1U8IB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldkwan
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8iB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8iB01
2YKLH 2PN5A 4MJ2A 2GT9B 4HS6A 4Y5XC 4Z7VF 4L3EB 1Q9OA 4GW1B 5JPNB 3G5YA 4YHLL 5CAYB 1VKXB 4AZ8A 1IC5L 4DAGL 2VLKA 2WP3O 5T1LD 5DMYA 1FNEA 3QPQC 1REIA 4UOJA 1E4XH 3VFNA 3NMEA 1S78D 3U0PA 2NW3A 2X42A 4FTVA 2BC4B 2IBZY 4PJDF 2CDGA 1YMMD 1R3JA 5E2UH 1DLHA 4PV9B 3GMNA 1UQSA 1EVUA 2ZG2A 4QXWA 1U6AL 3OAYH 2BVUA 4BH8B 4XGZB 3HN3A 5D1XC 3TPUA 1EPFA 3QNZB 1I7RB 3VE0A 5FGCB 5HGBB 2D31A 5HY9B 5F6HJ 4M1GH 5CBEA 3VH8B 4JO4H 4J23A 4XH2A 1OT1A 1JFQH 4NFBA 1PG7H 2V2WB 3FTGA 1R5VA 2GHWB 2EECA 3GKZA 5IW6B 1EK3A 2L7UA 4HIJA 4JREC 5IB2A 3O8XD 1LK3H 4X7SH 5EWIH 1RUAL 3VFVA 2DWDA 3R8QA 3ARDD 3OGCB 3X3FL 4N9OB 3QB7C 4BK4A 2Y6SD 2WBKA 3GSWA 3T65B 2H1PH 1MCPH 3OX8A 4OZFG 3T4YB 4RGND 5C8JA 5I9QB 2J6EL 2M2DA 2UZXB 4K23L 4JCLA 1WT5A 1OP3K 1OAKH 3VXRA 2BX5A 2EYTA 1QR1A 3QFJA 1PJ9A 1CK0H 2WNGA 1UG9A 2Q7YA 4PJEB 5FGRA 1D5BB 1EAPA 1W8OA 5I1AA 2WBJD 3LVEA 2VKXA 4AL8L 1WLHA 3UTPE 4I77H 4OZGE 4BZ1H 1QTYT 3P3YA 2VISB 3U2SB 4FQLL 3R0MA 5BRZB 4RGOH 2BP3A 1AIFA 4V1DD 3PWUA 3DXAB 2QBWA 3LEYL 1MJ8H 1XZ0B 1BBJB 3DO3A 1S7SA 1OM3H 4PV8A 5D5ME 2ZUSA 3ECBB 4RBPH 1UM5H 1TJGL 1YYML 5FHBH 1ZHNB 3GSQB 4ELME 1J1XH 2FB4L 2ICWI 4DKFL 4I0PC 1HE7A 2NYYC 1VDGA 2E7HA 2GAZB 4LPUA 1GOHA 1E6JH 3GRWL 4KV5E 3SQBA 1IBGH 3N85H 2VLMD 2WWMD 2IANE 3OXRA 1I1RA 4P9ML 5E00A 1CD1A 3KJ4B 5EU6B 3W39B 4LHUD 3C09C 3KWWA 2YPLE 4Z7OF 4HV8B 3UX9B 2X1PA 3BT2H 5I0DA 3S5LG 3DETC 3FN9A 3G6JB 4JY5L 4MCZA 1FAIL 2MJWA 3QIWC 4MZ2A 3NZ8B 2XQBH 4ZS6D 4LEOA 2P42B 1RK0B 1OP5K 1NGWB 2J88H 5ESAA 1NFIB 2BFVH 1HXYB 2XZCL 3T0AA 3IU3B 1XGYL 3EJYD 4K07A 4OFKA 1CICC 1NBYA 3GIZL 3OKLA 1L6ZA 1DUYA 5JW5A 2C3XA 4HHAA 3HZKA 2A2QT 4XNYH 4R8WH 3JUZA 4WW1A 3KLHC 1YECL 1NCBL 1S7WA 3BDXA 5DFVC 4PPTA 1MRCH 2XQYG 4I2XA 3WNLA 4JQVA 1NCDH 3CLEH 2FX9L 3QH3A 4PJ8D 4UT9L 5D2LE 1KPRB 3F7QA 1BZ7B 4QEGA 3H9SE 3GI8L 4EEEA 1CF8L 5T1LA 5DRNA 4NHUA 5EBGA 4O58H 5KJRL 1E28B 4UILH 1QD0A 1Q9LB 1PQZB 3P73A 3FFCB 4N8VB 1IEHA 2Y5TA 1JF1A 3UTQA 3DUSB 3LH2H 4DKDC 3OKOA 1SJVA 4NNPL 1YMMA 1F2XK 4Y4HC 1RAMA 2CIIA 1IM3B 4BKLA 3I2CH 1OD9A 2GUOA 4YZFF 4DK6A 4LSQH 2VABA 3U30C 1H9VA 5C0DB 1RZJH 4XVTH 2Z4QB 1X5ZA 5FV1L 3ARGD 4MGXA 2ADJA 5F8QC 1OPGH 4XVUD 3EDFA 1CE6A 4OZIF 2ORBL 3LKOA 4JY6B 1IEBB 5A40E 3HAEB 1OSPH 4JPWH 1ZXQA 5HYSB 1JTPA 3C9NB 3OXSB 4GG6B 4F37K 5E9DE 4LSUH 3TPKA 1U58A 3SBWA 5BS0B 4PJ7B 3WNKA 3O8XA 2VZ1A 4CDHA 1E4XI 5DHYB 5E5MA 1IC1A 2PO6B 4N0FB 3ARDA 1CDBA 5ETUB 4ONFH 4U6YA 4YEEA 3D2UB 3CFIC 3VFSA 4PREB 3UYRL 4FZ8H 4FXGB 5F9JA 3WDIA 2YN3A 4YX2L 4HS3B 5E03A 1MHHB 1VSCA 5DTFB 3JWOC 3EOYG 1JWSA 4MNQE 1UXSB 4HFUL 2H26A 3U46A 1YYLL 3V7MA 1FVEB 1HOCB 3ARSA 2R0KL 1NAMB 3O6FB 1P4BL 4HLZH 2WBJA 4Q58C 4FG6C 4KKCD 5DRWA 3VU2A 3WD5H 4GSDL 2IC2A 3MNZA 5IBLC 1T21B 5EZIL 4XPFL 4L4TD 2AK1L 4V1DA 1HSAA 1AD9B 4R26H 1MFAL 3WIIH 4HUUB 1QSFE 1A7QL 3IFOB 1QBBA 1T04A 1L0XA 4ZUWA 4KKAC 4NQDD 3O4LB 35C8H 4PUBL 4Z76B 3RWGB 1FAKT 3STLB 2ZCHH 5KTEL 5IHZA 3MRMA 5IK3B 5GGSB 5MENA 3HRPA 4N0UA 4G9DA 3L5HA 3L5XH 3PGFH 3Q5TA 1I1AC 3LHPL 1BFOB 3FOMA 5EN2B 3L3OB 3PP4H 4LHUA 4XXCA 4XVSH 4LRIC 3T8XA 2ILLA 1CFBA 1NANI 5KN5A 5L8JB 1KTDB 4UQ3B 5FYJL 4XPGL 1PZ5A 1HDMB 3VXSD 1HNGA 2P48B 2VDOH 2UWEB 4LLYB 5CJQL 5CP3A 3FB7A 4XB8A 2R0WH 1LEIB 4NQSA 3TIDA 4GKZA 5CP3H 4S1SH 3LD8B 4QO1A 1JMZA 3L9RA 3PABB 3RPIB 5JUEL 1QFWH 1J8HE 5DEZA 4ONGL 5DMKA 3ROLA 3QFDB 3V9FA 1YMHB 1NDGA 2A38A 4EQ3A 2V5YA 4EZMA 1NBVL 5IKCA 15C8L 2WINA 2CRYA 3C6SB 4DKAA 2ADFH 1ZEAH 2QQNH 3KYKH 3MJ7A 1KXVC 5ENWA 2AXFA 1KT2A 2I9LA 1IGIL 1V3MA 2C7UA 3KDMB 5B39G 4MNHA 1XGPB 2UV3A 4I5BB 3WXVH 3CK0L 3KPQB 4PJ8A 5DI8A 1SJXA 2XRAL 3ALWA 4U3HA 1DANU 4GAGH 2EZ0D 3PL6B 3CMOL 1T0PB 3U7AA 4YBQC 1A2YB 1P4LB 3KGRA 3C5SA 1W0VA 2KDGA 1QUNA 1EHNA 7FABL 1BFSA 1JPFA 3LKPB 1R3HA 3P30H 3U82B 4R3SB 5EUOA 4LU5H 4LCCB 4AMKH 3MXWL 3ZL4H 4WCYH 3QCTH 3FO2A 2FD6H 2W9LA 3ARGA 3D0LA 1GC1H 1RUPL 2VDML 3VW3L 1KYOK 2HJKB 5FYKL 2AJUH 4JVUA 5C6TH 5DJDB 1F3JB 4NPYA 5D72L 3O41A 1XF3B 2XACC 5C6WH 5TJWK 4OCMC 4YK4C 1Q0YL 5HGDA 4FQ1H 4FQXB 4QT5A 4QHLA 1KGCD 1S3KH 4FNLL 2EXYC 5DA0B 3RVVD 2IQ9L 1CDGA 3VFOB 4J3OC 2DLEA 4ZUTA 5SWZE 4E42B 2ZOLA 2O61B 1FL5A 4KGLA 1ONQB 1T22A 1JJUA 3QI9D 4M3JA 4FXKB 1NCCL 2CPCA 5E8EA 5GSVA 4IM8A 3ZKXB 5CD5D 2R2EA 5DD3H 4Z7QF 5DUPL 1TZIB 4U7SA 5A3IC 5L2KE 3BIBX 2R9HC 2J8UE 5LAXB 4ZG1A 3LKNA 1FN4B 3MC0A 3Q5OA 1FJ1A 4HWEL 1WAAE 3NTCL 1H3PH 1L0QA 1ZT1A 1BFVH 4Y4KD 2EH7H 2DKUA 2Q86A 4QRPD 1MCRA 4OZGB 1A6TB 3I3EA 2R0ZL 3F7VA 2YUVA 4AEFA 3V5DA 4L4TA 4XZUB 5C0BE 5AZ2L 2IPUG 3L3HA 5I75C 2VDRH 4FQCL 3NGBC 3BESR 3QDME 4D0BA 4LAQH 4ELMB 3LN4B 4NQDA 2DMBA 2P8LA 2CIKA 1N64H 2VLLB 2F74A 1EXUB 1JGDB 4K71C 5GIRA 1KEML 5B8CC 1YQVH 2Z8SA 3MBXL 1TQCC 4M62L 5J1TC 2DLFL 3FB6A 2IANB 4KMTL 1IAIH 3VRJA 4FRWA 3S37X 1F4YL 3NFSL 4HBQA 1SYVA 1EVTC 2YPLB 3DX9B 3K1DA 3KLAB 2IH1B 1I9RH 3IF1A 4HDIA 3VXME 1LO5B 4JRYD 1A5FL 5JXAL 3V6BR 3MBED 5FIEA 3VXSA 2G75B 3WFEL 1CLYL 3CJJA 2RFXB 4MWFA 5ESQB 3QJFB 5EO0A 4YXLL 4H5SA 2VIRB 4LSSL 1AGFB 1MAMH 32C2B 4U1SA 5LGJA 1FFQA 4ZQKA 2ITDA 3QEGL 3HRZA 3SDXF 3EUUA 2C4FT 4RRPA 4N8PA 1MCBA 5CILL 2FNBA 3QEUB 4QXTA 1UM4H 2CUIA 2JJSC 4TVPH 5CIPB 4LP4A 3RNKA 3HE7B 4CVZB 2AEWA 3F6LA 3MRKA 3WNPA 1X5YA 2JELL 5BV7B 1SEBB 1A6UH 3EO9L 5EO9A 1ZGLM 2ENSA 1PX4A 2NLJB 2QADD 1NMAH 5D2LB 2B2XH 1KLFA 2ZUXA 1EAJA 4Z7WF 3H9SB 1KFAL 1KJ3L 1LDPH 1LEGA 4NKQB 4XBEL 1T1XB 3FQRA 4WUUE 1TETH 5LKNA 3PHOB 2IMMA 1HHKB 1QFWI 3QHFL 2CSPA 2ZPKH 4OD2A 2A6IA 4YAQA 2R29H 5IWLA 4JANB 4PTUA 3BGAA 4Q2ZB 1VFBB 2P46B 4XX1G 3MGOB 1F45A 2BSTB 3JTTA 4JJHA 4MNGE 1RUQH 5F9DC 1MJJB 2NY4C 4L29B 1UVQB 4MA1B 1CBVL 1NGPH 5D1ZC 2AV7A 5JDSA 5MI0B 2VXUL 2XKNA 2B5IC 3DGGB 5L6YH 4TUOB 3QNXB 5E9DB 3T1FB 1RJLA 4PJIE 1W2KT 1RVFL 2N4IA 1LE5B 4M93C 3D39D 1C08A 1I1YA 1JHKH 3CFDA 5T3XE 1JCKA 4GW5A 1JGVH 4KVNL 1HN1A 4OKVA 5DJXB 5DD0L 2DQJH 3SGEH 1KIQA 1MCSA 3QI9A 4HG4J 4D8PA 1M05A 4NDMA 4DEPB 2H32B 4GS7B 5T1DL 4WI7A 4HUKB 3MV9E 4N8CL 4IRZL 4LNRA 2KUTA 4NNXB 5DJYA 4MNQB 3O3BA 1ND0A 1NMBH 2NPLX 5DJZB 4PJ5D 3T09A 1R5WB 3TF7C 4L5FH 1S5HB 3OWEA 1XT5A 3V0AC 4P2OD 1JNHB 2K7PA 2GEEA 3HUJE 4KRLB 3QPXL 3RWEB 4TUJA 2I07A 4G6JH 1KJ2A 3X14B 1OGTB 1UJTA 4Y4KA 3B6SB 1KJ2H 3Q6FB 1MSPA 2A74B 4QRPA 3VWJC 4N5EC 5EOCJ 3QWOB 1VGEH 2VLRD 2RHEA 2E6QA 2ZSVB 3QQ9D 4RFNC 2X4RA 5DGQA 4YHZH 2KQNA 1VACB 4NBYB 4S0TD 3F5WA 5JR1H 4YFDB 4OIAA 3U0WL 3PG2A 4X4ZA 5J1SC 1XH3A 4HIHB 2RBLA 1QSFB 4UB0L 5EZJA 1QLEL 3KPOB 4JN1L 4YNYA 4XP9H 1H5BB 5KSAA 1IVLA 5T1KD 2HFFA 5GS0D 1AD0B 4J6RH 3RWFA 3O2DL 4MDJB 3WN5A 4PR5A 4BQBA 4HPYL 1PY9A 1U3HB 4XBPB 5MHSD 4XPBL 1TZHA 3HNSH 5L88H 3G5VA 3B8SA 5ITFB 1J9CT 2NY5C 1RY7B 3CFJB 4P4RA 5EU7C 1YEKL 1IGYB 1OP9A 1EHXA 3CNKA 1G7JB 4X7TB 1M1SA 4HMCA 2YC1B 4YFLF 1A7BA 2X4UA 5IV2B 1D5MA 3EO0A 3N0PB 5JOPD 5F9WC 5E2VH 5SWSD 2ADIB 4KPHH 3BZ4A 4LPVA 2DQCH 3DV6A 4R4FH 1S9YA 2AQ3A 1BJ1H 4AG4L 4JRYA 1TPXB 3H42H 2XWTA 3MBEA 1JPST 4QOKD 5AYUH 2D03L 4MB4A 3L6FA 3RWDB 3WE6A 4KTDL 1OSZA 3WUWB 1EMTL 1J8HB 3IS0X 4I18B 4NGHH 1ZT4A 4MAUH 4X4XA 1XF2A 1U36A 4KY1H 4OFIA 3U36A 3O81A 5J3HC 4NSKB 3EDDA 3AROA 1CD9B 3BIKB 5FKPA 3QO0B 2BRRL 3B9KD 2DKMA 5FYJE 1J11A 1I8IA 1JZ6A 4ZTPL 1J8KA 4F2MA 2ZCKL 5DYOB 4AYFA 5GRXG 2FR4B 3HE6D 3PV7A 1IL1A 4NZUL 1A7RH 2V5RA 5I76A 2DLHA 3FO0L 3VI4F 3WFCL 4K7PY 4MS8D 3HNVH 2VYRE 2VR4A 4G43B 2XNAA 3CUPB 5J11C 4NQVA 3RZWA 3QUYC 1KC5L 4FQHB 2X9YA 4I9WE 4DJMA 5KSBA 3BH9A 3MX0A 4D9QE 4X6DF 5J1AA 1WEJH 1MCDA 1G6RL 3WIFA 3NVQA 5IGXH 3VD4A 4K23H 5HI5D 1VFAA 4D0CB 2VWEC 3DSNA 4CMHB 1RZKC 3E6HA 1A3RL 3EO1A 1FYTD 4NBXB 3SPVB 5ID1A 2Q8AH 5C08E 1EH9A 4LMQE 4JCMA 4G8IB 4ZD3L 5HHQA 1SMAA 5H35A 4MX7A 4CVWA 1X4ZA 3OV6A 3ZTJG 1S7VA 1MRDL 4ZYKA 1JK8A 5KG9B 3KNBA 2P24B 1JWUA 4QYOB 4HLZG 3DVNA 5TGBA 1E6OH 4FQLH 1E4WH 5C0FA 1GZPB 1CGSH 3C5ZC 5D7JC 2ED7A 3D39A 3I6GA 3QUMA 4P59L 1KOAA 3QUMH 2CKBL 1EUTA 3LEYH 4HUXB 2XV6B 4NJ9H 3ZE0E 3OPZL 3PGDA 4P3CH 1XIWB 4LEXH 1DVFD 1BVLA 5SWZB 4K9EC 5FO8B 3QIBD 4YQXL 2EIDA 2J8OA 1DQQB 3D85B 4ODHL 12E8H 4L3ED 1IGTA 3GJFK 4MB3A 1A6WH 1IGCH 5FYKE 1ZLUK 4P5MA 4OGXL 2CRMA 5L2KB 5DRZA 2DTSA 2J8UB 1IGJA 2V2XB 1DSFL 1QSZA 1FNGA 2G5BA 3GO1H 4Y4FB 4F9LC 4IBLT 1P2CA 4PJ5A 4HWNA 4O02L 5INCB 3G08A 5IBTH 1ZHBA 4P2OA 1U95B 2E27L 1IAOB 4FQJH 4UIMB 3S4SB 5KAQG 1FZMA 1JRHL 5DF0A 8FABA 1XGTB 4KRNA 5J89A 4LHUG 5F7DB 2R0LH 4DGYL 2CLRA 3CCHB 4AQOA 1N0LA 4PRNB 1G7LB 1CXKA 2VLRA 1UT9A 4R90H 3TVMD 4F3FA 5C0BB 1Z0MA 2X4OA 4LSTL 3DROA 1R5IB 1WICA 3IFLL 4NYLB 3E1F1 4LK4A 5ICYB 5CJXA 2BCKB 3NOIA 3QDMB 3BPLB 5T1KA 1HKLH 5GS0H 4FA8A 3ZDXE 5SWQB 3MJ9L 2EKSB 5ISZE 1YECH 4AENB 1K9TA 2BK8A 2R1XA 4RA3A 1I9JH 4TSCL 5C09B 1ED3A 1Z3GL 3K80A 2IAMB 3QCVL 4RDQF 4M3KB 3TT1H 1EEZB 5DMJB 4IIQA 5SWSA 3GSUB 4X99B 4MJ5A 2O5XH 3QRFM 5DMGC 3VXMB 4WFHD 5JOFA 1MI5E 3RZCB 4OLXL 4C58B 4QOKA 1LD9A 2HT2C 4DTGH 4JO3L 4F80A 1R3KA 3JXAA 3KG5A 2E7LA 1FPTH 3ILPA 3E0GA 3GZKA 3S3SA 5BW7A 3T0BA 3I6LE 1JGEA 4IHOB 4YWGH 1ZVSA 1SJHA 4X8JA 4PJCE 2V5SA 3VCLB 3B9KA 4HZLB 3EZ8A 2NZ9C 3O9WA 4N90E 4XTRC 4OM1L 5LXGL 4XB7A 1JZ4A 2NW2B 2HKHH 4GRWH 5EU4B 3HE6A 3AS2A 4P5TC 1AY1H 3FB8B 1U8NA 1NUNB 5F70A 1JWMA 3GJFH 1T66C 1TFHA 1KIUA 1ZLUH 4Q9RH 1S9WB 1LVEA 1VFMA 5I1LB 4ZFZA 2IEPA 4WU7B 4WUUB 3KPRE 1FO0L 4DKEL 3QUXD 1NFDE 3VXNA 3EYSL 3P11L 1DN0B 4OCYH 3UPCA 2EDOA 3KPLB 3QO1A 1C5BL 2FIKB 4JFEE 4H0IA 3R1GL 2QR0B 1EEYA 1FYTA 1YN7B 4P2CG 2B1AL 1PVHA 4C83A 2NY6C 4LF3B 5IVNA 5DEGB 3ULUD 3O3DA 2JKXA 4MNGB 1RMFH 1Q72H 1JP5A 2BVOA 4DGVH 3CLFH 1KJVA 4AEEA 2F5AH 4EI5B 3D1MC 2BVQA 5K9QI 2LU4A 3BPOB 5DSCB 1B0WA 4Y5VA 3U9UB 4PJIB 3P0YH 3RIAK 2AK1H 1EHAA 1ADQA 4JPKH 1ADQH 1SJEB 4LASH 5HD8C 2NXYD 1DVFA 5CEZD 3SCMD 4PRAB 2B0SL 4E0RA 3SDDB 4JFPA 3QIBA 4LBEB 2HFGL 1UC6A 4X5WA 4L3EA 4PB0L 4X6CF 5JPNA 4KK6D 3F62A 4FZEH 1A3QA 3IFNL 1XCTB 4FHBD 4UT6L 4M7LL 3ZHLA 2PW1A 4DVRH 5F1IB 3X13A 4X9IA 1KPVB 4FFVC 2DTML 3CSPA 4ZAKB 5GGRY 1NH6A 1Z6JT 3MMEB 2O5YL 2BC4A 3HUJB 3IETB 3ZDYF 3HLAB 3W11C 4K3HA 4HGMA 3TBYB 1G7IB 4PV9A 2HFEA 1NJ9A 1OF2A 3U0TB 5FGBC 3ZE2E 5I8KH 3EOBB 4BH8A 3VWKC 1G9MC 4JZOB 4AEHH 3QNZA 3L3JB 1I7RA 2BJML 3MODL 2NY2D 2ZZUT 4OSUL 3TVMA 3UO1H 3VD5A 1A6VH 3MACH 1GPOL 4PJXE 4TULL 3AY4A 5J7CC 1MFBH 4DW2H 2X4PB 1TQBB 4OKDA 4XCNB 3FKUS 4FQ2H 4LPCA 3RVWD 3WLWC 1I9EA 5CHNA 1LILA 4RRPG 5GS1C 5DD6B 4XP5H 2HH0H 5I1KL 5IMMB 4UINH 3BUTA 4YDIH 2DN7A 4J8RB 2BHZA 3F8UB 3QIUD 1QLFA 3T65A 3TT3L 4OF3A 5DEFB 4NWUH 4YE4L 4ZFGH 1ZANL 1L9NA 4RFOL 4JFZL 1B88A 1N5YL 4MDIA 1RSFA 4KHTH 2FO4B 2R4SH 4KUCF 5I16A 1UZ6E 2Z8VC 3O6FD 4JFFE 4PJEA 3CVIH 4OD3L 5EO1B 2CLZA 1CFNB 5JOEA 3QR2A 1FVCB 5DO2C 4S0SD 3EYOA 2ICWJ 2MWCA 1E4KC 2CDFB 1IT9L 4DZ8B 4U6VL 4M7ZC 2FHFA 1DQLL 3MRCB 2J12B 3SY0B 2OJZL 5IMLB 2X1OA 1XZ0A 3EYVB 5CINL 3IRPX 4YPGB 2VZTA 1J0IA 3AXLB 2FCBA 1PG7X 1AI1H 1ZHNA 1F4WH 1MEXH 3IGAA 3GSQA 4ZO6A 2YK1L 4GUPA 5I1JH 1TLKA 2WUCL 5J4MA 3IJYA 2GAZA 3MA9L 2AJXH 2WQRA 1KB9K 3QUXA 2DBLL 3GMQA 3W39A 1RK1B 1FL6B 4AY0A 3VXUE 5ACZB 1C5DA 5C08B 4KI5C 5KVFH 1WZ1L 1V7NL 3RVUD 4JY4A 3HC4H 1NEUA 3ULUH 3CFKB 4WHTA 2Z92A 3U7YH 4Y16D 3O11A 1I1FB 5KANI 5HTSA 5J57B 5ICZB 1NFIA 2AV1B 1HXYA 5IJKA 4NFDA 5GHWL 3QCUH 2YD1A 4YBLB 5D2NE 5FYLD 3H9YA 5EPMB 1HYSC 1BQSA 4NQCD 4QNPE 1N3NB 1QRNB 5DRXA 3SCMA 4PG2A 5CEZH 4XXDA 2HVKA 1XF5A 5HVFB 5I1EL 2NXZB 2VDKL 4L9LB 1OB1A 4NN5C 1BZ7A 4Z7VE 3C87A 3PL6D 1MVUB 1LQSR 1CL7L 3MZGB 4M62H 3O2VH 4AT6A 1E28A 4JG1H 1LEKB 4HBCL 3BE1H 3B5TA 3UC0L 2LTQB 3BKCL 2A6KA 3ZZ1A 4O2EB 3DUSA 3C60D 5D71H 2DQGL 1T4KA 5JXED 1MF2L 1A7NL 1IM3A 5DFWH 4GMSH 2ZG1A 3RWJA 1RIHH 4GW4A 3WFEH 2YS4A 5F44A 5GISH 5EZLB 2Z4QA 2DLGA 4K8RH 5TH2B 2F58H 4HLJA 4NRZB 3BUYB 4OLYL 2XG4A 3TNMA 3OKKB 4WEBL 3WFHA 1UZ8B 5JW3L 3B83A 3HAEA 5HYSA 4BSWB 3DRTB 4CAGA 2R4RL 5CP7B 4RGMC 4GBXD 1HINL 4FQXD 1AO7E 2P43B 4PJ7A 1BD2D 1NEZA 3TGXA 2YWZA 5J9PB 3ESVF 4J3XA 1N0XH 4CBPA 5ETUA 4RQQB 1PY4A 4KZEL 5K9QG 3QIUA 4FXGA 1FH5L 4OZ4A 1BFTA 3OZ9H 2ZCLL 3LPGA 4KFZC 3TBWB 4PJHA 2JB5H 1KJ3H 1MHHA 3PWLA 5DTFA 1L4IA 1MI5B 4ZOEA 1U8PA 2DICA 5J6GA 1JUFB 1A3LL 4NKIL 3O6FA 4KK8C 4PJFA 3VMPA 3V4UL 4UDUB 4Z95H 3U4AA 3UTPD 2HT4C 1HSBA 1KCVL 2APBA 2GTZB 1F6LL 4YHPA 2F54E 2AEQH 3P9WB 1W0WA 1JNLL 1SM3H 4HC1A 1B3JA 2Q3ZA 1FDLL 5C2BL 2FZ3A 1T21A 3BHBB 2EDLA 1MJ7H 3G04A 3MRDB 1YY9D 4X7CC 3QXUA 5CSBA 2JJVA 2PO6C 1AD9A 2CQVA 4HUUA 1G0YR 3PNWB 1MHPH 3GMLA 2BDNL 5DR5H 1MIML 2VDNL 5HDQH 2R56L 4M5ZL 1MCOL 1X5HA 3BP4A 3O6ML 5EOTB 3RWHA 1I8KB 3TCLB 2Y36L 2APTA 3P9MA 4KJWD 5E70A 4G6MH 1A4JA 3KPRB 3CVHA 1BX2A 1NFDB 3CVHH 2C5DC 5FDYA 3QXAB 2K7QA 2Y07L 1UWGL 4JHZA 1BFOA 4CUCA 5KSVA 2DB8A 4JG0L 1JNNH 5EN2A 2FJGA 4JFEB 4N8CH 1F3DJ 3FQNA 4RAVB 1AGCB 1MFEL 3ARBD 4MD0B 1EGJL 2AJYL 1KTDA 3M07A 5JZ7D 4M6OL 1KF9B 1ETZB 4KVCH 4LRNH 1QQDB 4DZBA 1T89C 3G6JF 5GRZA 4Q9QL 1V8HA 4L8DB 4QXGH 4Y16A 1NMCB 2PXYB 5F88B 5DD5H 1YMHA 2OJEB 5HHPB 4M02A 5C3TA 3WFBL 1UWEL 3C6SA 1FV1B 3IKCB 2C26A 5I74C 4JHWH 3D69B 3UBXA 2PR4L 3B5HA 1IC4H 2APXA 5MEQB 3AREC 5FYLH 4Y1AD 4NQCA 1KELH 1I85C 5T5NF 2RQ8A 5GRYA 3RDTB 2V7NB 3CU1A 2FECL 4P2RE 4HQQL 4MJ6B 3L5IA 3MJ6A 3KPQA 1XR9A 1PEWA 4G8EB 5F7FA 3GB7B 4L8SA 3BKJH 4HUMB 2L0DA 4O4YH 4OV6F 1HH9B 3PL6A 1YEKH 3ARDC 1A2YA 1P4LA 5CCKH 1DL7H 5EB9A 2P4AB 4PS4L 2XXCB 3QNYB 3OKMB 1OAUL 3PF2A 1BMGA 4B0MM 1B90A 1YNLH 4TSAL 1T0NA 3C60A 2NY0C 5CSGA 3LD8C 4NUGH 3GGWA 3OKNA 4JKWA 1JGUL 4KK9C 5DHVH 5JXEA 4R3SA 3ZT6A 4NZRL 3PWPE 4B7LA 3NIGF 5AUMB 4LCCA 5C0CD 3RY4A 1T1WA 5J6HA 3FCTA 5F1SA 3KS0H 4U05A 3C6LD 3CPLB 3BPCB 4YZFE 1YQ2A 1U8JB 4KTDH 1XFPA 1XR8A 2WV3A 1U8HB 2AK4D 1ZLVH 2LV4A 2YWYA 4PJXB 4OAWB 4P9HH 4W6YB 3ZYZA 4GKSB 3JWNC 4JM4L 1CZ8H 1NGZB 5EULV 4MQXD 2IG2H 1F3JA 3MOAH 1XF3A 2GJZA 4IOIB 4GG6F 2XG5A 3S98A 4HPOL 3TA3D 4GBXA 3RY5A 2BRRH 1YA5A 4FQXA 4WY7L 1BD2A 43C9B 1RULL 4XNUL 4APQC 4LQFL 5ADOL 5E99L 1NSNL 1JV5B 2ZCKH 3IT8D 1F02I 2O61A 1KIPA 3LKQA 3T0ED 4F57L 2PTUA 5B21A 1M71B 1S7QB 3L1OL 5FUOH 2VH5L 3RWCB 4XNMA 5KANG 4Z0BL 3VFUB 1FFOB 3OR6A 3P4NB 1Q9WB 5IVZB 5BVPH 4AEIL 3IS1X 2IALA 4CADB 1FN4A 5JORB 4O9HH 1CXLA 2FRGP 2BZDA 2XT1B 2DRUA 3N1PC 2NR6D 3WKML 4HXBH 2V2TB 1PG7W 4JFFB 2VO5A 4M1DH 4XMLH 4XXCC 1KN4H 3SE8H 1A3RH 4M48H 5E94B 4F7EA 4ZDHA 5I30L 1UCBL 4UAOB 5AAMA 3EYUL 1CE1H 1AC6A 1H0DB 2P8MB 3EOAB 3WS6A 2FEEL 1EJOL 4DN3H 4C56D 1CXFA 5TQ0H 4XMPL 1SEQH 3IJHB 1FLRH 5KVGL 1QSFD 3IJSB 5D5MA 1I7ZA 5E4EB 4K7PH 3ULVL 5T1MA 3EJYC 4ZFOL 1YNTB 5LBSL 4F7MA 4ELMA 3ZKXC 4JRWA 4X9HA 1HWGB 4K3EL 1PGRB 4S1DC 2VLLA 1IILE 3S37L 1JPTL 5DS8B 2YPVH 3SE3A 2A9MH 4XAWL 3BI9X 3ZKNC 1R24B 5HHNB 5HYJD 1TNNA 2MKLC 4UV4H 1J1PH 3H3PL 5CJOH 1XF4B 3N9GL 3NBNA 3KLAA 1KB5L 3FO9B 3VXUB 2GKIA 1LO5A 3ARBA 4NC1C 2VZOA 5BJTA 2G75A 3B4NA 2EXWC 3AFLA 4YUEL 2VAJA 1MCKA 4KXZH 2UWEF 3CDCA 3DVGA 2VIRA 1J8HD 4OLWH 32C2A 3DRQB 4A2MA 2GYSA 1DQDL 1G6RB 4OV5B 3OAUL 2EH8H 1M7IB 3DI3B 5D2NB 3QEUA 5A2LH 4B5EA 4HJGB 3DWTA 4M7JL 5CIPA 4F7CB 1F6FB 2DDQH 3LY6A 5CIPH 4Y1AA 4GG8B 4ZFFB 4G42A 1IEAB 3UJTL 3H7BB 2BERA 3WBDA 4OZHF 3VH8G 1SBSH 2ESVE 1T7ZA 4U1JB 3LIZL 3QEQE 3QUKB 5D2LA 5DUMH 4D3CL 5DLMH 3H9SA 4QGTA 2CUMA 2F53D 3UYOD 5D70L 1QLRA 2V9QA 3PHOA 2E9WA 1JHLL 1HHKA 4BSVA 5IIEB 2W0FB 2YRZA 3VD3A 1QPPA 4KRMB 1A1MA 1UB6A 1MRFL 4M5YL 3TNNA 5C0CA 2DMCA 3BD5A 4Q2ZA 5I1DB 1K85A 3MGOA 2BSTA 2NQCA 3C6LA 3QP3A 4KJPD 5JNYA 1MJJA 4L29A 3BAEL 5ABDE 4KAQL 3RUGB 2AK4A 3WXWH 2OZ4L 4YR6A 3N1FC 3HE7C 1DQJB 5ICXA 3DSFL 5TFSL 1JIBA 3GHBL 1OY3B 3HMXL 4KQ4L 3T1FA 3LEVH 5BV7C 1BWWA 3QG6B 3TFKD 3TA3A 1AO7B 3VFRA 3PV6B 4O2CA 1PYWB 4FQPA 3QQ4A 1MLCB 4OM1H 5SWZD 5I6XB 4LLUA 2V17L 1ZHLA 1EJ6A 2G5RA 3CSGA 3T0EA 3FAXA 1LO2L 5DJXA 5EU3B 1ZT7B 5C0JB 1QFWM 5C7XH 5I8OH 1F4XL 1BBDL 3QDAA 3SDYH 1MFDH 1PBYA 1BECA 1HEZB 2OR7A 1GSMA 3E3QC 4YHYC 2L4OA 2H32A 2PTTB 5L2KD 4KHXL 3MLSL 4UUJA 5MEOA 4NNXA 3ARUA 4MNQA 3Q0HA 2JLLA 1R5WA 2GK2A 1MFNA 3RBGA 1S5HA 4G6KL 4JO1H 4WFED 1JNHA 5C0NC 2I60L 1GIGH 1SMOA 5ECJE 5MI0C 3NACL 3Q6FA 3D25A 3JV6B 2A74A 3MRIB 4MA7L 2F54B 3HS0B 1NDMA 1WSST 4OZGF 4LARL 1FORL 5TDNB 1KNOA 1T5WB 2YRPA 3MUJA 4OCSH 4HIXH 4C56A 4LCWD 3A67L 1VACA 4BQ6A 3WL9B 1QSFA 4JQXA 4QCIB 4D94A 2AXHA 4AM0B 1H5BA 4RA0C 3H2WA 2HYMA 1AD0A 4HULB 1VPOL 2W0KA 4MDJA 4P57B 3H9ZA 4Q0XH 3LS5L 5JMOC 4Q97A 3TJEL 1MWAA 3CDGB 1MWAH 3HC3H 3FN0L 2DIBA 2HTKC 1R3LB 1KTLA 1G7JA 2IAMD 3A6BH 4X7TA 5EUKA 4OLZL 5HYJA 2Y72A 4KV5F 1R3IH 4PRBB 2AI0L 4WWKB 1KN2L 1WTGT 4MJ4A 3VFWB 1JPGB 5DC4B 4YGAB 4ZUSB 4OGZA 3V4PL 2ADIA 4M7LH 1Q1JL 2DD8L 3AS0A 3IYLW 3WO3B 2YPKB 4Y5XB 1UM6H 3U9PL 4KDVA 4MB5A 5KVMC 5TDPB 4NUJB 2XA8L 4WFGE 3RZCD 3QXTA 1FE8H 3SHSA 1DP0A 2ZJSL 3H0TB 5AD0B 5IT2L 4N8VG 3KHQA 3WUWA 3LDBC 5E8OB 3QJHB 1J8HA 2Y9RT 1FO0B 4HWZB 2H8PA 5HHXH 3FQTA 2EEDA 4Z78B 5I8CB 4NZTH 1RJYB 4MHHI 3SDXE 3QXDB 3BIKA 4XC3H 4Z18A 3QG7L 4ONHA 3QO0A 3O2WH 1UYWH 2HVJB 4ELKB 4UU9A 4K9EL 2O93L 3ARWA 4GQ9L 4QRUB 3NCMA 1YEEL 3MRNB 4TRPL 1HHGB 2EDNA 3HAEG 5HYSG 4PP1C 4P2RB 1WWCA 3EYFB 1RHFA 2G2RA 3I02B 1AP2A 2XWJB 4MXQD 1T0MB 3DIFB 3OAZH 3WIHA 4NP4L 3CUPA 4LSRL 3WIHH 5GQBA 2O5ZL 3QDHA 1TPXC 1CFTA 2F53A 4Z7WE 5I18H 1M6OB 4KWUA 3QI9C 2D9QB 1ZANH 2CJUH 1W0YT 1QNZH 1A47A 1LNUB 3ZHDA 5CD5C 4J3WA 4DOHE 5F7YC 3J7HA 4OCRL 4X80L 3SPVA 3S3PA 1UH3A 4PGDA 1QOKA 4XP6H 4WV1A 5EIQA 1F2QA 2RCSH 4G8IA 3V5KA 4JFQA 3CFCL 3SJVE 1MQKL 3NPZB 3QZWA 1IAIM 4QYOA 1U8KB 1BQHA 4PJ9C 3SDAC 1DBJL 2QSCH 5E2WL 1Y6NR 5F6IC 5GRUH 3TV3H 2UZIL 5JW4Q 4ODXB 1HK6A 1XIWA 5T3XD 3IDIA 1INEH 5SWZA 3NFNB 1RHHA 3T2NH 3HI5L 5FO8A 1MOEA 1RUML 4MD4A 2EYSB 3WKNA 2HFTA 3GUTA 1RFDH 3WN5C 1VADB 5F6HI 5L2KA 5DMIL 3MV9D 2J8UA 5GZND 1D6VL 2V2XA 4OUUA 1IRAY 4OLVH 4I0PB 3U79A 3DV4B 4HEPG 4KJQD 4HF5H 5INCA 4AH2B 5GGRB 2JE8A 3S4SA 1IQWH 1XGTA 2J4WH 1K3ZA 1RIVH 3LN5B 5DUBB 2EDTA 3PDDA 3MBEC 1J88A 3C09B 5D7IE 4PRNA 1G7LA 4XNXL 4LCWA 2JTDA 1YEGL 1DJSA 1R5IA 1CXIA 2BSRA 2X4QB 2I5YL 2VDPH 3OJVC 4ESKA 4NYLA 5DXWA 2R8SL 4H88H 4I3GA 3QSKB 2ID5A 4KTEH 4XP4L 2ZG3A 2B39A 3VG0L 4G80B 2VXVH 2A6JA 2EKSA 4MJID 5EC2A 4ODVL 1FRGH 2BOCB 1P4IH 2CGRL 3AU1A 4YHMH 1MFCL 4CVUA 5I1EH 2WW8A 4U31A 4GMTH 2FSEB 2A1WL 3ZKMC 2IAMA 2QADC 4FFWD 1MCEA 1EEZA 4HMDA 4TNVK 3B3IB 1VFUA 4X99A 1ULVA 4N68A 3FT3B 1C16B 2QHRL 1N59B 5E2TH 3IVKA 2CLVA 5C0AE 3RZCA 5E6YA 1UA6H 4S1QH 4NWTH 3O3UN 3OB0K 5DDHB 2HLAA 1Z9SA 4HD9A 4JFYB 3EBAA 2YEZB 3GRWA 2ZKHH 3VFTB 5I73B 3BMWA 1H3TA 3T2PA 2ITCA 4PRID 2LU3A 4Y4HB 4IHOA 3GI9H 1WIOA 4LKCB 3ULSA 1DBAL 5C0IA 1C12B 4NO0B 4DN4H 3PDOB 4QLRA 2Z31B 1Z5LB 4FFZL 4K3DL 3U30B 1EHLL 3IFPB 3REVB 2QV2A 4KMLB 4WVRA 1IZKA 4HZLA 3DPBA 2ENYA 2OBGA 3BEWB 4M1CD 2GJ6E 1EEUA 4W70A 2CUHA 2EE3A 4HH9A 3CX5J 3CXHK 3TO2B 3QEQB 4KRPB 3LRGA 4QRRE 3FB8A 1LMKA 1HXMB 1PKQE 1MJUH 4U1HA 3MPCA 2H9GA 4HWBL 3SGKC 5I1LA 3RFZC 4WU7A 4D9QD 4QTIL 1ZA3A 3TZVD 1KTRL 3HC0B 4UV7H 3RGVB 3WEXB 5C07D 3KPLA 5IB3A 2FIKA 2EDXA 3L3KB 5D7SL 2QR0A 1QA9B 1X5FA 5TE7L 2QLVB 2XTJD 4RFEB 4LF3A 5DEGA 2YA2A 3BW9A 4MYWB 5FUZH 1AR2A 5GRJL 5CUSH 5F7EH 4OCWH 1DBKH 1IQDA 4P3DB 4U1KB 4R4BB 1W72L 1YUHB 4HUVB 4X98A 1ZGLP 3O4OC 3VGEA 4KU1A 2IPTL 1MCNA 3H9HA 1K6QL 4PJIA 4JE4B 4PY7A 1D5XA 5HPMB 3NIDF 3FFDB 4OQ1A 1WC7B 1ZSDA 4NKOB 3TYGH 2D0FA 2JJWA 3L3GB 3UYPA 1TJIH 4YIQB 1EBAA 1AXIB 5GS0C 3FOLB 1FNSH 4JJ5B 1GOFA 2P47B 2D7MA 3O6MH 3T2QA 1T03L 2Y36H 5K9KB 4XCEB 3HCVB 3NABH 2NY7H 1XCTA 4QY8A 4BELD 2AABL 4MHHG 3MV9A 3SGJC 4MD5B 3P4OB 5KW9L 4YDKL 4PD4K 3S36X 1HYRC 5FO7B 1KPVA 1DLFL 2ADGB 3BXNA 5I1GH 1WAAF 3C8DA 5EU7E 4EI5C 1KCRH 3OB0H 5ID0B 5IMOB 3U0TA 1I1AB 2ZSWB 3ARFC 4Y19E 2AJYH 2N56A 3EOBA 1MPAH 2NCMA 1JYNA 1RZ8B 3FONB 4JZOA 5LQBL 2ZUQB 1B9ZA 2KKQA 5CWSB 5DC9B 4KK5D 3MUGB 4E41D 4QHUA 1FGNH 1NQBA 1HIML 5T5FH 5DJCB 2IH3A 1HHIB 3ARRA 3EYQC 1N6QL 3SDDC 3LMJH 4XCNA 3ABZA 4LLWB 5CZVL 4Z7NE 4HK0B 4BH7A 3QA3A 3BKMH 5CGYD 2GIYA 4RISH 3HPJB 5ISZD 3HHRB 2B4CH 4MJIA 3I9GL 4JKPH 5DD6A 5GS3A 5BZWA 5IG7A 5I0ZA 3QBTB 3RU8H 1D5ZB 1TVHB 4KMQA 3S9DB 5I19L 1DZBA 3BP7A 1MY5A 4ZSOE 4OT1H 5H37G 1L7IH 1E4XL 1NKRA 1YPZF 1U8IB 1UKSA 4MXVE 4NT6A 5GJSH 3BIAX 1BM3H 4DUWA 5E2UL 5IBUB 3RA7H 2DQFB 4P23C 1F4AA 5AG9A 2CMRH 4JFDB 2A9NH 2C4XA 3SDCC 3BN9D 4WJ5A 4JKLA 2NTFA 2ZUYA 5EO1A 2SEBB 5ANMA 5C0GA 2OYPA 1E27A 4LLQB 4PRIA 2CDFA 1YEFH 2VWEE 1BLNB 3SDXB 3CFBB 4M1GL 2C1OA 3EHBD 4JO4L 1I8LA 1JFQL 4XWGH 1PG7L 1YEDA 3G9VA 4G6FD 5IMLA 3MA7B 4N90D 5DJ0B 4YPGA 1ZGLB 4Y5VC 3AXLA 4HS8H 4GT7A 2OXGA 3L95B 2I27N 4X7EC 1LK3L 4X7SL 5EWIL 1RUKH 4H20H 1BIIA 5E99H 3MRLA 3QDJD 5CBAA 4KKLC 4YK4B 4MAYC 4Z7WB 2H1PL 1MCPL 3KPRD 3RJQB 5KS9E 3K1KC 4RMUA 1RZFH 3TZVA 1RI8A 5IEKA 5C07A 1OAKL 1DDHA 4DOHB 4JFED 4YXKH 1RK1A 3IDGA 5GGUB 3M1BB 1FL6A 5GSRA 2AERT 1CK0L 3HI1A 5ACZA 1LE9A 3FQXB 3SJVB 4XWOD 2VLJE 1AHWC 4I77L 1KJMA 4BZ1L 3DX8B 1X6LA 4UOW1 1UJ3C 2OSLA 5ICZA 4RGOL 3TM6A 1A02N 2AJVH 3KPSE 3D3VB 1G7MA 3NFPA 4MMZC 1MJ8L 5E7BA 3TVMC 1JGLH 3C8KA 2COQA 1N5AA 1OM3L 3AY4C 5EPMA 1H15B 4IMKC 1UM5L 5FHBL 2R1YA 4UTBH 3AVEA 2JCCF 1J1XL 3LEXA 5AWNH 5I75B 5DQJA 4YHOL 3UPRB 4J3TA 3RVXC 2E7BA 4CN4A 1E6JL 2E9BA 2IQAB 4X6CE 1MVUA 2YUZA 1IBGL 3N85L 3X17A 1KACB 1TZGH 4K71B 4MLSA 3X11A 5DK2B 5EOCH 3FZUD 2W1NA 4NNYA 3K8LA 3HUJF 4ENEC 3BT2L 1A1OB 3P40A 1U3YA 4B53A 5DQ9B 5D7IB 3MV11 2XQBL 3LB6D 3RY6A 4E41A 1X7QB 4OFDA 1UZ8A 2BFVL 4TTDD 4UBDD 1U8MB 3WUWG 3MLVH 1RQ5A 3F12B 5L2JB 3HA0A 2AAVA 2NXZC 4U1LA 3ZKQD 3KYNB 3OTTA 4L9LC 4XNYL 5ISZA 2WIIB 1MRCL 4J1UB 2GW5A 3MROA 5J9PA 4R96A 3UTZB 3CLEL 2G9HB 4H26A 1MVFA 5L9DH 5DJ2A 1N7MH 1Q9KA 2M8XA 5CEYB 4PY8J 2Z91B 4O58L 5EBWB 2ARJB 4IRSD 3V6FB 4UILL 4ZFOB 3RL1B 3LH2L 1RIUH 5C0AB 1T2QH 3MGTA 5E1AA 4NO3A 2DQUH 2RJMA 3I2CL 2XZQH 2VAAB 3CSBA 2BSSB 4M5YH 4H0HB 1F4HA 1F6AB 3B8YA 4L8CB 1RZJL 1FZOB 4LLDA 2XN9E 4NC0B 2VB5A 1VESA 1OPGL 3BAEH 3SE4C 4CJ1A 3TYFA 1FFPB 1OSPL 3BHBA 1P9MC 4JPWL 4PJCA 3MLXL 3CGTA 4YHKH 5GGQH 5I71C 3O6LH 3DSFH 1ZS8B 4LSUL 2NY4B 4W68A 2GFBA 4O5LH 2GJ6B 3FAWA 3MLZH 4Q6IA 4ZPTB 5ADPH 1BQHG 2B5IB 1PKOA 2XQYK 2EO9A 4QRRB 5CD3A 2Y7QA 3S8WA 3S34H 1PKQB 3SKJH 5TE4L 3QDJA 4WI2A 5EOTA 4NCC2 4ONFL 4OZFH 5DVKA 4I3SL 2A6DB 5CEXA 2BVEA 3KPRA 1NFDA 2X4SB 1JYWA 3QXAA 3LQAH 1T3FA 4B41A 2PYEE 3GIVB 5DFTA 4QHKJ 3PP3H 1OTUD 3EAKA 4JFEA 3OR7A 4HAGA 1ORSA 4F9PA 1OTTC 3FRUB 4RAVA 4MD0A 3T77A 5ACMA 1KLUB 5K93A 4X6FB 3U48A 1ETZA 4RIRA 1QQDA 3VA6A 3BZEB 3O0RH 2Y06H 2YBRA 3NACH 4L8DA 3WD5L 4G8GE 5F88A 3S4SG 3EJZC 1AJ7H 3MUHL 1A4KB 1TENA 5HHPA 4DGIH 1JI1A 3QQ3B 4F7PA 3B9EA 4K8RC 1JHTA 2I24N 1FV1A 3VWJB 2F15A 2WSKA 4R26L 3JV5A 1B4JH 3WIIL 1JZ5A 4LLMA 5MEQA 1IKNA 1V3LA 3HR6A 3ZE0F 3Q5YA 3FT2B 5J0BA 5IVOA 5I1IH 1JYVA 4RFNB 35C8L 3RVWC 1HILB 1TCMA 3PHQB 4MJ6A 2K1MA 2ZCHL 4LGSB 3RIAF 4EN3C 3RI5K 4PJBA 5E6IB 3ME0A 4WU5A 3GSOB 3LRHA 3L5XL 4KJYB 3PGFL 4LMQI 3TJHD 3T0WA 4XAKE 2C1PB 3PP4L 3FL7A 5IESH 4XVSL 2EE9A 4Z7UE 2V9RA 4L1HA 3I6KA 2ZUVA 4JM2C 4EIGB 5IW1B 1E4JA 5EOQH 3SKNB 2Z93A 1XGRB 5GS2H 4Y19B 1B0GA 3SKMB 2VDOL 5AUMA 1G7QB 1DEEA 1A9EB 1CLOH 2R0WL 3AC0A 1KG0B 3CPLA 4S1SL 1KCKA 5F96H 2J3SA 3G6DH 4XHJD 1JZ3A 3EW3B 1U8JA 4S10A 1QFWL 5DC0A 1SVCP 3DO7A 4Y8DC 2QTEA 1G84A 3PQYE 4ZO8A 4OAWA 2GTWB 1NGZA 1ZLWK 2ADFL 1ZEAL 4F7TB 2QQNL 3KYKL 3O6KH 5IHUH 4CRPA 4NO5A 3RVTD 3IDMB 4U1NB 3BSZH 3ES6B 4P2QE 1BVKB 3WXVL 3J8F7 4NKDB 1CWVA 3QUZD 1IM9B 3BH8B 3P77B 4ZSOB 1S7QA 3PIQA 3RWCA 2QQLL 4GAGL 1N8ZB 3KR3H 4W4OA 4MSWB 3VFUA 1FFOA 3P4NA 1OW0C 3GM8A 4IRSA 4PJGF 3ARQA 5FOBA 1T5XA 3SKOA 1P7KA 2W0LA 3P30L 3SEPA 5J11B 5TDOB 1FGVH 3QUYB 4XBGA 3VFGH 4LU5L 1I4FB 4AMKL 1VENA 5E94A 4WCYL 3ZL4L 3QCTL 4KZDL 5E8PB 3D18A 2F54D 3MRFB 3TN0D 1HCFX 2P44B 4ORGB 1GC1L 5DA4A 1CLCA 3CFCH 3IXAB 1IE5A 1O7VA 2AJUL 1MQKH 5C6TL 3HTLX 4KI5E 3IJHA 5DJ8A 2P5EE 2ICEA 2R2BA 4Z5RA 4GRMA 3IJSA 4MCYB 2EDYA 2VC2H 1T83A 3BZFB 4FQ1L 5CJBA 4PRHB 1S3KL 4YHIB 1P7QD 1YNTA 3QEHB 2NMSA 2DI9A 2NY3C 2BXYA 4LHQB 5IM7B 4E5XB 2OCFD 5D7JB 3NIFF 1YNKH 4M00A 1RUMH 5F3HB 5C9KA 1R24A 2WMPA 5KS9B 2W60B 5E0QA 5DD3L 4WI4A 3TBTB 1I8MA 1NCTA 4L8SC 5CGMA 5F8RC 3AAZA 2FJHB 5C86A 4HCRA 1CFQB 2MPAH 3FO9A 2H3NB 1H3PL 4UAOC 4HCRH 5EU6E 3M17B 1BFVL 3WUZA 2VITB 1CQYA 4OI7A 4XCFH 2VDLH 2VLJB 2EH7L 1GGYA 1NL0L 1FHGA 3LV3A 1NUDA 4JM2F 2QQKH 4POUB 3G6JE 3DRQA 1X5XA 4I48B 3FQWB 3L7FB 1IAMA 1VCAA 4XCCH 3PDGA 4WO4B 1M7IA 5C9JB 5D2NA 3OBAA 5CMAB 4P9HC 4HJGA 3MV7E 1YEGH 1HQRA 1ZWIA 2X1QA 4Y2DB 1C5CH 5D1XD 5IEHB 2VDRL 1FVDB 1OL0A 2PCPB 4GG8A 2DF3A 4ZFFA 1IEAA 4FMFA 4X9BA 5IB4A 5CLWA 4LAQL 1K5NA 3LSOB 4R7NA 1N64L 1MHCA 4U1JA 5SX4H 3QUKA 1YQVL 5F7NC 4Z7VA 1G7HB 4X6CB 3EFFB 4HIIA 1IAIL 1L7TH 3VDBA 5FUCC 5ALBH 3U4EB 1INDH 1I9RL 4QHNB 5IJVB 4OGAC 1A9BB 2AS5M 4Y8AA 4PJDA 2YA1A 2QHRH 4TUKH 3PWPD 3FFCE 4HFWA 5JLZB 3ZE2F 4DUVA 5F1NB 1D5IH 5BOZG 1MAML 2RIKA 4RNRB 1MY7A 3HB3C 4X7FC 4EBQH 2EDWA 2W65A 2UUDK 4UNUA 1BAFH 4RMSA 3W9EB 1DQJA 4PJXF 3JWDH 5IFHH 5M94B 2VDQH 2IPUK 5FB8B 4GRLC 1UM4L 4TVPL 5HBBA 3QG6A 1DBAH 1X5GA 1HHJB 4LP5A 1TIUA 2CO7B 3F7RA 2Z35A 3ET9F 2DIJA 3MOQA 3PV6A 3BX7C 1YY9C 3WDJA 1CDUA 1IKFH 1A6UL 1MLCA 3HMWH 5BS0E 1NMAL 3QUZA 2B2XL 1S7XA 5JQ6H 1AGEB 5C0JA 5DVNA 2NZIA 1U3ZA 3NZHH 1AFVH 3OG6B 2EO1A 1HEZA 1LDPL 5DT1H 2BOBA 2FHCA 1GXEA 1TETL 4PRPD 3VXPA 4UQ2B 5F21B 5HYFA 4I0PD 2NYYD 2X4TB 2YD8A 3QAZB 2ICWA 5H2BA 2ZPKL 2JIXB 2R29L 4XPHH 4XC1H 4LDEB 4FQIH 3QULB 1UZ6F 2FBJH 3D6GA 1A0QH 1FP5A 1OGAE 1RUQL 2VN7A 2XN9B 2F54A 5CSZA 1YJDH 3TN0A 1NGPL 2OMBA 4YBHA 3JV0A 2HMIC 5GRJH 3OAYK 5T33H 5L6YL 1YEHL 4LCIH 1T7WA 1K6QH 3QIWD 1YMME 4QCIA 2OS7A 3I50H 2AQ2A 4HT1H 3DYMA 1P7QA 1PAMA 4P57A 3LQZB 3BPNC 4YDVB 1DQTA 1JGVL 1MH5B 3QQNA 1CICD 1WIUA 2GSGA 2DQJL 3ARXA 1FZKB 1F13A 4JRXB 1WVZA 3IDXH 4Z77A 1OT2A 3KLHD 3VA2C 3BGMA 3DVFA 5HHME 5DFVD 2PYEB 4OIIH 4ZUSA 4LVEA 1TJHH 5EFIB 1NMBL 2B7DT 4Y5XA 5TDPA 4YLQT 3OHXB 3KXFE 2HKFH 4G6JL 2D4FA 2NTSP 3MNVA 1PFCA 1A1NA 2DQIH 5AD0A 1BHGA 1KJ2L 1J7VR 4ZOBA 3QJHA 3RTQB 2UUDH 1VGEL 2X70B 4HWZA 3MV8D 5EORH 4WDIB 3KVQA 4Y4HD 5LQBH 2ARWA 5I8CA 3VXOB 2W0PA 2PYFB 4JZJB 5MP6H 3QXDA 3TO4B 5JR1L 4LVHC 5D1XA 3D5OF 2HVJA 1GAFH 1I7TA 2VE6B 4XP9L 3IDJA 4J6RL 4TSBH 4QNPF 1HHGA 1A7PH 1Q94B 3MR9B 3PJSB 4M6NH 4XMKH 3V4VH 3KAAA 3INUH 3MCKB 3L7EB 2BVPB 2ESVD 4OZHE 3GSNA 1BQLH 1W72B 3QEQD 4KDTC 3X12B 3HNSL 5L88L 2IADB 4RBPK 3BP5B 1JN6B 3GSNH 3O45B 1LWRA 2XWJA 5I19H 4OCLC 4V1DE 5GS1B 5E2VL 3G5ZB 4KPHL 5HHOE 4Z7UB 3KYAA 5FHAH 1MLBB 3MSPA 2DQCL 3ILQC 4R4FL 4HKJB 4I4WB 4XNZC 4GH7B 3CSYA 1DUZB 3H42L 3PWPA 5F3BB 5AYUL 1DFBH 5KVEL 1QBMH 3T4AB 4MA3A 4ZXBB 2OR9H 3L5JA 2NR6C 4QRQB 3DBXA 4LVNC 4FFYL 4NGHL 1CIDA 3PQYB 4N0UE 4MAUL 1WZLA 2FX7H 3RUGF 4KY1L 4OZIA 2XIDA 5SX4I 1EZVX 3E6FB 2R23B 5FXCH 1NUGA 1WQVT 2EEAA 5LGKA 4ODXA 3W5NA 5TPWH 4M7ZB 5IBLD 4P2QB 3NFNA 2QHLA 1A7RL 4KC3B 5JQHC 5K9OB 4R97B 4BJLA 3HNVL 3G6AA 1UH4A 2L7JA 5SX5K 4JAMA 5FO9A 1ES0B 3N06B 3AUVA 1KYOJ 4KKAD 1WEJL 4W81A 4PRPA 5BOPA 5IGXL 3LQMA 4I0PA 4OJFH 2Q7NA 1JL8A 1JF5A 2YSSB 2HTLD 2UYLB 4JDZB 4Y88A 3ZYOA 3B5GA 1JI2A 5D7KD 5EZOH 4N0YH 2P8PA 4LPYA 2Q8AL 1I1AD 3KYMB 1Q9OB 3G5YB 1XMWA 3GBMH 1JRHI 2NX5E 2VLKB 1WBYB 2VJXA 3HG1D 2R1WA 1FNEB 4KROC 3EDEA 4JB9H 4NC1E 3VFNB 1E6OL 3U0PB 2YD2A 4JGJA 2P5EB 1E4WL 1NANH 2NW3B 4FTVB 3W81A 1CGSL 4FABH 3BRGC 1R3JB 3QIWA 4P48A 1DLHB 1CG9B 3BQUC 3QUML 4U6HB 2YN5A 4NJ9L 1K3IA 3EOTH 3DURA 4P3CL 4ZPVA 4LEXL 3GMRA 3TPUB 4D0DA 2JJTC 3VE0B 3RJDA 1CICA 2BOCA 5KVDH 12E8L 4Z9KB 2P45B 1A6WL 1IGCL 3UTTE 1HZHH 5CBEB 4D9RD 4YHOH 1MCCA 4XH2B 5T3ZE 3MRRB 2VRAA 3B9AA 3PXJA 2X9XA 4JPIB 3D0VB 3F7YB 5MEND 4PG9B 4H1LB 1SYSA 3FTGB 1R5VB 3B3IA 4XNQA 4CNIA 5F97E 3GO1L 4WNQB 3STZB 2BMKB 1C16A 1N59A 2FH8A 4NN5B 5IB2B 4WFGD 5IBTL 4V2BA 4FQJL 3BN3B 4YDJA 1VEPA 2DWDB 3LAFA 4YBQD 4P46D 4ODUA 3T08A 3GSWB 2R0LL 3KPNA 3OX8B 3S96A 3VFTA 3MV8A 4R90L 3ZE1F 4Y4HA 4R2GB 3WHXA 4KJPC 4LKCA 1GGCH 3IDYC 1WZMA 2EYTB 1QR1B 3MV7B 1Z5LA 3IFPA 1CVSC 3O3AA 3V2AR 2Q7YB 1I9IH 1HKLL 5GS0L 1A7OH 2F19H 5I1AB 5ACLA 3TO2A 2ESVA 1YDPB 3UP1A 3QEQA 5IOPB 2F5BH 1I9JL 4RGMB 5SX5H 4Z8FH 4GOSA 3SQOL 4K7FA 3PWUB 2EXYD 4NQED 4PLJC 2A73A 3TT1L 2RR3A 2VZ3A 1GVIA 1ZA6A 2O5XL 2VQUA 2XPGB 2YMXH 4UI2A 3HC0A 1IGFH 1V3JA 3GHEH 4PV8B 3WEXA 5E2JA 3L3KA 4NM4H 3VMOA 5I73C 3TESA 4RAHA 3MGAA 9CGTA 2OL3B 1NGXB 1WK0A 3E3QE 4EJ1C 5A3ID 4DTGL 1QBAA 5F7UA 1P6AB 5FA3A 3MUY1 1FPTL 3JWOH 2Z31C 4OF6A 2YD9A 4YWGL 1YUHA 4HUVA 2NY1B 5JHDE 5E00B 1CD1B 1QYGH 1KSRA 4NQUA 4PLKD 3KWWB 3WJJC 3MLXH 3CDFA 4KRPC 1WC7A 3VXSE 2X2YA 2HKHL 4MMXC 3L3GA 4JHAH 1FZJB 5JMRA 1F5WA 1BJ1J 2V7HB 1AY1L 4YIQA 4POZC 2CH8A 1Z2KA 1KLGA 3KHOA 4P49A 5AZEH 5TE4H 3RGVC 3NN8A 4Q9RL 1MCIA 5ESAB 3RGHA 3S36L 1OWRM 5K9KA 4XCEA 1NBYB 1TITA 4HGWA 4I3SH 3AM8C 4F33A 4TVPE 5EIIA 4I0KA 4PYGA 2EIZA 5D9SA 1DUYB 3P4OA 2FGWH 4HHAB 4OCYL 1IZJA 3HZKB 1XEDA 1FNAA 5JA8B 1T6VN 5FO7A 4WW1B 3Q6GH 1T2JA 2ADGA 2X05A 1MIEL 1DANT 1RU9H 5GZOC 3EGSA 2FYYA 5ID0A 4NJAH 4X5XB 2X5PA 1I1AA 2ZSWA 1OGAB 1RMFL 1K4CA 1Q72L 2Y23A 5FCSH 3BP6A 3ZTJH 4K3JH 1S5IL 4DGVL 3CLFL 3FONA 2F5AL 2BY3A 2V9TA 1NGYA 5JO5B 2FJFA 3HG1A 5DRNB 2YD4A 3ZKSD 3BDYH 1JF1B 5JHLH 3P0YL 1MHEB 4J2XA 1YMMB 4U1IB 4IMLA 4LLWA 4OQTA 2CIIB 4JPKL 4OQTH 4IJ3C 5BXFA 1ADQL 4NQXB 2GUOB 4N0RA 4LASL 2VABB 3GEWB 1XCQA 5FYJU 4AJ0A 3ZSTA 5I74B 1CE6B 4UIKH 1D5ZA 1KCUL 3AREB 4FZEL 1ITCA 5IQ7H 5HHMB 3CX2A 1UKTA 4M7KH 1YY8A 4WTWA 4JQIH 1TCRA 6FABH 2Q6WB 1U58B 4DVRL 2OP4H 4N0CC 4Q7DA 4JFPB 3O8XB 3KXFB 2ZUQC 3ARDB 4NN6B 2BNRD 4P46A 2C3VB 4U6YB 4YDLC 1X4YA 5I8KL 4FQQA 2SEBA 4AEHL 2FX8H 2AXJA 2NY0B 3K4DA 1IC7L 4R0LC 4NZJA 2EYRA 3HI6H 3UO1L 2LVCA 1A6VL 3MACL 4WI9A 2Z0BA 3SDXA 1VGKA 1MFBL 4D9LH 4DW2L 3GK8H 1QKZH 1SY6A 2H26B 4JEGB 3U46B 2CD0A 1SY6H 3MA7A 1KENH 1T1YB 2NY4D 4FQ2L 1Q0XH 5D1ZD 1SHMA 1J05A 4ZODA 3QYCA 1LDSA 2FGZA 4OZHB 4XP5L 5DRWB 2HH0L 4QRPE 4RSVA 3DX6B 4UINL 3MNZB 4EUPA 3WO4C 3V5HA 4YDIL 5E5RB 2E6JA 2VL5B 5HI4C 4WW2C 4EUPH 4Z7WA 4V1DB 3OGOE 4NWUL 3W82A 3OKYA 5HDBE 4ZFGL 4ZNEA 4APQB 4NQEA 2QQLH 4J4PC 5HHOB 2C3GA 5D1QD 3C08H 2ZWLT 5J56B 1FG9C 3WYRA 4KHTL 1F90H 4QHMA 2R4SL 2FEDD 4ZUWB 3M1BA 5GGUA 2VUYA 5DZOA 3MQIA 3GSVA 3P0VH 3CVIL 4YO0B 4KJQC 4G9FE 4X6BA 4WI5A 1BWMA 4N0UB 4G9DB 4LOUC 4KZDH 4U7KA 1R0AH 3MYJB 4OTXH 4LHUB 4H0GA 3F58H 1J12A 1I3GH 3N1QC 4QWWC 3T8XB 5HGAA 3FB5B 2FATH 1PZ5B 3NIDE 5EU5B 1H15A 3DUUA 2EDJA 4NQSB 3TIDB 4GKZB 1AI1L 1F4WL 1MEXL 1SBBA 1WFNA 3L9RB 5I1JL 4L3CA 3ROLB 4JKKA 5DMKB 3UPRA 5JIKA 1GJIA 3MJ8A 2AJXL 3NCEB 25C8H 5IKCB 3ZO0A 2IQAA 4A6YA 4ODWA 1FCGA 2D9CA 4A6YH 4TQEH 2DQEH 4DCQA 3MJ7B 4H25A 5ENWB 2AXFB 4OD1H 4JPVH 5B8CA 4LLVB 4XCYA 5JPMB 4M4RA 2VKWA 3FRPA 4UT7L 4Y19D 2ATKA 5KVFL 5LJYH 1A1OA 1XGUB 3HC4L 4PJ8B 1RURH 3AMLA 3ULUL 1PX3A 3K2UH 2BNUA 2NX5B 1P84J 5DQ9A 5IB1A 1NL0H 3U7YL 3C5SB 2DYPD 1V3KA 4IS6B 1W0VB 5KSBE 5IFJA 5I17A 4OM0L 2XY1A 5FDWB 1U8MA 3QCUL 1R3HB 3DYPA 3MO1B 4AQ1B 1J86A 1CFSA 1PSKH 1LP9F 4HJ0C 3S97C 3QHZH 1H3XA 1EIBA 5KSAD 5CEZL 5J3HD 4AK1A 3ARGB 3UTZA 2JJSA 1IM9D 2CO6B 2G9HA 3UTTB 1AGDA 3VGAB 4PGCB 4NPYB 4LIQH 3O41B 1A6PA 5C09E 2Z91A 3O2VL 1WJ3A 4JG1L 2ARJA 4FMKA 3OKEA 5B38A 3D39E 3BE1L 5HGDB 4QHLB 1RV6X 4WW2F 3UMTA 1C7TA 1UEYA 5D71L 1YPZE 1G1YA 3TZVC 4U49A 3VGFA 2BNRA 4GMSL 1RIHL 2VAAA 4DUXA 5E8DH 4TNVF 3RWIA 2J2ZA 4L8CA 1F6AA 5FKAA 5GISL 3WV0A 4CU8A 1FZOA 2XTJC 4K8RL 1QFOA 2F58L 3ESUF 5BVJA 5J13B 3MTRA 4KUZH 1A6AB 4MXWH 1KV3A 1OTSC 4Q9CA 1FFPA 1S9VA 1FJ1B 3TBVA 3VRIA 3V6OA 1H3VA 2K9UA 3KPMB 3RHWK 5D1ZA 2ZP0T 1EO5A 3L3IA 1NFKA 1U0QA 2AGJH 4QRRA 3V0WH 1U2HA 1RZIA 5FK9A 1N0XL 3ULVC 3C5ZD 1OARH 3O3EB 1BQUA 2VLRE 2VZUA 3UJJH 3V5DB 2A6DA 4L4TB 3UXFA 1IMHC 2BY1A 1NAKH 3OZ9L 2HLFC 2GK0A 2X4SA 3L3HB 4HUWA 4HH8A 5I15H 3REWA 2JB5L 5ILTH 5D1QA 4X6DA 3JV4B 5GGVH 5FECA 4BFBD 1GGTA 3FRUA 2P8LB 5DURD 1KLUA 2F74B 1Z9LA 5GGSY 1G9NH 5GIRB 4YHYB 4X83A 1PLGH 4Z95L 3VDAA 3BZEA 1DTUA 3MJGX 3BEVA 3FB6B 2AEQL 3K2MC 1SM3L 3GMOA 5JHDB 3VRJB 5GGTA 2XZZA 4HC1L 1A4KA 3WCYA 5GGTH 2IFFH 5SWSE 2XFXA 1MJ7L 3KPSD 3QQ3A 4KDWA 4HJJH 1HNFA 4HDIB 4KK5C 3RY6C 1FG2B 1YEHH 2ZOKA 2VSCA 3VXSB 2LE9A 1MHPL 2XA3A 3MRHB 4MWFB 4R9HA 5DR5L 5FA4B 5HDQL 1AE6H 2OI9B 1HILA 5LGJB 4ZQKB 5EBLA 2JCCE 3HRZB 2VQTA 4G6ML 2LAAA 3UROR 5K59F 3CVHL 3GSOA 4KJYA 4NOFA 1TTGA 1CT8B 1B6DA 4JZNA 2OLDA 2C1PA 2J1KA 3RNKB 1JNNL 3PWNA 4U0RC 5EC1A 3ZTNH 4U33A 4GXVH 1WZKA 4ZUUB 2A0LC 4PLOB 5EO9B 1EFXD 1AC0A 3SKNA 1O0VA 1XGRA 2DQHH 4P4KD 4KVCL 4LRNL 4Y19A 5B4MC 3U4BH 1G7QA 5TE6H 3W2DH 1J0HA 3IKKA 4QXGL 1LEGB 1MCJA 1B2WH 5D7IF 2DYPA 3BN9C 3FQRB 5DD5L 3PWJA 1AR1D 4EI6B 3VGBA 3K8MA 2AVGA 2HT2D 1CTOA 4IOSD 1MNUL 1U8OA 4NKMA 4JHWL 3LDBB 1IC4L 4OD2B 2A6IB 4YAQB 5FYLL 2FLBT 1TTUA 3TWCH 3CFEB 1KELL 2E3VA 2YOCA 3JTTB 5TF1H 5E6IC 4U1NA 4G6AC 2AQ1A 1CI5A 3ES6A 3W9DA 1J1OH 2AV7B 1YN6A 4NKDA 2E8YA 5ITBH 1IM9A 4NIKB 5ERWB 5F89A 3BH8A 3P77A 2AEPH 5JDSB 1Z9MA 4ZSOA 5ESVB 3WS3A 3BKJL 2B20A 2NZ9D 2XZAH 3D9AH 4XTRD 4O4YL 1LO3H 1QBLH 3S7GA 3VFMB 4MSWA 4P0DA 5CCKL 1XGQB 1DL7L 4ALAH 3GKWH 1PD6A 1C08B 4P5TD 3ULVF 3U1SH 1YNLL 4YHNA 1T66D 1TVBA 4KQ3H 5IMKA 5A1AA 1J10A 4NUGL 2YD5A 3B9VA 2X10A 4GW5B 4KUCD 4FP8H 4OKVB 1MUJA 1KIQB 3QI9B 5KVEH 1FSKC 1M05B 4NDMB 1AQKH 1M7DB 1X6NA 4ORGA 1QO3A 3AS3A 3DHMA 3K81A 4FFYH 4P9HL 1B0RB 5TF0A 4LNRB 1RZKH 1CZ8L 5DJYB 2NY6D 4HMEA 2OR8A 1SQ2N 2IG2L 2QSVA 4PIRF 3MOAL 3DOSA 1Y0LA 2QSTA 1I7UA 4R4NC 3I84A 2I07B 3BZFA 1KJ2B 5ALCH 4Y4KB 2IGFH 3O9WD 4YFLI 4QRPB 5BO1L 4PJ9B 4AIXA 4BK5A 4S2SB 3SDAB 2GY7B 3R06A 3C5ZA 3BWAA 2W07A 1N4XL 5FUOL 5F6IB 2CDEB 2A83A 5F3HA 2X4RB 4X6EB 3F5WB 5HD8D 3VXQA 4TOYH 3SOBH 2BNQD 4BFIA 1XH3B 2PYED 3SE9H 1T80A 4YNYB 5BVPL 3RWFB 2FDBP 4O9HL 4NHCH 1CFQA 2H3NA 3Q3GB 1IAKA 1HH6B 4PR5B 3CAFA 3NA9H 3WN5B 4HXBL 1TZHB 4M1DL 1OWWA 2WM0A 4XMLL 5EA0H 3PWVB 4MZ3A 5E7FA 4G9FB 1KN4L 3SE8L 4M48L 4P4RB 4QRSB 3ZT7A 2X7LB 1YEJH 3FZUC 3MXVH 3NCYP 4F9LA 4G8GD 4FFVD 1CE1L 5FEBA 4I48A 3FQWA 4DN3L 2EDRA 5TQ0L 1SEQL 3T0DA 3KPSA 3BZ4B 3IXTB 1S9YB 3DX7B 1FLRL 1KB9J 2XOTA 5C9JA 5CMAA 4JRYB 4WFHE 5CLTA 4OUOA 3VWKD 5IEHA 2XWTB 3MBEB 1FC1A 2MMXA 4K7PL 1FVDA 2EC9U 2Q76A 4JN2B 4HKZA 3S6CA 5L0QB 1QRNE 1AGBA 4X4XB 1P84K 1U93A 4PGEB 3U36B 2YPVL 3WLWD 2A9ML 3CZFA 4X6CA 4UV4L 2F8VA 3RAJH 1J1PL 3H8NA 4WUKH 5IROC 3UEZA 3JVGC 2YR3A 5CJOL 4TYUA 1UWXH 3U4EA 4PFEA 5D8JH 1EFXA 4IDJH 1IL1B 4P4KA 2QADB 4LKXA 2H2SC 2VR5A 4O2FA 7CGTA 4X4YB 2XNAB 1GGBH 3D87B 4WO4C 4OLWL 3VG9C 4G7YH 3PQYD 5KSBB 5IBUG 4Y2DC 5J1AB 1A21A 3QT2A 1AQDA 3W9EA 1KBGH 5JA9A 1TXKA 5B3JF 2EH8L 4EDWH 3U6RA 3BOVA 4G3YH 2VTFA 5DJAA 2DDQL 4Z7NF 3EO1B 4QXUH 5DO2D 3IB4A 3NCJH 3ARVA 4OF8A 5LWYH 5ID1B 3MNWA 2J7LA 1I3RA 1SBSL 5HHVH 5H35B 1F97A 1T83C 2VUOA 5DUML 2ARJQ 4ZYKB 4IOFC 4C55A 1AGEA 5DLML 2H6PB 1JWUB 3DVNB 5TGBB 1UADC 5DK0A 1BREA 4MVBC 2ERJB 2VOTA 5HVGB 3D39B 3SQOH 3I6GB 3QUMB 4C54A 4H8WL 3HZYB 3C2SA 4P5TA 3VFPA 4EUPG 4UQ2A 3GMPA 1YPZB 4PJGE 4MXVF 1BVLB 1X4XA 4NM8H 1CGTA 1OTUC 2FL5B 4OGYH 4XPTH 3GSXA 4MA8H 2N7BA 2FH6A 4UDTA 1INQA 3DLQR 3MFFB 3WXWL 5DRZB 4X4MA 4Y5YC 2G5BB 4BM7A 2OTUB 4PJ5B 2P5ED 3LEVL 5CGTA 5BRZD 4CN1A 4G7VH 3G08B 3MLUL 4LCYA 3ELAT 2M1KA 4WTXA 3DXAD 8FABB 1V7MH 4HK3J 3O4OB 1T1ZA 2DQTH 2CLRB 1OHQA 4JDVA 4ODTH 2VLRB 2I9TB 5C70A 5C7XL 5I8OL 2X4OB 3SDYL 1MFDL 3KS0J 2V6HA 2EDFA 1NBZA 3NIFE 1HYSD 3QAZC 3N1MC 2Y1VA 3S36H 3PHSA 2BNQA 4ZS7H 5KS9F 2PYEA 1HHHB 1KIRA 2I25N 5INDA 1ZAGA 1S7TA 3MRPA 2HJLA 5EU6D 1FBIH 1AXSB 4JO1L 5D6CA 5LGHH 1MIEH 1GIGL 4QTHA 2R1XB 3Q1SH 2B8OT 3HNTH 4CW1A 5HYQA 1ED3B 1JPSH 4M6AA 4G8GA 1S5IH 2HP4A 1K8IB 3FRPG 4IIQB 4QF1A 4OCSL 4HIXL 4PJHE 5SWSB 4MJ5B 3VXTB 5J06A 2HWZH 5FGBA 3ARFB 1OAYH 3VXOA 2ZUWA 5JOFB 3MV7D 1H3UA 1DE4A 3VWKA 1URLA 3FMGH 2GJJA 2XKSA 3JWDC 1G9MH 4QOKB 1EZVY 1T2XA 2HRPH 1LD9B 4BUGA 4JLRA 3UTSE 3WFDH 3B2UC 5M95B 1LO4H 1ODAA 4Q74A 1A22B 4PJFE 4Q0XL 1R3KB 3HKFA 2H2PD 2JCCB 1MWAL 3HC3L 4IRJC 43CAB 2IADA 5KSUB 3BP5A 1JGEB 4CN6A 2GT9A 4X8JB 3A6BL 4GW1A 3I75B 1KCUH 1R3IL 2HG5B 4W6WB 5E6ZA 5GS1A 1VKXA 3G5ZA 3IDUA 4Z7UA 1MLBA 2EDHA 1UM6L 4TTGA 3DVIA 3FFCD 3RTQC 5DQDH 3GJFB 1FE8L 3I3DA 1DEDA 5F3BA 1U8NB 2J8HA 1JWMB 1MAJA 5B38G 3NAAL 1RZ7H 4JZJC 4OI8A 2F9BT 3TO4C 4XGZA 1X5LA 3PQYA 5HHXL 4RZCB 3NPSC 4YGVB 3VXNB 1RJZB 4P23B 1YJDC 2GSIB 4NZTL 1D9KC 5HY9A 1IC7H 5HGBA 3QO1B 3SDCB 1AKJB 4XC3L 3O2WL 1UYWL 3VH8A 3E6FA 2R23A 1H8NA 2HT4D 2A77H 3R0NA 4OB5H 4C83B 2BHYA 1NGQH 2V2WA 2MHAB 3O3DB 1E4KA 3DMMC 2BVOB 5IW6A 1UXWB 4GLRH 1QPXA 5BS0D 2BVQB 3W0WE 2FLRT 5E08H 2W92A 3RRQA 1ZHKB 4M6MH 5F9OH 4N9GB 2PO6D 3ARPA 3OGCA 1JBJA 4Y5VB 3WIHL 4ODBD 4F58H 4HWUA 3D2UD 5I18L 2W9DH 3C2AH 4DQOH 3T4YA 2CJUL 1QNZL 3OQ3B 1QEWB 2P49B 4ZXBC 4MAYB 2MQCA 2IFGA 2YSSA 4OFYD 4X5WB 4XP6L 1OGAD 3KYMA 3SGDH 2RCSL 1D5BA 2G60H 1NLDH 2DBJA 1WBYA 4F15C 2PW1B 3UZEA 1C8PA 3X13B 2VISA 3U2SA 4EIZC 6CGTA 4NC2B 1AXTH 2P5EA 5BRZA 2XWBB 1AHWB 2QSCL 2Y25A 1CG9A 2HFEB 1NJ9B 3QRGH 1OF2B 3DXAA 5GRUL 4U6HA 3TV3L 4R97C 1BBJA 4OLUH 4XP1H 2W91A 1UJ3B 1CFVH 2MCPH 1INEL 3ECBA 3T2NL 1GGIH 3O4LD 3TVMB 3TH4T 1RFDL 2YZ1A 3ARED 3EJJX 1LHZA 3P9LB 5HHMD 3E2HC 3HFML 3MRRA 4JPIA 1FC2D 2ICCA 3D0VA 3F7YA 4PG9A 2E7CA 3MLTB 4KKBC 4H1LA 4JO2H 4OLVL 4H1LH 5CHNB 4WNQA 3STZA 1NCAH 2BMKA 4HF5L 5EU6A 2YZ8A 1BD2E 5CJ8A 3DI2B 1U92B 3KXFD 1IQWL 4HV8A 5IVXF 2J4WL 1CVRA 1RIVL 4UT7H 5FUCE 1KCSH 2UY6A 1QLFB 3G6JA 2BY0A 2QKIB 4PJAF 2NY0D 5CFHA 4KK9D 3NZ8A 4UMGA 4EDXB 4MDIB 1TVDA 2R2HB 2NNAB 4S1RL 5F9AC 1WF5A 4TNWK 1RK0A 1NGWA 3MV7A 2VDPL 4OM0H 2ICES 4RWYH 3IU3A 4H88L 3LN9A 4U3XA 4KTEL 5I16B 2VXVL 2N1KA 2CLZB 2V5MA 1YDPA 3EYOB 1FRGL 5IOPA 4LPWA 1P4IL 4YHML 1OCWL 3CXDH 4GMTL 4OCXH 1G1CA 1KPRA 3HR5B 1G0DA 4APQD 3MFGB 2LABA 5HHOD 2XPGA 3CMGA 1PDKA 5CZXD 4ISVB 1CLZH 4Z7UF 4WTZG 1GGUA 1Q9LA 4XHQA 1PQZA 5E2TL 3FFCA 4N8VA 3IGAB 1UA6L 4S1QL 1J5OH 5JW4R 4RDQG 4NWTL 4GUPB 2CXGA 2OL3A 4R2GC 3FQUB 1NGXA 3IJYB 2OL3H 1WT5C 5E8NB 2ZKHL 4G5ZH 4NN7C 5C0RH 3HPLB 5C0DA 3QUXB 3OB8A 5E95B 3MCLH 2DM2A 5J12C 3GI9L 3VD7A 3GMQB 3RUGE 3MRJB 2OX5A 2R69H 4DN4L 4JY6A 1IEBA 3C9NA 3HAEH 4JR9H 3BZDA 1C5DB 3OXSA 3FT4B 4GG6A 2VZVA 4LPXA 4JY4B 5DD1H 1FZJA 5L8KB 3FO1B 4O00A 4WHTB 5BS0A 2Z92B 2V7HA 1KEGH 5I71B 1MJUL 3O11B 3OJ2C 5DHYA 5I1HH 3KJ6H 2PO6A 4N0FA 3D2UA 1FNHA 3ARYA 4PREA 1UFUA 3WDHA 3RKDC 3M8OL 1CU4H 3ZDZE 4UV7L 5LG1A 4S1DD 2HT3D 4PJGB 3FJTA 5FFLA 4HS3A 4Y1AE 1F42A 1F8TH 1FIGL 2NXYB 3OG4B 5DRXB 3SCMB 1JMXA 4XXDB 4ZTOH 3UAJC 3ZKND 3T3ME 1UXSA 2HVKB 1XF5B 4OFYA 4K94H 4X5XA 1FVEA 1HOCA 2NY1C 2JB6B 1OGAA 5FUZL 1OB1B 1NAMA 1ZTXH 2AJZB 1NAMH 4HXAH 2DL2A 4PB9H 5CUSL 5F7EL 5F7HA 1IARB 2NX5D 4OCWL 1DBKL 5JO5A 4ZO9A 1OP3H 4AT6B 4GLRI 5D6DA 1J18A 4PY8I 2A6KB 2EXWD 4HC1H 1C1EH 4KI5F 1ZLVK 1T89A 1MHEA 1T4KB 4U1IA 3TYGL 5A2KH 1S7UB 3MRQB 4NQXA 3RWJB 1F58H 4GW4B 5C0CE 1T7VA 3IFOA 5D93C 5T3XL 3BKYH 1TJIL 1UB5B 4GAJH 2NY2B 1FNSL 3O4LA 4Z76A 1CN4A 3RWGA 2AK4E 3TNMB 2CRZA 3UTTD 3WFHB 3STLA 3AREA 5T3ZD 3NABL 2NY7L 5GGSA 5IK3A 1I85A 3SGDI 2Q6WA 4JQVC 1UENA 3B2VH 2IAND 5M7QA 1NEZB 5I1GL 3OSKA 3ZSSA 3L3OA 4EN3B 2YPLD 3KXFA 1KCRL 5BCAA 1L0YA 4JGMA 5IR1B 1RPQA 4GO6B 2C3VA 4UQ3A 3T0EE 2AJSH 3I85A 3PUCA 1HDMA 1MPAL 1S78C 4Y7MA 3QIUB 1YC7A 2UWEA 4LLYA 4OZ4B 5GJTH 2DS4A 1LEIA 4ETQB 3QDGE 1I1CA 4JM2B 4PJHB 1NLBL 3PABA 3RPIA 2IJ0C 1FGNL 4RMQA 3PWLB 5T5FL 2B1HH 3ZE1E 3QFDA 1RZJC 2DL9A 1U8PB 4WI3A 4QHKI 3LMJL 5J6GB 3DHJA 1VA9A 1T1YA 1MNUH 4JGUA 3UTSB 3BKML 4RISL 5L7XH 4PJFB 2B4CL 4WHCA 3HE7D 1CR9H 3V0VB 4OZHA 1HSBB 4JKPL 4ZOCA 4YHPB 3QHTC 3MRGB 1OP5H 3DX6A 4EOWH 1W0WB 2BSED 3RU8L 2IWGA 3KDMA 4NRXB 4BZ2H 3SBWC 1CCZA 2FZ3B 1XGPA 2VL5A 4I5BA 4C56E 4JDTH 1K8DB 4OT1L 4GJTB 3G04B 3O8XC 3LRSB 3H9SD 4APQA 3MLWL 1WTLA 1L7IL 5HHOA 5JW4N 4NN6C 1BOYA 2OMNA 2Y6SC 5GJSL 3GMLB 1BM3L 3LKPA 3RA7L 4RGNC 2CMRL 3KLSA 2C3WA 3BP4B 2A9NL 3RWHB 1N6UA 3P9MB 4YO0A 5FCUH 5TQ2L 2EDDA 1A4JB 1N6VA 2HTLC 3CVHB 1T6WA 1BX2B 1ZLSH 2WBWB 5HYJE 5JHDD 2RGSA 4WFFE 1YEFL 3K74B 5KSVB 3MYJA 3V6ZB 3M45A 5C0ND 4KKNA 1NCUA 2FJGB 3RX8A 2HJKA 4XWGL 3ZYJA 2WBJC 1DR9A 3FQNB 3FB5A 5DJDA 5E9DD 4P2YA 5EU5A 1QR4A 4DZBB 4HS8L 4M8QB 1EBPA 1K2DB 2YHGA 1GHFH 1FCCA 3W0WB 5BMFH 1RUKL 4H20L 4Y16B 3VFOA 4YXHL 5BO1H 4E42A 1ONQA 2Q1EA 2VMFA 4HEME 3WNOA 4TVPD 1N4XH 4LVOB 2LU7A 4FXKA 3UBXB 1RZFL 3EFDH 2NY3B 3AGVA 5J8OA 1TZIA 4NQCB 2Y4SA 4YXKL 4LPTA 5LAXA 4LLVA 5SV3A 2HTKD 1U91B 4MNQD 2ZUTA 5JPMA 2OQJB 2WWMC 2Q8BL 1XGUA 1XR9B 5EDXA 2E8ZA 4L8SB 4TVSa 5I1CL 3MREB 1MCLA 2NX5A 2EEBA 4P46C 4IS6A 1A6TA 4OZGA 2F53E 4KI1A 5IF0B 2AJVL 5FDWA 5DHVB 1T0NB 3C60B 3MLRH 3GGWB 3OKNB 4XZUA 1JGLL 4ZS6C 3CZJA 3MO1A 4GKNB 2WUBH 5HGHB 2W9EH 5F71A 1T1WB 3RL2B 5J6HB 3FCTB 1U3JA 4UTBL 2VXTH 2BVTA 1XR8B 4YC2C 3LN4A 5AWNL 1U3HD 2VNCA 3UTTA 1EXUA 1JGDA 4PGCA 5T3ZH 2GJZB 4PP1D 5HJ3B 5K9JH 4M43H 5LCVH 1N2RB 4GBXB 2IANA 1TZGL 4PJ8C 2MQ3A 3U7WL 1BD2B 2AKRB 2GCYB 2VQ1B 5EOCL 3BISA 2YPLA 3DX9A 2IH1A 4GQPH 4LHJB 1KIPB 3LKQB 1H3WM 1DBMH 4XNMB 2RFXA 5ESQA