1U8IB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkwan
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8iB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8iB01
3VXUD 5L88L 5J11B 1DQDL 2X42A 5ESQB 1BJMA 1BQSA 4LCYA 1UWEL 5CKGA 1T22B 5BV7B 1FN4B 1VKXA 3CFKB 1QFWM 4GT7A 2E6JA 5EB9A 5F6HI 2CXKA 1JHKH 5CP3H 3WUZA 5ACZB 5BO1H 2DTMH 1MWAL 4U6YB 5HHOA 3FOLA 1WCBA 2JJUA 3U36A 3ULVE 5CGYD 1NFDA 2NY0C 3E6FA 3UO1L 2HFGL 2FJGA 3R0NA 4FFZL 1EHNA 2RCSH 3CD4A 4F57H 4WWID 5SWZB 4MNQA 2HVKA 5CWSA 2VUYA 1OGAA 3GMQA 4X0KA 3VFWB 3B6SA 3PWJB 2AJVL 3WEXB 2DYPD 3QWQB 2NR6C 1D6EB 1EVTC 3IAPA 1JI1A 1QBMH 4G3YH 1I3UA 4F3FA 2BVEA 4NO2A 1QLEL 2PW2B 1UVQB 3KPRB 1FRGL 2VE6A 4OSUH 3OJDA 1P7QA 2ZNWA 4KKLC 4WJ5A 5EZIH 5DD5L 4L8DB 5HI4D 3CMGA 3REVA 2DAVA 1SYVA 2VLLB 4ZUUB 2I07B 3CDFA 2RCSL 4U1GB 2X4SA 3T2NL 5C71A 4JO2L 4UUJB 1M7DA 1HDMA 1ZTXH 3C08H 4Y1AD 4NQDE 2OK0H 3A6BL 1B6DA 4M5YH 1XF5A 4HFUL 4PJHF 1IKFH 4Y5VB 1J88A 2FR4A 2DTML 4HPYH 5LGHL 5IOPA 1XGYH 1E4KA 5DJYB 3V0WL 4HUNB 3I84A 3T65A 2R23B 5TE6H 1E6JH 5BS0A 3AS2A 2BOBB 4GSDH 4WFFD 1DLHA 2W38A 2EDXA 2FWOA 4CKVX 3D1MC 4Y5VC 3D9AH 1YEHL 1E4KC 3O6ML 4KGJA 3NIGE 4JPKH 4OI9A 4XPGL 5I8KL 3MRKA 4XP5L 4BK5A 1T66D 4G6ML 1R3LA 5IBTH 1CFSB 2JJSA 4G6MH 4NQCE 5DQ9A 2JE8A 5D4QA 3VH8B 4AM0A 4BKLB 5C6TL 3VCLA 4Z77B 4PTTA 3L6FB 3H3PL 4IS6B 1I7ZB 4GKNB 3TH2T 4PGEB 5C09B 4ZG1A 4RNRA 3KJ6H 1XGQA 3TA3A 3VW3L 5BVPH 1D9KC 4GW5A 4NDMA 4L3ED 2A6KA 4Q9CA 4N90D 5E08H 2K7QA 5KVDL 4GRMB 3RPIA 6CGTA 3QPQC 2XRAH 3LQZB 3O2VH 2FYYB 5DJ8A 1P4BH 4HPYL 2JB5L 1LO4L 1GGCL 4OZGA 2HG5A 4U6TA 1NCCH 2CQVA 3PNWA 5JPMA 1DBML 5F3BB 1QSFA 2X10A 3FONB 4PJAF 3VWKA 2VLKA 4JY4B 4OFYA 4MXVF 4U7KA 1MHEA 1Q38A 5ADPL 1RIVH 2Z0BA 1AP2A 5ICXA 5BRZB 2DI8A 3O45B 2X05A 4XBPB 2YUZA 4M4RA 1MHCB 3KYNA 3SDCD 1YNLH 4GKSB 4Y4HD 3TIDB 2VXTH 1TENA 1UACL 5I6XB 2DKSA 2EDBA 1BFSA 4K07A 4JKWA 2RJMA 3IFLH 1HILB 1IC5H 5INDA 5ALBL 2QL1A 2A74A 2AI0H 2DN7A 2W60B 5CIPH 3IVKA 4HHAB 5DURB 2UWEF 4JY4A 4YWGL 5IROA 5IVXA 1QPXA 3L9RB 4UTBL 4JN2A 3HC3L 5F7EL 1TCMA 4JFDE 2NYYC 5DMKA 1CICD 4GRLD 3U1SL 2YXMA 2WUCH 4IRJB 4PG9B 1WF5A 2JK5B 1BZ7A 4JM2B 4HKXB 3GJFB 3VXUB 1TQCB 1NCAH 3FRUB 5A2IH 1YEGH 4AEEA 5D7JD 4X4YA 3MX0A 3VRJA 3BKYL 3LMJL 2H6PB 3KLHC 5HHME 4WFHE 4TUJB 5CBAA 3T0EC 5E2WL 1K85A 1F42A 3GIVB 3O2WH 3R1GH 2YPLE 4AT6A 2Q6WB 4E9LA 3TNNA 1I8IA 2ESVD 4PD4J 2R0KH 1UYWH 4G6JL 4XNYH 4MD5B 4FZEL 1DBKH 3MLWL 4H1LG 2OQJA 4LU5H 3EOTH 1J0KA 1CI5A 3HUJB 3L7EA 4GAGL 2G5RA 1IGCH 4RFEA 5HY9B 3GSRB 1FNGB 1C1EL 5TDPB 4FFVC 3C87A 3CFDB 3GUTA 4LSTL 5CUSL 4U1MA 1MCJA 1WIPA 1ZLVH 3O3BA 3DROA 1EEYA 4I9WD 1GGTA 5D8JL 2DQIH 1KG0A 5CD3B 2A6JB 5KTEL 5CJOL 1HDMB 1TZIB 1XCQA 3ARED 5ANMB 3QDME 5JXEA 1XIWD 2X44D 5GZNC 4LSUL 4PJDF 3ARWA 4NHCH 1U8MB 3EFDL 4EI5D 4Y4KA 1IKNA 3S37H 5JDJA 3VI3E 5ACLA 1QSEE 3QCTH 2R39A 2D0HA 3ZYZA 1Z6JT 4FMKA 2K1MA 3RI5F 2OTPA 4MVBC 4WW2B 5FOBA 5HGDB 1IGTA 3GRWA 4Y4HC 4XH2A 2QHRH 1X3DA 4POUB 2CIKB 3FFCE 3QXUA 2IH1B 4LGRB 3LRSB 3N1PC 2HN7B 2NY2B 3L3OB 2E7CA 1JNNL 1KIRB 2EXYC 4WU5A 5HYSA 2C3VB 4YFDB 3KPSB 4Z95H 3CPLB 4KUCF 2W9DL 1EDQA 4C56E 1HE7A 5BS0E 1CFBA 3GSUB 3MODH 3TCLA 4D9LL 4KDVA 4OCXH 2EDEA 4XBEL 4H88L 2NY2C 3OAUL 3OF6D 3RVUD 3PHSA 1GZQB 2V17L 4XB8A 5DUMH 4F15C 3RDTA 4HEME 1N5AA 2ZOLA 1ZHNA 5TE4L 3VXSB 3F6IA 1W0YT 5DT1L 1KJVB 2IBBA 4YK4C 4G80A 4XNMB 3HFMH 3EOBA 5DHYB 2VTFA 3BE1L 4NP4H 1F58H 2CDEA 3DLQR 5SWZE 4CADA 3GMMB 4L29B 4K23H 3S35H 1I9RH 5ABDE 5KZCD 1XF3A 1I8MB 1EVUA 4R4ND 1UXSB 1B3JA 1UJTA 3HFML 1F6AB 4G43B 3QIUB 3MRFB 3HMXL 2HKHH 5FB8A 5DT1H 1KUMA 1KLUB 2VN4A 1NCDL 4JZOA 1UXSA 5EDXA 3RIAF 2ID5A 5FUZH 3U46B 1NL0L 4HC1L 1ONQA 4OAWB 2NY4C 3LOWA 4CMMB 3PWVA 3OB0K 2AJSH 3RUGA 5GRYA 5J3HC 3W0WA 3TWCL 1NEUA 2P5ED 3OKLB 3L5WB 4U1HB 1SBSH 2YC1B 4LASL 4LSVH 4WDIB 5CEZE 3ILPA 4R2GD 3EYVA 4UI2A 2NXZB 4Z78A 1QRNA 4E0RB 1NGXB 2DM7A 3J7HA 4G6AC 3V6FB 4XP4H 4I18B 2AV1B 1ZGLB 5EBWA 4OTXL 3BGMB 1KC5L 3IJSA 4S1DD 2NY6D 4OCYL 5JIKA 3BDBA 3OX8B 3O9WC 5CEXA 1IC7H 1JP5A 1JPFA 2XICA 1FLTX 2ADIA 1JK8B 4LIQE 4BQ8A 1ULVA 2KH2B 3MNZA 3RX8A 1GGYA 4E41D 2BVUA 4PLJD 5DTFB 2IH1A 1AGFA 4I18C 1OM3L 5T33L 2VDKL 1CFNB 5CZVH 5D2NC 4ZUWA 3T4AA 1ACZA 4MHHG 5KTEH 3ZKQD 4OZGF 1HK6A 3O9WB 5KS9F 3WNNA 4P46A 5EO9A 4Z7VE 2HAZA 2VQ1B 5IESH 5DVLA 5KVFH 3AGVA 5CEZH 5MEOB 5ILTL 4ERSH 3DYOA 4M5ZL 4XWOC 5JXAL 4S1RL 2V2TA 2P4AB 4MS8D 1TVHB 1A3LH 2WSKA 1TJHL 5IB1B 1ZA6A 3N06B 3QO0A 3T1WA 4XC1H 4UZGA 1YEJL 3HI1A 2ADIB 3P4OB 4HSQA 2P1YA 3ARGB 4I2XA 2BNQA 3BP4A 1ND0A 1OP3H 1GYAA 1CICA 4GRLA 3O3BB 1F4HA 4PJFF 2GKIA 4DKEH 3SE3C 3V6FA 4Y19B 2DQFB 1YYMH 3IJYB 1NGXA 2P5WD 2HRLA 3PP4L 5J1AB 3QUXB 3CSGA 1UEYA 2E7MA 2R8SH 5BRZE 5F21B 2BVPB 4URTB 5C8JB 3LEVL 4LCCA 1L7IL 4BZYA 4HC1A 4X6CF 4YC2C 4HUMB 4MXVE 1FORL 4NRYB 1P5UA 5BOPA 4YPGA 3MLZL 3AREB 2AP2A 3LD8B 4L5FH 4LCCB 3G5XA 5I1KL 1HSAA 4KJYA 5IB4A 2QLVB 3O8XC 3IFPA 1QLRA 3TPKA 1CQYA 1QEWB 3HC3H 2O5ZH 4JGMA 2WBWB 1A7RL 3RVWD 3VRJB 3FB7A 3WDJA 4G7VL 5E7BA 4L8CA 4KY1L 4ZOAA 1KCUH 5DUBA 3FO0H 3EYSH 3VXUE 4P59L 4UQ2A 2JJWA 4OLXL 1IGIL 1TXKA 3QO0B 3ARBD 4LGSB 3ZDXF 5JOFA 1AQDB 5C08E 5HHMB 4NO3A 1G7JB 2FGZA 1Q72L 5JXED 3P4LA 1FDLH 4M7KH 1MFNA 1I85A 4LLMB 4MA1B 3PDOA 3GO1H 4V2BA 4ZTPH 1KN2H 2YPLB 4LVNC 1TVDA 1OGTA 4NC0B 5GRJL 3SQOL 2CIKA 4PJ7A 3QAZC 4Q2ZA 4KTYA 1GGCH 3SGKC 1A21A 1N5YL 2HFTA 4WWKA 3KDMB 3L7FA 2CXGA 4U1GC 1DP0A 5F9JB 5KVDH 5E70A 1IC4H 3HNTL 4JQVC 4NZRL 1T7YA 2AXFA 3N85H 4O4YH 5F88B 2FD6L 3IDMB 4KHTH 3V2AR 2VDOL 3O11B 1NBVH 3KYMB 1WTLA 3CSYA 3SE9H 4C58B 5B39A 1AQKL 5JOPE 4HDIB 5KS9A 2YOCA 2XV6B 3V4PL 2CKBB 4ODTL 1XGTA 3OKMA 2P5EB 5DS8B 5FM5M 5JUEH 2ADJB 4LCIL 1RSFA 4LOUD 5L8JB 4GW5B 4FQHB 3RVVC 4MA8L 1YEHH 2PYFA 4UDTA 3H0TA 4FFWC 4NZDA 2ITCA 3CXDH 3W11D 3O41B 4HIEB 3EYQD 1J86A 2OQJB 5D1ZD 5I71C 3X12B 3WE6B 3JXAA 1FFNB 1I7UA 5IKCA 4BA8A 3LN9A 3SEPA 5H35A 5DLML 4KJWD 1N5YH 3LS5L 1CD9B 1BEYL 5KZCB 4E41B 4ODWB 3C6LD 4NFCA 3SDDA 4F7TB 3EGSA 1KJ2L 4PJFB 4CVUA 3MRDB 4EN3B 1DFBH 3E1F1 3UAJD 3HR5A 4FQQA 4ELMA 4FQJL 2Q8AH 5IK3A 2PYFB 4UDTB 1F3JB 1MLBB 4QF1B 2R23A 4QRPA 3TFKC 5DDHA 3VGDA 1AO7A 5IR1B 4YHZL 4OQTA 3VXQB 1EFXB 3VXSE 3A0OA 1VHPA 2DLIA 4AENB 4H0IA 4M8QA 1YEFL 2VITB 5SWSD 3QEHA 3QXTA 2NXZD 4NM4H 4WWKC 1A0QH 4JFED 2GSIA 2HFEB 2VR5A 4JDTL 2GK0B 3L3GA 1UH4A 3TPUB 2E8YA 2D7MA 2VLLA 5EBMB 4ZUUA 1U91B 1YN7B 3MLTB 4KVCH 1A1NA 4H26A 3HG1D 5D71L 1WISA 3MRMA 1TZHB 2A74B 4Y0GA 1A7RH 3L7FB 3RGVC 4WWKB 1UVQA 3WJLA 4N5EC 3C6LB 4M4PA 2AJUH 4N0CD 4JPVH 3I3BA 3H6JA 2BFVL 5FHBH 4NWTH 1CT8B 3OAZH 4QXWA 43C9B 3FT4A 2Z8SA 5MI0B 3TO4C 3U7YL 5LXGL 3F7PC 2GK0A 2ESVE 1IC1A 3MV9E 4PJDB 4OV5B 1TDQA 1BVKB 2CDGB 2FJFA 2QKIB 4LF3B 3IDIB 1T1YA 2VDQL 1AR1C 4JCMA 4GXVH 3LKSB 4PS4H 5F9DC 4U1MB 4K3GA 5JPMB 1F11B 3EOYG 1AGDA 1TQCC 1D6VL 4HQQH 1NMBL 3CFDA 1YPZA 5DDHB 2M1KA 4G42B 5ISZA 4PLOB 3ULVH 1QVOA 3OKKB 1MFEH 4X7SL 1INQB 5KN5A 1EA9C 5B8CA 4BSVA 4KRMB 2Y07H 4NQTA 2XXCB 3A67H 4K2UL 4MD5A 4GLRI 4P2RA 3ARSA 4J4PA 1I7UB 4MNGE 4LBEA 1AD0A 4YXKL 4YIQA 2OTUA 3IT8D 2FZ3A 3TNMB 3K2MC 4Z7VB 1S9YA 4S1RH 4R4BB 5F6IB 2LV4A 2BNRD 4RX4A 4JJHA 4AEIH 5IV2A 1N2RB 4HIIB 4DGIH 4XVSL 5C07E 2Z35B 3BP7A 5C0CB 1CG9B 4FOMA 1RV6X 4BSVB 3RKDC 4ZOBA 3I50L 2WLYA 1EV2E 3KYOA 4ZFOL 5EIQA 1RZGA 2BSTB 2H3NA 1INEL 2AABH 4LHUD 1UQSA 5LCVH 5C7XH 3GBML 1WFTA 3BD5A 5C0EA 3LHPH 4KKAD 5T1LD 4V2CB 3KPQA 1QFUH 2H8PA 1T04B 4ZD3H 3L9RA 4MLSA 4MJ2A 5JHLH 3NFPB 4GAYB 5ELIA 1FVCB 3GFUA 2GFBA 3M8OL 2ERJB 2HT4D 3HKFA 3JBG7 4NN5C 4F9LA 3B8YA 3KPRD 5F1IA 4Y4HB 3BW9A 4HT1H 2NNAB 5GGTA 3RNKB 2HT3C 3QPXL 4L1DA 1HNFA 4XPTL 1EHXA 1KSRA 1U3HC 4PRIE 4X6CE 3RTQC 4G7YH 3V5HB 1TETL 2QQNH 3HRPA 4PJ8B 3SGEH 3CFIC 2ZKHL 5HDQH 2ADGB 1AE6H 4QOKA 1AGFB 1CS6A 4JO3H 2BRQA 3NAAL 5CIPA 1AXSB 3BPCB 3WNKA 1CR9H 3CH8A 1SVCP 2Z91B 3HCVA 3S35L 1J12A 1DVFD 1L0QA 2D7QA 4UV4L 4QXGH 1IM9D 1MIMH 2FYYA 3WFCL 3FO9B 4KQ4L 4TTDC 3PGFH 2IGFL 4M7LH 4YXLH 4K71B 5D7LB 1XCTA 4PJCF 2BZDA 2P24A 4YAQA 3LIZH 5FYKD 3WHE0 4G8IB 3DJ9A 3OKLA 1JWMB 5D1ZC 3O6FA 3W0WB 4X7DC 1UGNA 5CSZA 4N8VG 3PWPB 2XQBH 3EOAA 4WEBL 1E28A 4RAUA 5ITFA 3VFSA 4IOSD 5GRXG 3S37X 4I0PB 1V5JA 3QQ3A 4RWHA 4YHIB 1QZ1A 3VXOB 2NPLX 5SV3A 1B9ZA 4C4KT 3FB8A 3B8SA 2YXFA 5FB8B 1D5ZB 4HZAA 1ORQB 4DN3H 3GKWL 2CLVB 4EBQH 1GGIL 3BISA 3BKJL 5IBLC 1YY9C 5BV7H 1QA9A 5J1AA 1PSKL 3ZTJG 2JF1A 5GGSY 1YJDH 4DKFL 3LHPL 3MYJA 5SX5H 3ARPA 1BQLH 5C7XL 4TSBH 2BJML 2EE6A 2WBKA 1CL7L 3FQRB 1U8OB 5TF1L 2CKBA 2EIZA 1ND0B 4XNMA 1FNSH 3VD9A 1CK0H 5I16A 1CD1A 5D8JH 2XG5A 3QA3B 4F2MB 2WLZA 3D39E 4ORGB 4JFOA 3OJDB 1T89C 1J0IA 1A47A 3MRBB 4RGOL 1GVIA 4XPFL 1YNTA 4NBYB 1KNOA 5B3JF 1VPOH 2JCCF 2IAMA 5C0AD 3CUPB 1IARB 4MNGA 3SPVB 2CIIA 1HKFA 2VDPL 3QFDB 1Z0NA 2EDKA 3W9EA 3GSNB 3P0VL 4PJFE 3T2PA 1DBJH 5CEYA 5I2IA 4LLMA 3BAEH 1UM6L 3M17A 9CGTA 1NUFA 1R6VA 2PCPB 5DC9B 3IDJA 3GSWB 4ZXBD 3OWEA 3BGMA 3IJSB 5I9QC 5EZJA 4F2MA 2AV1A 4HQQL 4I18A 2ZUTA 3K7UA 3L3HB 3ZL4H 1LE5A 3RY6A 1N3NA 2F53A 1RUKL 3F7RA 3BKYH 4PUBH 3CFKA 2PXYA 3QEUA 3UYRL 1EEYB 3TVMC 5I74B 3UPRB 3CXHJ 4P2RE 2ICCA 1I1AA 1YEGL 2YK1H 3IFOB 4EVNB 2VLME 3W39A 3O4OC 2APTA 1ITBB 4F33B 1DJSA 1CLOH 3V7AE 1EPFA 1OSPH 3IYLW 3RWHA 4LAQL 1IJ9A 2GY5A 4UDUB 2X1WL 3Q6GH 2CLVA 5GZOC 1OY3B 4FQPA 4DTGH 2ZUQC 4WUUB 3QIUA 4K3DL 5CMAB 1YPZE 4MA3A 1EUTA 5IHZB 4Z7UA 3AXLB 1H8OA 3MJ8B 3P77A 3SQBA 1A6AA 3JZ7A 5E2UL 1HOCB 4AJ0A 3SDCA 4G9FD 1M05A 3D18B 3QUXD 2LE9A 2MCG1 1QFWI 4FXGB 4PJDE 4Y2DA 3RY5A 1YMHA 3ZTNL 2DQCH 3MXWL 1R3IH 1EMTH 3DVGB 1RIUH 4XPAH 1JZ5A 1WITA 4PRAA 4AG4L 3P40A 2M26A 1OAYH 3MRNB 3THML 5E5UB 4E5XA 1Q9LA 3D25A 5ESAB 1YC8A 1KJ2H 3LS4L 1LP9E 4UU9B 4WFEE 2IBZY 3V0AC 5F8RC 1DVFB 1KCKA 2R56H 3NH7L 5C6WH 5MHSE 1IM9B 4G8FB 3QQNA 1TJGL 3O6LH 1XF1A 3MA9L 3X11A 5DMIL 3VMOA 4HHAA 3NBNA 2DBLL 3ORJA 3QAZB 1BLNA 2IBGA 2BP3A 4N5ED 1D5XB 1WZKA 3TVMA 1UZ6F 3KJ6L 4P4KD 4KJPC 3TIDA 3WD5L 3BEWB 4Z7QF 5IEHA 5AZ2H 4LCIH 5IEKA 3WFHA 4NO5A 3GSWA 5D2NB 3OB0H 5C0CE 4OCRH 2NY3C 1UCBL 3F58H 3MNZB 4I3SL 1XGPA 2IALB 5AZEL 4LSQH 3CDGA 1JPFB 3BVNB 2VH5H 3DXAB 1ZT1A 1T04A 3BEVB 5C9JB 4FABH 5LGJA 5HJ3A 4LPUA 3MLXH 1UXWB 4O9HH 1MI5D 2Q87A 3T0DA 1QNZL 4XP6H 1JVKA 1IAKA 2XQYK 5EC1B 1PGRB 3U0PB 4D9QD 4LVOC 3MRBA 3ARGC 3OG4B 4YX2L 4S1SL 5KW9L 5EWIH 43CAA 4KJQC 1MCLA 4Y5XA 1CIDA 4PGBA 1MRFL 3L5IA 5DI8A 4JO2H 5T5NF 1XGQB 3ZKMC 1MVFA 1T66C 4N9OB 5IT2L 3WIHH 3GIVA 4KMQA 1NUGA 3PHQB 4PRIB 5D5MF 1Z9OA 1JV5A 1J1XL 1FSKC 3IJHB 3PWPD 4OSUL 1T7XA 4NQVB 1DBBL 1HH9B 4KK5D 1MFCL 1MQKH 1S7XA 3AY4A 1U8LB 4PJ9C 4JFQA 4TUOA 3QEQA 4PRHA 4UIMA 2WQ8A 3TBSA 4DKAA 3EYSL 1J05A 1EEZA 4HS6B 5E2UH 3D2UA 3TBVB 3OKKA 3DV4A 1BOGA 3U6RB 2OL3B 3BO8A 4NQDD 3ZE1E 3PL6A 1WWCA 5DMKB 4U0RC 3JSSA 3UO1H 4LDLB 2NX5A 3RDTD 3MRCA 4JKKA 1OSPL 5D1XC 1R24A 1MCKA 5DJ6A 4Z0XB 3VFRB 2AXJA 4N8VA 3F62A 5IB2A 3ARFD 4JDVA 3KPSA 5DF0A 1QBLL 3NIDE 3OPZH 2MPAH 5IW1A 2B2XL 3O8XA 3F12A 4K9EL 3UYRH 4PY8I 5D1XA 2GUOB 5A2FA 3IDYB 3L3IA 4CUCA 1NKOA 4G5ZH 2IAND 2EXYD 1MFBH 1RUQL 2NY7H 4XMKH 1IGTB 3MNWA 1BECA 4MX7A 5HI4C 3FHAA 4ODVH 5CIPB 5JHDD 1D6EA 2IPKA 4ELKA 1N6QL 5F3BA 4Y4KB 3G6DL 3BUYB 2QQLL 4ZO6A 5IM7A 3TN0C 1NAKL 2WM0A 2ATKA 1RZIA 3H9YA 3BMVA 2FATL 4RBPH 2P45B 2FX9H 1ORSA 4LCWE 3N1QC 3MCLH 4JFXA 3NFNB 4HGMA 4TQEL 1T1XA 4PJHE 1LEKA 5ANME 1TJHH 1K4CA 3PXJA 1UM4L 3QDMB 4U2YA 4Y4KC 5E2TL 4UT6H 3LB6C 7FABL 2B4CH 5JIHA 2IPUK 3V8CA 4R8WL 6FABL 4Z7WA 3D39B 4Z7UF 2A38A 4M5ZH 4N0UE 1EBAA 1F3JA 1MLBA 2XTJC 3AY4C 2GFBB 2F5BH 2W92A 5FDYA 2F5AH 3T1FB 3JV4A 4U6VH 4F9PA 4DW2H 2BX5A 4GLRH 1R3LB 3UDWA 1KGCD 3FFCB 3VXRD 3PDGA 3D2UB 3U83A 4YLQT 2C3XA 3EKCA 3TBSB 3W2DL 1CL7H 4OZFA 2BJMH 3EO0A 3QJHA 3CMOH 4C56B 3DO7B 5E1HB 1JYVA 5BS0B 2DQTL 1UH3A 4FQHA 5ENWA 4DJMA 2Z35A 2Z8VC 5AUMA 1VEMA 4P2QA 4U1JA 2EEDA 5JDSA 2CRYA 3RRQA 1ZK9A 1HKLH 4J6RH 3DIFA 3GB7B 1NLDH 4YNYB 4MAYC 3DO7A 4NCDA 1ODAA 2HFFA 1U92B 1IT9L 1FVEB 1HQ4B 4NKMA 5GSRA 3K1KC 5SWSB 3SJVE 1RI8A 4LSVL 3VXUA 4XAKD 1TVBB 2XQBL 4MAUH 1BQHB 3WXWL 1T0PB 2X4SB 4P2RB 1KGCE 3WMSA 1A4JA 1PD6A 4L9DA 1BVLA 4PPTA 1U8IB 1LO0H 3O2DL 4R97C 4XXDA 3B9KB 4JGJA 3KXFE 3B2UC 1Q8MA 1A3QA 3QFJD 3EFFB 1E4XH 1ZVYA 4WUUE 1CIUA 1HHHA 4RMRA 2EDTA 1H3PH 1YPZB 4QNPF 1OD7A 1DLFL 3KR3H 5FYKL 1AGDB 1FFPB 1I9RL 1ZHLA 4QXGL 3ARDA 5FF6B 2IH3B 3HS0A 1YECL 3G9AB 5EU3B 2BC4B 3RWDB 1P1ZA 1VSCA 4XBPA 1CR9L 2NY1C 2V7NB 3FB5A 4YZFF 5FYLH 3RUGE 4MZ2A 1CFTA 2BC4A 5GRVK 1JPSL 4P4KB 5E00A 4QYOB 4J7RA 2EEAA 2KDGA 2UZXB 3EDEA 5F7LB 4G7YL 1N7ML 5IVNA 2OM5A 5ACZA 3HPJA 4XBEH 1V7MH 2Y36L 4LEOB 4K9EC 5CCKH 3CVHL 5CBEA 5IVZA 5DGQA 1OARL 1MI5A 4H8WH 3LQZA 2HJKA 3MRLB 4P4KC 2ZJSL 4GRMA 4DUVA 3FB7B 3DARA 1NAMA 2V5TA 3L3GB 1P9MC 4NC1E 4OGYL 2C1PA 3NZHL 1JZ8A 4XBGB 4KC3B 3QHFL 1W72L 3DBXB 1JL8A 1V05A 1DN0B 1FH5L 3BH8A 3RQ3A 4CMHB 3O0RH 2NW2B 3O8XD 1BM3H 4FP8L 3LZFH 1QSEA 5T3XL 1EXUB 5E8OA 5C0BA 3SKUD 3CK0L 4KTEH 5INCB 5HHOD 1I3GL 5D2NE 5C08D 2CJUH 4QHLB 3RL2A 3V6OA 4LCWA 2CPCA 1SYSB 5GGUB 1QACA 3U4BH 2IWGA 4F37K 3SCMC 1JN6A 1DLHB 5CSBA 1FAIL 5AAMA 1JI2A 4BM7A 1MJ8L 3PWNB 5CGYC 3QIBD 3NCJL 5HSFA 1EJOL 4PRHD 3WIIH 2DICA 5M94B 2J8OA 2OJEA 5TQ2L 1ZLVK 1OSZB 5IOPB 3QQ4A 4OJFL 1F6FB 1PKOA 2J88H 4Y4FD 5JNYA 4I2XB 2BNQB 2IPTH 2NY6C 4LQFH 4OCSL 4XWGL 3HZYA 3I9GL 3EOTL 4U7SA 5C2BH 4X8XA 3A67L 3MGOA 4X6FA 5J12C 3VRIB 2BVTA 4M61A 3G6AA 3RHWF 4N9GB 1FZJA 1I1AB 3IFOA 4NJAL 3SE8H 4EVNA 5DRZA 4Q97A 3NCYP 4HWNA 5IB5B 2EH7H 3O2WL 1KB5B 1RURH 1AGEA 4X7FC 3WKML 3CSYB 3U0PA 4N1CA 3MRRA 1T0NA 1Y18B 4PV9A 4BFEA 5FGBC 3IDUA 1PQZA 1BGXL 1GGUA 5EIIB 3S36L 1HH6B 5IFHH 3WEXA 3GSQB 5TGBA 3RVXC 1BREA 5ESVB 3E3QE 5F9JA 4EDXA 3RU8L 3BJ91 4LARL 5I2IB 3O3EA 3KDMA 2YPVH 4WTWA 5EU6B 2NXYB 1KELH 1MEXL 5I30H 3BGAA 1I1FB 4IHOB 4RISL 3F6LA 1JFQH 2D7PA 4JQIL 5GS1C 3V4VL 2UY6A 3DMMB 4OM0H 3P0YL 1A7QH 3FQUB 4HWUA 2ZCKL 2X4NB 3VD7A 5HYJA 2XZAH 1C5CL 4N0FA 3MACH 2ZG3A 1IBGL 4DWHA 3DUUB 1M71B 4N9GA 4JVWA 2Q86A 3B9EA 1RZKL 4U1LA 1KXQE 3TO2B 4K71C 1PG7W 4IDJL 5E94A 3RDTC 4DUXA 5D6CB 2VLMD 4ZNCD 4L4TB 4G43A 2K7PA 2YZ1A 3QIWA 1PX4A 2VZSA 3SCMD 3SKOB 4GBXC 1HH9A 4FQJH 1MIEH 2RFXA 4QTHB 3T0XA 1LDPL 5HDOA 5DQDH 3MJ9L 2BRRH 1CYGA 3HRZB 4Y2DB 3LRHA 2ESVA 1DL7H 1ACYH 3B2VL 4LCWB 5GS0H 3HZVB 4TUKH 5I1HL 4JY6A 2XZCL 3IS1X 4HPOL 4X9FA 5E08L 3EOAB 4AEHL 5F7NC 3MGTB 2P5EE 2LAAA 2UYLB 4RMQA 1UT9A 1EUUA 4BELD 4YBHA 5E9DD 4JY5H 1K6QH 3VJ6A 5KVEL 1T7ZA 2QADC 3JWDL 4MA8H 4FA8A 3UJTH 1JNLH 5T1LA 4HUVA 3BH9A 4LLWA 2OJZL 3DX9A 3NACH 3FMGL 4ZS7H 1U42A 3HI6L 4Z0BL 1HWHB 4JFZH 3MNVA 5HHVH 4JFHD 2YHGA 2HJKB 5HGBA 3PHOA 3VFPA 5C9JA 5DHVB 3BGFC 1NBVL 4U05A 4E41E 1E4JA 3EO1A 3IDGB 5FA4B 5EU4A 1SHMA 1S7WB 4QHMB 1NFDF 4CNIB 5FO9A 1NBZA 5DO2D 2VJXA 1RK1A 3DGCR 1FLRH 1C5BL 1KPVA 1R5WA 5TE6L 1RUPL 2VXSL 2VAAA 1CCZA 2X1PA 2H1PH 1XGYL 2BXZA 1MCEA 3KLAB 3IRPX 3ILQD 1LWRA 3SHSA 5SWSE 4EI5B 12E8L 1FBIH 1TJIH 3UBXB 4MAYA 4OD1H 4AK1A 5GRJH 5IHLB 3T4AB 3DROB 3QFDA 1ERNA 4G6KL 2X6MA 5C0AE 1IEBA 1IGMH 2CKBH 1KN2L 1IM9A 4G8FA 4LVOB 4JB9H 4KK9C 3MSPA 1EO7A 4JFDA 1RFDL 1LO3H 1RJZB 1HWGB 4HFWA 3BKCL 3W5NA 2HKFL 4YHMH 1NFIB 1V8HA 3LH2H 1QLEH 4RFEB 3MOQA 5TFSH 4M6ML 2DL2A 1PDKA 1ZGLA 2VLJE 3HC4L 4ZPVA 3GSNH 2XWTB 2AXGA 3IGAB 1GGBL 5E8DL 5BRZD 3ILPB 1A9BA 4QWWD 3MLUL 1KFAL 4QT5B 1N6VA 2ESVB 3E3QC 4TSCH 5IMLA 3RUGB 1U6AL 3MRPB 1KIQA 4PJ9B 5I1LA 2R4RL 5DJAB 4OF3A 2SEBB 4XAKE 1BIIB 1RQ5A 4P3CL 4QRRA 5I76B 3P77B 4BUGA 1ORQA 1KCLA 1OP5H 2WINB 2HH0L 1II4E 4XP1L 5GGTL 4KUZH 4JZJC 1FHGA 2GJ6B 3WS6A 3I6KB 3RIFF 1G7LA 5D96B 4R90H 3W39B 5L88H 4L29A 1QTYT 3G04A 2VERN 5IHBA 5HHPB 3DV6B 1X4YA 4CW1B 5IUSA 1G0XA 1P7HL 4JFFE 3KS0H 1JWMA 2VXVL 3EJJX 5IVZB 4BH7A 3QPQD 5DC0A 3NVQA 1Z3GL 1N8ZA 3H9ZA 3RTQD 2N7BA 4NRXB 3O6FD 3DMMA 3HNSL 3RPKA 3D0VA 1N4XH 3A6OA 4GKSA 3CH1A 5IW6A 1J0HA 3UTQA 4ZPTB 2B0SL 3OF6A 5C07B 2WUBH 2XI9A 1LO5A 3P30L 1T3FB 4XC1L 4OV5A 4LPYA 1AGCA 4LLUB 1HI6A 3X13A 4EUPH 1A3LL 3L5XL 1NAMH 4MQ7B 3WUWB 5FKAB 3IETB 1MFDH 3FN0H 5HGHA 3SPVA 3SKJL 3CX5J 1W8NA 2B0SH 3NGBC 4HUWA 2G9HB 4L3AA 1T5XB 1BF2A 4UOW0 3EO9L 4WV1A 2BNQE 3FQTA 4I2XE 5DJ8B 2ZPKH 1JPGA 2I9TA 2CUMA 3F12B 5CZKA 4L8BB 5IW1B 3N1MC 1CTNA 2GSIB 3QUKB 2VISB 3BPLC 4GKNA 3K80A 1I7ZA 2EIZB 1U92A 3RVTC 3FQRA 2QSCH 4YHNB 4YFEA 3QIUD 2W65B 4JVUA 5DGRA 3DURB 1OTTC 1D9KA 2ED8A 4CN1A 1J8HB 3ALWA 5DD3L 3HUJA 4F37F 1DQML 1NCWL 5FM5O 5EU6E 4NKIL 1A7NL 2G60H 1IGYB 4M7JL 2ZG1A 4NJ9L 1EXUA 1IAIH 4TVPH 5IV2B 3ZKND 3BZDA 3WN5C 3GSNL 3OR6A 2I9LB 5D7LE 25C8L 2ZCLH 3V52L 2FEEL 4IMKC 3RGHA 5H2BB 2KZWA 4RZCB 3W0WE 3B2UD 1PLGH 4PGBB 5I8CB 1WWAX 4RSVA 1K4CB 3C6LC 3WN5B 4WEUD 2HVJB 4H5SB 4CJ0A 4JFXB 3G08A 4H25B 1A64A 1LD9B 3TO4B 1ZLSL 5F9OH 4IM8A 2X70A 1TTUA 2LFGA 5HJ3B 3QEGL 1J8KA 1OGAD 2XTLA 5FKAA 2Q8BL 4NM8H 5EG6C 4Z95L 3MBEA 2WQRA 5D1ZA 4LLQB 3FQNA 3ZDXE 3MUHL 5GGSB 1OCWH 1MAML 1CE6A 2FJGB 4KK8C 4KVNH 1UH2A 4NBXB 2UZIL 3NABL 3UROR 1P4LB 1OQOA 4XCCL 1R3HA 1KBGL 3VE0B 2LU7A 1UFUA 4XHJC 4PRNA 5DEGB 4TTDD 3TN0B 5EUOF 3MOAL 4NRXA 1F8TH 5DVNA 3LAFA 3MXVL 1G7JA 4OF5A 2AEQL 2K9UA 1ZXQA 5L6YH 1AQDA 2DTSA 1MQ8A 3KPQB 2Z31A 3JWDH 4ELMF 4ZSOA 1PX3A 3UZEA 3L1OL 3KJ4C 2C4FU 4QXTB 2WANA 2NY4D 1U8NB 2VKWA 5DYOA 3BOVA 2I27N 1RZKC 5FV1L 1JTOA 1TVBA 1YEKH 2UV3A 3D25B 1CD8A 4FHBD 4U3HA 1F4AA 4MJ6A 3P9LA 4TUOB 5KVGL 1ACYL 1GH7A 1AJ7L 1KYOJ 3B2VH 4K55A 4NGHL 5GS0L 1H3GA 1CFQB 4NQXB 4EQ2A 3VFOB 3SGJA 3TVMD 4FQIH 3UBXI 1G9NH 1L9MA 3LN5A 1PVHA 5D7SL 3NA9L 1HHJA 4X6BA 8CGTA 1JBJA 1IZKA 2NTFB 1Q9OB 4LKCB 5BQ7A 4H20H 1GJIA 3OZ9L 2BERA 5DK0A 3RWFB 1ZAGA 4RFOL 3LDBC 4YDLC 1QLFA 1UYWL 4HEPG 2IAMC 4HS8L 2QR0A 2N7AA 4MMZC 1AD0B 3UP1A 5IQ9A 5HGGS 5C0AB 4PY7B 5J13C 4GXUN 5T3XE 3CU1A 1A7PH 4ZPVB 3K74B 1J7VR 4NNXB 4IRZH 4WFGE 2N56A 3KVQA 4OZ4A 1EERB 3PGDA 1F4XH 1CU4H 2IQ9H 2WBJA 5K9KB 4K94L 2Q76A 3QO1A 1YC7A 4HH9A 4U2ZA 3LMJH 4Y16D 2ZCHL 3UTSD 2IANB 3TBYA 4OM0L 1VFOA 5C86A 1UXWA 1NMAH 4Z7VF 3L5HA 1MREL 2FH6A 3EIFA 4ONFH 3C9NA 1MWAB 2EZ0C 3DSFH 4MS8C 3UPRA 4KI5E 1A9EB 1H15A 3WIHA 3AAZA 3IDIA 1CVSC 4XVTL 1MJUH 2WUCL 1CXIA 4MWFB 2JIXA 4RWYL 1CBVH 1QFOA 2DLEA 2DQEH 3BPOC 1AKJB 1LMKA 1X4XA 2W9EL 3RU8H 5EZJB 3MBXL 1QG3A 4S2SB 2VZVA 4ZDHB 3UBXG 1NEZB 3BHBA 5MEOA 4OGXL 3P11L 3S36H 2D9QB 1F4XL 3G5YA 1PYWA 5FA4A 2ZUWA 1T5XA 1LK2B 5D6DC 1YNLL 2EDWA 4WI6A 4O5LH 1TPXC 2L0DA 1WV7T 3D3VA 3T77A 2Z8WC 3C8HA 5GJTL 1KJMA 1LP9B 5FO7A 3S3PA 4ODHH 1A6ZA 2F54B 1TQBB 4YJZL 4FQXC 2BY2A 3IXAB 3F5WA 5DR5H 3ULUD 5EO1A 2BVQA 3AMLA 3I2CL 4JFFB 2F8VA 4WU7B 4V1DB 4X7EC 1T3FA 1TPXB 4KZDH 1KIPA 2HTKD 3SGDH 4K8RH 4WI5A 4I0PC 3NA9H 2UY7A 4BSWA 3RY4A 4PFEA 4ZFGL 1BBDH 1GAFL 1LO4H 3WSQL 2YD9A 5L9DH 1CDIA 4QF1A 3U79A 1IQDA 4J3OC 3L5WA 4D0DA 1QBBA 4K8RC 4M1DH 1MCNA 1I9IH 3ME0A 4DFIA 3GIZH 1S7XB 1CXKA 2F58L 4XZUA 3DXAE 5BVPL 2CK0H 3MGAA 1DQTA 5JMRA 2E6QA 1IAIM 1WIUA 3U46A 3KLHD 1A6AB 3DPBA 5KAQG 5LWYH 5FM8A 1FNEA 1JPTH 3ISWA 3SKMB 4HJJH 1F2XK 3QUZA 1MCCA 5I8OL 1VERA 1DUYA 1OTSC 4XP5H 4JZJA 1VFAA 4I0KA 4OZFG 4NRYA 4EDWH 4Q9QH 2R2EB 4R7DA 5JW5A 3NZHH 3MPCA 3D9AL 5ETUB 4CADB 4OLWH 2BHYA 2OTWB 2VZOA 3P4NB 2G75B 4LLYA 1AFVL 1E6JL 2ITDB 4AL8H 4U7MA 5D7LA 1MRDH 1QD0A 3V95A 5T5FL 3TZVD 1NGYB 1NLBH 5JPNB 5ERWA 1GZPA 3OKEA 3IAQA 4JLRB 5K59F 2VDLL 2YSSB 5JQ6L 1RUML 3DO3A 3T3PE 4UMGA 4M03A 3ARGA 3ARDD 5D70H 3QNXA 4OUOA 5IFAH 4FQ1H 4WEMB 2IALA 1ZANH 2RIKA 1VGEL 4PGDB 1ED3A 4ODSH 1ZT4A 3PL6C 4MB5A 2WAHA 3WL9B 1BPVA 3QWRA 3X17A 4QXUL 3LSOA 1PQZB 4XHQA 1B2WH 2O5YH 3QZWB 3TVMB 1T0NB 4JHWH 2D0GA 2QQKH 4MB4A 4G3YL 3QUYB 4HG4K 5L2KE 4AIZB 4LP5A 4NO0D 4FQCH 5IGXL 1A1MB 2VDNL 3EYUL 4Z7WF 4NN6C 5FCUH 1B0WA 1EGJH 3UTOA 1FZJB 3MV11 1DVFA 1CF8L 1D5IL 1YMMB 1CD1B 2A9ML 2JIXB 3SBWA 1WICA 1FVCA 3IDGA 5GS3A 4QRSB 3QT2A 4R7NA 1EH9A 4QY8A 4HK3N 5GGRB 3NOIA 4PBXA 1YYLL 5BO1L 5J1SC 3ECBA 2DQJL 5JPNA 4UV7L 5DRNB 2CDFB 3QG7H 4PB0L 3BH9B 1YMHB 3WFBH 3UJJL 4HGWA 3CMOL 2PYEE 4LCWD 2DM2A 4FXGA 2IAMD 3F8UB 5HYEA 1GHFL 5I66A 2CLRB 3QP3A 4UAOC 3UTZB 4WTXA 4YE4H 1KCVH 3MV8A 2R2EA 4XPHH 2LU4A 2EH8L 2ICEA 4PJHB 1T1WB 4Y4FC 4JZJB 2B1AH 3MV8B 4OD3H 4F8QA 4KFZC 2OR7A 4K7FA 5DEFB 3ARBC 2BVPA 5C8JA 2D31A 5L2KA 1G9ML 3AVEA 3EJYD 4N0UB 3HE7B 5AG8A 2OI9B 3K8KA 5CJ8A 5ITBL 4P4RB 2P24B 4YAQB 1T83A 4JANB 2H6PA 1BD2A 35C8H 1BJ8A 4N0YL 3GMOB 1OAKL 5GRVL 3WO4B 4R8WH 3ARBB 1V3MA 2DDQH 4Q6IC 1XFPA 2DDQL 3P4MA 1L6ZA 5E2TH 3DX7A 4O58H 3EOBB 3UTSA 4P2OD 2IMMA 1BAFH 4R7NB 1M6OB 2MNUA 4XVUC 1O7SA 1R5IB 1KN4H 1YMMA 3HPJB 5ID1A 3JV5A 5C9KA 3SKNB 5C0BD 4TNWK 4JFYB 3GBNH 1DSFH 4S1DC 1KEGL 4PJ8A 4PTUB 3BGFB 1BVKA 1E6OH 2CDGA 2B1AL 2OR8A 2J2ZA 3P2TA 2V7NA 5INDB 3D69A 3NFSL 4DK3A 5AWNH 1S8DB 3SJVB 1AHWC 1L4IA 2J4WH 3RGVD 4KH2A 5F1NB 1YQVL 2L4OA 4BZ1L 3S97C 3U9PL 3CCHB 3HE6A 1CFNA 3LRSA 4ZUWB 4GG8B 2WW8A 1A6WH 4P23B 1VA9A 3F7QA 3KXFB 1CDCA 5F7KC 4HBQA 2MPAL 1RIHH 1CFVL 4P5TC 3NFPA 1H0DA 1SMOA 4K3JL 1DQJA 1K2DA 1CDBA 4ORGA 1RZJL 3QA3A 4ZFFB 1ZSDB 4XXCC 1AKJA 4M7LT 2HG5B 5FYJE 5DMGC 3T3MF 1CGSL 1N59A 1WVZA 1CF8H 3A6CH 1IAOB 1Q9KB 3BD3A 1KFAH 5E6ZA 1KPUB 5GHWH 3JWOH 4V1DD 5CP7B 3P4NA 4LLYB 4OZFH 3RWCB 2HFFB 1YEEH 1F3RB 3X3FH 3UAJC 1DZBA 4KKBD 5IR1A 2YBRA 4ACPA 4OCNC 1P6FA 1P7KB 5HHQB 5C0CD 3RZCB 3CXHK 4JZNA 4CL7A 2B1HL 2FO4A 2O5XL 2R1YB 2XY1A 1F00I 4NNYB 1R3JB 1R5VA 3WJJA 2I24N 3MRGB 4J3VA 4U0RB 3FTGA 3SO3C 4YIQB 5IJKC 4W70A 4KK6D 2C1OA 1FO0H 1XF4B 3GI9L 5C0AA 2E9WA 4WY7L 1MLCA 4EXKA 2F54E 3QXDA 4XZUB 4M43H 4OD1L 2JJSC 2KZ1B 3VWJB 1BQHG 2V5MA 3N1FC 3T1FA 2IADA 1DDHB 4HF5H 3D87B 4V1DE 4G8IA 1CGWA 2RGSA 2Y72A 4X99A 3CLFL 2VXUL 5EOQH 2GTWA 4JM4L 5D96C 1C5BH 2P8PA 4APQB 4XP6L 1IL1A 1AFVH 4MQSB 2JELH 1BVZA 4HAFA 5F7HA 1RZ7L 4X4YB 3GGWB 4OLUH 3SDYL 2Y7QB 4OLWL 4MJ6B 5IMOB 1ORSB 2QKIA 5I1DA 2J3SA 4H0GA 5CILH 3FZUD 4HIJB 5E6IB 3L3KA 2D03H 1FPTH 3SCMA 3TT1H 1MPAL 4FNLH 4JRYD 4QOKB 4BJLA 2R0WH 4P2YA 1UWGL 4MX7B 4HWBA 4JG1L 5E6YA 3UJTL 3LEYH 4NO2B 1K5NB 3G5YB 1A6PA 1K6QL 4K8RD 1JGLL 4PJ5B 3RNKA 4HW6A 2CR6A 1CGUA 4ISVB 4DZ8A 5FOJA 3SJVD 1U8MA 2XPGB 4TNVK 1GC1H 1MCWW 3DRQA 3PWUB 3TPUA 5E6IA 5L9DL 1HI6B 2R56L 5T3XD 3UYOD 2BSRB 1MF2L 1YJDC 4IRSD 2C7UB 5EZOH 1MWAA 4IJ3C 1OAUH 5ID1B 4UBDC 5C09D 1P7QD 3H42L 1U95B 1PZ5A 3VA2C 2FO1A 4MXQC 2IG2H 2Q1EA 1V3LA 4OLYH 5IMKB 1IILE 1LQSR 2VLRE 3MJ6A 1RULL 3ESVF 5SX4I 4HUVB 3MREB 5FV2A 3QRGL 4FG6C 3WN5A 1U8LA 3TJEH 3KNBB 4I48A 1G7MB 1A4JB 3QNYA 4HG4J 5FO8A 1MLCB 1BFVL 1YQ2A 4XTRC 4O00A 3I6LE 3LDBB 4LOUC 4YDLB 2NTSP 5GIRB 1A5FL 1BP3B 4TN9A 5BW7C 4DCQA 2EDOA 3WFZA 4KJYB 5F44A 5L2KB 4KPHH 3O41A 3G5XB 4HIEA 3VG9C 3BIAX 2NTFA 4LKCA 1G6VK 3B9KC 3Q6GL 1MAJA 3O3UN 1BIIA 4LBEB 1TTGA 5JW4Q 3ZT6A 4M6OL 3SDXB 1HHKA 3VMNA 1UB5B 4O51A 4PJ9A 5I1LB 3UTZA 4LSPH 2DD8H 3I6GB 1NUNB 4YHLL 1YMME 1AO7D 2ICWI 2E7LC 3P9LB 4OB5L 4KZEH 3QJFA 5C6PB 4L4TE 1NGQH 3WFEH 2HP4A 4X6EA 2AXGB 5IFHL 1VACB 4Q74A 4K94H 3UXFA 3LV3A 5JOEA 2HRPH 2WIMA 4HJ0C 1WWBX 2E7LA 2C7UA 5KANG 3VFNA 5HYQB 3MMEA 1KEMH 4UOW1 1X5KA 2EH7L 5HVHC 4I3RL 1RJZA 4LIQL 3I02B 1U0QA 2QSQA 1VFBA 2PYEB 3RNQA 1RK0B 4X5WB 4GJTB 5DJ0A 1E27A 2I07A 2WWMC 3KYAA 3KYNB 3CCHA 3HE6B 2PW1B 3MV8E 3BEWA 4CVXA 3CZFB 1ETZA 2Y6SC 1PZUB 4M7ZB 3VFTA 1ZHBB 1G9NL 3VWKD 2YS4A 1CZ8L 3TT3L 4BQ9A 2VKXA 2EDJA 3CVIH 2ADFH 1IFHL 4OBRA 2AVGA 1OAXH 2B20A 3RKPA 4DVBA 3UCRA 1ZT4B 5C3LD 4Q58C 5FKPA 4EUPB 3TBTA 1J0YA 2GAZB 1E4WL 1JGLH 5I1DB 2Y5EA 1NFDB 1Q0XH 2CJUL 5EBWB 2Y7QA 1OB1A 2RBLA 2ZUSA 4GG6A 1UKTA 2AEQH 4LPXA 3WJLC 4C83B 4RGMC 5FYKU 1AI1L 4KROC 4ZAKC 3ESUF 4NUGL 1P9MA 1T20A 1VADB 1F90L 3DI3B 5FUCE 4IIQC 1KBGH 1FN4A 1PSKH 3HR5B 4FQQB 5E2JA 4JREC 1OTUC 2XQYG 4Z7WE 5E99L 2FGWH 2LVEA 3GKWH 4EBQL 5C0FA 5F3HA 2OLDA 1KCRL 4J2XA 2V2XA 3WXVL 1YZZA 2XIDA 2Z31C 3LPGA 2B39A 4X83A 3DGGA 3D0LA 2KQMA 4R4FL 3CLFH 4WUUA 3CZJA 4YUEH 4HULB 3QEGH 2Y36H 4JPWH 4JZNB 4XC3L 2NY0B 2P8LB 4ZS6C 3QI9D 4MQXC 1BF8A 3S3SA 3MV7A 2D7TL 1QSZA 2NW3A 1T21A 2X4PB 1UM5H 4F7CB 4MVBD 2VLJB 3ARYA 3PP3K 2LQRA 4CU6A 4QO1A 3MRPA 1WEJL 4BFIA 1EJ6A 4M48L 1HXMA 3FJTA 4D0DB 4QY8B 5GGRA 3BP4B 5TDOA 1RVFH 1UWXK 4N1EA 3BRGC 5B39B 1FJ1A 4FTVB 1ZT7A 3EHBC 2FBOJ 2ZCLL 2C5DC 1MOEA 1G7QA 3X3FL 4L8SB 2R69H 4TNWF 2X4RA 3VXTB 1JTTA 3Q1SH 2EE3A 1RUAH 3KXFA 5GS1B 3UTPE 3V7AG 3A6CL 3AU1B 1AXTL 3DXAD 4HX1B 1A7NH 2GJ6E 2RQ8A 2A9NL 2HYMA 1LEIB 5LGJB 3BT2H 4X7CC 5EA0H 3GSVB 4PJGF 1OAQL 4U0QB 5L8KB 2XNAA 3BQUC 4F58L 3AU1A 4QOKD 3D6GA 2BDNL 3WUWG 1KOAA 3C8KA 4RMTA 4FXKB 2R2BB 3PDOB 3D69B 4ODUA 3NTCL 3M8OH 5GSVA 2QSCL 2YWZA 4PTUA 3ET9F 1NLDL 2W1NA 4S2SA 3S8WA 1HKLL 4X6DA 4HIHA 3REWB 2R9HC 1AGBB 1GZPB 3X3GL 4OLVL 5ERWB 1QFUL 1TQBC 4DGVL 4MB3A 3U9PH 2ZSVA 4FFVD 3WJJC 5EU4B 4ZOEA 1M6OA 2J4WL 3WYRA 2N1KA 3EW3B 1B90A 4E42A 2Z92B 3NFSH 1HXMB 5D5MB 2BSSA 5HGBB 3O6FC 1D5BA 1X5JA 3BDYL 4PGCB 5JW5B 5DHXB 3TIEA 4U1IA 5IIEA 1JHLL 4I77H 3STZA 4QOKE 3NPZB 3GMPA 2QEJA 5GISH 1M7IB 5T1LB 1Q9LB 4AEIL 4E5XB 4PREB 1KPRA 2F5BL 3GRWL 3LQAH 1T2JA 4LPVA 3BD4A 3SDAC 1HEZB 3VFUA 2BMKB 4PJ5E 3AREA 1WSST 3G9VA 5KOMC 2FNBA 3E0GA 2QADB 1SEQL 1MRCH 2NLJA 3OHXA 2CLRA 5CSZB 2DS4A 3ROLB 5JIIA 1DTUA 4J8RA 1ZGLP 1FZKB 4LEXL 1FV1B 3QQ9C 3V5DB 4JO1H 4KKCC 4PY8J 2CDFA 1E0OB 5KG9A 3SKOA 1SY6H 3H7BB 1DEDA 3IKCA 3P9MA 4TULH 4W81A 3VFUB 1FYTD 1NMBH 2VXQL 3GSUA 3QDJD 1W72A 3RVUC 4XRCA 1SJEB 2VLRB 2AJZA 1JE6A 4MA7L 4XBGA 1J8HE 5GRUH 2AEWA 4K7PX 1KIRA 4HD9A 1EZVY 3BPCA 3QG7L 4PGCA 4KQ3H 3ULSB 1X6NA 2B2XH 5GGQL 4EI5C 2Z92A 2YUWA 4P2OB 1FL6A 2FRGP 4CU7A 3R06A 3WHXA 1NC4B 4P3CH 4NWTL 2F74A 1ETZB 4KAQH 3KLAA 3PIQA 3BI9X 3UPAA 5D93C 3RWIA 5ADOH 3BW9B 4JFFD 1AGBA 4CN6A 5GPRA 4GW1A 3SDXE 1IGJB 2CSPA 1QSED 1E27B 4Z76A 5FIEA 4WO4C 3ZKNC 2N4IA 2R69L 1CTOA 4L9LB 5D1QB 5L2JA 3TCXA 1MHEB 1KG0B 5CD3A 3QNXB 1J8HD 4GAJL 4B53A 3RWDA 5BMFH 3HC4H 2WWKT 3WDIA 2F15A 3IKKA 3VWKB 4OI7A 4YHPB 3KPLA 3QIBA 4QRTB 3MRRB 1RZGB 5I1AA 4XHJD 3PJSA 4XNZC 1YNTB 1RJYB 4HLZH 5IT2H 2CKBL 4WIQA 3CC5A 3RVVD 4EJ1C 2IQAA 3SE4A 4OZ4B 2E7HA 2FECL 1FAKT 1OAZH 3W82A 2F8OA 1MHHB 4YQXH 2CGRH 2A6KB 5DZOA 5E9DB 4PIRF 1DQQB 4KWUA 5HYJE 1SEQH 4RNRB 5TDOB 5ICZA 5C70A 1JRHH 3R4DA 5TPWH 1CVRA 2I9LA 2F53E 5DK0B 4IMLB 4LNRB 3RWFA 5EU5A 3PQYA 4RGNC 1RUPH 2YD6A 3QXVA 1F6AA 4WFHD 3LQAL 1PW3A 2DYPB 5KSUA 3VWJC 3MLXL 5HPOA 5GISL 1G1CA 1UCTA 4FABL 4OLZH 1JHLH 1FGVH 3BDYH 2CDEB 4KUCD 2VR9A 4PRDB 4MAYD 3MOBL 3DGGB 2F19L 1JRHI 4JJ5A 5IMMA 5IMKA 5AZ2L 4WI3A 4N5UA 5HI5D 4R0LC 4TRPH 1GC1C 5SX5K 2YWYA 1KTKE 3INUH 1Q0XL 3F7VA 3WD5H 1INDH 3BSZH 3NN8A 1H5BC 4YR6A 3ARZA 4OLVH 3TF7C 5E8PB 4UILH 4LF3A 5F7DB 1AR2A 1QYGL 1T5WB 1ITCA 4JFEE 4PJDA 4UUJA 4Z7WB 3C6SA 3UPCA 3IXAA 1U8JB 4L8BA 3L95B 1DL7L 5DZNA 2FHBA 3CVIL 2GY7B 4GG6B 1OAQH 2VIRB 3MJ9H 4HXBH 3OXRA 5EUOE 3LPFA 3ELAT 3Q48A 3RWEB 1YUHA 4LPTA 5ICXB 5DURD 1OAYL 4EDXB 2IFFH 2PO6D 4KU1A 3I2CH 1G9NC 4M7KL 3UX9B 4F7PB 1URLA 2X9WA 1JF1A 2IANE 2PUQT 3QIWD 4OQTH 1WBXA 3MO1A 4ZQKA 3VU2A 1UWXH 2YD4A 1OOAA 5HBBA 3V79C 4KKNA 1SY6A 2V5YA 3G6JB 4XX1E 1MCDA 1RZKH 4HBCH 1GOHA 1IQWL 3M45A 2XKSA 4ETQB 3QIUC 4JGUA 2J8UF 5GJSL 4MXQD 1FFPA 4N8CH 4F7MB 4NQEE 3QDAA 3G6AB 1MJ7H 3LRGA 4JPIA 2OP4H 2XWBA 4L4TD 4I13B 2CO6B 4PLKD 3TBYB 4UT9H 2O5ZL 4PV8A 5F7DA 1FNGA 1MHPL 5TH2B 3DSNA 4MGXA 3LKNA 3L7EB 4WFGD 1MJUL 2UUDK 1A4KB 3G04B 4EOWL 4M6OH 2R2HA 3K8LA 1UQSB 1IEAA 2NXZC 3PWNA 1NMAL 4KPHL 4MSWA 4KMLB 2P43B 5EU6D 1FORH 3VWJD 2KKQA 1LK3H 4KRNA 1WT5A 4N8CL 2YEZB 1DBAL 3LEVH 4WTZA 5E99H 4POZD 4PJEE 2R8SL 4TUJA 5LAXB 2H2SC 3GB7A 1SYSA 4D3CL 1BFVH 4N0RA 1UB5A 5INCA 1Z0MA 1X5YA 2W65A 2YD2A 3BIKA 3KWWB 4JFPB 3GM8A 1HIMH 4YH6A 4FQXD 3LEXA 1WZ1L 3OBAA 1A9BB 2NX5D 1BWMA 3SDDD 4CDGC 2AGJH 1C08B 1DQQA 2XWTA 5DJDB 1KB9K 3RJDA 4S0TD 3WLBB 3QDJA 3KNBA 4ALAL 3C5ZC 3G5ZA 3GI8H 4FQIL 4J4PC 5D1XD 1A6VH 4XAWL 5F9AC 2G9HA 1PZ5B 4RRPA 4CJ1A 2VAJA 4KRPC 4NT6B 1JZ6A 1HHIB 4Q9RH 2XA8L 3RGVA 1A22B 1P4LA 5T33H 1INDL 1SEBB 3MRIA 2HVKB 2FJFB 4QHNB 4P57B 1QQDA 2EO9A 1CE1L 5L6YL 1JZ7A 5I8EB 3LZFL 1CL7I 1QQDB 4FP8H 3HZKB 2GJZA 3B3IB 1K8DB 1MPAH 5CKAA 3QSKB 2F19H 5E4IA 4JO4L 2IH3A 3HS0B 2IPKB 1SJXA 3RWIB 4IEFB 1Q0YL 2J6EA 2BNRB 1EZVX 3TFKD 4WNQA 3VDCA 3MLYL 1NGQL 3WFEL 3F7YA 4P2OA 1JIBA 3V6OC 5IB3B 4LCCC 4LHUA 3RZCD 2WWMD 2VIRA 4H8WL 4L8CB 3J8F7 1BFTA 4FFYH 5F7FA 1Q9WA 1FQ9C 4IJ3B 1JRHL 3WLBA 1I8LC 3O8XB 5CS7A 1R3KA 4EEEA 4G8EB 2DD8L 5CCKL 2X1XR 5JA8B 1OTUD 3FN3A 4HF5L 5KJRH 1EBPA 1C08A 4HIXH 4HC1H 4KK6C 5H2BA 2M2DA 1D5MA 5F9OL 4HMCA 4MDJA 3SDXF 3LIZL 4AMKH 4IS6A 4YQXL 4X6CA 4UT9L 3VA6A 5SWSA 1HSAB 4YR6B 4WW1B 2APXA 1FCGA 4C55A 1IMHC 1W8OA 4K7FB 2JKXA 3NCBB 3TYFB 3VGBA 3LKQA 4PJHA 1K3ZA 1CLZL 5L7XL 1MIML 1IGFL 4UNTA 1KACB 1FZKA 2IFGA 1WFNA 4PRHB 4UIMB 1A6UL 2X1OA 1FYTE 1HZHL 5CAYB 3SE3A 2NY5L 4YHYB 2VO5A 2R0LL 1ZVHA 4XCFH 3QUMB 3ARUA 4MA1C 3QH3A 1A14H 2EZ0D 5AAWA 1CGTA 1BX2B 3I85A 4LVNB 4NJ9H 2O61B 1KIUA 3GJEA 4PRIA 2HLFD 4W68A 5ICZB 1DQMH 4YHYC 5EUOA 4UQ3B 4X8JA 3VFMA 3H0TB 1RU9H 3WXWH 5KAQF 4L3CB 5BZDB 3MFFA 4ENEC 4U1IB 2MTPA 4IMKA 5BVJB 2EYTB 2XZZA 1SYVB 4F8TA 1WBZA 2APBA 5HYJB 1MCIA 3S5LG 2BCKB 1CFVH 4KK9D 4UT7L 1XAUA 2MCPL 5GGVY 5KS9B 1J11A 4KQ3L 4YZFE 4KHXL 5CZXD 1CN4A 2F53B 2VC2H 3KPRA 1B0RA 5GRUL 2D4FA 3BSZL 2KL6A 2LTQC 1MFAH 4GO6B 3AROA 2OSLB 5JR1L 5HGHB 3EDJA 4QHKI 4GMTL 1RK1B 4P9MH 4PGDA 1X4ZA 2AERT 5E03A 3I50H 5D2LA 1S7WA 3V9FA 4OKVB 5I1IL 5E4EC 3C8KB 5DD0H 4CVZA 3OV6A 4I0PD 2R9HD 2XNAB 3BRDA 1TZGL 3E6FB 4DVRH 5ESVA 4ONHB 4U6VL 5C07A 3Q3GA 5IEKB 1YEIH 4Y19D 4XVSH 2PN5A 1S7UA 3FT2B 3CH1B 1OGTB 3L95A 1Y18A 1AD9A 2ATPB 2PR4L 2OR9L 1MRCL 1N6UA 4NUJA 3LKPA 3M1BB 3L5XH 2NZ9C 4X6DF 4GUPB 4ETYA 4JFEB 3ZE2E 2WNGA 4XVUD 5JOFB 5ETUA 2UYLA 4CDHA 4RGMB 3VRIA 1YDPB 3QG6A 1DBKL 3MFFB 4KTDH 4O2FA 4LAJH 4J3SA 1R5IA 5E1AB 5ITBH 4G6JH 4XNYL 5EUOB 5DQJA 5EZLA 4DVRL 3EBAA 2CLZB 3B9KD 1SM3L 3KAAA 3UZVB 2XWJA 5DD0L 3QEQB 2WINA 5HD8C 1N6QH 1FNEB 2DJUA 3BX7C 5BCAA 4QTHA 2W0PA 2X4PA 5JMOC 3TH4T 2O26U 1KIQB 1H9VA 3IFPB 4KDTA 3UJJH 4M00A 4I1NB 4F7EA 2VC2L 5F8QC 4LNRA 3O4LD 5GGUA 3RIFK 3ULUF 5GHWL 1JWUA 5DQJB 1YPZF 5EZLB 3S6CA 1A7OL 1JNHB 3EJZC 3GMNB 3STLA 4MLIA 2Z8RA 1JF6A 2V2XB 1LEGB 2DKMA 5D7IA 5IHZA 3WS3B 2VNCA 4LPCA 3V8OA 4MJIE 4QHUA 2R4RH 3TCLB 3PE9A 1KPRB 1C7TA 4L1HA 3NZ8A 2DLGA 5A16B 4RAVB 2FIKB 1A7OH 4RA3A 5D71H 3CVHA 1NANH 3U0WH 5ICYB 1NCNA 1NCBL 3K4ZA 4BQ6A 2HN7A 3CAFA 3KPLB 4EI6B 2V5RA 5D5MA 4MA7H 4G9DB 4L8SC 4NN6B 5TFSL 3QQ9D 4PP2B 1B2WL 2O5YL 3HPLB 1RMFH 1I4FA 1NFKA 1A6UH 2FSEA 3LH2L 1IEHA 4WHTB 3PV6B 4PJEB 5EFIA 5ADPH 1E6OL 5FXCH 1S5HB 3GK8H 2BK8A 4QYOA 1IGJA 1KCSL 1J1PH 3KS0J 3GBNL 1NANI 1VGEH 5EORH 4JO1L 4LNVA 1KTRL 3KLSA 4BZ2L 4J3WA 2XZQL 5EFIB 4LEXH 3FB5B 1NBZB 1ZHBA 4KTDL 3E8UL 3EO1B 4GG6F 3MRIB 4WHCA 3D85B 4ZUVA 5IJKA 15C8L 3LSOB 2H2SD 5J57B 2NZIA 2VQTA 4EI6A 4S1SH 3OKYA 5IWLC 1OAKH 4OV6F 2B8OT 3GNML 4H1LA 2HA1A 4YO0B 1FO0A 1T4KA 1MCOH 3QCUH 3QDHA 4ZODA 3MLYH 4X9BA 5HY9A 1W72B 1MH5B 4A6YH 3IB4A 3OKEB 1K4DA 1VACA 1XIWC 3FO1B 1FZMA 4RGNB 1U58A 3TNNB 1I1AD 1JWUB 2AXHA 2H9GB 1F5WA 5K9QG 4TVSa 4NKMB 1G84A 5DUPL 3STBA 3SE9L 5T1KD 3T2OA 4TOYH 5BQ7B 1CG9A 3S36X 3KWWA 1CQKA 4JFPA 3NCEB 4KHTL 1S3KL 4PRPD 3VXNA 2RFXB 4KHXH 2DWEB 1U2CA 4MJ5B 1UJ3C 5EOCJ 2FL5B 3QJHB 5DMIH 3C5SB 4XAWH 5I1HH 4R4BA 3V5KA 3MRFA 4XNQB 4PREA 4S1QL 3U9UB 5A3IC 3DX8A 5C0JB 2OL3L 5IVXF 1IKFL 1P84K 4P5MB 1F97A 1H5BB 1X5FA 3K81A 4PJ7E 2AAVA 3QUZC 3CNKA 5AG9A 4LHUG 3KPPB 3A6BH 5DD1L 3SQOH 2AJ3A 3RI5K 5TDNA 1M71A 1Y6KR 1A4KA 1SVZA 4MNQE 4UBDD 1N64H 1RUAL 5D7LD 3MREA 1C5DB 3FFDA 5TH2A 4UTAH 5KN5B 3K1DA 1MUJB 5DD5H 3F7YB 4PV8B 5TF0A 3DOSA 1U41A 1P69B 4XCFL 1L7TH 4FG6D 2NY5H 3VE0A 1F11A 4JHWL 2IPUG 1KEML 1LEKB 1T1XB 3REWA 1OB1B 4O5LL 2X89D 1NCTA 4QXUH 4P5TB 4ETQA 4KI1A 1PY9A 4HK0B 1KIPB 1B6UA 2YD8A 1FFQA 1CLZH 3B3IA 4P59H 4P2OC 2A2QT 5F9WC 1C5CH 3P11H 3FO0L 1DBAH 5I8EA 4OKVA 4WU5B 4FQ1L 5EU3A 3RAJL 4RRPG 3L3DB 4HZLA 3GSVA 1I1CA 3ARDB 4KI5C 4ZXBC 5FO7B 1JF1B 1ZV5A 4AMKL 3D3VB 4RWYH 4YK4B 3T77B 4LAQH 5KJRL 1BBJA 5B21A 5F9WB 4D8PA 1NLBL 1JHKL 3EZ8A 5HGDA 3LB6D 5FOBB 5I30L 1MRDL 4JFDD 4M02A 5HDBE 2BY3A 3QNZA 1MREH 4JFOB 4R2GC 2GUOA 3NIGF 4X5LA 3I3EA 5HPMB 2H26B 3BP5B 4NPYB 4PJ7F 4R0LA 2I5YL 3O6KH 3KPTA 4EZMA 5J1TC 1OLZA 3ZL4L 1KYOK 3BZEA 1IQWH 2Y9RT 2YA0A 2ZUVA 1HNGA 3H9SD 3BFOA 4R2GB 3ZYJA 1YMMD 3QRGH 3HLAB 1TFHA 2X4OB 1JPTL 1MNUL 1CFSA 5DQ9B 3S35X 1XZ0B 2F9BT 5E7FA 2D0FA 3TBWA 5LWYL 4OLYL 1IGYA 1MCSA 3P3YA 4S11A 4LLAA 3QXAA 2IADB 3GSRA 2DQDL 5KSAB 1G9MC 4OF7A 4LQFL 3QXAB 4Y5YC 4EQ3A 1XF2B 4POYA 4QHLA 3RL2B 2GJ6D 1S7SB 1NFDE 2AQ1A 4NZUH 1XT5A 5C0BB 4WW2C 5CJ5A 5IKCB 4S1QH 1U9KA 3PWPA 4ODBD 3X12A 1C8PA 1EGJA 5DJCA 3JTSA 3TEUA 3GI8L 1BZQK 4QRQB 5FYJH 3WIFA 4ALAH 2QBWA 3OKOA 3RWJB 3CDYA 4Y5YB 3PL6D 4ZNEA 3TJHC 2DQDH 2OS7A 2C1PB 2VDKH 5CZVL 3BZFB 4G8EA 4M9PA 1AKJD 4J12A 4R0LB 4L4VD 3OKMB 3DMMD 3HB3C 2HT2C 3MZGB 3VFOA 1S78C 5HPMA 3RWCA 5J0BA 5I9QB 1I85C 2YA1A 2BVYA 1FPTL 1LO2L 2DIAA 4JCLA 3HG1A 2Z93A 3MRHA 4H8WC 4W4OA 2AV7B 2JB6B 2JK5A 3QEQE 4G42A 4DKFH 4F3FB 4ZSOB 4LSRL 4Z9KB 1B0GB 1F4YH 5JW3L 5C0IA 4CRPA 1OCWL 3LD8C 4DGYL 5I73B 2W60A 3CFJB 4Z7NE 2VDRH 1X5XA 1KJ2A 1HILA 3IU4H 4CVWA 3S3JA 2Q8BH 4YPJA 2XPGA 4WV1C 4PJXF 4FTVE 2D2OA 4U6YA 4RIRB 1NDGB 4ONFL 3HI5L 2AK1L 3BN9D 3AS3A 2OP4L 1AP2B 2XZQH 3R8BB 3GHEL 3I02A 5F70A 5K33A 3UC0L 5SX4H 2ZCHH 2FX8H 1SJHA 3MRMB 3PGFL 1I7RB 2BY1A 4PJEF 3WFCH 5T1MB 5DD6B 3ULSA 3ZLQC 4HBCL 3AREC 3N0PB 5DJDA 1N0XL 3ULUE 4PJGB 1HHGA 2BSTA 2H3NB 4OZGB 3CDCA 1LD9A 3QHZH 1L7TL 4P2RD 1SJEA 2VLRA 3MRNA 1J05B 1EEZB 5DUBB 1KTLA 2V7HA 2P8MA 5D72H 3ARFA 4B7LA 4I4WB 3IKCB 4UTAL 2P8PB 4APQA 2P42B 4NRZA 5C0CA 3DIFB 1N64L 4P2QB 4QEGA 1K3IA 1T7VA 4U1JB 3WNLA 1MF2H 2VSDA 5IB4B 4HT1L 3RWJA 4PJ8D 2IBZX 4JRXB 4OFDA 4HH8A 1Z5LB 5HVFB 1M05B 3D18A 1NC2A 4G8GA 4K3JH 4PRPB 3HAEA 5D5ME 4L4JA 3FFCA 1MCWM 4PJIA 2WIIA 2LU3A 1LGVA 5JIPA 1NJ9A 1UJ3A 3HC0A 1G7PA 5IHUH 1ZLWH 1U93B 4TOYL 4F9LC 2AQ3A 5ISZB 4BUHA 1U95A 2DQFA 1A1OB 2D03L 3ETBF 3ECBB 4Y8AA 3T8XA 2ZPKL 1DSFL 2R1XB 1SM3H 1HXYB 1PKQA 1KB5L 4PP1C 3SGDI 2P47B 1XIWA 5F89B 3QWOB 3MLRL 3HI1B 2FECI 3K8MA 1M7DB 1B4RA 1U8KB 3MJ7A 1CICC 4GRLC 4XNXH 5CUSH 4KRPB 4HIHB 4NM8L 3ULVD 3T3PF 3U7WH 1NBYB 3FQWB 2WP3T 3M17B 4ELME 1MY5A 2GT9A 4YXKH 2OR9H 1FFRA 4K3EH 4LU5L 3DVFA 2CGRL 3PGCB 1CD0A 2DMKA 1OAZL 2KUTA 3X11B 4FZEH 3ZDZF 5EORL 3VFWA 3T0ED 3G6DH 3L3KB 3U7AA 1JCKA 2DM4A 4MNQB 4HIJA 3DX9B 4LLWB 4PG2C 5EPMA 1T5WA 4WO4D 4XPHL 1WZLA 4MHHI 3SOBL 1RMFL 2WWKO 1GHFH 4XCNA 2NY7L 2VSCA 1L9NA 1MFAL 5I17A 3HNVL 5HGAA 1YEEL 1AO7B 4K9EH 2W59A 1NCBH 4X99B 4JJ5B 5IMMB 4M7JH 3MV9D 1NCAL 4KKLD 2G60L 3U7YH 1OF2A 2OTWA 3HN3A 3HRZA 3EGSB 4PJFA 4F7TA 2DI9A 4N1HB 4KAQL 5EA0L 2NY1D 4GQPH 1FP5A 2FH8A 5F7EH 2XT1B 4XWOD 2RB8A 5GRZA 2C1OB 3DX8B 2BMKA 5C0JA 3U9UA 3E2HB 2AI0L 1XR9B 1EK3A 1IC5L 4IMLA 3FB8B 4AIXA 5JLZA 3RJQB 4DOHE 3RWHB 5JW4M 2VXTL 1S7VA 1QKZL 2WBJD 3CLEL 3TO2A 5EUKA 4NM4L 5DJAA 2HT2D 4FN0A 2YBRB 1D5BB 4TYUA 2RAMA 5E9DE 43CAB 1H3XA 1X5LA 2ENYA 2IQAB 3CU7A 4RQQA 5E6ID 3KPMA 4HDIA 4KRLB 1RFDH 1XCTB 2GITB 3FQXA 4ODSL 4L4VB 1DBMH 2CH8A 2EDQA 5LQBH 1JGDA 1RZJC 1QSVA 3ARTA 1K4DB 2AXFB 1NCCL 1UKQA 1YEDA 4ZYKB 5EU6A 4QRSA 1H0DB 4J3XA 5DMGD 5M95B 1T4KB 3S96A 5L2JB 2NY2D 2OXHA 4R4FH 1S9VA 4YX2H 3ZE0F 2H1PL 4NQSA 2ENSA 4U1KA 2LTQB 3L3OA 3OJ2C 4AQOA 1FLRL 4WCYH 3RFZC 3WFHB 2V2TB 5C0BE 3RKDD 3AS0A 2EDLA 2W0FA 5F1NA 4JG0H 3PIQB 1IE5A 1RY7B 1B0RB 4GFTB 1S8DA 4X98B 5EO0B 1IRAY 2ZOKB 3K2UL 1TNNA 2BOCB 4PR5B 5TQ0H 3FAXA 5I1IH 2MKLC 3LKOB 3FQWA 3ZE0E 5I8OH 4PYGA 3SY0B 3R8QA 4Z0BH 4HUUA 4XPGH 5DJ0B 2J5LC 4HLZG 1ED3B 1RJLA 2PYEA 5C0RL 1QR1A 4WHTA 4GG6E 3WNOA 4PP2A 1KLFA 1ADQL 1XIWB 2XKNB 2HJLB 2FD6H 5E8EA 5F89A 2I25N 3P73A 3MMEB 1QP1A 3RX7A 1MVUB 1YY8B 3HAEG 3N50A 4HPOH 3FCTA 2MCPH 4UT7H 2P5WA 3KPNB 4JEGB 1OAXL 5ICYA 3QH3B 3DTXB 1BQUA 3NH7H 4MDIB 1JGUH 2GITA 3FQXB 4PJXE 1ZS8B 4R6UA 2DB8A 2BRRL 4PJ5D 1CZ8H 1RU9L 5A16A 4J8RB 2YUXA 3G6JE 1FL5A 1T80A 3MJ9A 1D5IH 3RX5A 3I6GA 5DEFA 3MGTA 4WI2A 3GO1L 1EGJL 3MCKA 4M6NL 5MENA 5CSGA 1Z9LA 1E28B 4RAUB 2HLFC 1S7VB 2A77H 5JQHC 4NQEB 2H2PD 4MA3B 5ACMA 5IGXH 1HEZA 3S4SA 4P0DA 3QUZB 1EMTL 4IOFD 2G5BB 4XPAL 4Z7VA 1Y0LB 2CUHA 2QQKL 5DVMA 3ZHLA 2AJXH 1WIOA 5DZLA 2DI7A 1TCRA 3VRLF 3DTXA 1S5IH 2EYRB 3QNYB 3MACL 4R3SA 4R96B 3SGEI 3VFVA 2D7OA 2YN5A 4LP4A 3ZDYE 4JB9L 4PJGE 3P0YH 4ZO7A 1CDHA 1E4XI 1KCUL 5DHYA 2EEBA 4E42B 5GS0C 5E8EB 3HI5H 3T0EB 1IQDB 1QVOB 5E94B 3B5GA 4EUPA 4KKCD 4WNQB 5DYOB 3KHQA 4YDVA 1U3HD 1HCFX 4JQIH 3X14B 1U8PA 2B4CC 5EBLB 4LSPL 4WO4B 1U8HA 4PB9L 1QPPA 4X4XA 5E5MA 3FZUC 4IRJC 1K8IB 4P4KA 4D0BA 1NPUA 4P2QE 3Q5YA 2X4NA 4L5FL 1CFTB 4FTVD 4GUPA 2BSRA 5AEAA 5GSVB 2EDHA 3QWRD 4K7PY 2APWA 1X7QB 2NX5E 3D85D 3QUZD 2UWEB 3PWUA 5FGCB 5GJSH 4PRPE 1Q0YH 4EDWL 4PJCA 4GBXD 1I1FA 4JN1H 4NFBA 3B9VA 1LO2H 3VFGL 4CVZB 3FQNB 5D1ZB 2O93L 3I75A 5HHXH 4M1GL 1RULH 2AQ2A 3OR7B 5D2LB 4OQTL 2PKDA 4LKXA 1GOGA 1GCFA 3S7GA 1J5OL 1RPQA 4H26B 1G7QB 1A1NB 4WWKD 5ISZE 3G5ZB 1KENL 2NMSA 3PNWB 2F58H 1FNFA 3ARQA 2VMFA 4OCSH 3VDBA 4Q9RL 3MJ7B 3PQYE 2XTJE 1S9WA 2XZCH 4ZS6D 3LN4A 5TQ2H 2P49B 3NCYS 4U1HA 3O81A 5EBGA 4WI9A 2FCBA 2YR3A 5FGRA 7CGTA 1T6VN 3NCJH 4GMSL 4MJ4A 5KVGH 5I8CA 3Q0HA 4LPWA 4O2CA 3BZFA 1EFXD 1QYGH 5BZDA 1NUDA 1VGKA 3M07A 2ERJC 3MV8D 3MUZ1 4PGEA 2P8LA 1H3VA 4ELMB 4UINH 2BNRE 2OCFD 3PGDB 1S9YB 1OM3H 3MLPA 1NJ9B 2DLHA 4P23D 1J5OH 3VH8A 5DO2C 4BFGA 4MSWB 3QISA 5EOTA 5HHXL 4NSKA 2C4FT 1IEAB 3VFSB 2M8XA 3VFGH 3U30B 2W0KA 5B39G 1W72H 4DQOH 1NKRA 4OCLC 1J8HA 3GZKA 2FO4B 1IBGH 4QRRD 2EXWC 4Y88A 1FC1A 4DN3L 1MELA 3NABH 4M93C 1C12A 2JELL 1FE8L 2X1QA 2DQEL 3H9HB 4I4WA 1AO7E 2NW2A 4WEBH 3NFNA 1CDGA 4RISH 4Q6YA 3UMTA 3EDKA 4PRHE 2ZUQB 1KELL 1N7MH 2AK4B 1FYTB 4M93B 5FKPB 1NEZG 1FG2A 3IRZA 3B5TA 4Z6AT 3QUXC 5HI5C 1NMCB 4DVBB 4U31A 3VXMD 3RTQA 4F15B 4ISVA 4M7LL 4LHUB 3W5MA 4PJ5A 3IVKB 3PGCA 4WV1B 4KQ4H 3UTTD 1S5IL 3I75B 1W0WB 4ZFOB 5E2VH 1WJ3A 4Q6IA 5E95B 4DOHB 1NMCC 3OXRB 4PRBA 32C2A 5DK2B 5MERA 2PW1A 1U3JA 3EDFA 1R3HB 1BD2D 3PWJA 1MAKA 4Z7NF 4YBLB 2GJZB 2W07A 1FG2B 5HDQL 1A2YA 4M6NH 5DUML 3K0WA 4GBXB 2A6JA 1S9XA 3W9DA 5KS9E 1F02I 5JORB 1WAAE 3MUY1 1R24B 4XWGH 3C5JB 4IOIB 5C0IB 5HYQA 1A9EA 1H15B 2J88L 4D0BB 5C1MB 1TIUA 4QRPD 5D7SH 4L4VE 4M9OA 5EBLA 3BRFA 4RDQF 1A1OA 3D0VB 4NC1C 1JGUL 1VESA 1ZA3B 3HZMB 2DL9A 2C3HA 5J4MA 3QJFB 1RHFA 1TTFA 1EHLH 5J6HB 1GC1L 2ARJQ 4P99A 4U6XB 1EFQA 2MQ3A 2MQ0A 2YPKB 4HMDA 1JYXA 1VB9A 4UILL 2AS5M 1U8IA 1S3KH 4OFVA 5IP4A 3QUMH 1H8NA 5K9OB 2KQNA 2HJFB 4WHDA 2H32A 4JG1H 1MI5E 4KTEL 5EOTB 1QLRB 2XACC 3L3JA 4GW4A 1JV5B 2KBGA 3MRGA 3OKOB 3TT1L 5LJYH 4QNPE 3S4SB 5DC4B 2J12B 5FEBA 3CSBA 3MOBH 4NZTH 3L3JB 3BIKB 5BXFA 1DN2A 3IXTA 3MRKB 2E8ZA 4A6YL 1KXVC 5EU7E 4D2NA 5F96H 4JG0L 1ZEAL 5HI3C 2UZIH 5I1CH 2ZUXA 1WUNT 2YPKA 3GNMH 2V7HB 1KTLB 4GS7C 1EO8L 1ZS8A 3LN4B 4OZHA 3OB8A 2B4CL 2CKNA 1C1EH 1MCPL 3QFJA 4LRNL 1FIGL 1FZMB 1I3RB 4JRYB 5F88A 15C8H 4YC2B 3ZDZE 5JO5A 3MCLL 3PV7A 1V3KA 4GRLB 1CICB 2E7BA 2HLAB 3E8UH 4M43L 2FATH 2P44B 1JPSH 3PXHA 4PJXB 4GS7B 5LQBL 1FYHB 5I1EH 1NAKH 5FUOH 1N4XL 1OTTD 1UA6H 1G9MH 3FOMA 2X41A 1F45A 1J1PL 5IB1A 5HD8D 3GK8L 3W81A 5D2NA 4NO5B 2EH8H 2IF7A 3H3KA 4TVPE 4U3CA 4J4PD 4RFNB 1X9QA 3D85A 5D9SA 3LQAC 3SJVA 3V52H 4M62H 4MJIB 2I60H 4N90E 1ES0A 3UDWC 4G5ZL 3G5VB 2YD1A 5BJTB 3O9WA 3CFJA 5CGTA 1FL6B 4PD4K 3MBED 3BUYA 4YEFA 3SKNA 3WL9A 2HH0H 3BZ4A 4LDOB 3D5OF 4GXUM 4ELKB 1REIA 3L3DA 1B0GA 4HZLB 3MROA 3TC9A 4PJEA 5CWSB 4CNIA 1OWWA 2BDNH 1NGWA 2DLTA 5DD3H 1D7FA 5FHBL 5C0GB 1U36A 2Z31D 3ZE2F 1BMGA 3T0EE 1YEDB 1ZWIA 4X80H 4WFFE 3H9SA 2EYRA 1RIHL 5C0NC 3K4DA 3Q1SL 1C12B 4Q7DA 4J6RL 4QRPB 1PEZA 3EYFB 1MJJA 2EDRA 4WDIA 2ITDA 2VDNH 2VUOA 3HNVH 3KPMB 4LHQB 1DDHA 3MRCB 3HE7A 2G75A 4N0UA 3FFDB 3CJJA 1OQXA 3ZKXC 5C0DB 1W0VA 2B7DT 3TGXA 4ODWA 5TDNB 5FGCE 3SOBH 1DBBH 2VXQH 2VZ3A 4LVHC 5EIVA 1RIVL 5MENB 1J1XH 3ZHDA 4NSKB 2EECA 3DV4B 2VYRE 2GJ6A 2ED9A 1KLUA 2CD0A 4OZHF 1IGML 1IKNC 5MI0C 1FL5B 5IFAL 2ITCB 2Z4QB 4LVHB 4U49A 5I76A 4CBPA 4XC3H 5T5FH 4RGNE 3OMZA 2XTJB 2WP3O 1EO8H 4XPBL 1NC4D 3GRWH 1N59B 1ZHNB 3VW3H 1ZEAH 3MR9A 3W0WD 1ZA6B 4JKPH 3CX2A 1ZMYA 5KOVC 1U3YA 5F7MC 2JIXD 1BFOA 1L0XA 3QNZB 1NFIA 4NUGH 1UCBH 3F58L 5IBTL 2VXVH 2VE6B 2XKUA 1HSBB 1AI1H 4LMQI 4EN3C 1N0LA 4OD2A 1F3DH 4YE4L 2ZWLT 4HUWB 1S7UB 3AB0B 4DGVH 4PJ7B 3UTTA 2VOTA 2FJHA 3X3GH 5H37G 3T3ME 3N85L 1FSKB 3BWAA 4MAYB 4PB0H 4XH2B 2XXMB 2XN9A 5LVEA 4AEHH 5I18L 1KNOB 3L5JA 4P3DA 5H94B 4UNVA 3VXTA 5AD0A 4XB7A 4YFLI 2J5LB 1KV3A 3AB0C 4X4ME 1RHHB 4G9FB 3OJMB 4L4VA 2A9NH 1S7TA 4TSCL 3B5HA 5B38G 1QRNB 5DJXB 5IROC 1L6XA 4RMSA 5ALCH 3UJIH 1G6RA 4LCYB 3FRPA 4Y16C 5D72L 4OFPA 5EZIL 1A14L 3EYUH 4U4BA 1JUFB 2R0LH 1A6TB 1T21B 2BNQD 4K3HA 1MFCH 5D7KD 1N0XH 3OJVC 1JJUA 1CGVA 4JZOB 3D3VE 1U93A 4NN5B 3FO2B 1I8LA 4GQ9H 1RVFL 1G7PB 2Q20A 2HRPL 5L7XH 3SKMA 4A2MA 1XR9A 3EJZD 2O61A 2NY5C 5I6XC 2Y5TA 2FX8L 2NY0D 4PRAB 3QI9B 1LEGA 3UC0H 4FXLA 5ITFB 5D70L 3MCKB 4G8GD 1A3RL 5K93A