1R3LA

Potassium channel kcsa-fab complex in cs+
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Antibody Fab fragment light chain
publication title The occupancy of ions in the K+ selectivity filter: Charge balance and coupling of ion binding to a protein conformational change underlie high conduction rates
pubmed doi rcsb
source organism Streptomyces lividans
total genus 50
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2003-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3lA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r3lA01
2WBKA 4QEGA 1U8KA 3SKOA 4Z18A 2V7NA 3TO4A 4LVNB 1CLYL 1H3TA 5DSCB 5FCUH 1NJ9A 1ADQA 3MV9B 2C5DC 3UPRA 4KDTC 3BDYH 2HJLB 3MRFA 1UM5H 1LE9B 1RZGB 1V3JA 3GSRB 3HB3C 1YN6A 4FQXB 3HE6B 3DOSA 1HINH 5C0CA 3LHPL 3OQ3B 2Z8VC 2Y6SC 1JYXA 2JB5H 1X5JA 2Q3ZA 1KCUL 4WUKL 5JXAH 3PGDB 5I8OL 4QXGL 2CK2A 1E6OH 4L8DA 3TBTA 2GTWB 4J4PC 3RKPA 5HHOB 1KIUA 4JQIL 4Y4KA 2J8HA 4MAUL 4Z7VA 1IGML 1Q72H 1T5WA 5L2JA 3LS5H 3QEQA 4QNPE 2ESVE 3S8WA 3K8KA 3GJEB 5B38B 3WFCH 1N59B 3BEVA 2H2SD 4K94L 1IGTB 2C7UA 5EBGA 2VDRH 1UH2A 1OOAA 3A6CL 4FFVC 4YAQB 4GUPA 3NVQA 2BOBA 4JFYA 4O2FA 2V2XB 1W72B 5IMKB 5MEQA 3MOBH 2DYPA 2IADA 5TQ0L 2FX8H 1SJVA 3VWKB 3P0GB 1CXLA 5BS0D 2BNQE 1XR8A 4M93B 3TVMB 4LVHB 4AJ0A 4ZXBB 5E08H 1QPXA 1P9MC 3ECBA 5CZXD 2W59A 3BGAA 1U93A 4ZPVA 4LCCC 1MF2L 2OSLA 5KAQF 3QI9D 2BHZA 5T3XH 4PJDB 4UQ2B 5FHAH 5K9QG 4XP6L 2CMRH 4JAMA 4JEGB 2PO6A 3FQWA 3BWAA 3C2AH 3UZEA 1C7TA 5F6IC 5EBLB 3DV4B 1DANT 3PP3H 3CZFB 4XVUC 1J9CT 3FB6A 1ZT1A 5GS1B 4H1LH 3SKNB 3T1WA 3U4EB 5K9QI 4ZUTA 1KJ2B 5A2KH 5JIPA 3TC9A 4PP1D 1W0VB 3A0OA 3HUJB 4H8WH 4BSJA 5ISZD 1EXUB 4UDTB 1I8MB 3VH8G 3HPLA 1BP3B 4LVNC 4OZFH 3ARBA 1D6EA 1F3RB 4GSDH 3FTGB 1OAUL 5IVNA 2X4UA 4X8XA 3RY4A 3HRPA 2YD8A 3I3EA 1ZXQA 1BJ8A 5SX4I 5JA9A 2XPGA 2XACC 2Y7QA 1UWXH 1PYWB 5JW4M 5D7IB 3QA3B 1VCAA 1PVHA 3FONB 3G9AB 1K4CA 2BY1A 1J18A 3VWJA 1QBLL 4Q6IA 3D39E 4O02H 3QJFA 1TJHL 3NPZB 4M4RA 3H42L 4I13B 4XP1H 2X6MA 3KPMB 3UX9B 4F9LA 1U58A 1JYWA 4JANB 4OLUH 4MDIA 4PRDA 3RRQA 3QUZA 3IKKA 4LCWB 4OIAA 3GHBL 4P5TA 5F7NC 1AIFB 5E8OA 3TO2B 4BQ9A 5FO8A 4Q9RL 3VA2C 5AD0A 3K4ZA 2ILLA 2XG5A 2MHAB 2YA0A 2A83A 5DUPH 1NGZA 1MCPL 3IDGB 1NCWH 1RUQL 2ED9A 2YPVH 3QQ9C 5CSGA 3BX7C 4R6UA 1A5FL 3DUSB 4HSQA 1T7VA 4EXKA 5E4IA 1JRHI 4ZUUA 1G7QA 4KKLD 4E5XA 2V2TB 4MD4A 3FO2B 1DDHA 3MRNB 4GH7B 4ODTH 1NFDB 5D2NB 4S1RH 3HCVB 5CINH 4EI6A 4PJ7E 1QRND 3RVXD 3MOAL 5KVFH 4IS6B 2JCCE 4NN7C 3QQ3A 3CLFH 5TH2A 1DQLL 2BDNL 3EYVB 2Z8SA 1FZKB 2DRUA 4U1JA 4JQXC 3LN5B 2GJ6B 3QDGD 4UNUA 2P24B 4OV5A 3X11B 4W4OC 4AK1A 2FWOA 1J0YA 1IT9L 2OTUA 1I85A 4NDMA 5I1EH 4GLRH 4TQEL 2X1QA 1YEGL 3TBYA 5MEPB 4DUXA 1C16A 4IRSD 2VXUH 3WJLC 1FO0L 1T3FA 2VWEC 1CLCA 5JR1H 2ZG1A 5IK3B 3FT4A 4OCMC 4G6AD 3PDGA 4F7PB 1A3QA 5HYQA 1G0XA 1CXIA 1EGJA 3Q2CA 4H5SB 1ZLWK 2EO1A 2M8XA 4K07A 5BOPA 4EEEA 3GNML 3PWPD 5DFTA 5EUOF 4CU7A 2BMKA 3KGRA 2Q8BL 3PUCA 1NMAH 4LLYB 2YZ1A 5C70A 2EKSB 2XZQL 5H94A 2BVYA 1WFTA 2EIEA 1QQDA 2XICA 3V4VH 5GZOD 1FC2D 5DJCA 4TSCH 5DA4A 4UV7L 5E8PA 1OLZA 3GBMH 4JZNB 1A2YA 2H32B 4OCXH 4FTVE 4G6FD 3S4SB 1HQRA 4Y2OA 1NANI 4WW1B 5H37G 4OUUA 2IEPA 1KGCE 3AU1A 4QOKE 1NGYA 2B4CC 3ZTJG 4BELD 5C07D 3UAJC 1QG3A 4UT7L 4R4BA 3PWLB 3T04D 4LSPL 4X4YA 5IB3B 4Y5VB 2FGZA 1M05A 4WY7L 3EOAA 1ZSDA 2MJWA 3QH3A 2XXCB 1B0GA 4HWEL 2HFEB 1KIRA 5ENWA 1BAFL 3OB0K 3P11L 2XY1A 1P4BH 4MA8L 4U05A 1A8JH 1C5DB 4HHAA 2BRQA 2Y36L 3ZHLA 4LP4A 5D1XD 4ODWA 1CZ8H 4IOIB 5LGKA 3DRQA 3BVNB 4F7EA 1QLEL 2LTQB 3CVHB 3MRDB 3RY6C 1Y0LB 1CICD 4EZMA 3HNSL 4G8GE 1KJ2H 4FQIH 2V6HA 5ID1B 1F3DJ 1WFOA 4GT7A 3DX6A 5EIVA 2NTFB 4JFED 1RU9L 3LPFA 1UZ8B 4XRCA 3QUKB 4HKBA 4TVPD 3M1BB 3S7GA 5IJKC 3GSOA 5GGRB 1HI6B 3IJHA 2QSCL 1QHPA 2AEWA 3FN3A 2R29L 4YC2B 2CRYA 4U1LA 3MROB 4XP5L 3L3JB 3QO0A 2EC9T 4CVXA 1YNKL 2BNQB 4EQ3A 5H35B 1KYOK 4FQLL 1ZLUH 4KDTA 4AIXA 4U3CA 3HAEG 4M1CD 2FBJH 3X14B 1OM3L 1H3GA 4YHNB 1N6QL 2VC2L 4O2CA 3T4YA 4MQXC 2E7MA 2B20A 5KS9A 4J3UA 1HNGA 3TLRA 1MCOL 4R96B 2B4CH 3N9GH 5EZLB 1A9BA 4OFKA 2V17H 4JKPH 4W68A 3SKMA 3T3ME 4CGTA 4KPHH 2F15A 4OIIH 5SWZE 1V3MA 1WUNT 3REWA 5HY9A 3ZDZF 4J4PA 4LASL 1H3PL 2EH7L 1CD1A 3C6LA 1FNEB 1G7MA 1T21A 2NXYB 4M43L 5ESQA 4BSWA 5C7XL 1IGIL 2N7AA 2XOTA 1A22B 1DUYB 1DN0A 4XAWL 5GIRA 1HXMA 4K8RC 5HGAB 3TZVD 3KXFB 2V5MA 4XCFL 2VE6A 4JY5L 3RA7L 3MODH 5J8OA 3RFZC 1BGXL 1OSPL 4N1CA 1I9JH 2R0LH 4YPJA 3S35L 4Z5RA 1XF4B 5JMRA 1BIHA 3E8UH 3MV8A 2P8PB 3HR6A 2EYSA 3WIFB 2C4XA 2R56H 5F7DB 2PW2A 1JUFB 1YNLH 2W9EH 2ZOLB 1NL0L 2F54A 5DZOA 3BP4B 2AJVL 3FB5A 2BJML 1S9WB 4TNVK 3ELAT 4QHNA 5IV2A 5EOTA 2Q7YB 1AGBA 3X3GH 1P9MA 1EO7A 4HUNB 4J6RH 4NQSB 3SGEH 3CNKA 4WHYH 3AXLA 5HI3C 1W8OA 4XXCC 4IMLB 4H0IA 4LCCA 3TFKC 1CE1H 5EPMA 4CNIA 5FCUL 6FABH 1T6VN 3MV7D 3BDYL 3AS2A 3Q5YA 1UM5L 5HHQB 4Z77A 2LVCA 2FGWH 3GHEH 2CDGA 1F4YH 2QR0B 1LK3H 1HINL 4MSWA 2Q6WB 5HPMA 2P48B 4XGZA 4ETQB 3HNVH 5BV7C 2FO4B 2JB5L 5DEGA 3GMMB 3MLSH 4RZCA 4KWUA 3QNXB 5E8NB 3SPVA 5FYLD 2MNUA 3R1GH 3T8XB 1E6OL 5HYJB 1IZKA 5CHNA 1VEPA 3BW9B 1RJZB 1Q72L 1QD0A 2F9BT 3LS5L 3CD4A 1PSKH 2QKIB 4ENED 4XVSH 5FYKU 4PTUA 2B1HH 4ZYKB 3BT2H 5C0FB 4FFWD 1JJUA 3WFCL 4OQ1A 2VDRL 3DX7A 1QYGL 5FCSH 3KR3H 3KYMA 3LRHA 3RGVD 3UCRA 2LU4A 1UWEH 3QNZA 3D18B 2APBA 5L88H 2EH8H 1YPZF 4RQQA 1OVZA 2H2SC 4HUXA 2JCCB 4J2XA 2WIIA 1EHAA 3OKMA 4BFGA 1VHPA 5IEKB 4UDUA 5C1MB 3SJVE 4X7SH 3VXRD 2ZZUT 5BRZD 3HMXA 5E08L 3O8XD 2PXYB 5AG8A 3MGOA 5T3XL 5FHAL 1QRKA 3EFFB 2YUZA 4WV1B 3ZKQD 2CMRL 1D6VL 1BVLA 3OMZA 2PTTB 1EEUA 3BHBB 5CZXC 3C2AL 2ZUVA 4PR5B 4PV8B 5I16B 3WYRA 2G2RB 3QI9C 1IKNC 2VKWA 4LL9A 3T0ED 4KZEL 2PYED 2APFA 4I3SL 3LPGA 4Q9CA 5GRXG 3CVHH 5CJBA 4ETYA 5HGBA 2FHBA 3QXDA 1A02N 4URTB 3QIWD 1TETH 1K4DB 5DD1H 3VFTA 1PG7X 1JMZA 4H8WL 1CGXA 5FKPB 4N8PA 3QDMD 3RWJB 3U30B 3MUZ1 5CLTA 3LRGA 1OP3K 2DD8H 1IEHA 2BSTB 5BV7H 3IFPA 3DI3B 2DIBA 3LQAC 3FQTA 4HIHB 3O9WD 3N0PB 4GSDL 2CDFB 1FE8H 3UYRH 4RMSA 1MCEA 4NCC1 4HBQA 4W4OA 2JJUA 3ROOA 4LGRB 5LGHH 2HT4C 3K4AA 5IKCA 5EBWB 4YX2H 4NPYB 4KVCH 4GXUM 5CMAA 2R1WA 3EOTH 3NN8A 3MYJA 1JBJA 2OS7A 1IAII 4O02L 3DXAE 4RIRB 2BVQB 4S10A 4ZUWA 5C08E 4YO0A 4I0CC 5D5MF 4OLUL 1QFUH 4H25B 1HWHB 4XWGL 5IVXB 3W11C 3BE1H 3GIVA 3HZVB 1JGEB 3FT3A 1GOHA 1U8HA 5DUPL 2GJZA 3X17A 3HC0A 3VFNB 3VMNA 4P5KB 1NCWL 2YPVL 4QRPD 4G8GB 4F2MB 2X89D 5C9JA 1U6AH 4P2RE 4ODTL 3MLPA 4TUKH 3MV01 4S1RL 5CINL 4JHBA 4X0KB 3QHTC 4NNPH 4HMDA 4NO2A 3I75B 5AUMA 5KVFL 3CCHA 3RNKB 3QIUC 3UTSA 2E7BA 1MCNA 1N0XH 3CLFL 3OB8A 2A74A 3T2OA 4XPHH 3EJZD 3RX5A 4UTBH 4ZD3H 4EVNB 3RVXC 5GXBB 2NNAB 4WFGE 3A6OA 5I1EL 1OGAE 3P3YA 3LQAH 4JN2B 2VXUL 4QCIB 1EJOH 3VXSA 3B9KB 2GTZA 1MAMH 2I9LB 2NY7H 5JR1L 3D0VB 1CQYA 4U6TA 1I1AB 1T66C 3C09B 1B9ZA 4ISVA 3JWOC 1OHQA 3NCYP 2VR5A 3QQ4A 4FQHA 4HF5H 3RY6A 2ZOKA 1I3UA 1AO7A 5SWZB 4G6AC 5IBTH 1AD0B 5FDWB 1NMAL 2YUXA 5EUOE 2A0LC 3R8QA 5C0AA 4NN5B 5DK2B 1S7XB 2X09A 3UBXG 4D9QE 4DJMA 3V4VL 5J1SC 2NY1B 5IJKA 1I1YA 3VFMA 4TSCL 3CFEB 2VQ1A 2M1KA 3GBML 2UWEB 2SEBB 4OCXL 4JFFD 2GKIA 4QRUA 3CSPA 2YPLE 4R0LA 5F93C 4FQJH 5C09D 3VXPA 5JDSA 4IRZH 1KXVC 4UNTA 3V95A 1A6VH 1QHOA 3U0TB 1S7QA 3JUYA 3B3IB 3LKPA 1SVCP 4WW2B 4EI5D 1FNGA 2PETA 4K3DH 2VDNH 3WDJA 4NN6C 1VB9A 4Z78A 4Z6AT 1FFPB 2ICWA 4RX4A 3NCJH 4Q0XH 3WKMH 4DOHE 3WO4B 5EC1B 3DRTA 2X4SA 3MJGX 1P4BL 1Z3GL 4U4BA 5TDOA 2W0FA 2BOCA 2E5EA 4L4VE 5FB8B 3NFNA 3QEUA 4KUZH 4RBPH 3PABA 3JTSB 4PJGB 2DI8A 3DETD 3GO1H 4Y4HB 1QFOA 5D1XC 3BAEH 1JP5A 4Q2ZB 1KJ2L 4FQIL 2YN3A 4N8VG 2C1OA 5DQ9A 1CICC 4P2QB 2HVJB 1AD9B 1UENA 3C60B 5T5NF 3PJSB 4NQDD 4PRAA 2JIXB 3EO0A 1DL7H 4HJ0D 4C4KT 1TTFA 3BDBA 3VGAB 1FFRA 5C0GB 1NGPH 2G9HA 4JM4H 3BQUB 4NJAH 4XXCA 5GSVA 4G8IA 4M3JA 4RMQA 3IXTA 4KKAC 2Q76B 3MGTB 4ZSOA 3LN9A 5I1CH 3HI6L 2G5BA 1CLZL 2FBJL 43C9B 2A9MH 4WUUE 5E00B 5C0RH 5JDJA 4HWBH 2OR8A 4HUMB 5HHOD 2B4CL 3N9GL 3TWCH 2W0KA 2V17L 4JKPL 2QV2A 1KG0A 3U0PA 3UP1A 3IDJA 2NY1C 4KPHL 3SDXF 1FNAA 4OIIL 4PJAA 3K3QA 3HHRB 32C2A 5L7XH 1FFQA 2ITCB 3QIBD 1QSZA 3ZDZE 1RJYB 4L8SC 2FZ3B 2VYRE 4MAYB 3BPCA 4E0RB 1KPUA 2VR4A 2EECA 1NDMA 1VFUA 2VLKB 2BSSB 1GOGA 4H88H 3MODL 1RHHB 3VWKD 2GSIB 3RDTB 4PJ5D 1WIUA 1I9JL 2HG5B 2R0LL 3DO3A 4OJFH 1B0RB 3MBXL 4LSDA 5HYSA 2BXZA 3E8UL 2F8VA 1VGEH 3RWEB 2R56L 4ZXBD 4UMGA 1YNLL 2W9EL 3MNWA 3U7AA 3GMLA 1REIA 4P57A 3QCTH 3TH2T 3V0WH 3M8OH 5FUZH 3EYOA 2EZ0D 4NQCE 1BX2B 3X3GL 4J6RL 1S8DA 3ZYJA 1KB5A 4GW4B 1J8HD 1S9YB 5BS0A 2FCBA 5D72L 1CE1L 4XWOC 4PY7A 3PIQB 2X40A 3QG6B 5EORH 6FABL 1KNOB 1EAPA 3HE7C 5HDQH 3B5GA 2W9LA 4RA0C 3VRLF 3QI9A 3GHEL 4U6VH 1IKNA 5C08B 1F4YL 3OAUH 2CSPA 1LK3L 4U7MA 4UAOB 5T1LB 1HH6B 1C08A 3HNVL 5KSBF 4NQEA 2R2CA 1KSRA 3ZE2F 3R1GL 4Z76B 4LCIH 1K8IB 2P4AB 1JGLH 1K6QH 2HT3C 1RK1B 3VGAC 4P46C 4OZHA 1PSKL 4U31A 1EVTC 4XVSL 4A6YA 2B1HL 2CO6B 1X5ZA 1MJ7H 2DM2A 2NQCA 1DBBH 3ILQD 3KR3L 4R4FH 5ISZA 1G9NH 1UWEL 3FB7B 4K7FA 3OG6B 4DKFH 5L88L 3RBGA 2EH8L 3RL2A 3ILPB 4KRNA 2VIRB 2G75B 2OMNA 4JRYD 1YPZE 3RQ3A 2WINA 1KOAA 1QOKA 1TVBA 2BFVH 3EOBA 3TBVB 3KPRE 4PJEA 4MA7L 3GGWA 4X7SL 4M6OH 1JI2A 5F1IB 4OI8A 4Y7MA 1ORQA 3QEGH 4J23A 1AR1D 2Z31D 2NZ9D 4S1DD 1C12B 3IU3A 4XXDA 4EN3D 3MNZB 1KXQE 3C9NA 3NACH 4MGXA 4MJIB 5AEAA 4PGEB 3D69A 1YQVH 1KJVB 1IQWL 1CFSB 4NHUA 3O8XC 4U2ZA 2UZYB 2CXKA 4HULB 3GI8H 1JPTH 4GS7C 2RBLA 2IF7A 5L8JB 3LAFA 3EYQD 5DFWH 2FDBP 4NNXA 2AK4A 2QADB 1ACYH 4PGCB 2P5WE 5F89B 3OB0H 1T1YB 3CVHL 3FQNB 3U36A 1PKQB 1WEJH 3QZWG 4PRHA 3T0EC 3MMEA 3NGBC 2NTSP 1TETL 5DD1L 1BHGA 2IFFH 4RWHA 1HEZB 2P42B 4JHAH 5IR1A 4JCMA 1MJJB 1NGXA 4P2YA 4QHMB 2DD8L 5BV7L 3DO7A 3QIWC 4XTRC 4QXWA 1G7LA 2UZXB 3QIUA 2ARWA 4BH8A 2VDKH 3F7YA 3VXME 1TDQA 1HYSD 5HHXH 2ED7A 3WFEH 1FE8L 3UYRL 4NKDB 4ZFFB 3QNYA 2DB8A 1S9VB 3CFKB 2EC8A 4EBQH 5LGHL 5C6PB 1JGVH 5BJTA 4YX2L 4YPGA 1XCTB 4K7PH 2ERJB 5KVDH 3G04B 4O9HH 3EOTL 1RZIB 4S11A 3AB0B 3EDJA 2P5EE 3ABZA 4M1GH 3ROLB 4IRSA 4DOHB 1R3JA 4DZ8A 4GW1A 3O6MH 2BK8A 3RWIA 2BNRE 3MRGB 3UTZB 1QFUL 2R2HB 5M95B 5K33A 5D5ME 5DK0A 3L3KB 1A6ZB 1QVOA 3BE1L 1BLNA 4NSKA 4OF0A 1KPRB 1FH5H 2IH3A 3MSPA 3R0NA 4R90H 3RZCB 3L7EB 3BXNA 4NFCA 3SDAB 3KDMB 1R24B 2FATH 3PWPA 3WHXA 3DSNA 5HHNA 1YUHA 4POYA 4JDZA 1Q94B 3NFPB 3D3VE 1DFBH 1U6AL 4Q6YA 1MVUA 3AS1A 3CUPA 4TUKL 4OZIF 1LO0H 1F4XH 4NNPL 3C5SA 3U7WH 2DQJH 3WCYA 3TYGH 3G08A 3AREB 3CXHK 3FKUS 1MPAL 5E2TH 1N0XL 3LRSB 4G80A 3RZWA 3DVFA 4G7YH 4XPHL 2CIKA 4UTBL 4ZD3L 4BUGA 2GFBB 3IKCB 4V1DB 3MRPA 4L3EE 2HFFB 1KB9J 2Z93B 4G3YL 4YIQB 5D7JB 5C07A 3V8OA 5I1KH 5I76B 1DBJH 1U8JB 3LQAL 4GFTB 1UKTA 1EJOL 5DRXA 2EE9A 4WUUB 1MAML 2NY7L 3GUTB 3GDBA 4HIJB 1NDGB 5IEHA 2UUDH 1ZT7B 2RIKA 3RVUC 1HNFA 3ALWA 1P5VA 1OTSD 5MENB 4HF5L 1MWAB 2YBRA 3VFVB 4I5BB 5D7LE 3IXAA 1ODAA 4BH7A 1IL1A 2VZTA 1CFTB 1JWUA 5D1XA 5I73B 1A6TB 4E42B 4XVJH 4ODXB 5I75B 1UM4H 5JQ6L 4F33B 4S1QL 4PY8J 4XNMA 3BDXA 4MS8C 4OSUH 4PPTA 3S3JA 3D25A 4UZGA 1CICA 4JPIB 1RD6A 4XCEA 1CGSH 1LEGB 3HRZA 3PV6B 1X5GA 3GMQA 2F53B 2BNQD 3FRUA 4Q9BA 2CJUH 4MNGA 2P8LB 4P9HC 4D9RE 5EIIA 2ERJC 2XWJB 1YY8B 2D4FA 4JFEA 5IW1B 3IVKA 4UIKH 2NW2A 5DLMH 3E6FA 4FQJL 5DC9B 4L4TB 1QSEE 4KJWC 1R5WB 4IRZL 3B83A 2FR4A 2YPKA 4IIQB 1WZ1H 4XI5D 5D2LB 5FK9B 4NC1C 1A6VL 1F3JB 1OP5H 4NQCB 1DR9A 3KYOA 4E41B 3O4LE 2QHLA 4RDQG 1ERNA 2DQEH 2VDNL 3DVGA 4K3DL 3QPXL 1T1XA 1SQ2N 1EZVY 4PP2A 5AG9A 5JNYA 5B39G 3V0VB 1LO5B 5I0DA 5J0BA 1GGCH 4Q0XL 3H3KA 5F88A 3WKML 4MD5B 2Q20A 2NXYD 5I1IH 5I71C 2VAAA 3T4AB 1Y18A 3DVIA 5IM7B 2D7PA 1WBYB 3KXFD 3EGSB 4ZTOH 1KTDB 4K7PY 2EDOA 4KUZL 1ZHLA 4L8SA 4MB5A 1U3HD 3PHOA 3GO1L 5J3HC 3G6JA 3BAEL 4XPBL 1ZHNB 1I8IA 1SMAA 3O3BB 5DO2C 3TZVA 3CFBB 4PTTB 2YKLH 1BQHA 4PJFA 4LPWA 1MI5E 5D1ZB 3RIAF 4CU8A 1I7UA 4KK8D 4RFOH 1RK0A 1HXYA 1P84K 1N2RA 2X4PB 1P1ZA 1XCQA 3QT2A 5DHYA 4LOUC 3O2WH 1NGPL 4JM4L 5L2KE 5HGDB 2OJEB 2ZG3A 3H9YA 1OP3H 3IDMB 4NJAL 2BY2A 3KPNB 4FNLH 4PB0L 1DEEB 4X5XB 1KLUA 3WBDA 4X4MA 1T20B 2VZOA 1CVRA 4F9PC 4HCRL 3TJHD 1CK0H 2VLMD 4U1GC 5I75C 2V2WB 5E94B 2A9ML 3BP5A 5C0RL 1OAYH 4U1NB 43CAB 4HWBL 3W81A 2CLVB 5HHPB 3RX8A 2I07A 4MHHG 3T0VA 3TWCL 1TZGH 1T22B 1UM6H 3VFSA 1FL3B 2H6PB 1WISA 3ZHDA 2VLJA 2X4TB 3VMPA 2Z92A 5DD5H 3SDXE 1J0HA 5E56A 4P46A 1IGYA 2ZKHH 4ZQKB 1M7DB 2IPKB 4RGOL 4IIQC 4H88L 1N5YH 3BUTA 4NM4L 4LNRA 1A1NA 3RUGA 4OJFL 1ZT4A 3O45A 3RTQD 2Z91B 1QEWA 4KH2A 1VGEL 4HWZB 4N0FA 3DECA 5J6HA 2R8SH 3CFJB 3QCTL 5I6XC 3V0WL 5FUZL 3EHBC 4Y4FB 1TVHA 4XCYB 5IG7B 2QQQA 1D9KB 1AE6H 3G5YA 4YBQD 1RURH 2X4OB 3VXRA 1GC1C 1INDL 2EZ0C 5BRZA 5EORL 3SE3A 1U92B 5HDQL 5FOBA 3O8XA 3S5LG 2YXFA 2P5EB 3GMRA 3LKOA 3GKWH 1CD0A 3PG2A 3F12B 5FO9A 3SGDI 3LOWA 3MUJA 4U6VL 5DD6B 3VRLE 3OAUL 3ZMRA 4X6DA 1TITA 4WU7A 2ICCA 5CSZA 3L5JA 5CWSB 5LGJB 2QEJA 1MWAH 1MH5B 1FV1B 3T0EA 5KSBE 3DX9A 4LCIL 1KCRH 2PYEA 5IQ7H 3LKSA 1JGLL 1K6QL 3ZE2E 3TNMB 5JW4R 4FTVD 1CDGA 1Q9LA 3BP6A 3GMNA 4X83A 3D3VB 3RWDA 3QIWA 1NC4B 4QOKD 1LILA 1MJ7L 1UKQA 1J1XH 4JJ5B 5ANMB 3LD8B 1DBBL 3QDMA 4NO5B 4QRRB 1G9NL 4DKFL 5T5NG 5JXEC 2WNGA 5C2BL 2NY3B 3IDYC 4M9PA 4M8QA 1BJ1J 4JG0H 5EWIH 3V6BR 3JV5A 3O9WA 1RQ5A 2AJZB 5E5MB 1IKFH 2BFVL 1XGPB 4PG2C 2WUCH 4K3JH 4M6OL 3GRWL 4LKXA 1AKJD 1ZHKA 1PGRB 1GZQB 5FGCE 3EJYC 2R23B 3QEGL 3M17A 4UQ3A 3HA0A 5BXFA 4YXHH 2P8MA 3T65A 4IM8A 3U6RA 1F6AB 2Y25A 3NACL 3N1QC 1JE6A 4XPGH 3VFPA 1YQVL 1XGYH 1PQZB 1AXIB 2Z31C 1E4WH 3GI8L 5HVGB 1JPTL 4G8GD 4PJ9C 3SO3B 4ELKB 1SJEB 4YK4C 4EN3C 3QEHB 4R97B 4APQD 2J2ZA 1ACYL 1LK2B 5CP7B 5MP6H 1GC1H 4MXQD 4UIMA 3BEWA 5EO9B 1F42A 4XNQB 4LCYB 5IHLB 4KGLA 1J8KA 4YWGL 1JN6B 2CXGA 2IFFL 1Q0XH 2V7HB 4JHAL 4QRPA 3U2SA 4PJIF 4Y4FC 1BZQK 4OT1H 3V5HA 4ZO8A 3ULUC 1I7TA 2X89A 1FFOA 4MJ2A 4HQQH 2VDKL 1WGOA 5I1HH 5ALBH 1FRGH 4I4WA 3LB6D 3ME0A 3TBSA 5HXMA 4PY8I 5HHXL 3WFEL 2A6KA 3GEWB 3PWJB 4YEEA 1YJDC 4Z95L 1X5LA 2Y5EA 2I26N 3PDOB 1NH6A 4EBQL 1I1AD 3IT8D 1LP9A 1JGVL 3W39B 1HYSC 4CUCA 2X1PA 4K7PL 4Y1AB 5KVDL 4O9HL 3KNBB 1FSKC 3BP7A 4KKCD 5SWZD 1CDYA 2YSSA 3MR9A 3WUWG 4AENA 4XNYH 1JNNH 4Y19E 4M1GL 3VD9A 2CLZA 3O6ML 1RFDH 2R0WL 3NTCL 2RB8A 1LEIA 2D9CA 2I9TB 5IF0B 4QTHA 3DARA 5EOQH 3P9WB 3HI5H 4MQTB 3HI1A 4AMKH 1FH5L 4R90L 2RAMA 4RMTA 1JF5A 1CFNB 2W60A 4GO6B 4GRMA 3BO8B 2EYRA 2EYTB 2IANE 3L5XH 2E8YA 3PGCA 4QKXB 4B5EA 1LDPH 1DFBL 2P7TA 1F8TH 4PGZA 1Z0MA 2DBLH 5DGRA 1LMKA 4XMLH 2VUYA 5INCA 5I2IB 3VRIA 1KT2B 3GB7B 5K9JH 3T2NH 2P47B 1LO0L 1F4XL 2DDQH 3U7WL 2DQJL 4OZIE 3QUXC 5KOMC 1NBZB 3TYGL 4OTXH 2MOVA 3VE0B 2L0DA 4F57H 4JFFA 5A16A 4BKLA 5C09A 4U6HA 3KLAB 5FUCE 5LAXB 2P1YA 1F4WH 2VQUA 3SO3C 5FHBH 3ULUH 4MQ7A 4U1MA 4PGDA 5I1KL 1U42A 3TNNB 1DBJL 1R6VA 2FX9H 5FA4A 3LH2H 5J89A 4WDIB 3QXAA 5MERB 4WGVB 5CILL 1YJDH 3QXWA 5CFHA 4H0GA 4HKZA 2V5TA 1QKZH 4M00A 3VFOA 2VZUA 5SX5K 4QGYA 1HHHA 3E6HA 2V9QA 3E1F1 3TCLA 1GZPA 4XVJL 4DCQB 1UM4L 4X98B 4BZ2H 1MFDH 4M5ZH 3QULA 3C60D 3GI9H 4NBYB 3CX5J 4MVBD 2XWBB 4OSUL 4HZLA 4OLEA 1LD9B 1UWGH 2JIXD 1PEWA 5EU5B 4MD0A 4BFBD 1CGSL 2IH1A 4BUHA 2H3NA 4RWYH 4WCYH 3W0WE 1JZ6A 3T0XA 2EDQA 1H0DB 2CJUL 3DMMC 5F3HB 3SJVD 1OPGH 3U1SH 4GLRI 2K9UA 4UIKL 4MJ6B 4OB5H 5DLML 4LSRH 1X4YA 1CDUA 2H26B 2MPAH 2OBGA 5CAYB 2NY4C 5EA0H 4NQDA 1MY7A 5DJZB 1WZ1L 4KRPD 2D7MA 2VL4A 3DHMA 1A9EA 2E27H 5DFVC 4YHZL 2WIMA 4XPFH 4F9PA 5JOFB 3QJHB 1P69B 5IHZB 1HH9A 1HIMH 1U41A 1YC7A 2VNCA 1LE9A 1RZGA 4XI5C 4CW1B 4DVBA 2FIRT 4KJPD 1GGCL 5A2JH 3BGFC 3CSYB 5ERWB 3Q5TA 5F9WB 4RNRA 3EDFA 3RVTC 4CN4A 5ACZA 4JZJC 1IBGH 2ADJB 2EXYD 2OI9B 3PGDA 4MAYD 1IARB 1CG9B 5FKAA 4ZTOL 5HHOA 3RPIB 3DIFB 1IQDB 5F7HA 3G5VA 2LVEA 4OCNC 5AWNL 1PY9A 4JM2C 5E0QA 1NGQH 5F3BB 2XTJE 4LLDA 1F11B 3GJEA 5KSBB 5HDBF 4WENB 4I2XA 2H45A 3QIBA 2OL3A 2J3SA 4EIZC 1JRHH 2XG4A 1F58H 5GHWH 1ZS8A 2V2XA 1W72A 4PRBB 1SYSA 1FZJA 2AVGA 3L6FA 1RZJL 3THMH 3MLRH 4PJ5A 4RFOL 4LLMA 3KLHD 1FJ1B 1K3IA 3MRLA 5DJAB 2ZUWA 3SGJC 3MA7B 3SY0A 3O2WL 2VLLB 4WO4C 4WNQA 2RGSA 4FNLL 4KK8C 5DDHB 5SV3A 3IETB 4WI9A 4UQ2A 2O5YL 3OSKA 5F7KC 4HS3A 5C08D 4HUWA 5T3ZE 3BZ4B 2H41A 3LEXA 4EDXB 1L0XA 1CK0L 1J8HA 4L8CB 3LN4A 3TPUA 1XF5B 1YMHB 5CEZH 1OAYL 4LSUL 1BMGA 1J0IA 1U8PA 4Z7UF 2YWZA 5JPMB 5BZWB 1EJ6A 3K1KC 1M71B 3BUYA 1R3HB 2A77H 2ICEB 5L0QB 1UB6A 5DD5L 2KQNA 2YWYA 2DLTA 1FNFA 1OAKH 1SJXA 4P2RD 4QRSB 4YR6B 2AJ3A 2OJZH 2VOTA 2H9GA 1XGUA 2ZKHL 2DTSA 3B2UC 4YDJB 1NBVH 4CMMB 1WC7B 2DL2A 4FFYH 1IMHC 1KTLB 1N5YL 4HH8A 5JIHA 1DZBA 2HN7B 2O26U 5E6IB 3ZKNC 5JXEA 1MY5A 5IP4A 3TN0D 1AGFA 4WFGD 1NANH 4IEFB 3MBEC 4F7CA 2ZNWA 1OGAD 1PYWA 4YHMH 5JW4N 3ULVH 4Q9QH 2R8SL 1BD2B 3JUZA 1TENA 5D7IA 4ZS6C 5F9WC 3FONA 3RTQC 4PG2A 1CD9B 5EU6B 4JRYA 1IC4H 3HG1B 3F5WB 5TF0A 5EU3A 1AE6L 1CU4H 2FEEL 5ESAB 3QUMA 1RURL 2XN9E 3KPMA 3OG4B 2DWDA 4AT6B 5H37H 3WLWC 4MWFB 2IFGA 4PJ8D 1JGDB 4NQVA 5EDXA 4FS0A 3FHAA 3ISWA 4JRXB 4Z7WA 3VG9B 2Z31A 2A6JB 2GAZA 4JDVB 4AEEA 1F6LL 5I1JH 1E27B 4EN3A 4PBWD 1D7FA 3V7AE 4JG1H 5F9DC 3BIBX 3MNVA 4X99B 3ZT6A 1MWAL 4D9QD 1IAOA 1HHKA 4AM0B 5IB5B 4EUPG 3VA6A 2FIKB 2X4NB 3GFUA 5KSAB 4H26A 4PJHA 5I9QB 5I1AB 5IQ7L 1NFDA 2N56A 5D2NA 1T7ZA 1VFAA 5IQ9A 1AP2A 3F62A 4TYUA 5D1QB 3GSUA 5BQ7A 1Q8MA 1MHHA 1J1XL 3MRJA 3DURA 4KK9C 5GSRB 5IFJA 2AXGB 3FQRB 2P24A 2CKBB 4PB9H 1ES0A 4OZIB 1H9VA 5FYKE 4G6MH 3QWRA 4AH2A 1JHLH 3P9LB 4JG0L 2X4RA 3MLTB 4ZS7L 5L9DH 3ZE0F 1IKFL 1VFMA 4HIIA 4N68A 4K3JL 4DVRH 2FYYA 3V6OE 4F7PA 4ELMF 5L0QC 4L4VD 4FQ1H 4OGZA 2BHUA 1MFBH 4PJXF 1XF2B 1WFNA 4ESKA 4WHDA 2ICWI 3RZCD 5A1AA 1XGYL 3JXAA 3PNWA 5K9OB 3SDAD 1IAKB 3ARDC 2GUOA 3FOLB 3DX8B 1E4WL 2F74B 3GJFK 5B3NA 1A7RH 3O2VL 4NWTH 4GAYA 1J0JA 4CN6A 3KPOA 3QO1A 1ZVYA 5E6IC 4MNHB 5MP6L 4G6KH 2X9XA 2J1KA 5LKNA 1WQVT 2X1XR 4LAJH 5C6WH 1N7MH 4X6CA 4F15B 3FFDB 3PWVB 4APQC 4YDLC 2A6DA 2EE3A 3VH8A 2H32A 1Q0XL 2WBWB 5A40E 1JCKA 1R5IB 4MXQC 4N5ED 5TF1H 5I30H 3RP1A 2BNUB 4ZAKB 4OT1L 4KMQA 1JNLH 4MDJB 2XZAH 1NEUA 4PJIE 3TIEA 1U0QA 3QUXA 1KN4H 4HQQL 4D94A 4I77H 4X5WA 4OQTL 1FRGL 1FL6B 4QRQB 5GGVY 4RISH 1M1SA 2FEDD 2R0KH 1AGCB 1JNHA 4WUUD 5IB3A 4Y5VA 3NBNA 5FM8A 4OGYH 2WANA 1EEYA 3LB6C 3O0RH 3QRFM 5E4EC 3BRFA 3PP4H 2XWTB 5MEND 1EMTH 2ZSVA 2O5ZH 3MRCA 1QACA 4WJ5A 1QPPA 4K71B 2B5IB 4XNYL 1W0YT 5KSAC 1JNNL 2CLRB 1QA9B 4ZPTB 1RFDL 5CP3A 4PREA 2EE2A 3NPSC 2D3VA 4NQXB 1UEYA 3IFNH 1IZJA 4GG8A 4MCYB 5F9JB 4HUUA 2WQ8A 4WU5B 5EOQL 4JFXA 3HI5L 4AMKL 2ESVA 5CD5C 2AJYL 1DLHA 2ATPA 3OPZH 3DROA 3VFRB 1OQOA 5IMLB 3L5XL 2GITA 5IB2B 4L4TD 1BIIA 4PYGA 3JSSA 1LDPL 1F8TL 1UH3A 4JY6B 2DBLL 1W0WA 2NZIA 4HXBH 5B8CB 1PBYA 1QRNE 5K9KB 4NQCD 3MROA 4XMLL 2NR6D 2MSPA 2NPLX 3FOMB 3L3JA 5SWSE 4XNUH 5K9JL 5EU4B 3T2NL 4OV6F 2BNQA 1HHGB 2OQJB 1NBQA 4OTXL 3QDGE 3ARZA 4GG6F 1JWSA 3BPLB 2CK0H 5DRNA 5JHDB 2JF1A 1F4WL 3DYOA 3BZDA 4DUVA 5FHBL 4R7NB 2YR3A 5BMFH 3MLYH 4RFNB 4FOMA 3RWGA 1PG7H 2NCMA 3JWDC 5F8QC 1WCBB 2FX9L 3NCMA 5KS9F 4JZJA 1MSPA 3F8UB 3LH2L 3HS0B 2FJGA 3IDNA 1NFKA 2BVOA 1YJDL 4U0RC 4OKVA 3GM0A 5GRVL 1FNEA 4JM2A 5DJ0A 3O11A 1XGTA 5HGAA 4FXGB 4U6XB 3X12A 2UY6A 2N4IA 4R7DB 4X9FA 4BZ2L 1MFDL 3MRMB 5DMKA 5D1ZD 4NT6B 1KJMB 3GI9L 5IFAH 1EAJA 4ZUVB 4M7ZC 1U3HA 2WLYA 1UWGL 3OKKA 1WTGT 4C59B 3OKOB 1QBMH 3MUGA 1I75A 4RWYL 3OXRB 1VADB 4G43B 3BN3B 4MVBC 3X13A 3KYNB 2J8UB 1OPGL 3U1SL 4G8FA 4LSRL 4NQSA 4UT9H 2MPAL 4WO4A 3OJ2C 3B2VL 1Q9KA 2CKBH 5I1LB 4K71C 4NUJB 5EA0L 3ZT7A 3CH1B 4P3DB 2NY5C 2E27L 4Q97A 1L9NA 1RVFH 1KJ3H 1MLCB 4XPFL 3D39A 3WFDH 3QFJB 4WFHE 1HIML 1I1FB 4KRPC 2W65A 1GJIA 5C0IB 4JFDB 2Y06H 1IAIH 3FQUA 1N6VA 2BC4B 2P5WD 3I02B 5AYUH 4Z8FH 2FO4A 3U0WL 4NO0B 3WN5C 1IBGL 5C0DA 4KJPC 3VDAA 4Y5XA 3MRIA 2DLEA 2VISA 3L3DA 2GIYA 3I6GB 2CR6A 4BSVB 1WT5C 1NGQL 1FP5A 3SE8L 5HTSA 3JWDH 5C0FA 1RJLB 3TH4T 1NLDH 3S88L 5HDBE 3GMPA 3VXMD 4MA1C 4P5MB 1JRHL 1ND0A 1QSFE 4HPOH 1F58L 4UI2A 3WUZA 1KYOJ 5GHWL 3D18A 4PJ7A 1ZA6B 5C0BB 1NEZB 1E28A 2DMBA 3U7YH 5GQBA 2JCCA 4YFLF 1TQCC 1CI5A 4LQ1A 1FNSL 3THML 4WI5A 2EDHA 3MLRL 1JL8A 4C83B 1PW3A 3RTQA 3ZKSD 2AW2A 3QUYB 2P43B 3C6SB 4G8EB 1Z9OA 2FECI 4PFEA 1J0KA 1MRFH 4J3SA 5HJ3A 1KEGH 1F3DH 2OTPA 2P5ED 1GSMA 5J9PB 5CIPB 3HAEA 3KLHC 3UJTL 4O51B 3IFLH 4J12A 3D6GA 2BNRD 4PJBF 4PGBB 5CZVH 2PTTA 2UV3A 4ZOEA 4I0PB 2BVUA 3DWTA 2EDFA 3TIDA 2QSVA 5CEZL 2CRZA 5D96C 1A1OB 1DANU 1SY6H 5AZ2H 5EZOH 2NY5H 3FJTA 4HEME 4HFUH 5IHUH 3RKDD 2X70B 4Z7UE 1XR9A 1YZZA 3D3VD 4IDLA 3NA9H 5J6GB 2A77L 4JO1H 1XZ0A 4NIKB 1NC4D 4IJ3B 4LEXH 1PLGH 3EFDH 2HTKD 3V5KA 1P7KB 1OAKL 5JA8B 5JPNB 3S9DB 1FC1A 3VXNA 3MJ8A 4S1SH 5HD8D 2OJZL 4R2GB 3ESUF 1FL5A 1I3GH 2IBGA 5KANG 2NY3D 3OHXB 4FFYL 4FTVA 2AABH 3F6LA 4UU9B 4U6YB 4XVTL 1CGVA 4PJDF 1WFUA 4EOWH 4QOKA 3CDCA 1UJ3B 2PYFB 5E1AB 4N0UE 1MHEA 4AL8H 4YHML 1FYTB 2JTDA 3P77A 3ULVL 4Q9QL 3F7VB 3B5HA 4GKZA 2XXMB 4GXUN 3TN0C 3GSWA 4JY4B 1MRDH 1IC4L 4FXKB 3H9SB 2XRAL 3KPSB 3BRDA 2RQ8A 3ARGB 5FGBA 3MV7E 1CU4L 1BFTA 1KACB 4ORGA 3VXOB 2HLAB 3ARUA 3UMTA 1QR1B 2AQ1A 5D7LD 1AKJA 4JVWA 1NKRA 3HUJF 3ARDA 4XBGB 3QDJE 4JPWH 3DVNB 4KROB 5F70A 3QXVA 4OZGB 5I1JL 2XQBH 3WJJC 1S7SB 4JG1L 3SDCC 2NXZC 3MUHL 1TTGA 4PJ8C 3ZO0A 2RFXA 5EO1B 1IGJA 1BQLH 3MFGB 4LCUA 1BZ9A 3L7FB 1PZ5B 2W92A 1A21A 4APQA 1YY9D 1VESA 5F8RC 3UTTE 3IGAA 4NC0B 3PF2A 3QUYC 2I27N 1QSED 4KKNA 3BISA 3D85D 1HDMA 3U4AA 1I9RH 3NABH 5BVJA 5JQHC 1WTLA 3L9RA 1T04B 4Z0XA 3O4LD 3JV4B 3BD5A 1TZIB 1MRCH 4PB9L 5IOPA 1XH3B 2NNAA 3SOBH 4JFQA 3RWHB 4G6ML 3ZKMD 1ETZA 4XX1E 3WIHH 2DQUH 2FBOJ 5L9DL 3MREA 3VXUB 2YUVA 1JPFB 3V6FB 4DWHA 3B8SA 3ZE0E 4DVRL 2ZCLH 4OLWH 4M5YH 1FZOA 2VDLL 4IJ3C 1TJIH 1TCRB 2VITA 4FQ1L 4HJGB 1MFBL 1A7QH 4ELME 2HFGH 1YA5A 2YD6A 4PJXE 3CMOH 2C3VB 5SWZA 4QTIH 1TPXC 2OR9H 4HC1H 2EEBA 5C8JB 1TCMA 4U1KB 3SGKC 2V5YA 3U4BH 1A7RL 1BF8A 3NZHH 4WFEE 2DBJA 5D6CA 4CL7A 4G6KL 5ID0B 1MI5D 1BOGB 1MCWM 5DTFB 3OX8B 1N7ML 3CPLB 3O3EA 1UJ3C 2CIIA 1VKXA 2HVKB 1GAFH 3ULVD 3QWOB 1AXSA 2AEPH 1IJ9A 4LHUB 1IVLA 5TF1L 3UTQA 3FQXA 1CT8B 4W6XB 4KAQL 1TQBC 1JNLL 1D5ZB 3FZUD 4QT5A 3TJEH 5IMMB 1KN4L 3MJ7B 3B5TA 4NRZB 4HD9A 1I3RB 3L3GB 4W6YB 5DD0H 4RISL 3S96A 2R0KL 4GJTB 4F80A 2AEQH 5GGTA 4L3AA 2AXFA 2VLRA 3GSNB 4XPTH 3QAZC 4OGYL 1HILA 3O0RL 1BEYL 3CFDB 3PP4L 5C3TA 1U8KB 3SKOB 1CXKA 5HGGS 2V7NB 3TO4B 4J3XA 5IBUG 5JUEH 1NJ9B 3UPRB 2EDLA 2J88H 4OF5A 2F5AH 3MRFB 1G9MC 4NO3A 5E99H 1YN6B 2FSEA 3AROA 4O00A 5DHVB 1HSAA 5IJVA 1LNUA 5C0CB 4LGSB 5I17A 1DQDH 4U0QB 2KQMA 1I8KA 4FG6D 4LPTA 4L8DB 3TBTB 5CS7A 3NCCB 4Y4KB 4Z7VB 1T5WB 5FM4A 5L2JB 3Q3GA 3AM8C 4OKDA 3OJDA 5MI0B 2D0HA 4HKXA 4LPUA 2BSED 4HXBL 5FDYA 1CDJA 4KI5C 2IQAA 3C5ZC 2C7UB 4XNUL 4RMWA 3HC3H 1RIVH 3ES6A 5T3XE 4GUPB 1MHCA 2BOBB 4G9FA 2NY6C 4W70A 4O2FB 3SJVA 1FG9C 3DTXB 4XX1G 2DYPB 3SDYH 1MCLA 2IADB 1EZVX 2CK0L 3C8KA 4D0CA 4ZG1A 4GG6E 1XR8B 4P4KC 3IS0X 2Q8AH 3MLYL 5BMFL 4X8JA 3D0LB 1PG7L 1TIUA 5ACMA 3ECBB 1U93B 4ZPVB 2OSLB 3WN5A 2Y23A 1AQDA 1T4KB 4G9DA 3LKNA 5KS9E 4K7PX 2P46B 5JO5A 4JAMB 2NY0D 2PO6B 3FQWB 3BWAB 5E9DE 4M48H 2YEZA 15C8H 2HAZA 5F72S 4ZFGH 4P9MH 4RGNE 2R2BA 1Q9OA 2FZ3A 4PJAF 4Z7UB 1CDIA 5A2LH 1C1EH 3CDGA 4S0TD 3K80A 4N90E 5EBMA 4M6NH 1G7HB 1G0DA 2YD3A 3FB6B 4HS6A 4HWUA 3UBXA 3WKNA 1C8PA 5IFAL 1O7SA 2UYLA 3MLWH 4YGAB 4ZUTB 4Z7NF 1S7VA 1JIBA 4P23D 5DS8A 1NGWA 3V4UH 1SYVA 4YHYB 1QBML 1J5OH 3I84A 1K8DA 3P40A 2FL5A 4OCSH 3HPLB 2DN7A 4UT9L 3ARBB 3L3IA 5CJOH 2CKBL 1D6EB 1I3VA 3O6FD 2X4UB 5LCVH 4LPXA 3PWUB 1RVFL 2J4WL 4ZOBA 4XZUA 1KJ3L 3WFDL 2XPGB 3HPJA 2Y7QB 1YMME 3DXAA 1N5AA 4YGVA 4YE4H 2Y06L 1IAIL 1K4CB 5F44A 4YH6A 3VWJB 1A1MA 1UB5A 4X7FC 4Z8FL 2E9BA 3QDJB 3QJFB 4MJ5A 2BRRH 1JHTA 5GS2H 4CJ1A 4U7SA 4LIQH 4RAUB 5HBBA 4Z76A 1U58B 1KIPA 4LRIC 4MDIB 1G7JB 4PRDB 3UZVB 3QUZB 1RK1A 4N9OB 1I4FA 4P5TB 5E8OB 1B90A 4TULH 5FO8B 3CMGA 3H0TA 4N8VA 1OTTC 5AD0B 3WIHA 4YDKH 4YHPA 1NLDL 2IALA 3UTTB 1ZVHA 2A83B 1NGZB 4P2RA 4ONHA 5J11B 4NRXA 2XA3A 4HPOL 2H2PC 1JZ3A 4PRPE 3CAFA 1H8OA 3ILPA 5EU6D 3U7YL 1G7QB 1JVKA 4E5XB 5GISH 3HG1D 4MD4B 4ZNCD 1DDHB 4XC3H 3NIGF 4N0CD 4KFZC 3MV9E 3IJSA 3WNKA 5HYIA 5DWUH 3TN0A 4HC1A 2H1PH 3NFSH 4M6MH 1KULA 3C2SA 1Z9MA 3QQ3B 5JW3H 5TH2B 1KEGL 1OGAA 4JPKH 1OTUC 2BVPA 4Y19D 1EH9A 3GSNH 4U1JB 4D0DA 2PO6C 4KVNH 2OMBA 1AQKH 2UVEA 3IFLL 5T1MA 4OV5B 2CDEA 2LABA 2DTMH 2OTUB 1R0AH 3STLA 1CFSA 3BIKA 3LS4H 4H1LG 4WEMB 5CZVL 4UOJA 4PJBE 5DUMH 5C0EA 3TBYB 4XP9L 2WBJC 4NKQB 4ELMB 3WJJA 5DJXA 1T3FB 1ADQH 3SDCA 4PJCA 1NC2D 1SY6L 1YECH 4IRJC 4PJ8A 4WHTA 1GGUA 3FT4B 5DA0B 5AZ2L 5EZOL 2NY5L 1X6NA 5HYQB 3VFUB 4HFUL 4OAWA 5IHUL 4XT1C 4PG9A 5F9OH 1OB1A 1ZLSH 5EUOA 3NA9L 4J8RA 2C3WA 4OZFG 4LEXL 1PLGL 3EFDL 2OYPA 25C8L 3V2AR 2FLBT 5DJ2A 5ACLA 4S1SL 2BMKB 3RKDC 3ZYIA 5CLWA 1EUUA 1JWMA 4QHMA 3BH9A 2KH2B 1I3GL 5C86A 3VGBA 5H94B 3JTTA 2HTKC 1GOFA 4LHQB 3CVIH 1QQDB 2AABL 2YPLA 5HD8C 1WAAF 1N3NA 3VFWA 5DJCB 5ABDE 3QHFH 4EOWL 1KEMH 5E8PB 4PJDE 1A2YB 4TTDD 3FAXA 2ADGA 5FA3A 1YNTA 3RIAK 4AL8L 4YDVA 3VWJC 1HQRB 1XCTA 4Q6IC 4JHWH 2J6EA 4OUUB 1GGBH 2ID5A 3AU1B 1NGYB 4R3SB 1MRDL 4LHJB 5D9SA 4DN3L 5D93C 5J13B 1FNHA 4IHOA 5I74B 4X4YB 4I48A 4O2EB 1M05B 5EZIL 3EOAB 1ZSDB 4GRLC 3FFCA 3QH3B 4L4VA 1B0GB 4JPWL 3HUJE 1KIRB 5ENWB 2DKMA 2XQBL 2YOCA 2XZZA 1XIWD 3VCLA 4HHAB 2FJHA 3SDAA 3A6BH 4ODWB 1BQLL 1OF2A 3DRQB 2Y9RT 4ZAKD 3W0WD 4F7EB 1OW0C 1UA6H 4LLUA 2ZCHH 3KPQB 3O6KH 1LO2H 1YDPB 5E8EB 4PBVC 1YY9C 3DX6B 3JV0A 5ICXA 3GBNL 1I9RL 1S7TA 3NABL 4JLRA 3B8YA 4L5FH 2FEEI 2IG2L 4QHLA 4N9GA 3S97C 4LVOB 4XRCB 4HKBB 5IB1A 4WWKD 1QBAA 4X6FA 1MRCL 2ADFH 1BBJA 3IJHB 2AJSH 3BPOC 3SOBL 3QRGH 3BPNB 4U1LB 2K1MA 3WIHL 3S6CA 5KN5A 1IGCH 3QO0B 4LARH 1RHFA 5IVXF 2DQUL 4LCWE 4CVXB 5TJWK 3WS3A 3NH7H 4WUUA 3GSVA 3G9VA 2ZCLL 4OGAD 2XNAA 3SDDD 1W8NA 3MRBA 4OLWL 4M5YL 1B4JH 1TJIL 3CJJA 2Z8WC 1A7QL 1J05A 5DMIL 4NKOA 1U2CA 4O2CB 3CMOL 4I5BA 4HFWB 3OKDA 5KS9B 4QTIL 1WV7T 1K2DA 1WWCA 2OR9L 4HC1L 2EEDA 5B38G 3OR7A 1A9BB 3ZL4H 4XNXH 5JZ7C 5JHLH 3U4BL 3QZWA 3NZHL 4PYHA 4FQCH 1C5CL 5HGHA 2Z35A 1CE6A 4KGJA 2O93L 3REWB 5HY9B 4QXTB 2D31A 1KN2H 1CD1B 1JPSL 1G7MB 1T21B 5ESQB 4BSWB 1GAFL 4LSSH 5GIRB 4I3GA 1HXMB 2MQCA 3VDBA 5C0ND 2GJ6E 2AEPL 1AH1A 3IDUA 3C5ZA 2W1NA 3MXVH 4RMVA 2CKNA 4GBXD 4MYWB 1IAIM 5FK9A 3TJEL 3QP3A 4Z5RB 3MV8B 5I74C 3LSOA 2HTLD 2PW2B 5DD0L 1VDGA 1INQB 1T0MB 2D7OA 2F54B 3EKCA 2AEQL 3FB5B 1JTTA 4AQ1B 4XPTL 4QHNB 3AC0A 4ZO9A 3L3HB 5IV2B 5EOTB 5FF6B 4EDWH 35C8H 1AGBB 3OZ9H 3AXLB 4D3CH 1IC1A 2W0PA 4FMKA 3VI3F 4LCCB 5EPMB 3GJFA 4CNIB 3ZSSA 4OLZH 2OP4H 4KKBD 5JUEL 3SGDH 2GK0A 4LEOA 2J88L 3QPQD 1FYHB 5F6IB 5E99L 1E4KC 4Z77B 5JTWA 2HH0H 5E6YA 1INEH 1RPQA 2UWEF 4OM1H 1HHJA 1QUNA 1EGJH 5E1HB 4XGZB 1DQDL 4I18C 4RMUA 2F19L 1UCBH 4RZCB 3FO1A 3CFBA 4Y16D 1HHIA 4X6EA 4WW2F 2Y5TA 1FPTH 4B41A 12E8H 1TNNA 4WWID 1B2WH 2XKNB 5ETUA 3V52H 4PTUB 2IJ0C 3I50H 5CGTA 5A3ID 1GXEA 4HJJH 1YPZA 2OJEA 3DX7B 1RIVL 4BM7A 1RSFA 3QFJD 2YA2A 3BKYH 3KPRA 3OF6D 3QNZB 3RL1A 2XN9D 1CDBA 3MFFA 4DTGH 4RQQB 4HUXB 5I1DA 5JOPE 4P2OD 3SDYL 3MQIA 3QCUH 2WIIB 2Z4QB 4UDUB 1OD9A 4NO0D 4PJGF 4NCDA 5IMOB 4YLQT 4LVEA 1P2CA 1U36A 4CAGA 1JK8A 3OTTA 2GEEA 4PJBB 5TFSH 2EE6A 3MGOB 3MCKA 1O0VA 4WFFE 3EDKA 1YEKH 3W5MA 3C6LC 2GCYA 4HUVA 2L7UA 4LRIA 1BVLB 2P5WA 2FB4H 1GGTA 3D9AL 4M48L 15C8L 3V6ZA 4ZFGL 5KTEH 4P9ML 5IFHH 5DD3H 1FCCA 1FDLH 1ZLVK 1NAMA 1JZ8A 3X3FH 2NY0C 4M6NL 2BCKA 1YEHH 3BIAX 4XHJD 3CH8A 4M7KH 2GT9A 2CRMA 4PS4H 3MLWL 5HGBB 4Z7QF 3DYPA 3QXDB 3V4UL 4K9EH 4J3WA 4RAVA 3QG7L 4WHYG 4Z7NE 1ZVSA 5FYKD 4KQ3H 3RUGF 4TSBH 3MRRA 3VFTB 3VXMA 3EBAA 2D4DA 1J5OL 2HKFH 3HLAA 3P4NB 4MNQA 4P23C 4OCSL 3KPPA 1CS6A 1QFWH 3IFPB 4NN7B 4XCYA 4I0PD 5CJOL 3FQTB 1OSZA 2DQTL 5LCVL 4YXKH 4MXWH 4I9WE 5B39A 3ROOB 4OGXH 2VMFA 5FO7A 5GRWA 5IWLA 2AJUH 2P5EA 2PR4H 2LE9A 5IKCB 3PXJA 2WBJA 3MRQA 3FT2A 1M7XA 3O6FC 4R4NC 3V5DA 1S5HA 5JW5A 4ODVH 4YE4L 5CMAB 3UYPA 2R1WB 3NN8B 3LMJH 2BNRA 4IRJA 1VERA 1ZANH 3QB7C 5CWSA 5D5MA 3KXFE 3INUL 3UDWC 5HVHB 3RPKA 2O5XH 2BRRL 4JKMA 4ZUWB 4LIQL 4YO0B 1P84J 4HZAA 5KZCD 2HJKA 3N06B 4DZBA 3AUVA 1UKSA 4TULL 3RVVD 4ZFOA 3S4SG 3GIVB 1N64H 1NC4A 3FT3B 3QFDA 4YDKL 5EOCJ 1LE5A 1CF8H 1U8HB 5TDPA 2GJZB 4JJ5A 3MJ9H 5B4MD 3HC0B 2YK1H 1NBYA 3DV6A 1ITBB 4LF3A 5C9JB 2X1OA 4NKIH 5GISL 1CGUA 1MCQA 4XC3L 3E3QE 4YQXH 1P4IH 1ZK9A 4X6BA 4LKCA 3NIGE 3NMEA 3WLBA 2H1PL 5AUMB 3CCHB 3NFSL 4M6ML 3UTSB 4L3EA 4TUJB 5JW3L 1CL7I 1TZHA 4JPKL 3PHSA 1JYNA 3GSNL 2X9WA 4PLKD 2ORBH 2VLME 4KVNL 1AQKL 4HUKB 1RUML 1S7RA 2DTML 3BJLA 1R0AL 3LS4L 4GRLA 5HYJE 5DUML 4YBLC 2HJFA 1V5JA 3VXSB 3VDCA 1ADQL 1AY1H 2GTZB 5D7LA 1YECL 1PG7W 1S9XA 4ISVB 4KJQC 4N5UA 4OBRA 1S78D 5F9OL 1ZLSL 3QQ4B 1OW0A 4LBEA 5DZLA 3LQZB 2ZOKB 2BSRA 4FZ8H 4NM8H 2VL5A 2PCPA 1BQUA 4HT1H 2WZPD 5SWSD 3OXSA 2A6IA 3MXWH 3EDDA 3TPKA 1EFXA 3OAYK 1VA9A 1RUKH 5DGQA 3G5ZA 5KSUA 3PWNB 4ZTPH 5C0AB 4KJYA 1WBZA 3C5JA 3CVIL 4LU5H 1QSEA 5FYJH 1I1YB 3D85A 3QHFL 3P0VH 1KEML 1WAAE 2VQ1B 1ZA3A 5DI8A 2IPTH 1UACL 4FABH 4QRUB 4R0LB 3O4LA 3W39A 3KPLB 1UVQA 5JDSB 4ALAH 5FUCC 4JHWL 4LLQA 5GS0C 3ZKXC 5E5RB 5F1NB 1GGBL 2OZ4A 1LP9F 5HVHC 3KNBA 4XCNA 1S7QB 4PRNA 4LLWA 4AIZA 4OF6A 3LKPB 1IEAA 3S5LA 1S3KL 3BH8A 4XBEH 4Z78B 1DVFD 3HMXH 1EHLH 2ICWB 3CXDH 3O2DA 2X42A 1EHXA 1IM3B 4QO1A 1BFOB 3SE9H 4OBSA 3DRTB 3UYOD 3JVGA 2X4SB 2B8OT 2ENSA 5HI4D 5TDOB 1D5XA 1URLA 2W0FB 3A6BL 1N4XH 2BOCB 4D8PA 1D3CA 3NFNB 3QEUB 3KJ6H 4GKOA 4XBPA 3PABB 2WK2A 3M07A 1XIWC 1U8IA 1UA6L 3KWWB 1XGRA 2ZCHL 5F21B 2K7QA 1MI5A 5GGUA 1Z5LA 3GB7A 3O6KL 5EN2A 2C1OB 4OI9A 5DQ9B 1FVEA 2YN5A 3BD3A 4HAGA 4L5FL 1X6LA 5L2KA 4QYOA 5DMYA 2YZ8A 4WFHD 3WSQH 2ADFL 5ITBH 2AJSL 4ONFH 4PRAB 4HK0A 4X7TA 3EO0B 4KK5D 3TO4D 3QRGL 1IGCL 4WWKC 4N0RA 4KUCF 3R4DA 3NH7L 5GSVB 4G8IB 5LQBH 4FP8H 5IVXE 2G60H 4FMFA 2VUOA 4OF7A 2ZUTA 4ZSOB 1B4JL 4KK6D 3UJIH 2G5BB 4O4YH 3T09A 3FO9A 3N1FC 5HYEA 5I19L 3C08H 1E4KA 2ZUQC 3N1GC 4U1HA 1BJ1H 5GS0H 3IJYA 1UGNA 5CEXA 5FV2A 3SDXA 5GZNC 3CLEH 2YC1A 5KJRH 4IOFD 4Y4KD 4I18A 4HDIA 3ZL4L 4UBDC 4XNXL 5BV7B 5JHLL 1QSFD 1KG0B 3BD4A 3U0PB 4DGVH 1RV6X 3S37X 2XTJC 4FQCL 5EU5A 1FVDB 1G6RH 3Q6FA 4PJAB 32C2B 3FN0H 4JFPA 1KN2L 5GJSH 4JCLA 4R0LC 2E6PA 5KVMC 5F3HA 5EU7C 4J3VA 3BPCB 4LSSL 4GQPH 4OUOA 1KPUB 2D2OA 1NDMB 4MJ6A 1MQKH 3MXVL 1G84A 1IGFH 4DFHA 1NCCH 2G5RA 5ITFA 1NSNH 5HYSB 3MLUH 3F7QA 5JOFA 3CU1A 4AQOA 8FABB 5IHZA 3MNWB 4GBXC 4PRIE 3PL6D 2ZJSH 1CLOH 3GMLB 4P57B 1MOEA 3S34H 3IAPA 3EO9H 3K2UH 1F02I 3EYOB 2EDYA 2DWEA 3TA3C 4EDWL 35C8L 2EXWD 3OZ9L 3WUWA 4ZDHA 3OAZH 1S8DB 1KB5B 4D3CL 4GRWB 5BS0B 3REVA 2ADJA 1T2JA 2NY2D 3GSQA 4QY8A 4PY7B 3VI3E 3MJ9A 4OLZL 5I15H 2OP4L 1OWWA 2H8PA 1EAPB 2D7TH 1FCGA 3PQYA 3QI9B 5F3BA 1LEKA 5J1AA 1F11A 1INEL 4OM1L 5KSBA 3QCVH 2R9HD 2ENYA 2LFGA 1EGJL 2QSQA 2UWEE 1C08B 1S7UA 1U95A 2OCFD 3NCEB 3QPQC 4NQEB 1AR2A 5D2LF 1UCBL 2AI0H 3ARFD 1T1ZA 3RGHA 1ZMYA 1X4XA 1FPTL 5IBLC 1H8NA 1FN4A 1GGYA 4OZHB 1B2WL 4A6YB 4P23A 3V52L 3K8LA 4Y16C 1JNJA 2CH8A 1TMCB 3RIFF 4AYFA 1AFVH 2HMIC 2XFXA 3HFMH 2IAMD 1A4KA 5ISZB 3BKYL 4K7FB 3RL2B 1OT1A 2AKRA 2LAGB 2KL6A 3VJ6B 1FVCA 2WINB 4JHZA 3QCUL 3QDJD 1TVBB 3EOBB 3O6FA 4PJEB 3GGWB 4V2BA 4PJGE 5JXAL 4P2OC 1ORQB 3MOQA 5JPMA 3UDWA 3V0AC 5TFSL 4HX1A 1XGQA 1JZ7A 5KVEH 4QRTA 3LKQA 3IU3B 4XXDB 1YEKL 3C9NB 3H9ZA 3D69B 3R06A 3SCMD 3UTTD 2FB4L 4P2QE 5T3ZH 5KTEL 2JK5A 5IFHL 4XAKD 2VLJE 4NNXB 4YDJA 2AK4B 4FA8A 3X3FL 4CMMA 1F90H 2NLJA 1KTLA 4M7KL 5DVNA 3VW3H 5C0JA 3MRKA 3MOBL 4PS4L 4K8RH 4PRHB 2FX8L 4K9EL 2VABB 3MMEB 3B43A 4OF8A 4Z7QE 4KQ3L 4TSBL 4XHJC 5IR1B 2HKFL 1NGXB 3RUGE 4MA3A 3DO7B 4NCC2 1G7LB 3QIUB 5IW3A 4BH8B 1QFWL 3HN3A 3F7YB 2FX7H 1EHNA 1JZ4A 5GJTH 3QNYB 2J5LC 2Y4SA 4LFHG 4MXWL 4YXKL 4YHKH 2GK2A 3V6OC 4OGXL 4GQ9H 3PP3K 2AJUL 2PR4L 5I66A 2A6JA 4Y19A 5BJTB 4JDVA 2B39A 4YPGB 4ODVL 1WIPA 4CMHC 2C3XA 3LMJL 4Z7WF 4WFED 3OJMB 4JREC 1ZANL 5DYOA 1MJUH 2VLKE 4DZ8B 1R3JB 2O5XL 4U7KA 4KMTH 3RWIB 1MHPH 1NC2A 5HDOA 3DBXA 3KG5A 1IAMA 2DQFA 4PP1C 5DK0B 2IANA 1QVOB 1P7QA 1YEEH 1NMCC 1BLNB 4NSKB 2IH3B 1N64L 3BYYA 4S2SA 3DGGA 3BXNB 1CF8L 3PWPB 3WHXB 2YK1L 5HHNB 4JDZB 5CD3A 3S98A 3RVVC 1NMBH 4LGPB 1RIUH 1UWXK 1VPOH 4XCCH 4NKIL 4YQXL 3CUPB 2EDBA 5CJ8A 1H8SA 3QISA 2IPUG 4P4RA 3C5SB 3LIZH 2XA8H 2YD7A 3G08B 4XP1L 3BN9D 4G80B 3HZKA 1YC8A 4J1UA 4YXLH 2GYSA 2CIKB 2ORBL 4NN6B 2ZUUA 4MX7A 1G6RA 3D87B 2NX5A 4M7LH 4X4ZA 1KB5H 4GRWH 3H7BA 1NCBH 3H3PH 5C07B 4Z7OF 2WWMD 3V4PH 5DRXB 1AY1L 4K94C 5IEHB 1L0QA 4KDWA 3BKJH 4WEBH 3B9DA 4M03A 2YBRB 1XIWA 3IXAB 4ZUSA 4BH7B 1BVKA 1IL1B 4FZ8L 1JWUB 4NM8L 5D1XB 3RWFB 3T77A 4RSVA 1VFOA 4HT1L 1RIHH 1S78C 1G9EA 3MXWL 4KKLC 4XNMB 2YD2A 4ZAKA 5T3XD 3W0WA 5DRZA 1RUKL 2X7LB 4JRWA 3D25B 1VACA 4ZTPL 1CICB 2YMXH 2FH6A 1DJSA 2VH5H 2FRGP 4XCEB 4NHCH 1KFAH 3HRZB 4A6YH 5FYJL 3GMQB 1IE5A 3P0VL 3FRUB 4MNGB 1V3LA 4X4XA 2VB5A 3IVKB 4JFEB 4B7LA 3HZYA 2IPTL 2NW2B 4MJIE 4FABL 4JGMA 5KAQG 3E6FB 4WWKA 4ALAL 4PRIB 2X10A 2YPKB 3B6SA 3VD7A 4LK4A 4IRSC 3U9UA 2XKUA 3QDAA 1LP9E 3MYZA 5L8KB 3VRJA 1QA9A 4LNVA 5E9DD 3DVGB 3IAQA 3Q0HA 2Y6SD 4XBEL 4ZPTA 4RGND 3HMXL 3IF1A 1KCVH 1PKQE 3EYFA 4PP2B 3CXDL 3SDDA 5JNYB 1V7NH 4N90D 3SE9L 3V7MA 4L1HA 3HR5A 1DVFC 2ED8A 2VJXA 4GAGH 5HSFA 4EUPA 2VAAB 4QXGH 1Y18B 2AP2A 1IC7H 1N4XL 5BW7C 3RNQA 3KJ6L 5CBEB 4F7TB 4L8SB 4OFIA 5GZOC 3PHOB 3OV6A 3G6JB 1I8IB 2XQYK 3UBXI 3WV0A 4L1DA 1HKFA 1HHGA 5DEFA 1ZLVH 3RHWF 4BZ1H 1MCRA 4OLVH 4XHQA 3VMOA 1BQHB 4PJFB 4NBZB 4GBXA 1I7UB 5EO0A 1RK0B 3WSQL 4F3FA 1EEZA 1HXYB 1YMMD 5KBNC 5ITBL 1N2RB 4ONFL 1P1ZB 1XCQB 3ULSA 5DHYB 5CGYD 4OZ4A 3TA3A 1ROWA 2A73A 1KCSH 4PD4K 1CZ8L 5LQBL 4FP8L 1IEBA 1N8ZA 2G60L 4KK5C 1KLUB 3OR6A 4OD3H 3WXWH 5LJYH 3HE7B 4QWWD 2M2DA 3QHZH 2PTVA 3UJIL 4H0HB 4O4YL 2MQ3A 3C08L 3BZEA 2VTFA 3FB8A 5FM5M 3BP5B 2AGJH 2AV7A 5T1KD 4U6XA 5GS0L 3JWOH 4C58B 2Z8RA 3I85A 3D2UD 2I07B 5EUKA 1KJMA 3CLEL 1AGEA 4LLVA 4Y2DD 1LO3H 5FGRA 5DXWA 3VFSB 3KS0J 4LSTH 1CVSC 4PRPD 4DGVL 3ULVF 1UC6A 4GKNA 2VLJB 1FNLA 1G6RL 2Z92B 3NAAH 5GJSL 4P46B 3IAGC 2VZVA 1IFHH 3MV9D 3T2PA 4M1DH 5CCKH 3RWCA 1IGYB 3HZMA 1Z2KA 4Y16A 3P9MA 4V1DE 1X7QA 4FQXD 1UXSA 1MQKL 3HE6D 4TPRH 1IGFL 4LNRB 1ZLUK 1A1NB 1NCCL 3RUGB 1ZT4B 3O45B 1R3LA 1NSNL 1WWBX 2FO1A 1QEWB 1CGYA 1G7IA 2RJMA 1U8OA 4N0FB 4Q58C 5J12C 5J6HB 4LMQE 3EUUA 2ZJSL 3H6JA 1CLOL 1UEMA 3OF6A 3S34L 4M1CC 2XN9A 5AAMA 3EO9L 5MENE 4C4KO 3K2UL 1MFNA 4P2OA 1RY7B 1FG2A 2VXVH 2R4SH 3STBA 3G5YB 3O41A 5MEOA 5BRZB 2YD1A 1YN7A 1MNUH 3HMWH 4UILH 3O8XB 2D7TL 3I6GA 3L1OH 1T0NA 3LKOB 5FO9B 3GM8A 3TESA 4GS7B 5JORA 2NY2C 4GW5A 3LKRA 1ZEAH 3QCVL 2F53E 3ZZ1A 3GMOA 3TZVC 3TVMD 5CSZB 5DUBA 1RUQH 5FXCH 3N85H 4L4TE 4U33A 1J86A 3T0EB 5GRZA 3NGBB 4UUJA 3DX9B 3RAJH 4ODUA 5D2LE 2PYEB 1SJHA 1U8MA 1RZ8A 3JV6A 3OGCA 4E41E 3BP6B 3GMNB 4U3HA 3RWDB 3MOAH 3QIWB 1CDHA 5IB4A 2DQDH 1J7VR 1Z9SA 1U8NA 1AFVL 3HFML 1I9IH 3QDMB 4CU6A 1Q9WA 3O3AA 1JHKH 2FGWL 4TVPH 3V6OA 2WV3A 3FL7A 2O61A 5F7MC 2IAMC 5TDNB 1DUZA 1RULH 2B0SH 3WMSA 3NIFF 1ORSA 1M4KA 2GSGA 1TJGH 3IFOA 3S3SA 4LKXB 1ZHKB 3MLSL 4I1NB 3LDBC 4HLZH 1T1WA 3M17B 4HMCA 4UQ3B 3O6LH 4I3RH 5KVEL 2P8MB 3U6RB 1BECA 5DC4B 1ZLWH 2QSTA 3VFPB 1P7KA 3BT2L 3GNMH 5T3ZL 5TPWH 2Q8BH 2PUQT 3MUY1 4NQUA 4WEUD 2XZQH 2XI9A 4JVPA 5D71H 2YRZA 3SCMC 1UG9A 4ENEC 3OHXA 4PGJA 2LU3A 4I0KA 5HHME 4FFWC 1Q0YH 3VW3L 4FQQA 1AC6A 4HIEA 3I3DA 1FHGA 4K8RL 4UIMB 3BEWB 1UCTA 4PJIA 3RGVC 2AJXH 5SWQB 2X4QA 1A6AA 5DJDA 4QRPB 3U2SB 1U91A 3UAJD 3F7PC 4M61B 4NRYB 4LCWD 1I7TB 1H5BC 1FFOB 4XP4H 3LEVH 1F2XK 4F58H 1PD6A 1P5UA 1K5NA 3RI5F 4BJLA 1JF6A 5LBSH 5LG1A 3VXOA 3SE3C 4KRLB 2A6KB 5GJTL 3VXSD 2CR3A 2BP3A 1OAXH 4KZDH 4YHKL 4U1SA 1BVZA 5TQ2H 4N8CH 4GQ9L 1LP9B 4M3KB 3DVNA 1BAFH 3EYUH 2AV1A 1BREA 1KC5H 1GYAA 4YUEH 2R2EA 2YSSB 1P4LA 4AENB 4Z7WE 1G0YR 1FZMA 3K2MC 2BVEA 2CLZB 2R1XB 4KMTL 1I1CA 4Y5YC 1MHPL 5C0AD 4TSAH 1LEIB 2WLZA 1AGDA 2GJ6D 2MMXA 1MCJA 1NCUA 4ERSH 4QTHB 1I7ZA 1YEEL 3HI1B 5BO1H 2OK0H 4HH9A 1QRNA 4CADB 2W60B 4GRMB 5SWSA 2EYRB 4OM0H 4QHUA 3L95A 5FYLH 1RIUL 1VPOL 4XCCL 3VXQA 2P7TB 5ICYA 3O9WC 1ZTXH 3T08A 4KVCL 3CC5A 3QDGA 4HV8B 4K55A 5INCB 2E6JA 5LWYH 2F8XC 3VRIB 3E2HC 4IBLT 1XEDA 2K3TA 1DBAH 2GJJA 3V6FA 3LIZL 2XA8L 4MQXD 4IOSD 4L9LC 5DC0A 4JFOA 1OLLA 3O4OC 4JFFB 5A16B 4BKLB 5C09B 4U6HB 4YXLL 5EC2A 3VFGH 2APWA 1N6QH 2VC2H 2ATKA 5T1DH 4M7LL 1KB5L 4MQ7B 3BN9C 4U1MB 1NCBL 4PGDB 1ZHBA 4JPVH 4U1KA 1DVFA 5FA4B 2N7BA 3V4PL 4Z7OE 2Y1VA 3QXAB 5I71B 3CX2A 1KLGB 2EDTA 1SEBA 2GW5A 4CVZA 5BW7A 5ID0A 4HKZB 4WEBL 4D0BA 5DTFA 2WWMC 2C1PB 4MQSB 5ANME 3VFOB 4QRRE 1M7IA 1B3JA 5I8CA 1HHHB 1A6UH 1GZPB 4HGWA 1RIHL 3QULB 3RA7H 1CT8A 4PV9A 8CGTA 1KELH 4WIQA 1YEDA 1A6PA 3S35H 4HZLB 3GSXA 2YMXL 2VH5L 1V8HA 2VSDA 3L3GA 4NHCL 1KFAL 2EIZA 2IH1B 4A6YL 5JOPD 2H3NB 2QL1A 4JVUA 5HI3D 1XF3B 3TFKD 3EJZC 1I7RA 3WIIH 2VXTH 4B0MM 1ZAGA 4TUOA 4JO3H 1B6DA 5I8EA 4NQDB 4UTAH 4WFFD 1EBAA 3AAZA 1A9EB 3UXFA 5DK3A 2R4RH 4HG4K 1F2QA 1MFAH 4U1GB 1HH9B 5IBTL 1AHWC 1JF1A 4DVBB 2UVFA 1KCVL 3MO1A 1V7NL 4H8WC 5DHVA 2DJUA 3W5NA 1DQQA 3WL9A 4M6AA 4RNRB 4RGNC 3H2WA 5ACZB 4GAGL 3IB4A 2VZSA 3UTOA 2FHFA 5FKAB 2W91A 1IC7L 5CKAA 1R5VA 1DE4B 3KLSA 1DQJA 1UQSA 4G42A 1U8QA 1QZ1A 1H3UA 3G5VB 1QSFA 1MUJA 5FIEA 3MRHA 3WE6A 3MPCA 4LLDB 2ARJQ 3MZTA 4I2XB 1PDKA 4OFYD 3QIBB 1QYGH 2OL3B 5FECA 1FO0A 5HHVH 4BZ1L 4KHTH 4NP4H 5TGBA 1ZS8B 1QLFA 4OLVL 1H3WM 4Y1AE 1BZ7A 1OD7A 3DTXA 4I9WD 1SYSB 1CTNA 1FZJB 4GAFB 3L6FB 5CEZE 1KPVB 3NCJL 5FOJA 4X9HA 4PJ5B 1WZMA 3ZDXF 4LLMB 4EI5C 3MRLB 2FECL 5I6XB 4O5LH 2QBWA 4YBHA 3G6AA 3SY0B 5I0ZA 3D0LA 4KQ4H 4P59H 1KCSL 3Q1SH 4WNQB 2HRPH 3PL6A 2EDNA 1U8LA 2E6QA 1T5XA 1T4KA 1MEXH 4RBPK 4HS3B 1WBXA 5CGYC 3UTPE 4HUWB 4OD3L 1D6VH 2W9DH 3OKYA 5FYJU 3WXWL 5DVKA 2ITDA 3QHZL 3LEXB 1CFQA 2HFTA 1J8HB 3LN4B 3TPUB 4Z7UA 1EX0A 4NQED 3K7UA 4KV5F 2AGJL 5GGQH 3JWOL 4BYHA 3P4OA 4KZEH 4ACPA 4QWWC 1G7HA 4I3SH 1U8PB 3DETC 2GY7B 5DZNA 1LO3L 2BY3A 3BUYB 4LSTL 3WEXA 2VDPH 3ULVE 1UB6B 3NAAL 1DL7L 1NFIA 4ZODA 5HHMB 4Y2DC 4CJ0A 3U46B 1IFHL 5CCKL 2AJ3B 4M1DL 2H9GB 1XGUB 2ICES 7FABH 3BJ91 3OBAA 2MFNA 3ARFA 3F7RA 3JZ7A 4GKSA 4HJ0C 5EIQA 4HLJA 1X3DA 5DQJA 2HT4D 1JPST 1GGIH 4TPRL 4N0UA 5I1CL 2PW1B 4P9HH 3TYFA 2ZUXA 2LQRA 3BOVA 3VXTA 3PWUA 1AGFB 2DIJA 3FCTA 3IDYB 1DLFH 3OKEA 5EULV 1A7OH 4FQXC 3HE6C 3NIDF 2AQ3A 2IAMA 5GGSY 4F7CB 3MV7A 2WQRA 5HYJD 3TCXA 4TTGA 5IHBA 1E0OB 1UZ6F 4LPYA 4JRYB 3SO5A 2VXVL 2R4SL 5EU3B 3QDJA 1A0QH 5L7XL 3QUMB 3W11D 2VXSH 3LEYH 3IU4H 2DWDB 4RAUA 4JGJA 2V9RA 2AK4D 1MNUL 2VDOH 1G7JA 4NQVB 1A6WH 3HMWL 4UILL 4MHHI 4Z7WB 2Z31B 3L1OL 4XWGH 2V9TA 4OLYH 4PJ9B 2GAZB 3QIBC 4YK4B 4EN3B 4PRHD 3IDIA 2J8UF 1ZEAL 4JO4H 3SCMA 1MCHA 3UTTA 3UZQA 1MLBA 1WITA 3MNVB 3H9HA 5EZJA 4NNYB 1IAOB 3N85L 1HHKB 2PXYD 4MCZB 3VWKC 3RGVA 5C3LD 3RAJL 4M93C 4H26B 4B50A 3QIUD 4PJHB 3M8OL 5DMJB 3TVMC 2ADIA 4HIXH 4LVHC 3LCYA 1VFAB 4ZXBC 3U83A 5IQ9B 5E7FA 1AP2B 1MIEH 1QLRB 1H5BA 3GSUB 5CBAA 5F9AC 1CIUA 3PHQA 5BQ7B 1MHHB 2DQDL 5JLZA 5F6HJ 4ZO7A 1E4XI 3MRJB 3DURB 1I9IL 5IFJB 1HQ4A 4R26H 1KBGH 2VKXA 1JHKL 5DRWA 1ES0B 5EFIB 2DM3A 4ZFZA 4TVPL 2APTA 3NOIA 2VZ3A 3WNNA 4OFDA 1T66D 4AH2B 1DBMH 2X4RB 2R0ZH 1RULL 2B0SL 3ARRA 4ELMA 4L29B 4BQBA 1ZWIA 1MCDA 4HIIB 2DQHH 5GS1C 4PJXA 1TJGL 2FYYB 3NIFE 1FFNA 1FSKB 3BMVA 3VGDA 4GOSA 3VFUA 5GGSA 1B6UA 5ESVA 3JWNC 3O6LL 4I3RL 4PJCF 4Q7DA 3W9DA 5KSVA 3SBWC 4JN1H 2A0LD 5DJ8B 4Y5YA 4QF1A 3PNWB 2GUOB 1H15A 2OLDA 5TPWL 2NYYD 4L3CA 4JZOA 5D71L 4GAYB 4R4FL 1QO3A 3KPOB 2Q86A 3QO1B 2CGRH 4KXZI 1Q0YL 3VGGA 4B53A 3VI4F 2R15A 4X6CB 4BFIA 3ILQC 3I6LD 4OD1H 2A6DB 3VH8B 2F5BH 2AJXL 2OL3H 4NUGH 4WRLA 1MCKA 5BZDB 5GRYA 2OTWA 1D5MA 1W72H 5HVFB 3TIEB 1HSBA 4XP4L 3OKLA 3LEVL 3QUXB 1QFPA 4R3SA 4L9LA 4F58L 4X5WB 3TV3H 2IPUK 4JR9H 4J7RA 5D7KD 3T1FA 3BKCH 1G7PA 5LBSL 2WP3T 2MWCA 2NW3A 5AZEH 2E8ZA 1AR1C 2NZ9C 1JNHB 4GAJH 5GS3A 1OAXL 4S1DC 4O2EA 2FD6H 1R3KA 4K3EH 5C71A 4KZDL 5TQ2L 4N8CL 1EEYB 4NKMA 1TNMA 1SM3H 2WSKA 3B4NA 2ZSVB 3MRCB 3P73A 3EYUL 3W9EA 1Z3GH 1KC5L 4WJ5B 1WEJL 3HNTH 4YUEL 3AS3A 4Q74A 3EYQC 1A4JA 1KUMA 5D2NC 4PLNC 4HKJA 3EJJX 2WAHA 1JTOA 4PREB 4TSAL 5KOVC 2WP3O 4GG8B 1IILE 3KPQA 4ERSL 1UXWA 4HUUB 1YDPA 5E8EA 1CCZA 2KBGA 4JFXB 4X7DC 2VO5A 5BO1L 2OK0L 2ESVB 1BD2E 1QFWI 1DLHB 1FLRH 2ATPB 4HXAH 5ICZA 3B9KD 3DROB 5CEYA 5EU6E 2GITB 3KPTA 3HG1E 4G5ZH 4OM0L 1BIIB 5FYLL 5DJ6A 4PRID 4KRMB 3DMMB 1BJMA 1ZTXL 4UOW0 3QXUA 1W0WB 4LFHD 2XT1B 4KKAD 5K59F 3BZFA 3P4MA 5LWYL 4RFEA 4JRXE 4OZGF 2NY4B 1DBAL 4GG6A 5F1SA 1RMFH 3AVEA 4YHOH 5BCAA 2VDMH 4H1LA 2DICA 3HI6H 1JWSB 3T0AA 3I6KA 1ONQA 3TBWA 1CLZH 5DRNB 3VFGL 1AHWA 4PBXA 5KG9A 5T1DL 2NY1D 4HFWA 5INDA 1ED3B 1NCTA 3RWGB 5IW6A 3BGFB 1F5WA 3QUMH 5BVPH 5E9DA 1KENH 2FATL 4JPVL 1VSCA 4JZJB 1B4RA 2DKSA 3K81A 2FJGB 3IDNB 4OZFA 2BVOB 3WD5H 4QXTA 2P49B 4OKVB 1FORH 1A7PH 1RJCA 2A1WH 2ZSWA 4YHIB 4JM2B 4KTDH 1UYWH 3O11B 5DJ0B 1XGTB 5CJQH 1OCWH 3X12B 1A6UL 4KTEH 1A3LH 1CN4A 1UADC 1NUNB 4U1IA 5DMKB 3NZ8A 2ZUSA 5E2TL 1KELL 2E9JA 5IT2H 4G7YL 1IM9B 1U3HB 4KI5F 3H7LA 3MBXH 3BGMA 4ZOCA 5T33H 2QJDA 2D03H 4P0DA 3OKKB 2JLLA 3STZA 2HWZH 4Y5VC 1INQA 1T0MA 1HOCA 3MUGB 1U3YA 2DMKA 3X13B 4EI5A 5JIKA 4XH2A 1K3ZA 4XWOD 1AC0A 3WFHA 3L3HA 3WIIL 2VXTL 4G8FB 5FF6A 4OI7A 3HE7D 3C8DA 4JO3L 4WO4B 4Y4HD 1D5BA 1Q9KB 2UUDK 1YMMA 1M6OA 5D72H 1BF2A 2VLRE 4UTAL 3UROR 2LTQC 4JFHE 3G5XA 3EO1A 2R4RL 3D39B 4P2QD 2OM5A 1MFAL 2R1YA 2W65B 2FJFA 1OTSC 3FQUB 2VLJD 2C4FU 4L8BA 4EIGB 4JGUA 3WFBH 2HT3D 4HK3J 1O5DT 1HCFX 4P46D 1WVZA 1JPGB 4R9HA 4Y89A 5C0DB 5T1KA 3BQUD 1NKOA 3D2UA 4Y5XB 3MRIB 2VISB 3L3DB 4Y2DA 4YC2C 5E5UB 1JV5A 4M7JH 2XKNA 4PRPA 1C5BH 4JKKA 1JTPA 4AY0A 1OP5K 3GMPB 5DSCA 1OY3B