1U8IB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkwan
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8iB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8iB01
4K3JH 1JGVL 3TYGL 1BBDL 3V7MA 1Q9OB 5AAWA 1KCVL 4GG6B 1D5MB 1EMTL 3FFCB 4Z77A 2XZZA 1MFNA 1QYGH 4YQXH 4EDXA 1INDH 1WBYB 4Z0XA 3C87A 4JO1L 2DQTL 5C9KA 3W2DH 3MRLA 5DZLA 4YHLL 1PD6A 3CU7A 4OUUA 1BX2B 4AEEA 5F8QC 2V7NA 1AGFA 3VGAB 3VFUB 4P5TD 4JVPA 1UVQB 3C09C 1JHKL 2IH3B 3I85A 4N9GA 5F8RC 1SEQH 3IDMA 1FNHA 2GJZA 2RQ8A 4MJ6A 4O2FA 3BKYL 1ZLVH 4MJIB 4DVRH 3MACL 5FKPB 5JHLL 1UYWL 4RCAA 3V0WH 4P4KD 4WEBH 2D03L 2VZOA 3M17A 4EDWH 3NIDE 2XZCL 3U30C 4IHOA 1LWRA 4Q2ZA 1OP9A 5B8CC 2FX7H 3CU1A 1BM3L 2HWZH 5HGBB 2MTPA 5ENWA 4BH7A 5JXAH 2KZWA 5DRXB 2OYPA 3O8XC 1UJTA 3BPCA 4BELD 5IFAL 1IGYB 4IRSD 5TE7L 1U92B 3ULVC 3BGFB 1X44A 4YHYB 4LQ1A 3G6JB 5IVXA 3BJLA 5ESAA 2GTZB 2V17L 3DIFA 1HQRA 3MSPA 5FV1L 5HDLA 3RVXD 1KJ3H 4GBXC 4GKOA 4NQCB 2HTLC 3ARDC 1MJUL 2VXQL 1NAMB 4XVTH 4HIXL 3GMOA 4PJDE 1P7HL 4NM4L 5JZ7C 1I9JL 1N8ZA 4J3XA 1CXLA 1W0VB 4UT9L 2FCBA 1ZLSL 3FRUA 5JXED 2JLLA 1RUPH 3O6LL 4RFEB 2C7UA 3V6ZA 4E0RB 1BQLL 1U8OB 5J3HC 3VFVA 1YPZF 4JPVH 1BIIA 4P3DA 3GMLB 5C0BB 4OQTL 1UB6A 3OZ9L 3BE1H 4B7IA 3JV5A 3CVHL 3FN3A 5DVMA 1P5UA 4FZ8L 4Z7UF 2YPVL 4HK3J 1ACYH 3BHBB 5E03A 1GAFH 3ARFD 1H8SA 1INEH 4R2GD 1AKJA 5KTEL 2RAMA 1JMZA 3BI9X 2IEPA 4BK4A 2X70A 5HYFA 1YEFL 3PDOA 4UTBL 4U49A 4NT6B 1R5IB 3VD7A 2DI9A 2O5YH 2HKHL 4Y1AB 3ETBF 5ICZA 3J7HA 4OV6F 4GLRI 1NMAL 3IJSB 1DBML 1XZ0B 4I0CC 1OM3H 3QP3A 4HIHB 1QA9B 4PGBB 3P4MA 4YWGL 4OAWB 4OJFL 4UUJB 4TOYH 4LARL 3B3IA 4WHTA 4KJPC 1Q94B 1K6QL 4G8EB 1FNEA 1R5WA 1YJDC 1NGXB 1AHWC 1LD9B 4OLWL 1PYWA 4P99A 3OHXB 2XPGB 2N7AA 1WZ1L 4DVBB 5KVDH 5AEAA 1FQ9C 3O3BB 5GS0D 1LEIB 1BZ7A 3KLAA 4WI4A 2ZG1A 4HF5H 3O4LE 4E41A 4L3CB 4QRTB 1EBAA 2HVKB 1IAKB 3TA3B 4NZUL 3NFNB 4J1UB 5FCSH 2UZXB 4WI2A 4LLQB 2J2ZA 2RJMA 4OCSL 2VDKL 4M00A 3QIUC 2VDLH 2ITCB 3B9AA 4FQXC 1P6FA 3TIDB 2HH0L 2FD6L 1A6ZA 3WFHA 5LGHL 3BVNA 3WDHA 2JJWA 4BH8A 3T2PA 1Q1JL 4M03A 2YUWA 1NCBH 4XCFL 1MCRA 2P46B 1JI2A 2CH8A 3VXNA 2Y23A 1M4KA 3CDGA 3L5WB 5GRVL 2Z4QA 3QEUB 3MBEB 3U0WL 3ULSB 4KQ3H 4R4FL 2R8SL 3C6LB 1NBYA 3N1FC 5C2BL 1I4FA 2IC2A 3LY6A 4NQEB 4HX1B 3EYVB 1H8OA 2GAZA 4OI7A 4MXWL 1LO2L 4NSKB 2CDGB 5I19L 1RU9L 5FYKL 1CD8A 1PFCA 5H37G 2BSED 3Q2CA 1LEKA 3VFNB 2X4OA 3LKRA 4XRCB 5JW4M 1LHZA 2EYTA 1N5YL 4I0PC 4YDKL 1ITBB 2NY1B 3RAJH 4C83A 5IMKA 3HC0A 2X09A 4FFVD 5BOZG 3IFLH 3QQ9D 4G7VL 5IBUB 2BNQB 3H3PH 2V2WA 5CJOH 2FX9L 1CFTB 4OF6A 4ZODA 4WENB 1OARH 1F4WL 3SGDI 4U1JB 3ZMRA 4PTUB 1J0YA 2GITA 3LKOB 5IOPA 4HUVA 4PJDB 1KNOB 3MZGB 3AXLB 2VE6B 2XY2A 1AGEA 2EEDA 4YDVA 3VXUA 3V2AR 4Q6YA 1K8IB 3B9KA 3GMNB 4FQLH 3SKNA 1IBGH 1JHLH 2AXHA 5BV7C 5C08E 1X5YA 3ZKNC 3VD9A 3BZDA 1N6QH 4W4OC 1HYSC 3VXRB 5DC0A 1QRND 4WEUD 3BGFC 2NX5D 5SWZA 4YHYC 4OLXH 1KEML 1WCBA 1YEIH 3GO1L 2DMKA 4K55A 3WJLC 5HVFB 1CGXA 3L3JA 1DTUA 3TESA 5DJDA 4HIJA 4LKXA 3PHSA 4JDZB 5JDSA 2FDBP 1QBBA 4MLIA 1L6ZA 4LOUC 3PWJB 4XP1H 2WW8A 4WCYL 5EU6D 4ESKA 2HJFA 3QDGD 4R0LC 1R3IH 1IFHL 3FO2A 3HUJA 2YOCA 4WTZA 3GJEA 3L5XH 1EUTA 1A7QH 4GMSL 3RGVD 4BKLA 1MFBL 3MRFB 4F33A 1QZ1A 3F58L 3MNVA 4MJ2A 3FQUB 4KI5F 2Q20A 1ZHBA 2W9EH 2BY2A 1Y6KR 2R29L 2NQCA 4JM4L 4I18B 5KJRH 1R0AL 1U8LA 4JQIL 4HLJA 4LLDB 1J0JA 4KRLB 1N0XL 3WKML 4IM8A 4JFZH 4RRPG 1SYSB 5DA0B 3SE4C 4ZTOL 3VFTA 1P7QA 3DBXB 5C0AB 2D3VA 3EAKA 4DUWA 5GGRB 3X17A 3B9VA 1CFQB 1T6VN 3IKCB 3SE9L 1B6DA 4TULL 3QUZB 3BAEL 1PGRB 2NY7H 5MEPB 3U6RA 2W1NA 2BSRB 2V2XB 5E8DH 1CG9A 3MGAA 1JCKA 4X7CC 3MRBB 1F2QA 4H5SB 3KPTA 3MO1A 3WDJA 1SHMA 3VRJA 4OIBA 4KK5C 4H1LA 5EUOA 1NDMB 2EKJA 4HKJB 4M7LL 1EO7A 2AEQL 4HPYL 3PGCB 2R2BA 1KOAA 2ITDA 4P5MA 3PL6B 2P24B 3PXHA 4U1MA 3U2SB 4DGYH 4R4BB 3LDBB 3Q6FB 4BSVB 1D5ZB 3K4DA 3TA3C 3BUTA 1HKLH 1YZZA 4N0FA 4DCQB 2VQ1B 1X9QA 5HI5D 1ZSDA 4JFFE 2KDGA 4XPBL 5F7DA 1K5NB 4X5WB 4H25A 4BYHA 5LXGH 1GIGL 1MJ7L 2BMKA 2OQJA 1MRFH 3IAQA 4AZ8A 4L4TD 4D0DB 4UT7H 4W6YB 3PHOA 4JFFA 3G6DH 4M9OA 4ODXA 3RTQD 4QXGH 3S8WA 4R90H 4XP9H 5F44A 5K93A 2Y72A 1OSPL 3T4AA 4Z7UE 4I3SH 4LEOA 3L9RA 3M8OH 1MI5A 3RKPA 3MLUH 5TF1H 1FC1A 1N26A 3GI9L 2BJML 2IPKA 3MRIB 1KLGB 3R4DA 4Z7UA 1NUFA 3WS6C 1QOKA 5JLZB 4ZXBC 1KLUA 5LBSH 4Z78B 4NJAL 2AVGA 3MUGB 5F9WB 3C6LC 3U7AA 3RUGB 5E8OB 3D6GA 3T2NH 1DVFB 5T3ZH 5D71L 3VXQB 3L7EB 4L4VD 4RAUA 5K9KA 4HS6B 3RVTC 4R9HA 2I9LA 3DV4B 4G8GA 3ARPA 3CUPA 4HUUA 3V6OC 4HUMB 7FABL 3KHOA 1NGZB 3WEXA 4FHBD 3ZZ1A 3R8QA 5FDWB 4Z7VB 1E4XI 5C0GB 4R8WH 3TNNA 1KB9J 2NY1C 2DJSA 3STZB 1K85A 2UV3A 4YPJA 3C5SA 3MJ6A 3VFRA 5JIIA 2H6PA 1MWAH 5DEGA 3QAZB 4NRYB 3MR9A 3ZL4H 3K0WA 2X89A 2WWKT 4K3GA 4U6YB 1RZ8B 1FRGL 1JYWA 3SKJL 3OG4B 3UO1L 2DWEA 4MJ4A 4ZOAA 2Z31A 1R3KB 1BJMA 1T20A 3K4AA 3P2TA 3MLYL 1T1WA 4PRDB 8FABB 3TVMB 1NLBH 1W8NA 2KQNA 5GGRY 4XVJH 3RL1A 3HE7A 2P5EE 1DBJH 1FZJB 1SY6A 2H3NB 2P5EA 2D7NA 1HXYA 3BZ4B 3FB7A 2HN7B 1UJ3B 3DI2B 1CR9H 5D4QA 4HH9B 5DUPL 1QR1B 5EBWB 5HHNA 5T5NG 4U1KB 4KTDH 1KTRL 1UB5B 3EDDA 3MLZL 1HINH 4N9OB 2Z9TA 3UBXG 4CDGC 4B5EA 4UIMA 1FLRL 3LN9A 2B2XH 1FDLL 3IDJA 3VA2C 4KY1H 4C56E 3S3PA 1FNSL 1HH6B 3GRWH 2A6JB 3D39E 3WFEL 4C56A 3SE3A 2X4QB 1ZT4B 1H3PL 5GISH 3TT1H 3ES6B 3MLRH 3QFJB 4ODTH 1FGVL 5C7XL 1CICA 3UYRL 3T0ED 4RZCB 3QPXH 3U0PA 5B39A 4WW2C 1T6WA 2VDNL 3P73B 3O11B 4NOFA 5CJ5A 4LSPH 5F3BB 2X1QA 4I18C 2PXYB 3L3HA 4WY7H 3ULUF 4U1GB 1E4XH 3EOAB 3WJJC 2EXWD 4TVSa 3W0WE 1AO7E 4JPKH 2FGWH 2ESVE 2E27H 1P7KA 3VU2A 3SJVD 5E08L 4HGWB 2J6EH 3O4OB 2ESVA 2GTWA 3OR7B 4FMFA 4YEFA 4L8SA 2BVEA 3LEXA 1LE9A 2BVOB 4K3HA 1LO4H 3O2WL 5D1XA 4D9QD 1YPZB 2AV7B 5D7IF 3JTTB 3QUZC 4X4YA 2R2EA 1QTYT 1IGMH 1T21B 4OD2A 3BGMB 4K7PH 5EO0B 4J4PA 2WP3T 5K59F 3LN4A 1XT5A 3GSQB 1UH4A 2EEAA 4G42A 4HCRH 3BRDA 1PZUB 1J05A 1RIVL 1H8NA 1A6TA 1U3JA 1V7MH 4OD3H 4U2YA 2HRPL 3WN5A 3SDXA 4LVOB 1I85A 1HI6B 1B90A 3KNBA 3RHWF 1U95B 1FORL 5KSAD 3D0LA 4G6KH 4KVCH 4K9EL 4HKZB 3U9UA 4FZEL 1T0NB 1X5ZA 3CX5J 3BP7B 4O02L 2FZ3A 5FYJL 1MVUA 5K9JL 1K4CA 5E95B 4PB9L 1FL6B 2C1PA 4LEXL 3UTSD 4NNPH 1FNLA 3QXUA 4QCIB 1J1XH 4ZAKA 3VWJB 4GKZB 4Z76A 1CXHA 2BCKA 1A6WL 5EC1A 4XPGL 1NBQA 3L5HA 5GIRB 3HFMH 4U6VL 2BNRD 1A7RL 5TJWK 3GMQA 4WUUD 1N7ML 3NN8A 3HLAB 2GJ6E 3HNVL 1URLA 2QQKL 5CEYA 3F7VB 1FYTB 4G5ZL 2GJ6A 4QHLB 2HFFB 5F9WC 2CR3A 2V7HA 1DFBL 1BAFL 2GEEA 1DVFC 1DR9A 3QNZB 2VUYA 5FCUL 1FZMB 5GRXG 2P5WA 2DQFB 1NSNH 4ACPA 3D1MC 2I9TB 5IESH 1G7MB 4XWOD 2RCSH 3LEVL 3QUYD 1CQKA 1Q0YH 2EDKA 3E8UL 3GSOB 3OPZL 2OR7A 3U36A 1DBBL 3EFFA 4UILH 5DJXB 2DB8A 3F7YB 2I07A 3EFDH 5EU4B 5FYLL 5B21A 4HG4K 3KPQA 4CNIB 3OGOE 3WNKA 4DZBB 4JY5H 3ZYJA 1JWUA 4XP4L 3R06B 1UCBH 2CLZB 2MCG1 5DJZB 4XVSH 1I8IB 4G7YL 5MEQA 2F8XC 3RWCA 5HYIA 1IM9D 2B1HL 1SMAA 3GNMH 3VWKB 4GW5A 3TJEH 5ANME 1WC7A 3S36X 3PDGA 4YEEA 6FABL 2YPLE 4LLAA 3FB6A 3TVMC 4JZNA 4F7TB 4OZFB 3WS3B 2R0KH 4BUGA 1DEDA 4WVRA 3SBWA 2D4DA 3DX7B 4RMTA 4HEME 5EU5B 2PW1B 4JO4H 1MRCH 4JFPB 1C16A 2P8LB 3GK8L 2IADB 4FTVB 5T3XD 4C4KT 2AJSH 2YN5A 3K1KC 3ARBB 1UJ3C 1DQML 2DL2A 1I8KB 3CD4A 1MH5B 4YFDB 3TF7C 2VQTA 3X11A 5IEHB 2ICEB 2Q86B 1A9BA 3FQXB 1HE7A 1MCBA 2EO1A 3LS4L 1KC5H 2EYRA 4XC1H 1IM3B 1FPTH 1D6EA 4PJBE 1ZAGA 1L9NA 2KL6A 5INDA 1JZ2A 1OAYL 3ARUA 3HRZB 4PJBA 1U3HD 3NFPA 4EUPA 3QNYB 3MV8B 2XYCA 5IF0A 5LJYH 1DBAH 4OKVA 4LIQE 4DZ8B 1OAKL 2OJEA 3SGKA 5CP7A 1G7HB 3BEVA 4NFBA 1A14H 2DAVA 3BO8A 4YHIA 2VL5B 1DQJB 2BNUB 3FOLB 3UYOD 2PXYC 4ZFOA 4YIQA 4U1GC 2PTTB 4ZOEA 4J6RH 4NNXA 4PBVC 2ID5A 4M5ZL 3S35L 2FBJH 4YJZL 5FOBA 3QJFA 5CSBA 1VFBA 4LVNB 3CSPA 3EYQD 1M05B 4KKAC 4HUWB 3O4OC 2X44D 2JF1A 1BJ8A 3IDYB 1XGPA 2QJDA 1H15B 1WWCA 3L1OH 4ENEC 1NCTA 4AK1A 4G9DA 3DETC 4Z7NE 2VLKB 1T83A 2AXFB 5CJQL 2VJXA 2ZCKH 4MNQB 3PWLB 3S3JA 4TVPH 3VXPA 4C58B 3EYOB 1OHQA 2NY4B 3FO0L 1TETL 2HRLA 1P1ZB 2R23A 5DWUL 3ZDYF 5FHBH 3DMMA 2BOCB 4XVUC 4LVOC 4Q97A 1MFDL 3BOVA 3Q5TA 5FO7A 3G04B 1DSFH 1CD0A 4X4ME 5KSBA 2ED9A 3SCMD 2J7LA 2HFTA 2MHAB 1YEHL 2QSCL 1S5IL 1JI1A 4KJYA 2AKRB 4KXZI 4X4MA 1AIFA 3KPSD 2DWDB 1EFQA 2Y7QB 4K8RH 3DHJA 3LKQA 1VCAA 3MRPB 4XWGL 3QZWA 3RIFF 1RZFL 2H1PL 3DYPA 3JWOL 3SO5A 1U58A 4QEGA 1KG0B 2J8UB 3VWJC 3QDJE 5JPMB 4JRYE 5FGCE 2NZ9D 4JJ5B 4XI5D 1IQWL 4X0KA 2YMXL 3ULUE 5CZXD 1SBSL 3AU1A 3TYFB 1ZWIB 2R39A 4WUKH 1A1NB 3TWCL 3BRFA 3W39B 5HGAA 3KLHC 3SDAD 1T7VA 1FV1B 1JGEB 1OCWH 5DGQA 4NC1E 2DQUL 3C5JA 4RGNB 1LK2A 2B1AH 3FT2A 4XCYB 4GFTB 1ERNA 4XNQA 1YMMD 3GBMH 1J88A 1G6RL 2ED8A 3VH8A 3ZHDA 1OGAA 4RBPK 2GIYA 4OM0L 5MEND 1F58H 5D7IE 3WCYA 4PJ7A 3KYMA 3DRQB 4DTGH 1T5WB 3OAUH 5K59E 15C8H 1NC4A 5IBTH 4N8CH 5TPWL 1XGUB 4JCLA 1JGUL 2VKWA 3TJHD 4N1CA 2ZSVB 5E6IA 5FF6A 3MV9E 4ZQKB 1UWXK 1KJMB 4JKPL 1A4KB 5I17B 3GSXB 5DTFB 1LK3H 2Q8BH 4YGAB 1U8PB 3OTTA 4MA8H 2I5YL 4HJJL 5IBUG 2NY2B 4CN1A 5JDJA 5DMIL 3ULVL 4YUEH 1JPSL 2DICA 2W0FA 4IIQB 2F5BH 1D5BB 3TGXA 2C3HA 5D9SB 5GJSH 3FN0L 4H88H 5T1KA 4MA3B 5JPNA 3EOBA 4E42A 4OB5H 5ICXB 4XGZA 2ARJB 1MCIA 1MWAB 2VXSH 4PLKD 1OY3B 4QWWC 1U0QA 1WVZA 4KXZH 1MHPH 3KG5A 2IF7A 1HHKB 4XNMA 3B9EA 2ZKHH 1T03L 1EAPA 3OJDB 5HDBF 5EU3A 1XGQA 1MCHA 4XCCL 4FQQB 5D2NA 4NIKB 3L5IA 3RIAF 3QDME 3CSGA 2PW2A 3CFEB 2R56L 1XR8B 3AGVA 1Y18A 1C08B 1YY9D 1SJVA 3QDMA 3ARBC 3E3QE 1AQKL 4JEGB 3TPUA 3EGSA 25C8H 4IMKA 4ZFZA 1BQHA 5E8NA 1KSRA 2N56A 4OZHF 3A0OA 5C9JB 3O45B 4XTRC 1N2RB 5E2TH 5EO1B 1HYRC 4ZNEA 1BF8A 3F7PC 1KCUL 4JFED 3VW3H 1ZGLM 1GJIA 4PJEE 3ZKXB 1QBLH 2IAMA 4L3EB 3TIEA 5EU7E 3T0AA 3UPCA 5FIEA 1MNUL 3LIZH 4L8BB 1FNAA 1QBMH 4PJEA 3ARYA 4PJFF 2AJYH 3BRGC 4Y5YA 2FIKB 4J3UA 3OB8A 3KXFB 1NL0H 3T3ME 3CLFH 2C1OA 4WI9A 2XTJE 5CIPA 1QBAA 5JORB 3UTTD 5DMGC 1NBVH 5F7WC 1XAUA 3KJ6H 5K9OA 3QHFL 4YBHA 35C8L 3GKZA 3LPFA 1CGSH 3JV6A 4HDIA 4LVNC 5GJTH 4WWKA 3REVB 3QWRA 3QEQD 5SWQA 3HZMB 4M8QA 2A74A 3UJTH 3V79C 3IDYC 3I3DA 2OTWB 4FNLH 2ZG3A 4KI5C 3QDJB 4DWHA 1B0RA 3AC0A 2H2PD 3JVGC 3WFBH 4ZFFB 4KKLC 3BMVA 5FA4B 4OLZL 4X6CF 1ZLUH 4YHNA 2DD8H 2ZJSH 4N1HB 2M26A 3N85H 4BFEA 3F5WA 5GGVL 5CINH 2EC8A 5J1TC 5ID1B 3ROOB 3QIBD 5FYJU 3SQOL 2V2TA 2ZOLA 4M8VA 1Z3GH 5IW6B 4HUXB 1KJ2A 3B8YA 4NHUB 5D7LD 3UTQB 2WWMC 2NR6C 4G6FD 4U3CA 1TJHH 3NVQA 4XPFH 4U1NB 5F9JB 1Q9KA 4FQJL 2Z93B 4MQXC 4AIOA 1XGYL 4X7TB 1A7OH 1QLFA 3LHPH 4J8RB 3BQUD 4OV5B 4H20L 5IWLC 2Y06H 1NLDH 2MNUA 1L4IA 4P48A 4P2OA 4M43H 1JZ6A 2F53E 4OGAD 4G8FA 3CFDA 4OGYL 3U4EB 3GSUA 3MXWL 3SDYL 4P5KA 4K23L 2OZ4A 2F53A 2VDMH 3C60D 1BJ1H 3HG1E 5D1ZA 5IMMB 2HG5B 4RGNC 3P77B 3T77B 4WHDA 5KSVB 3CH1A 1KENL 1BD2B 5DI8B 3BUYA 4OLUH 2ERJB 2R0ZL 3QNXB 3QA3A 3K7UA 5EUKB 2K7QA 1HH9A 1ORSB 3DUUA 3I6LE 5JUEH 4P46B 4PJCE 2DLEA 2MPAL 4I2XE 1J8HD 1UKTA 4IDLA 2A6DA 2ZZUT 4U0RC 4WWID 1X5HA 5F89A 4PJCA 1AQDB 1BEYL 3O2VL 1PEWA 1ZMYA 5CEXA 1P9MA 3BKJL 2G75A 1XIWB 3IS0X 5BV7L 2VZUA 3KPOB 5BS0A 1ZLVK 3C6SB 4S1DC 1VFUA 3RX5A 3NBNA 3RU8H 1FZKB 4GUPA 2NY2C 5A3ID 1NCCH 4MQSB 5A16B 3B2UD 5IT2L 2DJ4A 2X7LA 2CMRL 3PP3H 4IIQC 2XQBL 4XX1G 4PJGE 4U6HB 3UC0H 4P4KA 3G5ZA 5CSGA 5EORH 3ARGB 4RWYH 4V2CB 4PJGA 5E1HB 1OSZB 1TZGH 3PHQB 5F1IB 1G6VK 4QOKB 4NNYB 3RVWD 1C12B 5FA3A 1HQ4A 4X4XA 2H2SC 1J7VR 4LLWB 5C3TA 5GRYA 4P2QD 5F21B 4KK6D 5I1KL 1VENA 5D93B 3H42L 1S3KH 4MD4B 4NJ9H 4XZUB 4AMKL 5D1QD 4H1LH 1B4JH 3MCLL 5BXFB 2E9IA 4K3DH 4QXTA 4YHZH 4CKVX 4LCUB 4RQQB 1ADQH 4XB7A 1QFOA 2JJTC 1NCDH 5GS2H 3JWDL 5I1IH 5IFHH 2AEPL 5IIEA 4K7PY 5JXEA 2VRAA 3UDWA 3CDFA 3MRQB 2HTKC 3QI9C 5DD5H 3O3EB 4LSQH 3QEHB 1M6OB 5HI3D 4DKEH 1PLGL 3ET9F 2EDRA 4P23D 3BIKB 5I74B 3LEYH 4EN3C 4LAJH 1CIUA 1GSMA 5GSRA 3MZTA 1I1AD 1SJHA 4OF3A 1RJYA 5GZOD 5L7XL 5HGHA 2K9UA 1IEBA 2X4SB 5HHMD 5IB3A 4A6YA 2BVQB 5KW9H 1S9YA 3L95B 4QHMA 2NLJA 3NFSL 5E9DA 3VXMA 4PG9B 2NY0B 2R4RH 4ELMF 3NACH 4EBQL 4CMHC 4DFIA 3UEZA 3ARSA 4EI6A 3AY4A 4S2SA 2YD4A 4NHCH 1WEJH 3TN0A 3OXSB 5HDBE 3IXTB 4PRNB 3QIWB 3B5GA 4OLYL 3SQBA 2A6IB 3L3DB 4P3CH 1OAQL 5D5MF 1IKFH 3NCMA 4H0IA 4MYWB 2XT1B 1S9WA 3SDDD 3ULUC 1RPQA 4GMTH 4HH8A 1KEGH 1A0QH 2ZOKB 4LLVB 5IB2A 1WT5C 3CC5B 4UDTA 5GGSA 5KVEL 5BJTB 3VXSD 1P4IL 3MUY1 2YK1H 4P59L 4Y5VA 4NN6C 4HHAA 4OZHE 1RY7B 4LHUD 4G80A 5C0NC 2HYMA 5DJCA 4LLUA 1MPAH 5GS1A 4MDJB 1MIMH 4XBPA 4OZHA 3NA4A 4PRIE 1CE6B 3PGFL 4I2XB 2A0LD 4HXBL 1U8MA 4LGPB 4OIIL 3FZUC 2PR4L 1WWAX 4MNHA 5BRZA 3FONB 5HHVH 3SPVB 2HT3C 4PJFE 4PRIA 1D5IL 1UXSB 1M7IA 2YC1B 1DBKH 3MRLB 5DS8B 3WO4C 4OUUB 3H7BB 5E5MB 4G8IB 4OBSA 4PJAF 4PJFA 1NAKH 4ODHL 3U1SH 4LAQH 3MXVH 3STBA 2IPTL 4MD0A 3PP4L 3E6FB 4O2FB 4JANA 4PY8I 2OL3A 4IRJA 4X6DF 1SY6H 3GSNA 4ODSL 1L7IH 1YC8A 4JHWL 4IHOB 3RKDC 4OCLC 4DUVA 2P47B 2VDPH 2PO6D 3D0VA 3B6SB 4BH7B 3DO7B 1C5DA 3CFBA 4P46C 4KROD 5E8EA 1T3FB 4ONHA 4X6CE 4JHZA 3O6KL 1DQDL 5GRUH 2AJVH 4WHYH 4NCDA 5EZLB 4PJIE 4JR9L 5C0IA 1XIWC 4X6CA 2WMPA 1CZ8H 2B4CH 4PJIA 3GMOB 4ERSH 3V9FA 5EO9A 2A6KA 3KPMB 5DURD 2V9RA 4LDLB 2B0SH 1FFQA 3FHAA 1NC2A 3CFCL 4KMTL 3E3QC 5JOPD 4PYGA 4NO5B 1LO3L 1T66C 1E4WL 4ZUWB 4M62L 1FE8H 4KDWA 1X7QA 2C7UB 3V6ZB 2WP3O 4LFHD 4L9LB 3HCVB 1T1XA 3QUML 3F62A 2EDQA 3I75A 2WAHA 3SDCC 3T2OA 1QRNE 1HHGA 4KAQH 2NX5E 4KK9C 3NZ8A 1X5AA 3T0VA 1U93A 2WINA 5K9QI 2DQHH 4OZFG 1G0XA 1PG7X 4R2GB 4W70A 5EU7C 5I1EL 3CLEH 3QHZL 2HTLD 2EDYA 5DLML 3ARDD 3QJHB 5ILTL 2X70B 2WBJB 4BQ8A 1N6VA 3OKDA 3PDOB 5EU6E 4HWEH 4YXKL 5D93C 4MCZA 3HC3H 5ICZB 1I8LA 2DYPB 3GGWB 5DD1H 4MVBD 2MCPH 4JY6A 2F58H 3IDGB 5DJ0B 2GK2A 2GFBB 3P4MB 4PGCA 5DO2D 5J3HD 5F1OB 3HI1B 4WHTB 1FNEB 1R5WB 4NRXA 3MLXL 5DD0H 1DN0A 3RGVA 3BH8B 3DTXB 1I7UB 3WIHL 1KN4L 4R4NC 2XN9A 1EHLH 4V1DE 3E2HB 3KLAB 5D2LA 1PEZA 5DJ8A 4E41B 4XMPH 3NCBB 1ZVYA 4QHNA 4V1DA 2CDEA 3HZKA 1DE4A 4M7KH 2A73A 3UAJC 3NH7H 2HVJB 3DRTA 5AYUL 4LHJB 3HPJA 1PSKL 1JFQL 4OUOA 1CL7I 3L3GB 5BO1H 3T09A 5I1EH 4LCCB 4XNYL 4KJPD 4OTXH 8CGTA 4NUJB 2NY0C 1IMHC 3GMPB 4KGJA 1G9MH 1I9EA 3PXJA 2QHRL 5EN2A 1Z9OA 4BH8B 5DUBA 1IGTB 5C0CD 4PY7B 3QIWC 1QSFD 2YPKA 4WW1B 4CGTA 4GRWF 3HZVA 2Y5EA 3CDGB 5EZJA 4PRBA 1DZBA 2Z4QB 4OGZA 3BT2H 1BGXH 1NBYB 4Y4HC 2FX8H 4MAUH 4JLRB 3U48A 4G6ML 1I3GL 3NPSB 4DKAA 1JZ7A 3IDNA 2DQCH 4AENA 1TTUA 1QPPA 1T80A 3QIUD 4NWUH 3VGDA 3MRNA 4Y4KA 4L4TE 2FO4A 4G6JL 3I6KA 1FGNL 1J87A 2X4UB 2P1YA 5I1LB 5FUZL 3K80A 1MREL 1S7TB 1MCCA 5GSVB 4KHXH 1F3RB 2WUCH 4HFWA 1V7NL 4C83B 3HC0B 1Y6MR 4YC2B 3OX8A 3QRFM 4KKCD 3P0VH 1KTLB 3F8UB 3Q3GA 3NABH 4C4KO 4ZD3L 2XKUA 3RWHA 1QHPA 1NJ9B 5IHUH 5BQ7B 4P5TC 2CKBH 3BSZH 1TVHA 43CAA 3TBSB 4HMEA 1PBYA 4L4VE 2VLLA 1CU4L 1KV3A 3MRGA 1RD6A 5AWNL 2L7JA 5L6YL 3MV7D 2DQGH 5DUMH 4ELME 1HHJB 2VB5A 4QTIH 4QGYA 1T7ZA 2OXGA 3P9MA 3F12B 5CILH 4Y2DA 3KPLA 2AEIT 3RX7A 4F7MB 1J1OH 4RMVA 3QCUL 1DQQA 3S4SB 2BFVL 4I0PD 4OI9A 1YNTA 4X5XB 2BDNH 5D5ME 4DQOL 1QFUL 2ZUXA 1A7PH 1QYGL 1YDPB 4IRSC 4ZUSB 1LO5B 2JJSA 5DDHA 1YN7A 4QRRA 5J56B 4TTDC 4G3YL 5SWZB 2X4PA 4LPTA 1WAAF 4ORGA 4UV4L 3IDUA 3FQTA 2YKLH 3RVXC 1ULVA 4ALAH 4CW1B 2UWEE 2R15A 3BDYL 3VFSB 1C1EL 1KPVB 4JG1H 5DJDB 3W81A 3T1FA 3W5MA 1EBPA 1F3JA 1MSPA 1I9IL 3RZCA 2UWEA 3QDGB 2ADGA 2HJFB 1MEXH 1UXWA 4WEBL 2J88L 2B20A 2R0WH 3VXTB 4XCNB 5IQ7L 3EDKA 2PETA 4JZOB 4EOWL 1VFAA 4L9LC 4Z95H 3SGEH 5F3HB 4RIRB 3SKMB 1H0DB 4HKXB 4QRSB 4EUPG 3S34L 1UACH 2OR9L 3VD3A 1B0GA 2DMCA 3ARFC 4R2GC 5DVKA 5ALCH 3VGFA 1QR4A 3VFTB 4NQCD 5CJXA 1E6JH 4LOUD 3AMKA 5E1AA 2EKSA 3BZEA 2WBJC 4XP6H 4KKNA 5DYOB 1MHHB 1EA9C 1BVZA 1MOEA 2VN7A 3P4NB 5AD0A 1QLRB 3T0EE 5LGJB 1GGIH 5D96B 4P3WA 4HBCH 3ME0A 5C0FB 5I1JH 5EUOB 3FRPA 3OGCB 4ONGH 3KVQA 2P43B 1ND0A 4ZTPH 2BRQA 4M6MH 3E2HC 3WFDH 2OLDA 4LVHC 1D7FA 4U1MB 3SJVE 12E8L 5B4MC 1K8DA 4RISL 1ZA3B 4N0FB 3S97C 1F4XH 4U1SA 1YEDA 4Y1AD 1ZSDB 1JNNL 3GSVA 1LNUA 4OQTA 5F7DB 1OM3L 4D9QE 3CVHA 4KVNH 4Q9CA 1AY1L 4P9HL 5IW1B 4XXCC 4JRXB 1PVHA 3PHOB 4LCCC 2GT9A 1EGJH 2EH7L 2VXTH 3QUXA 4YR6A 4KK5D 1B3JA 1C8PA 5EBLA 1RZJL 4LEOB 3QFDA 1MI5B 3UJIL 3CFKA 1NFDF 1OVZA 2Z35B 4UI2A 5B38A 1ZA6B 3PV6A 5F1KC 2O93L 3QT2A 1CDCA 4XAWL 4NQDE 1EHAA 4OFYD 3EJYC 2I25N 2R1XB 3ZKQD 4AM0A 2A77H 5KSAA 4JPWL 1ES0A 4NQDA 4P2YA 3K8MA 1JGLH 2X10A 3TO4D 3NPSC 3VG0H 5I8KH 4HMDA 3UTSE 5TE6L 2VDOH 4NKOA 4AIXA 5H35A 4JN1H 1FNGA 1A6VH 4LNRA 3GB7B 4AG4H 4R96A 2VLJA 3PIQA 4HAFA 4OFDA 5FM5M 1RJCA 4WEMB 5L2KB 3WEXB 5IGXL 5HXMA 3CMOL 4TUKH 4NBXB 4PRPA 2D2OA 3JV0A 3OKMB 2BNRE 5D5MB 3NAAL 1NCBL 1JZ8A 4FFVC 4GXUM 3QQ9C 2FEDD 3OB0H 2BNRA 3MBED 2R1YB 4JY4A 3C6LD 5DEGB 1I7ZA 1JRHI 3MR9B 2H32H 4BZYA 4M1CC 4NQED 4RAHA 4D0CA 2EDJA 1U8KB 2HLAB 4JDTH 5CSZA 2YR3A 4WFED 5HYJA 1KCKA 3O6FA 5KBNC 1UM5L 5IR1B 2YWZA 3VRLF 3I50H 1CE1H 4JFQA 5DT1L 4XHJC 4PJHA 2HLFD 3BP5B 1SVZA 2X4RA 3QRGH 3QSKB 3PNWB 3RNKB 3TT3H 3P4OB 4CVZA 3IU3A 1AGDA 4XPHL 2ZNWA 4NKMB 5EOTB 3QUYA 4GAFB 2GK0B 4GRWE 2NY1D 1A6UL 3FAWA 1FZOB 5I8CA 3ZHKA 1AFVL 2BNQD 4PJAB 5F1NA 3DUHA 3O9WA 3GBNL 3D85B 3OAZH 1OARL 4I77L 5LG1A 4NQTA 5HHNB 3LPGA 2H45A 3W11C 3MPCA 3BKML 3DWTA 1I7RA 3EDEA 4X6DB 4YFLI 1D5XB 4OQ1A 5IBLD 3BIBX 2MMXA 2WLYA 3I9GH 5F97E 4NQVB 5C0EB 5J8OA 4LPCA 4ETQB 2V5YA 1KT2A 1V3JA 4JFYB 2ZP0T 4GSDL 2BVPB 4XPTH 3PV7A 3TBVB 3OKKA 3P0GB 2DQJH 3D18B 3HZYB 4X8JA 4XT1C 2QQQA 4ZNCD 1EJOH 5CIPH 1CCZA 1LILA 4GW4B 3SKUD 3IETA 4JFXA 4YHPB 1CICB 4ZYKA 1ED3A 1G0DA 4HK3N 1PJ9A 3VXRD 1TCRA 1NFKA 2VABB 5T5FL 5T3XE 1CF8H 3N9GL 3VI3F 3PABA 1G7LA 1U8NB 4WU5A 5HHXL 2AAVA 5EBMA 2A2QT 1DJSA 4X4ZA 1WUNT 3SJVB 1P7KB 2R9HD 4NYLA 2PYFB 2X2YA 1TJIL 4JFOA 2R69L 2SEBB 2P42B 3NCFB 1JRHH 2GTWB 5J11B 3LEXB 2A9NH 4LSSH 5CEZD 4Y88A 5EIVA 1EXUA 2WQ8A 4X80H 1S7XA 2WIIA 2JK5A 2R2EB 3MUJA 1XR9B 2ADFL 4POYA 3STLA 1ZT7A 1EFXA 3BISA 5DQ9A 4G42B 4MQ7B 1A5FL 1IGIH 1ZTXL 3LH2L 1CXKA 3ARVA 1MVFA 2D7PA 3QH3B 3WL9B 1J05B 4Z7WF 3S88L 5D96C 1C5CL 1U3HA 4HK0A 1FL3B 5IMOB 3MOBL 1U3YA 2IGFH 3ECBA 5J9PA 5JOFB 5LAXB 3WN5B 1FC2D 3SDXB 3KNBB 2V5MA 5IK3B 2ICWB 4H0GA 1RZKL 2HT2D 1S5HA 3DURA 4ZFGL 1YECL 5LQBL 5C0AD 3MRDB 3A6BH 1YEKH 5BVJA 1U8QA 4M5YL 4I13B 4XC3L 1K4CB 2V9TA 1HHHA 2XA8L 5TF0A 5HI5C 1M71A 1UZ8B 1AGBA 1YEGH 3UTSB 2C1PB 3IDIA 4MAYB 3WUWB 2CLRA 5H94B 2OMNA 5IP4A 1WZLA 1VEOA 4RGOH 5I30L 1P2CB 2DLFL 4ZAKB 1Q72L 3RTQC 3DJ9A 5DQDH 2VDQH 5F7NC 5FGSA 3SHSA 4ONFH 4RFOL 1B2WL 4DGVL 3VFGH 4M9PA 4U1IB 2FWOB 5EIIA 4OZIA 4WUUB 1QFWI 3ZE1F 1MRDL 3MLSH 1TJGH 3DOSA 5IVZA 2DI7A 1T2QL 1YY8B 3W5NA 4HXAL 5HGGS 2YD3A 1N5AA 2NNAB 1HZHL 2HKFH 5SWSA 3PL6D 4DGYL 4YDLB 5GRJL 1J86A 2DM7A 2HJKB 4J7RA 4UOJA 2HA1A 4TSBL 4CDHA 3KPSE 2V5RA 3MNZB 3SCMA 1OP3H 3V5KA 5MHSD 1NMCC 5ISZD 2QBWA 4K94H 2YD1A 3QWOA 3UPRA 4LVEA 4TRPH 2P5WB 3CK0L 5ADOL 5E00A 3KPSA 3THMH 1R5VB 4LGRB 1GRWA 3LQZB 4LPXA 5J89A 1AP2B 3IFPB 3MQIA 3M8OL 1UM4L 4GRWB 3ISWA 3U7YL 3IDXH 4KZDH 5EWIL 1KIQB 1G7IA 1WTGT 1VGKA 2P7TB 3ZT5A 2E8YA 2OJZH 3KPQB 1RURH 5CMAB 1EERB 3C2AH 4ODUB 3UYPA 2H9GB 1V8HA 2N7BA 3SDAA 3G5YB 3T2NL 1IM9B 3TP4A 1DVFD 3CDYA 1OGTA 2VITA 1CFVL 1XH3A 2FHFA 4AH2A 5MENE 4JO3L 2OX5A 1BFTA 4FQIH 4GQ9L 5TE4L 1WC7B 4RAVA 5MENA 4M6AA 1CL7L 2IPUG 2R4SH 4JZNB 4YLQT 3PGDA 2CKBB 2QHLA 2ZUYA 4J3WA 3K2UL 1EO5A 4JFDA 5EZIH 4N8VB 1N3NA 1WBXA 2APBA 1EZVY 2IJ0C 5DEFA 1I9RH 2VZVA 1IEAA 4M1GL 3RPKA 1QNZL 5T1MA 2ILLA 1GGTA 5KZCB 2WBWB 2YA1A 1X5JA 4CU8A 4L8CB 1OD7A 5DMJB 4GAGH 4N5ED 1ZK9A 3V8OA 1T7WA 3EBAA 2YBRB 2OS7A 3ESVF 5IHZA 2EECA 2L7UA 5ID0B 4LIQL 4YNYB 2QSVA 1IGJA 5HHQB 1S7QA 4FFZL 5KVFH 1A9BB 5BVPL 1RHFA 4S1QH 1RMFH 4HWZA 3EO9L 3Q6GL 3TVMD 4TN9A 3EIFA 1XF4B 5DEZA 4C57C 1KTDB 5J6GA 1DBJL 2E6JA 4A6YH 4YO0B 4WTXA 3T0EC 3NFPB 3VJ6B 1MUJB 2B5IB 2HFGL 4QT5B 1S7RA 5CP7B 2IMNA 3BEVB 5L2JA 2UY7A 3H8NA 1T1ZA 1U8IA 2E7LC 3RRQA 4R97B 5ECJE 1CLYH 2CK0H 3JUYA 3U83A 4QRUB 3PWPD 5HGDA 2VISA 1IZJA 4LKCB 1GC1H 4X6BA 1QACA 2AERT 1IAII 3A67H 3GHBH 1C7SA 4PJXF 5ESQB 5J11C 5BW7A 5L8KB 4HEPG 4JFEE 2XWBB 4OLVH 3U4BL 3MLWL 3QUKA 4A2LA 5L88H 3VDBA 2VR5A 3QFJD 4JFEA 1S9VA 4C54A 4YDIH 2ZG2A 4QRPE 5F9OL 2N1KA 3LD8C 4LSPL 1JMXA 2PXYD 2IQAA 4HLZG 4QRPA 3UTTE 4PJ9A 1P6AB 3MMEA 1F42A 5FO7B 5JMOC 4PRHD 1OT2A 3MGOA 5KSBB 5T33L 1KBGL 1VKXA 4UINH 1HSAA 3UTTA 3DX8A 1BPVA 1YQVH 3Q5YA 4PJ8B 3ULUL 2XQYG 3MBXL 3QEQE 5GGQH 1GGBH 2WUBL 5JA8B 3DETD 3QZWB 4MAYC 4N5UA 3WHE0 4DKFH 4FQ2H 1EDQA 1TTGA 2GY5A 2OL3H 1ZLUK 3GSNH 4DEPC 3LKNA 5F6HJ 3DYOA 3F6LA 3ILQD 3OKLA 5DR5H 3VI3E 3VI4E 4OGXL 3AB0B 1IT9H 1MJ8L 1BFVH 1E6OH 1P4BH 3H9YA 4XVUD 4OT1L 2MOVA 3B5TA 1J1PL 1YYMH 2OM5A 3C5JB 4M02A 1JNHA 4AJ0A 1KELL 3ZO0A 1T5XA 5HDQH 1A7NH 1YMMB 3FT2B 4MCYB 4YDLC 1G9MC 2FBOJ 1KPRB 4I8DA 4L29A 5D7LE 4QNPF 4PV8B 1N59A 3OKNB 1CLZL 3BP4B 2R0LH 3GUTA 1BVKA 4G9FD 5GHWH 5I16B 1SM3H 3MA7A 4PJ7B 1HSBA 4M1DH 5FM8A 1NC4B 4DW2L 3VWJD 1J5OL 3WSQH 4XWOC 4JN2A 3S96A 4LSTL 2F74B 3FCTB 5FYJE 1IAIH 2IWGA 4Z7WE 1NFDB 5FF6B 1X4XA 5DJ6B 4Z7WA 1YEEL 1TQBB 4PIRF 4POUB 3RPIA 1FYTD 2VXUH 2ADIA 3SO3B 3IJYA 4TPRH 5IROC 5D7SH 1OOAA 2VAAB 5CD3A 2GSGA 3EOBB 4E42B 2Z0BA 3EYSH 5E0QA 4XGZB 1J8HE 3ARQA 2HMID 4X7SH 1KGCE 2H32B 3V4PL 3V52H 1CD1A 1J8HA 4XNMB 3ZE1E 2JCCA 3G5VA 3JZ7A 5KOVC 1EAPB 1Z9LA 3S4SG 2PYEA 5HVGB 1YN6A 5D2NB 1P84J 3Q1SH 3W9DA 4JY5L 3MNWA 1UWGH 2Q6WA 4H26B 1F5WA 2JTDA 3PP3K 4PP2B 3MRKA 4HV8A 1S7SA 4IOSD 3DSFL 2BSTB 4S1RH 3J8F7 3TPUB 3EGSB 1MJJA 3OF6A 1F4AA 3VWKD 1BQHB 1JNLL 3BW9B 3G5XA 1IGCL 1JZ3A 1ZE3C 3V4VH 2F54D 5JNYA 2DQIH 3CVIL 4F7PB 2EE3A 3F7RA 2CLVA 3TC9A 2FYYA 4Y7MA 2AABL 4FQ1H 5FK9A 5AZ2H 5TQ2H 5C86A 5KG9A 2LTQB 2G9HA 1GOFA 1FAIH 1U36A 4P2QE 3S37H 1MFAH 1P69B 3TZVB 2B5IC 5J6HB 3RL2A 1U6AH 4FTVD 4K2UH 3FFDA 3ARBD 2EDTA 2O5XH 4NM8H 2QQNL 2Z8RA 4R97C 3WFCH 3FT3B 4FA8A 1HWHB 5C07D 5IKCB 1T04B 4PGDB 2DOCA 4FQCH 3JV6B 4PR5A 4JM2D 3EYQC 4XTRD 4EI5A 5DK0A 5E6YA 3WXWH 1FPTL 3KPPB 3V5DA 1A3RH 4O00A 1KJ2L 4Q9BA 4JCMA 1B0RB 3IJHA 1IRAY 5DFWH 5CUSL 3KAAA 1I7TB 1GPOH 3MV8D 5J13B 1WFNA 4RRPA 4Q9RL 3NIGF 1SJXA 4LRNH 1Q9LA 2EDLA 4LSUH 3MCKA 1I1AA 5HHME 1DLFH 3GIVB 1JIBA 1CDHA 3MLTB 2DM2A 4NKDA 5DMGD 4NQSB 1DP0A 3DGGA 1E27A 3AROA 2ZOLB 3ZE2F 2ATPA 1U42A 3MROA 1J0KA 1MHEA 1RK1A 2XRAH 4KMLB 4U3XA 3EJZD 2OZ4L 3WFZA 1OAUH 2CGRL 4PJ8C 3GHEL 1J0HA 1HILA 1SYVB 5D8JL 1RIUL 1JPGA 3RA7H 3CXHK 2YD5A 5KSUA 1H5BA 4O9HH 3HI6L 2VLKD 1JPTL 3BD4A 4GG6F 4KKLD 2MJWA 3ILPB 3LQAC 4HQQL 5GGUA 4XI5C 4LBEB 4KZEL 3HNSH 1HNGA 2NY4D 5CZXC 3JXAA 4F58L 2VLRD 3LB6D 4LASH 4P57A 3AB0C 4LNVA 3VXSE 2H26A 5F7EH 4YHML 2AJZA 1X5LA 1FVEB 1AJ7H 3HR5A 2E9BA 3VXSA 2EYSB 4XXDA 3C08H 1PZ5B 2WWMD 4PJXE 4WDIA 4BA8A 4XMKH 4NKIL 3N1PC 1B88A 1HH9B 3IKKA 3D3VB 2A9ML 2Q87A 1FFOA 1NGYB 3V0AC 3V95A 1QKZH 1BBJA 2XZAL 1TQCC 5E2WL 4ELKA 3MFFA 4ZDHB 4MDIA 1JGVH 3TYGH 1BBDH 2F15A 3TJHC 1RAMA 1KCVH 1EMTH 3N1QC 3G6JF 4XMLL 4D3CL 4JO1H 3KS0J 5BS0B 2DQTH 1BLNA 3T2QA 4GKSB 5EB9A 4JFHD 4OFVA 4AEHL 4BFIA 4YHLH 4F9PC 1TQBC 4GUPB 4RGND 5CGMA 4HG4J 3CJJA 3K74B 3FO1A 1JHKH 1XF5A 5HHOB 2WZPD 1A21A 2DQDL 3BKYH 3SO3C 3MACH 5JHLH 3OR6A 1UYWH 5FFLA 1RULL 1IZKA 2D03H 1H3WM 4QYOA 2XZCH 3EDFA 2IQ9L 1PY4A 2NTFB 4Q0XL 1BM3H 1RZ7L 2EE9A 1HHIA 2NY3B 2XXCB 4XH2A 3DNKA 3QCVL 5CAYB 2XI9A 5T3ZD 5IFAH 3MLVL 3OMZA 4X4XB 5TE7H 1DL7L 1MCKA 1ZT1B 3KWWB 4S1DD 3BPNB 2PTVA 1QFWL 4GRMA 4LRIC 4MLSA 2V17H 1IC7L 1E0OB 2NY2D 5D1QB 3CSYA 4QNPE 1JUFB 3ZHLA 2Z91A 1MJUH 2VXQH 4XHQA 5F71A 1J0ZA 1U8HA 3S36L 4HIXH 5JOPE 1RJLB 5C6TL 4NO2A 1JWMA 1YMHA 4NM4H 3BWAA 1I9JH 5B8CA 2MWCA 3RWIA 4OCNC 4UT9H 1ZLSH 1UA6L 2VXSL 1W72A 3O6LH 4P23B 3O8XA 4IOFC 1BQLH 5JHDE 3EUUA 2W9DL 4F3FB 4HIIA 3T8XA 5TQ0L 4QY8A 3DX6B 4OQTH 3TO2B 3OZ9H 5JR1L 1D3CA 2XNAB 4NO0D 5JHDA 1NGWA 4DOHE 4FZ8H 1T1YB 3D9AL 3QPQD 2YPVH 4LF3A 4GBXA 4IOIB 4YAQB 4PGEA 3V4UL 2XWTA 3TZVC 1RZGA 2IALA 4Z8FL 1IEBB 3ARDA 3WNLA 5KTEH 5CBEA 2C5DC 3H9HB 3UBXA 2G5BA 1ORQB 4PJ5D 1YEFH 5DHXB 5GS0L 4UTBH 2IBGA 5I76A 4LU5H 4QHMB 2HKHH 5E9DB 1NMAH 2IMMA 4N0YL 4S2SB 3QQ3A 2D7TL 5FECB 1CXFA 1ZEAL 2VKXA 4YWGH 3L3KB 4OJFH 4LARH 3RVVD 3VMPA 3VW3L 3MJ9L 4OCXL 1K6QH 1QBLL 4L3ED 1NCAL 3V0VA 4I48A 5HYQB 2H2PC 2VZTA 1A9EA 3WMSA 1MFCL 1CFNA 2YD7A 5HPOA 3SDDB 1TVDA 1BVLB 2AJYL 1WZ1H 4U05A 4EXKA 1JF1A 2CO7B 4MNGE 4MX7B 1ACZA 3KXFD 4UDTB 3CLFL 5GGSB 4QF1B 1SEBB 5EOCJ 4AT6A 3BPOB 4MNGA 3QIBC 2D31B 3P9LA 1MIEL 4UQ3B 4Z7QF 2GUOA 4UU9A 1RUQL 1B6UA 2F19L 2FHBA 3FQRB 4LLUB 4OCSH 3GMRB 2VDKH 1WWWX 3PJSB 4BZ2L 4TUOB 3IRPX 2YZ1A 5C0CE 2HH0H 1AHWA 2FD6H 2W65B 4HC1A 3WUWG 1QSFE 4H8WC 4WJ5B 4MNHB 5LGHH 5BRZB 4UAOB 4GW1B 1Q1JH 4U1HA 1WITA 2B8OT 3BQUC 5C0CA 1PKOA 4TQEL 4XCFH 1QSFA 3T3PE 3ZTJH 1CDBA 3WHXA 1GZQB 3HN3A 3PQYA 2X4NB 4XPAL 4JKWA 3U0WH 4R4FH 2R8SH 1CXEA 3MJ7B 3KHQA 5C2BH 3C60C 2YWYA 1KCRL 1CK0L 2OL3B 3GSNB 4B50A 2DLTA 1Z9MA 1HOCB 5C0ND 1BFOA 4N0UB 1FG9C 3T4YA 4BSWA 3QIUA 3SOBL 4MXWH 1LO2H 3DX9B 3B83A 4FQXA 1S9KC 3KLSA 5EIQA 1ZVHA 4XPFL 5FYKH 5EC2B 5TGBB 5ELIA 5IMLA 4Y19E 5D6CA 3WO3B 5E8EB 1XF3B 2HT4D 2PCPB 1N5YH 4YDKH 4J12A 4Y19A 3O3AB 4G7VH 5BZWB 1BIHA 4Q6IC 3ZDZF 2FX9H 2NY5L 4QHUA 2RFXA 1WICA 3I3EA 1F4WH 4YPGA 4OCYL 3B2UC 4LQFL 5ETUA 1BD2D 1JTOA 3HMXA 3IXAA 5B22A 2DQEL 5TDOA 4P46D 1A1MA 4PLNC 4GG6E 1T1XB 3P11L 1VACB 3RDTB 4I0PA 1QD0A 4X99A 2I26N 3I75B 4PV9B 3VRIB 2DDQL 3NZ8B 1D5MA 3FFCA 5BCAA 4U31A 2CIKB 4X6EB 1XIWD 1Y6NR 1IKNC 1K2DB 1HEZB 4N8VG 5IB4B 4P2RA 3BPNC 3ARWA 1BX2A 1KEMH 1X5FA 3MRHB 4FXGB 4KK6C 3GO1H 3VFUA 1UVQA 2IH3A 1MLCB 5D1QC 4MJIA 4JY6B 4WCYH 5GGSY 3CNKA 2J4WL 4PGCB 3IB4A 1IFHH 5T1DL 3ARGD 5HGBA 4NRXB 4ETYA 4GMSH 4KK9D 4M6OL 4QOKD 4P23C 1MFBH 3G6JE 4W4OA 5DRXA 2JB5L 3F58H 3VFOB 2IFFL 5DHVB 3FQWB 5IUSA 2XN9B 1ZHKB 1TNNA 5DRNB 2R29H 4JM4H 5D2LB 3G6JA 4NQCE 3QQ4B 1R0AH 5GRWA 5GZOC 4JQIH 2GTZA 4LLYA 3WJLA 3RBGA 4QHNB 1N0XH 3WKMH 3HZKB 1KN2L 4ZTOH 2X1WL 4NQCA 3LZFL 4HULB 1FO0L 3FKUS 1OQXA 1D9KA 2VMFA 3HC4L 4R0LA 5ESVB 1S7WA 2Z92B 5J1AB 3MX0A 1DCLA 5AUMA 1F8TL 3KR3L 1MY5A 1TFHA 3SE9H 4TULH 5C0BE 3BAEH 5CCKL 4Y5XC 4E0RA 5EN2B 1WBZA 1U8OA 4FFWD 3DXAD 3QQNA 4ODVL 5DK3A 5C0BA 4KPHL 3V5HB 4BZ1L 1VGEH 4PD4K 4PRBB 4PYHA 4GKNB 5J1SC 2XTLA 1GC1C 32C2B 3QG7L 3SDDC 3BH9B 3SE4A 1A8JH 4M7LH 2BOBA 2AEQH 2VTFA 4HPYH 3RUGF 4Y1AE 3IDNB 3UAJD 4AENB 4MD5B 4UT6L 3W9EB 5DFVC 3VGBA 1FH5L 3G6AB 4KTYA 2Y5TB 1FNFA 3BPOC 3MRNB 4Y1AA 1IAOB 5CLWA 3DUSB 3NACL 3IJSA 4XPBH 3UROR 1XZ0A 4HIHA 4L8DB 5C09D 1QA9A 4WFHD 1GIGH 1MJ7H 1KXQE 4YHKH 2Y36L 3MCG1 4UUJA 4HFWB 2XKSA 3QISA 2A0LC 1Q94A 3QIWD 1RJZB 4P3CL 4Z7VF 1N6UA 4NZTL 1OSPH 4AEFA 3OX8B 1R3JB 4GXVL 5GXBB 4UAOC 2OR8A 4UQ2B 4NN5B 2XPGA 5IM7A 3GI9H 2BJMH 3RWHB 3GJFH 2BHYA 1LEIA 5L0QB 4TUJA 4L3CA 4QRTA 1HDMB 4NJAH 3MV7B 3NTCL 4OBRA 5E7FA 2LU7A 3TA3A 2LQRA 3BN3B 1UWEL 3VGEA 5CBAA 3NFNA 4ORZC 4J1UA 4GO6B 4OI8A 5D71H 5C0DA 5FB8B 3ALWA 4TVPD 2AXGB 3SN6N 1NCNA 1MPAL 5HJ3B 1GOGA 2PO6C 1DQQB 5C0JB 1TVBB 7FABH 1YNTB 3OB0K 2AK1L 3HAEH 3MYZA 4KROC 5HY9A 1RHHA 5DDHB 1YN7B 4QRRB 1A3LL 3LS5L 3UTPD 5HI4C 1L9MA 4ORGB 3IFOB 3V8CA 3WS6A 3FQTB 4I5BB 4NQEE 4ZXBA 3P4LA 4K8RD 3VXOB 1RUML 3QEUA 2QSQA 4U0QB 4WRLA 4WFEE 4NRZB 3GIZL 5FO9A 4D2NA 3DGCR 4NQEA 4LPWA 4M7ZB 4HX1A 2YXMA 3EYVA 4YH6A 3V6OE 1F11A 1JZ4A 3P30H 1FRGH 4HFUL 3SKJH 1RVFL 3TFKD 3UO1H 1SVCP 3WNOA 1HXMA 3CPLB 3MLYH 3U7WL 3V6OA 4NSKA 3QYCA 1ROWA 5MP6L 1CGWA 5DHYB 4QRQB 5TFSL 3VFNA 2WSKA 4XRCA 2BNQE 1F13A 3RDTC 3OAZK 4TTDD 3WE6B 4X9BA 4OM1L 3RP1A 1JP5A 3F65A 2AJVL 2YXFA 3IU4H 1MCLA 5KS9B 1B0GB 1UC6A 1TENA 5GPRA 3H9SB 4CN6A 3BP6B 2FO1A 4CAGA 4S10A 5C8JA 4X98B 3X3FL 4AEIL 5DUPH 4CRPA 4U4BA 5E4IA 4U1JA 4PTUA 4N68A 3LKOA 3D25B 1EEQA 3MLZH 1KFAL 4PJDA 1EHXA 1KNOA 3AXLA 3WXVH 2VE6A 5I1DB 4MVBC 5AD0B 1FLRH 1FDLH 5DO2C 1FNSH 4M93B 3GMNA 2X9WA 3WFEH 4AYFA 5C70A 3VXRE 1JL8A 1H3PH 2RB8A 1FGVH 5C7XH 1MCNA 3UYRH 3ZDZE 3SE8L 4Z9KB 1UADC 2VDNH 1OAZL 2WBJD 3ROLB 4HWEL 1K8DB 4MJ5B 4UDUB 4I3GA 4JDZA 4Y16B 2BXYA 3QUMA 2VO5A 2DYPD 1I3VA 1E4KC 3UZQA 4URTB 5DSCB 5DJYA 1QO3B 1MCPL 3MUZ1 1K9TA 3MA9L 2GT9B 4OZGF 4U6XB 3O2WH 1KACB 2F5AL 5F7HA 4YR6B 1F45A 4QKXB 1BOGB 3MRFA 3QFDB 2YEZB 4J23A 4WW2A 4D0BB 4X7FC 2O61B 3PV6B 4I18A 2YD2A 1RIVH 1W2KT 4LSVL 4E41D 3WJJA 2HRPH 3C9NB 4LLDA 5B4MD 5C0AE 1S7VB 3O4LA 4Z6AT 3TO4B 4EQ3A 3U82B 1WF5A 4EKXA 1ES0B 3DBXA 3R0MA 5CHNB 4K9EH 5C0AA 1JV5B 4FZEH 5D7JB 5HYEA 1IGFL 4O02H 3AREB 5FYJH 3WLBA 5K9JH 1CGUA 1M7DB 3D2UA 5LCVL 1FNGB 1CFQA 2BRRL 4XNUL 3WIHA 2EDHA 4PB9H 3IKCA 5E8PB 4R96B 2VLJB 3QUZA 3PIQB 4NZRL 2Q3AA 2V2XA 4TNVK 3X14B 4DN4L 4BQ6A 3GZKA 3MRBA 3BKCL 2XIDA 4CUCA 4S1SL 4KKCC 5H37H 1A6WH 2QQLL 4KDTC 4ODBD 4XPGH 5E5UB 2A83B 4JHBA 4U6VH 1A7RH 1INQB 2QV2A 3EJYD 1N7MH 1WIPA 1H3TA 4NN5C 3HNVH 2QQKH 4NPYB 1OP3K 1ZHLB 3PGCA 4OKDA 4GT7A 2P24A 3U2SA 3JUZA 3GM0A 4G5ZH 5HYJB 4R4BA 5ISZE 3O6FB 3Q6FA 4BSVA 3RFZC 1DFBH 1BAFH 2BC4B 2VQ1A 4ISVA 4DCQA 3GKWL 4PJHB 2YRZA 1IL1B 5DGRA 1K5NA 4X5WA 3OV6A 1AGCA 2D0HA 2EDFA 4GLRH 3L6FB 5FCUH 1VFOA 1FG2B 3IU3B 1AGDB 4D0DA 1AD0B 3GSWB 4PFEA 1WQVT 1PKQB 3MV01 3E8UH 3NGBB 3O81A 3OPZH 1JZ5A 2YRLA 1DBBH 3NABL 1CBVH 5JW4Q 5F1NB 3MRIA 5FYLH 1KLGA 5I66B 4M1CD 3RUGE 5M94B 2CKBL 3VGAC 2NW3B 5JLZA 4XP4H 5KOMC 4WNQB 1DQTA 2OMBA 3MUGA 3ZYOA 5E8OA 1DVFA 4G7YH 1KT2B 4E9LA 4XHJD 3VXQA 5CGYD 3VXUD 3L7EA 5T3XL 4JM2F 2B1HH 4Y0GA 4JB9L 4HS6A 4F57L 1YYLL 4N90E 5D70L 3DV4A 3OKKB 4LPYA 4Z7VE 2CUMA 6FABH 3C8KB 5C08A 1NGZA 3TCLB 4ZYKB 2DI8A 3HE6B 3N1MC 5CWSB 3SKOA 5C0GA 5DFTA 1G84A 2NZIA 1CWVA 2G2RA 5SWZD 1KIUA 3MYJA 3STZA 3PABB 1G7LB 2APWA 4WU5B 2C3GA 3W11D 2IFGA 4KTEL 5ABDE 3GK8H 4XX1E 4JG1L 3VG9B 4JQXC 1J9CT 3MRJB 2EC9U 1DQMH 3BWUC 4JFOB 2D9CA 1RZ8A 2Z8SA 5IJVB 4YE4L 4NQXB 1H3VA 5DVLA 1R3KA 3MTRA 5IB5B 1EXUB 3AAZA 4PRDA 8FABA 1QLEL 5F6HI 2JK5B 3TVMA 4M93C 3LS4H 3EW3B 5HHPA 4BQCA 2QR0B 1PG7L 3STLB 3LKSB 1ZT7B 1EFXB 3NZHL 3LMJL 1PX3A 2YS4A 1OAYH 1FZJA 5J9PB 1NEZB 2H3NA 4GOSA 5SX5H 4LP5A 4U6TA 3ELAT 1OAKH 3DURB 1S5HB 2HN7A 1UJ3A 3D48R 1WIOA 1G7JA 4HH9A 1QR1A 4K3EL 5EBWA 2OCFD 4S0SD 5ADPL 2VOTA 1U8QB 5BVJB 1G7PA 4W6WB 1MLBA 5E4EB 3SGDH 4M5ZH 4Y16C 3S35H 3QHTC 4IJ3B 2JB6B 1KIRB 4OD1H 2FECL 4DAGL 4ZUTB 1HH6A 1SQ2N 1JE6A 1CXIA 2A6JA 3QFJE 4XBGB 4F7EB 2J8UF 1O0VA 4CVWA 1T0MB 4K7PX 3ES6A 1RUKL 3QFJA 4OFIA 1FVDA 5CJQH 4AL8L 4RZCA 1QSVA 1Q9WA 4RX4A 3P73A 3O11A 3FO0H 4JPIB 3X13B 1TETH 4ZO7A 2PXYA 5GS2D 2ATKA 3LQAL 3EOAA 2EIZB 2FL5A 1XGRB 1MFDH 3TO4C 5ISZB 2OP4L 3UBXI 4PS4L 3V5KB 5KVMC 1YEHH 3SGJC 1S5IH 1YEJL 1YPZE 5D7JC 3AREC 3OR7A 3PG2A 1DEEA 3OJVC 4LHUG 4JRXD 4Q74A 2ENYA 2BVOA 4PB0L 1EGJL 1F6FB 3FHQA 4R7NB 2DF3A 4XWGH 1YPZA 5J57B 3JTTA 3DV6B 4C59B 1RZFH 2H1PH 3JWOH 3T0WA 1T21A 2EICA 4NO3B 3EHBD 1ZS8A 1MI5D 1RIHL 1T4KA 2EZ0D 5ICYA 4HZAA 3GSQA 5IB1B 2FEDC 4B0MM 1IQWH 2YMXH 5DJ2B 1WFOA 3MBEC 4YK4B 2GY7B 3TWCH 4R7DB 1MQKL 4HWUA 4B53A 1QUNA 4TSCL 3M07A 1A64A 1OGTB 1XH3B 4HKZA 5I8KL 4LSRL 4APQB 3BP7A 3IFNL 3O6FC 1XMWA 2COQA 2YUXA 3HKFA 2JIXA 1G6RH 4G8GD 2HLFC 4I0KA 1KB5L 3OAYH 3FN9A 3GJFB 1T7YA 4NUGL 2AP2A 2E5EA 5KANI 5L2KD 3UJJL 5I0ZA 3MRRB 4JFDB 3VWJA 5L8JB 4EIZC 4GKZA 1TDQA 1N3NB 3BN9C 1CT8B 4TNWF 5TPWH 5DC9B 5F72S 5ITFB 3PWUB 1JGUH 4O2CB 4ZPTB 2OSLB 1WSST 5K33A 5GIRA 1FYTE 4JKPH 5I15H 4YGVB 3HLAA 3KPRB 4B7LA 3LN5B 2I5YH 4HJJH 5DMIH 4L4JA 2WM0A 5IBLC 2XWJB 3ULVH 1JPSH 3HAEB 2HFFA 3QXAA 4M4RA 1V3KA 3EOTL 3I50L 1S7QB 2P4AB 5DD3L 3FN0H 1JGDB 5I73B 2EDDA 3MJ8B 2DQFA 2DLHA 3HE7D 4OSUL 2I9TA 4LFHG 3HPLB 1G7MA 5FKAB 1JPFB 1QQDB 3D69A 1RSFA 1T03H 5DJXA 2GCYA 3HE6C 1JTPA 4BQBA 3AS2A 3H0TB 5L2JB 1YA5A 2AJ3B 5EU4A 3WUZA 3D85D 1BOYA 2DM3A 4DZBA 2UVEA 4XCEB 3PWPB 3WBDA 2CKNA 1UEMA 2R56H 2R9HC 3VG9C 2CLZA 1S8DB 5DJZA 1YNKL 5KVGH 5J4MA 1I8IA 3O3DB 4X9IA 1F4HA 3CH8A 1AQKH 4I3RH 4X6BB 4IRZL 1ODAA 4UIKL 4ODWB 3N1GC 1WFTA 3LRSB 3QUKB 4C56D 1RFDL 1BZ9A 3D39A 1FJ1B 4YFEA 3QEGL 4F7TA 4OZFA 4KQ4L 5I1HL 1KCUH 1CICD 3TNMB 3DX7A 4FTVE 4CN4A 4HS8H 5EU5A 2PW1A 1MNUH 3ZTNH 4GAYB 2P8LA 2HT2C 4PRHB 4PJ9B 2IADA 5F96L 4YBQD 5DMKA 4ZUUB 3ARBA 2NPLX 3BIAX 3REWB 2XV6B 3BESR 3W0WA 1AO7A 3VFPB 3DX8B 2EIDA 1MH5A 2Y6SC 2ESVD 5E4EC 4MA1B 3QHFH 1FCGA 35C8H 3MODH 2ICEA 5EZOL 2RHEA 2Q86A 4IJ3C 5D1XD 2UYLB 5KANG 1AD9A 5GRZA 2WNGA 1NQBA 4ZS6D 1IM3A 1I3RB 4J4PD 3MV8E 3KYKL 5DZNA 3P40A 4NZJA 1IAMA 5ERWB 4EVNB 3QNYA 3A6CL 5JW5A 4OLZH 3DECA 1S78D 1XCTA 4H8WL 3SEPA 3PL6C 1WV7T 5D7KD 3FOLA 1OAXH 3LDBC 5GGVH 3G08A 2PTTA 2C4FU 1FLTX 1FBIL 3SQOH 4G9FB 4QTHB 5EOQL 1XGTB 2ZCHL 1TZHB 3EZJB 1BVKB 4Z5RB 2EXYC 4MAYD 4OZGB 1M05A 2NXZB 2VLKE 1HSBB 4KI5E 5I18L 4OCWL 4UMGA 1BF2A 4G43A 4ZAKD 1H15A 1QEWB 1DUYB 5HVHB 4MNQE 1PY9A 1YUHA 4FQJH 1ZGLP 3RVUC 2K7PA 3JVGA 3QULB 3R8BB 1XGYH 4P0DA 1HIML 5BMFL 4MNQA 3PWLA 4MA7L 2A1WH 4H20H 4M3JA 5E7BA 1A1OB 5CZVL 3ARTA 4OIAA 4JG0L 1WISA 3AS3A 1P1ZA 1UM6L 4OGYH 4YK4C 1NMBH 3SDYH 2C26A 3TLRA 4HKBB 4K23H 4O4YL 1DQLL 1FFNA 3PWNB 3RWFB 2MHAA 1KENH 3TBTB 4IS6B 5EH1A 4APQC 4F7CA 3X12A 3IGAA 2P5WD 3PE9A 2R0ZH 2J8UE 2XACC 2DWDA 2Y7QA 2W0LA 3FO9B 2MPAH 2JCCB 2IG2L 1M7XA 1AXSB 2QL1A 2CIIB 4HS3B 2J8OA 5IWLA 2PYEB 5FGRA 1BEYH 4JFHE 4JJ5A 4HUKB 3O2VH 1CDUA 3RWEB 4OCRL 3BKJH 4J3SA 5BV7H 2Q6WB 4RGNE 2CO6B 3TYFA 5CLTA 5M7QA 2VUOA 1ZWIA 3MLPA 4PG2A 3W39A 5I8EB 3QAZC 4M7JL 1JGEA 2XXMB 5FUOL 3M1BB 4N5EC 1Q38A 4D9LL 3LKPB 5IT2H 4XCYA 1NANI 2R1WB 2CMRH 2I24N 2XQBH 2J1KA 2F54B 3O2DL 5ANMA 5FHAL 3IVKA 1ZVSB 4NGHL 3DRQA 5I73C 5T3ZE 2YPLA 5FM4A 4JAMB 1RK0B 1KXVC 3NCJH 5FK9B 1XGUA 2H8PA 1IILE 1C7TA 3GMMA 2ZSVA 3C5ZB 2UY6A 4ZQKA 1KJMA 3RY4A 1IC5L 1G9NL 5JIHA 5I17A 3GSXA 1VA9A 4RMSA 4QXUL 5HYSB 2DIAA 5KZCD 3I6GB 4MB4A 4F37K 2EH8L 4HWBH 2VXVL 4M61B 5I1KH 5C07B 1JWSB 2OXHA 1C5BL 3O6MH 3H42H 2XOTA 4RMWA 4IIQA 4JM2B 4AMKH 5I1AA 3TV3L 1D5BA 4WFGD 1GGCL 2VDRL 3MCLH 1DLHA 2FB4L 4S1QL 4EI5B 5DK0B 2FEEI 4MA3A 3V5DB 3ZKMC 3JWDH 2AI0L 2AEPH 1Y0LB 4JHAH 3FMGL 3VA6A 4UTAL 1PLGH 5HSFA 4K71B 3R0NA 1DANT 3OJDA 3AS1A 4LCYB 1MFEL 4FQQA 3DHMA 2OTUB 5E24E 1FN4A 4PJ5E 2AJXL 5L7XH 1CFSB 2VN4A 3MFGB 1XR8A 1ONQB 4YHOL 1C08A 1E27B 3MROB 1MCFA 1N4XL 4ZSOE 2P8PA 3PWVB 1BWMA 2PKDA 2FATL 4O58L 3RWGB 1F4YL 3NFSH 4MA1C 3BD5A 4EBQH 1AR2A 1IVLA 5C9JA 3QI9A 4HIEB 4RA3A 4Q9QL 1H5BB 4L3EE 1N2RA 3WNNA 3HI5L 5EO1A 3PUCA 3H9ZA 3FOMA 4FQPA 3FT4B 1KCSL 4OLYH 4EN3A 3ILQC 2XA3A 5C6PB 4HT1L 1OAQH 2W38A 1KIPB 1W0WB 2VLRB 5F7MC 1TZIA 3KXFE 4P57B 5TDNB 1F3DH 2H26B 1EEYA 2FIKA 2KUTA 3DMMD 4GXUN 1OB1B 1NFIB 3G9AB 3HR5B 3OKOB 3NCCB 5KVEH 4BM7A 1P4IH 2V6HA 5JORA 1ZOXA 4P59H 1CDJA 2IBZX 4PJ8D 6CGTA 5GGQL 4R3SB 1OLZA 1XCQB 1HCFX 4LPVA 2GHWB 4F2MB 3K46A 4UNUA 1BBJB 3NIDF 3HZMA 2NXZC 2LV4A 3B8SA 4ELKB 5IG7B 3NCYP 4MDIB 3PGFH 2OTWA 5HVHC 4HXBH 3I84A 4OIIH 5GRVK 4H0HB 2PR4H 3QDJA 1LEGB 5DR5L 5IVXF 4ZFFA 4JRYA 1MHCA 5A2KH 1D5IH 1WK0A 3L7FB 5FA4A 5JW3L 1CLOL 2BZDA 1ETZA 2MQ0A 5EA0L 2QADB 2FJFB 1LO0L 1WT5A 4ODHH 3V6FB 5HDQL 1XF5B 2IPTH 3PP4H 43C9A 5ID1A 3ROOA 1OGAD 4ODSH 1H3XA 3OR6B 5IW6A 4HUXA 3U0TA 5IFJB 5CKGA 3UTQA 1NKOA 4JHWH 5DK2B 2GSIB 1JK8A 5D7IA 2HMIC 5B3JF 1NC4D 3WSQL 4R26L 1CVSC 4U1NA 5F9JA 4EXPX 4WGWB 1FYHB 3QXDB 2ZUTA 2Z93A 2AJUL 5JQ6L 4KK8C 2E7BA 3T08A 1W72L 3CCHB 2ADJA 4J8RA 4NDMB 4OV5A 4GRMB 3MV9A 2BXZA 1I1RA 1DQDH 3O6KH 4PRAB 1G6RB 3VFMB 3JV4B 3U4EA 3CSYB 3CFJB 3CFIC 1BD2E 2Z91B 2LU4A 3OXRB 4HGKC 1U8HB 1B4RA 5IMMA 2HG5A 3ARRA 4QHKJ 2LAAA 3P77A 1EO8L 3T77A 4HZLB 1ZANL 3VWKC 5KSVA 2AK4B 3BWAB 3X3GL 3CFCH 3RWIB 2VC2L 4KMTH 4OCMC 5DI8A 3GBLA 5EUKA 1LO3H 1E4WH 1FL5B 1G7QB 1ORSA 4M62H 4P46A 1OLLA 3LSOB 5JIKA 5F1SA 3QUMH 3T8XB 4F8QA 4QY8B 2ARWA 4NO0B 1YNLH 1AQDA 4YX2L 1WLHA 1NGWB 2YSSA 4KHTL 4EIGB 4LF3B 1XIWA 3C5ZC 4GBXB 5DVNA 3FQNB 2XWTB 3KPOA 2G5RA 1RZGB 4M48H 2IALB 3C6SA 3QHZH 4WI6A 5AG9A 5DLMH 2DTSA 4PJ5B 5D6DC 3KDMB 1LP9B 1FZKA 4MSWA 4JQVA 5ILTH 5A16A 2XY1A 2YD8A 5LKNA 5I76B 4YXKH 4CL7A 1MCOL 4ZSOB 2EDOA 4JM2C 2RR3A 5D72L 4U6HA 3T65A 1OTSC 4CADB 4IOFD 4O2EB 4QOKE 3KYOB 1QVOB 3SDCA 2IAMD 3MLXH 1OSZA 5DJAB 5I1GL 5F1IA 3PHQA 5AZ2L 4FOMA 1IC1A 5L9DL 1A9EB 1YJDL 1B9ZA 1FSKB 2VH5L 4HC1L 2LVCA 3WIHH 4K71C 2VNCA 3TZVD 1Q0XL 1RUAL 1JF1B 4LLWA 1KULA 2E9WA 1GGUA 5ITBL 2BVUA 3NIFF 1NEZG 1IC4L 2OK0L 4XZUA 4Z0BL 3EJZC 5AYUH 5BXFA 1P53A 2XZQL 1QSEB 2ZCLL 1PSKH 1JFQH 3QWRD 5FO8B 1U8JB 2IANB 5JQHC 4JKMA 5FM5O 4E5XB 4JO2L 3MRQA 1AC0A 4JZJB 2QHRH 2X6MA 1M6OA 2XFXA 1CVRA 2O5ZL 1GPOL 4WU7B 3HMWL 3VDCA 1LE5B 4P9ML 2GI7A 2NY4C 4TSAL 3MRCB 3RY5A 5J7CC 5BZDA 3WHXB 1CI5A 4GRLB 4X83A 5FGBC 3LB6C 3PQYB 4RNRB 2E6QA 1XF1A 2M1KA 1JN6B 4G6MH 1I3GH 2X4SA 3E1F1 4ZOBA 2AGJL 4FQHB 1I3UA 4N0CC 3T4YB 1H3UA 5DRZB 1D6VL 3L95A 4JE4B 1NDGB 1FGNH 3R1GL 1PDKA 5FUZH 3LV3B 4ZOCA 5IMLB 1MREH 3HMXL 1OTTD 3OXSA 1V7NH 3GJFK 3QIWA 2A6IA 3L3DA 4FP8L 1F97A 4P2OD 1UH2A 1KYOJ 4A2MA 4ZD3H 2FR4B 4M7LT 4Y4HA 2X40A 3AFLA 2CD0A 4YPGB 2QADC 2F53D 3S5LB 2ZOKA 4LLVA 5D1ZD 3CC5A 4DGIL 4TVPE 5BJTA 1CU4H 3HG1A 5L6YH 4HJGB 4MQTB 3N50A 4M6NL 5F88A 3HUJF 3I02B 4YZFF 5TDOB 3D3VD 1I8MB 4MDJA 1VADA 3QCUH 3RWDB 2VIRA 1CE6A 2BFVH 2J5LB 4GJTB 3I6LD 4I2XA 3ZDYE 3UTPE 4HPOL 4QGTA 4DQOH 1GHFH 1CD9B 1QFUH 2N4IA 3FONA 3SPVA 3U4AA 1EAJA 4CVXB 1UXSA 2YC1A 5BS0D 1II4E 4MHHG 5DS8A 4P2RB 4G3YH 3MJGX 2ZSWA 4P5TA 3H7BA 5E5MA 4UV4H 4G8IA 2VR9A 4HMCA 4L5FL 4Y4FB 5MERB 3BDYH 4OZ4A 1C1EH 4P4RA 1NGQL 5HHOD 3E6FA 3E6HB 1I9IH 1VPOL 3RNQB 5HPMB 1F6AB 1AE6L 4FXKA 3HAEG 1NAML 3B9DA 1FFRA 5BV7B 2J88H 1R24B 2ORBL 5I2IB 3BZFB 3B6SA 2NW2B 5IQ7H 3DO7A 2I60L 2NY3D 4NFCA 4ZO6A 5IVXE 4EOWH 2DBLL 3FB8A 4IRSA 1KCLA 4IDJL 5EUOF 1DUZB 3QB7C 5DRWA 1T3FA 1KPUB 1MCSA 2JELL 3S34H 3QPQC 4WO4B 2CUHA 2OR9H 4LLYB 5EZLA 1L0XA 3BEWB 1RQ5A 4XAKD 3RGHA 1EZVX 1W0YT 2Q7YA 1J12A 1D9KB 3WD5L 2Q1EA 3QO0B 2AS5M 3KPMA 2ZNXA 4UOW1 1JHTB 4WV1B 5E2UL 2HAZA 4R0LB 1S7WB 1LVEA 4AIZB 2VWEE 5AUMB 3ORJA 5B3JE 4NO5A 4LPUA 3ALPA 4NP4L 5IJKC 4ZUWA 3FJTA 3DXAB 2D0GA 4QXWA 1WBZB 4GG8B 3RVVC 4L9LA 2NMSA 5IW3A 5DQJA 3B2VL 3HCVA 5C0RL 3ZKXC 2C3VA 4X6FB 2CUIA 4GAJL 1KLFA 2VZ3A 3ARFA 1LDPL 1FSKC 5GGVY 3ZT6A 2CJUL 2BOBB 3QJHA 4Q58C 4FFYL 3MRMA 2WBJA 1A2YA 12E8H 3MV11 5J06A 1A6AB 2FJGA 4RISH 5F7LB 4LU5L 4Z18A 5E9DD 3VXMD 1JNNH 2DYPA 5C09B 3GGWA 5T1LB 1FVCA 1JNJA 1AY1H 3IDGA 5DJ0A 4P9HH 2GFBA 4LCWB 3HI1A 3MGTB 3TN0D 2Q76A 2EH7H 2RBLA 3K8LA 4UV7L 2HFEB 1NBZB 5AAMA 1XF2A 2ENSA 4JZJC 3BH8A 3DTXA 1I7UA 1RZJH 3CXHJ 5GS3A 3D87B 4E41E 2WWKO 3UJIH 4K7FB 5IM7B 2QKIB 2Y4SA 4TUJB 4XAWH 5EOCL 2NTSP 2X9YA 3FB5B 3WYRA 4LLMB 4GRLC 4CMMB 5DFVD 1UENA 3QCTL 3JTSB 4U1LB 5E94A 5CBAB 4JPWH 2HJLA 1UGNA 3MJ9A 5C0DB 2HVJA 4WFFD 1ZHNB 5TE6H 3DVGB 2FLBT 2R2CA 4XXCA 3L3GA 4LCCA 4ZUVA 2FEEL 4NUJA 4Z77B 3GMPA 5GGTL 5HY9B 4EDXB 1RHHB 3MOAL 4Z0XB 5IGXH 5BRZD 3CMOH 2HT4C 3OKEA 1IGTA 2ZPKL 4PRID 2APFA 3NAAH 4POZC 4PY7A 2V7NB 1AGFB 4WW1A 5FXCH 4EQ2A 3LCYA 1X6NA 4XP5L 4ZXBB 4PPTA 3NIFE 4N9GB 3IDMB 3NA9L 2GJZB 4MJ6B 1X4ZA 4W81A 5FO9B 4KUZH 1FIGL 4JLRA 3ALXA 3BYTA 1F11B 3K81A 4IRJD 3VGHA 5LGKA 3RY6C 3M17B 4OF7A 4Q2ZB 2BX5A 1HXMB 1UM5H 2ERJC 5ENWB 1MAML 4MXVF 5DT1H 3WIIL 2X4UA 5I1LA 2MKLC 1S7TA 1KJVA 2Q3ZA 3BPCB 1J10A 1OPGH 3WIFA 3CSBA 2FSEA 5GSVA 3O41A 4XPHH 5FAAA 5IVXB 4X7EC 2J5LC 5ESAB 5LWYL 1A6UH 3DIFB 1HQRB 5HI4D 2IBBA 2W59A 3INUL 3EJJX 3O0RL 2BSSA 1KTLA 3I2CL 1AFVH 2G60L 4HJ0C 3GBNH 5C8JB 1X5XA 4I77H 1NJ9A 5BQ7A 4OZFH 1ITCA 3BKMH 1N8ZB 3HNTL 3TBSA 3VXUE 1GL4B 4LSDA 1UCTA 4Y4FC 1NC2D 3FRUB 1OW0C 4XBEL 1LDSA 1HHJA 4GSDH 3VFVB 4P3DB 1BIIB 3F12A 3ARGC 4NQUA 1UB6B 4F7MA 3RDTD 3EYUL 2DKMA 3S4SA 2ZUWA 2DTML 5CEZL 4X5XA 5SWZE 1AI1L 1LMKA 1AXTL 1YDPA 4ZUSA 2XG5A 1LO5A 1QRNA 1AKJB 2NX5A 3SDXF 5T5FH 3N9GH 4WO4C 5E2VL 4YXHL 5HHXH 2YN3A 4CW1A 3QDGE 3VFSA 5KAQF 1KPVA 5HYSG 1CTNA 3QUMB 3QDAA 3HUJE 1D9KC 5EU6A 4YZFE 1EVUA 1TJIH 3QDGA 2R69H 2VYRE 4WV1C 3B3IB 3JWNC 4F9LC 5DJYB 2ICWJ 4PY8J 3VXTA 4XCNA 1PYWB 4Y89A 2AQ1A 5SX5K 4FFWC 4JZOA 4L1HA 2ADFH 5F3HA 3BGAA 4RIRA 4WW2B 5I74C 3PDDA 5I8OL 3AM8C 3SKMA 1BZ7B 2XN9D 1H0DA 1A5FH 4HKXA 1ZTXH 3LH2H 4QRSA 3P0YL 2EE6A 3S88H 1C5CH 2Y07L 1E28A 3DVIA 3MOBH 3EDJA 3O4LB 4V1DD 5INCA 9CGTA 1RZKH 3HS0A 1L7TL 4ZFGH 1YECH 3VE0A 5LQBH 3JWDC 4M5YH 5I1CL 3WLBB 4UB0L 4XC3H 2BK8A 2XA8H 5DYOA 5M95B 1MHHA 3D2UB 3EZ8A 1EPFA 1A6ZB 3P4NA 3WFHB 3BVNB 1ZGLA 2RIKA 4HGMA 3KPNA 5I30H 1F02I 1QLRA 2DLFH 1Q72H 5EUOE 5LGJA 3VXNB 4RFOH 1B2WH 1R3HA 1FO0A 4DGVH 1VGEL 5C0FA 5L8LB 2NYYC 1I1CA 3OGCA 1I4FB 1MRDH 1OTUD 1T2QH 4HXAH 1ADQA 2GAZB 3U9PH 1HK6A 1CDGA 4PLJD 1HZHH 2QLVB 2X05A 5GRJH 1N64L 1ZA3A 2VQUA 3DLQR 4ISVB 4TSBH 4Y4KD 1NCWL 3Q0HA 3CXDL 4JRXE 1LEKB 2X4OB 3LKRB 1AGCB 4L4TA 1A02N 4YHKL 4DN3L 2EYTB 3CK0H 4LCIL 5IW1A 3RTQA 5ADOH 4JRXA 5AZEL 1F90L 1MI5E 5IMKB 2D9QB 2V2WB 2CDFA 4XNXL 1UM4H 3U7YH 5EWIH 1GZPA 4ZS7L 2Z35A 2UZIL 2LVEA 4PUBH 2CXKA 1ZA6A 2YUVA 4K8RC 1MF2L 2GITB 5IOPB 4RMQA 4HUVB 1U3ZA 3S9DB 2BERA 2R1XA 1AGEB 1DN2A 4YDVB 3VXUB 1U91A 4L4VA 3OAYK 4G8GE 1T22A 1T89A 2PF6A 1CFVH 4I1NB 3TFKC 3B9KB 3SKNB 3BPLB 4JO3H 4ELMA 2DL9A 2W91A 5ALBL 4GQ9H 4Y2DD 4K3JL 5TE4H 5L2KE 1CL7H 3GB7A 4PP1C 2I27N 4YQXL 5C08B 1INDL 5L2KA 3K2UH 4PJBF 2Z8VC 3W2DL 3OKMA 3SKOB 5D5MA 3DVFA 1WCBB 4QRRD 2G2RB 4TNWK 5EDXA 3MYJB 3VCLA 3L3JB 4HIJB 4LKXB 4M1GH 1SEQL 5JDSB 1QNZH 1NUGA 2R1YA 5JOEA 2Q7NA 4EUPH 4DVRL 3QBTB 1U8KA 1Z2KA 3V0WL 3P30L 3RZCD 2HLAA 2NXYD 4EDWL 3GI8H 1NUNB 3FO2B 3HUJB 2DBJA 2FX7L 5IR1A 2HWZL 3GJEB 4LIQH 1U2CA 3AAZB