1U8IB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkwan
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8iB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8iB01
2X40A 3L95B 4PBXA 4PUBH 5TDOB 4PJFE 3MUGA 3BUYB 3BAEH 4GS7C 2ZUSA 4OFVA 2UZYB 3CFJA 4IOSD 4KI1A 4I13B 3QDGE 5HGDA 4DOHB 3FQWB 2WAHA 5C0ND 4WGWB 1DBKL 4NO0B 1OP3H 1X7QB 4KKLC 4U3HA 4HH9B 3MLTB 2L4OA 1I3GH 5KSAB 1MWAB 1RIHH 1X5LA 1ZK9A 2GK0A 4ONOA 4NP4L 3I6KB 4JZNA 3TBSB 4XP1H 3KGRA 3ARED 1N4XL 5I9QC 4I9WE 2GJZA 2PXYB 1ZANH 3UYRH 4FFWC 1JF1A 2NY7H 3UO1H 3NPSB 5IIEA 3HAEH 2AJVH 3LEXB 2C3VB 2DWEA 4W81A 1ZT7A 2ATPB 5IGXH 3QEQB 3ARDD 2N4IA 2GTZB 3H9YA 4Z0BL 4ZOEA 3QIWA 3RUGE 4OZGB 1KEGL 3HZMB 1K9TA 1LP9A 2VB5A 5IW6B 3H2WA 3K81A 3HUJA 4L9LB 2IG2L 5JPNB 1INDH 1QBML 1ZHKB 3F65A 3MV7D 4U0RB 5D4QA 2EH8L 1B6UA 1WFUA 1MFBL 3G5ZB 2Y36L 4K7FB 2XT1B 2VLRB 2HN7B 1KC5H 3FT2A 3E3QE 1OAUL 1MCWW 5EUOA 1NGQH 4DVBB 1J9CT 2FIKA 1K3IA 5DC0A 3TZVD 4NQDA 4KXZI 5DFVD 3ROOA 5IQ9A 2EKSA 3B9KA 4PY7A 1JWMA 4KKCC 1LD9A 3WS6C 3CSYA 4G6MH 3KS0J 1DSFL 3OXRB 3REVB 3QRFM 2ZUWA 3O2VL 3QCUH 3ZKXB 1B0RA 1CT8B 4YHYC 1P7KB 5FA4B 1R5IB 2XA8L 2VDNL 1NFKA 1A1NB 4Z78B 1CR9L 1DE4A 3HC4L 1KTLA 3FO9A 3RIAK 3BJLA 3PDOA 2Q20A 1IQDA 5IB1B 4GKSB 5C0NC 2Z92B 1KIPA 2HFGL 4MLSA 5JOEA 5IWLC 4YFLF 3WO3B 2JE8A 1X5HA 4OQTL 2E8YA 5ESQA 3SQBA 2H32B 3Q1SL 2WWKO 4RAVA 4Y4KD 3RVXD 4S1SL 1CL7I 3U0WL 2X4TA 2FHBA 3PQYA 5C0AA 3AREC 1ZOXA 5IM7B 1CIDA 2HT4D 1YEEH 4QCIB 3UAJD 4NNYA 3R8QA 3QQ4A 4PJAA 3AC0A 3F7VB 3TIDB 1KEGH 4Y2DB 3ARDC 4L8CB 1L7TL 2IG2H 2OBGA 3VCLA 2FH8A 3V0WL 5BVPL 1QBMH 1Y6KR 5T33L 5L88H 4P5MB 4GBXB 4LLDB 2Y36H 4QEGA 4D9QD 3HB3D 3PP3K 4DOHE 4M1GL 4JO1L 2D0HA 4HMCA 1ND0A 3MXWL 4WVRA 4M1CD 4GW1A 3SJVD 1JWUA 3TZVC 2BNRA 3GMRA 1CGUA 1MUJB 4JPWH 1CQYA 1KPRB 5DFVC 1RUPL 4OFYA 1DSFH 3P30L 2Z31C 4PRIB 5ETUA 4J8RB 4PRHB 5E94A 1MIEL 2OLDA 3SCMA 4GRLA 3OX8A 8CGTA 5F1NB 4M6ML 1RQ5A 3O3AB 4M6AA 4XCNB 3GZKA 4XCFL 1A7PL 2GHWB 2XA8H 2VDNH 5MEOB 2X44D 4OD2A 4GKOA 3QI9D 3HC4H 3QEQE 3ARXA 3NCEB 1NCBL 4L3EB 3OB8A 3V7AG 5F7KC 2UWEF 4EEEA 1S9XB 4D0DA 3U0PA 1JV5B 4P2RA 1BLNB 3FFCD 4HW6A 5FYKE 3D0LB 2X7LA 1PGRB 2DQEL 4OQTH 3RNQB 5I74C 2JCCB 3LDBB 1QO3A 3VGDA 2AV7B 3Q1SH 2H1PH 2NY6D 2VLRE 3VXMB 4XGZA 4S1SH 3U0WH 2W60B 2OJZH 4F33A 2WINB 4LOUD 4L8DA 4U05A 3RKDD 2EDQA 3WSQL 4Y4KC 3RVXC 1KPVA 4TNVK 1V3LA 5JHLL 2HT4C 3TLRA 1FO0B 5C0DA 1UZ6E 7FABH 4F7TB 3L3IA 4M7ZC 3TBWA 3V6OC 3UAJC 1QFWM 4Y16D 4LF3A 3RY6A 1CGSL 5C0BD 3RIFF 5BVPH 4D8PA 4FN0A 5T33H 3V2AR 3R4DA 1T7ZA 2HVJB 2AK1H 5JW4M 5B3JF 2XXCB 3U7AA 2R2EB 2DQGL 4JHBA 3MA9L 1YJDL 4M1GH 4HD9A 4JG0L 4JO1H 2GIYA 3VI4E 3BPOC 3HB3C 3MXWH 4P5KA 4WI3A 4EDXB 5ALBH 1LE5B 4KTEL 2JJWA 5D5MA 4M1CC 5IR1A 4N9GB 5TF1L 5DJ6A 4FRWA 4QNPE 3DXAD 3H8NA 2AJZA 3H7BB 3P30H 3TYGL 4P46A 1FNSL 1MIEH 1FVCA 4NN5C 2Q8BH 1BQLH 2BSRB 2DQUL 5ESAB 5HYFA 3BHBA 1G0XA 4FP8L 3DO3A 3X3FL 4P2CG 2VIRA 1A7PH 4MZ2A 3BRFA 1A64A 1FNGA 1MY5A 4XPGL 3DMMB 1FLRH 4RAUA 4PP2A 3SO3B 2AJ3A 1FZMA 5BVJA 2J3SA 2YSSA 1Q9OA 1S7QB 1KSRA 3MGAA 3EGSA 3QI9C 2P8PB 3TVMB 2YA2A 3GHEH 3LQAL 4YWGH 3K8KA 5I8KL 1ZXQA 1HQ4B 1IC5H 3GMPA 3MSPA 4MS8C 4NN6B 2X2YA 3UX9B 1FAKT 3QJFA 1QLEH 4MWFB 2BOBB 4QTIL 4HIXL 4PLJC 4MSWB 4F37K 4W6YB 5E99H 3FB8A 3SGEI 2NY6C 5C07A 3WSQH 1HINH 4CAGA 4P2YA 2FECL 2WUCL 4LOUC 3ARGB 2NW3B 3RKDC 3T0XA 5J11B 1IM9A 4I3SL 3VRLF 1ACYL 4PV8B 1FPTL 2ZOKA 3VFVB 1FZJA 1GJIA 5CJBA 5T1DL 4PRAA 3GSVA 4H0GA 4M7LH 4PRIE 4RMTA 5JR1H 4Y16C 1JYVA 4JFFA 4ODBD 3MLSH 4OZ4A 1OB1B 4RGNB 5EFIA 5GQBA 1YMHB 5JNYA 2DQGH 1XGTA 1YJDH 4Y88A 2RQ8A 2AJSL 1HI6B 1SYSA 4XTRD 4QHMB 3VH8G 5E6ID 4L3EE 4NQEA 1EEYA 3NA4A 2CIIA 5DC4B 4N5UA 1WISA 1QHPA 1X6LA 3CZFA 4HC1L 4KTEH 4UNTA 1Q9KB 5FOBA 4MLIA 2A0LD 8FABB 1LO4L 1IKNA 2BVEA 4QF1B 2A77L 1CLOL 3TYGH 1CXEA 2JCCE 4X6FB 1W8OA 4ZOAA 3VXME 4CU6A 2F58L 2AXFB 1IGML 2NZIA 1CVSC 2XRAH 3OKLB 4FP8H 1NAMH 4MAUL 5DQDL 1UCTA 5EU4A 5AZ2H 2AV1B 1QBLL 1J7VR 2FBJL 4XPGH 4GSDL 4KTYA 3AGVA 4ZXBB 2PYED 2Z93B 4C58B 5CCKH 2VDQH 5KTEH 1TZIA 3EYVA 3IKCB 5D7LB 3LQAH 1CXIA 1J1PH 1JHLH 4Z5RB 4OUUA 1JNJA 1TVBA 2H6PB 3BKML 5C0CB 4QHNB 3CU7A 4HIXH 1XIWD 3P4NA 5I1CH 5DD6A 2AQ2A 3PABB 3C5SA 3GKWL 3MACH 4NBYB 3PHQA 2GY5A 2LU7A 2YA0A 5E0QA 4ZSOA 5ID1B 3JWNC 4XBEL 4I3SH 3IS1X 4RNRB 1AC6A 3PV6B 1AD0B 3U7WL 3JV4A 4ZUSA 1K8IB 3CSGA 5T5NG 2A6IA 2V9QA 4BSWB 1CBVH 2UY7A 4IMLA 4LBEA 3GM8A 5GHWL 4F7MA 1P7QD 2BXYA 5E95B 1TVHB 2H2PD 1I1RA 3GO1L 3GSOA 1ZA6B 4X7SH 3V4PH 3VD7A 4XBPA 5IKCA 5GJSL 3PWJA 1NCTA 2ID5A 2H8PB 2AJSH 2F53A 4RBPK 3H9SD 3IDGA 2F15A 2YR3A 4IDJL 3DRQA 3QEGL 4XTRC 1JJUA 1A9BB 2EDKA 1UM5L 4GW4A 4OFPA 5E6IC 1U8LA 2KPNA 5ILTL 1W72B 4XB7A 2FEEL 3DURA 4FTVE 1ROWA 1HWGB 1Z9SA 2WP3O 4OKDA 3C5ZA 2A0LC 4H1LA 5KAQF 4Q9BA 1R3JA 1VCAA 2H3NB 4PJHE 3VXTB 2VRAA 1IGMH 1XCTA 4YO0A 5DQDH 3T2PA 4EVNA 1CE6B 1J0IA 3GRWA 4GSDH 4Y2OA 3TV3L 3T65B 5L2JA 3MRPA 5C0EB 3UTOA 4FQCH 2Q76A 1D5XB 5ANME 2YRLA 1KJ2B 5DUBB 4ESKA 3BH9A 3FT3B 3NH7H 2UYLA 1BPVA 4Y1AD 1X5ZA 3T1WA 2IMMA 3EW3B 3P40A 1CE1L 1YMMB 4NKIL 2YZ8A 1MAJA 2VL5B 5CP3A 5IJVA 3GKWH 1YJDC 5DK0A 5GRUH 5KG9A 1XIWC 3CLEL 4O2EA 4Q2ZA 4X9HA 3JUYA 4XBEH 1X4ZA 1OAYL 1WAAE 2PO6B 3U7WH 4WEUD 3EJJX 3S35L 1A3LH 3U2SA 5FGRA 4RGOH 5EC2B 3GO1H 3KPSA 1TJIL 5EWIL 4Z7OE 4KDVA 2ZUYA 4MJ4A 2H2PC 2QHRL 3HE7C 5GXBB 4OZHF 4A6YL 5FGSA 4UQ3B 2PETA 3MJ9H 4IDJH 1AXTH 4KK9D 3KS0H 4YDLB 1BF8A 5D7LE 1Q9LB 1IAKA 1N3NA 3G5XA 3VE0A 5ILTH 3LQAC 3PXJA 1PSKH 5A2JH 1MCNA 1IVLA 2I9LA 1O0VA 3LMJL 3WIFB 4PJDA 2R23B 4OF5A 1J87A 5DMYA 1NCNA 4UAOB 4MX7A 3S98A 4F57L 5E5MA 4ORZC 4HWNA 3IFOB 1RK1A 1UJ3C 4M1DL 4M4PA 1MI5B 3NGBB 1NGYA 2ADFH 1DBML 2ZZUT 5CSZB 4MD4B 1ZHNB 2NY3B 1I7UA 2PW1B 4LSRL 5EZLB 3L3JA 5D96C 1M71A 5D93C 4JPVH 1H5BA 2VDKH 4E42A 2BJMH 4XP6H 2WBWB 3F7RA 5ACZB 2FJFB 4QHLA 2DQHL 4ZNCD 2V2XB 3T3MF 3QZWG 5IQ7L 1DDHB 1MJ8L 4NKIH 4JZJB 3QDMA 1VEOA 1HNGA 1CFVL 1U41A 3TNMB 3P9LB 2V2WB 4D0BA 3CLEH 1KB5B 2IANA 1BAFL 1J0YA 3SPVA 5BCAA 1OARL 3LQZA 4L4JA 2CRZA 4A2MA 4KK5D 2YD7A 1OAYH 1LDPL 3WE6B 3B43A 1MF2L 5DUPL 5HGAB 4ONGH 3DV4B 1CDHA 1JUFB 5DHYB 4FQ1L 5IEKA 2NTSP 1QR4A 1TZHB 2J8UF 1MFCL 4U6TA 3UZEA 4P3WA 3BD3A 5GGSY 1TFHA 5F9JA 1MOEA 4YDJB 1TJIH 2EEAA 1TETL 3NCCB 1U8JB 2QHRH 3PWPD 2ADJA 4R97C 1C16A 1U0QA 3W0WD 4A6YH 1FE8L 3QZWB 1RIUL 5F3HA 3KYNA 4EUPA 4DKEL 1AGBA 2OZ4L 4K3GA 3MQIA 1QRNA 4ODUA 3EOYG 2CIKB 4KK9C 4M43L 2ED8A 3S36H 5K9KB 1I8LA 4GRWH 4JFYA 5K59E 4PRDB 3U0TA 3LMJH 2YPLA 3T3PF 1RVFL 2DQFA 4F57H 5E1HB 1BGXL 3T0ED 4HIIB 4QYOA 4Z7WA 3QA3A 4M1DH 3S96A 1QLRB 2CKBL 2C3GA 5JOFB 1EJ6A 4NUJA 4OFIA 1BZQK 1P6FA 4WI8A 1A02N 3FB5B 5F9AC 2Q86A 3GHBH 1N7MH 2V7HA 4UOJA 3QWOB 3O4OC 5C0GB 1XH3B 4FXKB 1N2RA 4QRPD 2GUOB 1DCLA 5ITFA 5IHZA 4RWHA 2DQHH 4WWKD 2GFBB 1CDBA 5ICZB 4G6FD 5IQ7H 3QXUA 5I1IL 1FVDB 3U4EA 2D7TL 3UTPE 3U4BL 4NJAL 1UYWL 2UVFA 4Y5YA 3O9WC 3K7UA 3SKOA 3NTCH 1BAFH 4NKOA 1OARH 3BPCB 1FFQA 5DHXB 3VXSA 1I7TB 1LDPH 4HZAA 1MF2H 3NZHL 1A7OL 1K2DB 4KK5C 1CD0A 2BZDA 5IVZA 1KNOB 3PL6D 4DJMA 3O3BB 3RRQA 4FQ1H 2FJHA 3RPIA 4IMKC 3H0TB 2HT2C 5MHSD 1QACA 1FC2D 1IE5A 5JW4Q 1HDMA 5F6HJ 2OK0L 3O6FD 1MRCH 3K4ZA 2XPGA 5EIIB 3ZE0F 2K9UA 2Y5TA 5DJ8B 4UNUA 4LHUA 1MI5E 3V5DA 2ZG1A 3K2UH 3MX0A 3D25B 2C26A 1RJLA 1FE8H 4LAJH 4NQCD 5F7WC 3MCLH 1MJ7H 2VKWA 4R0LA 1C8PA 4DKEH 4MNQA 2B5IC 1K4CA 4XX1G 4JM4L 2FX9H 4NKQB 3H42H 5DHVB 5I1GL 4XRCA 4ZTPL 1EAPB 3IDNA 1Y0LA 4F58H 5C2BL 3BD5A 1G6VK 2Y7QB 4CMMA 2ICES 1RUAL 3MLWL 3DX9A 5C8JA 2Q8AL 3WJJC 5C3LD 3MRMA 1RVFH 3GMNA 2VQUA 2Z0BA 2VAAB 3DLQR 2UWEB 1KBGL 4EI6A 3HPJB 3QUXB 3DI3B 2FX7L 5FYJL 3RWIA 3T0EC 5E1AA 2WANA 3DX6B 1OT2A 2V9RA 1KG0A 1SYVA 4TQEL 3IXTB 3VG9B 3L5IA 4HWBH 1INQA 1JPSL 5HDLA 1FP5A 4J3UA 4DTGL 3F7QA 2F5BL 4I3GA 1MH5B 1OM3L 5IOPB 4PJ9D 5BS0D 1OP3K 3F7YB 4JM2F 2E9JA 1YY8A 3TN0B 3QXAA 1J05B 1NLDH 3D2UB 5I1IH 3JTTA 3REWA 4WWKC 3G6AA 2XWTA 4ODWB 2D7TH 3RWJA 2WNGA 1Z0NA 1UYWH 5IV2B 2VUOA 1IAOB 1U8PA 5I1DA 5BZWB 4J3SA 4B5EA 3NZHH 1A7OH 3MBEA 1A1MB 1CG9A 1Z5LA 2VKXA 3CDYA 4YDVA 1U95A 3OKDB 4YK4C 4W6WB 3PL6C 2MHAB 2LTQC 2ZSWB 2GI7A 5DD1L 1D5ZB 3TP4A 4L4TB 4LLAA 1P84K 4AG4L 4BM7A 3O6FC 1B4RA 4NO2A 5EORH 1OCWL 2AEQL 1D5BB 5CEXA 1S78C 5JTWA 1P7HL 3QUMB 4GG8B 3ARBD 5C08A 2I07B 1EFXD 1URLA 4JM4H 5DRXB 4ZTPH 1QFUL 5H35B 2X1PA 5C2BH 3O4LA 2VISA 3D39A 3MLWH 2LAGB 3OJ2C 2Q8AH 4KJYB 2QADD 1HHIB 3K46A 1VFAA 2A6KB 3F12A 1ADQL 1UXSA 1KBGH 2HRLA 5JORA 2M1KA 1A6ZB 1FZOB 3B9EA 3CFDA 2FX7H 5FYJH 4TQEH 3N85L 4JO3L 1UKSA 2P8MA 4UQ2A 1B3JA 3ARUA 5DK2B 1K85A 3LS5L 4DTGH 2ATKB 1A9EA 2DI7A 1OM3H 4YHPA 1B0WA 5D6CA 5GGUA 4NQVB 2EDWA 2FZ3B 4KRPC 4HQQL 4PJ9C 3IDJB 1MVUA 1TMCB 5F6IB 2X4NA 1AE6L 1TJGL 4NKMA 4Q6IB 5SWZA 5J13C 2E6JA 4LSVL 4NO5B 2W0KA 5I1KL 1UWEL 2ESVD 4YC2C 3G08A 1DQJB 5BV7H 3OXSB 4IRSD 1IILE 2BVPB 3JWDL 4KTDL 3QDJB 5BMFH 2K7PA 2OS7A 4KHTH 2V7NB 3AAZB 3D0VB 3QWRD 5DRZA 5DD1H 1KN4L 3FTGB 2GTWB 2UWEE 5DFWH 3EDDA 3SE3C 4HS6A 5FYJD 2XZCH 4WFFE 2UY6A 1YEDA 4R7NB 3UTSA 3O45A 5BQ7B 1LEIB 4WO4D 3IJHA 2WIIB 5MEPB 2ARJQ 3RZCB 2MMXA 1QTYT 4Z7UB 2LU3A 4N8VA 5INDA 5D1ZD 2EIBA 4LLWB 3ARBC 1QFUH 4JLRA 4J3WA 1ITCA 4XX1E 4JFEA 5D2NB 3C2AL 1EO5A 3WNPA 2XTJD 3CX5J 5CP7B 1QFWL 4PRNA 2L7UA 4RWYH 2QADC 1BEYL 3MA7B 5DJZA 4C4KO 4QRRD 5JXAL 3PWVA 4PGEB 3OGCA 2F8VA 4JO3H 1M05B 1XGRB 1ZVSB 5IFJA 3OAUL 1FNEB 1P2CA 1UACH 3IU3A 2DBLH 1OGTA 3GSNB 4JJ5B 4L4TE 5BXFA 5JMRA 5KAQG 2VZOA 3KPNB 4HQQH 4K9EL 1PZ5B 5HGBA 3MO1B 5J8OA 2P5WD 5AZEL 1F6LL 4QGTA 4TUOA 3SN6N 1L0XA 2P5EB 4LSVH 5I1KH 3G6JB 4O2CA 1DANU 4YAQA 1A7NL 4G9DA 4LEXL 1XF4B 3EIFA 1PQZA 1MAML 4UU9A 3EOTH 4ZPVB 4IRSC 3BGMA 1GHFH 4NHCL 4KVCH 1KN4H 2HH0L 4P4KD 1I4FA 1HILB 5I8OL 1TTFA 1V5JA 1HHJB 1KXVC 1S7UB 1QSFD 2XZQL 5J6HB 3BIKA 3CC5A 3QXWA 4LMQI 1HCFX 3DJ9A 2Z91B 1VKXB 4IOIB 4U4BA 3KHQA 5D1ZC 2D7QA 5E24E 3C2AH 2EYRB 4LHJB 5EZIL 5KJRL 3VRLE 1MCPL 4O4YL 4RX4D 1QFWH 2BRQA 5C0RL 2XTJC 3V4VL 2ITDB 4U1KA 1FYTD 4L29A 1K3ZA 4RISH 5BO1L 2C5DC 1L7IL 5JHDA 1OPGL 1A21A 3FRPG 3VXPA 2KZ1B 3HE6C 5C71A 4ZS7L 2QV2A 1NGWA 4LGPB 4F7CA 5CEYB 1RZKH 3OAUH 5BV7C 3N9GH 3QDJE 1G7MA 1I1FA 2EYTA 2G75A 4WI5A 2APWA 4XP9L 2BSTA 4I2XE 5DJ0A 2DQIH 5JO5A 1C5DB 4IHOB 2D7PA 4YHKL 4HGKC 5F7EL 3RTQB 1MCDA 4G8FB 4GKNA 4ZFFA 4APQB 4KPHL 4N0FA 1GC1H 1A7NH 4LEXH 3MROA 3DVGB 2Z8SA 4OZHB 5D2NE 3PNWA 3MRKB 1G9NL 1ZGLA 3GSXA 1BD2A 5ESVA 4JCLA 3DIFB 4NHCH 4C56E 4HUUA 2HH0H 2P8LB 4XCEB 5CGTA 3MLYL 3OR7A 4OCWL 3ULSA 3R1GL 4G43B 1MCOL 5A3ID 5C09D 4X5XA 4XMPH 1NBYB 4P4KC 1CF8H 4HPOL 4PRBA 4JRYB 4MQ7B 5L0QC 5IP4A 1SJVA 3FOMB 4YXLL 1A4KA 3MRQB 3QH3B 4H88L 4LPXA 3BRGC 2OL3B 1Q9WA 2DIJA 3S9DB 1YECL 3VXNB 2C1OA 3D3VD 3RX5A 3KYKL 2DJ4A 4JFDB 4YHLL 4XXCA 5FHBL 2X89A 3MGOB 5JZ7D 2EC8A 4X6DF 4X6BA 5EO9B 1S7RB 1MCPH 5EUKB 5GGVL 1WSST 1A2YB 3TBVB 3TNNB 4BELD 1GGUA 3B2VL 4PY8I 3QCTL 2J6EA 4NRXB 3EDFA 3GB7B 1D9KD 3S7GA 5HHNB 5BO1H 3QIUB 2QJDA 1EPFA 1OPGH 4OD1L 4X7TB 3GUTB 1EGJL 3G6JE 5IVXF 3BISA 2IADA 5EOQL 5E8OA 4C54A 4JFQA 1E6OL 4Y4HB 3VWJB 4XP9H 4OZFA 3HG1A 3WNLA 2XKNB 5TDPA 2BCKA 2AW2A 2B39A 1KT2B 4TRPH 1OOAA 1FQ9C 1VGKA 1GGBH 3O8XA 1H3VA 3CMOH 4S1QH 1JGEA 3O11A 4WUUD 3GSQB 4WNQB 3BW9B 3GFUA 3RY4A 4X6CB 5D71L 1WZMA 4KPHH 2P48B 1D5IL 3FQWA 4OSUL 1XR8A 1QEWB 4XPHH 3DX7A 4HH9A 1G9NH 3MLTA 4DN4L 3SDAB 4MHHG 4J7RA 5DXWA 4KI5F 3MLYH 1KIRB 1EZVY 3KYOA 4OCWH 3TBSA 4LLMB 1IQWH 3QXTA 1NGXA 4HPOH 3VD4A 1FCCA 5IMLA 5A3IC 2V5TA 2AS5M 3S5LG 4YXLH 1FFNA 3MCKA 1Z2KA 4HK3J 2PYFA 5F70A 1OAXL 1RZKC 1YECH 4K8RH 1UJTA 1MWAL 4LQFH 3KYKH 4YHLH 1S7SB 1BX2A 2BSSB 2D9CA 1UCBL 3NFPB 4W4NA 3CU1A 4UIKL 1JPGA 5T1LD 4OZGA 3HZMA 4Y0GA 5FO9B 4I9WD 2CRMA 5FYJU 3C6LB 4TNWF 1K8DB 4HKZB 4NQSB 4L3AA 1IGJA 3KPRB 2A73B 3AM8C 3RY5A 1MJUH 1TQBB 4ZG1A 3KXFA 4JPKH 4CBPA 3DTXB 1FG2B 4R2GD 1QQDB 5ICYB 3TCLB 3OZ9H 2DLFL 1D9KC 2EIDA 2ZUVA 1PJ9A 1EGJH 1GC1C 3UXFA 2GJ6B 4LSUL 4DVBA 4HUVB 1XZ0A 4WU7B 3BN3B 1E6OH 4JDVA 4OZHE 1R3IH 2EICA 3S34H 2X70A 5SV4A 1JTPA 2Y07H 4XNZB 1BJ1H 4V1DA 1CD8A 3BE1H 1ZT1B 5DYOB 5FYKL 3F62A 3Q6FB 3NCBB 2QTEA 2NY4D 1IC7L 4R3SB 4HG4J 5B8CC 1DUYA 3VFNB 4JRYE 1CT8A 5A2LH 3OPZL 5D71H 1R5IA 1VPOL 2AKRB 4JPIA 1D5IH 4K8RD 4LLQB 4OSUH 2OQJA 3B2UD 1LK2A 3MV01 4JFDE 3AY4C 1NEZB 4BSJA 4DZBB 4DN4H 2PCPA 4GKZB 5ACLA 4U6XB 2MCG1 4NDMB 1KJVA 1QHOA 1RZIA 1T04A 4NRYB 3HFML 4MD0B 5KVGL 1NC4A 3OGOE 2NY5L 3LV3B 1T83A 3I02B 1Q0XH 3SY0A 5LXGL 1Y6MR 3UJIL 4X7DC 5D6DA 1R3KB 1BM3H 2MQ3A 2NCMA 3MFGB 1OAXH 3EO0A 2CLZB 4ISVB 5HVHB 1RD6A 4KQ3L 3FAXA 2RCSL 2IF7A 1UCBH 1UB5B 4CNIA 3F7VA 4UIKH 5DEZA 2CK0L 2XY1A 4G42B 3EFFB 3WL9A 1GZPA 4XXDB 5SWQA 1PY4A 4RMRA 5EH1A 4OJFH 1AIFA 2YD8A 4QOKB 4XWGL 2J8UE 4NKDA 2DD8L 2SEBB 1H3WM 4JRXA 2DLFH 1A6AA 1BQHG 4R2GC 3TF7C 5K9JH 4LSUH 3BP5B 3MRIA 4NOFA 4LSSH 3M1BB 1G9NC 1EH9A 2QHLA 4HAGA 4O2FB 5FYKH 1N5AB 1CFSA 2V5YA 3L3DB 1A6WL 3UDWA 1IC7H 2ILLA 5KSVB 4PRHA 1U8OA 4DEPC 3OKNA 1ORQA 2NY4C 2J5LC 1KCLA 4NO0D 1T0NB 5F1NA 5J1AB 3E3QC 3O3AA 2BFVL 3L5XH 3OJMB 1CXFA 4NZDA 3VFRB 4XCNA 5I9QB 1VPOH 3JXAA 3Q5TA 5KSAD 4Y8DC 4PJXF 2VQ1A 4S1DD 4K8RC 2P44B 2ED7A 4G8GA 2G9HB 3B2UC 4HIJB 3ESVF 1EEQA 1MHHB 3KPRE 3RL1A 5KVGH 3O2DA 2NY5H 5KS9B 3RNQA 2BNQA 5J6GA 2AV7A 2IQAB 2WBKA 3VJ6B 3UJIH 2R2BB 3CIQA 3QEQD 5CBAB 4HWZA 4UDUB 1N0XL 2GJ6E 1Q0YH 1JGDB 1YN7A 3QCVL 5L8JB 4P59H 4YBHA 4TVPE 5FYKD 3DI2B 4MA3B 3FMGL 3OG4B 4JM2A 1NUGA 2VLRD 3TO2A 1DQDL 5GRYA 2H32H 4OGYL 1FFPB 2HAZA 4I0PA 4LHQB 3KWWA 4XP4L 3BKYL 4TSBH 2DD8H 1U8NA 5JUEL 3SKNB 2H45A 4HUXB 4QXGL 3ZE0E 4YNYB 3KVQA 4AZ8A 1FO0L 2R4SL 4R96B 3L3OB 3MRDB 1SQ2N 3BEWB 1XF2B 1DUZB 4H8WH 3NN8B 3GK8H 2DQTL 4YFEA 3DV6A 4KMTH 3TC9A 4I5BB 3IU4L 3H7BA 3BN9D 1J1OH 3P4MA 2BSRA 2ZCHL 3KR3L 1SY6H 4OFYD 1WWAX 3MV9A 1IL1B 4XH2B 5CIPB 2BFVH 1U2CA 4GRLD 1HHGA 4RGMC 3B8YA 1BVLB 3VRJB 3DMMA 4DCQB 3BSZL 3T4AB 3AREB 2P7TB 1S5HB 1YPZF 1S7QA 1CD9B 5KSAC 1JTOA 2CD0A 3TVMA 4S1DC 5FM5M 1GRWA 5EZOL 3HS0B 3MXVL 3NCYS 4QTHB 5J1TC 4QRTB 4M7LT 3IGAB 4E9LA 1IEHA 4P9MH 3ARDB 3EOBA 5FKAB 1E4JA 5E7FA 3NPSC 4LCWB 4CDGC 3VFOB 3D5OF 2OTWB 4IIQB 3T1FB 3KYAA 1B2WL 5L2KA 1PKQB 4Y2DD 4RQQA 3QNYB 3EYFB 2AXGA 2NW3A 5DVOA 1LO5A 1JTTA 4E0RA 4PYHA 3IS0X 3TZVB 1DQDH 2YEZA 4H0HB 4U0RC 2ADGA 3C60A 1ZGLM 3FOLB 1GIGL 3L3GA 1UZ8B 1WZKA 5DD3L 3RDTA 4RIRA 3BKYH 5GJTL 3U4AA 2Z31B 4NZTL 3NIFE 1OB1A 5DZLA 3SOBL 3MRNA 1SMAA 3U6RA 3OKMB 4PV9B 5GGSB 1FO0H 5INCB 3U1SH 4OAWB 2IPKA 3G9VA 3IJSB 4TUJB 1QVOB 1IGYB 2DMBA 4XHJD 1C5CH 2I5YH 3OJDB 2ZUQC 3HCVA 3L6FA 2EEBA 4H26B 1CGVA 4U6VL 2J7LA 1FL3B 2DQTH 8FABA 4WHTA 1X3DA 3LHPL 5HD8D 4YBLB 1CIUA 5KS9E 4MB5A 2NY5C 4KRLB 2ZCHH 3MOBL 5D7SL 4LNRA 2AXFA 2XN9A 3ZE2F 3BN9C 4PG9A 5I74B 2NQCA 4XVUD 1CDGA 1FVEB 1IBGH 5K9QI 1MLBA 3WXWH 5EULV 5C0JA 3GMLA 3NZ8A 4GRLC 3QNXA 5FB8B 4Y4KB 5I1LB 3FN3A 5HYJA 4MA7H 1VFOA 3MXVH 4PS4L 3T09A 4Y19A 3VXMD 1FH5L 4M7ZB 5TH2B 1X5JA 4Z5RA 4U6YA 2FH6A 5MENA 4ETYA 5C0CA 4QHNA 4LMQE 4WCYL 3SGJC 5CEZE 3WS3A 3ZYIA 5HHQA 5F89B 4RRPA 4IDLA 1QLFA 4X4ZA 3PABA 3P0YL 1B2WH 4XCYB 3X13B 1T5XB 3I3EA 1HHKA 2CJUL 3DX8B 1JGUL 4Y2DC 4RNRA 3BPOB 5JQ6L 5AUMB 1AD0A 4U2ZA 1F3JB 4H8WC 2IH1A 4MJ2A 3SE8H 1K8IA 1IM9D 4JJHA 1ULVA 5FO7B 3P4OA 1GIGH 4LLVB 3SJVB 1SJEA 1ZA6A 4GJTB 4JAMA 5GJTH 2IQ9H 4PTTA 1A0QL 4NZTH 5CWSB 1ZLUH 4U1NB 3LRSB 2Q6WB 4NC0B 3RY6C 4LCIH 4YPJA 3VFWA 1QR1A 4TTGA 1DBBH 3CVHA 2EDXA 5D9SA 3HMXA 4PGCA 2E7HA 2YPVH 4E5XA 4KUCF 2DYPB 1W72A 4U6VH 1OY3B 3QI9B 4XHJC 5CZVL 3IJYA 3EHBD 1BQSA 2GYSA 3KPMA 3OR6B 1NBZA 1TENA 5HD8C 4LCWE 1H3TA 2FEEI 4CU8A 4WFGE 4W4OA 43C9B 2JJVA 3FFCB 5HI5D 4QT5A 1BVKB 2WV3A 1ERNA 4WRLA 4FTVD 4XVUC 2GITA 4MDIB 2BVQA 1W72L 1AP2B 2BC4A 5SX5H 3VGHA 4FFYL 2BVOB 1OHQA 4LVOC 4PS4H 3B3IA 1PYWB 1FH5H 3U36B 3ULVF 4ENED 5IW1B 2KDGA 4HUWB 5DTFB 2VZTA 2X4PA 3HC3H 2G5RA 4WCYH 5D2LF 2B4CL 3VFGL 1YMMA 5C9JB 2E7LA 1WWWX 2VWEE 1D5MB 2VQTA 5F7MC 4LP5A 3MYJB 1KJ2L 4OCSL 2QR0A 2CJUH 4JFZL 1JGUH 3OAYH 4S10A 3GRWH 1VFUA 1W0YT 3VU2A 3IETA 4OZIF 4KY1H 1V7ML 3V5HA 5J57B 3DYOA 3CVIL 5JIHA 2OX5A 5DMIH 3QUZB 5GS0L 4QLRA 1WIOA 3EYSL 3IDXL 3DXAB 4M5ZH 3I6GB 3OF6A 5F96H 4R8WL 3QHZL 3T8XB 4NWUL 1JRHL 3KPPB 3KAAA 3RHWF 5FYKU 4PGJA 1GOHA 1NDMB 5TE6H 3ZL4L 1I7ZA 1TCRA 5CP3H 5L7XL 2FWOB 1A1OB 3V6OE 5I16A 1O7VA 1WBYA 5C6WH 1SBSL 1T1XA 2R23A 3JV6A 1F00I 4IOFC 3V7MA 3EHBC 4ZXBD 3MRCB 2HLFD 2QQNL 2YD6A 5C86A 4TTDD 4Z95L 1A3RH 5DSCA 1JNHA 1JPFB 3C5ZD 3VI3F 3G04A 3SO3C 3EJZD 1MI5A 2DJSA 1S5IH 2HA1A 3HNTL 1G6RA 4UTBL 5CSZA 5HI5C 1Z9LA 5ITBL 2PW1A 2YXFA 4FFYH 4X8XA 3RGVA 1FLTX 5EZLA 4NN6C 1ONQB 3OJVC 4FQ2L 3NVQA 2X9XA 1DANT 1AQKL 3SJVE 1B4JH 2X1WL 1MFAL 2V2XA 1X4XA 4JFPA 4ENEC 2JB6A 1R3HB 1I8IA 5IVXA 3EOAA 5EU6E 4OV5B 4P23D 3TA3D 2NPLX 3SEPA 5J11C 3CFKA 3A6CH 1OTTD 2YPKB 3TH2T 1KJ2H 4MQTB 3QG6A 1UWGH 4JFZH 3THML 4XMKL 3GMQA 4YIQB 2YRZA 2W0PA 5I0DA 3DRTA 3EDEA 4NHUB 5DA4A 2XOTA 5E6IB 3MNWA 3TWCL 2Q3AA 1TZHA 3ZDZF 1FGVL 2WQ8A 1V7MH 3ARFD 3K0WA 3T77A 1X44A 3CVIH 3K74B 2HJKB 5GS0H 4P2QB 1U93B 1KB5L 2BOCB 3EYSH 3IDIB 4X99A 1R24B 4GH7B 2A9NL 4X4YA 4ZNEA 1JRHH 5B21A 3GI8L 4CU7A 3BQUA 3BO8B 3UJTH 3CCHA 3D69B 3ZL4H 3B4NA 5L7XH 5DJXA 2CIKA 1MHCB 3T0BA 3MLRH 3BIAX 1V7NL 4WDIA 3L5JA 1T22A 1QFHA 1SBSH 5CJ5A 1P4BL 3LKOA 2QQNH 4FQHB 4K2UH 4TUKH 4X6DE 4Z95H 4CW1B 2MOVA 1WEJL 2HLFC 4ZFZA 4TTDC 3C5ZC 4MYWB 2NLJB 4XP5L 3IVKB 2J8HA 4UTBH 3EJZC 1MJJB 4NYLA 1LMKA 5CJXA 1L6XA 5ITBH 4EIGB 2DLIA 3BVNA 4X4XA 3W81A 4G8EB 4WU5A 5F7UA 2GY7B 3IFNL 1U3HA 1FBIH 2J8OA 4NWTL 4PJEF 1TLKA 4EUPH 1J86A 4JFXA 4X9GA 1AQKH 1F6AB 3BP7A 5GS0D 4D0CB 2WZPD 4MXVF 2GFBA 4F2MA 4HK0A 2CLVA 3DXAE 3K4AA 4NJ9L 1H8SA 4AIZB 1DVFA 4K3DL 4K94H 2EIEA 2A2QT 1IT9L 2VLKA 1NAMB 5ICXB 4WUKL 3HE7B 1ES0B 5CZXD 4P23C 3TA3C 1J8KA 3MPCA 4XMKH 4YHNB 1OTTC 2IAND 4QHKJ 3CXHK 3BESR 4YHZL 4DGVL 1E4WH 3SDDA 1JYNA 3KDMB 5DO2C 3O3BA 2P24B 4BJLA 4EN3B 2X4SA 6FABH 3OKEB 4ALAL 1FGVH 4GMTL 2FGWL 3UTPD 1KXQE 3HZKB 5I8EB 43CAB 3FQRB 4NC1E 3ARFC 4PLKD 1ZHBA 5DMGD 3EYUH 1HSBB 4S2SB 2A9NH 3PGFL 1ZTXL 4B7LA 1FNHA 3GI8H 1UJ3B 3STZB 1M7DB 5EDXA 5I1AB 4ODSL 4DVRL 1SJHA 2DS4A 1WTGT 1JZ4A 1HH9A 2OSLA 3TO4A 1U8IA 2X4RA 3LKQA 4P5TA 2Y7QA 1YNTA 2W07A 1AHWA 4DGYL 5D93B 1CXKA 1LNUB 1P4BH 4OCLC 4WW2A 1RJYB 4ZAKA 3VXUA 1YDPB 2QKIA 1P4LB 3ROLA 3S4SB 3K80A 1RY7B 4WHYH 2VLJA 4X80L 1L9MA 4KC3B 4XP5H 2MNUA 5D7IF 1T1YA 3VDAA 1CGTA 1RJCA 5HHPA 2P1YA 4LU5H 3IXTA 5I71B 3FO1B 5HTSA 4WTXA 2A6JB 1QA9B 5TQ0H 3QQ9C 1T0MB 2V2TA 1KLUB 3PHOB 5IOPA 4MMZC 4OCRL 2M2DA 1DQLL 3EAKA 4P2QE 5JA8B 3MR9A 3FAWA 1J05A 1H5BC 3WDHA 4JHZA 2IBZY 4K3DH 1KCVL 1KELL 4OCYL 2O5ZL 1QNZH 4W68A 5IV2A 1CTOA 3U9UA 4KVNL 1CFTA 1VACB 4OLZL 5IHUH 2DWDB 5IBLD 4U1IB 5BZWA 4PJCF 3WHXB 1IRAY 5CZXC 3CLFH 4YHZH 1U8HA 3VXSD 4WV1A 4L5FL 5J89A 1TTGA 4GMTH 1F45A 2FGWH 1T66D 4KRNA 3TEUA 3GBNL 5HYQA 1RZ7L 3VMNA 4PJXA 1JFQH 1ZTXH 3TT1L 2J2ZA 3BUTA 4PLKC 4F7PA 3NIDF 3WUWG 5DMGC 2IALB 4ODSH 3FFDB 3CXDL 4LCCC 1I3VA 4QRQA 5JIPA 3IT8D 5DRXA 4PJBF 2OP4H 4X9FA 4UAOC 2I9TB 3QQ3A 3O4OB 4DGYH 5T5FL 4RMUA 1HHIA 5ISZA 4LKXB 1R5VA 1WCBA 4HMEA 3NGBC 3WN5A 1I8LC 3MBXL 5EB9A 1BOYA 1QSEA 3FB6A 1L4IA 2CO6B 4K94C 3QUML 1T3FB 3LN4B 3MRHB 5I1EL 3CFCL 3QIBA 1ZWIB 3MLVL 3QFJB 3O9WB 1WQVT 5DZNA 5E5UB 3ILPB 1MNUH 3VFMA 2E6QA 1CFQA 1I9JH 4O51A 2AI0H 2FLRT 4JZJC 4LPCA 4NQVA 4Y5VB 1DQLH 4HJ0D 4ZODA 2JK5A 4JANA 5IF0B 1CFBA 4RFOL 2OCFD 1BZ7B 4UBDC 4X5WB 3VFUA 5SWSA 3W9DA 2O5ZH 3SDXA 4BFIA 4Q6IA 3CFEB 4Z7NF 4JFOB 1JMZA 5J06A 4OLZH 1BFVL 1HXMB 1IAIL 3U82B 1NFIB 1QFOA 1DQJA 2EIZB 3HR5B 1T4KB 2XWBB 3C8KB 3ZSTA 2B5IB 4YLQT 3L9RA 5IBLC 2GT9A 4NUGL 4L5FH 2X5PA 5E9DA 1NUDA 5TE7H 2V7NA 3KLDA 3AAZA 3D0VA 4Q58C 4G7VL 1FN4B 1WIPA 3FTGA 5K9OB 2GTWA 3GBNH 4LVNC 2YUVA 2A74B 3FONB 4XZUB 3X14B 3BP4A 4YQXL 1YPZA 4HIEA 1CDIA 5EOCH 1UQSB 2IFFL 1SM3L 5HHXL 4U1SA 3W39A 2WIIA 4N0YH 4Q9RH 3SE9L 25C8L 4JKPH 3RZCA 4Z7UA 5HPMB 4HJGB 5I19L 4LLWA 3F7PC 5C08D 5DC9B 4WFFD 3N1MC 4YDKL 5T5FH 3O3DB 5BOPA 2RFXB 2I26N 4GAJH 3O4LD 4Z7QF 3PGCB 3MV8B 4URTB 2YHGA 3MBXH 3WLBB 1K4DB 3QUMH 2XG4A 5ENWB 4WWKB 1NSNL 4PGEA 3Q6GL 5JW5B 3CFCH 4G6FB 3SDYL 3W5MA 3MLUL 3MLVH 3J7HA 1QFWI 1F4XL 4BSVA 1S8DA 1SBBA 4ZDHB 4ETQB 2GSGB 3WEXA 1RZFH 3TN0D 3QDHA 1M7IA 1KLFA 3AB0B 1FNEA 2J4WL 3T0AA 2QQQA 3MZGB 3HI5H 2NTFB 1OSPL 2A38A 2X1XR 2GSIA 2WSKA 2AK4B 4IS6B 3GSNA 5FHAH 2DL9A 4YK4B 4XHQA 1IARB 2CDEA 3PL6B 2LTQB 1F11B 3KPNA 3QDAA 1BBDL 4HJ0C 1C7TA 3EFDH 2IH3B 3JWOL 3NA9L 4U1JB 3RA7H 2WP3T 2DQJL 5D72L 2LABA 4C83A 3O6FB 1T21B 3QNZB 2P5EA 3UZVB 4YXKL 1IAIH 4Y4FA 3G6JA 4U1LB 4NQCB 1R3LB 1XF4A 4L4TD 3FQXA 3GSNL 4HUKB 4ZPVA 5AAWA 2HVKB 4G7VH 1I8MA 3UTTE 2VE6B 3MBEC 4HPYH 1AD9A 2AJUL 5DDHB 3VWKB 3HI1B 5I17B 1SM3H 3QFJE 4F8TA 3QXVA 5SV3A 2OTPA 2EC9U 4G80B 5D70H 25C8H 2F54A 1J8HA 1CU4L 4MNHB 3DGGA 5I19H 2C4FT 3KPTA 4IOIA 1XF5B 1H3UA 5IMMB 2XQYG 4M5YH 3X11B 3FJTA 4D94A 5FYLE 4JFED 2LFGA 3WIHA 4PP1D 1LP9F 1MCLA 4N1EA 3MCG1 4Q74A 1F4YL 4JN2A 3QO1A 1FRGL 4PRPA 4DUXA 4KRPB 3RX8A 1A6TA 2D7OA 1JWSB 4LDOB 4PJ9B 5B38G 1NSNH 3Q6GH 4WEBL 1LE9B 3SDYH 2NX5A 5JW3L 3QEUB 1F4XH 2QSCL 3RWHB 5J13B 4FMFA 5F9OH 5GGRA 3GJEB 5EUOF 1JZ6A 4P3CL 4YC2B 5KSUB 1EEZB 1G7LB 3TN0C 4JB9H 1KJMA 2D7NA 4AH2B 2W9DL 1C08B 4OM1L 3ARWA 4TULL 1BOGB 1T89C 3BZFB 4KMQA 1BBDH 3RWDA 3JWOH 1F3RB 3NA9H 3JV0A 4OI9A 3RTQA 4OZIB 2DQJH 3P73B 1KLGB 4APQA 4GQ9H 3VXRB 2NXYB 3ECBB 2ZCLL 4Z8FH 4S0SD 1DQQB 5B38B 5DJYB 1BP3B 1AGEA 4BH8A 4BK4A 2ED9A 1YN6A 1WFOA 4X0KA 3ARBB 3BOVA 1XGUA 1BFSA 4BQ6A 3MV8E 3GJFB 4N1HB 4YGAB 4H5SB 1G7PB 5F6HI 2PW2A 1NBYA 2P4AB 4N68A 3UEZA 3WXVL 2ENYA 2QADB 3T04D 1YEGH 4OGXL 1IGTA 3FOMA 5HYEA 5TPWL 1CU4H 2OL3A 4C56D 5HHOA 5F1SA 4GXVL 4PJAF 5D2LA 2CLRA 2AK4E 3B8SA 1P1ZA 1RMFL 1A2YA 4PJIF 1FRGH 3GB7A 4PP1C 5JLZB 5FV2A 3UBXI 3DARA 5GISL 5EBWA 2R4RH 4NQCE 4POUB 5EC1B 2W0FB 4GRMB 1AO7E 4P3CH 4DQOL 2XA3A 5HYSA 5HDQL 3TGXA 3QPXH 4X5LA 2AEPH 2F19L 1KT2A 2W9DH 1II4E 1VGEL 4K7PX 4MJ5B 4NFBA 4TULH 1V3JA 4QKXB 5F6IC 4IRSB 3RVWD 3UPRB 4HKXB 5MI0C 3GSQA 1KIQA 4IM8A 4X6CA 5GS1C 2VN4A 2VDRL 4I3RH 2F74B 2J6EH 1U3JA 4HCRL 1P6AB 3C5JB 4FXGB 4M3JA 3TJHD 1RUMH 2EDEA 5F44A 1ODAA 3DUSA 3MTRA 4HXBH 3ZZ1A 5IB2B 5IBUG 5D1ZB 1HZHL 1GGTA 4U3CA 5IB3B 1BD2D 1JHKL 1REIA 4OZFH 2PUQT 2G60L 4WI7A 2R1XA 5FA3B 3WXVH 3GMMA 2GKIA 5CLTA 4OGXH 5D7JD 1CDYA 2H9GB 2M26A 2GK2A 3VXQB 3NFSL 3MRGA 1HHHB 5TPWH 1QPXA 2YUZA 5D2NC 1ZLUK 3HE6B 3RAJH 4X4MA 2FYYB 1MQKH 4J1UA 4GG6A 1S7SA 1XF3B 5BV7B 4GXVH 4K23H 5EBMB 1ZT4A 4ODVH 5I1JL 4LLUB 2APXA 1RHHA 1RMFH 4TPRH 1F90L 4KMLB 1MCBA 1S9WA 1FAIL 4OIIL 1PX4A 2A73A 5HPOA 1P5VA 1TCMA 4MXWL 1TTUA 5IBUB 4OZIE 1LEGA 3A6BL 4PJEB 3NFNB 3DTXA 3JWOC 3TCLA 4LKCB 3TIEA 3VXRE 1A6VL 4LARL 4AM0B 1TITA 4OLUL 15C8L 2XNAA 1CICD 3FB7A 2B0SL 32C2B 2P5WB 4CVXA 3UROR 1GVIA 4RFNC 5HDQH 3S6CA 3BZEA 5GGTL 1MIML 2F19H 5D5MF 4M48L 2VERN 1UXWB 3Q6FA 5SX5K 2XWJA 3ZO0A 5C0FB 5F3BB 1SJXA 3RVWC 1ZEAL 1XT5A 5HBBA 4U1HB 4R7DB 3KPQA 3V0VB 3DBXA 1P4IL 3D85D 4FQLH 4PJGA 2QQKL 4XBGB 4TVPL 4JY6B 2EO9A 2J88L 1GPOL 3FT4B 1G0DA 5HDBE 3HRZB 3ZYOA 3TT3L 2XG5A 3BKCL 1JF5A 3KG5A 5GIRA 3TJHC 1T03L 3AS1A 4GKZA 1IEAA 4MCYB 5L8LB 4JRYD 5DJ2B 2Q1EA 4ZUVB 4KGLA 1HZHH 4NRYA 4ELMF 4MD0A 3OAYK 1NGPH 1X5IA 4HDIB 1RZJL 3LV3A 2G60H 1U8MA 1GXEA 4WTZA 3SGKC 1A5FL 1U8QB 4ZFOA 3MRJB 3EO9L 3L7EA 1R3KA 3NFSH 4GW5B 1AGDB 3WDJA 5D7JC 4JREC 3TPUA 4LASL 2ENSA 4HEME 1I7RA 5D7IB 4J4PD 1TZGH 3KLAA 5I1JH 3IDYC 3QIUD 4I48A 1BFTA 1F90H 3RI5K 3RNKB 1HXYB 2IAMA 1NMBL 4HXAL 4BQCA 1FAIH 3GIVB 4OIIH 1E27A 1KCRL 4QHUA 1W0VB 3ZDZE 4QOKA 4P57B 3A6BH 4ZTOL 2HWZH 3VWJD 4X8JA 4NIKB 5TGBB 1OSZB 2L7JA 3DUUB 4NRZB 15C8H 1NC2B 2VH5L 1AGFA 4CL7A 1BWMA 1CICC 5FCUH 3M1BA 3TYFB 5GGTH 1T5WA 1MIMH 4O2FA 4P2OA 1X5AA 3WDIA 1WF5A 4PJCB 4U7MA 5TDNB 5KSVA 3KYMA 1OF2B 5ADPL 4YX2L 4GUPB 4Y5XB 1ZEAH 1IGFH 1KXTB 4TOYL 5I73C 1T0NA 5KN5A 4UINH 3F5WA 3SDAD 4EIZC 5LAXA 2VMFA 3MJ7A 4FG6D 1FCGA 5C09B 2IPUG 1BFOB 1OL0A 4TVPH 3QUYD 3RQ3A 1GPOH 1AFVL 3BKCH 5T1KA 3P9MB 2R69H 2C3WA 1T03H 3L7FA 4HS3A 4NNXA 5HSFA 4LLYA 4MXQD 3LSOA 4U6HA 5L9DH 2Z35A 3D3VB 1RZJH 5IB5B 2VABA 3IFLH 4JFHE 4J6RH 4PJBB 4PJEE 1KTKE 3ARRA 1A3QA 5IT2H 1S7TA 2Q87A 4MXVE 1BIIA 5FUCC 5CBAA 2E7MA 3FQTA 4CKVX 1HN1A 1C12B 3A67L 1ZE3C 1D9KB 3DROB 5CHNA 3I85A 4LASH 3C6LD 2MJWA 5B22A 3PWLA 1MREL 5F71A 3VMOA 3H3PH 3KPRD 3OKKB 5MERA 1IC1A 3HN3A 2ICCA 3CDGB 1HNFA 4LPWA 4UTAH 2KQMA 3GBML 4J4PC 4HXAH 3QIUC 1KCRH 5JPMA 1KCUL 1XGQA 35C8L 2VITA 5HGHA 1WBXA 1A8JH 3FRUB 1PG7X 3SE4C 3C6SA 4TVPD 3B5HA 3O2DH 3DVIA 1F5WA 1KB9K 4JO2L 3W2DL 3ZDXF 1I3RB 3WKMH 2FX8H 4WUUB 3MRDA 5CD3B 1X5FA 4OT1H 4GMSH 2CR3A 2VC2H 3DSNA 4HV8A 3FKUS 1B0GB 2FATL 3NN8A 1N64H 1FZKA 4KK6D 4M03A 2EDRA 4HMDA 1A6UL 5JDSB 2ICWA 3CNKA 1UM6L 2YWZA 3UJJH 4I5BA 1OW0C 5CEZL 1G7HA 2VDML 5ADPH 5IWLA 4YX2H 3MLXL 5E03A 5CIPA 3GMOB 3BWUC 4NSKB 1NDGB 4UMGA 1SVCP 1RJZB 5I75B 5DURD 4YDIH 2X4UB 3T4AA 5BZDB 3KNBB 4MJIA 4I18A 2E9WA 3MJ8B 3IXAA 5D7IE 3RWEB 4FG6C 4JVUA 2ZKHL 4C4KT 3QUYC 5E2UL 1EXUB 4M7JL 1FNLA 1OAQH 3OB0H 1CLCA 2XV6B 5E6ZA 1HKLL 1UM4L 2Y23A 4HKJA 4MD5A 3PWNB 5DQ9B 2DN7A 2HJFB 4JHWH 4XNXL 4KQ4L 4MXQC 2V17L 5T1LB 3SKMB 3UTQB 1YYLL 4X98B 1OGAA 3LS4L 3VRIB 3VFOA 4J3XA 3MGTA 3O3EB 5BRZE 1PKQA 4QXTA 3MV7A 1KF9B 1T83C 3QR2A 3JVGA 3EYFA 4UUJA 4M61A 3OMZA 4CADB 5KVDH 4OIBA 1N5YH 5D6DC 3DO7B 3HPLA 5DD5L 3S3SA 4XVSL 4HLJA 3GBMH 4PJCE 3H6JA 1TQBC 3RVVD 1T1ZA 4PUBL 4JM2D 5DEFB 2EYSB 4P9HL 5F1IB 4D9RD 1KCUH 35C8H 2YD4A 4AENA 3PDGA 3QYCA 3WV0A 3L3HA 3T08A 5ERWA 4DEPB 2VAJA 1Q94B 1GOGA 5L8KB 2NY4B 3HI6H 2J5LB 2KZWA 4G8IA 4PV9A 1HCVA 1X6NA 4JO2H 1T7XA 3C9NB 4OAWA 3HAEA 1IGYA 3MUGB 5GRJL 1D6EA 5IK3A 3NIDE 5IROC 3CFJB 1H3GA 2FATH 1I3GL 4H20L 5DLML 4HHAA 3V4UH 3D3VE 4L1DA 5MEQA 2EH7L 3WD5L 4KK6C 5HGDB 4PJBE 1ZLSL 2VDMH 4FFWD 4XP1L 1CI5A 4PJDF 2XXMB 3BH8A 1ZANL 1F97A 2C7UA 2D9QB 2NY7L 3UO1L 4PJ7A 2AJVL 1TDQA 1MLCA 4HIHA 1FL5A 2GK0B 5IGXL 1DN0A 2FEDD 4JZNB 1X5YA 5I1LA 1U91A 5E2UH 5C0IA 4KDTA 1JYWA 2HG5B 4MB3A 3QSKB 2C3XA 3ZHKA 1JF1B 1HKLH 1UM4H 1HH6A 3CZJA 5IIEB 1INDL 2HLAA 4EZMA 3L3KB 2BHUA 2DWEB 2V17H 1YYLH 1PEWA 1PD6A 2VZUA 3BMVA 2Q7YB 2D03H 3LS4H 5F89A 5F1OB 3VGAB 3TBTA 2WBJA 4CVZA 4XCYA 3HUJB 4WUUE 3BRDA 1MCQA 5EBLA 2RIKA 1Q1JL 2DKSA 5L2KD 4Z7NE 4JQVC 4JO4L 1M6OA 3RWCA 4MQXD 2Z8WC 2DM3A 5DD5H 4XVSH 1UVQA 2VLLA 1N59A 1JHTA 2XKUA 4KROD 3FT2B 4K3EH 2EZ0D 1BWWA 2EE9A 4P9HH 2FIKB 3QCUL 4OF3A 4KHXH 3RVVC 4JM2C 4NQDB 2A83B 3DHMA 1GOFA 3LRSA 3ROOB 4YHMH 1JZ7A 3VDBA 1NBVL 1I85A 1T7VA 4PGBA 4M9PA 1JWMB 2OJEA 2NMSA 1LD9B 3CUPB 3CSYB 4RGMB 5GRJH 4JGMA 5EO1B 4K07A 3QG7L 5D1QA 1B0RB 4H20H 1RZ8A 5LCVL 5DLMH 3QI9A 4ZPTA 1T2JA 3WFHA 2EH7H 3WD5H 4JDTL 3HKFA 1DE4B 1ZLSH 1KTLB 3PDOB 2BDNL 3K8MA 3WKNA 1IQDB 5HVFB 3M17A 43C9A 4Z7QE 1JNNL 3DGCR 2X4OB 1UADC 3FFCA 1KIPB 4MDJB 4Z7WF 2XN9D 3QBTB 4ZO7A 1E4KC 1YEEL 1IJ9A 3FQUA 2ARJA 1N26A 2AEWA 2RGSA 5ESQB 2BVOA 4ODHH 1OP9A 1HEZA 2FEDC 4LCWD 4RAVB 1PYWA 3CVHH 4Z0XB 3V5KA 2X4TB 3PQYB 4GOSA 1RAMA 5C0AB 4WFGD 1WBZB 4C55A 5HYJD 5IW1A 5L88L 2MCPH 4IRJA 5K93A 1MSPA 4Y16A 4G9FE 4NFCA 3QQ4B 4PJAB 5C0BA 3K1DA 4MAYD 1NCDL 4JZOA 2E6PA 3KPLA 3DVFA 4I4WA 3RIFK 3VCLB 4PG2C 1I1YA 1Q1JH 3ORJA 2GCYB 4WHDA 4I8DA 3WFBL 2FL5B 5FK9A 3AXLA 4JO4H 5CGYD 2Z31D 4JPWL 2ZUQB 4O58H 5C70A 3C08H 5ALCH 4MQXC 4DN3H 1JL8A 5KSBA 3SBWA 1TPXC 4KROC 1ND0B 2EZ0C 2D31A 4GAYB 4GW1B 4OQTA 2HFFA 1JWUB 2BNRB 3GMRB 5F7DA 1NBVH 2HJLB 2JB5L 4AT6A 1WZLA 3KPPA 4XPBL 5CGMA 4O00A 5A16A 5ETUB 5E94B 5H94A 2EECA 1OQXA 4FQXD 4U49A 3SCMB 3QG7H 4GRLB 3OX8B 3CH1B 3DYPA 5LCVH 3ARZA 1JRHI 4ZO6A 4GO6B 4JDTH 3ZT7A 3MMEA 3MRCA 1DZBA 2H1PL 3EKCA 2BDNH 4BA8A 1JPFA 2OJZL 1JNNH 5DS8A 1PG7W 3HUJE 5FDWA 4D0DB 3ESUF 3IF1A 2X7LB 2AJXL 3LKPA 7FABL 1QO3B 1SEQH 1MHPH 4RZCA 3RU8L 4PJIA 1GGIH 4F33B 4L8DB 5BJTA 3CDCA 1KPVB 4P9HC 2CQVA 3F58H 4NQDE 5FF6A 4IIQC 2AK1L 1I1CA 1PBYA 1G7IA 5C0DB 1IAMA 4L3CA 2RB8A 3L3IB 3TBWB 1NCDH 1HK6A 5D7KE 1J12A 4LF3B 2XIDA 3IFPA 4MAYC 4D8PB 1T20B 3WFBH 3VXOA 5ALBL 4OLXL 2X09A 2EC9T 1G6RH 1NAKH 5CGYC 4NGHH 2WMPA 5EU6D 2EEDA 3MODH 2DJUA 2Q8BL 3N1FC 1BQLL 1BJMA 4P5KB 5B3NA 5J56B 2DRUA 2VWEC 2DQCH 1GZQA 5B39A 1R24A 1U36A 2VR5A 1F3DH 2DYPD 5IR1B 2JB5H 5DJ6B 1FLRL 4XPBH 3OKOA 2AJZB 4PJ5A 1RUQH 1WLHA 4EOWL 1LQSR 1FVCB 4MS8D 3GSRA 3GHEL 3BHBB 4YWGL 4YBLC 3PQYE 1JP5A 5C0AE 1IC5L 1NCCL 4FQXC 5DA0B 4LVOB 2VIRB 2PYEA 4O02L 3LKNB 3MFFA 4PLJD 1FNGB 1QLEL 4RAUB 4PP2B 2AJ3B 1FZMB 4LGSB 2YSSB 4PJAE 3WFCH 1Q9OB 2Y06L 5C7XL 3EGSB 1OAZH 4WFHD 5E99L 5I1HL 1JNLH 1HINL 2WK2A 5DRNA 1AXSB 3I50L 3QJFB 2WM0A 1XIWA 2AJXH 2ZJSH 3JSSA 4W4OC 1AI1H 1J10A 3LPFA 4G8EA 1MCKA 3RU8H 4RMWA 4M7LL 3FB8B 5JR1L 5C07B 1NFDF 5I66A 5IG7A 5FGCB 1T1WA 5LG1A 3MLSL 1FNAA 1LEKA 5DJCA 5DF0A 3QB7C 1IM9B 2BNRE 4AIZA 3HNSH 3NIGF 3T0DA 1P7QA 1PLGH 5E8PA 2R1YA 3GSVB 3H9HB 4AEEA 3LIZL 2FO4A 4HGMA 4YFLI 1YZZA 4EI5A 4NC2B 4OZ4B 3QUZD 4OLXH 3H9SA 5EFIB 5JNYB 2P24A 4JRWA 5IMOA 4XWOD 3ZTJG 1SYSB 1ZA3A 1HIMH 5I8EA 2DTMH 4X7CC 2HRPL 1K6QH 4YXHL 1EEYB 2CIIB 2XRAL 1NAML 5HJ3A 5AZ2L 3CZFB 4RDQF 1HSBA 4S2SA 4M9OA 3WMSA 4P2RE 3U46A 1UJ3A 4KJPD 5HDOA 3STZA 5CCKL 5KTEL 2VDQL 4EOWH 3N50A 4X9BA 3RWGA 3UPCA 4TYUA 2EDHA 2CGRL 4ELMA 3EJYD 3LPWA 4FTVB 5EU4B 1NCCH 1J1PL 1JHLL 4O02H 2OXGA 2YMXL 4KI5D 4MCZB 4PJHB 2O61B 1TZIB 1P4LA 2Y06H 5C7XH 3EYVB 5I1CL 4WEMB 4Y1AA 5I1HH 3MACL 4LIQH 3LKSA 3I50H 4GXUM 3V8CA 1C1EH 2A6JA 5ANMB 4PPTA 5DD0H 1QA9A 3GSWB 3P4NB 5CKGA 5DD6B 3QO0A 4HC1A 4ZUTA 3C5SB 1CBVL 3PHOA 1A14L 3EDKA 4ZSOB 1U3HD 4OM0H 4X7SL 3V4PL 1JF6A 5JW4R 5ID0B 5D5ME 4G6KL 1IC4H 4H1LG 5EU5A 4LRNH 4ZUSB 2VDPH 5DT1H 3L1OH 1RUKL 2E7CA 4DKDC 3LIZH 4F7MB 4HX1A 2DWDA 2VLKD 4U1IA 4RMSA 3WHXA 5IKCB 4XC3H 3ZYZA 3PWJB 4P2QD 4KV5F 4JY4A 4L4VA 3WYRA 3CD4A 2F53B 3QUZC 5E56A 2RAMA 3SDDD 1S7WA 3IDGB 5CUSL 4K55A 4XWOC 2HRPH 4YXHH 4CDHA 3DPBA 1I1AD 4GW4B 2IBZX 1U8LB 4DKAA 1LWRA 2BY3A 5H37G 1DR9A 1N8ZA 1S7VA 3C5ZB 1MVFA 4FQCL 4H1LB 1R3JB 1XCQA 2CGRH 4KJPC 3VH8B 5E00A 4R90L 1R5WA 1RULH 2YRPA 3ARYA 1QP1A 3N1PC 4PBWD 3NH7L 4EVNB 3V7AE 1S7XA 5C07E 3BQUC 3GIZL 5FGCE 3EJYC 2YMXH 4NC1C 1UGNA 3HMWL 1CYGA 1XFPA 5L2JB 3UC0L 4BQ8A 2Q76B 5I6XB 4KI5C 1H0DA 4OTXH 4ZAKD 3VXUD 5GRUL 3BH9B 3VD9A 5F7LB 2MFNA 2UYLB 5FCSH 1BREA 3FQNA 3MREA 4JFFE 4UT9L 2MSPA 3PV7A 5IHLB 4DK3A 2DM4A 3EYOA 1DEEA 4P23B 3TA3B 3MNVA 3ILPA 1RI8A 4BUHA 1A3LL 3E6HA 1E28B 1FHGA 3LN5A 2XQBL 5IJVB 5DK0B 4RGOL 1A14H 2X6MA 2BY2A 2XZAH 1NCAH 2BERA 4O2EB 4NQEE 4Q2ZB 3PDDA 3HE7D 4LCUA 1T2QL 1FJ1A 1BZ7A 1I8KA 1U3HC 4G6KH 4BK5A 4OF0A 3ARFB 1TNNA 3U2SB 3MJ9L 4EN3D 1FNFA 1RUKH 1AXTL 3U9PH 4GFTB 3KPSB 3PWPA 4ZOCA 1GCFA 1CLZH 3W0WA 2ITCA 3QUKA 1PSKL 1DBAH 4YR6A 3BGAA 4CVUA 1KEML 1W2KT 2FRGP 5CUSH 1FN4A 3ALXA 1G7QA 1IAII 4Q9QH 4O9HL 1KCSL 1A7RH 5TFSH 3WJJA 3S97C 3SDDC 3WNOA 5J1SC 2PTTA 1IAKB 1N3NB 3G5XB 3VE0B 1UH4A 3PF2A 1S3KL 1KPUA 2JJSA 1I1AC 2ADFL 3V52L 3D6GA 3M8OH 5ABDE 4YUEL 5CBEA 3T0EA 4KU1A 4R90H 5E5MB 4JPVL 1NL0L 1GGCL 2VDKL 3S3JA 4K3HA 3RBGA 2BJML 4JKWA 4ZSOE 4XP6L 3GIZH 1XGYH 1NGYB 3WFDL 2W65B 3HMWH 2OR7A 3UC0H 5FIEA 3VFSB 3WBDA 4P5TC 4QRPA 1AHWC 1M71B 2H26A 3NACH 1H5BB 4WWKA 5H8DA 4BH7B 4ZAKC 4UT9H 2APTA 2CRYA 3V79C 4A6YA 4U1MB 4QHLB 4ETQA 1YEHL 1UEMA 4PD4J 4ONGL 3BDBA 3ZDXE 4EUPG 3P3YA 2UV3A 2CUIA 2F53E 2XQBH 4D2NA 4D0BB 2IANB 3SPVB 4GAGL 3LQZB 5FOJA 3PL6A 1T2QH 3GKZA 1P5UA 2DOCA 4M62H 1EIBA 4HAFA 4N5ED 1YC8A 1NJ9A 1T21A 1RURH 2N56A 1OAKL 1EFQA 1KFAH 5AWNL 4EN3C 4AL8L 4YGVB 3S36L 1NANH 5ADOH 4LCCB 4KRMB 4M93C 2B1AH 3JTSA 3EZJB 1KEMH 1C16B 1AJ7L 5FYLH 4Q7DA 5F3HB 1MCSA 2R0LH 1J1XH 2CDGA 3KYNB 4O9HH 5E9DD 4EUPB 5F8RC 3DVNA 1KCSH 5E8EA 4XC1L 1VADA 1OTUD 4WV1C 1ORSB 4ODUB 3P77A 5I17A 1S3KH 2I24N 1AKJA 4JFYB 3V52H 4O5LL 3U0TB 4LSQH 3T4YA 4YUEH 2B7DT 4S11A 2ICEB 3GHBL 3B9VA 1OLZA 1N7ML 1KV3A 2DQFB 5IMKA 1AGCA 2VZSA 2ICWJ 3UTTD 1PKOA 2XYCA 2ZNXA 1NL0H 1GGCH 4CJ1A 3QA3B 3S96B 4EBQH 4C57C 4NUJB 2NY1D 3WFDH 3ZDYF 4OZGF 4H25A 3QFJD 2Q86B 4WHYG 3O9WD 2JTDA 4OFKA 2IFGA 2V7HB 1XEDA 5CJQH 4L8BA 1XR9B 2MWCA 3RWFA 1JWSA 5I71C 4PJ9A 3GNML 3NTCL 5BS0A 2VOTA 1N2RB 1ETZA 3QEUA 3ZE1F 3KPSE 4LHUG 5IHZB 3WN5C 1YEHH 5JXEA 5EIVA 2HT2D 4ODXA 5FYLD 2DL2A 2AXHA 2OZ4A 3B5TA 4ELKA 5KSUA 5M7QA 1G7LA 5EIQA 4Y5YB 3SKOB 1F6FB 1X9QA 3MRRB 4GAGH 4NKOB 1MRCL 3VXSB 4HKBA 3ZHLA 3OB0K 5IVZB 3K2UL 1U6AL 4JHAL 4LVNB 5GRVL 3SE3A 3MCLL 1MJ7L 4I0KA 2FJHB 3RPIB 4PJDE 1KLGA 2CKBA 1OAKH 4N5EC 5GGQH 2W38A 5AWNH 1HDMB 2FX9L 3H42L 4AL8H 2XPGB 3BEVA 4QHKI 2ZPKL 1QBBA 2Y5TB 3VI4F 3TCXA 4Y4FD 4F58L 5I18L 4LHUB 3V5DB 5HXMA 5LGHH 1AJ7H 2KQNA 2VN7A 5TJWK 4R0LB 4X83A 1EFXA 5I76A 2GAZA 4MNQB 4XC1H 4ZMAT 3KLHD 4H5SA 3O41A 3PXHA 3VGEA 4XRCB 5FM8A 3IDNB 4LSTH 1OTUC 4O5LH 4CMMB 1JGVH 3DX9B 5C8JB 3MRMB 4PY8J 3OQ3B 4HWBL 3QDME 1JMXA 3CPLB 4WI9A 5DGRA 3MV8D 3MRBA 4EI6B 2IBGA 1P84J 5IB4A 1UA6H 2IANE 3RWIB 1FSKC 5E1AB 4JY5L 1KG0B 1SYVB 5KVFH 1NLDL 2NY1C 4ZQKA 3W9EA 1DQMH 1MCHA 5DRWA 5JLZA 3V6ZA 1OQOA 5CSGA 3GNMH 4HS8L 1UH3A 2CUMA 5DEGA 4UDTA 3MRFA 2HKFH 4FQQB 2R2HA 1PG7L 2H2SC 1RK0A 3LRHA 2AK4D 2NX5D 3QJHA 3QXAB 5EC1A 4GRMA 3REWB 5I8CA 3G6AB 2XWTB 4ZUWA 4MNGA 4Y5VC 3RWJB 4XPAL 4P3DA 2ESVA 1H15A 1U8PB 1FV1A 4MJ5A 4IRSA 3ULVH 2O5YL 5I1DB 4GQPH 3VA2C 3S35X 1S78D 3MBEB 5IEHA 1U6AH 4JHAH 2UUDH 1CG9B 1J18A 5EORL 1Z5LB 4MJ6A 3V95A 3BI9X 1NGZA 4YDVB 1AO7D 1U95B 5F21B 2X1QA 2YPLE 4PR5A 1MRDL 2F74A 2G5BB 5DR5L 2W0LA 4F9LA 2FJGB 2MPAL 3O81A 4FXGA 5IFHL 5KOVC 5TE4H 3WCYA 4Z7WE 2ZPKH 2YD5A 1VERA 4KUCD 5I18H 3AMKA 4WW1B 2R8SH 3VWKD 4WO4A 4NO2B 4Y4FC 3QXDA 4N0UA 1D6VH 5CINH 5C08B 1RZGA 2LAAA 3KLHC 4KKBD 1MCFA 3WLWD 3K2MC 1Q72H 3O4LB 4D9LL 2VISB 2N7BA 1ZS8B 2PTUA 3HZYA 1A7BA 1HHHA 4ZFGH 1UFUA 1VFAB 1KYOJ 1T6WA 3F12B 4QRRA 3MV11 5J3HC 5JORB 1YEIL 1XF3A 4PGDA 3GJFH 3CFDB 1MFDH 4KRPD 3ULVD 4QRUB 1E0OB 4JY5H 3VXSE 3TPKA 1FG9C 2P8MB 4UQ2B 4JQXC 4IRZL 1F58L 1T0PB 3VGFA 4L8SC 4HS8H 4D3CH 1T2XA 3Q3GA 5E70A 2YBRA 4AM0A 4YHPB 3AB0C 5D6CB 1PG7H 3LEYL 2HYMA 5GGUB 1I75A 2VZVA 3HLAB 2E27L 5BV7L 1H9VA 2P5WA 1C5BL 3IDMA 2HKHL 5BMFL 5J12B 1MVUB 5DQJA 5SX4H 4KHTL 4XPAH 1YNKL 4NKMB 4N8VG 5SWZB 3LH2L 3L5HA 4JN1L 1UXWA 3EO1A 4MNQE 3BWAA 3VXRD 2O5YH 2NXYD 3MLPA 4ERSH 2XZCL 3G08B 2R9HD 2DI9A 3FO2A 1MELA 3R06A 4R7DA 1ADQA 4MHHI 3P11L 4NM4L 5DJAB 3CH8A 2Y1VA 4P4KA 2VTFA 1J0ZA 1MRDH 2DBJA 5DR5H 3F6LA 5DRZB 5KZCD 2MPAH 5IFHH 3RL2A 1QSFA 4HS6B 2NY2D 5EN2A 1DLHA 1YEDB 1N0LA 3MUY1 4R4BB 3UTSB 1VENA 2CO7B 3VWKC 2NNAA 4N8PA 3IJHB 5IBTL 1RHFA 4HDIA 4RWYL 2R0KL 4N8VB 5INDB 3MRJA 4RX4A 4JFEB 4D9LH 1ZLVH 4AIXA 2QSVA 3O6LH 4KKBC 1FYTA 1WT5A 3WLWC 2P47B 4PRNB 1KJ3L 1E6JL 4EDWL 3QEHA 5E4EB 1NFDA 1YEIH 2DLGA 1UACL 3PHSA 4PTUB 2DBLL 5DJZB 2MKWA 3PWVB 3ULUF 2I27N 3TFKC 2FDBP 3OGCB 2K3TA 1F42A 2VXQL 4KWUA 3ULVC 2HFEA 3QULB 5IFJB 4IRZH 4FZ8H 1PZUB 1F58H 1HOCA 2YK1H 1LILA 5I15H 1DL7L 1YYMH 2JJTC 4RFEB 1P2CB 3WFEH 4WY7L 3IU3B 5MI0B 1KULA 4NRZA 3LEYH 4DAGH 3UYOD 2E27H 5GS1B 3IAQA 5BXFB 1C5BH 1WVZA 2HKHH 5HGBB 5T3ZE 1WZ1H 5JW4N 1X5XA 3PP4L 3VW3L 5DGQA 3EOTL 1YNKH 2AQ1A 1BVZA 2YS4A 4I2XB 5E5RB 1GL4B 4Z7VA 1Z3GH 3LH2H 1GHFL 1EERB 4KVCL 4JN1H 3PGDA 4F7EA 5C08E 1Y18A 4O2CB 1OP5H 4YAQB 4V2BA 4LDLB 2NXYC 4MA1B 1PQZB 3O4LE 4LSPH 2LE9A 2R9HC 4TSAL 3P11H 4NM4H 4UU9B 3BGMB 4LEOA 5EO0A 1VA9A 5FECA 2V5MA 5C09A 1A6PA 2XACC 3STLA 4X7EC 2BY0A 3TM6A 1UC6A 3P9MA 4M8QA 2Z4QA 2NY2C 3BD4A 4E41A 5IBTH 1Z6JT 3BIKB 3CC5B 4XAWH 4C56B 5CLWA 1NEUA 2B2XH 2VLME 3ZTNH 2R0KH 5IB5A 4EXPX 4RISL 4PJ8D 3BKJH 3D9AL 4P4RA 3HE6D 4N9OB 3UTZA 4BQ9A 5FGBC 5B4MD 5B3JE 5CMAA 1D9KA 3NIGE 3BXNA 1RZKL 1MHEA 2DKMA 1KJ3H 1PW3A 3N9GL 4LRIA 1E6JH 4EDWH 1WC7A 4QY8A 2EXWC 4NQXB 4U1KB 4L29B 1P9MA 5SWZE 3S88L 4JFHD 2DQIL 4RFNB 5IW3A 5JHDB 3M45A 4TSCL 5CJOH 3VXPB 2VXQH 4N0CD 1NGWB 1HQRA 4GXUN 4WJ5A 1DL7H 2EYTB 5IESH 5B8CA 2BSTB 4WY7H 2LVEA 4DWHA 3VFTA 5DJ0B 1GC1L 1PDKA 3V6FA 4ZYKB 5JO5B 5D1XA 1I3RA 4YHIA 4OD3H 3PWUA 3BGFB 1SEBA 2E3VA 2FR4A 3UTSE 1KGCE 3PP4H 3VW3H 2K7QA 1DQTA 1WJ3A 3AY4A 1G0YR 4GKNB 4QRSA 2DF3A 4N0FB 1TXKA 2D0GA 4PJFA 1YUHA 4P2OD 3MROB 4XMPL 2EDOA 4CMHB 4ONHA 5GS2H 1CF8L 1K5NA 5BW7A 3BZ4A 4JFEE 1CCZA 3AFLA 3GMOA 4TSAH 3PNWB 3GBLA 3D48R 1ZGLB 1LGVA 3WHE1 5DI8A 1BD2B 2C1PA 5ESVB 3QDGA 1IM3A 4HUUB 4Q0XL 3OR7B 3ULSB 3RWEA 5D7JB 4JREB 1FIGL 2OTUB 4X5XB 5E08L 3ZHDA 4PRBB 2YZ1A 3GDBA 1CN4A 2AJYH 4LFHG 5CAYB 1A4KB 3ZKSD 3IDYB 4OZFG 5HHVL 4BFEA 1Q9WB 5K59F 3D9AH 2C1OB 3E6FA 1F2XK 3VRIA 2EE6A 3E8UH 4PJ8C 1JK8A 4X6BB 1VFBA 1EMTL 4TNWK 1JN6A 5J9PB 5H2BA 5B4MC 4ONFL 4Z76A 3W82A 3QFDA 1V8HA 2A1WH 3S88H 5ECJE 2EDFA 4TRPL 3RUGA 1CICB 5HI3D 1GGBL 1EO7A 4TSCH 5TF0A 4QXWA 5GS2D 2LQRA 2IADB 4OUOA 2ZSVA 5E8OB 4KV5E 4OLWH 1GH7A 2PNDA 4JFQB 3CMOL 4S1QL 5F1IA 5BRZD 4J12A 1NC2D 4N0CC 4OZFB 4JQIL 1OWWA 5I73B 5TDPB 2BCKB 1XGPA 4HT1L 3O8XB 4G6AD 5I30L 3OWEA 1KENH 4XPHL 3D85B 1H3PH 4OF6A 2BXZA 2PR4H 1JGEB 5I2IB 3O11B 4BUGA 2BK8A 1EO8H 2WUBL 3UBXA 4K71C 4DZ8A 4M02A 1IQWL 1XR8B 5HYIA 3SDCA 3DX7B 3NMEA 4P2OC 3FO0H 4M6OL 1EJOH 4H0IA 5GZOC 3HZVA 1FFOB 2JELH 1IZJA 4Q0XH 4Z77B 4NN7C 1CTNA 2YD1A 1EGJA 1AH1A 3KYOB 4K8RL 3OV6A 4LQFL 1FIGH 1EUTA 1EK3A 1NGXB 4JGJA 4MJID 5E08H 3Q0HA 5JHDE 5IMLB 2HG5A 3CK0H 5GSRB 4K7PY 1FFNB 2GQHA 1MPAL 2C9AA 3MCKB 2X42A 3L3KA 5HHVH 1DFBH 1UKTA 1MJUL 1KCKA 1W0WB 2PYFB 2BMKA 3W5NA 4JPKL 2Q7YA 3VFPA 3OZ9L 3PJSA 1BX2B 1ED3B 4CN1A 1JPGB 1YNLH 1EMTH 1OGAD 1U8KA 3MLZH 4ONFH 1R3IL 4P48A 1IGJB 3S34L 4AEIH 5AD0A 2O26U 2Y07L 3KXFB 3QQNA 5BOZG 2W59A 3BE1L 3CFBA 2KUTA 1J0JA 3ISWA 3L95A 4NBZB 5TDOA 3BUYA 2W92A 2JIXD 5HI3C 2RR3A 1XZ0B 4JDVB 2J8UB 2X70B 5GRWA 2A83A 3PG2A 1IFHH 2IGFL 1BD2E 4JQIH 2VZ3A 4V1DB 2B20A 2IEPA 4HT1H 3CUPA 5I30H 1YEKH 4NO0A 5E8NB 5DMKB 1X7QA 3LD8B 1DUYB 1S9VB 4G6AC 5EO1A 1RV6X 3ZT6A 1OT1A 5KSAA 1MWAA 1VESA 3V0AC 3QUYB 3ET9F 2WUBH 3MRLB 4JPIB 4Y5XC 4G5ZL 3I6KA 2OQJB 2W1NA 3RVUD 1S9YB 1LK2B 1DBKH 1Q0XL 1F4HA 1ZVYA 2VXVL 2PXYA 1CGYA 4M6OH 2PCPB 3L5WB 1BM3L 2X4OA 4MDJA 3LEXA 2C3VA 1KJVB 1RZIB 1T04B 2ATPA 4OI8A 1NC4B 3QEQA 4NP4H 2ZG2A 3I6LD 2GTZA 1N4XH 3SY0B 5JIIA 4Z0XA 5IW6A 4N90D 4L9LA 5JPNA 1MPAH 1WBZA 1ZHKA 4I18C 5E8DL 4OJFL 3EO0B 5EOTB 3G5ZA 4K7FA 4WIQA 2DLHA 2VLRA 2HN7A 2VUYA 3HG1E 4Z0BH 4DFHA 1EV2E 4CNIB 1BF2A 3LVEA 5K9JL 3WL9B 1GZPB 5SWQB 3S5LB 2GCYA 2WBJD 2FL5A 3VDCA 4MA8L 1AIFB 2EH8H 4LSSL 4NKDB 5GGRY 1MFBH 4JRXB 1A6AB 4G9FD 3JVGC 3OXRA 1OAUH 3REVA 2Z8VC 1MRFL 3MRIB 2AXJA 2IBBA 4GAYA 1P7KA 2IGFH 5FA4A 3L5XL 5IUSA 2Y72A 1CZ8L 3U30C 5FUCE 1A1NA 2HJLA 4Z78A 1CFSB 4LPTA 2FSEB 1U8OB 3MOQA 5IB1A 4CUCA 1NPUA 4GKSA 3O2VH 3OKNB 1ORQB 2Z92A 3CH1A 5DURB 1Z0MA 2YD3A 5D1QD 4G5ZH 1CR9H 1JZ5A 2MKLC 2VQ1B 2H32A 2VXVH 4WW2F 1NUNB 4PIRF 5I75C 4G8GB 3T3ME 3RVUC 3ZDYE 4OZGE 3SGJA 3RKPA 1Q0YL 5IM7A 2HFGH 1F4AA 3NPZB 3RL1B 4QCIA 4P59L 2F8XC 4OV6F 3G5VB 3CX2A 2BNQB 3KXFE 5J6GB 3MNZB 3LPGA 3TIDA 3ZE1E 4BYHA 4Y2DA 4HWZB 4L8CA 5F7YC 5E7BA 3QIWD 3S8WA 3RJDA 4XB8A 5E8DH 4P5MA 1YN7B 4GBXA 4LLDA 4TSBL 4KDTC 4V1DE 4IRJD 4Y7MA 1SY6A 4JM2B 5AG8A 3MUZ1 4HSQA 3TO2B 1L7TH 1DN2A 1RSFA 1FL6B 3V0WH 1LVEA 1T20A 4I0PB 4ODTL 3KWWB 2B8OT 1QKZL 4MA8H 4YBQD 4H8WL 1U8NB 3GK8L 1MUJA 4NQDD 2WBJC 1KPRA 4KMTL 4C59B 4PRIA 1LDSA 4J8RA 3B9KD 1J1OL 5D7KD 1T6VN 1SY6L 4M6NL 3BPLC 1MRFH 3VGGA 3WO4C 3T3PE 3MZTA 4XNQB 3T0WA 1CZ8H 5MEOA 3DV6B 3BP6B 4J3TA 1RUPH 2Y9RT 1BQHB 1P69B 2X05A 3RIAF 4HBQA 4L3EA 3P4MB 3MV9B 1I85C 4M6MH 1S9XA 4XCFH 4P9ML 1JV5A 1HHGB 1BLNA 3LKNA 3D0LA 2JCCA 5D1QC 1NCBH 3VXMA 5DJDB 4FA8A 5E2VL 3B6SB 2W60A 4UV4L 3R8BB 2WINA 2EDBA 5GS3A 1AXSA 1WTLA 3PQYD 2DM2A 1VDGA 1Q38A 5C0AD 3EOBB 2DQEH 4HZLB 1FO0A 4F7TA 3BX7C 4JRXE 1SVZA 1FIEA 1AXIB 3T2OA 3DYMA 5L2KB 4RQQB 3VGBA 3JBG7 4AIOA 3QIWC 2AXGB 3VGAC 2HVJA 5JHLH 1TPXB 4KROB 1LO2L 1LO5B 2C4FU 2R2EA 1BECA 4E0RB 1CGSH 1ZHLB 2YEZB 3U1SL 3H9HA 4IRJC 2ADGB 3C60B 4PRHE 3SDXF 3L3GB 4ODTH 3RDTB 4RIRB 4EDXA 1C5CL 2I5YL 1QKZH 1LE5A 4CJ0A 2OXHA 4HFWB 4N9GA 2OI9B 2E9BA 4YBQC 3HC0B 4BKLB 3MA9H 3MRNB 3BDYL 2BNRD 4JG0H 3U6RB 4XAKD 1JZ8A 2IPKB 5ESAA 4M6NH 4U2YA 4G8GE 3B9KC 3CDFA 4IEFB 3HCVB 4YFDB 3L6FB 3SCMD 1IBGL 3WXWL 5TF1H 4WHTB 3ARVA 3SBWC 1JIBA 3IRZA 2AABL 4RRPG 2BNQE 1FNSH 2P8PA 2WQRA 4NCC2 2DQUH 3HHRB 4MA7L 4LNRB 4PJ5D 2XN9B 4PG9B 4Z7UF 4FTVA 1HQ4A 3X3FH 4QWWD 5KANI 1MLBB 5LKNA 4MWFA 5C0JB 2BOBA 3ALWA 4EQ3A 3GMLB 4MCZA 3NZ8B 3QNXB 4PJHA 2O61A 4MSWA 4P2RD 5MP6L 5E2VH 4UV4H 3E1F1 3FHAA 5HYJB 4D9RE 5I8KH 4Y19B 3ZKQD 1WWCA 3PUCA 4TNVF 1BJ8A 3ARGA 4U6YB 4XPTL 4MAYB 5MENB 2UUDK 5GRVK 4PV8A 3VFVA 4QTIH 2Z8RA 5ANMA 3WS3B 1WGOA 3SE8L 5HHQB 3GSWA 1QLFB 2JLLA 4NO3B 4HF5L 2WUCH 1WICA 3EDJA 2IQ9L 1HHKB 5ID0A 1LO2H 1ACYH 3IRPX 1YMHA 1FPTH 2XQYK 4JR9L 4LCIL 2IH1B 3B5GA 1NQBA 5T1DH 4HK3N 1HI6A 4QHMA 1DBBL 4HFUL 2FNBA 3P4OB 2EO1A 1SJEB 3MV9E 4JAMB 2YPVL 1WAAA 1Q9KA 3G6JF 4PTTB 1SMOA 4QF1A 4EI5D 3VFWB 3BDYH 4YZFF 1QR1B 2WLZA 4FQXB 3CVHB 4X6FA 3RHWK 4F9PA 5D9SB 3ZT5A 3OKLA 4P46D 3GJFK 3GSUB 2EDNA 3TESA 3P0VL 4PGCB 4E5XB 4HC1H 2AV1A 2PN5A 4NOBA 1LO4H 3IJYB