DGQA 3DROB 1S9XB 3QIUD 3OX8A 3BGAA 4JKPH 3QUYA 4ODUA 4X9GA 5IOPB 5L7XL 5DD3H 4HUWB 1NGZB 1NGWB 3VXUE 2F53E 4MB5A 5IG7A 1G0DA 5GGTH 3FO9B 3PDOB 1MI5B 4ZUUB 5BQ7B 5GRVK 3GI8L 4JG1H 3WLBB 1MHCA 1VDGA 1TXKA 4HLZG 3PHQA 2C3WA 1JZ6A 3DOSA 3JVGC 4NZRL 3FQXA 3C5SB 5DQDL 5EO0A 5EU4B 5TH2A 1IM9A 3VXMB 2EECA 4GKZA 3QH3A 2HT4D 4QRRB 5HHNA 5CEXB 2W9EH 1KELL 4EOWH 4X0KB 3ILQC 3NCYP 5F9WB 1SJXA 4KROD 2X9YA 3EGSB 1A02N 4TUKL 3V4PL 4MQ7A 1YECH 1JWMA 4S1QL 1IM3A 4A6YA 2DDQL 1DQJA 1XIWB 1Q1JL 4NSKB 3QDMD 4X6DA 1RIVL 2BOBA 4GRLD 4RX4A 2XA8L 3FT2B 3PGDB 3G5YA 3TH3T 4PLJC 4ODWA 2MSPA 3N9GL 4FNLH 3SKOA 5GHWH 3QEHA 4NQEE 4P4KC 1KJVB 4K9EH 2FL5B 4ONGH 5F7HA 2YPKA 3UTZA 3EYOB 1NFIA 4Z7NE 1JL8A 1YEHH 2A77L 2WP3O 4N8PA 1LK3H 3NH7H 2HT3C 4JO2H 3TWCH 5I9QC 4TSCL 5CS7A 3MNZB 4ENEC 4MXQC 2NR6D 1MJUH 1MF2L 3ULSA 1UWGL 1E27B 1DVFD 2YD2A 2W92A 2OSLB 2ZCHL 3GSUA 5E2WH 3UEZA 4LCCA 2UWEA 4F7PA 1KCSL 4ZTPL 3PXHA 3TN0C 4JY4A 3VG0L 5ITBH 1P4IL 4XP5L 5DD3L 2Y7QA 2RFXB 5I0ZA 1B0GA 3BWAA 2EE2A 3RUGE 2Q3ZA 4LMQI 2FBOJ 5ETUB 1KGCD 1S7UA 1B0RB 1O7VA 3AAZB 1CFTA 3OAYK 3OZ9L 5EOTA 1G7HA 3TPUB 4BKLB 1B6DA 4PY8I 4GBXD 4UDUA 1E6JL 5DHVH 1MRDH 3GI8H 4R8WL 2X1QA 5E2UH 4JRXA 2NW3B 4QHLB 4JZOA 4UOJA 5EC2B 1A4KA 5HY9B 2W38A 4MD5A 1A2YB 5D9SB 2FBJH 3UXFA 1G7IB 3TLRA 3AU1A 1JWUA 3HC0A 4OGAD 4QXGH 2VXVL 4NZJA 1E4WL 3WXWH 2OBGA 4JZNB 4BSVA 1FVDB 4FQCL 1L9MA 1QLEL 3L7FA 3HUJA 3W2DH 5EBLA 2YD8A 1INEH 2BRRL 2FB4H 4HH9A 1JUFB 1ZGLB 2ED7A 1DLHB 4LNVA 3IVKA 4JFPA 2DKUA 4I3SH 1UB6B 3BVNB 3HUJE 3GMMB 1FO0H 1G7PB 5CBEB 4A6YH 5A2KH 4MSWB 2GCYB 5E99H 4OAWA 4YO0A 4DZ8A 3KR3H 5I16B 5I1GL 1NDMB 2B0SL 3IFOB 3P9LA 4UQ2A 1RZKL 3QI9A 1QBBA 1JWSA 3RWHB 2OMBA 3QQ4B 5SWZE 3PF2A 1T0MB 1A9BA 2ZNXA 3PP3K 5BJTA 5I1LB 3FAXA 2GTWB 3KPPA 4M7JL 5GRYA 2HKFH 4PJIE 4KK6D 1L7IH 1FDLL 3EO0A 4BUGA 3VXSA 1CK0H 3NAAH 2FO4B 1MI5E 1CDUA 1VPOL 3G6JB 3HCVB 5HYJB 4NQDB 3WIIH 4YHYB 2Z8WC 4OLZH 3VGDA 3LN5A 2DQCL 3LKOB 4X4MA 3TBTA 2XN9D 2CGRL 4PLKC 4XP5H 3CVHA 4X5WA 5F7DA 4HQQH 4I48B 1X4XA 3LEYH 1ZEAL 2I9TA 4WEMB 3QIBB 2EKSB 1FJ1A 1H8NA 8FABB 3MLTA 4YHLL 4AH2B 5EC1B 4NO5A 1XEDA 1RURL 4HUMB 4JG0L 4JE4B 2VUYA 4XGZB 1SVZA 5CJXC 1WEJL 4U6YA 1IC4H 2QSCL 3BX7C 3MR9A 2GJZA 3O4LD 3M1BB 5TF0A 5FECA 3QUXD 1U41A 5IMKA 3O8XC 4YK4B 3KLHC 2R69H 2P46B 5F7EH 5IMOB 5DZNA 2Q3AA 1T1ZA 3PG2A 2FX9L 1QSEA 4JPVL 4K23L 2PXYC 3VRJB 4KDTA 2WUBH 4QTIL 5HHVL 1FNLA 4FXKA 3B9KC 2V2XB 5B21A 3MCLH 1F6LL 4U7SA 4O5LL 4JN1L 2WW8A 5BZDB 1N6VA 4UT7H 3F58H 2XTLA 3SY0B 4OZHF 4ZFOL 4NRZB 5CD3A 1HIML 3N85L 3T1WA 2BFVL 5E03A 4KMTL 3EFDL 1BECA 4HUWA 1U3YA 3UJIH 3C6LC 4M93B 4MJID 1HKLL 1MRCL 2X4QA 1BLNA 4L9LB 5IIEA 1J1PH 4L4VD 2DIAA 1XF3A 3NGBB 1GGUA 1CZ8L 1FNGA 1ZLVK 4HMDA 2JK5A 4P57A 5EOCJ 1N0XH 3DUSA 4JJHA 3PWJA 4X98A 1DFBL 5MENA 4P2QD 3RP1A 3QHTC 1U36A 1ZS8A 3Q3GB 4JM2B 3TF7C 4H26B 3RVTD 4H5SA 3NTCH 2BNQB 1CXIA 5HD8C 4Y4HB 3O6KL 1T1YB 4D8PA 5A43C 1M05A 4JY4B 4HK3J 4NT6B 5ID0B 5LG1A 2MOVA 1N4XH 3MACL 4PRHA 3RKDC 1ZSDA 4POZC 5C0IA 1IQDA 3U4EB 1G7PA 1ED3B 4QHKI 5HI4D 5D2LB 1CLOH 3VFWB 2W0KA 2EYSA 2C9AA 3MLRH 3IB4A 5A2IH 1S9VA 5I76B 4UV4L 1BOGB 4UB0H 4PD4K 3QFJE 4R96B 1OARL 2QHLA 1M7XA 4YGAB 5HHNB 2PR4H 1CD0A 5FO8A 5DUMH 1DEEB 1K4DA 5A2JH 4XMLH 1QLFB 3TVMB 2A6JB 3UTPD 5F71A 5JUEL 1L0QA 1YEFL 4KUCD 1N8ZB 4JM2C 4JFXB 1A4KB 4TNWK 2XTJD 1D5BB 3MA9H 2ADIA 4UT7L 4MXWL 4UT6H 5ALCL 2C1PB 3P30H 5DFVC 1RJZB 2CKNA 2ZUXA 5CJ8A 3RWFA 1HEZA 2ESVE 1EV2E 1F3DJ 2W9LA 3IKCB 4M1CC 1J8HD 1KFAL 3LKOA 3UTSB 3QNXB 4Z7UE 1BQSA 5GJSH 4KMTH 1NEZG 3U6RA 4PJ7B 1Z0MA 1HQRB 3BIAX 4ZUTB 4KTEH 3T2NL 4J6RH 5HVFB 5FKPB 4KDTC 3G5ZA 4UOW1 1P9MC 4PJCE 2DI7A 2MNUA 5F9OH 5GZND 4BH8B 5LAXA 1AFVL 1UA6H 5GJTH 7CGTA 1RVFH 1TPXB 4NKIH 4EQ3A 1YEJH 3LKNB 3IJYB 2E7CA 5DQJB 1TZIB 3W9EB 2NY3B 1VGEL 2BSRB 2CDGB 3O2WH 4S1RH 1X5JA 2P8PB 4U6XB 4OI9A 5T3ZH 5INCA 2IBGA 4NN6B 3DMMB 2VZTA 1AQKH 3V0VB 3TJHC 4TUOA 4PPTA 4KJPC 2E6PA 3DRTA 2H32A 1IL1A 3SBWA 3KYOB 3EJZC 2X2YA 1FYHB 4WV1B 1B0RA 4I3GA 1H9VA 4KZDH 5JIIA 2A6IB 3B8YA 1U8PB 4WGVB 5I71C 4S1QH 4HPYH 5J12B 4CBPA 2NX5E 4V2BA 2IWGA 4BQ6A 4KKAC 1FYTA 4G8GE 2V2WA 1AR1C 1GZQA 4KKLD 1H8SA 2GAZA 3FT3B 1HXMA 1QHOA 3G9AB 3QUYD 4HXAL 3VFVB 2GSGA 3EDFA 5IMKB 3GSXB 2E7LA 2EXWD 1QTYT 4ZOAA 5D5MA 1A1MA 3P4OB 5FM8A 3KLDA 4NKOB 3TJEH 4FZ8L 5CEZD 4F7EA 5D6DC 3OKNB 4XMLL 5KJRL 5C09E 5C9KA 2W9DH 3QI9C 2OTWB 1A1OA 3AS2A 3O6LL 4FFWC 2BNQD 3OAUH 5TPWL 3V2AR 2YPLE 5EUOA 1U8OB 4O2EA 3GO1L 2AEQL 1C7TA 3EFFB 3O2VH 3WS6C 5B22A 3MV7E 2XRAH 2IAMA 2HT2C 1AO7E 5E2WL 5FYJU 2YPLA 3L7EB 3BT2H 2W0PA 2YUZA 3RY6C 4KZEL 5BXFB 5EFIB 2D3VA 5E8NB 1OTTD 5F8QC 4L4VE 4D8PB 5HDLA 1XCTA 3W0WB 4XCYA 1KJMB 3QIUB 3CH1A 2ZOKA 1FCCA 4P48A 4XCEB 2P5ED 1T04A 4BJLA 1NAKH 3O45B 2DQJL 5EA0H 3QDJA 3QISA 5F3HB 4B41A 5GPRA 5I75B 5B8CA 3MLSH 1IC7L 4GS7B 3T4AA 1MEXH 3O0RL 3BSZH 3MZGB 4Q9QH 5E2UL 2AK1H 4WHTA 3EBAA 1RZ7L 4ESKA 5F7KC 4C56E 3S96B 1AQKL 2R1WA 4W81A 4MSWA 4WW1B 3WXWL 3IDIA 2EC9T 4Y2DB 1L4IA 1QQDB 3N1MC 4GRWF 5HHXH 4DCQA 4JM2F 2A2QT 1AKJA 4YC2B 4OD3H 1P4IH 4I0KA 4H0HB 5GRWA 1KEMH 1HH6B 4IHOA 3OHXA 3QEUA 3MYJB 3MQIA 3RNQA 5I74B 5J9PA 1ZT4B 3MJGX 4CN4A 3QPQC 4MHHG 5E99L 1J0ZA 1AGBA 4P5KB 3F62A 3KR3L 1EX0A 1A7QH 2WBJD 1C08A 1S3KH 3HZMB 5D9SA 1VFUA 1CF8L 4R2GC 2VXQL 1F6FB 3PABB 1KTKE 3UAJD 5LKNA 4JFOA 3CSPA 5MERA 4X7EC 1RZJH 5C8JB 2VDML 3KYAA 1AP2B 1PD6A 2WZPD 1BOGA 25C8H 5D7LD 3RX8A 3BIKA 1F42A 5J13B 5TE6L 1KBGL 3EDEA 1MCQA 4L9LC 4ETYA 5ICYB 5HPMA 1BX2B 1CE6B 4KKNA 4J3XA 3MR9B 5IHUH 3SQOL 5KOVC 1KJ2H 1YJDH 3SDDA 4WFGD 2R9HC 3C60B 5E8EA 3ZKXB 1ND0A 5JXEC 4OLZL 2COQA 3VWJC 1YEKL 1QPXA 2LU7A 5IBLC 3EYFA 3KYNA 1A6VH 3ZKMC 5L0QB 4KRPC 5KVDH 4X7CC 4QCIA 1SY6H 3RIFK 3RRQA 2IFGA 1RIUL 4KY1H 2RQ8A 3MPCA 4N8VB 2R8SL 3BZEA 2CXKA 3CUPB 3O3EA 5DUPL 1I8LA 1OSPL 4LRNL 1LEGA 4RMQA 1FGVL 1SBSL 5IVXA 4O58H 4YHZL 1JGEB 3WFZA 2XICA 3FMGH 5SWZA 4BELD 5BZDA 3RIFF 3IDXL 3ARBC 4OT1L 4S11A 2FZ3B 3I9GH 3UTQA 2FDBP 4Y7MA 4FQ1H 1V3MA 2N7AA 2XZAL 3GSXA 5D1QA 4QWWC 5AAMA 3KLAB 1YMHB 2GI7A 4X7TA 2ZUUA 3RX7A 2O5XH 3IFNL 3QNYA 5IGXL 1I7UB 2VXUL 4GMSH 1MLBB 2X4TA 1TZIA 2HP4A 3JTSA 1M1SA 2DQTL 2EDHA 2CH8A 3TVMC 3PDOA 2IANE 3K4ZA 5ESAA 1Q0YL 1FIGL 2XWBB 2E27H 1YEEL 1A7NL 4XH2A 3CK0H 5AD0A 2D0GA 4Z76A 4P2YA 2NTSP 5DJZA 2GJZB 3EYQD 5EH1A 1QYGL 5IF0A 1WEJH 4RX4D 3EO9H 4RFOL 4XNZB 2Z92B 4GW4B 1O5DT 3MBEB 3QDMA 1IL1B 5GZOD 1C1EL 1IEHA 4Q6IA 2FJFB 4K7FA 3TA3D 2ADFH 4X6FB 2EH8L 5CJQL 4NZTH 5DRXA 4XT1C 3PP4L 1FCGA 3VWKD 1I1AA 3MRLA 3T2QA 1UGNA 2UY6A 3QDJB 1FGNH 2A6KB 4HS8L 3UJTL 4BH8A 1V7NL 1NCDH 2AI0L 1RK0B 3P2TA 3FB8B 3KPLB 5DEGA 1T2JA 3RU8L 2VDLH 2WWKT 1C16B 1YNKL 4X5XA 4M7ZC 2BDNL 2HTLC 3TGXA 3N1GC 5HI3C 5KBNC 1FRGH 2PW1B 3MJ9L 3VWKB 4G8FA 4Q6IC 3TYFA 4WY7H 4IDJH 5E5MA 3BEVB 3V0VA 2MCPL 4S1SH 4PTTA 5K59E 3GSNH 4WFEE 4JQIL 2ADJA 1MVFA 1WUNT 2J12B 4I8DA 4NHUA 4LCUA 5CINL 3DX7A 4GW5A 2BJML 2NYYD 1WBZA 1N4XL 2H26B 1X5IA 2DMKA 1QLFA 3TVMA 2FZ3A 4Z0XA 1K4DB 1DEDA 3QCTH 4JO3H 5ID1A 2WBWB 4UZGA 1AO7D 4NC1E 2YD5A 4MNQB 2ED9A 3GSWB 2P49B 4OM1L 3NBNA 3SGDH 1WGOA 4ACPA 4OCSL 5I8EA 4WJ5A 2E9IA 3IJHA 5DT1H 3TZVC 3ZT7A 2BNQE 3NABL 5JDSA 4M6MH 4U2ZA 3T0WA 4OTXL 4PV9A 5I66A 5BS0A 4JM4H 3OKEB 5KOMC 1KJ2B 4IRJB 2JCCE 3HMWL 4L29B 5TDPA 5CEZE 5DI8A 1JGVL 5B39G 4DW2H 5D1XA 1MCNA 1CE6A 1S5IL 3MRFA 1J1XL 1MCOH 3P30L 4ORGA 3KPMA 3WFHB 1LEIB 4L4VB 3MLXL 1I8IA 3TA3B 2BMKB 3U2SA 3WFEH 5INCB 1GAFH 4LPVA 3CXHK 3EIFA 1Z3GL 3TNNB 4U1NA 4UT9H 3QDGE 5D2NB 3MOQA 5I1KL 1C08B 4DOHB 4PJFE 3QIBC 2ILLA 4NNPH 1H3VA 1RJYB 3MSPA 3MRHA 4N90D 3KJ6H 5KVGL 1FNEA 4FXGB 1AGCA 2DM4A 1Z9SA 2ZCKL 4HIJB 2HRPL 1M7IB 2MCPH 4L8SA 4WU5A 3SHSA 3SN6N 3WEXA 4XPAH 1MLBA 3SEPA 4JHAH 4KK9C 1ZHLA 5ICXA 1R3IH 3MV7A 1MCEA 4KJYB 3STZB 1NMCC 2APBA 4R97B 3VXNA 3O2DL 3QCTL 1MCDA 4GLRH 3O4LB 5DHYA 4RGNE 3RNKB 1IGIH 5DXWA 3X12A 3IJHB 4IMLB 4PJDB 3EYUH 1RUAL 4PRDA 2E6JA 4JFDB 4R97C 4X6FA 5EU5B 1SJHB 3UPRB 4MDIB 2C3HA 4N8VA 2D31B 2XTJE 5ISZE 1YPZF 5J1AA 1QRNB 1EBPA 5DEFA 5DD1H 3LEVH 2Y36L 3QH3B 4NBYB 2AABH 1JNLL 3SQBA 4OI8A 2JB6B 4LP5A 5IVXB 4QXWA 3VD4A 1ZHKA 2QQKH 4L4TA 2BHUA 3L3OB 2Z9TA 4G8EB 5D96C 4M48L 4AIZB 4UDUB 3HR6A 4CDGC 3BVNA 3L3IA 4LSUL 5TE7H 4KVCH 2HVKB 3K8MA 2K7PA 4G42B 2EYRB 3TYFB 2RB8A 4XAWH 5EPMB 1INDH 4ZYKA 4UQ2B 1RHHA 4M4RA 3ECBA 4QRTB 3LKPA 3ZKXC 3QPXL 3UTQB 1FORH 5D7JB 1WLHA 1NFDF 4Z5RA 1O7SA 4WW1A 4LKXA 2BVQB 2IH3A 2X4OB 2ORBH 5E94B 3KPPB 2AJZB 4Y5XA 5HPMB 3BJLA 4Y1AD 4JN2B 3RAJH 3TT1H 3HZVA 5I1EL 3SE4A 3EOTH 2WBJB 5F8RC 3BEWB 3PQYA 1Y18A 3RTQD 2IF7A 3MYJA 5KVGH 5AYQA 1FH5L 2PYEA 2BNRE 2MJWA 4XB8A 1HI6B 3QEQB 4RIRA 3ULUD 4EI5D 4PG2A 3JWOH 5EO9A 4LFHG 3P77A 4H20L 4EDXB 1Q72H 3B2UC 4ELMB 5ESQA 2ZSWB 5E8OB 5CSZB 4D9LL 5TQ0H 5C1MB 1JHKH 5E6ZA 3CFDB 3V9FA 4L5FL 1BF8A 4X0KA 4Y19E 2FSEA 1J5OL 3I85A 1A7QL 1G9NC 2J7LA 4N5UA 1MFAL 1TVHA 4NZRH 3S37L 3GI9H 2VISA 1ZMYA 3IGAA 1RIHL 4ZFZB 1QLRB 1JI1A 4JB9L 5IOPA 2XPGB 1JNLH 3WD5H 5IFAH 4JANA 5EOCH 1S7VB 1JJUA 4E5XB 4MD4A 3QFJB 1BREA 2IBZX 4XNMA 2R4RL 2DQDL 3VCLA 5IMMB 4ISVB 1VFAB 3ZL4L 4CVWA 3WJJC 1MJ7H 3FONB 1GOHA 1K8IA 4NN5C 1WFUA 3ZDYF 1QUNA 4OZGA 5LQBH 2Y25A 2MKWA 3NN8B 3D25B 3S7GA 1A5FL 3O3UN 3V6OE 4QGTA 1MF2H 43CAA 1TNNA 1EUUA 1LGVA 1DUZA 1U8MA 2X1OA 3O6FB 2C4FT 1RIUH 5DMIL 1M6OA 5KSBE 5BJTB 5GGUA 1WTGT 1WBZB 4U0QB 3VW3L 4KK8D 3OB0K 5JW3L 3TCLB 3EOTL 5FAAA 4IMLA 4PJDA 2OZ4H 4PTUB 2CLVB 2GT9B 1MI5D 3GBNL 2DWEA 1NGWA 2I07A 4FQ1L 5GS1B 3BEVA 1ITBB 2NY7L 1I1AC 3F6IA 1SY6A 5TDNB 1KPVB 2FX7L 5C0FA 5A16B 4OBRA 4L4JA 5IVOA 1HN1A 5T5NF 2VLRB 4ODTL 3KXFE 1JUFA 1ZGLA 4H20H 5SWZD 2FBJL 2W60A 4RWHA 1CXLA 4OIIL 1JGDB 1FFNB 3CH8A 3LD8C 1MUJB 5DMGC 1PX3A 3WNOA 1EVUA 5EBMA 4U0RB 1DBML 2AJVH 4PRPA 5BZWB 4CVXB 1INEL 2BRRH 1H0DA 2J8UA 3CSYB 3DVFA 1NANI 3K1KC 4GUPA 3W11C 4ZFOB 4R9HA 4GG8B 3RVXD 3ZKMD 5JMOC 4NQDE 2ZP0T 3VWJD 4OCMC 4NO0B 2R9HD 4M4PA 4JJ5B 4XP1L 1HYRC 4HUUB 1RHFA 3SDCB 3DO7B 1BZ9A 4L8DA 5HGBA 4CAGA 1UXWB 2VXUH 4NNXB 4WHCA 3O4OC 5J56B 1ADQL 3U0WL 2I25N 1AO7B 4LHQB 4U1MB 3VFWA 1CYGA 2WK2A 4P2OC 4MGXA 5DD5H 1EZVX 1CU4L 4HHAB 3D3VB 5JW4Q 1AD9A 2AJ3B 1BP3B 1LDSA 4F33A 1XR9A 5CEYB 3EO9L 4RFOH 4KI5F 4OJFL 1FNAA 3O11B 1BFVL 5JW4R 2M26A 2XA3A 4IIQB 3QIBA 5D2NA 3VFSB 1T0PB 5SX5K 2GTZA 4TULH 3DXAD 1CDCA 3DV6A 4MZ3A 3LN5B 4TOYL 4XXCC 3EZ8A 4XX1E 5DJDB 3E3QC 3BP6B 5DDHB 5CZXC 2Q86B 4EJ1C 1CICC 1NKRA 1T22A 4Y1AB 5I17A 1PGRB 5KVFH 4DGIL 4KRNA 1HHJB 4P46D 4JGUA 4DGVL 5MEQB 2NY4B 4NFCA 1C12A 1HINH 4B0MM 1WCBA 5DK2B 1U3ZA 1G7MB 2NXYB 4LF3A 1S8DA 4FQIL 3UYRH 1GCFA 4DFIA 5ERWA 1R5VB 1LO4L 1NCAH 3C2SA 3BD4A 3OR7B 5D96B 1QSFE 5CINH 3BKYL 3E6HB 4NQED 1NC4D 1F2XK 1YY9D 4L4TD 1AIFA 2RCSL 1BVLA 2J5LB 2NXYD 1P53A 2F74B 4Z8FH 1OGAA 4Y4FA 2VE6A 4MDIA 3S36L 1OTTC 3IVKB 4KWUA 1AGFA 5I76A 3CCHA 2X1XR 1G6VK 1BFOA 3GJEB 5I30H 1P7KA 5TF1H 4XPHL 2B5IB 4UT9L 3HE7B 2DYPA 4OZIB 2CKBB 1P2CA 1HIMH 5D8JL 4IOIA 3ZE2E 4ELMA 5K9KB 4KV5F 4HWNA 5HVHC 3DURB 3IU3B 1U93A 4QRRD 2FLRT 4JANB 3RHWK 2ATPA 5HYSA 2X4QB 5B8CC 1VACA 4KVNH 3D48R 5D7JD 5IM7B 1SYVB 5EZOL 4HWEL 4XMPH 5E00A 1YC8A 2D0FA 3B9VA 5TDNA 4JVPA 1RJZA 4X6CB 4JY6B 1CS6A 1NGXA 2EXWC 4XBEL 4HUKB 1NC2D 3RGVC 4HFUH 1HE7A 1U8KB 5ADPH 3AROA 1A64A 1CZ8H 4OKDA 5DQDH 4RQQA 4LLDB 3RJQB 4TULL 1OQOA 1JV5A 4WWKC 1FYTE 3G08B 3C6SA 1QNZL 1VADB 5JA8B 1QSFB 32C2B 3OJ2C 3MREB 3B2UD 4P2OD 4QXTB 4P46B 5DJAA 2UUDK 3VFPB 3DGCR 4XPGL 4DUVA 1RUKH 3MOBH 3CPLB 4I0PA 4NC2B 5CILH 4AL8H 1NUGA 1NLBH 5FHAH 5GS1C 4J1UA 3RWDA 4TSBL 2X4SB 2H2SD 3CSGA 3WFBL 4CMMA 1UXWA 3ROOB 1D9KB 4I2XA 1I8KA 1TPXC 3T0EB 3N9GH 2BNRA 1KF9B 1PVHA 3IF1A 1OGAB 1UH4A 1GHFH 1UKTA 3RI5F 2EC8A 2EE3A 3ARED 4ZNEE 4Q97A 5DMGD 1J0HA 6CGTA 1RJLA 1INDL 1DZBA 1E4KC 1QKZH 3UPRA 3U1SL 4EDWH 3QPXH 1GGBH 5KSBB 1A6ZB 2ID5A 3SE3A 1P1ZB 3FQWA 4NRYB 4FA8A 4Z78B 2EZ0D 2GTZB 4PJ8B 2YMXH 2B4CC 3KWWB 1JZ7A 2G75A 1IGCL 2NCMA 3BESR 4PRPD 4PJAB 2APTA 2VQ1A 3FT2A 2W0LA 5J13C 5HGAA 4M3KB 1A7BA 1KIRA 5L2JB 4PJGA 4HK0B 3MUGB 1G9MC 4UV7L 3HS0B 1I1YA 2P7TB 3HUJB 4HUXA 2I5YL 1NFDB 4AZ8A 5IV2A 5IROA 5F7NC 3OJDB 4K8RL 4G43B 4JJ5A 4JO1L 4BSWB 3B8SA 3MREA 3IGAB 4ZFZA 3F7YB 4KTEL 5T1KD 2ZSVB 1NBYA 3O9WB 3T2NH 1J9CT 4Y5XB 4H88L 3RWGA 4JFPB 4RMUA 3T0EE 5IR1A 1S7TB 4QHMB 4R0LC 2BSTA 5LWYL 1XR8B 4X6EA 5IVXF 1FVEA 2A9NH 1ZHNB 2CLRA 2FB4L 3HZYB 3O3AB 4R4BA 3BZFA 5T3ZL 3IFPA 4JFZL 2NY4C 1EHLH 2DLGA 5FKAA 1HEZB 2LQRA 4YHOL 3WUZA 2EO1A 5AAWA 1G7JA 4RCAA 1NAMH 4LQ1A 4NZUL 5EZLA 1QQDA 2AK4D 4M43L 4ODUB 5C08A 2B2XH 2AV7A 3FN0H 4RWYH 3GMNB 5FO9B 1RZFL 1CXHA 4ZXBC 3SGEI 3MV01 1BOYA 4E41B 2CIKB 1BGXL 4YGVA 3UYOD 4EEEA 5FO8B 1NC4B 4L5FH 3HAEH 2N1KA 3CLFL 4JZNA 4NO0D 1BHGA 4G7YL 3KLAA 1U95A 3L3GA 5EG6C 3WUWA 4NDMB 4G80A 1N5AB 4ZFFA 3BPOC 3L3HA 3K0WA 5DHVA 1NC2B 4Y19A 4HIHA 2FWOB 4O9HL 3HG1E 4PRPE 5C70A 1TVBB 4U6VH 2ITCB 3C2AL 1ZT1B 3HG1D 2DB8A 4WUKH 1QFWL 3D85B 3ILPB 1XF2B 1R5WA 1XGUA 3BQUB 3HS0A 1SHMA 4ZUVA 3LEYL 4G8GA 5K59F 1MJJA 1CGWA 2G5BB 2WLZA 2X5PA 5C9JB 3S3JA 2PXYD 3KPOB 3QJHB 4YO0B 3DGGA 4G6MH 4WUUB 2R2HB 2FX7H 5IW6A 4PJBF 5E08L 5LGHH 2GK2A 2VN4A 4KJQD 1MLCA 3ZLQC 1QRNE 2Z4QA 3IU3A 1XGPA 4YDLB 3SE3C 1QVOB 3D2UB 5LCVH 1B90A 1BIIA 4ODBD 5F88B 4ZAKC 3WLWC 2IANB 3K2UL 4GT7A 2IFFH 3BZFB 1UG9A 2Z35B 3RGHA 2E7LC 3PHSA 1D6VL 1I4FB 3X17A 4WWKD 4MJIB 3O6FC 1FVCA 2V5RA 3WIHH 2AJXH 3B9KA 5J6HB 3U36A 4PLKD 5ILTH 3KDMA 2YRLA 3RGVD 4MD0B 3CZJA 1MCRA 4HJJH 1YECL 2FX8H 2GSIB 2V9RA 1I85C 4NOFA 4KXZH 4GW1A 5DS8B 1NGYB 3ARTA 1P4LB 5B39B 1DBJL 4PJAA 5D7JC 3C09B 1Y6NR 1C16A 5I1CL 1DLHA 4BZ1L 1KCVH 5F9DC 2VLJE 2CPCA 3BWAB 5T3XH 4JPIB 1AKJD 2IQ9L 3D18A 4FQHA 1H3PH 2BMKA 3V6ZB 3ET9F 1ADQA 4LHUA 3PL6A 4TSCH 3LPGA 1U91B 5EU3B 3P0VH 3CCHB 4X6CA 5EU6D 3NFSL 3LAFA 1YPZE 1CXEA 2JF1A 4MD5B 4OGZA 3DSFH 3TA3C 5HPOA 4Z7UB 4QRRE 2CDFB 3B5GA 1R5IA 3S37X 5C2BH 1RY7B 1JK8A 5I1AA 4LLDA 2VDMH 1X7QB 4Z78A 3HRPA 1MFBL 3EYQC 1ZLUK 5CGTA 5AZ2H 5TQ2H 3CU1A 3RL2B 3W39B 1P7QD 3Q6GH 3CLEL 4HKJB 3ALXA 1W0YT 1MPAH 1U8JB 1YMMD 4HIXL 3FKUS 4XCYB 3TVMD 2HVJB 1Z5LA 4O4YH 3L3DB 3KPSD 1AI1L 1CQYA 4DGVH 4LRNH 3PWUA 4JRYB 5GGRA 3KHOA 3RBGA 2OTUB 5LGJA 2P24A 2IH3B 4AK1A 1CLOL 1QSEE 4CU6A 3OWEA 1PKQB 1YEKH 1KB5L 3FQWB 4NRYA 1KEGH 1QSFD 3QUML 4Z7OF 3OXSA 2DTML 3HE7A 4YDVB 1R3KB 1ZLSL 1MJ8H 3DX7B 4GW5B 2R1YB 4B5EA 1KCUH 3N06B 1NC4A 3DJ9A 5E9DB 4KV5E 1BD2B 3U2SB 3JZ7A 1XT5A 3SKMB 1ORSB 3R8BB 4D2NA 5T1MB 1LEKB 3NZ8B 5EWIL 5EIIB 4MJ6B 4NUJA 3DX8A 5ID0A 2DLHA 1IEAA 2E9WA 4YDKL 5JXED 1QYGH 4MNQD 3ARGA 2BXZA 3TBYB 3P4NB 3GNMH 4X80L 1I8KB 1C1EH 1OWRM 3RVUD 2VUOA 4MMXC 5F1KC 5JDJA 4S2SA 1F4YL 1D6EA 5F7MC 1MCPL 1K2DA 5E4EB 2F5BL 1MFEH 5D93B 2NX5B 2XZQH 4MVBD 3CK0L 1IGYA 2BSTB 1R5IB 4QHUA 2QQQA 2I27N 4M7LT 1DSFH 2MQ0A 5CSBA 5C0AE 1G7LA 2FJGB 3NFSH 1XFPA 5EUKB 4X9HA 3S8WA 2AGJL 1MOEA 4P9ML 4CADB 4HFUL 1A6AA 1OAUL 5FF6A 4X4ME 5GXBB 1EAPA 4PY8J 1QSEB 2XQYK 5JIPA 1BEYL 3PP4H 1UZ6E 2OJEB 1ZHBA 2HTLD 2DQCH 1YMMA 1XGTB 4LGPB 3AXLB 1AD0A 3FN9A 3F12B 1OAXH 2IG2L 4DN4L 3ZDYE 2P24B 1RJYA 4N1EA 5E1AB 2XWJB 1KYOK 2DI9A 5T5NG 1AQDA 3V5DA 3LHPH 1K3IA 1NLBL 2RBLA 4XMPL 4XXDA 4HWEH 1AXSB 3VWJA 3KNBB 4RISH 2Y72A 3FFDB 1JGUL 5C9JA 1PAMA 4XMKH 2QEJA 5DK0B 2QV2A 2AAVA 3U4AA 4PJXF 4RNRA 2CUIA 4KMLB 4WJ5B 3UC0H 4RZCA 3TCLA 3I2CL 5D1QB 4H0GA 4ALAH 1SYSB 3K46A 2DIJA 2DQIH 3KPMB 1JF5A 1MHEA 1MWAA 1ZTXH 3KPQB 4OTXH 2WUBL 5FECB 5JHDD 4Y89A 3CFCL 3O6LH 2Q76A 2D03L 3QUKB 3U7WH 1GGCH 2AEPL 2VITA 4OSUH 4WWKB 1S7RA 4MXVE 4WIQA 1S7XA 4AEFA 4PJEA 5LGKA 1NSNL 5GGVL 1JNHA 1X6LA 3H2WA 1AC0A 4RMVA 4HKBB 3DXAE 2P47B 4I4WB 4P46C 5IW1B 3RL2A 5MP6H 3W39A 1GVIA 2O61A 3CVIH 4WV1A 4I77H 1KIPB 4NT6A 1IAII 1CICD 4M6NL 4OD2A 3MRBA 4G9DA 4K3DH 5JR1H 1N2RB 3QULB 4MCYB 3RWIA 4P59H 1MCFA 2MCG1 3BDBA 5H2BA 4NKOA 2AXJA 3IFLL 1OAQH 4HWBL 3NN8A 2N4IA 4PBXA 3VI4E 4JG1L 5KSBF 3ALWA 5ANME 3QUYC 1ZVSA 4BQ8A 5FA4A 3MLYL 3ETBF 3IXTB 1AR1D 3QQ3B 3D2UA 3FO9A 5DHYB 1CTNA 1M4KA 1U3HC 2AV7B 1AQDB 1F4HA 5C08B 5F89B 5D7IA 3BD5A 1IAKB 3ES6B 1UM5H 1XR9B 5CEYA 4W6WB 3O3DA 3GSRB 4KJQC 4EVNB 3RVUC 1BM3H 3IETB 4EI5C 4Q6YA 1LO2H 1XF1A 5HYSG 3TJHD 2HRPH 5C0EB 3MGAA 3MA7B 1V5JA 4M43H 1JI2A 3PL6C 3RZCD 4R2GD 1T3FA 2VXQH 3UTOA 4EI5B 2WBJC 3I2CH 4XCEA 1XZ0A 2ZZUT 1MFDL 3QPQD 1LDPL 1OT2A 4BM7A 5IHBA 1EMTL 5DC4B 1DR9A 4JO4L 4YDIL 2DWEB 3GMLA 2H32H 1KBGH 3OKLB 1KN2H 4XVJL 3VJ6B 2FIRT 5D7JA 4WHYG 1CLCA 1F90L 3VGBA 5DMKA 5FFLA 2PO6D 3DO7A 1XCTB 2DDQH 1TTFA 3I75B 3C60D 4NQEA 5C2UB 4AEHH 5FO9A 2PTVA 1XGYH 1AE6H 3GKZA 5AYUL 5FYKD 4JDZA 4WU7A 5JMRA 1J11A 4Y5YC 1RZFH 4B50A 3MYZA 4YFEA 5BOPA 4PRPB 4CVXA 3QHZL 3DARA 4WEBH 1IZJA 4LEOA 1NEZB 4NKDB 4GXVH 2Z35A 4OLYL 4K3JL 2J6EA 4JFHD 5FM4A 1GZQB 2Z8RA 4XAWL 2BVYA 1Q0XL 2NY4D 2DL2A 3HC3L 3LS4H 1JHTB 4R26H 4P3CH 4WI6A 1T04B 1CFQA 3I9GL 3SO3B 4KUZL 4HUVA 5HI4C 4RFEA 3MGOA 2D7OA 1A3LL 5ISZD 2DLEA 4WUKL 3DX9B 4ELKB 4XC1L 2DOCA 2HVJA 3O3BA 1NMCB 1LO3H 3R0NA 5C0EA 1P9MA 1KG0A 3WIHL 4PG2C 1BD2E 4JFFB 4Y19D 3QI9D 3JV4B 5BVPH 2M1KA 4GOSA 2VLLB 3KYKL 3HPJB 4IJ3C 3KYOA 4GXUM 3S9DB 1J8HA 3QCUH 3GMLB 4MWFA 2CDFA 5C09A 4N8CH 1FFOA 4PGCB 1W0WB 3IJSA 2CUMA 3CFJB 3QIBD 3OR6A 3PQYD 1I7RA 1ZANL 4JFQA 4M6AA 3U82B 4W4OA 4JHZA 1JHKL 1WITA 4ZAKD 1FE8L 1VHPA 4GRWB 4LSPL 4N0YL 4XP9L 2VH5H 4MNGA 4PP2A 5J89A 1OP5K 2HLAB 5D7LB 3ZDZF 1CDHA 5DYOA 1NGYA 3ULUC 3C6LA 5B38A 3TIDA 4LSQL 3OXRB 3R0MA 3DI3B 3LN4B 1SJEB 4RMTA 4Z0XB 3OX8B 5E9DD 3GSVA 4EN3A 3I02B 4MNGE 1U92A 4GQ9L 3FO0L 1IC5L 5CZKA 3RWCA 2C3XA 4L3EA 3L1OH 4LGSB 5E9DA 3ZKNC 5I73C 2YA2A 1IGJB 1TETH 2VDPL 5TDOA 2H9GA 4JN2A 3EO1B 4RFEB 3HUJF 1MH5B 1VFBB 2GY5A 3B9EA 1U58B 4JKLA 4Y5VA 1MCWW 5FGCB 5D72H 3GZKA 5DVLA 3RGVB 1CD9B 1N2RA 3QULA 4MCYA 4KUZH 2CXGA 3DTXA 1OGAE 4OF8A 3OAZH 4RA3A 3NFNA 3WNNA 2QLVB 3MUGA 3MRCA 4NO2A 4XPBL 5JNYB 5BOZG 5JW3H 4ZXBD 3MCLL 2DWDB 5DJ6B 4DKFL 4YHLH 2ICES 1HHJA 3STLA 3BMVA 5DLMH 4D0CB 4ELME 1KTRL 2DKSA 4NQEB 5K93A 3MGTA 4UTAL 3UDWC 4RAVA 1QBML 4LLMB 1V3JA 3G04A 1VADA 4LFHD 2A6KA 5HXMA 2Z8VC 5F7YC 2ICEA 2EC9U 3FB7A 1OD9A 4WWID 4WFED 5FYLE 3JV6B 3RKDD 4JY5L 3VWKC 3V5HA 1X9QA 4P2RA 4PJ5D 2HAZA 1T2XA 3QHFL 4WTZA 1ZHLB 4KK9D 3GSVB 3HFML 4OUOA 3QDJD 5D1XB 1CT8A 4OZHB 3ZHKA 3UTSD 1W8OA 3SBWC 3DBXA 1H15B 3PNWB 4H1LG 1EZVY 1K2DB 1BMGA 2X70A 3U79A 5EBGA 1LVEA 3IRPX 1S9YB 4XP4L 1P7QB 5IM7A 4YHMH 3C60A 3MMEB 1PG7L 5EUKA 1RFDL 1P4BL 3C6LD 3G6DL 1AGEB 3QDMB 5J12C 1FL6A 2EZ0C 3DX6B 4MXVF 4I9WD 4MWFB 4HMEA 4OT1H 1XMWA 1MAML 3O3EB 1DQMH 2YUWA 5C0AA 1I9EA 4PRBA 3MUHL 4H8WL 3FT4B 4HF5H 1QR1B 4NUGH 3AREC 5J7CC 1B2WH 4M48H 4G9DB 2B39A 4OD2B 4JDTL 5CKGA 3DX9A 5F6IC 4PGJA 4KRPD 5KVFL 5DR5L 5EOQH 1LP9A 2VLRE 3LMJH 5IB4A 2JJUA 4IJ3B 3I3EA 1DBAL 4WW2B 5DUBA 4I48A 4MQTB 1N5YL 5DMKB 1KJ2A 1K9TA 3JTSB 4XVSL 4X6CF 5HHME 2DQEH 4PB0L 3QYCA 1KJ3H 2DQUH 3K2MC 2DJ4A 1J88A 3T3PF 1H8OA 4ZNCD 4M3JA 2F53A 5FIEA 4MXQD 4OM0L 3OF6A 4O51A 2C1OA 3FO2A 1EEZA 5C0RH 3OKLA 2EDDA 2VL4A 2LTQC 1U3HD 4WFGE 4LSDA 4Q2ZA 4JFQB 3TYGH 4KDVA 1NCCL 4NKMA 1T1YA 1NGQH 3W9DB 3ELAT 3GM0A 1F3DH 1AD9B 1I1AB 3IRZA 4H1LA 4X99B 3VGAC 1UFUA 3GB7B 1V8HA 3A67L 4GG6F 5D7LE 3CFDA 5E7BA 1I85A 3H0TB 2MQCA 2NLJA 1FBIH 1F4AA 1IGMH 3O3AA 1SJEA 4M6OL 4R4BB 4KROC 1CD1A 1VEPA 1KTLA 2ARJQ 2BNUB 3K81A 1FN4B 2HLAA 5D7LA 3D0LA 3DV4A 4Z7UA 1HH9A 4JREB 3H3PL 1LO2L 2Q1EA 4TUJA 3H7BB 4X8JB 5GJTL 5FYJE 1UM4H 1JF1A 5L8LB 1CGSL 1YEIL 2J8UF 3OKYA 4HEPG 2NQCA 1NFDA 5IV2B 2GY7B 5ADPL 2PUQT 2A73A 3PQYB 4QHNB 3S37H 4OCNC 1T1ZB 4Z7UF 3FRPA 3ZYJA 2YPVH 4KK8C 1J12A 2G5RA 1Z9LA 4YNYA 1WCQA 2QSTA 3WN5B 3S4SA 4YXKH 4EN3B 4JFYA 1J8KA 5T5FH 1CLYH 1DP0A 4JRYD 1E4XL 3GSOB 3LQAC 1R3JA 3PWVA 3NCYS 4KI1A 3EAKA 2OMNA 1NMAL 3AVEA 1NEUA 2AK4B 1T5XA 1F58L 3LKPB 2PYEB 2DWDA 2JLLA 4FQQA 2A77H 4Z7OE 43C9A 3L5JA 3MNVB 4NWUL 3QDGA 3TBTB 4JKWA 1A1OB 1TIUA 2AERT 2ZNWA 2OR9L 2A9MH 3QXAB 4DGYH 5B38G 2MQ3A 3ALPA 1KCRL 35C8L 1LEKA 4LSVL 5ACZA 2X41A 2V2TA 3GK8H 4ZFGH 4W4NA 2I07B 1EMTH 3GJFA 3LEXB 4D0CA 4F2MB 5EA0L 4G6JL 4NM8H 1IJ9A 1IZKA 4FQ2L 2X4RB 1OM3L 4PG9A 2OR8A 4OKVB 5IJVA 5KS9B 1BZ7B 4CNIB 3UYPA 4ZODA 4C58B 1CWVA 2X4SA 3BKJH 4B7LA 3FJTA 3LKRB 4KKAD 1RMFL 4YZFE 5EULV 3MRJA 1DVFC 3L3JB 1QR4A 3ZSTA 3DV4B 5FGBA 4P2QA 4I9WE 3WE6B 1OAYL 4KZEH 2ATKA 2EDOA 4MVBC 1G9MH 4D0BA 2NR6C 4ENED 1LO3L 4LBEA 1HDMB 4FQXD 4ONHB 2ZPKL 1YDPA 2J2ZA 1H5BC 4GJTB 2HT3D 3OAYH 3Q2CA 3DMMA 5D5MF 3BH9B 4LDEB 3P9WB 3WEXB 4WCYL 3BHBA 3SE9L 2NX5D 3BKCL 4CU8A 1D5MA 1YNLL 5FB8A 5JQ6L 5ISZA 2Z93A 4DCQB 3NCEB 3NPZB 3SO5A 3FQUA 1G6RB 1XGRA 5BVJA 3QCUL 3BN3B 1YQVH 1S7SA 3ZMRA 4EIGB 3TN0B 3MRIA 4LMQE 3RTQC 1NH6A 3T4YA 2X89A 2RGSA 3V4PH 3MV8B 3UTSE 3LQZB 4GRLC 1YN7A 2J8HA 2X4OA 4CVUA 1OTUC 4QOKB 3OXRA 4H88H 1QFHA 2EDRA 5GZNC 4JZJB 3TZVB 2LU4A 3FONA 4C56A 3WLBA 3ULUH 3UTSA 4PJHE 5GHWL 3OJMB 1NMAH 5ENWB 3SDXF 1JHLH 1ZLVH 1ZV5A 4GSDL 2HT4C 4X99A 4KVCL 4H1LB 5GS0D 1Y0LA 3KYKH 4MQSB 3H3BC 3KG5A 5LVEA 2P5EE 1I1AD 2CIIB 4J12A 4L4TB 3IJSB 3O6ML 3WSQL 1A6TB 2EICA 4V1DA 1C8PA 3RWGB 1JRHL 2AEWA 1UM6L 3ULVL 3CU7A 1E28A 2BNUA 1VPOH 4HIIA 3VFOA 5D6DA 1J8HE 2ESVD 3S35X 4QRTA 1LK3L 5DQJA 1RUPL 2R0WH 5JPMA 2B8OT 4G7YH 1T4KA 1CL7H 2FD6H 1LP9F 4NCC1 4PJGB 3SJVB 3RZCA 1T89C 2EIZB 4LBEB 4O9HH 1F4XL 1NCUA 4XPTH 4XP6H 4R8WH 3IFNH 3VXUB 4POZD 4JFDD 3BPNB 3VG0H 2ZCLL 3GMOB 3L95B 4GMTL 5J6GB 3VCLB 4PJXB 3EDJA 1EEZB 3JUZA 3U7YL 5HD8D 4DJMA 1QEWB 5ISZB 2C1PA 4KPHL 5F1IB 1S9WA 4R0LB 1I7ZA 5DQ9A 1X5FA 4JDVB 2KDGA 3UTTA 4JFDE 4NKMB 3BPLC 4D3CH 1A6UH 1JMXA 1OVZA 3REVB 3QIUA 5FCUL 4ERSH 1WBYB 5DHVB 4QRPB 4RMWA 5E9DE 2GSGB 2XACC 3FMGL 4UINL 4PB9L 4XNYL 3QO1A 4OF0A 1PY9A 3O6FD 3T1FA 1SYSA 2XYCA 2D7MA 1WT5C 5IT2H 4UTBH 1XIWA 3K7UA 4KK5D 4P23A 1NL0L 4X4XB 1QLEH 2CDGA 3WLWD 2WSKA 1KOAA 5EUOB 1S7QB 3ZZ1A 1AJ7H 3MRPA 5EORH 1YNKH 3EJZD 2DS4A 2OQJA 1HH9B 4MA8H 1J86A 3HNSL 5CFHA 2BDNH 2XPGA 4PREA 3D85D 3QO0B 4IDJL 2D0HA 4XGZA 3QSKB 1IT9L 3FB8A 1RULL 1DBJH 2NZIA 1ZOXA 3WO4B 4HH9B 5C0AB 3W81A 4IMKC 5D1ZA 5IQ9B 1RZJC 4LARH 2Y06H 3QNYB 1PZ5A 3L5WB 3TZVD 5HYEA 4P9HH 2KL6A 3H7BA 2OZ4L 4XHJC 1MQKH 4JLRA 4FTVB 5IB4B 2WLYA 5CILL 3LQAL 5LGJB 2N56A 3E8UH 3OR7A 1LNUA 4K94H 2GTWA 1KIQB 5DJ8B 2EDXA 1I3RA 3NABH 1JYWA 5DQ9B 1ORQA 1YJDC 3OKDB 4JQIH 3CFEA 2XTJC 4EIZC 4JFHE 4Z7QF 3CVHB 3MC0A 2Q7YA 4X5WB 5CAYB 2B20A 1UVQB 1ZXQA 1JPSH 4O4YL 2PCPA 1F3JA 3L5XH 4NQDA 3DYMA 1J1XH 1MCOL 2P43B 5KSAA 3J8F7 1PYWA 1Z2KA 4F80A 3KWWA 4JGJA 1EGJH 5ECJE 3G6DH 4HUVB 1DBMH 4OZ4A 4RDQF 5DEGB 1S7WA 1XCQB 2XQBL 4ZO8A 5L2KB 2W07A 5DVMA 4PJCA 1X5AA 3H9SD 2DQUL 3VFVA 3HAEA 1N6QL 2UZIL 1W72H 2DYPD 1CDIA 4Y2OA 3MLTB 4UTBL 4K3GA 1A4JB 1NGPH 1FZMB 1LO5A 2CR6A 2OS7A 2UY7A 3UZEA 4XZUB 5HDBF 4ZS6D 4LVEA 3BP7A 4IRSA 1T5XB 2O26U 2F5BH 2J6EL 3QO0A 3QUKA 1AJ7L 5EWIH 2XZQL 5EC2A 5MEQA 2BNQA 4S0TD 3FFCA 1OAKH 3V52L 3JTTB 1M05B 4OBSA 2NY0D 4MJIE 4LP4A 1YY8B 4WHDA 1Q9WB 4AM0B 3VGFA 2AXFB 4FXKB 3N1QC 4OJFH 3KPSB 4XI5D 1J7VR 1MFEL 4X5XB 4JZJA 4UNVA 1MRCH 8CGTA 4LCCB 4TPRH 3S35H 1K5NA 4DTGH 4NHCL 4QWWD 5I1KH 4J4PA 1QO3B 2ZWLT 5CSGA 1X44A 3REVA 3VG9C 3V79C 4P4RA 1HHKB 4RQQB 4N68A 4KZDL 2EEDA 3HRZB 3HPLA 3L3DA 4UU9B 3CFEB 5E4IA 1EHLL 3LQAH 1REIA 1U8QA 3RWCB 5IK3A 1CFTB 1T5WB 1JGUH 4YBQD 3BYYA 4PJAF 1NEZA 4NKDA 4ELKA 4PGDB 3TZVA 2AJSL 3INUH 4LU5H 3VGAB 1EGJA 1PLGH 3EYVA 3O4LE 1G7IA 3EZJB 1DL7L 1UYWL 4IOFD 5GS3A 2FO4A 3RZCB 1VA9A 1ZK9A 5IBLD 1FFQA 2V9TA 2SEBA 3B5HA 2H2SC 3O2DH 2OJZL 4KQ4H 4WI9A 4AT6A 3CAFA 1UENA 3ZO0A 3MTRA 4AEIL 2IEPA 3U7WL 1JP5A 3KLHD 2Q7NA 2VLMD 4BFBD 3CUPA 1EUTA 1I7RB 5I30L 3ZTJG 2QHRL 3PWNA 4Z18A 1KG0B 1E28B 2ZUSA 1OPGL 3U4EA 3VD9A 1NFDE 1DN0B 3FHQA 2ATKB 4N9GA 1JGEA 5L9DH 3CX5J 1NCWL 3M1BA 3D69A 4NQCA 5I1DB 5JW5B 2VDNH 5JUEH 2GHWB 2VKWA 1GC1H 3RPIB 2VZ1A 3GMNA 3UAJC 4F7MB 2IH1A 4JDVA 4B53A 1S5HA 3ARDC 3BISA 4PV9B 3RWHA 5I66B 1T6WA 4J1UB 3RWDB 2Y7QB 1EFXD 3FB7B 3VXQB 3O3BB 1OF2B 5JLZB 3NGBC 3I02A 1AKJB 4Q9QL 2QKIA 4ZQKA 4JHBA 5MP6L 2VLKE 4N1HB 2O93L 3GJFB 3ZE0E 2D9QB 2VDQL 4AENA 3VFUA 5E8DL 1GZPA 1QFWM 3UP1A 4GAYB 4O02L 1WWWX 4AYFA 1XF5B 4NM8L 5J57B 5IQ9A 3WUWB 1DUYA 4PJEE 3DHJA 1HSAB 1T3FB 3WS3A 3MOBL 1BM3L 4AL8L 2KH2B 1F8TL 4OZGF 5GZOC 4U1JB 1OSZA 4XCNA 2NXYC 3AC0A 4Q0XL 3ARRA 2H8PA 3VXPA 1U2CA 2APFA 5IBTH 4O2CA 3AMLA 2MHAB 4YHIA 3GSNA 1YY9C 1A3QA 4CW1A 1EJOL 4LASH 4GKNB 4ELMF 4BZ1H 4XNXH 3R1GH 2R4RH 3QG6A 1Q9KA 1H3WM 4AJ0A 1WV7T 1U8NA 4QRSA 5F9AC 3JV4A 1ES0B 4BQCA 1GOFA 1MNUL 4N1CA 2WAHA 5A2LH 1J1OL 3FQUB 2P48B 3OV6A 2WV3A 4PD4J 2WINB 5BVJB 2DJSA 4OGAC 1T0NB 3ARWA 3OAUL 3K4DA 3T1FB 3SKJL 1CN4A 1BVKA 1CD8A 3QRFM 4HAGA 4P2OA 4YIQB 1BIIB 5F88A 2DLFH 4UI2A 2E6QA 4O2FB 3DRQB 5K33A 5CZXD 4PJ5E 4DVBA 1R3LB 2RJMA 2EH7L 3QRGH 4GG6A 1VEOA 1YNTA 5IB3B 4KROB 2HWZH 4U1IB 1A6VL 1CFVH 3CC5B 4ONFL 3ULUL 2OQJB 5I15H 3H9ZA 4FZEL 5J6HA 4Z7WB 3BKML 4LAQL 2Y1VA 5IB5A 2R15A 3IFPB 4UIMB 1SEQL 3ZL4H 4X5LA 3T3PE 1KXTB 2GK0B 3ZYZA 1YUHA 2UVEA 1D5ZA 5C0DA 1FGVH 3DVGB 2VQ1B 3BSZL 3O0RH 5AUMB 1XGYL 1QSED 1CR9L 1CFQB 5L6YH 3GRWH 3TNMA 1DCLA 4WEBL 3QDME 1A21A 4Y0GA 4EZMA 2E7BA 3DGGB 3IT8D 2JKXA 3D3VD 5J3HC 1FNHA 2PCPB 3DWTA 4ODSH 5C0JA 4CL7A 4P4KD 3PWPD 4QF1B 1YEEH 4LHUD 2EYTB 3RVXC 1RZ7H 4PLJD 4JFZH 5HJ3A 5BVPL 3W11D 1ZSDB 1FIEA 3G5ZB 2RHEA 2ZG2A 4FQLL 4PJDE 2R2EB 4XPTL 3HE7C 5I73B 1NAML 3G6AA 2XA8H 1NL0H 1DN0A 4J23A 3EJYD 5TFSH 1KLGB 3SCMB 4XCFL 5FHBL 3WDIA 3ILQD 3T0EC 5HHPA 3FQTA 1XF4B 2J8UE 2F8VA 2B4CH 3EOBB 3U48A 2PYFB 1QLRA 4KTYA 1JK8B 2H32B 5HDOA 3R06B 2JIXD 3MROA 1I1FA 4NBZB 5EIIA 1HWGB 3WNKA 4P23C 4R3SA 2ICWA 2VDOH 1MCJA 1IAOA 1OGTB 3I75A 1ZANH 4FQHB 1YJDL 4C4KO 2F9BT 2DKMA 1BD2A 2VZ3A 2XI9A 4TOYH 4QTHA 4D9QE 1FL3A 1KC5H 1JPST 1UJ3C 4G6FD 5F7WC 2ARWA 5EBWB 4P9HC 3VFTA 5I15L 1IC5H 4Q9RH 4HG4K 3FQNB 4RA0C 1MELA 5H35B 2FEEI 4IRZL 1NFKA 5HYQA 1KB5A 4GS7C 3UJJH 4GKOA 3JWDC 5I8CB 1CE1H 3DPBA 3FTGA 4X6DF 5E08H 1QRND 3FN3A 1SBSH 2NLJB 5GSVB 4OD1L 4MA1B 3W5MA 1J0IA 1U8OA 4O2EB 1OB1B 3PHQB 1RQ5A 4PTUA 4ONOA 5IJVB 1TZHA 1A4JA 3PDGA 4DKEL 5KS9A 4IS6B 1JIBA 4KY1L 4LHUG 5DT1L 2LVEA 4QHKJ 5D7SL 2F58H 3O9WD 4WDIB 5SWSA 3WDHA 3WO4C 4OI7A 3O6FA 1FIGH 4GRMA 1FAIH 2ICWJ 5BRZE 1NJ9A 5E8NA 4F8QA 3TC9A 1FO0L 4QXUL 3T2OA 2KBGA 5FYJH 3VXQA 1JPTH 4QYOB 1MREH 2GW5A 4GQPH 2X7LB 1JWMB 2FYYA 4ODXA 4HKJA 4DUWA 3I3BA 1FV1B 5DK0A 4ZO6A 3W9DA 4LVHC 4I77L 2AK4A 2X10A 4Z7WA 4F57L 4NZTL 5DJCA 3I3DA 2R0KH 3V5DB 2R0LL 3RA7L 5DS8A 3LH2H 4M7JH 1MHEB 5D2LF 4Y5VB 5DRZA 4FOMA 1L6ZA 2VN7A 4TVPL 1NUDA 2XZZA 1EK3A 4G3YL 2UZIH 4JEGB 3AY4A 5CEZH 4PJHF 1PJ9A 4Y5VC 2C5DC 5DRXB 5J9PB 4X4ZA 4X8JA 1IMHC 4GRLA 2G9HB 2AKRB 1QNZH 4TNWF 1QRKA 1BAFH 2UUDH 1CVRA 2BY1A 1UM5L 3FTGB 3MCKA 1P69B 3CC5A 3QHFH 3U83A 3DX8B 1RURH 5DJ2B 1F5WA 4M1CD 5I8KL 4DVBB 3UJJL 2B1AL 4XCNB 2EDEA 1S7UB 3TPUA 5JHLL 3WFBH 3JV0A 3K8KA 4GLRI 4S2SB 3SJVE 3A0OA 3I6GA 2DIBA 3QNZB 3KPRE 3IU4H 1PLGL 3WIFB 3FQTB 1AXSA 1JNNH 3BHBB 3H6JA 4NPYA 2UWEB 5DD1L 4JO4H 4YDIH 4WEUD 2FLBT 4P2RB 1BBDL 4L8SC 4Y16D 4ETQA 1UACH 3SGDI 4AEIH 1ONQA 2NXZC 2H1PH 3DXAA 3PWPB 4UIKL 4EBQL 2NY2B 4LCWB 2HN7B 3L3KB 1XAUA 3V4UL 5IESH 4PJFA 1QFWI 4TSBH 3N85H 3C09C 4NNXA 2EEBA 1S7RB 3GM8A 2VE6B 4JDTH 4AG4L 1IEAB 5HYJE 2JTDA 3B2VL 4ZSOA 1Q38A 5DR5H 4JKKA 5EC1A 1XF5A 2BVEA 2BVTA 4I2XE 4GXVL 1YC7A 3HA0A 3LV3B 5C07B 4UILL 4LLQB 1RZ8A 4OFYA 4U05A 2IJ0C 3QUZA 2DQGH 4LKCA 4F9LA 5IJKA 4PRDB 2OI9B 2VIRB 4R7NA 4M5YL 3WFCL 2QHRH 1GPOL 3ZT6A 1C12B 1ACYL 4O02H 1DQLH 1IARB 4N0CD 5I71B 3LQMA 4ODWB 1ND0B 5KANI 5TJWK 5L7XH 1OAXL 2A1WL 4DN4H 2X4NB 1BWWA 4OUUA 4M03A 4Q7DA 5FV1L 3MUZ1 1ZHKB 3C5SA 1UWEH 2BVUA 4BKLA 5F7DB 4DKAA 1DQDL 1EFXA 5I8KH 2NY3D 4BFIA 1VKXB 5GGTL 2OJEA 3MJ7B 1IKFH 2BX5A 3LKSA 2H45A 1CGSH 1T0NA 5D1ZD 3LB6C 3MLPA 3EYUL 5GGSB 1BPVA 4NZUH 3LPWA 5AZEL 4HKZA 2YS4A 3MRMB 4LLWB 1FBIL 4UV4H 5A3ID 1ZHNA 3AM8C 5ACMA 3UC0L 5HTSA 4BFGA 3DRQA 1FP5A 3B9KD 3PIQA 2YR3A 2BY2A 3TN0D 4MNGB 1MIML 4PP2B 2A74A 4HJ0D 2X1WL 5I19H 4NQUA 3FQXB 5J1TC 5IFAL 1AXTL 2FHBA 2Z93B 4EOWL 4Q9CA 2ARJA 5FDWA 2ESVA 2Z8SA 4ZDHB 5FA4B 2AEQH 2AXGB 3O8XD 5ETUA 5BW7A 4JFFA 3V4UH 1FPTH 1MIEL 1Q1JH 1Y6KR 2ZOLB 4JRXB 5F89A 2NYYC 3V4VL 3LSOB 1V3KA 3CVIL 3QUXB 5DZOA 3BH8B 3L3OA 4LAQH 3F7YA 1UEMA 1FFRA 4LSUH 4U4BA 5TE7L 4LNRA 5J0BA 5MEPB 3MLVL 4LKCB 3SO3C 1WF5A 5L2KE 4FQJH 1OAQL 3VW3H 2OXGA 5HI3D 1XR8A 5LGHL 1MHPL 4NQVB 3SKJH 4XVUC 3UTZB 4KHXH 4EQ2A 3FCTB 2BCKB 4M5YH 3RWIB 1PKOA 3TO4A 3RJDA 1BVLB 3GK8L 4ZFGL 5FUZL 3QJHA 1CDGA 5EOTB 4LCYA 5D6CA 4LSSH 1KCSH 4ZYKB 2BOBB 4ODTH 8FABA 3CD4A 1OM3H 2AQ1A 3B9AA 2ZPKH 4H5SB 5FGBC 3T09A 3TPKA 4FQQB 3ARBA 1DVFA 4YDJB 2CIKA 2VSDA 2KUTA 2HN7A 1KJVA 3L3KA 4F7PB 3SE8L 5L88L 1TITA 2VABB 3LN4A 4PJFB 5H8DA 4D94A 1J5OH 3ARFA 3QP3A 4XVTH 5D7IB 3T0VA 2ATPB 5HYSB 3VXSB 3WJLA 1EVTC 2KZWA 3L9RB 4XTRC 5LCVL 1ZAGA 5SWSB 4ZG1A 3K2UH 5T3XL 3RX5A 3ZYIA 4P4KA 4FQCH 5DMYA 2DL9A 4GXUN 4LLQA 5JQ6H 4YUEH 1WFTA 3JWNC 5TPWH 3QWRA 2L7JA 3WFDL 3P0VL 2BHYA 4ZUVB 4LPYA 3LRHA 3HE6D 4MJ5B 3ARBD 4YFLF 3L3IB 3GMRA 5ESQB 5KSAD 3RQ3A 2YD7A 5CD3B 3HLAA 2WQ8A 3WFHA 1IE5A 1L0XA 3KJ4B 4AEHL 3LDBC 4H8WC 5CHNA 5TQ2L 5CKAA 5JW4M 5EOCL 4YBLB 2YA0A 3KPRD 1I3GH 4U1KB 2QADB 2EKJA 1EFQA 4BFEA 2R8SH 1CFBA 2NY5L 3VRJA 3ROLA 3QIWB 2HKHL 3CX2A 2ZJSH 3A6OA 1NGXB 5D7KD 4OLXL 1J87A 1MHPH 3LQZA 4PGCA 3IDXH 5C09B 2V5MA 4P3CL 3CDGA 1TVDA 3O9WA 4FMKA 4RAUB 1MAMH 3ARVA 3GKWL 4XC3L 2XZCH 1CIUA 1OTSD 5CIPA 3QR2A 2EIEA 3OG4B 2C7UA 5I1HH 1OW0C 5EPMA 4OD3L 1B2WL 1YY8A 4I5BA 2VL5A 2V17H 4HJGA 5IFHL 4YQXL 3GBNH 3GJEA 3I6KB 3SE8H 3NFNB 2Y23A 2ERJB 2G75B 4DVRL 1CE1L 3EYSH 3DVNB 5TDPB 5FGSA 4WFHE 3MV8E 3VFUB 2WUCL 2CMRH 3VXSD 1S3KL 3N0PB 4Q2ZB 1B4JL 1KTDA 2DQEL 4PB0H 4U7MA 1KB5H 2HFEB 1F6AA 1NCNA 3T0BA 1N5AA 4NPYB 3BE1L 5ESVA 1UVQA 4U1GC 1ZA6A 3SCMD 3T3ME 4OIIH 1IGJA 4F15C 4PR5B 3E6FA 1MCBA 3UX9B 2VERN 5MI0C 3UPAA 3WHE0 2R4SL 3C8HA 4IBLT 1ONQB 4QTIH 5HHVH 4D3CL 4Y4KA 1NCCH 5KG9B 5J1SC 3V0WL 3ZYOA 4HGWB 4AIZA 1J10A 3RDTC 5BRZD 5DJ2A 4I3RL 1UCTA 1CG9B 1JPTL 3QXVA 4OZGB 2VDRL 4RFNC 2MKLC 2VKXA 3TCXA 4YAQB 3CMOL 2YBRA 4NFBA 2BFVH 4AIXA 3SJVD 5D1XD 2BY0A 3V8OA 1NGZA 3C08L 4HS6A 5B39A 4HUUA 2ITDA 2CSPA 1ERNA 3LHPL 3ARDB 2HT2D 5BMFL 4U1SA 1ROWA 4Z7WE 4PRIA 4YJZL 2PKDA 5T1MA 1AD0B 5JHLH 1JCKA 2LE9A 3OJDA 2GT9A 1FNSH 5EU6B 3B9KB 1LE5B 1VENA 4FFWD 1N0XL 5DD6B 1U8LA 2C3GA 5C0BD 1SMOA 4MCZB 4YXKL 4DZBA 3X13B 4M62H 2BVPA 3NIDF 4A2MA 1WBXB 1KJMA 4PJXA 1NCAL 4P4RB 1HQRA 4ZUTA 4W6XB 5KVEH 2FH8A 2QL1A 4DW2L 3O41A 2ICCA 4KKLC 1BJ1J 1I9JL 4QT5B 1UWXH 1OY3B 2EDFA 3HNTH 4OF7A 4ZO7A 4DVRH 3TP4A 4KH2A 3GMPA 1J05B 3OF6D 1MJJB 2GEEA 2CLVA 3C8DA 3LN9A 4HWZB 4LGRB 5D1ZB 1Z3GH 2ZUTA 1N59A 5AEAA 3VA6A 3ZTNH 4K3DL 3CXHJ 4LLUB 1NCBH 4NUJB 3L9RA 5D8JH 2YPKB 2HFGH 4PFEA 2Y6SD 3P0GB 3VFMA 4LLMA 1V7NH 4KJPD 2BOCA 1B0WA 1BBDH 1U8HB 2OYPA 2JJTC 1FNFA 5C0FB 2H41A 1YEFH 4Z5RB 2CRYA 1OHQA 1N64L 2VMFA 4O51B 3TT3L 3S36H 2AEPH 3L3HB 4HKXA 3TO2A 4NQVA 2FGWL 3E6HA 4K3HA 3PWPE 3BW9B 3QQ9C 4NQXA 4PGEB 1K8IB 3VWJB 3IDJA 3D3VE 1PSKH 3HE6A 2NXZB 3KJ4C 4JHAL 5DURB 2VWEE 1SM3L 5LBSL 5E8EB 2A1WH 3P0YL 4PUBH 2Q87A 1AP2A 2YSSB 4M1GL 1I9IL 3KXFB 2CJUL 3OKNA 4F7EB 1UT9A 5AWNL 4TPRL 2UWEF 5T1KA 4JO3L 4WO4D 5ICYA 5DFVD 4UILH 1VGKB 2FIKA 3FB5A 4Y4HD 2VWEC 2GJJA 1FL3B 4X9BA 5CP3H 3H9YA 1F6AB 1HQ4A 3QDHA 4N5EC 2CK0L 1JFQL 4OCSH 2PW2B 4JM2D 2X9WA 5E2VL 1QD0A 1DQML 4HDIA 4QKXB 3AU1B 2VTFA 1MIMH 4QRQB 2A6IA 2KZ1B 4HF5L 3EYFB 2JJSC 1HHGA 2DM3A 3LSOA 1CBVH 1JF6A 1MCKA 4P2RD 4PJ5A 3RNQB 1UWEL 5B3NA 2CRIA 4JCMA 4TVPE 3QDGD 4XH2B 3S4SB 4ZS7L 3WO3B 4HPYL 3QFJA 4NWTH 4XNMB 4JQXA 3HI6H 2D7TH 1QKZL 4WV1C 5DEZA 5C0NC 4X7SH 4Z7VB 4OM0H 1MWAH 4XPFH 4G5ZH 1JTTA 1MFDH 3D39E 4KU1A 3R4DA 3RVTC 2ZCHH 1W72B 5MEOA 5CLWA 1IGTA 4P3DB 5AUMA 5C0CD 2R29L 4UOW0 1IAIM 3L7EA 2HFTA 4FXLA 1B4RA 3P4MA 1CL7L 2D4DA 1PBYA 3UO1H 4LEOB 1QSZA 2H6PB 2ZOKB 4RFNB 3UCRA 4F9PC 2YMXL 3K80A 5KTEL 4L3CB 3G5VA 5FO7B 1MRDL 1OPGH 1EO8H 2I5YH 3CFBA 5EU7E 1NCWH 12E8H 4FG6C 3X11B 1PZUB 3HKFA 1T2QH 4HGWA 1WBYA 4JO1H 1GZPB 4OZIE 3U7YH 1YN6B 1L0YA 1E4WH 1DQQB 2VAAA 2J4WL 2ZUWA 3HAEG 4UIMA 3MRIB 1HNFA 4MS8C 3X3FH 4OZFB 5ITFB 2ERJC 3RZWA 2HTKC 4XVTL 2OTWA 1UJTA 4K7PH 3MRGB 3T65B 4ERSL 3HRZA 2AP2A 4Z0BH 1FSKC 1BJ1H 3VFPA 4K8RH 3O8XB 2IPKB 4XNYH 2FJHA 5CP3A 4HIIB 1IQWL 2V2TB 1Q9KB 1YYLH 2O5ZH 3QZWA 1DE4A 4YHPA 5K9OB 2DI8A 4K9EC 3RUGA 5FUZH 3MLWH 1GGTA 2EIZA 2ENYA 5E70A 3Q6FB 2XXMB 4PYGA 4APQA 4F58L 1ITCA 3PGDA 4Q74A 2PXYB 1INQB 3RKPA 4PGDA 2OL3A 1I1YB 2P7TA 4NO3B 1KELH 1QP1A 4LVNB 4LSPH 4N0YH 2P5EA 3NA9L 4M8QB 4RGNB 5FYKL 1NMBL 1AGDA 3QWRD 3BQUA 3QUXC 5J11B 2JCCF 4GG6B 4YC2C 3MUJA 3V5KA 3KS0J 3GSOA 3I6LE 4PJ9B 3RWEB 1IGTB 1MSPA 3CDGB 5EZLB 5FM5O 1IEBB 3VMNA 4RWYL 4G5ZL 1KCRH 35C8H 4PJ8A 5FKAB 4K9EL 4HFWA 3TNNA 1TQBB 1OP5H 4XCCL 1PQZB 1UCBL 3EOBA 3ARFD 3GFUA 3B9DA 2PYEE 5FB8B 3MRKB 3TT1L 1A6PA 1WFOA 1KUMA 4WI2A 5CZVL 4OLWL 4PJ8D 2CLZB 4G6FB 1X5ZA 3MRFB 4S1DD 1S5HB 4PY7B 5JOFB 4KK6C 5CWSB 5CBAB 3BRFA 1T03L 4L4VA 1R0AH 2YEZA 4U6VL 5CJOL 4GKNA 4WI7A 1KPUA 1P6AB 1HHGB 5I1HL 5JQHC 3ULUF 1TCRA 2X4PB 2VLKD 1KEGL 1G9ML 3SDXA 3MRPB 2DQHH 1MCIA 3FO0H 4GRWE 4TQEH 1EERB 1KCUL 1H3GA 4PJEB 2MMXA 1G9NL 2ZG3A 3GJFH 1GOGA 4MDJA 3KXFD 3CDYA 2JB5H 3VRIA 3IXAA 1ZT1A 5GIRB 4MNQA 2ZJSL 1DE4B 3TESA 3RNKA 1GC1C 4JPKH 1N6QH 4PGZA 1RUQH 3MV11 1YYLL 4AMKH 4M7LH 1GH7A 3U0TB 3BUTA 4DOHE 4N9OB 3GNML 3VXPB 2DBJA 1SJHA 1U8IB 3O81A 3IDMA 1PZ5B 2IFFL 4F58H 5H37G 2GUOB 3ROOA 4NNYA 3R8QA 3TA3A 1PX4A 3CIQA 3G5XA 1ORQB 4OFDA 3W2DL 2BERA 4CMMB 1A9EB 4XCFH 5FHBH 3REWB 2DBLH 2J6EH 4MQXC 5GSRA 4QT5A 4G8EA 4UAOB 4I3RH 1HCVA 4TYUA 1OAKL 3RVWD 2IQ9H 3V52H 1LNUB 5C6TH 5JO5A 4MA3A 5DLML 4GBXC 3G5VB 3KPTA 3VA2C 5SV3A 4AY0A 1RK0A 3L5WA 3DO3A 1A6ZA 3FQNA 2ADFL 1EEUA 1UM6H 3ULVH 5IUSA 5I8EB 2DJUA 1DFBH 2R23B 3PDDA 2R2CA 4NOBA 1KB9K 3BP4B 1UCBH 2XWTA 3EOAB 5F1SA 3THML 5AZ2L 1U8KA 5DVNA 3VXMD 2AJUH 1S7WB 1XCQA 1DBBL 5D70L 2B1HH 4KKCD 4U1GB 1U92B 5T3ZE 3MV7B 1Q94B 3VXOB 3MACH 1GSMA 3V6FB 5HYQB 4FFZL 4G9FD 1T7WA 4U6YB 4ZOBA 4OCXH 3RVVD 4TNVF 5GGRY 5IF0B 5I1JH 4A2LA 1N0LA 4NUGL 4KQ3H 1JVKA 3VGHA 4JM2A 3CDFA 4NN7B 3RWFB 5ADOH 4JFDA 1S7QA 4LU5L 2P5EB 4IRSC 3LRGA 2PW1A 3S4SG 1ZLSH 2KQNA 1JZ2A 4M7KL 4P5TA 4NC1C 2NW2A 5IQ7L 1S7TA 4F7TA 2IMNA 5FEBA 3SKNB 2HJKB 5IEHB 3R06A 3BD3A 4N8VG 3V5HB 5FCUH 5MEND 2PW2A 1NAMB 5FOBA 5JORA 3MA9L 3T65A 4OB5L 1KENH 3RTQB 1BQLL 3ZTNL 3Q5YA 4DKEH 1TJHH 4XBGA 2F58L 2HFGL 4M7ZB 3JTTA 1KLGA 3GIZH 1QACA 4Z95H 4WHYH 5IP4A 2K9UA 1G7QA 3QI9B 2YSSA 2G2RB 3LRSB 1A14H 4YE4H 4P59L 4MJ6A 5BS0B 4JAMB 3RUGB 1WAAE 3LIZH 1MRFH 2YEZB 3FZUD 1K8DA 5E5UB 5J11C 4HWBH 4X80H 4HBCL 4NN5B 3QWQB 1CTOA 4TVPH 1JPFB 3MLUL 1ZT7B 1FG9C 2XWTB 4PJGE 4UQ3B 5EU5A 5A2FA 2DLIA 1KXQE 3DUSB 3W0WD 3P0YH 1NUFA 2F19L 1ZWIA 4M00A 2E9JA 4P3DA 3QIUC 2FECI 1U8HA 1WWCA 1PYWB 5KSAB 5C07A 1F11B 1KN4L 3QJFA 4J8RA 5LJYH 4GRMB 2CK2A 2EE9A 3TYGL 4OZ4B 2IG2H 1YEIH 1A22B 1W0WA 4MAYC 1HWHB 4L29A 1UH3A 5KSVB 1BQHG 1QBAA 1Z5LB 4FFZH 4UMGA 5C07E 1ZLUH 4L8BB 1ZLWK 3QG7H 2C3VB 5DTFA 3SOBL 4OCXL 2FYYB 5FOJA 4U1KA 4U3XA 1RV6X 4M1DL 4E42A 2BVOA 3WL9A 1KLUA 2GUOA 4ZDHA 5ADOL 1TQCB 3PWPA 3BAEL 1JE6A 5JA9A 1UKSA 5E6ID 1GHFL 5ICZB 5JOFA 3TJEL 2DQIL 5MI0B 4HHAA 5T1LD 3Q1SL 4OLUL 4F7CA 4IM8A 5TGBA 3C9NA 3WN5A 1WJ3A 2QADD 1ZHBB 3P4LA 2Q8AL 4DAGL 4NJ9L 3GGWB 1P7QA 3O8XA 3VRIB 4BZ2L 2H1PL 2FGZA 3MRMA 4LLWA 4X7SL 4HKZB 2H2PD 1MHHA 4PJ9C 1KENL 1F02I 1UB5A 2FEDC 3Q5OA 4NO3A 3KPRB 5ANMA 3TIEB 5DSCB 4JKPL 4X83A 5K9JL 5DO2C 1KLFA 2MHAA 3UTPE 4CVZA 3DVGA 2NY1C 1KACB 2X42A 2OM5A 1GGCL 3GMRB 5KVMC 4D9RE 3WN5C 3GIVA 4Z6AT 4Y5YA 4H1LH 4LLAA 5EZOH 4R6UA 3W0WE 4IRJD 2MTPA 1NSNH 4U6HA 5GGQH 2J88L 2XT1B 4NNYB 1D5IL 4ZOCA 5IBUB 1T7YA 5SX4H 1UQSA 3BPNC 2F19H 3U0TA 5BV7H 3AUVA 3WKML 5HI5C 4AG4H 5KG9A 3CH1B 5JR1L 5GS1A 2FR4A 3DRTB 5I9QB 1QRNA 5DEFB 1MUJA 2OXHA 5HYFA 4L9DA 3EO1A 1JBJA 3OKOB 4NSKA 5D5ME 2YC1B 3MFFA 4P2QE 1U8PA 2ADJB 3ULVC 3VXRB 5DRWA 5BS0D 1NBZA 4XXDB 4U31A 3D39B 1F13A 1YYMH 5I1DA 4W6YB 5GGTA 2YD1A 4Y2DA 3FN0L 3D5OF 2ENSA 5FKPA 5F44A 4GAGL 1IAKA 1A1MB 3ES6A 5D5MB 1AO7A 4A6YB 1OSZB 1YN7B 4D9LH 5I0DA 5I8OL 2LAGB 3X3FL 1T5WA 3SDXE 3MRGA 1BZ9B 1FE8H 3BZEB 1MY7A 4JO2L 5FDWB 3TWCL 4NKQB 4FFVD 4C56B 3CSBA 4XP9H 4NQSA 1HYSD 3N1FC 1D5BA 2YWZA 5CUSL 3O11A 2FL5A 3EUUA 3HC0B 1Y6MR 4HBQA 3GSRA 2QSVA 5EO0B 1WISA 4G9FE 1LDPH 2EXYD 4G7VH 4K07A 4XX1G 1OW0A 3OJVC 1IGCH 3VGEA 5BXFA 4F15B 4P2QB 3WE6A 3X14B 1UC6A 4U1HA 2VDNL 3U6RB 1KIPA 3LVEA 1T66D 3QHZH 1UKQA 3BJ91 2JCCB 1F90H 3SGJC 3LOWA 1MCWM 4OLYH 3OZ9H 1YNTB 4I18A 1UZ8A 5FK9B 4PJHA 3GHEH 4AIOA 5LXGH 3BP5B 4RGMC 5CJOH 4JAMA 3QUYB 1IGFL 3MV9E 1AGFB 5HGHB 4Y4FD 5IHLB 4ZFOA 3OTTA 4X9FA 4URTB 1J8HB 3DMMD 5ABDE 2R2BA 2XY1A 2XKUA 1BQHA 2IAND 4FABL 2QR0B 2QKIB 4HW6A 5GRUH 1IC7H 2PF6A 2XN9E 3GGWA 1ZA3B 4OQTH 5FV2A 1Q0XH 1WC7A 3GMOA 3L95A 2AK1L 5J6GA 3VMOA 4DKFH 3GSWA 4D0BB 1NAMA 4HGMA 4WUUD 5TE4H 1G7MA 1YDPB 3D9AL 2BC4B 2FX8L 2UYLB 2LV4A 1IFHH 2XN9A 1WZKA 2OSLA 5HDQH 5EFIA 1YYML 3UBXG 1KNOB 2GAZB 3IYLW 3HNVH 3TFKC 4NQTA 3WS3B 1KCVL 2E3VA 2VL5B 2J3SA 4F57H 4BQ9A 2IADB 1TQCC 2RIKA 3SGKC 5HHMD 5E2TL 5F1NA 3GHBH 3LS5H 4HGKC 1TMCB 5F7UA 3DBXB 2NZ9D 4YBHA 5EZJB 1EEYB 4YK4C 5GQBA 3GMPB 4XWOC 4HX1A 1R24A 15C8L 2GJ6E 4WFFD 1LE9B 3ISWA 3V6FA 3SKOB 5ID1B 4M9OA 4HPOH 3NAAL 1UQSB 4N8CL 2YK1H 1A7RH 4WUUE 3UTTE 3FO2B 2VLJB 3MJ9H 4M7LL 3ARDA 2IAMB 5IVXE 3SDDD 1MFBH 4WI4A 5B4MC 3QIWA 3QRGL 4S1SL 3THMH 1GGIH 3F7RA 3BI9X 2W65A 2CGRH 3BYTA 2PYED 3MZTA 2IGFL 1WWBX 2YC1A 4UBDD 5F6HI 2B1HL 5IG7B 4CVZB 5C6WH 5FYJD 5F7LB 1U42A 2YD4A 1CG9A 5E56A 3SQOH 3FB6A 2D7NA 4PP1C 5FGRA 1JRHI 1X3DA 2OL3H 4PV8B 5IEKB 4QY8A 3BGMB 2HJFA 3ARGC 1JZ4A 1BFVH 2WBJA 4Y2DC 1WSST 4M61A 1M71B 4ODSL 1TETL 1NANH 5FM5M 1VGKA 2IAMC 1JF1B 2FCBA 3S34L 5ELIA 3MLZL 2AJXL 5HY9A 3T04D 4YHNB 1WAAF 2BSSA 2WWMC 4ZOEA 5EO9B 2QSQA 4DGIH 1OCWH 2PN5A 2AW2A 3DVNA 2F5AL 3PXJA 4OLEA 4QRQA 4R4NC 4K94L 3NIGF 1NBZB 1JGLL 4LPXA 4HT1L 4DZBB 2XNAA 3T0XA 5SWSD 1GIGL 1Q9OA 2GITA 1DTUA 4HC1L 1ZA6B 1QFPA 2NY6C 2FIKB 3FB5B 1A7NH 5IFHH 2WNGA 3CVHH 5FUCC 4YE4L 3P11H 4P4KB 2JELL 3BRDA 5E6YA 4PYHA 1DSFL 1UADC 3TBWB 2EO9A 5C7XH 2AEIT 3BP7B 4IRSB 2Q86A 1E27A 2NY6B 1MLCB 3QXAA 5BS0E 2YK1L 1MCCA 4HS6B 1BIHA 4F37K 4IS6A 2GFBA 3WFCH 2BVOB 2ZCKH 4E42B 3D1MC 4XNUH 5I1LA 5HHOA 4J3TA 4KRMB 1DQLL 1KC5L 4WI8A 1OGAD 4MZ2A 5FDYA 1S8DB 3T8XA 2HLFD 4Z95L 4U33A 4WW2C 5C09D 1ZVYA 1ED3A 4Q9RL 4XRCB 3BN9C 3C08H 3ILPA 2H26A 1IAIL 2HG5B 4KVNL 1RJCA 5D7IE 3SOBH 4RGMB 3LIZL 3EDDA 1UM4L 1QZ1A 4G8GD 1AHWC 1IBGH 3VFTB 4HMCA 2E8YA 2X70B 2GKIA 3HAEB 3HZYA 1V7MH 3MRLB 3G6JA 3HCVA 2F53D 4X7DC 4LAJH 2MWCA 1S78C 3Q1SH 1FLRH 4OLUH 4L9LA 5I19L 1CDJA 5BMFH 3G6JE 4NHCH 1AXTH 4JR9L 2Y4SA 1JV5B 3W5NA 3STBA 3GMMA 1FNSL 1OAZL 1OCWL 2BXYA 5D71H 4L3EB 3M17B 4PTTB 5T1LA 1U6AH 3MBEC 1MIEH 3HPJA 1NQBA 2V7HA 3GB7A 2JE8A 2Y07H 3PGFH 4K7FB 4XAKD 4I18C 4M8QA 5CJ5A 1R5WB 1XGUB 1JWUB 5DC0A 3CFJA 4K94C 2O5YL 2R0LH 5IR1B 2K3TA 3MRJB 3WXVH 3B3IB 3QB7C 4DN3L 1CLZL 5MHSE 4DEPB 4DAGH 1N5YH 3ZHDA 1EXUA 1DLFH 1NBVH 1EEYA 4R4FH 2YUXA 1KJ3L 5E5RB 1GAFL 1S9VB 3T2PA 5FUOH 2L7UA 1FO0B 3OMZA 5C07D 1W2KT 5IMOA 4NRZA 2VB5A 4MHHI 2NY2C 2R2BB 5C0RL 5HYIA 3KHQA 5SWZB 3P40A 4MAUH 1TQBC 4RAVB 5B3JF 3TV3L 1K4CB 3V6OC 3NZ8A 4ODVL 2V2XA 1EJ6A 4I18B 5CWSA 3BGFC 3ULVF 4PJEF 3A6BH 3Q0HA 2VZOA 1PKQE 1S78D 1KIQA 5DJ8A 4JPWH 4UV7H 1HKFA 3ME0A 3L3GB 5IBTL 3ZKQD 4NCC2 1MFAH 4OCYH 4F37F 4NYLA 1FVEB 5F21B 1PKQA 4DWHA 3QBTB 4HIHB 1YN6A 2VDQH 3P9MA 2I9LB 5E8PB 5FA3A 5I18H 2IQAA 3QDAA 3IXAB 2PTTB 2YD6A 2W9DL 5E2JA 3RWEA 3FT3A 4QOKE 4QO1A 1UACL 4C4KT 3WFDH 4EBQH 5C0GA 2XIDA 4LEXH 1JHLL 4OCWL 4OZHE 1SVCP 2P8PA 4U6XA 3MXVH 2G5BA 2HLFC 1OAZH 4YR6A 3JBG7 4I3SL 1T89A 1D9KD 2WIIB 4RMRA 1MVUB 3BGFB 5I1AB 3BZ4A 1FFPA 3PQYE 2Z0BA 2BRQA 1PFCA 4HZAA 5FYLL 2OL3B 2PXYA 5AYUH 1A3RH 4HUNB 4JLRB 4OUUB 1JNJA 2X4NA 1AHWA 2YKLH 4LVHB 5CBAA 1T80A 2GYSA 4I0CC 3QEUB 3RL1B 3N1PC 2QR0A 4G6JH 5ALBH 3MLSL 1J1OH 1JPGB 1MFNA 3P4MB 1GYAA 3NH7L 4J3VA 2RAMA 1BD2D 3EKCA 3OBAA 1P6FA 4XBPA 1KSRA 1FDLH 4WTXA 1GJIA 3WUWG 5DMJB 2A9ML 4DGYL 2HJFB 5IW3A 2APVA 4Y4KD 4GUPB 1DQQA 3BKJL 5F9WC 2LVCA 2VC2H 5T3ZD 4F3FA 3HLAB 1MWAB 1T83A 5JTWA 3WV0A 2WWMD