3NJMA

P117a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPDAQIINRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njmA00
1MG2C 3QQXA 1A8ZA 3H4HA 2IH8A 4DPBX 1JZEA 1URIA 3PXLA 3GDCA 1JZIA 1PMYA 2JFCA 1A4BA 1WS8A 2J56A 4ZK8A 2UXGA 1AANA 2W8CA 1ZIBA 2TSBA 5B3SB 2RACA 1I53A 3IN2A 4GP4B 2FQGA 1AZNA 1TEGA 5I5MA 4HHGA 2IDSA 3T9WA 2DV6A 2DYRB 5B1JC 1FA4A 5D4JA 1AG6A 4DP2X 3NT0A 3QJTB 3HB3B 2ZOOA 1E65A 1JXGA 4HCFA 3FYIB 3NJMA 2EINB 2JKWA 2IDFA 3FQ2A 1J9QA 2Y1AA 5AFAA 1PZAA 1VLXA 4KO9A 5I6NA 2AZAA 3S8FB 4K9JA 1HAWA 4JHUA 1TEFA 1QLEB 2CBPA 4AKPA 5IY5B 1NIBA 3NYKA 4HZ1A 2IH9A 1J5DA 2P80D 4HCIA 1SNRA 3OM3B 4BXSV 2BP8A 3IE9A 5EHFA 1E67A 1AOZA 4BK5C 1ID2A 1L9PA 1SHXA 1MZZA 4QKTA 2GI0A 3IEAA 1ILUA 5I26A 1BEXA 3QJVB 4F2EA 3C75A 4CSZA 1ASPA 3JT2A 4AX3A 2HX8A 1J9RA 1BQ5A 1GYCA 4Q8BA 1QNIA 2XLLA 3PAUA 2BWIA 2CUAA 2GC4C 2I7OA 3NP4A 4GP5B 6PAZA 2XVBA 3CVBA 2FNWA 1TU2A 2GBAA 2VW7A 2VN3A 2ZWNA 3H4FA 3ZIYA 1PZCA 2QT6A 2BP0B 2CJ3A 4DP0X 3V9CA 1A3ZA 3ZBMA 4E9XA 2VSKB 1OCZB 2R7EB 3ERXA 3X1BA 2UX6A 2PPDA 1SFDA 1M9WA 3HEIB 2YAPA 4WKXA 1BQKA 1JERA 1UATA 4GYBA 4KNSA 2LLNA 1ASQA 3EH4B 1IBZA 4YSEA 4A2EA 7PAZA 1PY0A 1KYAA 4Q89A 3T6WA 3WKQA 4DP7X 5I6OA 4E9QA 2NRDA 1KDJA 2H3XC 3UACA 2AZUA 1BYOA 3PCYA 2J5WA 1IBYA 3FT0A 3UAAA 1JXFA 3T71A 5PCYA 3SBPA 2FWLB 4HCGA 5B1KA 2FQDA 2CCWA 3WG7B 1ET8A 1KGYE 3FPXA 3T6XA 1JZJA 1RZQA 2XXGA 4P5RA 2BHFA 1PLAA 1V54B 2FT6A 2Y69B 4MFHA 3EH5B 2OJ1A 2ZONA 2UXVA 4YSAA 5PAZA 3DKHA 2YAOA 1E5YA 4PAZA 1MG3C 3TASA 4KO6A 4ENZA 3WNIA 2VW6A 4QLWA 1N68A 1ZDQA 4A66A 3WI9A 1JZFA 3FU9A 2BP0A 3NJJA 1NWPA 2HX7A 4HHWA 2N0MA 2R7EA 3QJUB 1HAUA 1FFTB 3NP3A 1L9TA 2AVFA 1T5KA 3CVDA 3UADA 1BXVA 4YSCA 1E5ZA 4UANA 1PAZA 3N55A 1X9RA 4HIPA 1J5CA 1ADWA 1SDDB 1XMEB 1ZV2A 5I6LA 1WA2X 5B7FA 1ET5A 4M3HA 1L9OA 3GYRA 1PNDA 4F2FA 4YL4A 1TKWA 4DP9X 2PP7A 3ABLB 4L0PB 3V9EA 3BQVA 1WS7A 3TU6A 5I6MA 2FTAA 4P5SA 3SBQA 4NB7A 1OF0A 2UXFA 1J9SA 3FSZA 1A4AA 3KW8A 5LDUA 3TBCA 3MX0B 4BDVB 1BYPA 2CAKA 3U25A 1GY1A 4AI7A 3NJHA 3OD3A 1AS8A 1XB6A 2IDQA 3AG2B 5TK4A 1BXUA 5F7AA 3ASOB 1ASOA 3IN0A 2XV0A 1BXAA 5B1AB 3S8GB 1NZRA 8PAZA 1NIFA 1EHKB 2BZ7A 3PLYA 3FU8A 1NICA 3ABGA 4KOBA 1JOIA 1NIDA 3OMNB 4AKQA 2YAMA 1ZIAA 2H47C 1PCSA 1L9SA 3DTUB 2HZHA 5I6PA 4NERA 4G7RB 4KO5A 3BVDB 1AZCA 2BW5A 3DIVA 2XX1A 1YLBB 3MBWB 3ABKB 7PCYA 4E9SA 1AS7A 2XUWA 1ET7A 1BQRA 1GR7A 3S3CB 4DP1X 2IDTA 2WO2B 3NSYA 1PZBA 2E86A 2EILB 1SDDA 3AG3B 3CG8A 3N2JA 3G5WA 5ANHA 3NJNA 1AZUA 2EIKB 4WTQA 2PP8A 2Q9OA 4E9VA 1AIZA 2YAEA 4HAKA 4A2HA 4G71B 1CC3A 3ASNB 4YVNA 4BWUA 1NPNA 4AKOA 3FS9A 1WA0X 1L9RA 2PPEA 2VM3A 3ZX1A 2PCYA 3WIAA 4BWTA 1QHQA 4DP4X 2A3TA 4A67A 1IUZA 4NAJA 5AKRA 2B08A 5F7BA 1NIEA 2OV0A 2P80A 3FU7B 1KBWA 4BDVA 2DYSB 4A2DA 5D4IA 2GSMB 2XV3A 4M4RB 3X1EA 4YSQA 1HFUA 1AZRA 1B3IA 3FQYA 1PLBA 1PNCA 3FSAA 3PAVA 4N4YB 4YVUA 3QJRB 1MDAA 4KNTA 4E9WA 3FQ1A 1OE2A 1W6WA 4G7SB 1DZ0A 4HALA 2GB2A 3NSDA 2HX9A 1F56A 2YAHA 5I5IA 2FT7A 3T6ZA 5B1BB 5A7EA 1GW0A 2IWFA 2H5UA 3AY2A 1WAEA 5D4HA 2YQBA 3QJSB 2PLTA 2GC7C 2FQEA 1EZLA 1GS8A 3JTBA 4FAAB 2HLEB 1W6LA 2J55A 2X87A 1SJMA 4UF7C 5B7MA 2QPEB 4GXFA 2FQFA 1JZHA 2XU9A 4UAHA 5E9NA 1X9UA 3KW7A 4A2GA 2VM4A 3NSCA 2QPDB 2X88A 1OCRB 3EF4A 1ETJA 2BO0A 2W88A 4JHVA 1JVLA 4G72B 2JXMA 2GIMA 2WO3B 3NSFA 2HRHA 4N8UA 1KCBA 4A2FA 3S3DB 4W1TA 2BZCA 4GP8B 1NPJA 4YSTA 2HRGA 1M57B 1RCYA 2VW4A 4RH4A 2QDWA 2PPFA 3AG1B 3PAZA 1OOWA 4CSPA 2PCFA 1V10A 2PPAA 3CVCA 2IWEA 1FWXA 2YXVA 3FU7A 3NJGA 3OMAB 4KO7A 1E30A 1RZPA 2CALA 4AZUA 2WSDA 3D12B 3NJLA 2IAAC 3WNJA 2AFNA 2I85A 3EHBB 1SHWA 1MZYA 4BXVA 1A65A 1PLCA 3UAEA 1NWOA 1PF3A 3OMIB 3ABMB 4DPAX 1OCCB 4YSRA 2BWDA 3S3BB 2UXTA 3X2QB 3L45A 2HXAA 4BWWA 1JVOA 3NJFA 3CDZB 4KOCA 2QDVA 4X4KA 3SQRA 1GY2A 3AZUA 3FYEB 2FJSA 2TSAA 3CZUB 3TA4D 2XWZA 5I28A 2FT8A 2IWKA 1DYZA 3SBRA 1OE3A 1CYXA 2EIJB 1N70A 3FSVA 1KCWA 3T6VA 3NJKA 2XYBA 4G7QB 2GHZA 4EF3A 3AG4B 3FPYA 4DP5X 1SF3A 1ZPUA 5AZUA 3X1GA 4GY4A 1KV7A 1OCOB 1SF5A 2YXWA 1RKRA 5FC9A 4JKNA 3QPKA 6PCYA 3X1NA 1JZGA 2EIMB 1AAJA 2XXFA 3AW5A 1BAWA 3TBBA 1CUOA 1AZBA 3QJQB 2J57A 4YSSA 3PPSA 4A68A 1CURA 1V55B 1OV8A 4YSPA 3EH3B 1XB3A 2DY2A 3UABA 4TXVB 1L9QA 2MTAA 1JXDA 1KDIA 3OQRA 2OCCB 2IDUA 1CYWA 2YARA 2XX0A 3WKPA 4YSUA 4KNUA 3NJIA 4F7KA 1GSKA 2BW4A 5TK2A 2YAFA 3IBOA 1A4CA 2AANA 2PPCA 5I5JA 2Q5BA 1NINA 1NIAA 4FA7B 2MRYA 2VMJA 1GS6X 2ZXWB 9PCYA 3FSWA 4E9TA 1AQ8A 3CDZA 4DPCX 1OE1A 2UX7A 1ILSA 3ZDWA 2VSMB 1M56B 1SFHA 1R1CA 3GXUB 1IC0A 4PCYA 3X1FA 1W8EA 2PP9A 4E9RA 1J9TA 2DWSA 1NDTA 1AG0A 1IKOP 1GS7A 2XV2A 4YSOA 3RYMA 3H56A 2I7SA 1ZDSA 1KBVA 2BP8B 2YAQA 4DP6X 5B1JA 5B7EA 2B3IA 4E9YA 5I6KA 3UGEA 1AS6A 4G70B 2DWTA 1AR1B 4W9ZA 4YSDA 1NTDA 1WA1X 1XB8A 4DP8X 1AACA
chains in the Genus database with same CATH superfamily
3L3OC 3HBPA 1CIDA 1PPIA 4NI6A 3MR9A 3WMQA 2WXMA 1GZHA 3ARTA 4B9FA 3P2TA 2K1MA 3BI9X 2AXFA 3LQMA 2J1YA 4LNRB 2W0KA 3EUUA 1NDGA 3PHOA 4ABWA 1KTJA 5I75C 3HG1D 3VCLA 3KPNB 1TEGA 2X4UB 2MSPA 2X2IA 3T3PF 1MVUA 3Q43A 2EXSA 4YNYA 3KWUA 4QO1B 3E3QE 3ARDD 4R0LA 3OWEA 4CC4A 3HAEA 5IQ9A 3ARDB 5T1MA 4OLXL 2B59A 2WLIB 1ZV5A 3BMVA 4YWGL 3NFPA 5HHNB 3AACA 4GJTB 2OZ4L 4QRRA 4MYPA 4JFYA 2DBLL 2EINB 1HXMB 3X3FL 3F7YA 4QTHB 3GHBH 4LSSH 1SJEA 3U1SH 4KZDH 3P4OA 3Q8BA 3LN4A 2X1WL 3QJOA 4HBCH 3GRGA 3GD1C 1S8DB 5A1AA 3M07A 4M03A 1QZ1A 1Y0LA 5GGVY 3OM3B 4PR5A 4GG6B 3EFOA 3ARWA 3EJZC 3F62A 4JDEB 4ZTEA 3MJ6A 1E67A 1TQBB 4U1HA 3T0WA 4PG2A 4LE8A 4QRBA 4MZ3A 4OZIE 1N6VA 3H0TA 2R2BB 2NY6D 3TN0A 2BHZA 2IXQB 5C2UB 2NY6B 4JN2A 1S5HB 1K8IB 3ZO9A 2CDFB 1Z5YD 1E4XI 2FO4A 3C75A 3QJFA 3UTPE 4CSZA 1TJHL 1SEBB 4L05A 3LRSB 1YN6B 5I1KH 4Z7NE 1QNIA 4M48H 1IILE 1T7XA 2ATPB 1VACB 2NZ9C 4TQIA 5L6YL 3DETD 4QY8A 5IV2A 2CHZA 4QXUL 5AW1B 4A37A 3C6LC 3L1EA 3L81A 3ZIYA 5ID0B 5JIDA 1JYXA 4P49A 4LLYA 2H3KA 3NESA 5T5FA 3ZE2E 4NP4L 4P46A 3NCJH 1OGTA 4U6HB 1IAKB 1JS4A 2MQ3A 2ZG3A 5HD8D 4EUPB 1KBKA 3CC1A 1BFSA 3D4YA 4J39A 4GUOA 1KNOA 1NH6A 1ZHNA 3H3KA 3QPQC 4WU7A 4F3FA 4QJ3B 2DLGA 3ZRFC 4JFVA 4X6CA 3P4LA 4W9IC 1YEFH 1I9IH 2HT2C 2WMPB 3HRPA 1QFUL 5ERWA 4ZFOB 3ZOAA 5KAQF 3QXUA 3JWDL 1YJDC 3LV3A 2QHRH 4LCWE 2AZUA 3LSOB 4HZLA 4FYTA 1LE5B 2Y06L 3PWVB 3FT0A 3FTZA 2L7EA 2NY1B 3H9SE 4POUB 5ISZA 1UHVA 1X5XA 1FC2D 2O6CA 2FWLB 2X4RB 5CGYC 4HHAA 2OK0L 1HCZA 4TULH 4G7VL 4P06A 2IOOA 2QQNL 5E6IA 1KUMA 4ELKA 3FFDB 3KL0A 1REIA 1S7XA 5F7YC 4P5TA 2D73A 2K78A 2VR8A 1HEZB 4M62H 4OGQC 1SY6H 4LCYA 4AJVA 3QT2A 3GMNB 5CJQL 5IBTL 2WXHA 2CO4A 5MHSE 2YZ8A 3BSZL 5DSCB 4JM2A 1FG2A 2BP0A 3WXWL 1FH2A 1RURH 1RU9H 4HJTA 2ATKA 3M17B 5I24A 4WI4A 3MA7A 2FWOB 4ZMLA 2YC1A 2HTKC 2VDPH 5DTFB 5EUOF 4ZTPL 3S34H 5BV7C 5EF3A 5HDWA 4ZX3A 4QRPD 1TQBC 2VISB 5E9DD 1HEJC 1XQ4A 2FB4L 3CXDH 4QRPB 4E5XB 1DBBL 4X4MA 5E9DB 1ZT1B 4UANA 1UJ3A 1RERA 1PAZA 2EO9A 2W91A 4XN2A 4MD5B 1PX8A 4PJFA 4B27A 5DZOA 3GMRA 2IMMA 5I8EB 2RTTA 3QNYB 3QUZD 3MLWL 1KJ3H 1CPUA 1BMWA 4P2OA 4D8PA 3NCYP 4AV5A 5DJCA 1ET5A 5JIQA 4OGAC 4ONGH 1R5VA 3ZT5A 3MRNB 4EJ1C 1WS7A 3TU6A 4N90D 5IHBA 2EIBA 1UA6H 2Y7LA 1U36A 3AXLA 3SE8L 5CMAB 1S7SA 4X5PA 4X7TB 4IS6B 5INDA 1A4AA 4QHLA 5CHNA 4OVUA 5L7XH 3VGAB 3V6FA 2DQMA 4BDVB 1OAKL 4N3TA 2N3JA 4P2RA 4PREA 2GSIB 1TCMA 2WXOA 5K59F 4G9DA 1A0QH 1BXUA 3MGTB 4R6UA 4E41A 3BP4A 1XZ0B 3V9FA 1KFAL 2F54E 3F58H 1JD7A 1EHKB 2XIDA 3SGEH 4MS8D 1KMGA 1ZHBA 4XCCH 2DJUA 1B0GB 4XP4H 4A1RA 3PUCA 3GFUA 4ZUVA 2LHAA 3OJDA 2D0FA 3B2DC 2ORBH 5BJTB 1TCRA 2IALB 4PEEA 2NY1C 5ENWA 5DA0B 3DX6A 4MAUH 4MJIE 4Z7UA 5I6PA 4ZNEA 3EFFB 4UQDA 5KYXB 3V0WH 3WUWA 5C9JA 3ELQA 4OV5B 4KTGA 4UNUA 1CXLA 2J1KA 3OAUH 1AS7A 4JANB 4OF6A 5IFAH 5KUKA 2R0ZH 2ICEA 4L4TE 4JHWL 2XVKA 3U7WH 3WFZA 3AAZB 3QIUD 1VKXB 2UVFA 3PPEA 4AUJA 4KMTL 3VX1A 4H0LC 3TT3L 5EEXA 1I7ZA 1TZGH 5DFWH 2ESVA 4Z7NB 2HTLD 1XIWB 5LBSL 2LU3A 3FN3A 4OLWH 1RPUA 1SVBA 2GSGA 4D9RE 4I0PB 1ETZA 1IM9B 2HB0A 3D39A 1ROWA 4QRRE 1R34A 3NCEB 3SPHA 3ZSSA 1A25A 1GZQB 5DHDA 1U3HD 1SXCA 5TF1L 4KGLA 4OD3L 4PJ7B 2W59A 1KF9B 1C5CH 3KPLA 1FIGH 4AGLA 2K7QA 5T1DH 3VG0L 3GJFA 2UZXB 2IFGA 3NSDA 3ARFA 2PWFA 4HLZH 4NN7C 2CKNA 3PJSB 4JKPL 1U8CB 3CDGA 4LCWB 2YD6A 2FRGP 3CK0L 4HZAA 5JDSA 5FWQA 1F86A 4FQQB 1F3DH 3DYPA 3B7TA 1QSFD 1LK3H 1DQML 3CC5A 4UF7C 2QPEB 3E3QC 4EI0A 4F57L 2NLJA 5D7LA 3WHE0 2FQFA 1W2KT 5LLIC 1ES0B 3HCVB 4X7EC 1X9UA 3QORC 5AOIA 1F42A 1MWOA 2QPDB 3CZLA 4AW4A 2FSEA 3VM5A 5J3HC 5BXFA 2G3MA 3PWPA 1GCYA 4RFOH 3TBTB 3HE7A 1MNNA 3QR0A 5KW9L 1LQBC 1A7QH 3EDJA 1RZKH 3RVTD 3SYOA 3WSQL 3ZE0F 5BRQA 2IWGA 2LABA 4RMTA 5MP6H 2B7DT 3HBQA 3N1MC 4X6CE 1DJSA 2XA8H 2P28B 3OKNA 1OOWA 2BNRA 3D18A 1LDPH 4HFUL 1E3XA 3R0MA 3UJIH 1WFNA 2GJJA 2WBKA 2DH3A 3QEGH 1RQ5A 5A2AA 2Q76A 3JV5A 3GUTB 5EUOA 5ISZE 2NX5D 4S10A 1SHWA 4GI9A 5F89B 1CDCA 2NX5B 1YEDB 2LU4A 2ZOTA 5C1MB 3OMIB 3IDXL 4HWBL 3THML 1GH7A 4Z8FL 4FEMA 4GT7A 3RY5A 2DQFA 4ZO8A 5FYKD 3TJPA 1XIWC 4JG1L 3T77A 1D2PA 4I0PC 5DWUL 4JDTL 4S1DD 5TGBA 4EO5A 5I16A 1XGTB 3SQRA 3ZQ9A 1XF2A 1X44A 4IBSA 3BZEB 4WUUA 2O6FA 3BVTA 3EADA 4NCC1 3RWEA 3W38A 4QRSB 2F7PA 1DQQA 4B96A 5EA0L 1CFNB 1DVQA 2NOYA 3EYOB 3CLEH 3FSVA 1NAKH 3HI5H 3QEUA 3N06B 1FF5A 1BAGA 1XSKA 2V9TA 5ALBH 3HZVB 3WIHH 5I1JH 4MLSA 1T20A 4XNYL 5B38A 4APQA 2VLRE 2IH3B 3ZTEA 2E56A 3TPUA 2V2XA 2F74A 4BUQA 2D7OA 2VITB 3TBBA 2KH2B 4HS8L 4ODSL 1G5GA 3MR9B 5TQ2H 1A6TA 2FIKA 4P8QA 4NEHB 3U4BL 4HWNA 4XWGH 3QZBA 4JY5L 2WIIA 2AXFB 3LH2L 1NCDH 4F1SA 4NO0D 4KUZL 3EJQA 1J5IA 5AD0A 5E5UB 2P5EE 1H0DA 1NDGB 3PHOB 3VCLB 4N28A 4HEME 1V7MH 2X5PA 3CQQA 3GMOA 3HVNA 3TJHD 1H9DA 1UH3A 1MVUB 4Q6KA 2HJKA 4YNYB 2WTOA 5AB1A 3VGEA 4R0LB 3UPRA 5I5JA 3WD5H 5HYSA 3HAEB 5IQ9B 2JTDA 5LWYH 1QYGH 3QYCA 5T1MB 4A39A 4APXA 1PZSA 2B59B 2I60L 2JK5A 2QGDA 3NFPB 2Z7UA 4XAWH 1SHSA 1K5WA 4KVNL 3X11A 2Z31A 3QUYA 3BJLA 4LVHB 4XC3H 3T3PE 4AIOA 4QRRB 3FW6A 1AD9A 1JMZA 3FTUA 4JFYB 4E41E 1KSRA 3F7YB 5ACMA 1A6WH 1SJEB 3P4OB 3BKCH 2KLRA 5E51A 1IC0A 4DHLA 4EQ2A 3LN4B 3HR6A 1W8EA 2PP9A 3FQXA 2ZD0A 3SQOL 1WIUA 1JPGA 1IC5L 3FQNA 3TURA 2DJ4A 2XXCB 3U9WA 4B97A 1Y0LB 4KDVA 1CLZH 4QYAA 3EYUL 4PR5B 5ACZA 1YNLL 3EFOB 4QOKA 1PIFA 1QNZH 2N59A 1DQJA 4AK2A 4OCRH 4JQIL 4U1HB 4KKCD 1QTYT 3OMZA 2R59A 1JHKL 3H0TB 1MFMA 3HN3A 3TN0B 5CINH 4WDIA 1LO3L 4A7QA 2ZYSA 2O5ZH 4JN2B 4JRYE 1JPFA 1I8AA 4GRMA 1HILA 2AJUH 4M6MH 2FO4B 4O51A 3QJFB 2K4AA 4N5UA 3GKWL 1EDQA 5DMIH 4G6KH 3VXSE 2ESVE 2F5BL 3HI1A 1TYJA 1KB9K 1NMBH 2DQUH 5FLUA 4FXGA 4GLRH 4QY8B 3ISWA 3REVA 5IV2B 3DHUA 4ZK8A 1LEGA 4OCYL 3SGKC 1E4JA 1FH5H 2C34A 3V4LA 4DEPB 1N64H 2ZUYA 1PG7X 2OX5A 4LLYB 4ZMQA 3IN2A 4Z7VA 2NY7L 4H7VA 3VH8G 4P46B 1OGTB 2W9DL 4HS6A 4KXDA 3WNKA 1VF5C 3O3BA 3I50H 1JPEA 5SX4H 2CR6A 1O75A 4NWUH 4GBXA 4M8UA 2VZ3A 1KNOB 5CILL 4Z0BL 1ZHNB 3DOIA 2YKLL 4WU7B 5FCUL 4F3FB 4X6CB 3AGVA 1P1ZA 3RY6A 5JNYA 5ERWB 3VFGL 4TRPH 1WBYA 1YUHA 3LV3B 1YRKA 5C0BA 3S8FB 1QI3A 4QR7A 1QLEB 2NXZB 3DOSA 1B3JA 4HZLB 4NKDA 1E6OH 4YDNA 5DLML 1XF4A 1GGCL 3EYQC 5FV1L 5ISZB 5HPOA 1C8QA 4WSJA 4CC1A 3LH8A 5IF0A 1G7MA 3DECA 3NJVA 4HHAB 1VFOA 4JMNA 4XZUA 2WLMA 3DTXA 1KWGA 4ERSH 4CC4C 2ID5A 5E6IB 1W0YT 5A2BA 4ELKB 3HPJA 4DPRA 1KPUA 1S7XB 4P5TB 2QQLH 4LSPH 2YD7A 3RILA 3D2TA 3BH8A 4H1LH 3PWPE 4LCYB 6PAZA 4Z5RA 3L3GA 1E4HA 1JVKA 1E5BA 3C5ZC 4G6FB 5E23A 1TU2A 4JM2D 4JM2B 1FG2B 3IETA 2BP0B 4ICWA 4K07A 3V9CA 1ND0A 3BZ5A 2ATKB 4R7VA 1TQWA 5IVOA 2GUOA 5JIPA 3MA7B 2E9JA 2YC1B 2NY0D 4N2GA 4RMWA 4IBZA 4K7PL 4PG2C 2NY0B 1MVYA 4BJLA 3TN0C 1UJ3B 4NZRL 5JXAL 2DM2A 3FULA 2MEJB 1R9FA 2FD6H 4PJFB 4GW1A 5I1HL 5EUOE 3GMRB 5BNXD 1M71A 5JPMA 2EDWA 3WKQA 1JRHL 5TDNA 1G9NC 4WFHD 1SBSL 4ZS7H 1W15A 1P0SE 1PIGA 1GOHA 1KPVA 4NKMA 4P2OD 4P2OB 5E56A 4X99A 2Q7YA 4D8PB 5DJCB 3OLEA 2PMZA 3FUNA 5BZWA 3ZU8A 1R5VB 4NZTL 3UZEC 4PSPA 3A6BL 2A2QT 4ICXA 3WCYA 1R5WA 2CLVA 1P53A 3AXLB 3V5KA 3FT4A 1MPAL 1S7SB 4P46C 1Z9PA 1U0QA 4TMPA 3KVDD 3PHSA 5EU7E 3MLYH 5INDB 4QHLB 5CHNB 2VYRE 3ZTNH 1OF2A 3PP4L 4GAJH 4OM1L 2ZWZA 4P5RA 4PUBH 1NAMA 3SSGA 3US9A 3V6FB 3WDIA 5MENA 1IMHC 2DI9A 4P2RD 4P2RB 4PREB 4O9HL 2ROXA 4G9DB 4KK5D 3T3PB 1T7YA 1M4KA 1YECH 3BP4B 4B95C 2ZKHL 5B21A 4E41B 4QLWA 2OTWA 8CGTA 2DD8H 1ZDQA 1JZFA 1ZHBB 3FU9A 5K59E 2NXZC 2YJQA 4WI5A 5EU6D 4ZUVB 3OJDB 4GQZA 4FFWD 4XOAA 1AIFA 1TNNA 3WTVA 1TCRB 1FFTB 3LOWA 5J1AA 4JHZA 5ENWB 3X3GL 2VXUH 3DX6B 3SDCD 4Z7UB 2HKHL 5E70A 3IMTA 3WUWB 3ZYIA 3SN6N 3UYRL 5C9JB 1Q0XL 4PJAF 4AVIA 1FAKT 4KTYA 3NZ8A 5E6IC 2ICEB 4KUCD 4UV4H 3NIGF 4WEUD 2DQHL 4TLUA 4P5TC 1JWSA 2FX7H 3QUXD 2QZ5A 3DVFA 4HH9A 4I3RL 3SPGA 5GS1A 2WZPA 5JXEA 3IDUA 1I7ZB 3HLAA 3QDMD 2BRRL 2MHAA 4OIIH 2ESVB 3SE4A 3V4PH 1MW3A 3SJVA 1CJYA 4HEPG 4KC3B 3BPCA 4M3HA 3RIAK 3CZKA 1H6TA 2FJUB 2QSQA 2ADJA 5IBLD 4JPQA 2GSGB 1ETZB 3QB7C 3D39D 1ZTXE 4XXCA 5AVTB 3D39B 3AU1A 5CEZL 2R29A 4ZUUA 2Z6FA 4J4PC 1ZEAH 3ROOA 2X09A 1TJXA 1J9SA 3A21A 3FUEA 1M7DA 2KZKA 3QRGH 3QDHA 1F13A 4HLJA 1XSIA 1MIML 2WXQA 5D7HA 2H2PC 1LD9A 3U36A 4PGJA 1WISA 2G2RA 3DSFL 3KPLB 5CS7A 5FFLA 4ZO7A 3MO1A 3ASOB 4YLBA 1A14H 3ARFD 3GJFB 2KDGA 3ARFB 1UD6A 2EECA 3BJ91 5CR8A 1A1NA 1SN5A 3CDGB 1ZS2A 2G3NA 1NICA 2E75C 3GO1L 2Q87A 2VDRL 4P0DA 3IFNH 4MNGA 4PB9H 2CJSA 5EIIA 3ULUF 3MLSL 4G82A 1BJ8A 5JDSB 3ALWA 1K4CA 2DZEA 1ADQH 3KL5A 3T8XA 2JKNA 2JB6A 4ZW7A 1MI5E 2JQZA 3WY4A 3CC5B 5D7LD 3RBSA 2NLJB 1DQDH 1AFVH 5D7LB 3HS0C 1RP8A 4DUWA 2CK2A 1KYDA 3DHJA 3U2JA 5CJOL 3VXUA 5BXFB 2FSEB 5MEPA 3ES6A 2YD8A 2GPZA 3PWPB 5DVNA 3HE7B 4IEFA 5BRZE 3NEEA 4MXQC 5IB4A 2LOEA 3Q48A 5B4MC 5FDWA 1QBML 1KGWA 4D0DA 5JA8B 3F6IA 1DE4A 1KYUA 3STBA 2LTQB 5HHPA 1BAFL 2CHNA 1CDYA 2BNRD 3OKNB 1CU4L 4DP4X 3UIZA 5IJVA 4G59C 1E8ZA 2BNRB 2VDKL 3D18B 3K6IA 3UJJH 3ZE0E 5C0BE 1AHWA 1OAQL 1MFAL 2I26N 4IBQA 2CDEA 1HXKA 3NCXA 1JRHI 3BKML 4DTGL 3P54A 2ICEC 2VDLL 3LPWA 2IPKA 2Q76B 5EUOB 1AZRA 1EMTH 4E9WA 3QZLA 2WIMA 3DX2A 2EICA 4ZUTA 2XIBA 4I77L 1YN7A 4AMWA 2DQFB 5L88L 4AE0A 1MRFL 4J2QA 5I1GL 3T77B 4ZMPA 3FQTA 1CGXA 1XF5A 1TTGA 2EDBA 2DWDA 5TGBB 5I16B 3L4VA 1XF2B 4WUUD 3TGXA 3ZL1A 4WUUB 1I75A 4FDWA 2B1AL 3CSGA 1D7BA 3RWEB 2J55A 1ZGLM 2B15A 1DQQB 4BK4A 2XQ0A 3V4UH 4GXFA 4IJ3C 1D5IL 3K8LA 1PSKL 3QEUB 3KW7A 3L3KA 4PJCF 1SMAA 2D9QB 1WIOA 2B1HL 3DO4A 4JHVA 1OANA 4QJ4B 1THCA 2W94A 5TTRA 1BHGA 1IAII 2HT4C 3CLFL 1T20B 2UWEF 2HVJA 5B38B 2F1BA 3NA9L 4TUKH 4APQD 2VSCA 4JG0L 4B9IA 5HJ3A 4APQB 3HMXL 3L1OH 3TPUB 2R0WL 2V2XB 4UT9H 4EN2A 2F74B 4RH4A 4RIRA 4MDIA 2QDWA 4ZUWA 4JM4L 4LDCA 3T0EA 4UV7H 4HU8A 2Y07L 1UD4A 2Y0SA 1A6TB 1QRNA 1SZNA 2FIKB 2WIIB 4KU1A 1QTSA 4LESA 4PWJA 2IAAC 3WNJA 5AD0B 4AQAA 1QFPA 4AVHA 3LB6C 1H0DB 3ESVF 5DQDL 4B9JA 2F68X 3QAQA 5GGVH 4ANVA 4LK4A 3GMOB 2VWEE 3BIKA 4PJAA 1B9KA 3TA3C 1K3IA 1XZWA 1NCAH 2HJKB 2X4TA 3HE7C 5GGTA 4AGNA 12E8L 3UPRB 5MENE 5HYSB 4OKVA 3WNLA 5AZEH 4APXB 4F58L 1FRGL 5JR1H 2JK5B 3QUYD 3GBDA 5FB8A 1E6JL 2E7HA 2Z31B 3QUYB 1SM3L 2BINA 1MHHA 4NAMA 3X11B 2VAAA 5KSBF 2VCOA 2JI1A 2LTQC 1AD9B 2AEQH 2CHWA 2OP4H 3L5XL 2E59A 3MQIA 3ALPA 2FAUA 3KDPB 3MLUH 5KANG 3PREA 5T3XE 3FXIC 1OE3A 3HNSH 3VAEA 3FQXB 2NY5L 5DJ0A 1N70A 1JPGB 3FQNB 1LHZA 3GI9L 4QOKD 2R83A 4RETB 3CFBA 4G7QB 5ACZB 4QOKB 1CBVL 1DQJB 1FNHA 1MFUA 2DQTH 3O9WC 3K8KA 4GY4A 3X1GA 5DHVH 2COVD 2J20A 3SKJL 5JPNA 3JYBA 1WH0A 4XBEH 4H20L 5KJRL 1JDAA 4I48A 4RZCA 4WDIB 3L2NA 1JPFB 1UZGA 1B2YA 1HILB 3MJ9L 4GRMB 4O51B 3QJQB 4WI7A 2YEVB 4Y7MA 3FQUA 5C0RH 2IAND 2A74C 2PTTA 3DXAA 3HI1B 5GPRA 4X7FC 4H8PA 4FXGB 5EU7C 4IRZH 1J11A 3REVB 4YJZL 4M1CC 5LKNA 1W80A 2D3VA 4Y1SA 2FECL 4WGWB 1LEGB 3W2DH 3HNVH 4BCXA 3T2NH 5IGXL 1A22B 2VE6A 3WKPA 4U1GB 2OX5B 5F7EH 2IQAA 2JKXA 4FG0A 4N5ED 2E7LC 5DRWA 2B14A 4Z7VB 1D7FA 1I8IA 1WWAX 3RKPA 4HS6B 3QUML 1FGNL 4LBAA 3RHWK 2AANA 3O3BB 2WPGA 4GBXD 1RSFA 9PCYA 1TO5A 1GS6X 4GBXB 5EEYA 4LASH 1AQ8A 4DPCX 4UQIM 2XDHA 4M7LL 5F2FA 1S4IA 3MODL 4GW4A 4ZW6A 4FFVD 1IBGL 3ZDWA 4ACPA 3K80A 4Q74A 1P1ZB 2GBVA 1R1CA 5JNYB 1R47A 1WBYB 1DSYA 1YUHB 2HLFC 5IB3A 5C0BB 4EZJA 2XOTA 4XMUA 3N43F 3RP1A 4GQQA 3DOSB 3HC0A 4AG4H 4NKDB 1VENA 1YNKL 2Z4QA 3AY4A 1TVBA 2CR3A 5ANME 1GJWA 4MNGE 1XBDA 4XWOD 3NZSA 1XF4B 2OL3A 2OMNA 4HK3N 1S78C 5CSGA 4P3CH 1PLGL 5FHAL 2YAQA 3BUBA 5IF0B 1G7MB 1A7BA 1OPOA 3WFEL 1N4XL 2XJKA 4OLXH 2YD4A 1RZGA 4XZUB 1DANU 4YWGH 3DTXB 1MFEL 1NEUA 4GIOA 3QULA 3G6JA 4L2YA 4ZO6A 3U30B 1NSNL 2KT6A 4YHOL 5IKCA 3HPJB 3TBVA 4UILH 4J3OD 1KPUB 4UNIA 3X3FH 4JFTA 4DP8X 3TC9A 5A3ID 2Z31C 1SJXA 3VXUE 4WO4A 1J0IA 1NCUA 1PZ5A 3EYSH 1RAMA 1MREL 3BH8B 4HK0A 2EIEA 1AHKA 2HG5A 4Z5RB 3MN8A 1N12A 3L3GB 3NJXA 5E00A 3P4NA 1TU2B 4KJPC 3T4AA 1ZVYA 4QF1A 3IETB 5JIMA 1CDIA 1U3JA 1ND0B 1WZ1H 3LQAL 2GUOB 1EK3A 5KWYC 4V33A 3L54A 4PJ8A 5LCVL 4EOWL 5BPPA 1WAAF 3PU7A 1FA4A 2V17L 2WBWB 4BEIA 4JHBA 3PJNA 2ZX5A 5I1CH 4ES8A 5DVMA 4XT1C 3DGDA 5AOKA 4MYWB 3OAZH 3TCLA 3KPRE 4HJEA 2OW7A 1A1MA 1NC2A 1WJ3A 3S2CA 4GW1B 1TJHH 1ORQA 3FU6A 3FT9A 1M71B 5FCSH 5IEKA 5JPMB 1GTNA 5L6YH 5TDNB 1SXSA 1JCVA 4AY0A 1KPVB 4NKMB 4QXUH 4F9LA 1CLOL 4X99B 2Q7YB 1HAWA 1FYTD 4FXGC 1XD0A 4LLQA 5BZWB 2VMCA 3K4DA 1IC1A 3UROR 4NP4H 4U1GC 2Y2TA 4I13B 1R5WB 4LLAA 2CLVB 1Z7JA 5FYLD 5J6HA 4IGBA 3V5KB 3FT4B 4F7PA 3B3IA 3FHEA 4FS0A 3WEMA 1FLRL 4JG5A 3AS0A 4QYOA 1MZZA 1OF2B 4RWHA 4DUVA 1INEH 2AQNA 1ILUA 1NAMB 2ITCA 5MENB 1EWHA 2VN7A 2VXSH 4F2EA 2R56L 1F6AA 5FK9A 2BVPA 4KK9C 1QFUH 4AITA 2Q2EB 1TMCB 6PCYA 3P9MA 1QKZL 4XO5A 3JWDH 4H8QA 4GP5B 4HGWA 5DMGD 3RVXC 4IIZA 2BLFA 5CAYB 3UBXG 2OTWB 2Y06H 4PRBA 2ZSVA 1UGKA 3BDYL 5KSBA 4QD2E 2VSKB 1EQWA 2CMRL 1AIFB 3P69A 3JWOC 2UX6A 4JAMA 1X5YA 3QUKA 3T0EE 4AVKA 4LDOB 4KKLD 5J1AB 2OK0H 2X4OA 1J8RA 4G7VH 3L5JA 1D3CA 1UATA 2NNRA 3X17A 1JNLL 3O6LH 3NZ8B 3OR7A 2CKBL 3RX5A 1W72L 4N0CD 4HUUA 4NBZB 2C9PA 4FJ6A 1C9SA 2GIXA 4L8BA 1JWSB 1NGPL 3MBXH 5JXED 4HH9B 5CJQH 5CZXD 5IBTH 5GS1B 4PJAE 1V7NL 4OZGF 1GAFL 3HLAB 3SJVD 2BSED 1TF4A 2MHAB 3BSZH 4R4ND 3T0XA 3SJVB 3O3UN 1OM3L 3NIGE 3BPCB 2H3XC 2IH1A 3O6FC 2PCXA 5DO2D 2ADJB 1BYOA 3PCYA 1KLFA 2D4FA 3JYCA 1EHNA 2JKSA 3AU1B 4HH8A 4ZTPH 5PCYA 4DK3A 3MNVA 3ROOB 3TJEH 1AOHA 1M2VA 2FB4H 2FQDA 3UC0L 4I9WE 1DBBH 1M7DB 5T3ZL 3VFTA 5JO5A 3T0BA 3N1QC 1EPFA 4DGWC 2G0LA 4H40A 3U36B 1LD9B 3HZMA 2G2RB 2HH0L 3BUIA 1B4RA 4XE0A 4WWOA 1DANT 3E38A 1ETA1 1WC7A 3MO1B 5PAZA 3ZJAA 2J8UA 4F5CE 2P1YA 3WNIA 5DZ9A 4QGTA 4Z7OF 4DUXA 4MBOA 1A7NL 1U95A 1A1NB 2F9BT 3WOVA 2QV2A 1Z32X 3QJUB 3SE8H 4LEEA 2Z91A 1HAUA 2V5TA 1T5WA 4MNGB 5EIIB 3FCGA 4MJ2A 5L0QB 1JF5A 4FYSA 3SZ6A 3DXAE 1HWWA 1XFPA 1MN4A 3K7UA 1K4CB 3D1MC 3PDDA 3T8XB 1J9CT 4J5VA 1NGXA 1OAKH 2JB6B 2VWEC 4FNLL 5AVVB 3IFOA 1IEAA 3BLBA 2WWMC 3ULUE 4LO9A 1VCAA 3F83A 5K9JH 1A3LH 1E3FA 4BFKA 3BWSA 1MCOL 1EDHA 1KFAH 3VXUB 4UQBA 5MEPB 3ES6B 3Q8FA 4HT1L 2BS8A 3MA9L 1BVNT 4IEFB 3WY3A 4P05A 5AEAA 5IB4B 1BZ9A 1PNDA 4HC1A 2Y6SD 4HIEA 5FDWB 4D0DB 2B16A 4B5EA 1DE4B 4P5SA 1OF0A 4KZCA 5FGSA 1S7TA 5IJVB 3E6FA 3MRGA 5FW7A 3NPSB 5FECA 4FG6D 3J7HA 3KW8A 1AHWB 3B6SA 3RIAF 5DUPL 3CIQA 3GXFA 2CDEB 4JHWH 4KKQA 1QOKA 1HL9A 3NRPA 5E8PA 4KMTH 2IPKB 3TT3H 4WTZG 1NBZA 3J8F7 2AJ3A 2Y24A 3BAWA 4HA1A 1BXAA 4NFDA 3SDXA 3KYMA 3SE4C 1NIFA 4ZUTB 4LOEA 3Q8CA 3RQ3A 1YN7B 4XVJL 3RB7A 4GSDL 4PRPD 2HVKA 3FQTB 4KMQA 1XF5B 2B0SL 2DWDB 1PCSA 4HAFA 1QFWI 5C7XL 3CFDA 5GHWL 3MC0A 4L5FH 4BFGA 1AQHA 2ZXGA 2K7PA 5JOEA 2ZP8A 3DIVA 1DBJL 5TF1H 4OD3H 3L5WA 4KDTA 2YK1H 3INUL 5KANI 4DWHA 4LPWA 3LNDA 3NG5A 4NQEA 2J6EA 2VR9A 3L3KB 2R27A 2A38A 1HNYA 3N2JA 4FQJL 3GM0A 4JKPH 4LSQL 2PCPA 5CJXA 2EE6A 3LNEA 2HVJB 5BO1L 4K73A 5HJ3B 3V7AG 1YA5A 1CC3A 4PJCE 3X12A 3CK0H 5GRUL 4P4KC 3IPFA 4RIRB 4MDIB 5D6DA 4ZUWB 2UWEE 4UMSA 4NUPA 4XXDA 3T0EB 1CD9B 3OAWA 1DQMH 1ZANL 1QRND 2ZWLT 3DHPA 4OUOA 1JIBA 1QRNB 2M1KA 3AS2A 4F57H 3KR3L 3H42H 2EVHA 5DMKA 4MJHA 4AQAB 3AJ7A 2BOCA 4M6OL 2V5SA 1RZ7L 3G5VA 3ZKMC 4R96A 3H2QA 5DUJA 3TOPA 1FHNA 5KW9H 5D7EA 1HH9A 1B6DA 4LGSB 3HB3C 4PJAB 3BIKB 1IGTA 2I07A 3UP1A 5AB2A 2X4TB 4OFYD 3WSQH 3KYOA 4OKVB 2DL9A 3SY0A 4XP6L 1SYVA 5FB8B 4NHCL 2R0KH 4OZGA 1MHHB 1WAEA 2VAAB 3N04A 4KX8A 3QJSB 3BPNC 4HFUH 5EG6C 4HIHA 1EZLA 5KYWA 4FNQA 3FAXA 1AHWC 3BAXA 5DJ0B 1MJ7L 1OD7A 5D7IA 2NPLX 3IM1A 4N8VA 3B2UC 5CGTA 4HUKB 5E9NA 3WIFA 3MGAA 2ALWA 1NL0L 2QKIC 1IGYA 3CFBB 2V33A 3IDXH 1AVAA 4HWBH 3W9DA 5I1IH 4H44C 1J8HE 3EKCA 2AQ1A 3UP6A 3MCYA 4ZOBA 5JPNB 4LQ1A 4BFJA 3DK2A 4JG1H 3VO0A 4N8UA 5DWUH 3AMLA 3Q8AA 4I48B 5EO0A 1J87A 4JDTH 4RZCB 4L1LA 4QNPF 1SJVA 3U0TA 2F1AA 2IG2L 2Z3FA 5F0LB 3VI3F 3FQUB 2PTTB 3DXAB 5FUOL 1HINH 2C26A 5K9QI 5EA0H 4KNQA 2VZ1A 2LU5A 3Q5TA 1UGNA 3GK8H 3U7AA 3OAYK 1N67A 3RL1A 1HYRC 4JFED 4JPKH 3SPVA 4Z3EA 2VE6B 2YD3A 1P4BL 3S3JA 2IQAB 5DRWB 4G83A 2F8OA 1NWOA 4XNYH 1I8IB 2ZZUT 2CG9X 4NQSA 3WJMA 2XWJA 1RIVH 2NYYC 3MRBA 4PM1A 3MCLH 1NDMA 4HS8H 4ODSH 4U1LA 5BS0D 4TVPL 5I0YA 1TEYA 3BAYA 2JWYA 3FK3A 4GW4B 2X89A 4XMVA 2WZ0A 1OQXA 3D4CA 3T0EC 4J12A 3U4BH 3QSKB 4W81A 3J2PA 4JY5H 4MJJA 2IPUG 3LH2H 4DKFL 2ZCZA 4KUZH 5IB3B 1WDAA 2FHFA 3QK0A 2XICA 1E3ZA 1UASA 1R3JA 4QGYA 3HC0B 5E03A 3GHPA 4PBVC 1KOAA 2Z4QB 1TVBB 3R06A 5DGQA 2OL3B 2C3GA 4W9FC 3FPYA 3JTTA 1ZPUA 3DRTA 3ATAA 3WJLA 1UOWA 2IFFH 1RZGB 1D6VL 1EAQA 1EX0A 4ZFQA 3QULB 3G6JB 5IKCB 4KVNH 4NNXA 2WWKT 3TBVB 4PBWD 3ETBF 3D0VA 2EABA 4WO4D 1HSBA 4WO4B 1PZ5B 3FC8A 2NYKA 3KHOA 4P59H 1FIEA 4HK0B 2A6JA 4XO3A 4FLOA 2HPOA 2HG5B 3SQOH 3VGBA 4J6RL 4KK6D 4OCXL 5E00B 1IC5H 3P4NB 4WWNA 2BJML 3N40P 1S9VA 5HY9A 3T4AB 3OQRA 2ADGB 5DZAA 2JI3A 3EYUH 4QF1B 3GMPA 5I0DA 1YNLH 5IW6A 3S9DB 5KOMC 2LAAA 4JQIH 4BIKA 4PJ8D 3RI5K 4PJ8B 1MH5A 2KI6A 1UT2A 2BW4A 1JHKH 2XKNA 1LO3H 1LWJA 4M8QA 3BZFA 2VQ1A 5D6CA 3CDZA 3GKWH 3TCLB 1A1MB 1IAMA 1NC2B 1UUNA 3EBHA 3TWYA 1ORQB 4N1CA 1WAAE 2F5BH 5IEKB 3V7MA 4DERA 1JGVH 1QW8A 5T1KA 3V4VH 1IQWL 3NZUA 3VXMA 1A47A 3X1FA 4EDWL 3C5XA 4OCYH 2EEDA 4JG9A 4E9RA 5IEHA 4QDGA 1KCKA 4LLQB 4GSUA 2XV2A 4YSOA 2NY7H 4NRYA 5IZ7A 3ULUC 3RPKA 4F2MA 5K93A 4IGBD 2W9DH 5J6HB 4IGBB 1ECZA 5DFVD 4F7PB 1NBYA 3B3IB 4KJWD 1I8KA 4QYOB 4Z0BH 5CILH 5LUMA 4NGHL 2JNZA 5CSZA 3NCWA 2ITCB 3RJOA 5FCUH 2QSCL 2FZ3A 1KG0A 2BY3A 1NGYA 5F0JB 5FV2A 1F6AB 1AACA 2HFTA 3DX3A 4NQEE 5FK9B 2BVPB 3O8XA 3VFGH 3P9MB 2WP3O 4B9PA 2PW2A 4HGWB 4V11A 1OCWL 3K2KA 4OF7A 3ALXA 2F7QA 3FFCA 4H0GA 4PRBB 5C6PB 1X7QA 2E6PA 5DLMH 5A2IH 2ZSVB 1GGCH 5KSBB 1BM7A 3D25A 3AY4C 4M5ZL 5TD4A 2GKIA 4JAMB 3QUKB 5FOJA 1OK0A 1DLHA 1PTZA 2X4OB 4UTCA 3V52L 3TX4A 3MJ8A 5D2NA 2IBGA 3Q1EA 1EJ8A 3VFRA 2NCMA 4AEFA 1QW9A 3OR7B 2DQGH 1ID5I 4HUUB 3NJMA 2WANA 4L8BB 1J9QA 4KHTL 3B7RL 2YQ2A 1EFXA 5F3FA 5AKSA 4LOVA 1OM9A 2IH1B 1Y1DA 3DX7A 4BSVA 3MOQA 2AJZA 5IFJA 1KLFB 4UDUA 4OZGE 1SNRA 1VPOL 3E9UA 2BP8A 2J88L 3S88L 4X5WA 3MNVB 4MGXA 4JRFA 1M2VB 1AOZA 3UYPA 3RURA 4C57C 3LZQA 3QWQB 4FLSA 4RFNB 4NZRH 1CK0H 5JO5B 5HHVH 3O2DL 3VFTB 1KTCA 1SN2A 5I1HH 3COOA 5GS2H 3FUFA 3LVTA 4JFDE 3RNQA 3HZMB 2ZX9A 1JRHH 2ZXCA 3LPPA 4J27A 1SBSH 3BDBA 4KVPA 5C0GA 1WVZA 1WC7B 2HPTA 5IVXF 4LOUC 2BWIA 4KV5F 2J8UB 3OLGA 4P2QA 2XVBA 5E4IA 4KI1A 4CJ0A 1BVKA 4NZTH 3A6BH 1QI5A 4G6JL 1U95B 3CVHA 4LLWA 5JZ7D 2K8QA 3FKUS 2BFGA 1A3ZA 3BD5A 1WFOA 1QQDA 3EOTL 4AK1A 2Z91B 3U4EA 1T5WB 4Z7OE 3UPAA 4ZMVA 5I1EL 4OM1H 3QC6X 2F15A 4FKHA 5FGBA 5AG9A 5ICYA 4QIRA 2YGNA 1NGXB 2BDNL 2KDYA 3GBML 3IFOB 2LLNA 4D8OA 1KTLA 1IEAB 1WEJL 2WXLA 4FNPA 4EI6A 4O9HH 7PAZA 4X0KA 3N85H 4IKKA 1TIUA 3L9RA 2ZKHH 5I6OA 2EH7L 2FX8L 4LRNH 3ESNA 4RGND 3F05A 1F0LA 3ZZSA 1A3RH 5EF1A 4RGNB 2WSKA 4PW3A 1BZ9B 4B50A 2YQGA 5F9WC 2OM5A 4H1LA 4HIEB 4ZFFA 3PP3K 5IT2H 1JXFA 3X3GH 1M9SA 1AO7E 1YEEL 2HKHH 2LR4A 2YSSA 4KRNA 4A04A 1ZXKA 3QXAA 1S7TB 3FPXA 5F1OB 3E6FB 3UYRH 1BQHG 1Q0XH 3MRGB 5AL8A 5FECB 3B6SB 3TFKC 2E4TA 2VRKA 4ZPTA 1C08A 2DQHH 5C0CA 5E8PB 4I3RH 4JJHA 2ZF9A 4WTXA 5FFGA 4BQCA 1HJBC 1NBZB 4P2CG 2BRRH 2AJ3B 3GSUA 3P3TA 4JFOA 4PAZA 1R0AL 5CUSL 3SDXB 1YMMD 3KYMB 2OCFD 1MHEA 1HCYA 3GJEA 4PLKD 3W5NA 1J1OL 1MQKL 5DO8A 4K5OA 1MCPL 4AH2A 5CEZH 1RK0A 3KVQA 2HVKB 1U8OA 4AQ8A 2B4CL 3CFDB 4JVUA 1AYOA 1TZIA 4LHUG 2WB1A 4W6XB 3SO5A 5CKAA 2R8SH 3VXNA 3FUIA 3U1QA 3BE1L 1VEMA 3L5WB 5GGSY 4YSCA 5CD5D 4HWEH 3DSFH 4G5ZL 3IGAA 3EJYC 1X5MA 1KGCD 2BK8A 1ZLSL 4XMPL 2YS4A 3VFSA 4NQEB 2E6JA 1QABA 1IAOA 3IJEA 5DT1L 2PCPB 1L6ZA 5F7NC 4FERA 4C58B 1SYSA 3GO1H 1DVFA 4L9LC 3WEOA 4V1DA 1HHIA 4YHZH 4L0PB 5MEOA 2F5AL 4R2GB 3BQVA 3WO4B 3X12B 2XI9A 2XACC 2ZXAA 5K1NA 3DDFA 1YPZE 3QEQA 4XXDB 1NFDF 3BH9A 4K8RL 2XC8A 4TTDD 3WTUA 3P2DA 3VXME 1YY9D 5A2JH 4FGMA 4HKBA 3TWCL 4EBQL 4AI7A 5DMKB 5L4FA 5ILTL 2Y7MA 5CJOH 1JCKA 2BOCB 4XCYA 2ZUQB 2UZYA 2IVFC 3G5VB 4ZODA 1OWWA 3QP3A 4R96B 5DD3H 5DVKA 1HH9B 5D8JL 5EZOH 3OJMB 1IGTB 2I07B 1QBMH 3KYOB 2WJ5A 4O02H 3LDBB 1JOIA 5JYLA 3PGFL 3SY0B 1BAFH 1SYVB 4ZQKA 3V4PA 5GRVL 4B9KC 1EXUA 4OZGB 3CIAA 2Z8VC 4U3HA 2VDKH 4AEIH 4BGLA 5CGBA 1BIHA 3L4ZA 1MFAH 3BVDB 4HIHB 1XGPA 1YEIL 2XZQL 5KYWB 1RXLA 7PCYA 2G2PA 3BKMH 3HFML 4XNXL 1FNSL 4CMMA 1L9MA 4N9GA 4DTGH 1GR7A 2VDLH 5EEWA 1ZTMA 1GGTA 2CRYA 3N0AA 5LAPA 1XGYL 3NSYA 5D7IB 4N8VB 3WIFB 2EC9U 4FQCH 4CBZA 1CG9A 4LF3A 1IGYB 4DETA 3W9DB 3DMMC 4TS6A 3B5TA 5IK3A 5L88H 2DLHA 2YN5A 5D2NE 5I1GH 3I6SA 1IIIA 5EO0B 4A7GA 2JMRA 4B9YA 5B3JF 4ISVA 2SEBA 2MNWA 3U0TB 1LEIA 4OH2A 5IVXA 5BOPA 4LFHG 2X6CA 2D7TL 3U0PA 1TFPA 2B1AH 1SRDA 3RJQB 4LSUL 4C55A 3EJUA 5BUGA 3FCTA 3VU2A 4QNPE 2QV4A 1NFKA 2P80A 3L3HA 3KPSE 1D5IH 3OKLA 1CD1A 1L0QA 1CXKA 3RL1B 3OZLA 4BFIA 3VI3E 3JVGC 3SPVB 2B1HH 2IAMD 2B39A 5DRZA 1W6WA 4BZYA 2LV4A 3NA9H 1NANH 3GLDA 3CSFA 4JG0H 4NQSB 3V0JA 3S3SA 3WJMB 1BECA 2HFGL 3HMXH 4GXUN 2R0WH 2XWJB 4W9KC 3T8MA 3ZPDA 5CLWA 3MRBB 2WUCL 3KLAA 3D5OF 1NC4A 2DOCA 3WO4C 1NDMB 4U1LB 4XN7A 3US0A 4NBYB 4W70A 5HSFA 4BZ2A 3NGBB 4PS4L 1H8SA 5CLZA 1CBJA 1JMXA 4P2QE 4PGEA 3MBWA 5EOCH 5D1ZI 1W6LA 3KLHC 2X87A 2ZX8A 1OAUL 1CQYA 1V8HA 5F96L 1R3JB 1NJ9A 5DQDH 1CLYL 4I87A 3R06B 4XB8A 3VWJD 3R0NA 2XG4A 2ZUQC 3Q6FA 3JTTB 1OPGH 3DRTB 4GRLA 2ZAIA 2NTSP 4ABVA 5ESAA 1KCBA 1FRGH 4FADA 3UCQA 2PWEA 3LDBC 3KE0A 1E6JH 4P9HL 4NNXB 1SM3H 5E8OA 4OSUL 3BN9C 3DJZA 3L5XH 5CSBA 3D0VB 1HSBB 2YD9A 5C6TL 3HZYA 2A6JB 1OP3H 4X7DC 4KITB 2NY5H 4D2NA 3QDJD 1U2CA 3OMAB 1QSZA 3QO1A 4P48A 4BK5A 1S9VB 5HY9B 3KGRA 2N7AA 4M4RA 1SXNA 3GMPB 5IW6B 3WN5C 1CBVH 1I1RA 4AEEA 3ASWA 3SKJH 2WO4A 3ABMB 1MH5B 4H20H 4I1PA 3MRJA 5KJRH 2XKNB 3S3BB 5ITFA 1O5PA 3WAKA 3WFHA 3VW3L 3MJ9H 3BZFB 2W0FA 4M8QB 5C0CE 2VQ1B 5D6CB 2VLLA 1N59A 3CDZB 1GY2A 5T1KD 2DL2A 3APDA 1QBLL 4HV8A 4UQ3A 5T1KB 5J56B 4ELDA 4YDIL 5EN2A 3CQFA 3KBPA 4HIJA 3VXMB 4XNZB 5IEHB 4FCAA 2VDOL 5IGXH 2FE0A 4GEJA 4P9ML 1UYWL 2M8XA 4MB4A 5HI5D 2YEQA 1NFDA 4NRYB 1JTTA 2V3DA 4F2MB 3BT2L 4I3SH 3QUMH 1FGNH 5C0ND 2BVQA 1NBYB 1X4ZA 4OUUA 4ZZKA 1I8KB 2AS5M 1TTFA 2CU9A 3IJYA 5CSZB 3QPKA 4JW3A 4GMTL 3MODH 3DRQA 1HKFA 1KEGL 1IBGH 1KG0B 1KJ2A 1NGYB 2FZ3B 4N86A 3CVIL 3O8XD 3SOBL 4R7NA 3T65A 5A16A 3O8XB 5ECJE 4YSSA 4QHUA 1J0KA 1I85A 1CL7L 1RZKC 4ZAKA 2PW2B 4OV6F 1MSPA 3FFCD 4UM9A 5F8QC 2P46B 3WAJA 4A6YL 3FFCB 1YNKH 4RRPG 4V1DE 2MTAA 3Q6GH 1X7QB 3HE6A 5HYFA 1V3MA 2V5RA 3D25B 3KCWA 1PLGH 4LSRL 2Q3ZA 5FHAH 1WGOA 4Y9GA 4OM0L 5I66A 3QHZL 4ANKA 3WFEH 1N4XH 1DLHB 1KYOK 3IDIA 5C0EA 1ML0A 1MFEH 3MJ8B 5D2NB 4MASA 1NSNH 4YHOH 3WJLC 4HX1A 1IEBA 3JWNH 3N40F 1I1FA 4CSTA 3VFRB 1FFQA 3CXHK 1RK7A 1MREH 3L6FA 3SBQA 4AEHL 2VSMB 4RGMC 4UT6L 1EFXB 1YEWA 2YPVA 3LY6A 2ITEA 1G84A 1JPTL 3DX7B 3LQAH 4BSVB 1EFQA 2V3FA 3ROLA 2AJZB 5IFJB 5IOPA 4UDUB 4KFMA 1CLCA 5LCVH 2RQEA 4EOWH 4PBDA 2BP8B 5CP3A 4W9DC 4X5WB 4IRZA 4O2FA 1WZMA 2CO6A 4AGMA 2V17H 3UYPB 3QUHA 5B1JA 3VACA 3OZKA 2WLKA 4XPBL 2P9RA 5F70A 1MW1A 1NCTA 2XWBA 2AQ2A 4XPGL 4BZ1L 3RNQB 5SWSE 3P3RA 1IVLA 3TF4A 1UACL 3O3EA 1JNJA 2ED8A 3DV4A 1LP9A 5C0GB 1P5UC 4FXTA 1CLOH 2VDML 5H37G 1XV8A 1URIA 3GUFA 4Z7QF 2WXGA 4P2QB 3UL4A 1BVKB 2O61A 1GGYA 2P5WE 4XNZC 3EF7A 4Z3FA 4JZNA 3CVHB 4LLWB 1XCWA 3ECVA 4AYSA 1QQDB 4KV5E 4HJ0D 1U8LA 2WYTA 3IU4L 3U4EB 5DC2A 1AZNA 2KQNA 2P42B 4WW2F 4AM0Q 1BEYL 1UM6L 2DYRB 5ICYB 2AK4A 2R51A 4K71B 4WGVB 1N2RA 1KTLB 1X5AA 2R56H 3QJTB 1UB5A 4EI6B 4WEBL 4QKXB 2Y7NA 4X0KB 1QKZH 2ARWA 3DROA 3L9RB 4JJ5A 4KK8D 2Y1AA 4XNUL 4OI8A 1KJVA 1NCIA 5DEGA 3CFIC 2CMRH 1E4WL 1DR9A 4HZ1A 5EF0A 4BELD 3RE0A 4H1LB 4ZFFB 2YSSB 3BCDA 4WWKC 3QXAB 2RCSL 2XQBL 3BZ4A 4EVNA 1SHXA 1JNLH 4MQTB 4ZX4A 2VRAA 4C8XA 1OY3B 2CKBH 3QQDA 1W72H 3LXBA 2VGLM 4ZPTB 4KQ0A 1C08B 5C0CB 4ZFZA 1PZ2A 3MLVL 5IOKA 4KAQL 3ATEA 1GAFH 3MCG1 1CDUA 4OQTA 1TYRA 2K4WA 2C4FU 2E74C 4PJ5A 2PR4L 5EU5A 4N8CL 3GSUB 4JFOB 1KCLA 4WWID 1PBYA 2EDXA 2WZ5A 3L13A 1ZLWH 3AITA 1MHEB 4Z23A 3GJEB 3RRQA 1G7HA 3SDDC 4XVOA 1XD1A 4DP0X 4L3AA 1S9WA 4AH2B 1RK0B 3UC0H 1U8OB 3HC3L 3G6DL 4I7ZC 3MV7D 4G2AA 3FF8A 4DGIH 1EHLL 2XKSA 5T3ZH 1TZIB 3HOGA 1XCQA 4NNYA 1T7ZA 3VXNB 2QFRA 4GUPA 3I75A 1OOAA 2ZUSA 4P23C 2WQVA 2HH0H 3MFFA 3O4OC 1X6LA 3IGAB 3RVWD 1CL7I 4PGZA 4WIQA 5F7DA 1ZLVK 1X5FA 3FRUA 3OPZL 1XR8A 2LU7A 3D06A 3VFSB 4UTBA 5LHDA 4GS7C 2F18A 4NN6B 1IAOB 3ESOA 3IJEB 1A7NH 1RV6X 4DKAA 1SYSB 2GTZA 1DVFB 1A6UL 2IGTA 4V1DB 1HHIB 1EZVY 5MEOB 3FT3A 4XN8A 5F7WC 5HI3D 3QEQD 4POZD 3MV9A 2F08A 4K3EL 2V2TA 1PKQA 2CCWA 3QEQB 4FNLH 3BH9B 1AXTL 4CMHB 4MA7L 3C8HA 4Q14A 4OLYL 4HKBB 2WWOA 3C6SA 4ORGA 4C47A 3ULSA 3C08L 4N8PA 3L9YA 1HHHA 1NFDE 1MCOH 5IROA 4EUPG 2AQ3A 3CHSA 2ZONA 1MFBL 4XCYB 4HT1H 3MA9H 3W11D 2UZYB 1KIPA 3VG9B 3OGCA 4NT6A 4X4ZA 2BVUA 2ADIA 1MRCH 2WW8A 3WI9A 3EZ8A 4HS3A 3D0AA 4QTIH 3NJJA 1NWPA 3KS0H 1BCIA 1H6UA 3ZKQD 2R7EA 1Z5LA 3OZ9L 3TNNA 4ZQKB 3V4PB 1EXUB 5DHXB 3MYZA 4GQRA 4Y2LA 3F5WA 3MKKA 5DUPH 1XGPB 3CVDA 2OYKA 3MPCA 4CMMB 5IMLA 2V37A 4N9GB 3TLRA 3UBGA 3WXVH 3BX7C 4GMSL 1CG9B 1GGBL 4LF3B 3BP6A 5JHLA 3RIFK 1GMEA 1TQTA 1XMWA 3CMGA 4Y9FA 5IK3B 2Y7SA 2KMWA 4HW6A 1U2HA 4WNQA 4RESB 4XVJH 4ZMZA 4GSDH 5TE6H 1BWWA 3RGVA 3K0YA 2DICA 2AHIA 5LNDA 4QPEA 5KBMA 2B0SH 3F7VA 4ISVB 2SEBB 5GHWH 1LEIB 1MEXL 2Z8WC 5IVXB 4Z95L 5I9QB 4A2LA 3U0PB 3MRMA 1DBJH 5F1IA 4MZ2A 4OKDA 3FCTB 3INUH 1SJHA 5B3JE 3VFUA 3L3HB 3CH1A 3QISA 4OJFL 4MNQD 3OKLB 1CD1B 3PWUA 5AQ0A 1AS8A 3E0GA 3GDBA 5MI0B 4BFIB 4E5XG 5KVFH 4WI3A 2P49B 4WW2A 3U4KA 1EO8L 4FQJH 2QADB 1W0WA 3IK2A 3IDJB 3QDGA 5D70L 5DRZB 4YUEL 4JNXA 3GGWA 2BZ7A 3AROA 4U7KA 2PETA 3B5HA 1GL4B 4PJ9D 1DVFC 5GRUH 4FLQA 4KOBA 3KLAB 1JNHA 5HHXL 3TEYA 1NC4B 3WNNA 1X9LA 4HOXA 2EDOA 4PJ6A 1KENH 1KB9J 2X3CA 3KR3H 1DBML 4PGEB 4U6YA 1BF2A 4WU5A 3MBWB 4CMHC 1YY8A 3OHXA 1BVZA 3B4NA 2EDYA 5KYNA 2IDTA 1QP1A 1NJ9B 4M6OH 4XVUC 3L4WA 4QRQA 4PCKA 4NIKB 2XG4B 4R7XA 5JHDA 3KLDA 2OR9L 3Q6FB 5JW4N 5DZLA 2P3YA 3F84A 3KJ6L 1YEGL 4GRLB 4PP1D 5ESAB 5M7QA 3K6DA 3NZHH 4XP6H 3LD8C 3OJ2C 3SYQA 2FEDC 4NHCH 1LDSA 5E8OB 2KLTA 5IR1A 1UWXK 5D72H 5FKAA 4Y5VC 3P30L 4A67A 4U49A 3ELAT 2A77L 3HZYB 4FFZH 2VR7A 1MJ7H 1WUNT 4IRSA 1S2EA 3QIBC 3QO1B 3VXTA 1QA9A 5L4IA 3G5XA 4M4RB 3UTTE 1NL0H 4QCIA 3CZFA 5HYEA 2RFXA 4OF8A 3PAVA 1M42A 1CVRA 1NCCL 2R23A 3Q2WA 2GB2A 3G5YA 3MRJB 1ACXA 2OTUA 2XCMC 4Y9CA 2G5UA 4XP9L 1H3TA 4LCCB 5ITFB 3WFHB 1DJWA 4PS7A 2IG2H 2W0FB 4M7KL 1T66D 1N59B 2VLLB 2ENQA 4S0TD 3RTLA 4CSSA 1Z3GL 1J5OL 2DI8A 4HQQL 1Z2KA 5I9QC 5D4HA 2ZTBA 4FTDA 4PJ5E 4HV8B 4UQ3B 3SYAA 5CGMA 2X40A 5MERA 2OMYA 4OFQA 4F93B 3JTBA 5EN2B 4FAAB 2HLEB 4HIJB 1MCRA 2W5PA 4PV8A 4GPVA 1IGCL 3FCUB 4WI2A 7FABL 3DNKA 3N44B 4RBPK 4YK4C 4N22A 1JXJA 1KGUA 3T6QC 1U8MA 4R83A 1NFDB 3H3PH 2BFVL 2QADC 1WWCA 2BVQB 5EBLA 4ZFOL 2G60L 1RIUL 5B3NA 2P43B 3IB4A 4OUUB 2EUVA 3IJYB 4EIBA 4GQPH 5D1XA 1A02N 4G42A 1QPKA 2NR6A 2BZCA 4IDLA 2DN7A 4TVPH 5GZOC 4RAVA 3DRQB 1KJ2B 3HS8A 4K3DL 2D3JA 4R7NB 3T65B 5A16B 2PWHA 1AY1L 1G7PA 2AQRA 3LVEA 1CS6A 1XH0A 3OB0H 4QHUB 4ZAKD 2PCFA 1EO5A 1Q9LA 3QUGA 4RZKA 4ZAKB 2YXVA 3LHPL 2LQRA 4E36A 3L95A 2E27L 5D7KD 4UM9B 2H6OA 3HE6D 4M3JA 3P0VL 2WSDA 3HE6B 2VJ0A 1KC5H 3F64A 4F9PA 4XMTA 2ADFH 4XTRC 3BFWA 3C60A 4XXWA 3MV9E 1PLCA 1PKQE 1BJ1H 5I66B 3IDIB 1IGFL 1D6VH 5C0EB 1OCCB 4YDVA 1E7UA 3GZQA 4GRLC 1Q9WA 1IEBB 1EJOL 1S3KL 2V2WA 4HX1B 4C56A 1I1FB 5C8JA 2GI7A 1NGWA 4W68A 3QQ9C 1OQOA 2ZUXA 3FQWA 4TLTA 4X4KA 4BFNA 5AW3B 2Z93A 3L6FB 2AJSL 3IMSA 5I28A 1LL1A 4FX5A 1FVEA 4UOJA 4ZMNA 1CYXA 4WFED 4EIGB 1BOYA 4J3SA 2WQ8A 4C54A 2FEJA 2KYIA 3ROLB 2XVLA 5IOPB 5E1AA 1TETL 3PDGA 3FOMA 3WLWC 2HMID 1MQ8A 4U3SA 3C2AL 3FUDA 4XWOC 4X80L 1U4FA 4O2FB 2CO6B 4WNSA 4X9BA 5FM5M 3UJTL 2I27N 1OB1A 5IREA 1KV7A 1OCOB 4GXVL 3TM6A 3TZVA 1EZSA 1WLHA 1JD9A 1JUFA 2CZNA 2XWBB 2EVGA 1M6OA 2AI0H 1H5BA 2VO8A 1I9JL 4ZBJA 5FO8A 3RDTA 2A99A 3DJSA 1IQWH 1L4IA 3O3EB 4LCUA 3MXVL 3DV4B 2AITA 1LP9B 2APBA 3NABH 4EDWH 3LN9A 3IAPA 2PYEA 5F7KC 1MUJA 2O61B 4H8UA 2YD5A 1A7RH 4JZNB 1L3NA 2IDUA 5GS0H 2WNGA 2RR3A 5D71L 1U8LB 4Z7QE 4F8QA 2Q6WA 2XQYK 3APMA 1MJ8L 1ZGLP 1WQVT 2AK4D 1XL6A 2AK4B 2XTSA 1H3GA 4BYHA 1BP3B 1N2RB 4UNTA 1NUFA 1UB5B 2VDNB 3MXWH 5F7UA 2R69A 4OI7A 1FO0A 2Q8BL 3ZR6A 1AGEA 3LRKA 3QDGE 1UXLA 3DROB 4Q9QL 3BP7A 4JJ5B 1OCWH 1KJVB 3JUZA 3DURA 4WHTA 1X5ZA 4AE1A 4MVBD 5DEGB 1IB5A 4YBLC 3RLSA 3T0VA 3PNRB 3QZOA 5LGHL 4U3XA 3GMQA 3V52H 3AREA 4EQ3A 1AGFA 4JB9L 5I0ZA 4N26A 3L9BA 1UKQA 4G1MA 3BZ4B 4DJMA 4UQAA 4EVNB 4CGTA 3QQDB 2NQDA 2WYZA 4HGKC 4HIXL 3OLDA 4OD1L 4Z77A 3CMOL 4ZFZB 3BW9A 1WG3A 3HAEG 2QVIA 4HKZA 5JHDE 3CZJA 1JWUA 3ET9F 3LX9A 2KQMA 4GIAA 5DHYA 4OFVA 4PJ5B 4WY7H 1QG3A 5EU5B 1BQHA 4DPBX 5I0XA 4FNSA 3QAZC 2CXKA 2DYPD 2WOBA 2EACA 2FDBP 2FX9L 1G7HB 1XDTT 3M45A 4M7ZB 2DLFH 1S9WB 4WNJA 3V4VA 1HZKA 5SWZA 1FORL 4MMYA 1E5CA 4EXPX 3HVDA 3HS9A 5JW5A 3O2DH 1XCQB 5B1JC 4NNYB 3HJEA 5I19L 2L4OA 2AJXL 4GUPB 3I75B 2UZIH 4FTVE 4L5FE 5AVYB 2NTFA 1E65A 3BKYL 3MFFB 5F7DB 3FRUB 1IJNA 2DAVA 3WFCH 3FQ2A 4YDJA 1E9QA 5AVUB 2AEIT 3LCYA 2ITDA 1B9ZA 3MCKA 3MJGX 4G6JH 1RIHL 3SDYL 2OXGA 4K9EL 3QHFL 5ESQA 5IY5B 5JQIB 4X8GA 2GTZB 2A9CA 3FB7A 3EOTH 3WFDL 2X44D 2WWNA 3FT3B 3GRWA 5I1EH 4UTAL 1BD2D 2HFEA 3DDGA 3MV9B 2ZSWA 2V2TB 4R8WL 1PKQB 2JLPA 2BDNH 1OL0A 3IKKA 3PNWA 4A6YB 1G9HA 1WEJH 1KXVC 3ARGC 5C07D 4FQ2H 2H9GA 3VD5A 3C6SB 4ORGB 4W4OA 1XAUA 3ULSB 3KLSA 3QJVB 4D9LL 1MIEL 4HPHA 1HHHB 4WEMB 4DO6A 3R19A 2VLMD 4M6NL 4RX4A 2E3VA 1BM3L 4AX3A 4NNPL 1KIPB 2GC4C 5T5NG 5D55A 3OGCB 5CIPA 3CVBA 3UTSD 4NT6B 1PAMA 1HYSD 2ADIB 5L2KE 5D1XE 2ZP0T 4HS3B 3GBNL 3LZFH 5KTEL 1YEEH 4N2CA 4MCNA 4QTFA 2YD1A 2MNUA 1Z5LB 2R7EB 1EEYA 1UWGL 3TNNB 1TDQA 3ILQD 4LGPB 4DSYA 3QVAA 1DQLL 1MF2L 1EBPA 3F5WB 3LHAA 5CZVL 1WYJA 1LO5A 3WV0A 3U9UA 3LS5L 5IMLB 5FYKL 2IOIA 4MDRA 3BYTA 2WVSA 1IBZA 3L4XA 3KYAA 1OAYL 3D4GA 1IKFL 3ZDXB 1R0AH 3BP6B 5CUSH 3AUVA 2E6QA 1MCHA 2AGJL 3KAAA 4Y1AA 2QPSA 1J1OH 1H8OA 1MQKH 1HT6A 3BOVA 4WNQB 5F7LB 3RGVD 1MCPH 2O6EA 2P47B 5K1VA 5EIQA 3RGVB 4C56E 4DEWA 4IBVA 3LRGA 3F7VB 5JOPD 4PWEA 3FCBA 5EMYA 4JPIA 4UQ9A 1FG9C 2WBJA 4JFFA 3MRMB 5F1IB 1KGYE 1QPXA 3BE1H 3T6XA 3QIWC 3QG6A 1SJHB 1JZJA 1BX2A 4M1DL 4G5ZH 3VFUB 3FH5A 4FXKA 3VA6A 3CH1B 3DWTA 4XHJD 3DLQR 1ZLSH 3SO3C 4XMPH 3PWUB 1VRSA 4MFHA 1IKNC 1ANUA 4WW2B 2MKWA 5EC1A 1W0WB 3QDGB 3O2WH 3VQMA 5F9OL 4YHPA 4LEBA 2EE3A 5D2LF 5HGDA 3GGWB 4YDMA 1CDBA 3LIZA 1AGCA 5F8RC 4YL9A 3LNIA 3WELA 1JNHB 4DCQA 4E0RA 3JWDC 1QHPA 5J4MA 4ODVL 4K8RH 3LZLA 4ODTL 3QWRA 1LM8V 1AMXA 2DI7A 1DVSA 1NEPA 3UGUA 2CK0H 4EBQH 1RVFH 3IWUA 4U6YB 4WU5B 1YY8B 3RX8A 3OHXB 4OY9A 2VC2B 1VFBA 2GUYA 5ILTH 4BRJA 4J2XA 4ANXA 5IROC 1J18A 4QRQB 4WSGA 5D7SL 4OF5A 1BOGA 2MCG1 5D8JH 5JHDB 4G11A 2PO6A 2QGEA 3MZGB 3KM1A 4TNVK 1O6TA 3NAAH 3U9PL 3NVQA 4Q9CA 1TYEB 1WBXA 3KGSA 5FGBC 4Z7AA 5IHUL 1TKWA 3PGFH 2DRUA 2OI9B 2VL5A 3MRLA 5B39A 4WHDA 2P24A 2RBLA 4WZ9A 4IOFC 2WUBL 4MMZC 4YX2L 4CKQA 4IRJA 5I23A 5IR1B 5FKAB 5HYIA 1YEIH 2QJDA 2XZQH 3HFMH 1FNSH 3DUHA 1R46A 3ETSA 4IRSD 5L8KB 4IRSB 1XGYH 3VXTB 1N0LA 1QA9B 1OALA 3OD3A 3G5XB 3WUWG 1IC7L 4QCIB 3CZFB 2UY7A 2RFXB 4L1TA 1UWEL 1KN2L 1HQRA 4KHXL 2R23B 3ZKND 3G5YB 3VGFA 2OTUB 2N56A 3KVPA 5AVSB 2HP4A 4LHJB 4JPVL 4LBEA 2D7TH 2BVOA 3OMNB 2OR8A 4LSUH 1L9SA 5T5FL 3RTQA 4FABL 4FJYA 3N1PC 2BW5A 2Y6TE 5MERB 5BCAA 2OMYB 4K23L 1FGVL 1WPCA 3EO0A 1KCUH 1U33A 2XUWA 5KBLA 4PV8B 4NUGH 3TF7C 2H0FA 2YMTA 4KRMB 1PZBA 5HDQH 1U8MB 3F04A 4WW2C 1HN1A 3MLPA 5D1ZD 1ZD6A 1VZGA 5EBLB 4IBUA 5I1LA 2EVFA 2WUCH 5D1QE 2BOBA 2NR6D 1DO6A 5D1XB 6FABL 4G42B 1X5HA 4HJSA 4M61A 4LIQH 4RAVB 4YE0A 3KWXA 2VM3A 4PS4H 4G43A 3Q2NA 5AVWB 4KQ4H 1CICC 4L0ZA 2N0KA 1G7PB 1XCXA 1LYQA 4O02A 4TQPA 5AKRA 1GA2A 3PWLA 4Z7IA 5F7BA 2PCFB 1OAUH 5F96H 1Q9LB 2CIIA 4S1SL 5IMOA 1W0VA 5HYJD 3L95B 5KAQG 3OHXC 4L4VE 4PJIF 3B9EA 3QZWA 4F8OA 1WFMA 1JGLH 3C60D 3D85A 2C9AA 5C09E 4OZFH 5FIEA 4N4YB 3WY2A 3C60B 4YVUA 2IBBA 3QJRB 3S48A 1EGJA 4F7MA 1DZ0A 1UB6A 5K39A 2WTRA 4UT7L 1F56A 4YDVB 2EJ1A 1Q9WB 2V2WB 2FO8A 3T6ZA 4Y4KA 4C56B 4OSUH 1WFTA 4FI8A 5C8JB 1NGWB 3MMEA 3ZKXC 2MTPA 1DVYA 2GBTA 3FQWB 5C6TH 1BXXA 4NJ9L 5JIKA 2Z93B 4L3EA 4HGMA 5IJKA 4DQOL 5C86A 1NUGA 2FQEA 4JDVA 1VESA 4IQHA 4BH7A 5FO7A 1FVEB 4ZXBC 5TDOA 4DOHB 4F33A 3HMWL 5C3TA 3JV0A 4YXHH 4B3VA 2JKJA 2BSCA 2WLLA 1FFPA 3MTXA 4NQDA 5E1AB 1OCRB 4MQXD 4GUQA 3FOMB 3OXSA 2Z7ZA 4U3SB 2FHBA 4GKLA 1PDKA 3TZVD 1OB1B 4GEIA 3VW3H 4G8EA 1G0XA 3TZVB 2HCZX 4FQ1H 1JUFB 2IBZY 4JDZA 4M56A 1M6OB 1OGAA 1H5BB 3UZQA 2AXHA 4IHBA 1M57B 4NQCA 3CPUA 4JKWA 2VXQA 3OJVC 5FO8B 3RDTB 2Y5TA 2QPFA 4YDIH 4LCUB 5D2LA 4YOKA 3VRJA 2PYED 2WNWA 2PYEB 5JHAA 2V8MA 4U7SA 1MUJB 3FO2A 4R5TA 4X7SH 3ARQA 4R97C 3D12B 3NJLA 1NUDA 3BT2H 1ZA6A 4QHPA 2BWQA 1CTNA 3D3VA 1AXSA 3DHMA 2V9QA 3HHSA 1CGSL 2Q6WB 1PF3A 1WZKA 4G5AA 4JUSA 2E7MA 4OJAA 3HZKA 3I85A 4DPAX 4OIAA 1NPUA 5EFIA 4GMTH 3L45A 2HXAA 1KEGH 3B9KD 2G5RA 5D1XC 5HHOA 3CVIH 3SOBH 2ZWYA 4E2OA 5B38G 3MSPA 2V3EA 1FO0B 3O0LA 1AGEB 3ULVH 1I3VA 2EXWD 3BP7B 2WVVA 2VO5A 2OJZL 3OKDA 3DURB 5DEFA 4A6YH 2IWKA 3LZNA 1PEZA 4WHTB 4G9FD 2C3WA 2RJMA 1RZ8A 1L5GA 3BT0A 4YFLI 3ZYOA 1ACYH 4LSRH 3U4AA 4JO3L 3JZYA 1IBBA 4FXLA 3NH7H 3LS4L 4F9PC 3GMQB 4UIKL 3AREB 2ZOWA 1BG9A 4XXWC 3VE0A 2CHXA 5I30L 1UWFA 4YXKL 4Y5YC 1AGFB 3KXFA 4G1MB 1JE6A 1HIMH 1VFAA 4GFXA 4PLOB 3CFEA 1MWAH 1DBAH 43C9A 1ZY9A 4I2XE 1HSAA 4AEHH 4UT6H 4Z77B 5E7FA 3BW9B 5AALA 1CE6A 3WKNA 1AZBA 5HYSG 4HKZB 2EVJA 2BVEA 2ZKYA 1JWUB 3ILPA 4JKLA 2DBJA 5DHYB 4R26L 5E2WL 1BQHB 1RK1A 1G7JA 1JPTH 3T3MB 2Q10A 4GIPD 5F6HJ 4A38A 5E9AA 1U3NA 4G8IA 5DZVA 3RVVC 4JY4A 4LARL 4UU9A 5SWZD 2I5YH 3HA0A 3V4VB 5FS5A 5SWZB 2VZUA 3UG3A 2X1QA 2X9ZA 4MMYB 1U91A 1P6FA 4F7KA 2G9KA 5JW5B 3MNWA 4XPBH 3Q01A 5CEZE 2YAFA 3VSVA 5SX5H 4XPGH 2WNXA 4BZ1H 3DV6A 3KNBA 3P0YL 2NTFB 1H5BC 1FL3A 1T1XA 1UACH 4PMEA 2L8AA 2BCKA 1VEOA 2J71A 4UIMA 2VDMH 3RDTC 4JRXA 4LHUD 4YDJB 1E9QB 1FVDA 3GTNA 2F53E 2ITDB 3MOBL 2A0LD 3MCKB 2H1XA 4JFWA 5IG7A 2G30A 5FYJH 3VGHA 2OXGB 2WVUA 4X5RA 2HFFA 3C6EA 5ESQB 1NDTA 4EZMA 4QXTA 3FB7B 2WWKO 4ODBD 5DF0A 5LVEA 3P3YA 4LGRB 5AG8A 1JGEA 4LPCA 3IU4H 1UCBL 1BEYH 1KBVA 2HFEB 2P26A 4AV4A 2ZSWB 3VFMA 3PNWB 2IDCA 2ZOKA 4I3GA 5D96B 3BPLC 4FZEL 4IIQC 2H32H 3RVUD 4PJIA 3S5YA 2CDGA 2F61A 2H9GB 5EO9A 2WJ7A 4YSDA 2VM4A 3ZE2F 4TVUA 3SE6A 4L18A 1NM9A 1QUPA 4RX4D 1SVCP 4XR8C 4BD4A 3J27A 5F1SA 1A8ZA 2OMXA 1XGQA 2ZCLL 1INDH 5DC9B 1YSOA 1E42A 3PXLA 5C0AA 3K81A 5I73B 2H1LM 1BPLB 5CIPB 5KYYA 1E4WH 3EGSA 1Z9SA 4ZNCD 3QS3A 2OZNA 1TTAA 1FHGA 3L5HA 5ECGA 1FP5A 1I53A 1EEYB 4Q4EA 2XQBH 3AREC 4WFFE 3WE6A 3B43A 5KVEL 1NFAA 4PJBE 1MOEA 4D7PA 2PTVA 2EDEA 1WZAA 2QR0A 1LO5B 1ZT4A 2QTEA 3U9UB 1F58L 3QQNA 5LCVA 3OGOE 3K0WA 1KBBA 5KUMA 4KAQH 4MA1C 2ZOUA 2IADA 4CILA 3E7JA 2PR4H 3V5DA 4N8CH 2BPBA 4Y1AD 3S36L 3GPEA 4MA8L 4R4FL 4Y1AB 5EULV 3P0GB 4KO9A 4HDIA 2FBJL 4ODWA 3K3QA 1Q9OA 3HBZA 4OAWA 3BRFA 2VKWA 5KBNC 3HC3H 3G6DH 1EHLH 3CV5A 4PRIA 4JFFD 1E43A 4JPIB 2WBJB 2HT3C 2XBTA 4F24A 4JFFB 2WYHA 5CU9A 4YC2B 3BVNA 4Y19E 2XWXA 4PG9A 1N6UA 3QG6B 1BX2B 3IEAA 4FXKB 4G1EA 4D7BA 5D1QC 3OPZH 2NSXA 3N50A 3SDAC 1OARL 4NQDE 3K2UH 3BZDA 5EZPA 1IU1A 4IOSA 3S4SA 5EC1B 4MKTA 5TPWL 4NX0A 4MS6A 3ZL2A 4YHPB 3WFBH 1HL5A 1A6UH 2D0HA 5HGDB 2VW7A 2GBAA 1F4HA 3VFNA 1NGQL 1AGCB 3E8UL 1OGAE 3W5MA 2MCPL 2Y3NA 4Q9RL 5DCCA 1A8JH 4NQCE 3UOAB 4DCQB 4E0RB 1O9VA 5D2LE 3WU1A 1AXTH 1ZKAA 4KI5F 2P52A 4MA7H 1AZVA 4PTUA 1OTUD 4OLYH 4PI2A 2DM7A 1CGVA 2CBTA 5D96C 4HOZA 1C5DA 3C08H 1QSED 5DD1L 5ICZA 2R9HC 1VFBB 2VDQH 3RL2A 2NNAA 1MFBH 2HVBA 3D3VE 4XP5L 3WBDA 4P5KA 4LVNB 4MZIA 4BH8A 1BOGB 2NY2C 2PO6B 2FR4A 3B2VL 1K9TA 1RULL 5I73C 5DK2A 1WBXB 1M7UA 5H35A 3X14A 4L48A 1TKWB 3CFJA 3OZ9H 2VL5B 3MRLB 1WFIA 5B39B 4AUYA 2P24B 4IRJD 2K45A 2YUWA 4YQXL 3GT6A 3N1GC 4N2EA 4IRJB 4QRAA 5B1KA 3RWFA 3FB8A 3AXHA 3QORA 3TVMD 1I3UA 4ZZFA 5H37H 3EO9L 3HG5A 1N0LB 5A6MA 4WQOA 1GRWA 2UY7B 3GSNH 5ALCL 5AKTA 4YSAA 4HUVA 2BIMA 1HQRB 2N01B 2QMJA 5E8DL 4GOSA 3KXFE 2XWCA 5JDJA 4AL8H 2ZUVA 4WJ5A 2ZNXA 1QTPA 4P04A 3LEXA 1XF3A 4ZMXA 5K9OA 4Z95H 4LBEB 2BVOB 2XQYA 4OZIA 2BIIA 3RTQD 4LP8A 2Q3AA 5I6XB 1U8NA 3KEHA 2WBJC 3RTQB 2FGWH 2XRAL 1J0ZA 4OJFH 4UZUA 3CFQA 3EO0B 1O0VA 1GOGA 2O93L 3VVVA 4FZ8L 1RFDH 1EO8H 2X70A 2OQJA 3KGUA 3CLWA 5D70H 2E5EA 1ADWA 1NFIA 5D9SA 4YUEH 1XMEB 1EHAA 5BOJA 1AC0A 3BPOB 2DEYX 4BQ9A 3G9VA 4YL4A 5I1LB 5HHXH 2BOBB 4NPKA 2XN9E 4ZS6D 4M61B 2BNQE 2FTAA 1AI1L 4G43B 4JRXE 1D9KD 4M00A 1DBMH 4AIEA 2ZCHH 4O02B 4TNVF 3PWLB 4EEEA 2C