4FABH

Three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
216
structure length
216
Chain Sequence
b'EVKLDETGGGLVQPGRPMKLSCVASGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDSVKGRFTISRDDSKSSVYLQMNNLRVEDMGIYYCTGSYYGMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 4-4-20 FAB (LIGHT CHAIN)
publication title Three-dimensional structure of a fluorescein-Fab complex crystallized in 2-methyl-2,4-pentanediol.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 38
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1989-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fabH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fabH01
5HI3C 1TQBC 2CJUH 3SE4C 4LDOB 3FL7A 1QFUH 3LMJL 4LCWE 3TV3L 3GB7B 3WL9A 4KVNL 5TGBB 2ITCA 4OQTL 5E2TH 3EFDL 3L5WA 3BDYH 4IDLA 3T0XA 3HI6L 5JOEA 3GMQB 1EIBA 3QIUA 3I6GA 1DE4B 4GRLA 4WJ5A 4ZTPH 4X9FA 2BK8A 2NQCA 4QOKB 4PJGA 2Z91B 5JPNA 3QDGD 3HCVA 3M1BA 1CGTA 1RZGA 1FVEB 4EXPX 2K9UA 43C9B 4H1LG 2R9HD 1CDUA 1ZT1A 3U4EB 3QXUA 4A6YL 2OZ4A 3WIFB 2VLKE 3PGCB 1TFHA 1J8KA 2VQ1A 4HKBA 1RPQA 3GIZL 3VFVB 4TRPH 3LHPH 3V5DB 4UAOC 1RK0B 4WW1B 4NNPH 4ODSL 1G7JA 3K1DA 5D2NC 1HNGA 3C9NA 2H2PC 1VACA 1CL7H 1AGEB 4HF5L 5AD0B 2FD6L 2PTVA 3O45A 5MEQB 3SDDB 4NO0A 3U9UB 1FFOA 1OVZA 3OKOA 4DAGH 1FDLH 3QG6A 2HG5A 2IAMA 4Q0XH 1X6NA 1E4KC 1F58L 4N0YL 5EZJA 3VDBA 3FN3A 3CFJB 3PHQA 4KY1H 5GRYA 5TF0A 5GGQL 4U1KA 3NABL 4JKLA 4RNRB 1QTYT 2Q8BH 5DJ0A 3TA3D 4KKBD 3QHFL 5J11C 5L88H 1FE8H 4XXCA 3HE7C 2XQBL 1WITA 2NR6D 3ECBB 3SBWC 5HHPB 1BQLH 5IW3A 2JCCA 1T3FB 2CO6B 3G5VB 4ODWA 4P48A 4JQVA 4EDWH 2EZ0D 4RMTA 5D2LA 4IIQC 4OKDA 1U91A 4ZTOH 1YYML 3CFEB 2VLKD 1WWWX 3SJVA 1NGYA 4O9HL 1NCBH 4XAKD 4Y5YC 3AY4C 5TE7H 1A21A 2CKBA 1KB5L 3S4SA 1AIFA 4L3EE 3MRKB 3OF6D 4PJ9B 3BOVA 4HXAL 3D2UA 5MENB 2VKWA 2APBA 3EYQC 3N1GC 3IDJA 1IQDB 4Z7VA 2GK0B 3PUCA 3DIFB 2NXYD 4WFFE 5EBGA 3JTSA 2F15A 1R24A 2O5YH 5IEHB 3FN9A 5T1DL 1ZA3A 2YRZA 4QHUB 4Z78B 3TO4A 1EUTA 1YN7B 2P44B 1NBZB 1A7QL 3VH8A 3G08A 2BHUA 5T33L 5F1OB 1UM5H 4I48B 4JKPH 2GT9B 3E1F1 3F65A 3O6KL 3DO3A 5DC0A 4ISVB 1G9MC 1K9TA 2A83B 1U92B 3VXSA 5KSBB 5CFHA 1V3KA 4HWBH 4PJEF 5LXGH 3MUY1 4QXGH 3RY6C 4KJPC 2G2RA 5F3BB 2HMIC 4MJ6B 5IFJB 1INDL 4YK4C 1T0PB 3CXHJ 4W4NA 4U6HB 3KPNA 3KPSD 4O4YH 4DGIL 3MPCA 3PWPE 2MFNA 4JN1L 4FG6C 1VESA 3SE9H 4YGVA 3PL6B 1JF5A 1F3DH 3UTZB 5T3XH 5JA8B 3KR3L 4JFFB 4L3ED 4NWUH 3LEXB 4CVWA 4LHQB 5L7XH 5HHNB 2A6JA 1YZZA 1JRHI 5CD5C 3O0RL 3OXSB 4D0BA 4NRZB 2BNUB 4EDXB 1NUFA 1WIPA 4WFFD 4WTZA 1KN4H 2A6DA 4H0IA 4FQJL 4MAYC 1J0JA 5DA4A 3EIFA 5EBMB 4KQ4H 2F53B 3D69B 5JTWA 5KVDH 1HQRB 2OR8A 1TZGH 1T83C 1X5HA 3ESVF 3OL2A 5CZXD 4NRXA 2IBBA 3W0WB 5L0QB 2YRPA 1TZHA 2NNAB 1FFNB 4H0HB 1NGZB 2GTZB 4LLDB 3BZEA 3O3EB 4C4KT 5AG8A 4HIJB 4JY5H 4CL7A 1BWWA 3MXWH 3E2HC 4WDIB 3A6CH 3TVMA 2A6KA 1A6AB 1UVQA 1WBXB 4KPHL 3QYCA 4PRHE 5EFIB 3QJHA 2X09A 4UT6H 3NTCL 4Z0BH 1KC5L 2VLJE 2F19L 4CN1A 3B5TA 3CPLA 5IBUB 1MCFA 1U41A 43CAA 1J5OH 5JUEH 3V5DA 2AXFA 3CK0H 3PWPD 3D0LA 4WW1A 4IOSD 3P11L 4UIKH 2BY2A 4L4VB 3MR9B 4WFEE 3QFJE 2BVQA 4JZJC 2B0SH 3UTTE 2WIIB 4WTWA 5IROA 5TF1H 4OSUL 2ZOLB 1M7DB 4GKNA 3SDDA 1MHHA 1Q9KA 1IILE 2DL9A 3VXRB 3MRJA 2P7TA 3D39B 5F9WC 3ZMRA 1AXSB 5IB1A 2DLHA 3VFGH 2XKNA 4HFUL 5JZ7C 3R8QA 4WGWB 2E7LA 1RVFH 3RRQA 1OHQA 2FZ3B 3LKNA 1MRDL 2BOCA 4YDVA 3T1WA 4X4MA 4FQ1L 3HMWL 4ZUUB 2X70B 4OV6F 1INQB 5AG9A 2HT4C 2XPGA 3S4SG 1RJYB 3TT1H 4CW1B 1FZMB 3ECBA 3HI5L 3L5HA 1HOCB 1DDHB 3OJDB 4MVBD 5EO0B 4NQVB 4UB0L 5ANMA 2OI9B 4M93C 4KRLB 4K2UH 5DI8B 5BJTA 5I73C 2NTSP 1CWVA 1FLRL 3IDXL 1WTGT 2DMCA 2FIRT 2D0HA 1WUNT 3PE9A 4Y2DB 2X1OA 1T03L 2ID5A 2DB8A 3MMEB 5IVXB 5BV7B 1C08B 4WFED 4GRMA 2XTJB 1IQDA 4M1DH 1LO2L 3ARDD 1YYLH 1A4KB 3EOTH 3ZT7A 3KJ6L 4Y19E 2JJVA 4OIIL 3WXWL 4KTYA 2AERT 4GG8B 1YEFL 2Z9TA 3O9WB 2A2QT 5BVJB 1EO8L 3GBMH 4UIMA 4G9FB 4YAQA 2MWCA 3KLAB 3MV9B 4K9EH 1A7BA 3NAAH 1F4WH 2GEEA 4H5SB 4TUOB 2VR4A 3TFKC 3QI9B 3LKRA 5BMFH 5DK0A 3QXDA 1CDYA 3Q0HA 1BVKA 3GSWB 5EU4A 2A83A 5D72L 4CMMB 3VXMB 5KSBA 4RMRA 5D96C 5GHWH 2F8VA 4AL8H 5CEYA 1ZGLB 4KTDH 2YA2A 5F3BA 3RWGB 5I1LA 3NCJH 3IFOA 4KHTH 3K8MA 1KJ3H 4NOFA 1WWCA 4K8RC 1MIML 5FKPB 3PABB 1NJ9B 3ISWA 4LAJH 1HQ4A 4H1LH 2IANB 1WEJH 1H3VA 2Q7YA 2EIBA 1EEYB 3QEQE 1U8IB 4JGJA 5HVHC 1IGCH 4UI2A 2X6MA 3P4NB 2WV3A 3O2DH 4UUJB 4NWTL 4R3SA 5HXMA 4Z95H 5DQDL 5F7DB 2XXCB 3DX8B 2Y7QA 1HE7A 3O4LB 3OXSA 4LLVB 4NRZA 2BNUA 4MS8D 4FNLL 4HS3B 1KCRH 1JZ8A 4NKDA 3TN0D 1U42A 3GHEH 5IWLA 1NMCC 3CDFA 1YY9C 1LO3H 1N5YH 4PD4K 1DBMH 2F53A 1OGAA 5GGRA 2ARJQ 5HGBA 3RWDB 4ZQKA 2FLRT 2GTWA 2Y5EA 3PHOB 3WFEL 1KJ2H 1YECL 4QHMB 1EFXD 1NFDF 1LP9F 4RBPH 3I2CL 3H9SA 4P59L 2LVEA 3CFDB 1HNFA 1EHNA 2R8SH 5DS8B 4ELMB 4HQQH 5GRVK 1NQBA 3GMLB 5T1LA 1KGCD 1P7HL 4GW5B 3MJ8B 1H3PH 1C16A 2CLZB 4N5UA 1CGXA 1TJGH 5FYKD 3V79C 3BO8A 4YDJB 2A73A 1G9MH 1QFWI 1SYVB 5DJXA 5MEOB 3TBYA 2COQA 1D7FA 1HHHA 5SWSB 3H7LA 2ITDB 3QEQD 4KRNA 5E4EC 1A9EB 1A7PL 2KZ1B 4JY6B 1XGTA 3QCVH 3X11A 2WIIA 4XXDA 3IFPB 4EI5A 1F97A 4Z18A 5MENE 2GUOA 2YD9A 2HA1A 3RPKA 4PBVC 4TOYH 5I1AB 4YNYA 3BP5A 3NFNA 1ORSA 2I5YL 2FEDD 3CVHA 5AUMB 1JPFA 5CWSB 3ZE0E 3QRFM 1MCDA 2FH6A 2FZ3A 4Q9CA 3UZVB 4PGDB 1ZANH 1GCFA 5IMKB 4KVCH 3FB7A 5IG7B 1SQ2N 4OZFA 3U0PB 1CGYA 1FNGB 3EZJB 4HWUA 3S36L 2D7OA 4LIQE 4P4KB 5FEBA 1RJYA 1X5YA 4ODVL 2XG5A 5C0RH 4MA1B 1UENA 3BKCL 3SDAB 1DDHA 3MOQA 2E7LC 3QNZA 2PCPB 4G6MH 5K9QG 4O5LL 4JREB 4TSCH 2A38A 3D9AH 4GRWF 1EJOH 4DQOL 4A2LA 3N06B 1B0RB 3E8UH 4I3SH 4U7MA 5DJ8A 1IT9L 3KYMB 1MF2H 5MERA 4WUUA 5E99L 1DN0A 4EI6B 1ZV5A 5J12B 1S7VA 1ZT4A 1BREA 1YMMD 4QWWC 5CS7A 1TLKA 4YHNB 3BZFB 4KUCD 2FYYB 1QBLH 4XP4L 4JFFE 1P7KB 3EYOB 2B1AH 1T6VN 1OAZH 2LTQC 4APQB 4UT7H 4PFEA 2PNDA 3O6FB 1T22A 2NX5D 4N0CD 3D0VA 2GHWB 3OKNA 4XP5L 5I1HH 3O8XD 2DTMH 1KB9K 4EXKA 3WSQL 3KLAA 5I76B 1IAOB 3VXQB 1G9NC 5HI5D 2J3SA 5JOPE 5E8EB 3VW3H 5CIPA 1G0XA 3FFCA 3WHE0 4K07A 2DQCL 2YEZA 2BVTA 1PDKA 4EUPH 4YHOH 2EDXA 3EOYG 2OL3A 2R2EB 1VFBA 1WBZA 3W0WE 3TBVB 3NCEB 4WV1B 3U0WL 3BE1L 4WI6A 4YDKL 5E8PB 1NJ9A 1CQYA 3WV0A 4MA8H 1UB5B 4D94A 3BVNB 4LMQI 4C56B 2AJXL 3GI9L 3LSOA 1X6LA 1ZSDA 2V9RA 3GKZA 1RURH 1A6VH 3S34H 2EDKA 3QEHB 3GMOA 2IC2A 5EU5B 3QUZB 5IEKA 1EAPB 3HPLA 2ZP0T 4Y16B 4POZC 4F33A 3MLTA 1MUJB 5DFTA 3BYTA 2Y1VA 1K8DA 4PRPB 3VXRE 4MQXC 1JZ2A 3UJJH 3BPNC 5BRZB 3RI5K 5ACZB 4M5YL 5JOPD 4LFHD 4DCQB 4XPGL 1JZ4A 5C3LD 3T0EC 4H20L 4X9BA 4Q9BA 4NKIH 1W0VB 3HMXA 3B2UC 4ELMA 4EVNB 3BWUC 3ZL4H 1KJMA 1XGUA 2LU7A 1CD9B 1T1WA 3GSNL 2GKIA 4K23L 4X6CF 1GYAA 3HE6A 3RA7L 2XN9E 3QWOA 1UEYA 2CLZA 1TJHH 3QCUH 1QBML 4ZO8A 4NZRL 4QYOB 1A1NB 2CR3A 1L9NA 4YLQT 1TQBB 3N85H 1Z5LB 2DOCA 1JRHL 5LBSL 2W59A 4OGYH 5J1AB 2PETA 1QRNB 1FFQA 4FFZH 1HDMA 1DQJA 4GS7C 4LVHC 3PDGA 2X4SB 1UWGH 4YR6B 5IVXE 2UZIL 5KTEH 2EC9U 1T5WB 3Q3GB 1P7QA 2XTJE 3MBED 3LRGA 1YJDH 4WEUD 2A0LD 3STLA 3B2VH 2HFEB 5FM4A 1RZJC 5C2BH 2YSSB 4H26A 4K94L 3WIIL 4XZUA 4G9FE 4UAOB 2CSPA 5IMKA 2BVYA 2DI8A 4Z7UE 4LK4A 5C6PB 3KLSA 1NKOA 5E6ZA 5C7XL 3ULVE 3IXAB 5D2NB 4P4KA 4S0TD 4HX1A 4J1UB 3UTSB 5CMAB 4NUGL 5TQ0L 3VXME 1AXIB 3ARTA 3LN9A 1KCLA 3RWFA 3RTQD 4NQEA 4DZ8B 2FHFA 3TBTA 1Y0LA 1SM3H 3SOBH 3DWTA 2XN9D 4Q6IA 1A5FL 4KTEL 3MROB 5B38G 5INDB 1WT5C 3NA9L 4IRZL 1UYWH 4G6AC 3F7PC 4QRRA 3KYKH 4X6DB 5GGSY 3GSOB 2BVOA 3FN0L 4JVWA 4LPUA 4XTRD 4GW1A 1UWEH 2XZQL 1AR1D 1G7LB 5EC1B 5ID1A 2DQUL 3FO2B 3IRZA 4UTAL 2FYYA 2AEIT 2HLAB 3AS1A 4G7VL 1CIDA 1CLYH 1MJ8L 3WDHA 1P7KA 2V5TA 5MI0C 4BZ1H 2HKFH 1CICA 4APQA 4DOHE 3FO1A 1RZIA 4PJAA 1XF5A 3PGDB 1RUKL 1NAMA 3O4LE 4LU5H 4Y4HA 4IIQB 1JHKH 4X80H 5JIPA 4OFKA 4NC0B 4JQXA 1RJZB 4LPWA 4QRPD 1T7XA 2X4PA 4UQ2B 5B4MD 4GBXD 3QQ4A 2DDQL 4Y5YB 5EIIB 4X6FA 1CT8A 1MOEA 3SDXA 2BERA 2DM4A 3MLZH 1UKTA 1UH4A 1KJ2B 3BUYA 1N4XL 3VXPB 2AGJL 5E24E 5H2BB 2AK1L 4MD4B 3T4YB 2Q20A 4JFDA 4OF8A 4R0LA 4X5WA 2BDNL 4DEPC 1I9IL 5IHBA 4KZDL 5E0QA 3LKSA 3D18B 12E8H 3T2PA 1IGYB 2ORBH 3MC0A 4J4PD 4U6VL 1N8ZB 5IBTH 3IDYC 1CFSB 5IB3A 4X7SL 4DVRH 4HUVA 4JM4L 3TNNB 4ZUVA 3C5ZB 5GS3A 5I16A 2J4WL 3DXAA 4S1QL 3W9EB 3VXUE 4D9QE 4Z7OF 4PP1C 1W72L 2VLRD 3OR6B 2E9IA 5I1GL 1EAPA 4X5LA 4HGWA 1FC2D 1FNLA 3VFNA 1KT2A 5JDJA 4XNZC 1JGDA 4YK4B 3RVUC 4BK4A 3S98A 5K93A 3ZT5A 3P0YH 4AM0B 2DQFA 3JWOC 3UC0L 4KK8C 2C7UA 3B6SA 3IVKB 1KLUB 5BS0D 1I85C 5DD1L 3KG5A 3C8HA 2B2XH 3BKJL 3QO0B 4YXKL 1P9MA 1DEEB 5CKAA 4OCWH 1SYSB 3EYFB 4NJ9H 1W0VA 4PJFA 4WIQA 4GJTB 4PS4H 2GJ6A 3U83A 3VD3A 3MREB 3GI8H 1OL0A 2QQLL 4LSQH 4WI3A 5KSVA 1VKXB 4CVUA 2YUZA 4MAYB 3EJYC 5CBAA 3FQNB 5SWZB 4LHUD 4KK6C 4DN3L 2VE6A 2XG4A 4TTDD 5E08L 1R3IH 3TJHD 4UQ3B 4U0QB 5EZLB 3DTXB 2QADC 2H26B 4PY7B 3BAEH 5HGAA 1J1PH 4QGYA 1IFHL 2NY4D 5FF6A 1SJHB 2N56A 3IFLL 4JHWL 3VXUD 5SX5K 3HE6C 2VDPH 4CRPA 4C83A 2XA8L 5BCAA 2AV7A 5F1KC 3ZYZA 3MGOA 4LASH 4R8WL 4LSUH 5IVZA 2V9TA 4PTUA 5FYJD 5T3XE 3F7VB 1L6XA 3HAEH 1B0WA 1A6UH 4ZXBD 2V2WB 1FSKC 1UCBH 1S7QB 5IMMA 1LEGA 4M1GL 4OLYH 4OTXH 4WU5B 4NUJA 1S7WB 1QYGH 2XQYG 4XBEH 5EOTA 4YQXH 3WO4C 1MCPL 5DJAA 4OLUH 1CU4L 4ZUWA 5INCA 2X9YA 5IESL 4JZJB 1ACYH 3OJ2C 1X44A 3RL2B 3UTSA 3BZ4B 1JPTH 2V2XB 2A77H 4ODHL 3ZTNL 1K5NA 4EUPB 1V7NL 1JZ3A 5ALCL 1Q9OA 5F9WB 1NFKA 3MRQB 2VB5A 1R3KA 1AJ7L 1MAMH 3EBAA 3QUMA 1FH5L 2RIKA 1PEWA 1I1FB 3SQOL 3SEPA 3FB5B 4PJHE 1T0NA 4LLUA 4X6DA 3WNKA 4XCYB 1XIWA 3UZQA 1RIHH 3MRLA 2HH0L 4X4XB 3DVGB 4R2GC 2QSVA 2AI0L 1D6EA 2VXSL 3SDYH 2UWEA 5EC1A 3QXAB 2VC2L 4C56E 3VWJD 1S5IH 1EXUA 4XVUD 3CVIH 3OKYA 3OKEB 5HDBE 1KV3A 3AC0A 1G6RH 4CU7A 1U8HA 4QF1B 4K3JL 1GRWA 5ESVB 4X5XB 4P2CG 5E70A 2KH2B 1FL6B 1I1YB 2XNAB 4M8QA 2R0ZL 5TE6H 4PBXA 5I73B 4U1NB 2R1XB 2YKLH 4V1DD 5E8DL 4TULL 1HI6B 5EIIA 3H9HB 3FO9B 4H25B 5HYFA 3GMPA 4W6XB 4EQ3A 4FQ2H 1CF8H 4PLKC 1MFEL 1EVUA 1FGVL 1LE5B 3QH3A 2YD2A 4OLXH 5BRZE 3WLBB 5FM5M 1HHIB 3SO5A 4JQXC 2CDGA 3HZMA 4XMPH 2P5WB 5D7LB 5TFSH 1ZHLB 4Z9KB 1RZJH 1KXQE 3MLSL 1AY1H 3DARA 2NXZC 1IGTB 4UU9B 3DVNB 1N8ZA 3QPQC 4LCCB 2P43B 5FYKL 3TYFA 1NDMA 2VDQH 2VDRL 3I9GH 2MNUA 4N1CA 1U2HA 1PZUB 3EO9H 3N1MC 3Q1SH 3BUTA 5FCUH 5JHLH 5D96B 2ENYA 1QHOA 4WW2F 1YY8A 1OAQL 4MNHB 4JFQB 5F7FA 1GGUA 2NY6C 4F7PA 5I1JL 3QPXH 1CD0A 1DZBA 3QUXC 5ISZE 3LKQB 2FBJH 4A2MA 5DLMH 1H15B 4TNVK 5C0EB 4M5ZH 4PJXA 4AM0A 3MA9L 3QWQB 4U1HA 2WWKT 1F90H 3VFMB 4XBPA 3VXOA 2QLVB 2Z31D 1YNLL 5I1KL 4BUGA 3QO1A 3M45A 2WBJC 2MHAA 3FT2B 1JHTB 5HHMB 4S1RL 2WWMD 4C4KO 5HVHB 4RWYH 2VUYA 2YC1A 2YD6A 3C5SB 4PJIF 1AQKL 4O58L 2X42A 2KBGA 2JLLA 4QT5B 1D5BB 3I50H 1FNEB 5L2KA 4L8CA 2YPLA 4Z77B 1I7UB 3P77B 2DL2A 3ME0A 5D2NE 5DEFA 4MXVE 4PY8I 4CVXB 4JPIB 3GSXA 1KOAA 1GOHA 1S7SA 2I07A 3MREA 3FT4A 1G1CA 5CJQH 1PG7L 3PGFH 4PJ8A 1NMCB 4U1MB 4XCCL 2VDNH 4MMXC 3QEGH 4I0PC 1OAYL 1P9MC 4HUKB 4EN3C 3K2MC 1FZKB 3DX9A 4FZ8H 1S9VA 1RY7B 3VCLA 5DVNA 2EKSB 1A02N 4Z5RA 4ZFZA 4KH2A 3GHBH 3MRNA 3WIHA 1VFAB 1AGCA 1MI5B 5D70L 2ZWLT 2DWEB 1N0LA 1ES0A 1MJUH 4HK0A 2YWZA 4JEGB 1KLGB 3U2SB 1JWMA 5BVPH 2V5SA 3QNYB 5C08D 1I9EA 2CDFA 2K7PA 3MV7E 4XP1H 4ZOCA 4LNVA 2DQDL 5ISZD 5IR1A 5EIQA 1KEGH 3STZA 2FX7L 2VABB 1GIGH 4I2XB 3KNBA 2I60L 2OCFD 4Y1AA 3RUGB 1K8IA 4YFEA 1W8OA 5AWNH 1WC7A 1QA9A 3K80A 3LRSA 1TVHA 2QR0B 3EOBB 2H3NA 2AJUL 5E4EB 1PBYA 2CUIA 1QVOB 2FJHB 2MPAL 1R6VA 3ARZA 1HWGB 1YUHA 2ARJB 2ESVB 5BQ7A 5JQ6L 3GMMB 1OSZA 15C8L 1JMXA 1R5VB 4EUPA 2Y23A 1MCKA 3PF2A 1BVLA 1WTLA 2IQ9L 5F1NB 4LIQL 4JFPA 3JWOH 2GSGA 3HN3A 1CDHA 4HBCH 1NPUA 4NJAL 5CJXA 4OCRL 3DVIA 2RBLA 3UJIH 1RUAH 4KUZL 2CRZA 4U0RC 4HHAA 1DEDA 1BJ1H 4P23A 2R2BA 1DQML 3E6FB 5FM8A 5CILL 4R6UA 3H42L 4GKZA 4BKLA 3UBXI 4AQOA 5ACLA 1DQQB 4YIQB 3T08A 3IRPX 3LPGA 4P2QB 3GRWA 2HJFA 4NN6B 2ZCLL 3REWA 5TPWH 4J3TA 1J8HB 1QLFA 2B20A 3MRHA 3HE7D 3T2NH 4JPVH 1I1YA 3C2AH 2H1PH 3MV7D 4HULB 4C55A 4ZFOL 4MX7A 1I8KA 3O3AA 1I3RA 1XR9A 1U8MB 1UACH 1ADQA 1F3JA 1F3DJ 5E00B 2VUOA 5GZND 2ADJB 4FRWA 1L7IH 3TBWA 1R5WA 2D3VA 3GIVB 2JELH 2V17H 5IFHL 5IM7B 1FN4A 1H3WM 4X7DC 4XCNB 1LE5A 2OR7A 4FABH 1W2KT 3NFPB 3VFWB 4K7FB 1SY6H 1HH6B 2LTQB 2BCKB 4LVOC 5D7LA 1NBQA 2MCPL 5IV2B 3QIWC 1OOAA 4G42B 5KSUB 3RX7A 1BF8A 1IKNA 1FJ1B 4HIHA 4LCCA 5DT1L 2BC4A 1G7HB 1HIMH 2VDOL 1F45A 2BFVH 3KPRD 4YE4H 5SV4A 5JW4R 4QCIA 5I1CH 2E27H 1NBVL 1VERA 2IADB 3IDNA 5D8JL 5SWZE 3ZKNC 4MAUH 3BH8A 3JV6B 2FJGB 1VEMA 5FA3B 1O0VA 4XT1C 4GG6A 1EO5A 1J88A 1INEL 1UM4H 1I9JH 4WNQA 4GQPH 1VFMA 1NGQH 2O61B 2GSIA 1D6VL 3NZHH 2ATPB 2E9WA 4MNGB 4AEEA 2FNBA 5JA9A 3B9KA 2QHRH 7FABH 4KRMB 3V4PL 4KJPD 4CJ0A 1OLLA 3WLWD 4N0UE 8FABB 2HMID 3K7UA 1N0XH 1WLHA 3HAEB 2RHEA 4E41B 2F5AH 3L3KB 1V7ML 3OB8A 5I1EH 5BOZG 4AEIL 1IC7H 4FQIL 1Q0XH 4JRYA 4YBLC 4NT6B 3RDTD 4ETQB 2YZ8A 4FG6D 2CK0L 5ITFB 1UB6B 1AGBA 1I7UA 2F5BH 4HIIA 4NP4H 2XQYK 4LDEB 4LCUB 5L9DH 5DWUH 4YZFE 4JFOB 1I8IB 4PRIB 2A1WH 5I8EB 2OMNA 3PQYB 3FQWA 3OXRA 1E4WH 2HRLA 4XWOD 4YFLI 3L7FB 4FZEH 1S9YB 3BPNB 5DFVD 1NDGA 4R96A 3H2WA 1JCKA 1DBJH 3T0EB 3MLUH 3BW9B 4GXVH 5HY9B 1Z9OA 2Y6SD 4BZ2H 5DMIH 4WO4A 4DW2L 2NY0D 1MCOH 25C8L 4WWKA 3NPSC 1G6RB 2DBLH 4JZNB 4NSKA 2G75A 3PWVB 4I2XA 3NH7H 3KJ4C 4XMLH 4D0CA 5ICZB 1C5BL 1K4DA 5F9OL 1X5IA 4XNYL 1BIIB 2QR0A 4JHAH 4ONGH 4ZPTB 5AZ2H 3WNOA 3QIUD 4GRLD 4MNQA 1Q8MA 3AMLA 4G80B 4R90L 4ZNCD 4JQIH 4RAVA 3GK8L 1CK0H 2WANA 3CSYB 3ULVL 4G43A 3GSRA 1K6QL 4AMKL 2HT3C 5F1IB 1HINH 2J8OA 4BUHA 5C0JB 2X7LB 1Q94A 1JNLL 2CJUL 4QLRA 5DHVA 2JE8A 1QFUL 3F5WB 4GQ9H 4FQXC 4L29B 3SJVE 2W9DL 5IJKC 1FAIH 3BDYL 2VXUH 1IBGH 1CVRA 4LSVL 5KSAB 2HVKB 3U4BH 3BKML 2OBGA 1IC4H 4P2QA 4MA7L 3U0TB 5CAYB 3NN8B 1BMGA 2ZCKH 4MZ3A 4G6KL 4GLRH 1GH7A 4JDVA 1ZEAL 2IAMD 1OTTD 3UPCA 4ODTL 2R4RH 3LHPL 1CDCA 4D2NA 5DYOA 5ENWB 4NNPL 4OF0A 2ADJA 2RGSA 3SGEH 5DSCB 4JGUA 2VZOA 1CL7L 2W1NA 4YHKH 3I75B 5HHME 4MXQC 1RI8A 4Q0XL 1HH6A 5MI0B 3BP6A 3K3QA 5GJSL 4NRYB 4DGVL 4HMCA 1MCWW 5DUBA 3KDMA 1XF4B 3DUSA 3MFFA 3FONB 1JBJA 4DZBA 5FFLA 5IV2A 5I8KH 4HUNB 4HZLB 3GBNH 1FJ1A 1NGXB 3W11D 3RIAF 3HNTH 3EO0A 5IB5B 2I24N 3SJVD 3OKMA 1FE8L 1MJJB 1N59A 4WCYL 3SKMB 3WFHA 3MJ6A 1RHFA 3NIDE 1BFOA 3S3JA 1JHLH 2AK4E 5B38B 1CIUA 3D2UD 5SX4H 1S7XB 1VGKA 2D7TH 1MI5E 3DETC 3HLAB 3GMRB 3I6KB 5IHUH 4OM1L 3SE3C 1IKNC 1XGYL 4DEPB 1ZA6B 3LMJH 3TV3H 4KVNH 2ED8A 2EXYD 4K3DL 4Q6YA 3EFDH 3TO4D 1W0WA 1DFBH 2ZG3A 3S6CA 3HI6H 5FYJL 5F8QC 4YXLL 3IDYB 1XCTA 3QDMB 1UZ8A 4K8RD 3LB6C 4E41A 1MQ8A 2CQVA 2WINB 2C3HA 2VWEE 5L2JB 2BX5A 5F6HJ 5JDSB 3RUGE 4X6BB 2P5EB 3X3GL 3VXSD 4KRPD 3LS5L 4F3FA 3B3IA 2VL4A 2FIKA 3B9KC 2DM2A 2NY1B 3LKPB 3TCLB 4EBQH 4F7TA 4XNMB 1GGBH 3EO1B 4XNZB 5ID0A 4D9LH 2ERJC 3GIZH 1SJEA 2BSTB 2DLEA 1E6OH 3CJJA 5LGHH 1UM5L 4LLQA 3G6JA 4PRIA 1I1AC 4JKPL 1BFTA 3GNMH 3IAPA 4ODSH 1T1YB 3ZDZE 3FB6A 4ZAKA 4F9LA 1P5UA 4E42B 3WNPA 1FGNL 4LCIL 1YY9D 3DMMA 4ZMAT 5C9JB 3BW9A 1VEOA 1MHEB 4YDIH 2AK4D 1F58H 3JXAA 3WS3A 4N0YH 1N5AB 1XH3A 3BQUC 4MA3B 5D71H 2EDDA 5GS1A 3UYOD 3B9DA 3LEYH 5FOBB 5GGQH 4ESKA 3NABH 1J8HE 3QHFH 2PYFB 2ICEB 5ICZA 4OCLC 3ARFB 3DO7B 1QLRB 5T3XL 2XQBH 4X4ME 3WDIA 5CSBA 4NWUL 2E6QA 1BIIA 1M7IA 5CGTA 3Q6GL 4JAMB 4J8RB 2MJWA 1NUGA 3CD4A 1DR9A 4PTTB 1KB9J 1CG9A 5JPMA 5HYIA 1IEBA 2N4IA 5K59E 1YYMH 3CUPB 1KN4L 5GGVL 1TVBB 3TVMD 1N64H 2XWBB 3MO1A 4O9HH 5FB8A 2X7LA 4NBZB 4F2MB 1KB5H 2M2DA 3JV4B 3F5WA 5C09B 3T0AA 3GSVA 4HJ0C 3MUJA 3DOSA 4MWFB 2J6EA 4JFYB 4QHLB 1H5BC 2XWTA 3CLFL 3OAZH 5EORL 5TDNA 5EWIL 1PFCA 5IVXF 5T1DH 3OAZK 4LSTH 4ERSL 1A7QH 1J0YA 1I3GH 5T33H 4JFXB 2CRYA 3FOMA 4M9PA 3O6KH 1I8LA 4HGKC 4AZ8A 6FABH 3E6HB 1DTUA 4Z7UF 4MNGE 1CI5A 4YFDB 3ULVF 5EO1B 4UIKL 3MYZA 1HH9B 1SEBB 2PO6C 4P5TC 4G6FB 4R2GB 3WNNA 2F74B 1P2CB 2JJTA 5D7JC 1P4LB 3TZVB 3VD4A 3LZFH 4L9DA 2Q76B 3L3IB 2EDRA 4J23A 4GAGH 2R4SL 3PXJA 1JWUB 3LD8C 3G5ZB 4AIZB 4DGIH 4JANB 1CLZL 4O00A 5FHBL 4XC1L 1E4XL 3U7WH 2AQ3A 3KR3H 2VAAA 4FS0A 1JTOA 3ARGB 3D87B 4JN2A 3O0RH 3PQYE 4GH7B 1ZT7A 1ND0A 4C54A 1G7IB 4PGZA 2R2HB 2YZ1A 3BWAA 4WHCA 3QDHA 3EDFA 3VD9A 3U7YL 4HCRA 3T0EE 3RVTD 4UDTA 3K2UH 4QHNB 1ZA6A 2NXZB 4HV8A 1KIPA 2P8PB 2OLDA 4IS6B 2ICWB 2VDKH 4JZOA 4Q9QL 3MXVH 1AKJB 3O6LL 5CZKA 5BZDB 3HZVB 1PD6A 2EYTB 3S3SA 5JDSA 1JGVH 2J8UA 4MQ7B 3LKOB 3GO1L 1X4YA 2P5EA 2X1PA 4KPHH 3RWHB 3QQNA 3L3HB 5HYSG 2EE2A 2NY6B 3NTCH 1KC5H 2F19H 3DGGA 3QISA 2PXYC 3JBG7 3QUXB 3WMSA 3G5YB 3IU3A 4CDGC 4X99A 3WBDA 1ZOXA 3H8NA 4JM2A 5BMFL 3EYUL 4HLZH 4POZD 5GPRA 1T1YA 2WBJB 3IFNH 3JZ7A 2H45A 5GS2H 4OB5L 3KAAA 4OSUH 5GHWL 1MVUB 3QZWG 4AL8L 4GSDL 3TNMA 1JK8B 4PGCB 1OGTA 2YXFA 2MKWA 2P4AB 2AJ3B 1OD7A 3WFCL 1MHEA 3NCJL 1RIUL 2ATKA 1LO4L 2Y5TA 3KXFA 1LNUA 1BIHA 3RVXD 1FO0A 4HH8A 3EJZD 3B2UD 3D25A 3QFDA 3ABZA 1WEJL 3HMWH 1WIOA 1YPZA 2R9HC 4I0PB 5CHNB 2CIKA 3DGCR 3DMMC 4EN3B 4UTBL 2V7NB 4BFBD 1UFUA 2IBZY 2OYPA 1BHGA 1IGCL 3ARFA 4K7PY 1OGAD 4YHIB 3ALWA 3WN5B 5IB4B 3HI5H 2IG2H 5D6DC 4Z95L 2YOCA 3OKKA 1KIQB 4F80A 3F6IA 1ORQA 2VR5A 3V6FA 3AAZA 4UB0H 3H9SD 5E8NB 1FG2B 4HIEA 5GS1C 1KCRL 4RMUA 2W0FA 1DBAL 3O3DA 1G7MB 3VFPB 4AG4L 3MRFA 5T1LD 3S5LG 1LO3L 1CXIA 1HHGB 1N5YL 3L7EA 4U31A 1T03H 3P4MB 1OAUL 4HUWB 1SBBA 4LVNC 3RPIA 3HC0B 3G5XB 4BQCA 5GRVL 5E8OB 1LO2H 4QHLA 5FO7A 2GITB 3KPLB 1V3JA 3BPCB 2R8SL 4OIIH 4RFNC 1YEFH 3SKJH 2ZG1A 5E5MB 5IKCB 4KKBC 4B53A 3X12B 1EO8H 4CAGA 1X5KA 4X0KA 1H3PL 1YEDB 5B39G 4EI5D 1TJGL 1RZ8A 4ODUA 1N6UA 5A16B 5F89B 1DLHB 3FKUS 2FL5B 2EZ0C 3VJ6B 3B9EA 2VISB 5DTFB 1N3NA 1JGLL 3REVB 1WQVT 3CFCH 3QCVL 2A74B 3FFCE 4PP2B 4JJ5A 3U46A 3A0OA 3ZZ1A 2DQTH 2FSEA 3HUJA 2DKMA 2YBRA 4X8JB 1UGNA 1WFOA 3DV6B 5LCVH 4RGND 3MNVB 4PRAB 2DWDA 1I7TA 2NXYC 5EOQL 3RGVA 4A6YB 4LF3B 2RFXA 4LPYA 7CGTA 1AE6L 4OZHB 2P47B 3EDEA 3DSFL 3OG4B 5CSZB 3QR2A 5HHOA 3RZCA 1P1ZB 3ARBC 3BXNA 4NWTH 5DQDH 4XBGB 2BXZA 4NHUA 1KTDB 4WUUD 3EYSL 5C0RL 4NFBA 4FNLH 5DJZB 5HDBF 4PUBL 1D9KA 1T0MA 5CP7A 1JZ7A 1J05A 5HGHA 2WWKO 3CFIC 4TSCL 1OARH 3NFSL 3P4OA 3PJSB 4LVOB 1WBYB 5DJCA 2C1PB 1CCZA 3EKCA 4IJ3B 4RISH 1I3VA 4IM8A 1ZLVH 3QIWB 4Z7NE 3WFEH 1BQUA 1YECH 4J2XA 1NUDA 4FXKB 1ACZA 1MF2L 5IK3B 1OP9A 3I2CH 4XB7A 1V05A 4P59H 1ZLVK 5AZEH 4PG9B 3HZVA 5LGJB 1OD9A 3BIBX 1AH1A 5JXEA 3FFCD 2HJKB 3NIGE 3RNQA 1TXKA 1OAZL 5C0FB 4F8QA 1QNZH 5BW7A 5E9DA 2DTML 4PP1D 1QSEA 5A2KH 4MDIA 3G5YA 4QRUB 3BESR 1U95B 3VU2A 3ZE1E 5EU3A 4Z7WB 2XRAH 4IRJA 4PJEA 1OB1B 3GJFH 1BJ8A 3QIBB 3SPVA 1A7PH 3W9DA 2H6PB 1KB5B 3RVUD 1SVCP 4S11A 2OZ4L 3BP7B 2G5BB 5C0AA 3GJFK 5C09E 2PW1B 5H37G 4U1IA 3ARYA 4YBLB 5HYJB 3EHBD 4M43L 3WJLA 4F7MB 3MRRB 4B50A 3EDKA 4FTVA 4M8VA 1JF6A 5IIEA 3LQAC 4BZYA 2X4OA 2KUTA 1L0XA 2X9XA 2DMKA 3CAFA 3VFRA 5D1QB 2WP3T 3S37X 3PWJB 3AREA 2NTFA 4U1SB 5EU7C 3DECA 4IMKA 4HEME 2LFGA 4EIZC 4HAGA 4O2FA 1VHPA 4ODVH 1RHHB 3WN5A 3S34L 4I0CC 4PGEB 5FGBC 5HGDA 2QQNL 4MXVF 3GM0A 5EPMA 4PJ5B 4U05A 3DURA 3BMVA 3UTQB 2QADD 4DQOH 3VFPA 4RCAA 3K8LA 1ONQB 5GGTA 3HE6D 3NPSB 3MZTA 5E99H 5DK2B 3P4MA 4G8GB 1RMFH 4HUWA 3RX8A 1GOGA 3UMTA 5CCKH 4NIKB 5FYLE 3FRPG 3L3OB 1AD9B 5DRWA 3GSQB 4NDMB 2GITA 5IOPB 4OV5B 2EEBA 1T4KA 2DMBA 1J0ZA 4L8DA 4DWHA 1DVFA 4BYHA 3BMWA 1DUZB 3PDOB 5D1XB 2CKBL 4XP5H 3IETA 3WSQH 3D3VA 3QDJA 1P7QD 1FBIH 4MVBC 4ZDHB 3MV8A 5B3JE 4AJ0A 4LSRL 1S7RB 4F37F 1NFIB 2IH1A 5DEGA 2DQCH 2G9HB 4U3CA 4OQTA 4Y5VA 5C0BB 1HHKA 4D9RD 1AI1L 2EDJA 2QJDA 1BFVH 5D6CA 3A6BL 4ZD3L 4K8RL 5I0ZA 3U0WH 3BE1H 1VFOA 2LU3A 3EGSB 1Y18A 1IVLA 2OQJA 5DHYA 2FR4B 4A6YA 3B2VL 4JKKA 4NQED 4M48L 4F15B 2DI9A 5IF0B 2NY3B 1ZS8B 4L4TB 1IARB 4HKJA 1LO0H 3P4LA 1MVFA 3GI9H 4BQBA 2RAMA 4TUKH 1WWBX 4N8VA 1MAKA 3H0TB 1WGOA 3U79A 4QRRD 3WFZA 2BNRB 1RJLA 1NLBL 4WEBL 3DXAE 4FFVD 5GIRB 4Q97A 5FYLD 3WUWG 2IALB 5DJZA 3FB8B 1NMAL 5I66B 3VWKA 3MOBL 2VZ3A 2JIXA 3GUTB 1DUYB 5JLZB 2PF6A 4GW4B 1CICD 4BFIA 3RZCC 3FO0H 2BY1A 3FRUA 2BSSB 5ESQA 3HG1B 2AKRA 3KYKL 4Y4HD 2EECA 2DQHL 5E56A 4XPGH 5E1AB 4H20H 1TVDA 2XTLA 1Q9LA 1UWEL 5LGJA 1KNOA 3GSNH 3QPQD 4K23H 5K9OB 1R3LB 3RA7H 1K2DA 2HKFL 2X41A 1JVKA 2YS4A 1QBMH 1L4IA 2J12B 3P9MB 2FCBA 4NZRH 1OF2B 1JHKL 3WCYA 2BY0A 3ROLA 4NQSB 2OTWB 4JFDD 4NN5C 4U2ZA 4PV8B 1U95A 5D1ZA 1FPTL 5JIKA 3TN0C 4W6YB 4G3YL 1JRHH 1TDQA 2PW2B 4YHPA 5LBSH 5KOVC 3WFBH 3X17A 5F88A 3QIBA 3L3DA 1KBGH 2EDTA 4NZUH 1GVIA 3T0BA 1LVEA 2B5IB 4M7ZC 2V7HA 3VFTA 1T1XA 2LU4A 3DXAD 4LPVA 4ALAL 5HDOA 5I8CA 3HZKB 4HKZB 3QNXA 3ZDXE 2ERJB 1JN6B 2DTSA 3P3YA 1T04B 3WIIH 5J6HB 5IBTL 1C5DA 3LN5B 1U8JB 5D1QA 2XI9A 3X14A 1I1AB 1BJ1J 2YD8A 5FUCC 5C7XH 5A1AA 3WJJC 2ZKHH 2W91A 3PV6A 1HILB 4FQHA 2WSKA 3MJ9A 4PGEA 3SGDI 5TDPB 1A7OH 3VXNB 2PTTA 1QQDA 1KJVA 4GXUM 1IM9A 4GAJH 4YZFF 2W07A 5FDWB 5T1MA 2DIJA 2GJ6D 4KTEH 3BQUB 3P0YL 3NA9H 4ZYKA 1LD9B 1T80A 1NFDA 3FN0H 1LP9A 2OP4L 1T5XA 1EHXA 3BRGC 1FL5B 3VFSB 4G8GA 4KGJA 4HAFA 3EOAA 2B2XL 2FEDC 1NCNA 3SDCA 2XZQH 4PLOB 3BD3A 1RZKL 2AEQL 2DQUH 3DJ9A 3KPOA 2XY2A 4OZHE 4UTAH 1CLOH 3GSQA 4OCWL 4G7VH 5IOPA 1MJ8H 1A2YA 5HPMB 5FA4A 2XKUA 3T77B 4J3OC 1FQ9C 5IQ9B 5FO9B 3BH9B 1KTLA 3PDOA 5KN5B 5D1XA 2YPKA 1RUKH 1ZHKB 3VG0L 4LPTA 4MJIA 2FJFA 1MFAL 1G9NL 5DZNA 1KENL 3IXTA 4Y4FB 1OT2A 5BXFA 1YEJH 2XOTA 1YEKL 3E0GA 5EBLB 1CTNA 1LQSR 3QUKA 5EO9B 3CH1A 4ONFL 2G9HA 3VMNA 2HAZA 4NO5B 3IJYA 2VOTA 3BAEL 4AENA 3RI5F 1PZ5A 1N4XH 4N8VG 4M7JL 2AGJH 3LQAH 3G04B 1JPGB 2JTDA 4YHMH 1Y6KR 4LGRB 3U36B 2ARWA 4KDVA 4LSUL 4X83A 4KZDH 5HHVL 2DBJA 2GAZB 1RZ7H 3EGSA 2IPUG 2EIDA 4U6VH 3TJEH 5I6XB 2WUCH 2FR4A 1LK2A 4U33A 4X7SH 5IFAL 5JR1L 4OLYL 4Y5VC 2R69H 1MNUL 3L9RA 4CU8A 1AGFB 4XPTH 4N0CC 4S1QH 5C0DB 2EYSA 1FVDA 1FZJA 3O8XC 3RL1B 1X5LA 1IL1B 5H35A 2P24B 4CNIB 4P2OA 4ZSOA 3MNWB 3RKPA 4Z7WE 1R5IA 4WU7A 1W72H 4OLUL 4PYGA 3GJFB 1BBDH 2PO6B 1XIWD 4P5TB 5I1GH 2YA0A 5HI5C 4CDHA 5D7JB 4W4OA 1MHCB 4RWHA 2CXGA 3QQ3A 4IHOB 5GGRY 2A77L 4RA3A 2VQUA 3RWJB 4OZGB 5LGKA 5H37H 2IGFL 4QGTA 5HYJE 5IJVB 5ERWB 4D8PB 1MAML 3FHQA 4NQCE 3UC0H 1A47A 1F6AB 4HH9B 4N9OB 2BVUA 5EH1A 3SKOB 4TVSa 5DD1H 1FCCA 1ULVA 3BKJH 4YXKH 1RIHL 4HEPG 5HYQA 3CC5A 1BOYA 1OPGL 2UY7A 3K1KC 5C0GB 1CFNA 1PX4A 4M6NL 4QHKJ 4HUXB 1IRAY 2NY2D 1S5IL 1A6ZB 3CVIL 5T1KB 3OKDA 4MD0A 5L2KE 3MJ7A 4YC2C 3DRQA 1G6RL 2QQLH 1T2XA 3VMPA 4OFIA 4FHBD 1MRFL 1WAAF 4KKCD 1WFUA 1BGXL 2C1OB 2EC9T 4Z0XB 4LCYA 4X98A 4DN3H 4JDZB 3NZ8A 1AD0B 4OAWB 4XCEA 2VZ1A 2PW2A 1UJTA 3KHOA 5B8CA 5FECA 1P4BH 5A40E 3NIDF 2R1YA 2X4NB 35C8H 4JHWH 1FIEA 3JVGA 4XCFH 4XHJD 3BSZL 3OX8A 3HC4H 3MRPB 2GFBA 4G8EB 3L95B 3O3BB 1EEUA 2VLLB 1KPRA 1AC0A 5TFSL 1RZJL 4C59B 3IKKA 4PGJA 4G8IB 4HUUA 4M1GH 2PXYB 2AJZB 2AXGB 4P5MB 5DRZA 2V5MA 4NQCD 5I30L 1IAKA 2Q6WA 5CP3A 2QEJA 1CXLA 4XH2A 4Y1AE 1CU4H 3RUGF 2C3VA 1S5HA 3BIAX 4L8SB 2FX9L 5FCUL 3MV11 1IE5A 1X9QA 4ODHH 5CJOH 3ZTNH 3UPRA 2JB6B 1V7NH 2MOVA 5TDPA 5DQ9A 3V0VB 5ALCH 1HSAB 4XX1G 1AJ7H 3OQ3B 2LAAA 4PJBB 2X10A 5L2KD 5FDWA 5A2LH 3LH2H 2FBJL 1Q1JL 1L0YA 2HP4A 3MRGB 3QDGB 1HXMA 3BGMB 3ZDZF 1QFWM 4B7IA 2Z93B 4P3WA 4PJ8D 3MBEC 5HYSB 2AI0H 3TC9A 2A0LC 3C8KB 5HVFB 1FZOB 4L4TE 1LK3H 1HHJA 4OCNC 3I50L 4X6CA 1XR8A 1NL0L 5FO8B 3QEUB 3MRCB 3T77A 2BNRE 1DLFL 4HKXA 2DM3A 1Z0NA 2I27N 5JMOC 1A6TA 1D5ZB 5L6YL 4ZNEE 1WIUA 2D7QA 2R0ZH 5DQJB 3ZHKA 3QZWB 4Y4FA 4JE4B 4TULH 4QTIL 3RTQC 1K85A 4HC1H 2HN7B 4LVNB 4NCC2 3UAJD 4XNQA 4CADA 4OI9A 4ELKA 4WI7A 4Y1AD 3HG1E 4JFEA 2HT3D 4AEHL 2NY7L 1VFUA 4RFNB 3LCYA 2KPNA 4ODXB 4FQXD 4LEOB 4XTRC 3TA3B 3H9YA 4LQ1A 1F6LL 1GOFA 2Y06H 1IM3A 3BP4B 2CLRB 1AR1C 2WLZA 1U8OB 4XP1L 3GSNB 3U48A 4F57L 3FQXB 1SEQL 3CU1A 2X05A 4QY8B 4M03A 3H3PL 4TUJA 5FYKH 2O5ZL 3ZTJG 1MLCB 1AXTL 5C1MB 4MJ5B 5H94A 2VDRH 4HJGB 1E6JL 2FH8A 3CDGA 1MFCH 1R3JB 4NGHH 3RWCA 4OZ4B 5F7WC 1X4ZA 1OAQH 2VLKB 4P23D 1IZJA 1U8PB 1T1ZB 3S5LB 1BOGA 4H8WC 5FYKU 5B4MC 1J1XH 1HXYB 4I18A 5I1JH 1GL4B 1PKQB 1DL7L 3QUYA 4GG6E 2WIMA 5C0CA 5DRNA 4X6EB 3RWJA 4B7LA 3QB7C 5IW1A 1YDPA 3MA9H 3JWOL 1MCHA 1JGEB 4HBCL 1U3HC 2NXYB 5I1KH 1F6AA 1YNLH 4HH9A 4PGBB 4S1RH 3AROA 1XGRB 2IFFH 4O58H 4BH8B 2XACC 3CFKA 3K0WA 3ARBB 3IU4L 1CD1A 3L5XL 3S36X 1QR1A 2D03H 3V6OC 4KJYB 3SHSA 1MY5A 1H0DA 3GGWA 3TCXA 3M17B 5I1DA 3S7GA 1PG7H 2QKIA 1KCKA 3HHRB 5KVGL 4FN0A 2EIZA 4JPVL 2EXWC 2H1PL 1OAYH 4LHUG 4MDJB 2EDWA 1JE6A 1X5AA 4GKSB 1CBVL 3DPBA 1BEYH 3PG2A 3HMXL 4JDZA 4Z76A 2D9CA 5E7BA 3D85A 3PNWB 3NA4A 5I1IL 2EDEA 2EYRA 4GO6B 3DETD 3OTTA 5MP6L 5D70H 3MLWL 5FGRA 3KPSB 1JYWA 2M26A 3R06A 1RQ5A 4NNYA 4TSAL 4N0FA 1JPSL 4GAYA 4P2RA 4XP9L 3IAQA 4WFHE 3P0VL 3UBXA 1QSFA 1SY6L 4O2CA 4WHTA 4G8EA 3L95A 4RRPA 5M94B 1XCQA 4L3EB 1MWAH 5I75B 4DUXA 5B8CC 4OCYL 1S78C 4AEFA 1IC1A 2X4RA 5E6IA 5C9KA 5EU6E 5LKNA 4MCYB 1I7ZB 3B9KD 3QXTA 1HIML 2NMSA 5A2FA 2A6IB 2NPLX 3DV4B 3LOWA 2E27L 5GGSB 4PJ7B 2MPAH 2ZPKL 4TTDC 5JQ6H 4WTXA 15C8H 4OD2A 1L7TL 1CDBA 1UM4L 4JRYD 4LIQH 4IRSA 1NGQL 3HZYB 4YXHL 3UDWA 1S7UB 3JTTB 1FYHB 4OCRH 5DZLA 2QHRL 1T20A 3MRGA 4Y5XC 5D7KE 4NBYB 1ZHNA 1N0XL 1DQMH 4EOWL 3O11B 4QTHB 1NC2A 3SGJA 3LPFA 5CILH 5MHSD 1I8MA 4YHZL 1EA9C 1UJ3C 4Z8FL 4ZXBC 3C8KA 3H42H 4Y8AA 2IPUK 1IC7L 3CZFB 1NLDL 1MPAH 4NQUA 1A4JA 1OLZA 4QKXB 1YMHA 4BH7B 3PWPB 1W72B 4YPGA 2ZCLH 2F5BL 1SJXA 1NBYA 4JRXA 4WFHD 5FYLL 1S9WA 4RAUB 1A7RH 4P3DA 4WO4D 2X4QB 1ETZB 2W60B 2XXMB 3AM8C 5ICYA 3AXLB 1B0GA 4TNVF 5F7YC 4JFZL 1E4WL 2NLJB 4WWKD 1VADB 1HCVA 5EU6D 1KXTB 4FZEL 2C3WA 5KAQG 2IPKA 4ORGB 3OR7A 4LAQH 4S10A 3MLUL 4KKLC 4X9HA 1LO5B 1IEAB 5K9KA 1ZVSB 4BZ2L 4LCWA 5KBNC 5DMIL 3TA3A 4HJ0D 2FGZA 3ZKXC 1ZHBB 3HS0A 2VL5B 1QSZA 3BP4A 2MCPH 2VZTA 1MCOL 4MNQD 1U8OA 4OZIB 4JHZA 5CINH 4FMFA 5C07A 2VDOH 5JHDE 3ZKMD 1CGWA 3I85A 4ONHB 1NBVH 2OXHA 3P73B 3TIDA 1OM3L 4OZ4A 4JHAL 1XF3B 2VLKA 1K4CB 1T1ZA 1INEH 2D31B 4R9HA 4ZO6A 4JQIL 5FGCE 4HWEL 3X13B 4XNUL 1D5XB 4NC2B 5GRXG 1G6VK 1P4IL 4EZMA 4UV7H 5FUOH 5D5ME 4GQ9L 2XA3A 4ZUSA 4YEFA 5DMGD 4HS8L 4GMTH 2JF1A 5SWQB 1N6QH 2FWOB 3SKNB 1IBGL 4AEIH 4FQIH 1I75A 3WS6A 2ZOKA 4PRNB 1P5VA 1PSKH 2CK0H 4IOIB 4JO3H 3U4BL 1MHPH 5I15H 1IC4L 3RGHA 2ZCKL 3K46A 3T04D 3TPKA 2FO4B 3UBXG 1E0OB 1JNHB 5KG9B 1KIRB 4PJBE 1LDPH 3SN6N 3IJSA 5JHDD 4LLMB 3QDGE 1JZ6A 4U6YA 4Y88A 2H32A 4BSVB 5I18L 2VSDA 3CCHB 2Z31C 1NCUA 4U1LA 2WWMC 4N1HB 4P9HC 4O2EB 5B21A 4DW2H 4JY4B 4X7TB 5E4IA 4H0GA 4L3EA 1NC4A 2WP3O 3CDYA 5IBLC 3TPUB 3EZ8A 4Z7NF 1FLTX 1FRGL 3TF7C 1MQKL 1G7PA 3L5JA 4BSWB 5IW6B 4NN5B 3GBNL 4P5KB 3TN0B 1GZQA 4WW2A 4M61A 4XNYH 1C7SA 4H8WH 3HNSH 5TJWK 3V7MA 1X5JA 5ADOL 1JHLL 1X7QB 4O02H 4P57B 4PJDE 4R90H 5HVWA 3GK8H 5GZOD 1IGJB 3F7YB 3WNLA 3PIQB 1K6QH 3VGAC 1EFXB 2BVPB 4AMKH 3L5IA 4ZG1A 1S7UA 5F7NC 4OF3A 5LAXB 1JNLH 3BEWA 3ZE1F 3C08H 4YHLL 2OJZH 3G6AB 2W9DH 1GGCL 1DFBL 2AJVH 4PJIA 2NW3B 1A22B 2E5EA 4NYLB 4QXWA 1U8QB 4QTHA 3ZTJH 4LSVH 4CKVX 4WI5A 1HEZB 4E5XB 2YD7A 2X2YA 1CGSL 2GJZB 4ZAKD 3BKMH 4QXUL 4MA7H 4BH7A 2DQGH 4EBQL 1BQHG 1A14L 3DMMD 3MZGB 4G6KH 4NNXA 3QEQB 1ZEAH 1GGBL 5TH2A 4D9LL 4GKOA 1QOKA 4XAKE 3HKFA 1EHAA 3UO1H 3WUZA 4F7EB 3ROOA 3W2DL 4ODTH 1PKQE 1E6OL 4HZAA 4XGZB 5LGHL 4E9LA 4DN4L 1RFDL 3AXLA 3GNML 1VADA 5C2UB 2ADIA 1EHLL 4XMKL 3UROR 5IMOB 3MA7A 2MQ3A 5BZWA 1U8LB 1C8PA 1YEGH 2B4CL 3QULB 1CE6B 2B1HH 2Q86B 2WMPA 1BECA 3LQZB 1RK1B 1LO5A 1VSCA 4YDIL 5GJSH 1TZIB 4XPAH 3ESUF 3HR5A 4DGVH 3IDGA 1PQZA 4KMTH 3C6SA 1KEMH 5D71L 2X4UA 3U6RB 4HFWA 3DI2B 4I1NB 3LEYL 5F9JA 3DROB 4L9LA 5GISH 3SE8H 2D4FA 1BX2A 4X7EC 2FECI 4PV9A 4ONHA 4WCYH 3P73A 4TVPH 2OXGA 2H9GA 4PRHA 4FFYH 1XZ0B 1K3ZA 3F6LA 3N9GL 1GC1L 2VLJA 1ZWIA 3QRGH 1M71A 5GZNC 3KPSE 4OM1H 1M6OA 1XGYH 1MFDH 2GY7B 5DD6A 2VN4A 1YMMB 2ZUQC 1RUPL 2Z92A 4K3DH 1N64L 5B3JF 3ARDA 3QFJA 1ZLUH 2VR9A 5FYJH 4YXLH 3WHXA 3UTTA 5DVOA 2D0FA 1XGQA 3IKCB 4UINH 1MWAB 1AGDA 5KW9L 4Y4KA 2X4TB 1Q9WB 2I9LA 1IGML 2NX5B 1EX0A 4RIRA 5EBWA 1ZLUK 4NKMA 4UDUB 3O8XB 3X3GH 2HFGL 3LS5H 3VGEA 2JJSA 3FQUA 5FYJU 2XV6B 4IOIA 4IMLA 1P6AB 3X3FH 4PJ7E 4LSTL 3ILPB 1MLBA 3LN4A 4U6XA 1I3GL 2XZAL 3V0WL 3ARBD 1HYSD 4D3CL 3A6OA 3VE0B 4N9GB 2X1XR 4NOBA 1AO7A 4RDQG 3C60A 2CIIB 4KK5D 5EZIH 1EEZB 6FABL 1IAIM 1OW0C 3WKNA 3C6LA 2FEEI 3BEVA 1FGNH 4LCIH 5L8JB 5E94A 1FCGA 4FP8H 3WLWC 2D4DA 1T2JA 3HRPA 1N26A 5JMRA 5FKAA 3VDCA 3DBXB 4LBEB 3OPZL 2VMFA 5EU7E 3LZFL 3HPJB 3LV3B 5EZOL 4HUMB 4GAGL 1Z2KA 1U93A 3MLPA 4YC2B 2YXMA 4LSSL 4X7TA 4XPBH 4GFTB 1DANU 3RDTC 3S96B 3WIHL 3KXFE 3W39B 4LLWB 2ZSWA 1M05B 5T3ZD 4RFEA 5I2IB 2UUDH 3ULSA 4XPFL 2BXYA 3KYNA 4FXGB 1F00I 4ZFOB 3U7WL 3SCMA 3ARQA 3KYOA 5KANI 5ILTL 3E3QC 4Y19A 2J88H 1W0YT 4TYUA 1WF5A 2UUDK 4XVJL 4P46A 2A9ML 3Q6GH 3BN9D 3KWWA 1F42A 4HWZB 1GZPB 4FQLL 1MSPA 4XWOC 2R1WA 5DJDA 3TGXA 3O3UN 1R3HB 5DFVC 1WZMA 4J6RH 5GGVH 4AY0A 4JO2H 3K2UL 3N1FC 4NO2A 4Q2ZB 5LAXA 1QEWB 1WZ1L 5I17B 1IC5L 5TE4H 3GB7A 4ONOA 5TGBA 2Y6SC 4W81A 2V2TB 3CDCA 2ZJSL 2VDKL 3MXVL 2NY0C 4ZUTB 3GMQA 3VFOB 5DGQA 4OZIE 3CLFH 4JM2D 4NPYB 1DE4A 5EORH 5EWIH 1ITCA 4QOKA 2Z91A 1JGVL 2DJSA 1JYVA 4DVBB 1FVEA 4ERSH 2VIRB 4KFZC 3BHBB 43C9A 3D1MC 5IGXL 3U4EA 5DJYB 5DZOA 3WIFA 3PGCA 1GGIL 5A2JH 3DHMA 2UYLB 5DUMH 3VFVA 3QIUC 1AQDB 4GRLC 3V5HB 3KXFD 4M1CC 1RK0A 1P84J 2AQ2A 4M62H 4P3CH 3GRWL 3MBEB 1YN6B 3IFNL 1AGEA 2EDLA 5AD0A 4G8FB 5MEQA 4P9HH 1WFNA 3U9UA 4MQTB 5CBEB 1CE6A 1WICA 1JYNA 1TTGA 2R4SH 5GRWA 4F7CB 1RK1A 4G7YH 1ADQL 1C5CL 3HUJE 1CLZH 1CVSC 1WFTA 5FHBH 1PG7X 2L7JA 3CFJA 4XC1H 1E4XH 4RNRA 2CUHA 3RTQB 4OZHF 1QZ1A 2IAMC 1OTTC 3O4OC 4UZGA 2LAGB 2XN9B 1TNNA 1TJIL 2IG2L 5HHPA 1T3FA 1MCWM 3G5VA 4YH6A 1YNTB 1OTSC 4DK3A 3F7RA 3DRTB 4MB5A 3U7YH 3ULUC 2HT2C 4L9LC 1UXWB 2PN5A 3V0AC 3CFEA 1MCIA 3IDIB 3RY5A 1G7QB 3T65B 3VH8G 4XXCC 3KPTA 4KJQD 4Q9QH 4QRTB 3NGBC 3MNZB 4I77L 5CEZE 1YEIL 5E2WL 1QPPA 3O6LH 3MRKA 1SMOA 4PJ9A 1ODAA 1JWSB 3FCTB 4OGXH 3CMOH 5MENA 5IB2B 3L1OL 1BQSA 1JTPA 2LQRA 3AUVA 3GO1H 4JQVC 2GK0A 3L3JB 4JPWL 4CJ1A 3RIFF 3DIFA 3B83A 4QRPB 2FX8L 1G84A 3RHWK 3W11C 3T8XB 1CTOA 4GBXB 3SKJL 5IEHA 4AT6B 2C26A 4QHUA 1JIBA 3ORJA 5E7FA 3WEXB 3V5KB 4Z78A 1NGWB 1YN7A 3O6ML 1NBZA 5MEPB 5EUKB 4Z7UB 1J87A 4TTGA 4I48A 2I26N 2GT9A 3EYUH 1IKFL 1QSEE 5FAAA 4ISVA 2G60L 4HMEA 1AFVH 1U92A 3RGVD 5CUSH 4Z7WF 1WCBB 4OB5H 1I4FB 4GSDH 2EXYC 5F72S 3TO4C 1KGCE 3CFCL 4X9IA 1F4HA 4MJ6A 3DBXA 5HHOD 3WFCH 4CGTA 3RZCD 5IFJA 3GZKA 1RIUH 5FUCE 5FYKE 1LO4H 2ADFL 5EUOE 2DQTL 5DMKB 4U6HA 5LCVL 3H6JA 3OGCB 1EVTC 4PLNC 4J3XA 4WTZG 1D9KD 5CKGA 4KRPC 4P99A 2Q8AH 2VLRB 1RAMA 1E28B 4OBRA 4UTBH 3PL6A 1AC6A 3UTZA 3GFUA 4JFFA 4YHYC 1PYWB 5CEZD 5AYQA 2X89A 3F7QA 3LEXA 2IMMA 5HHNA 4DOHB 4K3HA 4EDXA 2B7DT 2EDBA 4KROC 5BS0B 1DBAH 1EGJH 1E27B 2ENSA 4AG4H 1URLA 5C0IB 1OARL 4G6JL 5EBMA 2VN7A 3UXFA 4DFHA 4RISL 3D69A 1OAUH 1HQRA 1FYTE 4ZPVB 5E9DD 1QSED 1S3KL 3KGRA 4K7PH 4ZUTA 5J6GB 3W0WA 4RZCB 5AYUH 2NNAA 5AZEL 1FFNA 1VPOL 4QXTB 5GS0D 1NGZA 2GTZA 4IRJD 4LLDA 3O3EA 4W70A 2I9TB 4HIJA 3CXDH 4LMQE 3DX7B 5KVFH 1NEZB 4OIAA 4WDIA 4LHUB 3V52H 2H8PB 1A6AA 4F8TA 1WBXA 5EFIA 1D5IL 5C0AD 2ZNWA 3RVVD 1OAXL 1LEIB 4GMSH 1QNZL 2VWEC 2EDHA 2NY4B 3VXUB 4FTVD 2IPTL 1JNJA 2XRAL 1F11B 4HPYH 4Y5XB 1YMME 3VRIB 4L4VA 3MR9A 5FDYA 3TVMC 3V2AR 1JGLH 2CLVB 2OTUB 1UJ3B 3ARED 4ZXBB 3RNKB 2ZOLA 1M7DA 1V3LA 3ILQD 2NX5E 3AMKA 4P9ML 3VXRA 1CR9L 5J9PB 3D39A 1AHWB 1AXSA 2ED9A 4HW6A 4S1SH 4OGAD 4R4FL 2AABH 4FQQB 1YEEH 2R29L 2WQRA 5EOQH 1UA6L 1AE6H 3MYJB 2MTPA 3DSFH 5IROC 3MLXH 4ZFGL 1FYTD 2I25N 3SDDC 4ZUUA 2EICA 2X70A 1F2XK 1INQA 1G0DA 4PRDB 3O81A 4YDLC 3EYSH 1HSBB 4CW1A 2PTUA 5IMLB 1FZMA 5F3HB 3VXTB 4AIXA 4PUBH 1HOCA 2C3GA 1KPUB 4PJCB 3OJDA 3IS0X 2DAVA 5EO0A 1J0IA 4NQVA 3TIEB 1Z0MA 5D7IE 2XZZA 3NFSH 1DVFD 2SEBB 5DD3H 5CEXB 2BHZA 3ZKXB 5DI8A 3I02B 3I3EA 1B4RA 2CMRL 2MQCA 3RX5A 3VWJB 3TM6A 3T4AB 4PLJD 3D3VD 3IF1B 4Y2DA 5IHZB 1RMFL 3QDJD 3MMEA 3KPPB 5IVXA 2JKXA 1JNNH 5CCKL 1LEKB 1A1OB 1C08A 3MV8D 32C2B 4CMHB 1T7WA 5TDOB 5ITBL 1A4KA 1RZKC 2HFFB 1NCAH 4V1DB 2XFXB 4GG8A 3R4DA 4GBXA 1ROWA 3O9WA 5BVJA 3NCBB 2WQ8A 4G9FA 3MV9A 2RQ8A 3NACL 2F54E 4LNRB 4JCLA 3BN3B 4GLRI 4H5SA 4TUOA 1BLNB 3QI9A 1FBIL 1MCNA 2N1KA 4I4WB 4RGMC 3GSWA 3RVTC 3FAWA 2YD1A 3LQMA 4CMMA 3VXMA 3U4AA 2OZ4H 1U2CA 1ZGLA 1UM6L 4B5EA 2FHBA 4M00A 4M43H 4RFOL 4J4PA 3BISA 3KPQB 5ECJE 3RWGA 1BFVL 3RWIB 4IEFB 3C8DA 1YC7A 4NQDB 4PJHB 3CX5K 5FKPA 3PABA 3PP3H 4R7NB 2Z8WC 2G5RA 2V9QA 3JV5A 1KUMA 3ARSA 3VWKD 2IANA 1J9CT 3PP3K 1UXSB 1KF9B 1EEYA 3VRJB 2RJMA 2JIXD 1LO0L 1U8IA 3DNKA 5FV1L 1S7TB 2ZUSA 4TUKL 3P4NA 3PV7A 2R23B 5DJ6B 1XGPB 4UUJA 4N8PA 2XWJB 1T21B 5F7DA 1DSFL 2QQNH 3DX8A 4LLVA 3O4LA 3V8CA 3WHE1 2DYPD 2BVEA 3P2TA 1QACA 2Z31B 4HS3A 3D6GA 3AGVA 5EA0L 5SX4I 5KS9B 3MTRA 2QQKL 4FA8A 3AVEA 2HVJB 2F54D 4FFWC 2FEEL 1DP0A 3FO0L 3RWDA 5J4MA 1FG9C 4S2SB 4ZPVA 1F8TL 3PHOA 4QHMA 1LP9E 3RVXC 3IJHB 5DD0H 3BDXA 5D1ZD 3EJZC 5IWLC 4QXTA 5J1SC 4J3SA 2BNQE 3CFDA 2NYYD 2I9TA 5DS8A 4HIXH 1BD2E 4HG4K 2DQIL 1NCTA 3GMLA 2CKBH 4XX1E 3GMNB 4KDTA 3LS4L 4GW5A 3MJ8A 1U58B 4HJJL 3O2VL 1P53A 3FTGB 2J6EL 4LLYB 4YDJA 4WHYG 1SYVA 4MJIE 4CN6A 1LE9B 4LSRH 5MEOA 4JG1H 1CFTB 1KLFA 3NCYS 5C08B 4L8BB 3WFBL 5SWSA 2ITDA 2EE6A 1A9EA 1KBGL 4NZUL 1H3UA 4JY6A 1AI1H 4OZFG 5ISZB 5DDHB 3IFPA 4XVTL 3A6BH 4XPHL 4ZD3H 4K8RH 3RNKA 4OUOA 5J9PA 5I1AA 2FLBT 5E1HB 4QRPE 4M3JA 1TNMA 5JO5B 5AUMA 1OT1A 4M48H 3DI3B 5CWSA 3WD5L 1IM9D 4PGDA 3MYJA 3WDJA 4RQQB 3RY4A 3FT3B 5IG7A 3U0PA 4EI5C 1WZLA 3D48R 1FNGA 1NLBH 4WEBH 4YX2L 3G9VA 2ZKHL 4GUPB 5F9DC 2NW2B 4OJFL 5ALBH 2YMXH 3SDAA 4PPTA 2BNQD 4HWBA 1NMAH 4F9PA 3SDCD 1A7OL 2PCPA 1BD2D 1QR4A 3MOBH 3ELAT 4GAJL 4PR5B 3FHAA 3V6OE 4P49A 4OZGF 4GXUN 4KZEH 3HFMH 4LKXB 1B0RA 3GBLA 3VWJA 1QBAA 2DQHH 3V6ZB 4BQ9A 4MJID 3KYMA 1A1MB 2Z35B 3F58L 4H1LB 1B90A 4RGNC 4EI6A 4NBXB 1BQHB 4BQ8A 5J11B 5KVEL 2VLRE 4HCRL 5A2IH 3TYGH 3HE7B 2P8LB 3OHXB 4YHNA 3MV7B 3KYAA 2YK1L 3BZFA 2OI9C 3IDMB 1CLOL 1JUFB 5LG1A 3EYOA 2Y36L 2BSRB 3VA6A 1XF1A 4E0RB 5D4QA 2FGWL 4ZO9A 3O6FA 1CDIA 5EN2B 1BZ9B 1JZ5A 1EDQA 5I76A 1QFPA 1IAOA 5BS0E 4XRCB 4LEXL 3VXQA 1FPTH 3O41B 5GSRB 5D9SB 4G3YH 5BV7C 3T3ME 5E8EA 1YEJL 1JI1A 3EDJA 3FOLB 4ALAH 3TO2B 3MLRL 3WE6B 5KZCD 1U3HD 3Q5TA 4D0DB 2R2EA 3CFBB 3P0GB 4I5BB 4P2OD 3TBVA 3LQAL 4WV1A 3FQTB 2ADGB 4YHML 3KPRB 1D5MB 5E8PA 3LIZL 1RZ7L 4PG2A 3SY0B 4TVPE 3MRBB 5GGUB 5D5MF 3TJEL 2Y9RT 2J5LC 2WUCL 1UB5A 5ELIA 3P9LB 3OMZA 5KVMC 3BVNA 4Y7MA 1UXSA 5JW3L 2R69L 1DQDL 2GJJA 2ZSVB 4C56A 4XPTL 1VEPA 2CDEB 3ZHLA 4TPRL 3QEHA 3W5MA 1QD0A 1BBDL 2EXWD 2EEAA 5EU5A 3QUZA 3T2OA 4YO0B 1FO0L 4MSWB 4Y16A 5FYJE 5J13C 3OBAA 4LQFL 3WXVL 3MUGB 1MUJA 2HKHH 3PWLB 1OP3H 4N5ED 4PRPA 5ICXB 2EDFA 5FIEA 3RDTB 2FBOJ 4MLSA 3EHBC 4PJBF 2OP4H 1T89A 1OP3K 3H7BB 1XT5A 3T1FB 4FQCH 5BRZA 4DUVA 4OKVB 5ACZA 5JORB 1H3XA 3BT2L 1RZKH 2AEQH 1GPOL 5CSGA 3MOAL 4DCQA 3VFUB 1XF2B 1F13A 3BGAA 4MJ4A 3GSUB 1S78D 2H2SD 4EVNA 3TWCL 4KC3B 4OUUB 3QT2A 4X6CE 1P6FA 3P40A 4K3EL 3VG0H 2PYEE 4LOUD 1MFAH 3OG6B 1G9NH 4PJCE 1S9XB 1KENH 2AP2A 5E5RB 4R4BB 3C87A 3GKWL 4QYOA 1A1NA 4TVPD 4AH2B 1YEKH 1Z5LA 2EO9A 2AJSH 2E8YA 3L6FB 2W65B 5SX5H 5F44A 2HFTA 4ONFH 4KI1A 5J1AA 2NY0B 4QNPF 1P4BL 3J8F7 1QRNA 2CUMA 35C8L 4M7JH 4PJDF 1EEQA 5AAMA 4XCFL 4UNVA 5JNYB 2X4SA 4KHXH 4YR6A 3E2HB 2DQEH 2P8MB 3HC4L 1T5WA 4N0UB 1O5DT 3Q3GA 1FL3B 5HHVH 4UOW0 3WL9B 2ITCB 3HNVH 3L5WB 4V1DE 5JIIA 5IFAH 2HFEA 3QCTL 5JR1H 1MNUH 2YSSA 3QIUB 3I6GB 4GRLB 4WJ5B 1VB9A 2EIEA 4PJGB 2CPCA 3BRFA 5GXBB 5JPNB 1SVZA 4OCXH 3HCVB 3M1BB 3IXAA 1RZGB 5D2NA 4YWGH 2WZPD 3CLEL 4KK9D 5FOJA 4GUPA 4J1UA 1QLEH 5CMAA 4W6WB 3RP1A 3THMH 4ZOEA 1LDSA 5CJOL 1MY7A 4HKBB 1V3MA 2IGFH 1QFWL 4DZ8A 5BO1H 2C4FU 1TITA 4PR5A 3RIAK 1E4KA 1OSPH 1U8NB 2PYED 3LH2L 1I7RB 3MROA 5INDA 1IGIL 2RCSL 4NQDE 1G7JB 1VENA 4OI8A 4KKLD 4P4KC 3GSOA 3C9NB 1VACB 4HS6B 4JJHA 1A1MA 3RBSA 4MA1C 4H1LA 1OPGH 3SDAC 4NO0B 1ZTXH 1FFOB 3OKOB 4M6NH 3QG6B 2HG5B 2IAMB 1G7LA 1LK3L 2P8LA 3O4OB 3OHXA 5DD5H 3FO2A 2HLAA 2FHCA 3SBWA 1IGFL 4Q6IC 3O2DA 5EZJB 1JI2A 5CEZL 2L0DA 4JFED 3EUUA 1MRFH 4M93B 3PHQB 1BGXH 3PGDA 4FFVC 4IIQA 4U1KB 3OZ9H 1RJZA 5DJ0B 5KS9E 3O41A 4UQ2A 2B8OT 3MRMB 1T7YA 4Y5YA 3AY4A 2H41A 3NGBB 1DBBL 4HC1L 4U6TA 2JCCB 1UH3A 1CICC 3BSZH 4ODWB 4MLIA 4APQC 1KJ2A 1EPFA 4Y4HC 5D2LB 1NCWL 3JV0A 4Q9RH 1U91B 3VXPA 5GS0L 5H2BA 4MD4A 3T4YA 2OS7A 3GJEB 1BBJB 1CQKA 4P2RE 1NGYB 3SJVB 2Y06L 4BQ6A 3MJGX 2CKBB 3S4SB 3D18A 1AIFB 1IAII 1IGYA 3QUYD 1RUMH 3AS2A 5I30H 3D2UB 1CFSA 2Y25A 1HK6A 3P9LA 2HRPL 1OP5K 3IDJB 4NQDD 1RIVL 3TNNA 3C5ZA 1MFCL 4NGHL 3W9EA 2FX9H 4I9WE 3JTSB 5D93C 3CVHH 4WV1C 1ZA3B 4R0LC 3RY6A 5C08E 3OR6A 3TO4B 4LARH 4PJ7F 5JQHC 3VH8B 1J1XL 5GJTL 4MSWA 3G08B 4YBQD 2W0LA 3G6DH 3KVQA 4OZFH 3CNKA 3OAUL 1Q1JH 5CGYC 5ICXA 5KJRL 3VXSB 4KRPB 1KELH 3IVKA 3S35L 1KLUA 4K3GA 2P48B 2IFFL 3QUZC 3QO0A 1V5JA 4YHYB 5I8OH 1TETH 1DEEA 3D85D 1SYSA 1NL0H 2D03L 3BJ91 3EYFA 5IBLD 5CZVH 5GGTL 4X7FC 3KPNB 1DLFH 5DJ2B 4X8XA 4B41A 5L6YH 1T89C 2JB5L 4WEMB 1VKXA 4P2RD 4YGVB 3QA3B 4MAYA 1QSFD 3FQNA 3DYOA 1UC6A 4QTIH 5SWZA 5HD8D 1XAUA 1BEYL 2AK4B 3VGHA 3RKDC 4WUKH 2A6JB 1T83A 4UQ3A 4D0BB 5EZLA 2DIAA 3DTXA 2H26A 4PY7A 2YUWA 5E6ID 3STBA 3IGAB 4AEHH 1JYXA 4RSVA 1NEUA 1SJHA 2NY7H 2LVCA 4I9WD 2E7CA 3CIQA 3JUYA 1HKLL 1OY3B 2A6DB 3IYLW 5CIPH 4NN7C 4F57H 1SEQH 5K9JL 3F7VA 2VZSA 3H3PH 1MWAL 2KL6A 2V2WA 2O5ZH 1AXTH 1S7QA 4IRSD 4NRXB 1CLCA 1ZK9A 2OL3H 1E6JH 4OZIF 1TZHB 2P46B 4WU5A 2VERN 1S7WA 3BZEB 5JIHA 5C07E 1DJSA 2D0GA 4PB9L 4HBQA 3TVMB 1ZGLM 2A6KB 1UVQB 4JZJA 1NC2D 1M7XA 3RL2A 3QJHB 1MJ7H 2O5XL 3PXHA 3BZ4A 1DL7H 2V2XA 2VTFA 4ZS6D 5GSVB 5HBBA 4UBDC 4KKAD 3CPLB 3MRQA 43CAB 4K9EC 2DLFH 2AXFB 1A3QA 1U8NA 3D0LB 5I19H 1I1FA 1I7RA 1CZ8L 3S88L 3KPRE 1UWXH 3FB5A 4JRXD 2BVQB 4XCYA 3IT8D 4HS6A 4X4XA 4GKNB 4P0DA 3DVGA 1UWXK 3IU4H 3L5XH 1MHHB 1Q9KB 3MRJB 2P7TB 4YDLB 3QXAA 5IB1B 1MPAL 2XKNB 5E95B 3OKEA 3HUJF 2YHGA 5HHQB 3PHSA 4QF1A 5ESVA 3LKNB 4X5XA 3ARUA 5KVGH 4JG0L 3ZLQC 2BOCB 1FL6A 2XNAA 4YDVB 1XIWC 1ERNA 1CBVH 4LCWD 3HMXH 4U1NA 1A7RL 2R1XA 4OM0L 3U1SL 3MRMA 3K4DA 5I1IH 1HYRC 1TIUA 2XPGB 1HI6A 3H9HA 5MP6H 3FO9A 3MLWH 3MUZ1 4H25A 5E03A 3CMGA 1IQWL 4WI8A 4OFVA 4OLWH 5C07D 3KS0J 2NY5L 4PY8J 4TSAH 5ANMB 3BFOA 4LAQL 1JPSH 5L8LB 3WLBA 2B4CC 4XP9H 1QUNA 2VKXA 3P0VH 1HHIA 3E3QE 5BJTB 4OFYD 3GJEA 2P5WA 1BBJA 1ZHLA 3QSKB 4OCYH 2NY2C 1IGTA 4UU9A 3DVNA 3T0WA 5IQ7H 2VZVA 5CINL 4ORZC 2VZUA 2Z0BA 1OAKH 4GRMB 1B6UA 5HDQL 4RGMB 4KKCC 1LWRA 1RZFL 5DR5L 5F96L 4TSBH 2ZPKH 4MNHA 4JFQA 1CD8A 1L7TH 4UIMB 1GC1C 1MCBA 4YAQB 1PKOA 1FNAA 4YXHH 3IAGC 1LMKA 3LKRB 3LKQA 5DK0B 3QXDB 4XHJC 1H15A 5C0EA 1BVKB 3ETBF 2EDQA 5EU4B 3C5ZC 4UV7L 4OD3L 4JRWA 4PIRF 3VFMA 5FUOL 3MJ9L 3O2WL 4EOWH 4YHZH 3FT2A 5CEYB 1JHTA 4Z8FH 3K74B 4PJIE 5ACMA 4GMTL 1L9MA 5FHAH 5J1TC 2EKJA 3C5SA 1N6QL 2DQJL 5I1LB 1NLDH 1PSKL 3IFOB 4QT5A 5I71C 1D5BA 1FNEA 5EUOF 4PJGE 4JO3L 4Z77A 1HQ4B 1WAAA 3P77A 3WYRA 5DJ2A 5FYLH 4CVXA 4JPIA 1MHPL 4DTGH 5I15L 2Q7YB 4U1MA 4R4ND 5DVMA 3QA3A 1PVHA 3EFFB 4C58B 1EAJA 1A8JH 4JFZH 1FZKA 3FAXA 4ZFFB 2P45B 2R0LL 1NC4D 4R3SB 2AK4A 2EKSA 1LDPL 2Y7QB 3SGDH 1F5WA 1VFAA 1NAMH 1MI5A 4JR9H 3IGAA 1NAKH 2DWEA 4NKDB 4LPXA 1KLGA 3U2SA 4PJ8C 2APTA 2ZUYA 3QNYA 2F8XC 4M6AA 3W81A 1Q38A 4PREB 2PR4H 3ZHDA 1OGAB 5GGRB 5HGBB 4EUPG 4ZQKB 4XC3L 2GTWB 3RBGA 2VABA 3K4ZA 3H9SB 5JW4Q 3RUGA 3ULUE 2FDBP 1OM3H 3EOBA 2A9NL 4H8WL 4S1DC 1FNFA 3HNSL 5T1LB 2BRRL 4U3HA 1QVOA 4GS7B 2HYMA 4LVHB 2FJHA 5IP4A 2Q1EA 1C16B 4O02L 1YQVL 2JCCE 1DBKH 2GW5A 4M1CD 2ARJA 2ESVA 4LHJB 3UAJC 5GSVA 3BO8B 3GMMA 2A73B 1R5VA 2AXHA 4HWEH 3DSNA 4XNUH 5DJXB 5F1NA 2NZ9D 1P4IH 4CBPA 5D2LE 3TBYB 3C08L 1HHHB 2OJZL 1GAFH 3MGTB 4HS8H 2AJVL 1NANI 4KUCF 1XGTB 1DQTA 3X11B 2OR9L 4XXDB 3E6FA 3KLHD 3ZSTA 4EI5B 1JGUH 2GUOB 1TPXC 5T5NG 4Z7VE 1DQQA 4YIQA 1G1YA 4YNYB 3BP5B 3NFNB 1ORSB 3NOIA 3CVHB 5CJXC 1JPFB 2DQGL 4NO0D 4NC1C 5F6IC 5HHQA 4V2CB 3V4VH 3ZE0F 1J8HA 3CSPA 4P23C 1EJ6A 5DO2D 3UO1L 2CK2A 3FB7B 4OZFB 1U8MA 1OTSD 1AO7E 3MACL 5E00A 3ULUD 3H9ZA 4RGNB 2HT2D 2XKSA 3VXSE 3GIVA 4AK1A 5I18H 5IM7A 3QNZB 3WFDL 1YEGL 4XCNA 1A9BB 2B1HL 5D7IF 1RUQL 2OJEB 3NFPA 3VFWA 1KG0B 4PRHD 4K7FA 5E2VL 4XPAL 2BCKA 4WENB 2VLJD 4KMTL 3EW3B 1CDGA 1KEML 5DJ8B 2MMXA 1FRGH 5MERB 4WUUB 5CLTA 1DN0B 1MQKH 1U9KA 1L6ZA 4G42A 4JB9L 5KSUA 4H88L 5GISL 1S7VB 3SE8L 4G5ZL 1ZT4B 1G7HA 3MRDB 3QFJD 2IADA 4TVPL 3UTTD 5ADOH 4FFYL 2YWYA 3JV6A 2FJGA 5FA3A 4Y4KD 1F2QA 1T22B 3D0VB 4RX4A 3OKNB 5J3HC 3QRGL 3ZDYE 2O61A 5DVKA 2ATPA 4LCCC 4MNGA 1MFDL 2R0WL 3EAKA 3ET9F 1MH5B 4YHLH 3FFDB 1B6DA 1GGCH 5CIPB 8FABA 1A6WL 3RQ3A 5DGRA 2J5LB 3FFCB 1CE1L 2YEZB 3HAEA 4UINL 3R1GL 3L3KA 1AO7D 3C60D 2OL3B 1BAFL 1VFBB 4U7KA 1WBZB 1CGSH 3QUMH 4ZOBA 1UADC 4NT6A 4WFGE 1FFPB 3C6LD 4ETQA 1PLGH 4QXUH 4N1EA 1CYGA 4QOKE 5ITFA 1A14H 5IHLB 1UB6A 2XZCH 3C5JB 3X3FL 1OCWL 5J13B 2QSTA 4HLJA 1IAIL 4LCUA 5DURD 4NHCH 3W2DH 1YJDC 4JFOA 4KV5E 1I8IA 4DN4H 5I8EA 1RFDH 1UEMA 2Q3AA 3LSOB 2VDLL 3EFFA 3PQYA 4EEEA 1ZSDB 5EZIL 4KROD 3BZDA 1EHLH 4ZFFA 3MRIB 4XMKH 3GMOB 3L7FA 1HKFA 1S9YA 2GK2A 5IEKB 2B4CH 3HPLB 5LQBL 4FP8L 4F33B 3T0EA 3SCMD 3MLTB 1YNKL 4Y19D 2K3TA 5HY9A 4P46D 3RAJL 1K8DB 3BJLA 5CLWA 1PGRB 4HT1L 5F7EL 4F37K 4PREA 1TENA 1Z9SA 4WI4A 2APVA 4HPOL 4XPBL 5SV3A 2YUXA 1G6RA 4JZNA 4NZTH 3ZYIA 3PWVA 5IT2L 3ES6B 2KDGA 5D7SL 2J88L 1EMTH 4DKFL 2EH7L 2AS5M 2QADB 4LDLB 4RBPK 1B4JH 1KJMB 1GC1H 1XGUB 2F9BT 3N9GH 4WO4C 3CH8A 1T1WB 1YQ2A 3HE6B 4ZPTA 3QWOB 1WISA 4WWKC 4JPKL 4WFGD 4G80A 2DJ4A 4QOKD 3CSYA 4MCZB 5F93C 5ANME 1FNSH 4J6RL 1RUPH 4M6OL 3LEVH 1FORL 4JO2L 5F1IA 4LP5A 5C0JA 1T66C 4I3GA 1FSKB 5TE4L 5KW9H 3DX6B 4L29A 3MGTA 1IGMH 1HDMB 1DQJB 1RULL 1J1OL 2IF7A 1DQLH 2HFGH 3WO4B 4OF7A 5TQ2H 1P7QB 5KSAA 3CX5J 3ZKMC 2HVKA 1CXEA 2XZAH 3STLB 3V0WH 3Q2CA 4JCMA 3U0TA 4LGSB 3NN8A 3SDDD 4L3CB 4D3CH 1PJ9A 4H26B 4XZUB 2D9QB 2W0KA 5DUML 1NCCH 5DK3A 3ZO0A 1WT5A 2L4OA 5E2UH 5ENWA 1KCVL 4M62L 4HX1B 4P3CL