3NJMA

P117a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
b'APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPDAQIINRPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njmA00
3ASOB 2BZCA 1CC3A 3AZUA 1WA0X 2XXFA 1OE3A 5PAZA 2XLLA 4ENZA 3FU7B 1MG3C 4YSDA 3PLYA 2UXFA 4AKQA 1RCYA 3IEAA 3NJHA 1QHQA 4HCIA 2H3XC 1NWPA 5B1JC 2YAPA 2VN3A 1M56B 4G7QB 4K9JA 4UANA 1YLBB 2FWLB 3FYEB 4AX3A 3T6WA 3ABMB 1HAUA 1BQKA 2EIKB 4HHWA 2H47C 1J5CA 4KO7A 5TK2A 2YARA 1BAWA 3FSVA 2DWSA 3ASNB 1V54B 2AVFA 2W88A 1JZJA 1E65A 2XUWA 3JT2A 4NERA 4CSZA 1W6LA 3WI9A 3G5WA 1NINA 4GXFA 3RYMA 4YVUA 4JHUA 1BQ5A 3QJUB 1PZCA 1ASQA 2PP8A 1RZPA 1JZEA 2I7SA 3L45A 1PLCA 4HCFA 4G7RB 3NP3A 3IE9A 1JZFA 3ERXA 4Q8BA 1FFTB 4KNUA 1AZUA 3AW5A 2XV0A 2AFNA 2VMJA 3DIVA 2HX8A 3FQ1A 1XB6A 3H4HA 5I28A 1ZV2A 2IWEA 2I85A 2CUAA 3NYKA 4DPCX 1BQRA 4E9SA 2IH8A 3OD3A 2PPAA 4E9YA 2Y69B 1BXVA 2XXGA 2UXGA 2ZXWB 2AZUA 4FA7B 5E9NA 1E67A 3FU8A 5D4JA 3PPSA 1FWXA 5B1JA 2XX0A 1KYAA 3C75A 5FC9A 3IN2A 2EINB 4HHGA 2XVBA 4M4RB 2FNWA 3AG3B 4UF7C 3WG7B 1SF3A 2UXTA 4YL4A 2IWKA 1A65A 4RH4A 1GY2A 5I5JA 1JZGA 1W8EA 3D12B 1IC0A 1M57B 1AANA 4DP0X 1ILSA 1OCCB 2FQGA 1PY0A 1XB8A 2P80A 2PPFA 2BP0A 4BDVA 3NJIA 1ZIAA 2Y1AA 2EIJB 1WAEA 4A2GA 1OCRB 3FPXA 4A66A 3UAAA 1BEXA 2FJSA 2TSBA 2I7OA 4PCYA 3UGEA 2FQFA 1PF3A 1T5KA 6PAZA 4KNSA 2BWIA 5AKRA 2GC7C 9PCYA 1ET7A 3H4FA 2GIMA 3HB3B 1GY1A 2FT7A 3X1GA 2OJ1A 1ET8A 2YAEA 1HAWA 3ABGA 1PNCA 3QJTB 1OOWA 3NJNA 2BP0B 4WTQA 1SFHA 2FQEA 4BDVB 3FSWA 3U25A 1NICA 5EHFA 3TASA 4G70B 5IY5B 3T9WA 1PZAA 1JZIA 2NRDA 1AS6A 1XMEB 4DP4X 4GYBA 2A3TA 3UACA 4P5SA 3AG1B 3PCYA 2J57A 3CG8A 1IUZA 3QJSB 2R7EA 1L9PA 3S3CB 2HX7A 3EH3B 4DP2X 1HFUA 1JVLA 1AZBA 1WA1X 2XU9A 1N70A 1ZDQA 4EF3A 2ZOOA 3QJVB 4KOBA 1KGYE 2EIMB 2TSAA 3T71A 2J5WA 2CBPA 3OMIB 2JXMA 3H56A 1KCWA 4P5RA 4ZK8A 1X9UA 1KDIA 1M9WA 1ZIBA 5B7EA 3EH4B 4QLWA 1IKOP 4DP7X 3N2JA 1AG6A 1OF0A 1AOZA 4FAAB 3WKPA 1NPJA 2R7EB 4A68A 4BXSV 1UATA 4DPAX 4A67A 3T6XA 3DTUB 4HIPA 4KO6A 1GW0A 1L9TA 1TEGA 3KW7A 5D4HA 3X1NA 4AKPA 3ZIYA 1JERA 1TU2A 5AZUA 2QDVA 2DV6A 1EZLA 2HZHA 4BWWA 3WIAA 1RKRA 3ZDWA 4YSSA 1AG0A 1NIEA 3NJMA 3NJLA 4DP6X 1OCZB 2E86A 2BHFA 2BP8B 5I5MA 1L9QA 5F7BA 3TA4D 2YXWA 3TBCA 1L9SA 2Q9OA 5A7EA 5I6MA 2XYBA 2WO2B 1MZZA 1R1CA 3QJRB 2PCFA 1A4BA 1AZNA 3CVBA 4X4KA 2PP7A 4GY4A 4AZUA 4F2EA 1PNDA 1GR7A 2PLTA 3SBQA 5F7AA 3QJQB 1BYPA 2BW4A 3FYIB 2IAAC 1WA2X 4KO5A 3IN0A 4NB7A 4YSQA 2YAHA 3T6VA 1SHXA 3TU6A 4N4YB 2VW6A 1E30A 4Q89A 4BXVA 1MG2C 4MFHA 4YSUA 2ZONA 2YAMA 1OCOB 3N55A 3UADA 1TKWA 5TK4A 1NZRA 2DY2A 1L9OA 2GSMB 3FSAA 3GXUB 1J9QA 2UXVA 5ANHA 1NIDA 1PZBA 1SF5A 2VSKB 4DP5X 1KBWA 2B08A 4A2FA 4GP4B 1E5YA 3S8GB 1PCSA 3UAEA 3NT0A 2VW4A 7PCYA 1GSKA 1URIA 1NWOA 1CURA 1NIAA 1WS7A 2IH9A 1CYXA 1W6WA 1J9TA 1GS7A 2GB2A 3NSYA 1KCBA 3V9CA 3FQYA 3T6ZA 7PAZA 3NJFA 1ADWA 3FS9A 5B7MA 1MDAA 3X1EA 2AZAA 2IDFA 2GBAA 2PPCA 2YAFA 5I6LA 4AKOA 3JTBA 3GDCA 2QPEB 1OE1A 3NJKA 2VW7A 2JKWA 4W1TA 1IBYA 1SHWA 1KV7A 3OMNB 1ZPUA 4UAHA 5I26A 3AG2B 1A3ZA 2DWTA 2Q5BA 1GS8A 3PXLA 2XV3A 2PPDA 4JKNA 1EHKB 4G7SB 4YSOA 3EF4A 4HZ1A 2QDWA 1BYOA 1L9RA 2JFCA 1GYCA 1X9RA 1AAJA 4L0PB 1AS7A 3IBOA 2PP9A 4E9RA 1AACA 4F2FA 3X1FA 1JXFA 2J55A 2BW5A 1V55B 4HAKA 1OE2A 2XV2A 3WNIA 2IDSA 3OMAB 2DYSB 1AS8A 3FSZA 1ID2A 2DYRB 4YSPA 2W8CA 3V9EA 5B1BB 1ET5A 2IWFA 1KDJA 3NJGA 1ILUA 1PAZA 3PAZA 4M3HA 1ASOA 2FT8A 2IDQA 1PLBA 4GP5B 2BP8A 4E9WA 1PLAA 1J9RA 1ETJA 2PPEA 2FTAA 2H5UA 5B7FA 2HRGA 2QPDB 2PCYA 4KOCA 2WSDA 8PAZA 4E9QA 4AI7A 2YQBA 6PCYA 1SJMA 3HEIB 3EHBB 5I6NA 1TEFA 3MBWB 2XWZA 1SDDB 1KBVA 4PAZA 2RACA 3CDZA 2CALA 3CVCA 2HX9A 5I6KA 3S8FB 1JZHA 2ZWNA 1A4CA 1BXAA 2XX1A 2FT6A 3GYRA 4YSAA 4HALA 3OM3B 1WS8A 2P80D 1OV8A 2IDTA 3S3DB 3FU9A 3NJJA 1AZRA 3WKQA 5LDUA 4G72B 5B1KA 1VLXA 4YSTA 3PAUA 4YSRA 3BVDB 4F7KA 3QPKA 1J5DA 2GC4C 1FA4A 2WO3B 1SFDA 1DYZA 1IBZA 2HXAA 3CDZB 3NSFA 3ABLB 1QNIA 4KNTA 3ZX1A 1N68A 4NAJA 3FT0A 2QT6A 3TBBA 1AIZA 1B3IA 4BWTA 4A2EA 1DZ0A 3AG4B 3S3BB 3EH5B 2MRYA 2J56A 1I53A 2BZ7A 2VM3A 1AR1B 1NDTA 1A4AA 3QQXA 4G71B 1NTDA 3X2QB 4W9ZA 5B1AB 3WNJA 3NP4A 4A2DA 1JXDA 2EILB 1NIBA 2FQDA 2UX7A 4JHVA 1SNRA 2LLNA 1NIFA 3CVDA 4QKTA 2X87A 2OV0A 1QLEB 4HCGA 3SQRA 4TXVB 1JXGA 3AY2A 4WKXA 2CJ3A 2BWDA 2HRHA 4A2HA 1PMYA 4GP8B 1AZCA 3SBPA 1XB3A 1NPNA 1CUOA 5B3SB 2N0MA 3X1BA 1F56A 2MTAA 4E9VA 5PCYA 3FPYA 4DP8X 3SBRA 3FQ2A 1E5ZA 4DPBX 4DP1X 2YAQA 1ASPA 3PAVA 1JOIA 3KW8A 4BK5C 4CSPA 1JVOA 2CCWA 3OQRA 5D4IA 2GHZA 1ZDSA 2VSMB 2YAOA 3DKHA 3NSDA 4YSCA 2BO0A 2AANA 2HLEB 3ZBMA 4DP9X 1CYWA 3ABKB 3BQVA 2B3IA 3NSCA 1A8ZA 2VM4A 5I6PA 4KO9A 4N8UA 1AQ8A 3FU7A 2UX6A 4E9XA 4YVNA 2GI0A 1V10A 1GS6X 3MX0B 2IDUA 4YSEA 5I6OA 1J9SA 5AFAA 3UABA 2OCCB 5I5IA 2YXVA 4E9TA 4BWUA 1SDDA 2CAKA 3CZUB 1RZQA 1BXUA 2X88A 1MZYA
chains in the Genus database with same CATH superfamily
1G0XA 3A22A 4U6XA 3GT6A 3P30H 3RVXC 1YEWA 2N7BA 4OAWB 4PRAB 4I9XA 2BM3A 1YQVH 2FGWL 2XBTA 1WPCA 4JRYB 1CN4A 2BZDA 4KVCH 4N0CD 4PG9A 3EUDA 1DCEA 5AVSB 1RCYA 4ZMXA 1B0GB 2FB4L 5IFHL 5DZJA 3EBIA 4LKXA 5KVFE 1H8LA 3ZSSA 1T0NA 2G5UA 3GTVA 2Z91B 2YAPA 3X14A 3BIBX 1M56B 5GRUH 3N5AA 4UANA 3KMDA 5LBSH 3ULSA 3V6FA 1WJ3A 4X6EB 3GMRB 4D3CL 2BPBA 4OD2A 5KYYB 2BSEA 2EIKB 2JJWA 3EW3B 3UZVB 1AQKH 3MLXL 3SCMA 1UEYA 4FX5A 2NYYD 1MAJA 1T89C 3TH4T 2P8MA 4JFFD 1K4DA 3NQIA 2CBQA 2WLZA 5C0BB 4RNRB 1QP1A 1CJYA 3QE5A 3TBWA 3RWEA 5DA4A 2DLIA 4M56A 4P3CL 3V0JA 2OL3L 1I1RA 4M5YH 2AEQL 2JJVA 2PW1A 4NERA 3WY2A 3B2DC 3P40A 2VDNB 2NDFA 3UTTB 4N85A 3WI9A 4JJ5A 1KJMB 5CZRA 5CEZE 2J20A 2H41A 1Q0YH 4ETYA 2CUHA 1NCUA 2J5LB 2VWEE 1BQ5A 4RRPG 4NQXA 1HEJC 2B0SH 3ARBA 3FO0H 1CF1A 1WBYA 4FNLH 2NY6D 1IJNA 4MA3A 2IWGA 1TT6A 1U8QA 4WUKL 1P7HL 3IJSB 1BV8A 1QSFD 1T22B 2ZPKL 2VMJA 3M07A 5IMLA 4MQ7A 1RAMA 4TLSA 1U91B 5BMFH 3A67H 4HWBA 2G9HA 2GVYA 1HHJB 2VXTH 4TSCH 4HC1H 2OAAA 2R56H 3HE6A 3JTSB 2PPAA 3AREC 4ICWA 5FEBA 1EHXA 4LGPB 3B2VL 5L4MA 1GGBL 3P3YA 4Z9KB 1KLGA 3T8VA 4XZUB 3LJ3A 3U0PA 2DN7A 1FNSH 3EJYD 1A6WL 1MHEA 1E6OH 1UQSA 2W94A 5D1XA 4MLIA 1KFGA 3VYNA 2I07B 2J44A 2PCXA 3L3IB 3MLTA 5I5JA 4QIRA 4PJFF 3VD4A 1AMXA 4UTCA 2K7QA 1DLFL 3D25B 3T3ME 3NG5A 5F7WC 1QACA 4DVRL 1I3UA 3RTQB 4Y16C 3PGFL 1ZIAA 4MAZA 4XN1A 3GJEA 4PJEE 3UAAA 5J3HC 3RBGA 3KVQA 4I0PB 2A99A 3AADB 4ZXBA 2QQLL 4PV9A 3DVIA 4RISL 3UEQA 4FZEH 4IBUA 3M45A 4FXLA 3ZHKA 3PYCA 1CD1A 2AQTA 2GC7C 5I82A 1AMYA 2OK0H 1EAPB 4PD4J 4PJ9B 3UTSB 1R3JA 3QHZH 4UNTA 1G9EA 4PJIB 2ARJQ 1HAWA 2NY1C 3EYFA 4NC1E 1PNCA 4NN5B 1MI5A 4WHYG 5I1AA 3DUUA 3IWUA 4GO6B 3ZLQC 4AVJA 3V0GA 2XZAL 3WHE1 1RUPH 1NICA 1FZOA 4RMTA 1I75A 4AQAA 1TZ8A 2G5BA 2GBTA 5LWYH 4J39A 4Q9BA 3QXVA 3SOBL 1S3KL 3KLQA 4G9FA 4PJ5E 1HNGA 5ESQB 2R0ZH 4QRRB 1JZ6A 1SZNA 3QQ4A 4XCNB 3VQLA 4S1DD 1XD1A 4RMWA 2Y3NA 3BP5A 3H9YA 4MJ2A 1SHMA 4LVNC 2UZXA 4KJQC 4OCYL 1BLIA 1F3JB 2DYPD 3F04A 4OLZL 4Q52A 5HHXL 1OP3K 3CZNA 4G1EA 1QSZA 3DHPA 3GSNB 1QLFB 3QJVB 3BWUF 4YQXH 1A6UL 3T71A 4QHPA 3L4TA 4ECNA 5IFJB 2ZNXA 4KK8C 2A4CA 4HFUL 5B22A 2WD0A 3H7BB 5JNYA 1KT2A 2HRPL 4Z0BH 4WI8A 4IOIA 2ATKB 3DGGA 1WZ1L 4F3FA 1QUNA 2JQAA 1A2YA 3QEHB 4JFHD 2ESVD 5G4MA 5CR8A 1X9QA 2Q1EA 1HXYA 5DEGB 4K15A 4BXSV 3COOA 2N3JA 5FYJH 4YHZH 2VJXA 3MRPA 3IJEB 4WU5A 1L9TA 1J11A 5I5RA 3GLZA 1SXBA 1S7SB 2VLKB 4I18B 1XT5A 4UAOC 1NAMA 4OV5B 1A6AB 1RKRA 1DE4A 2OMXA 5D5MB 4O2FB 4JCWA 4ODSL 3GRGA 4PB0H 4PY7A 4AYID 1CT8B 4QRBA 1ZLWH 7FABL 4YDIH 5BO1L 1QBML 3BT0A 1F00I 3T8XA 4XHQA 3RWJB 4IU2A 4JY5L 5AW4B 2VDPH 1F4YL 4JKPH 2WPGA 1CIUA 5I9QB 3G5ZA 1C8QA 3CDYA 3K0WA 1B88A 3HZYA 3QJRB 2N1TE 3X12B 2PP7A 1OB1A 1S7QA 2W91A 4TSBH 5JUEH 3IFPB 1KCRL 4ABWA 4Z5RB 3WEXB 5K5YA 2QGBA 3P0YH 2IAAC 5C9JB 5LXVA 4HMDA 5IF0B 2HFEA 4LESA 4NKDA 5AAMA 5LGHL 3QUZB 1UC6A 1U21A 5FK9A 1YEKH 2Z8RA 3IFNL 5HSFA 1Q1PA 2ZONA 4R97B 2Q2LA 2OXGA 5FLUA 4N6RB 2NDGA 3N55A 4XP6L 3BZFB 1AHMA 1TTUA 2PYFA 5B3JF 1SJEA 1ZTXE 1THCA 4JFFA 3CFMA 1NLDL 2RIKA 4MJJA 4I8DA 3BD5A 2XTJB 3IWVA 4HUVB 2ZOUA 5I1CL 1NGZA 4M6ML 3FQ4A 3SPVA 3V6ZB 4NXKA 1H5BB 4YHNA 2EABA 4UIMB 3MFFB 3CFIC 2EJ1A 4PWGA 3JWDL 4XMUA 3DMMC 3W5MA 3MLSL 4IBTA 1CE1H 4QF1B 2ZF9A 1PZDA 1UUSA 1E27B 5T1LB 2GB2A 1CG9B 1GS7A 1UD6A 2BSTB 1SY6L 3QUKB 3PP4H 5B39A 4ZO8A 2XN9B 2UY6A 3HAEH 4XMLL 2QADB 3QDJE 1JZ8A 1X7QA 3L95B 1KPVA 1W2KT 3A0OA 1WWAX 4HD5A 1Z7JA 4WTZG 4Y7OC 1OSPH 3F00A 2YC1A 3IDGB 5I6LA 1QSFA 2ZTBA 3EZJB 4EAEA 4JFPA 4WGVB 2QPEB 5T3XD 4Z7WF 1RPKA 4C59B 3LRGA 4CMMB 4LL1A 3NCYP 5BS0B 1PG7W 2G60L 1XEUA 1HN1A 2W9LA 3SIKA 2E7DA 4UAHA 2XN0A 3SYAA 3PJSB 1ZK5A 4LRIA 2NQDA 3S2CA 1XIWB 1Z0NA 5C2BL 3LV3B 3PIQB 2A6JA 4P5TC 3F7VB 3PHAA 1KY7A 4K2UL 5G5DA 1A25A 1TTBA 3QI9D 2AVGA 1XSOA 2F53E 3X3GH 3I3DA 4U1IA 3VE0B 3QXAA 5DZVA 4X6FB 1GMEA 2BW5A 2WLYA 2WNWA 4P57B 4WI5A 2JB6A 4HIIA 3FQXA 4MJIE 1UVQB 5E56A 4YSPA 4A7SA 2R2BB 3BKCL 5FYJU 2IBGA 4AQEA 4AMKL 3Q8FA 4OGXL 5IIEA 5GGQH 2FZ3B 1W72B 1PJWA 3LNEA 1FZJA 1OTSC 3LQZB 1WEJH 4R3SB 4YUEH 1ETJA 5FO2A 1I9IH 2H5UA 1A1OB 1DVFC 1NBCA 3MJ9A 3SE8L 3ZT7A 1QFWH 1YEFL 2QQKH 1TQSA 4GMTH 4GXUN 4D0BA 1GZQB 4NRZB 3VSQA 1A1MB 3D07A 3SGKC 3RGVB 4CKVX 4ONGL 1KGCD 5I6XC 3WJLC 4BFRA 5DO2D 1J10A 4ATWA 1L0QA 3HBGA 1EJOL 3SPHA 4J8RB 1D5MA 3INUH 4Z3FA 1LWHA 5JXAL 3CCHA 2A6DA 3PWPE 1AKJD 1SUJA 4U6XB 4CC4C 2NY7L 3HS8A 1VF5C 1S7TB 4DGIH 2ENJA 3GRWH 1E5BA 3MZGB 4PG9B 1KIRB 4S0TD 4WY7H 5J56B 2DYPA 1COBA 1X5ZA 2X1PA 4LKXB 4PR5B 5LN8A 1OAZH 5GRXG 5LDUA 4KTYA 4GT0A 4HETA 4YSTA 3HPJA 4NCC1 4TNVK 5A6LA 4E0RA 4KMLB 3ULSB 3V6FB 1E4HA 5IGXL 4LOUD 3JVGC 4GRLA 4XVOA 1NCNA 3U1SH 4U1GC 1JV5A 3RFRA 4JL2A 4NUPA 1G84A 2FJUB 4WFGE 2H2PC 1OT2A 4K8RH 1AIZA 2NUPB 2FGWH 3ATBA 3QFDB 2ESVA 4MNGA 3RWEB 3VI4F 4BWTA 5JXEC 1CXEA 2NPLX 2PW1B 1XGUB 2C4FU 4B3VA 5FA4A 2FB4H 5IVZA 4YDLB 3L13A 4JJ5B 1CL7I 4ZX3A 1E4JA 2JJSC 5GPRA 2F18A 5JQHC 2WM0A 3GS0A 4RIRB 2F9BT 3AT0A 2MCMA 4YHYB 2H4EA 1R5IB 3H54A 4NQXB 4D3CH 3NA4A 1LP9A 3C5ZD 3RB5A 3GB7A 2X9WA 3MLXH 4LP4A 3BQUC 1MAML 4FFZA 2JCCE 4UNUA 3RUGF 2HG0A 2F19L 2CJ3A 5D1ZI 3SDCA 1E8ZA 4XCYA 3EBGA 2HRHA 3DO7A 1EERB 3FO9A 3VGFA 3G6JE 3HBPA 2JWYA 5L8KB 5IMLB 4L8SC 1UM6L 1WVZA 4HEPA 1P1ZA 4MQ7B 3TPUA 1NPNA 2N4IA 3PDOA 1NCCL 1RZKL 2G9HB 3X1BA 3RTLA 3IM1A 1LQSR 5PCYA 5LCVA 1O6SA 1TFHA 1T4KA 4WFHD 5CU5A 2YAQA 4DZBA 1AGDA 3KDMB 1WWCA 3UCRA 4BFNA 2EE3A 1KLGB 3ARQA 5D7SL 4P04A 3ARGD 4NZ8A 4KV5E 1XR8A 1ZDSA 4NZFA 1ZVYA 2JI2A 5HGAB 2AANA 2MEJB 1MHEB 3FZUD 1UQSB 3BVWA 4WUKH 4GNKB 1CYWA 2KZWA 4XWOC 4ENED 3BQVA 3MRLA 2C1OA 4GLRI 1WZMA 4XH2A 2XIIA 4L8DA 5L8JB 4YVNA 3OB8A 4DNLA 2Z35B 4IRSA 4ODHL 4JFDE 3TIEB 3HS0A 4P5KB 2Z31B 2BNRA 1KN2H 2ZKHL 1NBVL 2OCCB 1QTSA 3RA7L 1OM3L 1NQBA 3APFA 4EZLA 5I5IA 2HFTA 1ERNA 1D6VH 1LDPL 3OXSB 1ZT4B 4NUMA 2ICES 1YECH 4UQ9A 5A2CA 3HS9A 4PRIA 4L4TE 4PV9B 1HZKA 4BZ1A 4JB9L 4JPVL 2WHVA 2UZIH 1QWNA 1CD1B 3W39A 3EOBA 3PY9A 2P42B 1R3JB 3KYOA 2KMWA 3IDMB 4XNYL 3D3VD 3MRFA 3TP4A 3FU7B 5KANI 2F8OA 1MI5B 2YO3A 4B7IA 3DUUB 5I1AB 4OGAC 4R4ND 5BV7C 4M6AA 4DVRH 1DANU 2H3XC 1FZOB 4FNQA 4RGNB 3PGFH 4AQAB 3U2SA 2G5BB 3TFBA 2ITFA 2AJUL 3EYVA 3HI1A 4KRNA 4AX3A 3RIAF 3T6WA 4A7UA 5FYJE 3HB3C 1HXMA 5D1QD 1DJGA 4URKA 3PL6C 3W0WD 5IR1B 3LDBB 2O5YH 2P5WE 3BP5B 2OTPA 3GNML 4QHUB 1WIUA 1WFIA 5DEFA 2FGZA 4NPYA 3EYSL 5KW9L 4MDIA 1KENH 4FQHA 4DESA 2APTA 3DJZA 3QI9A 5C0AB 4KK9C 1IGIH 3OSKA 2AQNA 5H37H 2XZAH 1D2OA 2IFFL 1UXWA 2NCEA 5JNYB 1KT2B 1NL0H 4PLJC 4ZS7H 3W9DA 1G9MH 2FSEA 4FQLH 4J3TA 4PW3A 3V8OA 4ZX6A 4IOIB 3DGGB 2NXYB 4F3FB 1QUNB 4FFVC 4HCRL 4X6CA 4RSVA 1MJUL 1BJ8A 4OLZH 3MLVL 1U8KA 2KKQA 1CCZA 3ERXA 4KQ0A 5ACLA 4FLQA 1LJMA 4BZ2A 3CSTA 4XO5A 3AW5A 1JF1A 3EG9B 4AUYA 2NY4C 3MRPB 4WU5B 2GK0A 4HJGA 3OKMA 3OPZL 2IEPA 4QRSA 1IILE 2Y7MA 2ZCKH 4HFUH 3TT1H 2EXWD 2OMXB 1P1VA 1DE4B 2PO6A 5E24E 1BQRA 4HJUA 3CHRA 4PY7B 5ESVA 4ZUSA 1KELL 2WVUA 2UXGA 1WZ1H 4EBQH 4U1MA 3GIVA 5HHMD 4FQJL 1REIA 4ZTOH 1URLA 4IU2B 5HDBE 3UYPA 3FT2B 4JL1A 2VLLA 5HHOE 4X6DA 3KLSA 1AKJA 4Z7VF 5E5RB 1IMHC 2IWKA 1TYRA 3DO3A 3HZYB 2ZYRA 3B4NA 1IC0A 2YWZA 4JPKL 1AANA 3C87A 3F58L 3MCYA 3D85D 3U46A 1YY9D 5IVXF 2EDYA 1VJSA 3Q06A 2VB5A 3I9GL 4ODSH 4I9WD 4XTRC 4KZEL 4NKDB 2L8AA 3RBSA 1TMCB 4F8QA 3STLA 3NDZE 2XQYG 1QBMH 4F9LA 5FK9B 5BO1H 4KKLC 1TDQA 4A6YB 4PCYA 4JY5H 2OXGB 5I75C 1Q72H 1V7NL 2HJFA 1WLHA 1E9OA 4YBHA 1SJEB 3QXDA 3LQAH 2V37A 4JFFB 3TVMA 3SEPA 3H2QA 1JDAA 4U6VH 5D7LD 1N0LA 4AJ0A 4YPJA 4IRJD 3RKDC 3Q8AA 3NGBB 2GT9A 1KCRH 4NOBA 1J1OL 2FQEA 4G3YL 1I3RA 5C86A 3GMQA 3ZR6A 2FLMA 3DJ9A 4G70B 5AOKA 5LGHH 1JZIA 4FHJA 2ADIA 4KRLB 1QPXA 4MJ5B 3LVTA 2VQ1A 3IFNH 1SLWA 1HOEA 1ZKAA 4ZTEA 2CO1A 3C5ZA 5ICXA 4L1TA 2UY6B 1A7BA 4DW2H 4HEPG 3ULUD 2NY6B 2B1OA 1KB3A 4U1HA 1HFUA 1NLDH 5JW4R 2YWYA 3MNWB 5CP3H 1OW0A 3WN5C 5J9PB 3P73B 2YC1B 1R3LA 1QSFB 4B9PA 1JPSH 3VA2C 4JFPB 2D7PA 4M6MH 4FABH 2JXMA 3V7AG 5GGTL 4XWGH 1K8IA 4NX0A 4P2AA 3JWDH 3MLSH 4HGMA 3RX7A 2OXHA 1B2WL 1JGIA 4X7DC 5LBGA 2NXZC 3T0VA 4MXVE 3UPAA 1AG6A 1F97A 3NRPA 5G5DB 1P69B 4FAAB 3H9SD 3L5XL 4R7XA 4ZFFA 4A68A 3QUML 2B1HL 4A67A 4IGBC 3LKQA 1JZDC 4U1IB 4PJGF 4AZ8A 3SYPA 2YBGA 3AXLB 1HWWA 3MOBH 2FIRT 2ZXBA 1QRND 1CMOA 4DFIA 2V9QA 1VEOA 1LVEA 4JPWL 43CAB 2JB6B 1UWXH 5FOJA 2G60H 4HIIB 4NS0A 4AL8C 1LO3L 4LHUD 4HIHA 4PFEA 4AQEB 4KZDH 5A2LH 5C3IA 4RMRA 5JR1L 1X5GA 2QKSA 1P4LB 1N10A 4K2UH 3WE6A 5EIQA 5E6IC 1XF1A 1AHWB 4ODUA 1R1CA 1RUAL 4P23A 2PCFA 2E47A 5E2TL 4OLUL 2VMDA 2YRLA 1QD0A 1TU2B 3BIAX 5F7AA 4QY8A 5AW3B 2H0PA 4BHUI 1FYTD 1O7DC 5EF2A 5I23A 4U3SA 1WA2X 3QUXC 2GABA 3BKCH 1M2VB 5A7BA 4L1DA 4AMKH 1F4XH 2A6DB 1IM9A 3PGDA 4PEEA 4Y4FC 3L1GA 3V5KB 2E9BA 1AGBA 8FABA 2VDKH 4XN2A 3PWJB 4HJ1A 3ZQ9A 1VA9A 1YEFH 2XVGA 3EHBC 4H26A 2DYPB 1KTLB 1HS6A 4LCWD 1TQVA 1LNUA 2CR6A 5LDSA 3ES6B 4KGLA 3HPJB 5D2LF 3L3KB 2CHWA 2CG9X 3QP3A 3LNGA 5CCKL 3QYMA 2WXQA 4HUUA 3A6CL 4O02A 3S34L 2VW4A 5JXAH 3ZMNA 1M71A 1RFDL 2WYTA 1J8SA 1VACA 2BSBA 2NY7H 1NH6A 4MMZB 4PI0A 4OB5H 2ESVB 3ILEA 3T6ZA 3IGLA 3FW6A 1OZUA 4F80A 5IBTH 1TZHA 1E2VA 3MNZB 5EPMA 5FYKL 4BE5A 2GITA 3T0EE 5LGYA 1AQDB 3O4LA 3X1EA 4JQVA 5EIIA 2IDFA 3C5SA 1FZMB 3HZMA 1IVLA 3O11A 4AY0A 3LIZA 3MSPA 5I8CA 4A7VA 2JKWA 1N6QL 1HC1A 5IGXH 1KV7A 5EBLA 1LP9B 1TUPA 3GB7B 1FIGL 4QKXB 3EXJA 5IQ9A 2PPDA 1KV3A 2ZT9C 4BSVA 5CEZD 2BERA 3ZDYB 1G7HB 4IHOB 2AK1H 3DO7B 4Q9RL 1SYVA 2VQ4A 5E51A 3U9WA 1YQ2A 3QCVL 4XAWH 1P1ZB 2CGYA 1AS7A 3OGCA 3PDOB 4JVWA 1T66D 1AACA 1EXUA 3SE9H 5HPOA 5EEUA 1J18A 1JYXA 2EDDA 1JRHL 1SN5A 4GKNB 4JFVA 5HI5D 5LN4A 4DVBA 3D85A 1T4KB 5DXWA 5DJXA 2FBJL 4DZBB 1AGDB 4RVBA 3MBWA 1U4FA 3IDYC 1MAMH 3DURA 3KD4A 5EO0A 1XR8B 2F19H 5GS2D 4ZNEE 1BQLL 1PAZA 1QG3A 4UM9A 3QH3A 1AY1H 1PLBA 4DO4A 3CVHL 3VWJD 4ZFZB 4DO5A 2C1OB 4IKIA 4TS6A 3E8UL 4XH2B 1I85C 1XF4A 4N5UA 1UM6H 2FTAA 4N9GA 3MRNB 2VZVA 1NCCH 1RZKH 1VIWA 2WXLA 4Y2DC 3W9EA 5F72S 2IAMA 2WSPA 2WVVB 3ECWA 4IRJA 3OB0K 4NIKB 4R4FH 2FJGA 2J1YA 5L4FA 1S46A 1K4CA 3LZFL 4F7MA 3SD5A 1W80A 3DBXB 4NN6C 1CR9L 1FVCB 3DSNA 5I6KA 1SM3H 2R2EB 3OTTA 4AVKA 5C0GB 1TZIA 3W39B 1F90L 2I26N 3EOBB 3GM0A 3K5SA 4NENB 5TH2A 3CC5B 4OCLC 1L6XA 5J0BA 1IBBA 4PU2A 4F7PA 4Q14A 5KVEL 1MCQA 4BKTC 1P5UB 3RAJH 2EDXA 3WKQA 1U9KA 4ZUWA 4G72B 1BW8A 3FKUS 1NBVH 4OTXL 5AW2B 3MOAL 3RA7H 3PAUA 4OBRA 4PIBA 1U3HD 2LFGA 2JKXA 3HI1B 1HXMB 2ENSA 1I9JL 3GLEA 1N5AA 1AP2B 2B59A 2R0LL 3L2NA 1UH4A 3D7PA 4JB9H 4JPVH 5D1ZD 4RMQA 1N68A 3N1MC 4XNYH 4ELMF 4OVVA 4GBXC 3RE0A 1CFBA 4FFTA 4FQHB 2MRYA 1I53A 3QI9B 2BZ7A 4UOW1 1ETB1 1ZOXA 2Z7WA 3DOSB 3V4UL 2VXVL 4PJ5D 1BJMA 3X2QB 5B1AB 2EEDA 1AIFB 3I6KA 1NDMB 1OAKH 3W9DB 1QRNA 2FSEB 2AJUH 1JTOA 3GHPA 4X6CB 4ALAC 1CI3M 1K2DA 1MELA 3TJEH 3TTSA 3VSUA 3DJRA 2CO4A 2LLGA 3NFPA 4WW1B 3FO2A 1U8KB 3CHPA 1T21A 5JPMA 3UERA 2QTVA 4JY6A 2X1WL 3EYSH 3WLWC 4BFOA 1JF1B 2EH7H 2GK0B 2NY0D 3P54A 3WY3A 4NI3A 1JZ2A 2IFFH 2PO6B 2AAAA 4RMVA 4N68A 1E5ZA 2XFXA 4AGLA 3VGEA 4ZUSB 1O5PA 3NBNA 1NUNB 1VENA 4HCRH 4U1MB 4XRCA 4M43L 1JOIA 1R3HB 2IADA 4TF4A 1HHGB 1MJUH 4CSPA 5KSBA 2HMID 4LLVA 3VU2A 1OWWA 5I1KL 2EICA 1RZGA 2VLLB 3MLVH 5HDRA 4X6DB 5J06A 1AKJB 4XODA 1MOEA 1ZCRA 3EOAA 1HQ4A 3HMXL 4TSAH 2W38A 3C60C 2H7WA 4FCHA 2UX6A 5BRQA 1X44A 4BFKA 2EADA 3U46B 4C83A 2WBJC 3UABA 1GGCH 4G80B 1J8HA 4MAYD 4QWWD 1MNUL 3STLB 1EDYA 2LAAA 1BEYL 3Q13A 4FQJH 4JFYA 4I48A 3WKML 3QO0A 5FM5M 5DC9B 5T5NG 1E9OB 4G6AD 3BPLB 4F8TA 2BK8A 1DZBA 5SWSE 5CR1A 4BELD 1N0LB 1S7XA 1WZKA 2A9AA 4ZAKD 5T1MA 4JPKH 4GSQA 1H8NA 3CAFA 5C09E 4PG2C 2FO4A 3FU5A 4HJJL 1I3RB 1EPFA 2FH8A 4ADJA 3GMQB 3I9GH 4KZEH 2VZ3A 4G7QB 3U0WH 2VDOL 1CYGA 3HC2A 4OUOA 2K6ZA 5KUKA 4DEUA 2VQ1B 1HAUA 2J1ZA 3C5ZB 3E38A 1IBGL 1V7NH 1NFDB 1TLMA 4R7NB 2NW2B 1TEYA 2RH0A 5FUOH 4A7TA 5C92A 3ULVL 4QR7A 1T20B 3EDFA 4U1HB 3AB0B 4BK5A 5CLXA 5FDYA 1JZJA 3SYOA 2P28B 1R3LB 4NNXB 3AM8C 5IMMA 3UO8B 2ZICA 1W6LA 5DZ9A 4K5PA 3OKKB 1TQWA 3UMNA 1VFBB 4DUWA 1K6QH 4CMHB 3U4AA 4GAGL 3WUWB 2C9UA 4OQTL 3KPQB 4JHUA 5E6RB 3QDJD 4B0MB 5INCA 1IU1A 1CICC 4NQQA 1JTPA 2BVQB 3I74A 5LUMA 4I0KA 2NTSP 1RZPA 4EN3D 3F65A 4OCSL 4PGEA 1HKLH 4OGYL 1MSPA 1YPZB 1ZVHA 1UM4L 1VERA 4ZFFB 2V9TA 2YRPA 2OZ4L 4AZ8B 2QPUA 2D3NA 4PJFE 4KHTL 1RZJC 5I28A 1ZV2A 5GGTH 4J6IA 2G4GA 5A2FA 4HEME 3CZFB 3AT9A 5F2FA 3TTYA 1DUYA 4MSWB 4PJBF 4HIHB 1YEDA 2F53D 1B2WH 1PYWA 2VRKA 4XXWC 4N20A 4QAMB 3FU8A 3PPSA 5FOBB 2DH3A 4G6FD 4LNVA 3JBG7 4RESB 3SO3B 3WE6B 3IN2A 2VDML 3L5XH 4G43B 4UF7C 3VMNA 3WO4C 5JTWA 2B1HH 4A55A 4FL4B 1IGTA 3WIFB 1NEZA 1HH9A 4J2XA 5IW1A 2EDRA 3D3VB 1CDYA 4EIBA 1FFOA 4PJEA 3QIUD 4QY8B 4IK7A 4JPWH 1AD9B 1BZ7A 2BNQE 1Y18B 4H8WC 1SVZA 2NY3D 2VSCA 1LO3H 5FA3A 4YLCA 4A2GA 1KJ3H 3WJMB 4LCCA 3VD3A 3GS4A 1U3HA 3G04A 1URZA 1NCBL 1PS3A 5JR1H 2A7BA 3SKOA 1XDTT 4OF0A 4ZS6C 5D1QB 4FADA 1YVLA 3W0WB 4APQD 1ZLVK 3VFTB 1PKOA 4H26B 1KGIA 1A6TB 2FT7A 1TIUA 5DD3L 1U8HA 1Z1WA 4LEBA 5E2TH 3HBQA 5INDB 3RVUC 2DM2A 2XJKA 2ZUSA 3PV7A 3PWPD 4NGHL 4XVTL 5EWIL 3VFSA 4QXVA 5HBBA 1NSNL 3FUKA 4KX8A 5IWLA 2G75A 3U7WH 5CJQL 4YAQA 3LSOA 3EFFA 1XSKA 3TLRA 3UDWA 4LHUG 4UZGA 4MD5A 1C1EL 2VZ1A 3BMVA 5IQ7L 1VACB 1Q9WB 2I5YL 4NWTH 1IC5L 1JGLH 1CQKA 3Q9QA 4J3OC 5BRZE 4Z95H 4U31A 1XEDA 2QSCL 4NO3A 3MLPA 4OM1H 3QG7H 2VDRL 4WRLA 3DI3B 5E99L 4IU3A 4EN2A 5EPMB 5EZPA 2ETWA 3PABB 3C5SB 4UZSA 1NBQA 3O11B 3OR7A 5C2UB 2PCPB 2A9CA 1NGPL 4WFGD 4UTAL 4UQCA 1YEHH 3A6CH 4WO4C 5EBLB 3G08A 3S34H 4HW6A 4TVPE 1OAYL 4HA1A 3VW3L 1IAII 3QJZA 4JO5A 5F1OB 1IC4L 4BSVB 5HHMB 3U4BL 3KE0A 4IYKA 3T08A 1INDL 1SYVB 2J2ZA 4M5SA 3B3IA 5EU7C 1MEXL 1NPJA 5FYKH 3I85A 5BOZG 3RFZA 3MRHA 1KBPA 5F1KC 1EXUB 4PJCB 5I2IA 3T0AA 2AXHA 1SXZA 4HPYH 3S96A 1Q9OB 1UOWA 2QDVA 3BHBA 3D39A 3SGJC 4F37K 1N6QH 3D85B 2OJZL 2P7TA 3FSOA 4DTGL 4CN1A 1FIGH 3SDAD 3FNKA 1T2QL 4UI2A 1FHNA 3EZ8A 4UM9B 2VUYA 5MHSE 4Y2OA 3SYCA 4WHTA 1TCRA 4MJ6A 3ZDXB 1RZFL 3FRUA 3O2DA 5F7BA 2YN3A 4HGWB 3TBCA 1XF4B 3NK3A 2Q9OA 2VZSA 2ZUQB 3U48A 5B3JE 5K1JA 1Z0MA 1T5XA 4AMWA 2WZAA 2R1YA 4XNZB 3WBDA 3O6FD 5LQBL 4AH2B 5D7LB 1I8KA 2PTUA 4IRJB 1WP6A 3SBQA 2I25N 1YCSA 2FJGB 2CMRL 3FCTB 5ALCL 1BBJB 1OSYA 1MJ8L 2Y1YA 1K4CB 3N1QC 4IIQA 2XC8A 4F7MB 4XXCA 1P84K 3E6FA 2NW3A 4IOSD 4MKTA 3FONB 5EOCL 1MG2C 1BQLH 3AQZA 1IAOA 4LSDA 1TZIB 5F1IA 4JFOA 2J1KA 3MJGX 4JFDD 1MJ7L 5TH2B 3ZRSA 3CVHH 4BH8B 3TA3D 1HXKA 1CU4L 2UYLA 5E23A 3GI8H 4TQHA 2NMSA 4F7PB 1JMZA 5I0VA 2O5ZL 3BDBA 4IRZA 5B8CA 2FR4A 3VI3F 3ZYJA 4MZIA 5D2NB 2K6YA 1EBAA 3QEQE 1XL4A 1X4YA 3GXUB 3LKOB 4FG0A 4L4TD 4ZUWB 1HINL 1T1XA 3TZVD 3TV8A 2PR9A 5ID1A 5CP7A 4DKFL 1SF5A 2WXMA 4JG5A 1NDGA 3LZFH 3OKEA 1N5AB 1CR9H 1E5YA 4TYUA 2B59B 5DK3A 3S8GB 3QDJA 2CH8A 3H3PL 5EUKA 4KAQL 1F90H 2C7FA 4EN3A 5GS1C 4W70A 3II1A 4LPXA 2RQEA 3P9LB 2EEBA 3FS9A 5B7MA 1KMGA 3H9SB 3QXTA 2MNUA 3FN3A 1N59A 2QGDA 2ADGA 1FFRA 2FVNA 3K1DA 2J8UF 2X09A 3KDPB 1JK8B 2X4OA 2HUHA 25C8L 1BVNP 4LKCA 4TNVF 5E6YA 43C9B 2TAAA 4ERSL 2XBDA 3I6KB 3O2VL 2XIDA 1QRNB 4MA8H 2P5WD 3NJKA 1TNNA 3FTVA 1FQ9C 4B97A 1I9JH 3WS6C 3CXHJ 2Z65C 3B9KD 4HMEA 5CU9A 2R0LH 1WCBA 4LHUB 4OZGE 3RNQA 5F9WB 4O9HH 4N86A 1BVZA 4YSOA 1NEZG 1T21B 3KCWA 3MNVB 1RZ8A 2QDWA 1FLTX 4JY6B 4PV1C 3O8XC 1CK0L 2EC9T 1KXTA 3FFCA 3N43F 3IU4L 3CE1A 1RSYA 2VXVH 3LMJL 3DX0A 4L48A 4MJIA 3DHJA 2Q7AA 2EUVA 2IOIA 3CFEA 5IQ7H 2XFXB 3L1FA 1NAKL 4JKMA 2RR3A 1FYTB 2ALWA 3QRGL 1BPVA 3QFJE 4P2QA 3ORJA 1ID2A 1B4LA 5FYKU 4OF8A 2IADB 1Z6JT 5KSBB 2EE9A 4HKZA 2KLRA 4Z3GA 3ULVC 5LBSA 3X17A 4RQQA 3ZQWA 3EOAB 3O9WD 5AD0B 3L08A 3GKZA 4CN4A 2AEIT 3MLZH 5DJ2A 3TN0D 2PWGA 1UG9A 3KGRA 5J13B 4APQA 2XT1B 4JE4B 1QI4A 2J8HA 4C83B 3SDXF 3MUJA 4LCWB 4EXKA 3O4OB 4OV6F 1CFMA 1P5VB 4L8BB 4Z7UA 2V2TA 3CSGA 3IMWA 3UJIL 3H53A 2EYTA 1QVOA 1E9PB 1VCBC 2WTRB 4M43H 3T3PF 3TEXA 4PSRA 1KCSL 2DQGL 4JFYB 1GGUA 4WCYL 5I1KH 1IC7L 3QO0B 3CDFA 3MLWL 4MB5A 1S6NA 1OP5K 2DLGA 4ELDA 2RAMA 1LEGA 2NSXA 2WLLB 4GAAA 1DLHB 1MNUH 3MUGA 1K5NA 2DLFL 4BFJA 1QA9A 4JN2B 2ENYA 2NX5E 1ZLSH 1FA4A 2ERJC 4MDJB 4HC1A 3KH4A 2LE9A 4NIYE 3NSFA 4LSUL 4WWID 3RUGE 2O61A 1ZJAA 5IVOA 2WIIA 1T6BX 3R18A 3TEWA 1QQDB 5IMMB 5KANG 4XMZA 3OAWA 4HJJH 3D08A 3WNJA 4P46D 1N6VA 4C4KO 2DI8A 1FL5A 4FQXA 1RLWA 4GXVL 1J0IA 2JCCA 5INCB 2VDOH 3IDXH 5IHUH 3VFUA 4BHUA 5IM7A 2CR3A 3DVFA 5DRXA 1Y1DA 2B5IB 3KPPA 5DJ8A 5HVHB 3G6AB 2DQTH 4DWHA 4HLJA 2ZCHL 3CH1B 1IBGH 3W56A 4M61A 4NQEA 3MROA 1ACYL 1FLRL 3GHEL 4PP1C 3B7SA 3U9UA 5A2JH 1PMYA 5E5LA 1UJ3B 3IFOA 3KBEA 3NIGF 2VL5A 4B96A 2GEQA 4QTHA 4BK8A 3O6FA 3V8CA 3FQ2A 4GAGH 4OQTH 3QARA 1WFTA 3BEVA 2R51A 5HTSA 3ZZ1A 1YEDB 1PYWB 1ACCA 4OCSH 4RAVA 4OGYH 4JJHA 3PF2A 1KJVB 5JOEA 4DERA 1LQBC 2HJKA 4IOSA 4IJTA 4DK3A 5DWPA 2BY2A 1HHKA 1GZHA 2OZ4H 3T3MB 1NEZB 2PUQT 4OQ1A 5ITFB 5BQDA 3SKNB 4AW7A 5KYNA 3H85A 1DEEA 1AD0A 4KY1L 1UWGL 1JNLL 1FFOB 2GI0A 2FWOB 2XA8L 3HBZA 3LNDA 1I7UA 1BZ7B 4W9KC 3IFLL 2IV8A 5D7JA 3L9BA 5E2JA 3QNXA 4L4TA 3ARYA 5FA3B 1S9XB 1VCAA 4TTDD 3TZVA 2AABH 1KULA 3VRIA 1WAAF 4LCCB 2ZWKA 1HNYA 1F3DH 3VDAA 3BZDA 1U3HB 3G3LA 3TS8A 4GKZA 3SKOB 3N85L 1BXUA 3J2PA 4G6JL 1MZYA 4BCZA 2VDMH 3S2AA 3I9PA 4X5RA 5D1ZB 1FIEA 1USZA 2R8SL 4K8RD 3RDTA 4EI6A 1CDIA 5EU5A 2UXFA 3NCJH 3FQRB 4IMLB 3VG9C 3VFSB 3DV4A 5BUPA 4K7PX 2WK2A 3S3JA 4PJ5B 1I4FB 3FUEA 4YAQB 3ILPB 4OJDH 1ZE3H 3K2KA 5DO8A 2P5WA 2K45A 5C6TL 1Z3RA 5JPNA 5DVKA 1NCBH 3ROOA 3BUTA 3MRGA 1BM7A 1YN7A 5FWQA 5I24A 4NO3B 4N0YL 2E7HA 3NMEA 3MGOB 2D9QB 2OMUA 3WHE0 5DD3H 4POZD 3B9VA 4UILH 4JG1L 2XUWA 5D8JL 3OR7B 2NY0B 5EWIH 4XVTH 4DQOL 2B3RA 1JVKA 2ZKMX 5C3LD 3D06A 2NLJB 4Y8AA 3G08B 1Q94B 3EH2A 2P24B 3ME0A 4BSWB 1C1EH 1G0DA 1IGCH 2K6WA 2X0WA 2VN5A 3CFNA 3T0ED 1JZEA 2I5YH 3HHRB 3ZTEA 2KI6A 2O6FA 5HHVH 1IC5H 4GI6A 1YNTB 4ANVA 2GAZA 2XY1A 3MUHL 3QR0A 5GGRA 1OARH 2J2ZB 3B3IB 1M1XA 3LS4L 5E99H 3IE9A 4WI2A 4Z78A 1JWUB 4XVJL 2XV0A 4NN7B 4PJXE 5EZLA 5I2IB 2XTLA 3TN0A 1TXKA 5CS7A 2CRIA 5ENWA 3BHBB 2Z6FA 1R47A 4M00A 2C3GA 4OM0L 2L7UA 2YMXH 1U30A 2YPKA 2H0JA 3IDNA 4MAYB 3WL9A 1OAYH 5EC2A 2E4TA 2ZP8A 4YLQT 5HHOA 3VW3H 4MX7A 1IC4H 1W72L 3K46A 4XN4A 4Y2OB 5HD8C 5EOCJ 3T0WA 1UZGA 4Q58C 5D6DA 1A7PL 4MJ6B 4OJEH 1MEXH 1DFXA 3SE3A 1JF6A 2ZZUT 3VM7A 2UXTA 2JIXD 3RGHA 2J5LC 1FG9C 1I8KB 1W8EA 2EDMA 2X1XR 3HAEA 4ZAKB 4DP0X 2YBRB 4WI7A 1R75A 1BJ1H 2YD5A 3TYFA 4Z7QF 2DWEB 1MFAH 3HN5A 4G59C 3HHSA 4DTGH 2EIJB 2HVKB 2LQRA 2O6DA 2WWKT 4G9DA 1T2QH 5HVWA 3QUYA 2R1WA 1IAOB 5EZIL 3DGDA 4N2GA 1WTLA 1S3RA 3J07A 2Z3FA 1RZFH 4KNSA 2BWIA 2UYLB 3QULB 5K9QI 3OC8A 5C0NC 2JKIS 3MV01 5B8CB 4TMPA 3T0DA 5T1DL 2FR4B 5LQBH 3OC5A 3PV6A 3JZ7A 1XGRB 3GXIA 2V3DA 4FI8A 3IAQA 5FV2A 5DD0L 2CMRH 2NNAB 1T1WA 5ID1B 3HZKB 5CP7B 3CPLB 5A16A 1NDGB 3R4RA 1F6LL 3QDJB 3NIDF 3TF7C 1KTKE 1NM9A 4EN3B 1W16A 1MJ7H 4DN3L 1CLOL 2YZ8A 1B4TA 4GG6B 1CU4H 2FLBT 3HNSL 5D93B 4KH2A 5F0LB 2VR5A 4PJGE 2XTSA 4UQEA 3CHXA 2X4OB 3OF6A 1C5BL 1SOKA 3QWQB 4GB9A 4NO0D 1KGYE 4XMTA 4HSCX 1WZAA 1EHNA 4TQEL 5DD6B 4PRPA 4I0PC 2K3HA 4HKXA 3QQ9D 1A9EA 1M9WA 4KK5C 2N56A 2OMBA 2X6MA 2XA3A 3FL7A 5B7EA 1QBBA 2ZAGA 4KAQH 4TVSa 1KNOA 4PJ9C 2F53B 4RLDA 4IKNA 1ZANL 3GD1C 5AW1B 1RZ8B 3H6JA 3VXUE 4GFTB 4G6FB 4NN5C 5DUML 5IBLD 2FLRT 4XOEA 2W0KA 4WNSA 4LARH 1UATA 2ZSVA 2Z93B 2BDNL 3APMA 2O72A 1L3WA 1OVZA 4HIPA 4LP5A 3S97C 3GRWA 3B56A 3CFEB 4BFFA 2YFNA 1KBGL 1G7QA 1WH0A 5AZUA 1OP3H 1PZUB 3QIUB 5MEOA 5CAYB 5I71B 4U1KB 1T80A 4AYGA 2DQJH 4PGDB 2NY3B 1A3QA 5FPIA 2DQHL 1KCLA 3TIDA 2V17H 4FFWD 2FWSA 1TNMA 2LU5A 3U1QA 2FX9L 1UOKA 2B39A 4QRTA 1W9XA 1CK0H 3O45A 1BFSA 4NJAL 4EDXA 4P2RE 3NQKA 3IU4H 4R5VA 4APQB 4I85A 1P7QA 2YXFA 4NNPL 5FM8A 1ITCA 1IFRA 3UBGA 3DO4A 5D2LE 1XXDC 4NM8H 1S5HB 3Q2WA 3PWPB 2EYTB 4PVLA 3QRGH 2BW4A 3CXDL 2K9UA 3QZLA 3MV7D 5KS9E 1VFUA 1F3RB 1SHXA 2W0LA 4Q56A 4YDJA 3PHQA 5AQ0A 4G8EA 3JSSA 4X5PA 3OG6B 1A6VH 3MBED 4L3AA 4PJHF 4I18C 3I6GB 4PVMA 3MV9D 5SX4H 4ZX4A 2HTLC 1YJDL 1DL7L 1LK2A 4GQQA 3U7AA 2FEJA 1LEGB 3WFBL 4AGPA 3I50L 3BSGA 4B60A 3D51A 3C9NA 4LSPL 3PG2A 4HKJA 5FECA 1OGTA 4X9GA 3G9AB 2DQGH 4WCYH 4RFNC 4ZT1A 3UAEA 7PCYA 5I9QC 4XPAL 2YQ3A 5C09D 2VXUL 5IROD 1NIAA 3UYRL 3T0EA 2O61B 4Y5XC 2OZNA 2WIIB 4JKLA 4EO5A 3BH8B 4UV7L 4D8PA 5J11B 4Q9CA 1PSKH 2COVD 4OCRL 1RK0B 1DVYA 3E9UA 4MNQE 4B50A 3AWEA 1BA9A 1FL5B 3HUJA 2GUOA 3KG5A 2JCCB 3VFUB 4KDTA 5DRXB 1R19A 3KPPB 5DJ8B 1LK3L 3G6JB 3AS3A 2Q5BA 2I9TA 5GSRA 4DHLA 3PXLA 4HISA 4LSUH 4M61B 1BVKA 4U6HA 5DZPA 3SDAB 1M7IB 3KLHC 5D7KD 3ZUCA 5IG7B 5ALBL 3ZE2E 1MWAL 1U3YA 2XTJC 3U9UB 2CIIB 5E08L 1JTTA 3HAEG 2EXYC 3IFOB 4PGZA 3DLQR 4LPVA 3GXMA 2DDQL 4AGOA 1H5BC 3N42B 5LHDA 3MR9B 4CDHA 4QTHB 2JIXA 5I1JH 3O6FB 1GMIA 2I69A 3LEVL 1O6TA 3QRBA 5GRJL 1DN2A 3UAJA 3CUPB 1OE2A 3LAFA 4HDIA 5IUSA 3T6QC 2K4WA 3F7RA 3VTMA 4RAVB 3V9EA 2ZCHH 4U1LB 3L6FA 4G8GE 3DVNB 2QADC 5EFIB 3V7MA 2V2WA 4PY8I 1A66A 3JV5A 1ACYH 1PZSA 3LKNA 4UDUB 5J1AB 1X5YA 4JFDB 3HZ3A 1BQSA 3TA3B 1DEEB 3B7RL 3D0LA 1INEL 1AD0B 4UDTA 2PPEA 2AMUA 2VKXA 2WOYA 1PTZA 2DQEL 1I7UB 4KOCA 3VM5A 4IIZA 1OPOA 1H19A 4L4TB 2HYMA 3RGBA 1IM3D 2VERA 3TZVB 3VB9A 1XIWC 3TJPA 5H37A 1C9SA 1L5GB 3QQDB 2EYRA 3VFRB 4A6YL 4GKZB 3DK0A 1G1CA 5BRPA 4L18A 4NHUA 3KWWA 4FHKA 2BNQD 4IKLA 5HHQA 2DBJA 2W81C 3DVGA 3RPBA 4KY1H 3SPIA 1UWGH 4ZUUB 5T33L 2E0PA 3LH8A 2XA8H 1WO2A 1XL6A 1RSFA 3RY6A 2EVJA 3IFLH 3E0GA 3WEOA 2RD0A 3FUMA 4PS3A 4NO0A 2AQRA 3BVDB 2P5WB 3JV4B 3L5HA 4P2OD 3TOPA 5JPNB 1LL1A 4JCMA 2ZX9A 3N85H 4JS7A 4G6JH 3MRGB 3REVA 4QNPE 1YN7B 4JEGB 1AZVA 1DUZA 3B9KB 4C56E 1HYSD 3CFJA 1BZQK 3FQNA 4XNQB 3T0BA 1MCKA 3SJVA 2OMUB 4LF3A 1G7IA 1DQML 1CTOA 4YDKL 4WNJA 1D7BA 4S1RL 2VDPB 2YZ1A 3RGVC 1T0MB 2VM3A 1OAUL 5IQMA 1U8NB 1NTDA 2R15A 1UFGA 5DMGC 5BRZD 3BW9B 4A2DA 4F8LA 3N9GH 5HGHB 2DJ4A 3BDYL 3ME0B 2UY7B 1I1YA 1OAQL 5C6TH 3MGAA 5F21B 3TC9A 4AGMA 1NIFA 3ARFD 5E9DE 4QKTA 2X87A 1MDTA 1QLEB 3LZPA 1U8JB 3P2TA 5B21A 1G0YR 4YJZL 4N0YH 3C5JB 4X4YA 1M1XB 1K8DB 4JGNA 1EDQA 1LE9B 1M7UA 5GGSY 3O9WB 4LLYA 4V1DE 4A2HA 1BD2E 3OKOA 4HUKB 3VXOA 4U7SA 4JG1H 5AYUL 5A3ID 3TN0B 4TVPD 3VD5A 3UBFA 1RZIB 5I74C 2EE2A 3FPYA 3O3DB 1JGEB 4UIKL 3WENA 2FX8L 4F7EA 5HDBB 3IDNB 3SCMC 3GUTA 3HLKA 3WL9B 1Q9LA 4FJZA 5EC2B 2WV3A 1D7CA 4KUZL 4YIQB 3S35H 2CCWA 1G9HA 1JG9A 1V3JA 2IPKA 5D4IA 5EUOA 4JW3A 1CDBA 3LS4H 4GO8A 5L88H 2H2SD 2P26A 2PF6A 1UHVA 2B7DT 1X5XA 2CGRL 2YD1A 3GSOA 5DU7A 2ZXEB 4AIXA 4EQ3A 1KIUB 4N2LA 3HAEB 2QVIA 4YHYC 2Q86B 1CGXA 4KNQA 1RIUL 4L3CB 2X5PA 3ARBC 5MHSD 3H42L 2RTTA 3HHSB 4FLSA 4BINA 5JOFB 1QATA 2R1WB 2Q7YA 1W72H 1GPOH 4JGUA 3RY5A 2CAKA 5E4OA 5SWSA 5TE4H 1A7PH 5I26A 1YAIA 1QFHA 1ZS2A 5DT1L 4ZDHA 5IQLA 2VDLL 3CBJB 2Y7QA 5C09A 3AZUA 3HZVA 3B2MA 3HE6C 3IYLW 1YUKB 4NP4L 4HMCA 3IMVA 2YPVH 3ZL4L 1XGYL 3DETC 3NJHA 3C2AH 4IS6A 5A16B 3ROLA 2Y5QA 4M9PA 1FAIL 1KFAL 1KTDA 3BD3A 4P46B 5AB2A 3ESNA 4K9JA 4HV8A 4JJOA 3VG0L 1CLZL 2OI9B 3LPOA 4D7PA 2X10A 1A6PA 3CFCL 1T0OA 4YS4A 3ABMB 5D1XC 3BP7A 1L9NA 4G42A 5JLZA 1JL8A 4OIFA 5AB9A 1A7OH 4G8AC 4KKAC 2YARA 3QHTC 4MJ4A 2G3ZA 4XP1L 2FECL 5T1DH 2J21A 1XO8A 5E6UB 5F7MC 4K3GA 2Y25A 2OX5A 5T1KD 4QT5B 3JT2A 2QR0B 1UA6H 1OM9A 5DF0A 4EUPH 3VAEA 4ZXBC 1FE8H 5BUAA 1UURA 1GC1C 4L1SA 5E00A 4PJBE 2AK4D 3LZNA 3HCVB 4FJYA 3DOIA 1CLOH 1PLCA 3FBQA 5AZ2L 5G2NA 3ILDA 3GMMB 2ZJSL 3ZN6A 3CQFA 4MKMA 1IKNA 3BI9X 3NEEA 3P4MA 2ZSVB 3I02B 5FHBH 5TDPA 3JWNH 3HIZA 4LSVL 4URTB 4QHKJ 1RP8A 5LCVL 3FQ1A 2ZAIA 4TQEH 4YX2L 1CGWA 1G7QB 3OAUH 1GA2A 1HE7A 5FGRA 3QCTL 1D5ZA 1E8WA 1OF2A 2GHWB 3NYKA 2R2HB 2XJLA 4I89A 4AE0A 1FVEA 4BUQA 2RALA 1TQCB 2ALAA 2VZUA 3TIDB 2DQUL 2LAGB 3FF7A 4PJ8D 5CJ8A 1HOCA 1ZANH 4HYTB 4I13B 1XGQA 1ETZA 3PHOB 4HSAC 5BNXD 1PX4A 2XG5A 3VXNB 4QHMA 5DJ6A 4JM2A 3O45B 5I1DA 2FNWA 1T03L 2NUTA 5IOPA 2HH0H 3KLAA 3ZTNH 5A6MA 3QFJD 1TZGH 2E6QA 2WQRA 2VJ8A 4EVNB 1IO4C 4F37F 1A3LH 1DTUA 3QC5X 1KBGH 4ANUA 2NXYC 3UTSE 3VACA 2BP0A 3CN0A 4GQ9L 3BN3B 4ES9A 3Q5OA 1DHKA 4L4VE 4XMVA 1OTUD 2IF7A 3X11A 3FB7A 5DWUL 1QEWA 4YDJB 4P2OA 4G8EB 3GSUA 3PUUA 2FX9H 1MCWW 1PEZA 4AT6A 5GRVK 2G4EA 1FNEA 2AQPA 1ET7A 3Q2VA 4DGYL 3FTGB 4GEIA 4U0RC 2H8PB 2NTFB 5HHNB 3CD4A 1SLXA 4IBQA 4OJFH 3B1UA 5T3XL 1IFGA 2FCBA 2JF1A 4O2EA 1R33A 4PLKC 3L1EA 4MB1A 5FECB 2DBLH 2ROYA 3CXDH 3U25A 1OPGL 5GGVY 5BRZA 3ZE1B 1TETL 3K6FA 3FOMA 3NJXA 4PVBA 3M7OA 4QHNA 4DP4X 4PYHA 2H32H 2A3TA 2CU9A 1A7RL 2LT9A 3T0EB 3ARFA 4EJ1C 1LO5A 3F7PC 4B9FA 4TLUA 3QNZB 3WV0A 1N8OE 4XP5H 3MRQA 4HIEB 2Y36H 5FO7B 5HYSA 4NHCL 1YJDH 1DL7H 3NRQA 2NX5D 4AEEA 1OIOA 3MBXL 1HEZA 4PV8A 4UYQA 4M8QA 3I50H 5E8EA 1RU9H 1D9KD 3QIBA 4I4WA 2EIMB 2ICWI 5AAMC 4B9IA 2QMJA 3BKML 3DX3A 1RUQL 3NESA 1NA8A 1WUZA 3NACL 4H1LB 3SPCA 5BZXA 4OZHE 4ICXA 5F7LB 2BOBA 3QJHA 4GKOA 4Z23A 2FO1A 3EJUA 4LAJH 1TG8A 4ZMTA 4XPAH 2NYYC 4L9LA 1BVKB 2VLKE 4U6HB 3AMKA 4I1NB 5F9OL 5E2VL 2QKIB 5C0EA 2ADFL 2DQMA 1OF0A 3NGBC 2W07B 3IMSA 3BO8A 2R7EB 3IDUA 4B9JA 4UV7H 4D9QE 4Y4HD 4OCRH 2DMHA 2FHBA 3T6XA 2JIXB 1SN0A 2R39A 3B2XA 3CZGA 2XV6B 4R26L 2YMTA 2YEVB 3KBHE 4HDIB 3I6LE 4LDLB 1M05A 1E42A 2JSFA 1E8XA 1N19A 1Q1JL 4DAGL 1LK3H 1TO5A 2MFNA 2Y3AA 3E9TA 4DP6X 2OR9L 1ZV9A 3TESA 3BVTA 2D4DA 3TV3L 2FRGP 2HKFL 1G5AA 2XKNA 4F7TA 2XNAA 1MWAH 1L9QA 2C4XA 4UDTB 3TA4D 3L4VA 1Y07A 3QZMA 1YYLL 2Z0BA 1BOYA 5F9AC 5A7EA 1AGEA 3HRZA 2GSGA 1SJHA 2DRUA 4XC3L 3MLRL 4X4KA 5GRJH 4WJ5B 1WSST 3D87B 2B9BA 4LRIC 4M02A 4NAMA 2BS71 2AITA 2C7UA 4M48H 5MEQA 5CNHA 1X5FA 2EYRB 2YD9A 4OIIH 5AOLA 2APSA 3RLSA 6CGTA 4NHUB 3B8YA 3KWWB 2VIRA 3T5WA 1EXHA 3HMWH 3BD4A 3QEQA 2DL9A 3GK8L 2DQDL 4GPVA 1HH6B 1DCLA 1DQTA 2DQEH 2MKLC 3BFOA 2VZOA 5DRWA 3HN8A 2A83A 3O2WH 4L0ZA 3U4EB 3UP1A 4F33B 1F86A 5T1KA 3ZHFA 4NO0B 2FH6A 1QNZL 4X4XA 5ANHA 2V3EA 5CO1A 2R4RL 2HB0A 4A6YH 5CJ5A 2H9GA 5KVDH 2Y0SA 3REVB 4GP4B 2W9EL 1X5LA 1CI5A 2DEYX 1WBXA 3CFJB 4FQCL 3ML8A 4GINA 1NWOA 4HCRA 1CYXA 1U95B 3TO4A 1YEEH 4LF3B 2J8OA 2JCWA 4HHAB 4K3JL 4TUJB 2VITA 1LXMA 4MHHI 1H6EA 1L9MA 1P2CA 3KYKL 5L2JB 1SEQH 1ZJBA 2X0UA 3MRMA 2CNZA 3EYQC 4I88A 2WBWB 3QWOA 4NKOA 4OZGA 2XWJA 4ZUTA 1I1YB 1XR9A 4GAJL 1FH5L 4PJDA 1X9LA 2OMVA 3LKRA 1ZPUA 4NO2A 5F0JB 5F3HA 5JIIA 3QEUA 1PDKA 4S1DC 4GI8A 3CMOL 3IJ7A 2F7OA 5TF1L 2C4FT 4X4YB 3MNDA 4KKBD 4PJ8A 4UOW0 4AK1A 1W0YT 1DQMH 5LVEA 2JFCA 4S1RH 2D7TH 4YXHL 4GSDL 1X9RA 1AFVL 3L1OH 1WFMA 3BGFB 1XGTA 4GAYA 1FGVL 4L1BA 2HT2D 2XZCL 1H3WM 4GRLC 3MQIA 3K8MA 5C0IA 3GUTB 2WYZA 4Z0XB 4GI9A 4CJ1A 3BPCB 3WNIA 5EULV 1MRFL 1QSEA 2G30A 3MV7B 2YUZA 5D71H 4HUCA 4OY9A 1D6EB 5D72H 4F15B 2WUBL 4ALAH 4JRXE 2B14A 4AIOA 4GP5B 1MHPL 2WQWA 1HEHC 5AYUH 3MBEB 1PG7X 1WG3A 3Q2CA 3STZA 3NZHL 3R06A 3MV9B 1CLVA 4H13C 3BSZL 2GBUA 3OJMB 4E9QA 4XT1C 4UIKH 2MPVA 5AVVB 3UEZA 3EFDH 1IIIA 1PAMA 3RIKA 3U6XS 3QWRA 4ZNCD 2MQ3A 2OJEA 3SDCC 4HWEH 5JDSB 2Q7YB 1MCRA 4PAZA 5DRZA 3FQUB 1F58L 4LSTH 4ZDHB 2PYEE 2Y7QB 3CGTA 5HYSG 5CBEA 5C09B 2CGRH 2CJUL 3HZVB 4O2CA 3VFVA 1ZPLA 5HJBA 1G1YA 1RIUH 1U58B 2QSQA 5CN1A 2F08A 4U7KA 2EXSA 5SX4I 4MCZB 3DYMA 2BVEA 3H42H 1PGRB 4NUQA 3BGMB 1KTDB 2P45B 1D9KA 1I1FA 3P4NB 4ZFOB 4HV8B 4JMNA 3U79A 5GGTA 5CD5D 1VEMA 3JWNE 3O0RH 1SBSL 1JHLL 3OB0H 5DQDL 1IBZA 4ZODA 4ZMZA 3L3DB 5JLZB 2EDBA 5DT1H 2PMZA 3LB6D 3P0VL 2IANE 2VDLH 1TZAA 3L9RB 2VERN 4GO9A 4ILDA 4D9LL 4IRSC 5JO5A 1E7VA 1ZLEA 2HTKD 3U0TA 1DANT 3HS0C 2D7MA 1FRGL 3AUVA 1DN0A 2WUCH 2OX5B 5D7IE 4FABL 5F96L 1G4RA 3ZL4H 1LHZA 4AK2A 5IW6B 4W9ZA 1FAIH 1KFAH 3RI5K 4BCXA 3KYMB 3VG0H 3CFCH 3DIFA 4YC2B 3FHAA 4RAHA 3GPEA 3QB7C 2FIKA 2MOQA 3CFTA 1JHTA 1HZHH 1L7TL 2DJSA 4PJFB 1ONQA 1PY9A 3P4MB 1I8IA 5TDPB 1ED3B 2ZE0A 3LRSA 2H45A 2ITDA 1JPGA 2FAUA 2VDKB 4BKLA 4DN4L 2FEDD 1XB3A 4LK4A 4CSTA 5B3SB 4XO9A 1UACL 5EU6D 1NGYB 4E9VA 1OF2B 1AJ7L 2ZXAA 4H88L 1ORQA 3VXUD 1J1XL 2ZG2A 1XAKA 2A6IA 3LKPA 4X6BA 1IM3B 1H3PL 3WTWA 1KBKA 1ETZB 1Q38A 4CA4A 5AZ2H 4LCYA 2XG5B 2ZJSH 3CH8A 3P4OB 1Y1UA 3HI6H 1ZA3A 3QI9C 5I1DB 1J5IA 3ZBMA 2DWYA 2NUTB 2X4TA 3KLAB 4NT6A 2Q8AL 4ACTA 1EUTA 4LSVH 3ABKB 2BNQB 3CSYB 3PREA 5F8RC 3N41F 1UKQA 1OT1A 2R2CA 2WY3B 2IQAA 1GS6X 3RDJA 4CJ0A 3GWJA 1J9SA 5FW8A 2D2CC 4NC0B 4P2RD 2PR4L 2YXVA 3FB7B 3ARWA 2ZP0T 4P2OB 4N1HB 3UGXA 3GSUB 5GGSA 4KQ3L 3BOVA 1A14L 4CGTA 1BF8A 1QFPA 4X9HA 3VH8A 2Q20A 1T03H 3Q1SL 1MCOL 3NZSA 3ULUL 4XMKL 3NCCB 1GCFA 1W15A 5HDOA 5KTEL 2PO6C 5FFGA 2QHLA 1FNGA 4LCUB 1ZVSA 3HR6A 5JA8B 3RVXD 3M1OA 3OBAA 4NLAA 1YRKA 1E3XA 1QWUA 5DO2C 4BKSC 1BIIA 1M7DA 4X5XA 5DCCA 4N2CA 5BRZB 2AI0L 3FOMB 4XP9L 2YD8A 2GTZA 2CO3A 4UCFA 4R0LB 3LZQA 4NP9A 3ARFB 5LGJA 1WTGT 3WELA 3KCPA 5D5MF 3MRQB 4DGYH 4DCQB 1BAWA 3FSVA 3G6DH 5HYSB 1FL3B 2Z8WC 1V54B 4WHCA 5ERWB 2VKWA 4OJCA 1HEZB 4PV8B 4OKVA 1W0VA 1ZAGA 3ARVA 2ZWSA 1L3NA 5T3XH 4JZOA 3VXMA 1N9PA 3EUUA 4F9LC 1OPGH 2DLTA 4Z3JA 4B5ZA 3BESR 5F7FA 4HIXL 2K78A 3RWFA 1NFIB 4G1MA 4L9LB 3U82B 5AW9B 3BPLC 4QXGH 3TVMC 1A7RH 2AXFB 1A9BB 4MNQD 4PTTA 4L37A 4PJXA 4AUUA 2JH2A 1Y0LA 5KSUB 4JO1H 2XWTA 2W65A 4NHCH 1N8ZA 1AZUA 3E6HB 3MBXH 3WNOA 1VFAA 3CVHA 1J0KA 4LAQL 4OCMC 3CFDA 4FNUA 3QC6X 2IALB 1PKQE 3A6BL 3H4HA 2NYZA 1RUQH 3NACH 1NOLA 3CHSA 5BJTA 2ZYSA 1ZHKA 3VWKD 3C5ZC 2QSTA 3P4LA 4LFHD 2O5NA 3AS1A 1K72A 2OM5A 5EA0H 5E2VH 2M8XA 3AB0C 4JRWA 1EGJH 5HJ3A 3ZTJH 1OW0C 2ADFH 3ARED 4NKMA 2XNAB 2YA1A 4CVZA 5C0FA 5K9JL 4YLBA 1BQHG 1HVXA 5DJ0A 1A65A 2CKBB 4CMHC 1D5RA 1SJHB 2GSGB 5KVDE 2FO8A 5J1TC 1CO1A 2DL2A 4G8GD 3KYNA 4WWKA 4L1HA 4L2LA 3C6LA 3SN6N 1A6ZB 2C7UB 2OYMA 2EC8A 4DAGH 5LKNA 5MEQB 1MCFA 1KACB 3WKNA 1ID5I 3C2SA 5CILL 1KZQA 2ICEA 3IKCA 5E4IA 4LPYA 3K2IA 4HFWA 3HG5A 3Q6FA 4GW5A 4JKKA 2HKFH 3TV3H 3FZUC 2CLZA 2OMTA 3M6DA 4YK4B 4Y16D 5KVFL 3UPRA 5DYOB 2QQNH 3QEQB 3LRKA 1YYLH 5HGGS 1F8TL 3H4FA 4AEFA 4Z7NE 4UB0L 3IGAB 2A83B 4JFQA 2P5EE 4XC3H 3MLRH 2VN6A 3MJ6A 2X9YA 5T1KB 3WGUB 4Z8FH 2DS4A 4X4XB 4NQTA 4MASA 3RVWD 1VB9A 2NY1D 3HNVL 1GVIA 4XX1E 1YNKL 2H9GB 2PWEA 4Y1SA 3SO3C 3ZK0A 5DSCA 5ITBL 3O81A 4WIQA 4RZKA 4FL4C 1HCFX 2QJDA 5T1JA 1SLVA 3KHQA 4AVHA 5CEZL 4P23C 1JWMA 2K9FB 4W9FC 4CGUB 3GK8H 3H7LA 4DP2X 2JLPA 3HFML 4LSSH 4KJQD 3QWOB 4C56D 4MCYA 1ZLVH 5EZOL 1QNZH 2H26B 2XWJB 4OZGB 5DFAA 5LJYH 2R4RH 4LMQE 5EN2A 5TDNB 2OMVB 3LKRB 4NO2B 3U36B 3QQ3A 5F3HB 3VXUA 4M6NH 3RL1B 3QR1A 1TSRA 1EXGA 2F74A 4FQCH 4KK8D 1KJ2B 4HT1L 2KDYA 4XMWA 2EAEA 2Q76B 2LU7A 4PJ8B 3LYRA 3AQXA 4M6OL 3PWLA 1I7RA 4KBPA 1KTRL 4E5XA 1LD9A 3V2AR 1CGVA 3V5DA 2EKSA 3UCQA 1T7XA 1JGVL 1QHPA 1A4KA 3QFJB 4MBOA 5E9DD 4H8QA 4KO6A 1GW0A 1QZ1A 3BUYA 3GJFK 3M7FB 5C0IB 4JHZA 3GI9L 5FKPA 4HUXB 3FT4A 2APXA 1EZLA 2DTMH 3QZWG 5KBMA 1YAZA 1JPST 4MZ2A 1JJUA 4YSSA 2BJML 4AW4A 2A38A 2Y2WA 5DEJA 4XHJC 2YRZA 4P2RA 1OCZB 1P7KB 5EEVA 1M3JA 5DLLA 4EDWL 4ZTPH 4QHLA 4JQVC 1S9YA 2O93L 4K4KA 1AFVH 3WXVL 4FQQA 3O6MH 1U92B 3R06B 2WO2B 2XZCH 1CL7L 2CO7B 1JCKA 2EXWC 4UV4L 5KS9A 1PNDA 5IB3A 1A02N 4TUKH 4X99B 3S98A 3B2UC 5GXBB 3FN0H 1MRFH 2BP5M 3KM2A 1FPTL 3RZWA 2WUBH 4H44C 4CADA 1CVSC 5BXFB 2OMNA 2PETA 4O2CB 4HKBB 2VAAA 4QRUA 4XN5A 3TBTA 3VFVB 5C0JA 4BQ9A 5FFLA 3NPZB 1TKWA 1F41A 4NKIH 4KI5C 3ZGIA 1BFVH 1BQHB 4Q4EA 2VISA 1C12A 3BSZH 3C6SA 3L5IA 3CJJA 4PRHE 2NX5B 4FERA 5CSGA 2MJWA 2Y1VA 4YXLL 4M7KL 3VFOA 1D9KB 1I1FB 3RUGB 5BO0D 5EORL 1HU8A 1BZ9A 1DQQB 1TTRA 2B08A 3F12A 4NNYA 4OQTA 3R8QA 2ZUQC 3FTXA 1URIA 4WFED 2DLEA 1KCKA 5CSBA 3RZCA 5JO5B 1W6WA 3JV6B 3D05A 4LEEA 3DMMD 2IAMC 1DN0B 2V7NB 4IRJC 4ZQKA 3WMPA 1JNJA 2CHNA 4TTGA 4KJPC 2PXYA 5BZDB 5I15L 5ETUB 2V4LA 2C9XA 2OZ4A 4Y4HB 3VUAA 3C09C 5C7XL 3KL0A 1UZ6F 3OQ3B 5DK0A 4JY4B 3L4YA 1C5DA 1HQRB 2VW7A 4GRWF 3K7UA 1E4XI 3DXAE 3VX0A 5DQDH 1SBSH 1JHLH 3VWKA 1JV2A 3UIZA 5T3ZE 1EO8L 4LHJB 1Z9NA 4YHKL 2FIKB 3P0VH 3US0A 4RFOL 4D9LH 2AEOA 1A1NB 3EDJA 4XBEL 5IT2L 1I8IB 4KPHL 2L0DA 2WXPA 3K80A 3M88A 1GYCA 3W11D 1XZWA 5C0RH 5I30L 3K71B 4BKLB 3LCYA 3WUZA 2VR3A 3MJ8A 3CDCA 3DOHA 4P5TD 3UBXA 4JPIA 2K8QA 4HXAL 2COQA 4ODWB 3G5XB 1KG0A 1IVTA 1KY6A 3IXAB 2A6IB 3QZBA 4HAKA 3FQTA 1NCWL 1KYOJ 2X41A 2J3SA 2BSCA 1E6JL 4AQ8A 4LCYB 5KAQG 4U0QB 1AI1L 1L7TH 3O2DL 2Z4QB 3BAXA 1ZA3B 1JIBA 1Z3GH 1KDJA 2WAQA 4JQIH 4NT6B 1UUNA 5EC1A 1CTNA 1MF2L 4KXAA 1T1ZB 1OK0A 2O4EA 3GIZL 4APXA 3VA6A 2YXMA 4DN4H 4L8CA 3IVKA 1U93A 1MFCL 2DD8L 1OP9A 2IQAB 5FWRA 4PLOB 5TGBA 3VCLA 1OTSD 4CNIB 1AJ7H 4XAKE 4H88H 4JFEE 3LPGA 1DVFD 4NQCA 2ICWA 4OT1L 4FEMA 3SKJL 5F9WC 4RWYL 3A3YB 1NBZB 1H3PH 3U6RA 1TEFA 3QZWB 4LOVA 5JPMC 1GXEA 1GOHA 5GGSB 3FU0A 1NBYB 1RUML 5FDWB 2AMGA 1U8OB 3EJCA 2ARJB 1BCIA 2UZPA 3HN3A 2VGLM 5T3XE 3SZ6A 1VADB 4GKLA 3ZRFC 2Q8AH 2ZKWA 4OLXL 1IBHA 1OSZA 4FNTA 4L4VD 2WWMD 3ZW3A 2VXQL 3QORA 4P9MH 4Y5YA 3L7EA 1DQVA 3Q5YA 4N8VG 1A3RL 4AYFB 3BZ4A 1M7DB 3N91A 3D09A 4X8XA 4TUUA 4GG8B 4I2XA 2PR4H 1HI6B 2NY5C 2R23B 1NMCB 5FXCH 5HVGB 3V6BR 2GTZB 4GIOA 2KLTA 1FFNA 1KXQE 2K1MA 5I18H 1WICA 1A14H 4JM0A 2AEPH 3QA3A 4R96B 5FIEA 3BEWA 5LGJB 1R3IL 4M5ZL 3KCPB 3ZKMC 3G7TA 2WZPA 2WNXA 3Q1SH 1QNIA 5J13C 2NQ3A 3ULUH 15C8H 1N0XL 5KTEH 1D2PA 3FB8A 4Y5VA 3S3BB 2ZOLA 5DJAA 2X44D 5L2KE 3KXFE 4JZOB 4KJYA 4PJAA 3LRLA 1OP5H 4ZUVA 4G7YL 4P3DA 5E8NB 2AI0H 3HG3A 4XP9H 1FSKC 2K0RA 4L1LA 32C2A 4OSUL 1Z9SA 1U8CA 5E0FA 4Z7VB 2WKOA 4F7CA 1XH3A 1XV8A 4V1DA 4ELKA 1BD2A 4L37B 4PJXB 2Y5TA 1Y0LB 3AY2A 4L4JA 4I3RL 2XWTB 2W65B 3MUUA 5TQ0H 1FNFA 3WFDL 5CWSA 2B4CC 1ZGLA 3ETBJ 4LLWB 4HXBL 3EOYG 1KIQA 5BJTB 4WUUE 2R27A 4HIXH 3FAWA 3QW9A 3ESOA 4LVEA 2WMPB 4JNXA 2BVYA 4NZTL 5GRUL 4D9QD 3CLFH 3PAVA 4LE8A 4BK5C 1X5IA 3C12A 3IMBA 3VD2A 2OQJA 3DJTA 1F42A 4XGZB 5C07E 4MB3A 3D30A 4ZOAA 2VWEC 1IC1A 4YSCA 3FB6B 3OPUA 4D9RE 2RMNA 1BMZA 4LMQI 3I6LD 1T66C 5DJ0B 4PRAA 2ZXQA 1A8ZA 2VM4A 4M4PA 3KYNB 3I84A 5I16A 2MOVA 1PU0A 4MQXD 2CDFA 5HI5C 4XWOD 1B0GA 1BHGA 1MHHA 2A9BA 3LKSA 3S4SB 2Z91A 2ICEB 3QO1B 1Z5YD 3D2TA 1JF5A 4HFWB 3Q6FB 4A63A 4GW5B 3OG4B 4X6EA 5CXPA 2DM7A 2CLZB 3P69A 4GMSL 4QXTB 3UPRB 1H3TA 2NCMA 3DX7A 3DRQA 5K9JH 5IB2B 3EGXB 2CLRA 4RNRA 1GHFL 1MVFA 3BWZA 2VMEA 2KZBA 4K7PL 3UZQB 4ENZA 1NFDE 1UB6B 2BX5A 4YSDA 4GEJA 4GIPD 2UWEE 1UGKA 3FCSA 2DQCL 4FP8L 2AC0A 3A67L 5CILH 4HC1L 3UG4A 5AW0B 2R56L 4OGAD 1UT1A 5GGUB 3FULA 3R7QA 3X13B 3L7FA 2EIDA 1R17A 2N01B 2PKDA 1HWGB 1J8KA 4PJGB 4KRPC 5KVFH 1JWMB 1KOAA 4QUOA 4Y0GA 3EYUL 3BZEB 4LCIL 3HB3D 3ASNB 1E6OL 4MGXA 3PL6D 2J88L 2VLJE 3L3HB 1T22A 1T1YB 1YPZE 4MCYB 4LCCC 1U91A 1U3HC 5EN2B 4K3EH 2CUMA 1HHJA 2OSXA 4GXFA 4N8VB 5EU6B 2F1EA 4M5TA 3VXUB 5FHAL 3N44B 1P4UA 4Z3TA 5ITBH 4U49A 1PZCA 3NDYE 1S8DA 2C9PA 5LXGH 1KC5L 3HG1E 4IJ3B 2DPKA 1H15B 2EKSB 4Q8BA 4AC2A 2GIXA 2OK0L 4W4OA 3WE1A 3AJ7A 1ES0B 3TM6A 5IWLC 1A4KB 1QPPA 2ZKXA 5G4NA 2HRLA 3BUYB 3UDWC 3ZJAA 4MMXB 4XZ4A 4WWNA 1KB9J 2BRQA 3D25A 3S88L 2NY4D 1JZ5A 1RUPL 3RTQA 2OCJA 4O51A 4PUBL 3D3VE 5LWYL 1TVBA 5AKSA 4KZ0A 2BVTA 4NFBA 1U36A 2MQ0A 3K5RA 4P2RB 1JSYA 5L6YH 2VABA 3FOLA 4M6OH 5FUCC 1DVQA 3ABZA 3QSKB 3FB5A 3ELQA 3RPIB 1S9YB 4F93B 3IKKA 5D2LB 1SXSA 3UTSA 1JGVH 4FTDA 5TTRA 4P48A 1GY2A 4PJIA 2Z8VC 4MA1B 1MFNA 5KS9B 1SOSA 2WQSA 3GI9H 1JYWA 3GSWA 4OZ4A 4UZUA 4RDQG 2ILLA 1BG9A 2X89A 4QTFA 2VL4A 3QUHA 4JRXD 1M4KA 5E1QA 3RWHB 1HHHB 2BJMH 4MQSB 2Y1AA 2HMIC 3Q2NA 1B4JL 3RFZC 2VDOB 5DFVD 1AYRA 4EDWH 1CIDA 2EIBA 4CADB 1IQDB 4XTRD 4QRUB 3TBTB 1VFMA 4NN7C 1T5KA 4QRRA 6PAZA 4XCNA 3VRJA 2X2HA 1TKWB 1TFPA 3WXVH 4O4YL 4MXQC 3HHMA 1LP9F 2WYIA 1C12B 4OVUA 2VUKA 1CL7H 3C6SB 4UV4H 1G7LA 1CXLA 4DKEL 4QRAA 1QLFA 3ZGHA 4E9LA 1WFJA 1TQTA 2PW2A 2YSSB 4JO4L 4FMFA 3VFOB 4DOHE 3SQBB 1FC2D 1PD1A 5IFJA 3NJNA 2D0GA 2PYED 4FTVD 2E9IA 3H7BA 4CBPA 4HJ0C 2ED9A 1FPTH 3F12B 4F24A 5IY5B 3MHZA 1PZAA 5KJRL 5ICZB 3KVPA 4PWIA 3GBNL 4BRVA 5LAXA 1XGZA 3BIKB 3OAZK 4G6AC 1NFKA 4N2FA 3N0AA 5CGTA 1XTLA 2J57A 4MNQB 2VDPL 4ZQKB 4PYGA 1B9KA 1EFXD 4OZHA 5KSAA 1Z5HA 4IIQC 4XXCC 4NI6A 3IJEA 5CN2A 4C4BA 2E9JA 5DK0B 3KJ4C 4M7KH 4HH8A 2CBPA 2IAND 1C5DB 2VLKA 2FBRA 1W8OA 5EORH 4OV5A 1GYWA 3P0YL 1ZV5A 3VWKB 4PJCE 1JV2B 4D2NA 1QLEL 2I60L 3QDGD 3EJZC 1RQ5A 1U3JA 1ZIBA 1CT8A 4KZCA 1JNNL 1U2HA 5B8CC 4RRPA 2Z0UA 2E8ZA 1YEKL 1WT5A 1J48A 3AREB 4ODTL 4GLRH 5JQIB 4P4KD 4MHHG 1OCWL 5I0YA 3MJ8B 2CO6B 4Z3EA 1WISA 5L4JA 1TEGA 4A38A 4G8GB 3ZIYA 4AKPA 4QYOA 4IGBD 1ZXKA 4HULB 3FQTB 4EN3C 5BVJA 4WK2B 3RP1A 1QI3A 3VQ2C 1T7ZA 1FG2B 2WXNA 4K5OA 3V55A 5JDJA 3QUZA 4RFOH 5IT2H 2BHFA 4KPHH 4H8HA 4Y16B 2A9DA 3Q9PA 1JPFB 5JA9A 4APXB 1KUMA 4YR6A 3UZEA 1UH2A 1U93B 4FA6