3NJMA

P117a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPDAQIINRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njmA00
5IY5B 2BW5A 2P80A 1E67A 2FTAA 1SFHA 2H5UA 3NT0A 1J9SA 4BXVA 1ILUA 1ZPUA 1GY2A 3CDZA 5PAZA 4F2EA 3QJVB 3FU9A 4WKXA 2YXWA 3UAEA 1A65A 2YAFA 3OMAB 3NSFA 3S8FB 4A2GA 5I6LA 1OV8A 4DP9X 3KW7A 1GR7A 2YAOA 1ZIBA 3FSZA 1PNCA 3AG3B 1AS6A 3WKPA 1E5ZA 1PF3A 1W6LA 3UACA 5A7EA 3PCYA 5B7EA 1V54B 3NP4A 2OV0A 2E86A 1OOWA 2PPEA 1SF5A 2UXTA 2N0MA 3ZX1A 5I6KA 1JZFA 4GXFA 2QPEB 1DYZA 7PAZA 2IDTA 4G71B 3GXUB 5E9NA 2FJSA 2BP0B 1AQ8A 1IUZA 3NJFA 1J9QA 2XLLA 2YAPA 3KW8A 1PZAA 2PP8A 1KCBA 2PLTA 1WAEA 1OCOB 5I6PA 1AOZA 3L45A 3FYEB 4A2HA 4E9VA 1PY0A 2BZCA 1NZRA 2X88A 2CBPA 2EINB 2IAAC 4DP8X 2XX0A 3EHBB 3JT2A 4M4RB 3CG8A 2YAEA 3WIAA 3OD3A 1JERA 1JVLA 4YSAA 1PLBA 4GYBA 3TA4D 1ETJA 1ASOA 1MG2C 1ET7A 4BWUA 1BYOA 2PCYA 3GDCA 4DP0X 3S3BB 3N2JA 3EH3B 3ZIYA 1X9RA 2XV3A 4TXVB 2VN3A 4DP4X 3H4HA 5B1BB 3G5WA 4FA7B 1CYWA 2HXAA 2AANA 3NJIA 2UXFA 3NJJA 3MX0B 3X1FA 8PAZA 4A2EA 1CYXA 2FQEA 1SJMA 1NIEA 3T6ZA 1JVOA 3QJUB 2GBAA 5I5JA 3C75A 1QNIA 1SDDB 1ZDQA 1KV7A 1PZCA 5F7BA 2VW6A 2R7EA 1AZNA 2EIJB 1ID2A 5I6NA 5I5IA 1BQKA 1AZBA 4N8UA 1IBYA 2VSMB 3QPKA 2HLEB 3CDZB 1OE3A 4HAKA 4YSUA 2AVFA 2Y1AA 1A3ZA 1A8ZA 3FPXA 4UF7C 4A68A 2AZUA 4A66A 4YSOA 3S8GB 3HEIB 3ABMB 1NINA 2FNWA 4DP2X 2W88A 1HAWA 3D12B 3QJRB 4NERA 1AAJA 1BXAA 2Y69B 3EH5B 5D4IA 4F7KA 4HALA 1MG3C 3WNIA 3MBWB 4A2FA 2DV6A 1ET8A 3EF4A 2XVBA 5D4JA 3AG2B 3UAAA 3X1EA 4KOBA 3GYRA 3FU8A 1EHKB 1XB6A 1ADWA 3H56A 1TEFA 2RACA 5B3SB 2IDQA 1NTDA 3X1BA 2IH8A 3DIVA 1BXVA 3ASOB 4W1TA 1RZPA 3QJSB 1CC3A 2YXVA 4X4KA 4WTQA 3OM3B 2JFCA 4DP1X 3AY2A 4ENZA 1B3IA 4N4YB 1SFDA 1GSKA 1GS6X 2VM4A 2ZWNA 2B08A 2XWZA 3ZDWA 2YAQA 2BZ7A 3U25A 4QLWA 2PPCA 3CZUB 2CUAA 2XV2A 1NIFA 1TKWA 2HX7A 3S3DB 4HCGA 3ABLB 3NSYA 1J5CA 1NWPA 4E9YA 5B1JA 1NPJA 1GW0A 1VLXA 4BDVA 2TSAA 1AG6A 2WO2B 3ZBMA 5B1AB 3EH4B 2HX9A 4BWTA 5EHFA 4YSTA 1X9UA 2FQGA 3FQ2A 3T6VA 2J57A 1L9PA 5I5MA 1PLAA 1ET5A 1SHWA 2H3XC 3TBCA 1NIDA 4DPAX 1OE1A 1SHXA 3NJGA 3WI9A 1J9RA 2ZONA 4EF3A 2I7OA 3IBOA 1SNRA 1FA4A 1TEGA 3SBQA 1QLEB 4KO5A 1N68A 2BWDA 4YSRA 1M9WA 3V9EA 1GS8A 4DP6X 1M56B 2BW4A 4CSZA 4KO9A 3NSCA 3FT0A 5AFAA 2CAKA 1JXGA 2VSKB 2IDSA 4E9QA 2YAHA 1R1CA 3AZUA 2BP8A 4AZUA 3IE9A 2YAMA 3T9WA 3IN2A 2GI0A 2PPFA 2DYSB 2R7EB 4YSDA 2XXFA 4DP5X 2Q9OA 1RCYA 3FSVA 1AZCA 2J56A 1KYAA 3UADA 2GSMB 1ZV2A 1L9SA 2WO3B 1WA2X 1I53A 2CJ3A 3FU7A 1PCSA 2PCFA 1W8EA 1KBWA 3BVDB 1URIA 1PNDA 1IKOP 2XYBA 2ZXWB 3WKQA 1KDJA 4L0PB 4DPBX 1IBZA 4MFHA 1E65A 3S3CB 2EIMB 4DP7X 2LLNA 9PCYA 2AFNA 3QJTB 1BEXA 3T6XA 2CALA 2BO0A 2OJ1A 4AI7A 2W8CA 5FC9A 2JKWA 2UX7A 2UXVA 3ASNB 3TBBA 5B7FA 3AG1B 1WA0X 1AR1B 2QT6A 4KOCA 1PMYA 4AKQA 1GY1A 3T71A 1XMEB 2IWFA 4E9TA 2XX1A 1OE2A 1L9QA 1PAZA 1NICA 3QQXA 1NDTA 3PAZA 1PZBA 1AZUA 1A4AA 4G7SB 2CCWA 1BQ5A 2VM3A 4PAZA 1MDAA 2JXMA 3FSWA 4JKNA 4GP8B 3X1NA 5D4HA 2FQDA 1E5YA 4FAAB 3H4FA 3T6WA 1HFUA 5AZUA 1GYCA 2UX6A 1W6WA 1BXUA 1MZYA 3CVDA 4K9JA 4BDVB 2B3IA 1JOIA 2DWSA 3PXLA 4HCFA 2FT8A 3UGEA 5F7AA 4CSPA 1XB8A 3AW5A 1GS7A 1A4CA 1IC0A 2BHFA 1WS8A 1T5KA 3WG7B 1NPNA 3NJMA 1J9TA 1L9TA 4A2DA 1RKRA 2FT6A 1J5DA 2HRGA 4HIPA 3ABGA 4E9SA 1ZDSA 2HZHA 3CVBA 1OF0A 3FQ1A 1AS7A 1FWXA 2VW7A 3NJNA 1ASQA 2EIKB 7PCYA 1JZHA 1JZGA 4QKTA 3FPYA 4Q8BA 2GHZA 2XU9A 2QPDB 3NSDA 1M57B 2FT7A 3UABA 4YSSA 2I85A 2BP8B 1AS8A 1F56A 4G72B 4YSQA 2DWTA 2FWLB 1BQRA 2MRYA 1NWOA 3SQRA 1AACA 2VMJA 1KDIA 1TU2A 4GY4A 2XUWA 1AZRA 1V55B 5B1KA 1KBVA 2FQFA 4G7QB 1MZZA 3FU7B 3NJLA 4RH4A 2YARA 3SBPA 5B7MA 1JZJA 1WA1X 3BQVA 2Q5BA 5AKRA 5I6OA 4YL4A 2IDFA 1UATA 2TSBA 4F2FA 2HX8A 2NRDA 4YSEA 1KCWA 4YSPA 3NJHA 3FSAA 2UXGA 2H47C 3NP3A 3DTUB 4A67A 1BAWA 3PAVA 2IDUA 3ABKB 3SBRA 1JXDA 3X2QB 1A4BA 4NB7A 1L9RA 2PP9A 4HCIA 1BYPA 3N55A 4HZ1A 4G7RB 2IWKA 4KNTA 1HAUA 2YQBA 1OCZB 3TU6A 2GB2A 1RZQA 4M3HA 4PCYA 1CURA 3FYIB 3X1GA 2IH9A 1WS7A 2DY2A 5PCYA 2GC4C 1OCRB 3IN0A 4AKPA 2XV0A 2WSDA 3AG4B 1JXFA 1V10A 4BXSV 6PCYA 3IEAA 4GP4B 5TK4A 1AIZA 2BP0A 3NJKA 2HRHA 3HB3B 1FFTB 2ZOOA 5I28A 2MTAA 3PPSA 4G70B 4HHGA 4KO7A 4KNSA 3RYMA 3TASA 4JHUA 1N70A 1SF3A 3WNJA 4JHVA 4E9XA 1AG0A 5B1JC 6PAZA 2XXGA 4KO6A 1XB3A 3ERXA 3OQRA 4P5RA 2P80D 1OCCB 4AKOA 4YSCA 5ANHA 4KNUA 5I6MA 1QHQA 1ASPA 3OMIB 4GP5B 1NIAA 4UAHA 3NYKA 2PPDA 3FQYA 1DZ0A 1JZIA 4BK5C 1ILSA 4AX3A 2OCCB 2J55A 3DKHA 2QDVA 2A3TA 2PP7A 1L9OA 2IWEA 2X87A 2EILB 3V9CA 4E9RA 4E9WA 4ZK8A 1AANA 1KGYE 3QJQB 2AZAA 2GC7C 3PLYA 4NAJA 1JZEA 1ZIAA 2J5WA 1CUOA 1PLCA 1E30A 4YVUA 4YVNA 1EZLA 2GIMA 2I7SA 2VW4A 4HHWA 4UANA 3CVCA 5TK2A 4BWWA 2DYRB 2QDWA 1YLBB 5I26A 1SDDA 1NIBA 2PPAA 3JTBA 4Q89A 3FS9A 4W9ZA 5LDUA 4DPCX 3PAUA 4P5SA 3OMNB 2BWIA
chains in the Genus database with same CATH superfamily
1FFNB 4I77L 5E1HB 4N6RA 2YWYA 3HS9A 4RIRB 4Y8DC 1NCOA 5BQDA 5BRZB 1ZPUA 1Q9LB 1SXSA 4GAJH 4JRYE 4PI0A 2NNCA 4S1QL 5IF0B 2DJMA 2ZYRA 4RGOL 1YZZA 2D03L 1MUJA 1Y18B 1BPLB 3UO8B 3MBXH 1A3RL 1JPGB 3IMVA 2GITB 4U3SA 4OY9A 4PYGA 3PFUA 2UYLB 4TTGA 2XQ0A 3K91A 4UNTA 2D3LA 2ZG2A 1INDL 2Q20A 5I82A 2E3VA 4K8RL 2DQEL 5AOKA 4H5SB 3GLZA 1D5ZA 3ZE1E 4AK2A 3PCYA 1K85A 4XXDB 2OV0A 4UBDD 5D7LE 2UXTA 4GKNA 1AQDA 4A6YH 2N0MA 3KPSD 3HIZA 4MNGB 1FGVL 4ENEC 4GSQA 3S36L 1V3KA 2NSMA 1NCWL 2F5BH 1CGSH 4WWKB 3VA2C 5L88L 2HN7B 4HS8L 4Z7OE 1PS3A 4FQHB 5ESVA 4ZX4A 3AY4A 3RPIB 1K3IA 3FHQA 4NWTH 5E9NA 3ECQA 2YJLA 2DBLL 3DDFA 3BMWA 3ZTEA 3TO4D 3DTXB 4MMZB 1V3MA 1G9MH 2FX9H 3IPFA 2Y1YA 1KIQA 4V2BA 1I4FA 3F5WA 4HD9A 2IAND 2YO3A 3D07A 3VWKD 2FLMA 1SY6H 1F3RB 3NCEB 2YKKA 3L5IA 1SUJA 2HVJB 5I1IH 4OCRH 4K55A 1OTTC 2X88A 1KEGL 4L0YA 3IDNA 3SIKA 1H5BC 1DQQB 2Z92B 3JZ7A 2KLRA 4H0LC 4I48B 3D4CA 1I7UB 4ZD3H 4MXVF 3DBXA 4E36A 3LZOA 5I1LA 2BNRA 4UU9A 1MRDL 4K2UH 5K1NA 2WMPB 4B3VA 4LGSB 1P9MC 3ARBD 2F6AA 2BVEA 1FP5A 3QZNA 2EIZB 2HPTA 4OCSH 4QYOA 1EGJA 4FLOA 3Q3GB 3HS0C 1MW2A 4NZFA 2VXTH 1MHHB 1TEYA 2Y3AA 2OCJA 3MLUH 2EDXA 3GGWB 2X0WA 3DV4A 5B22A 1G87A 3DMMD 1KLGA 2QEJA 3DTDA 1YSOA 1CL7H 2C9RA 2NY6D 4FL4B 4TLUA 4XHJC 1U92A 1VZIA 3LEXB 2OXHA 3NJIA 3L3KA 3EJPA 4IBYA 2AEPH 2ZUXA 5H2BA 5JDJA 1NIEA 3HJ0A 4JZOB 5JHLL 3T6ZA 2V2TA 5IROC 3T4YB 2P9RA 3HPJB 4GRLC 1VA9A 4V33A 2WUBH 3V5DB 4DWHA 5EO9B 1BJ1H 3M17A 4CC1A 2KT6A 1YYLL 5F0LB 1BZEA 3RY4A 3B3BA 4WEEA 1R3LB 4KVPA 5C97A 2EECA 1WWCA 5E6IB 3WTYA 4GG6B 4JW3A 1AGBB 5DMKA 1R9FA 3STLB 1CCZA 3MLTA 4P48A 4G6JL 1UD2A 3EFFA 1GZPB 2AJUL 4ZXBC 5D1QB 1UWEH 1CD0A 1I85A 4X7CC 5CHNB 3WS3B 4QHKI 4GXVH 2V3DA 4D7PA 3PHSA 1RZGB 1QSZA 4BE5A 1Q8MA 4QRBA 2PYEB 3WNIA 3NJXA 3FJTA 3QIUA 3UDWC 2YGNA 4NEHB 4Y9FA 5C0NC 1HQRA 1BLNB 2ICEB 2ZT9C 3CFKA 2RCSL 4KTEH 1FDLH 4BZ1A 4HQQL 2V5SA 4XMWA 4TVUA 4UOZA 3MV9D 3ZGIA 3U9PL 4AM0B 5EEXA 3U2SB 3F62A 2V7HA 3AY2A 1SOQA 4F58L 3N43F 4NO3A 3MJ7A 5E2JA 3NEEA 4QRSB 4JFWA 4Q2ZB 4P0DA 5IZ7A 1R33A 1ZPLA 4Y2OB 3EDFA 4C59B 2B14A 5T3ZD 1MHEA 1BQLL 2C3WA 3KXFD 2AXFA 4PJXF 5FM4A 1ZHLB 1MCEA 4YLQT 5DK2B 3LZFL 3MRGB 2BY3A 1RZKH 2R29A 3CIQA 3LY6A 4WWID 1ZLUK 1J11A 3SDXE 2TRYA 2ZUQB 4KI1A 5IV2A 2CHNA 5HI4D 4HJEA 1WFOA 4WO0A 3EHBC 1O5PA 1AMYA 2VQTA 5FHAH 4I4WA 2LGNA 4EQ2A 1EBPA 3LRSB 5HI3C 1NIDA 4QAMB 4DPAX 1EANA 5DS8B 3KMDA 5DWPA 2AC0A 1RHFA 4XN4A 3L95B 5FF6B 5FIEA 4GIPD 3TT3H 2A6KB 2JVUA 4JDZA 3MUUA 3FOMB 1WIUA 5KVEH 3UAJC 4TNWF 1T1WA 1U8MB 3FHEA 4EI5D 3QEQD 3TH2T 5DRWA 2X4PB 2IDSA 1N67A 3F7YB 5K39A 4AZUA 3K1KC 4EI0A 5TPWL 3I9AA 1B4TA 4I88A 3U46A 1PZ5B 1PYWA 1RJZB 2XXFA 1MW0A 4PWFA 1KBBA 5IBLD 1F0LA 3HW7A 3LN4A 4GW5B 3K8KA 1QRNB 3PIQA 3UADA 1OP5K 5CILH 4MD5A 3MTRA 2EYRB 1Z9SB 2VWEE 4J2QA 3P4OB 2OTWA 1PNDA 4UOJA 2TRHA 5LAXA 5HHQB 2WXPA 2EDBA 4O02A 1IBZA 4L9LB 2IV8A 4AXWA 5I1DA 3V6FA 1F42A 2FSEB 3W5NA 2HKAA 4WW2F 4Y16D 2W38A 5C0JB 3LKPB 3D85B 3ES6A 4DOHE 2CNZA 2NNFA 1YN6B 4I9XA 1OTUD 3TEUA 5AAWC 2OP4L 3D69B 3L5XL 4RX4A 4UNUA 4F80A 1JN6B 4FG4A 4Y5VA 2XX1A 3ARDD 3G9AB 4UOW0 2Q7AA 3CLFH 3QQXA 3VVWA 4LDCA 4NBXB 3F3HA 3T6QC 1WIPA 3MR9B 2R8SH 3D1MC 1DBJH 1PZBA 1XH2A 2ZF9A 3PL6A 1YEWA 2F8VA 2VR9A 3T2NL 4C56B 5B38A 2BSEA 3CSBA 4JKNA 4JFFD 4IIZA 2YA2A 5LNGA 4NQSB 5EO0A 2JKLA 2J71A 2BSDA 3Q6FB 4R4FH 1OLLA 4S10A 4RMQA 5D72H 4CN4A 3ULSA 4WIQA 2WO4A 4P2RA 4Y4FA 4PRHD 5DHYB 3IVKA 3QXDB 1TMCB 3ARGC 1WFIA 4KKAC 3W5MA 2EUWA 3WFDH 1I9RL 3S4SG 1TLKA 1HILA 2EXYC 2HKHH 4JRWA 3ZE0E 3UGEA 1LO5B 2MQCA 2PWEA 4DQAA 1K3ZA 2VLKA 3G08B 2J44A 1RPUA 5D2NB 2R9HD 1IBBA 4YHMH 5BZDA 4HG4K 1YMMA 3UG4A 4NSKB 1D5XB 3HI5L 2WXNA 4N2KA 5C07D 3HCVB 1RKRA 3KWUA 5B8CB 4F24A 4Z7NE 4JY5L 1F58L 5K69A 1XZWA 1RUML 4UNIA 5DLMH 2VDML 4UIKL 3QXAA 1JZGA 3GMMB 4X6DA 1XF3A 4FQ2H 4JKPH 5KBMA 4ADJA 4W6YB 3PV7A 2CRIA 1QBBA 1DVXA 5AKSA 2ZKWA 3GJFK 1F4WL 1M71A 4KRPC 2ZUUA 3UCQA 3WFEH 3E0GA 1ZEAL 4GT7A 2PR4L 1MY7A 3FU6A 4J8RA 3P0VL 2MRYA 5EZIH 5HBBA 3O8XA 3WUWG 1A1MA 2WGXA 2K78A 1KDIA 3FTXA 2H1PH 4OZFB 2VLRE 3PWUB 3MRNA 4ZFZB 3C9NA 2QADB 3O6KL 4G5ZL 4BQBA 1MFCH 3HBGA 2DRUA 2CBQA 2Y07H 4JFYB 1IAOB 2BRQA 2Y7QA 4PR5B 5LNEA 2GIXA 1KBVA 5L8LB 3T8VA 1G7MA 3VFPA 1MIEL 4R7NB 5BUGA 3B2PA 4NQQA 4L4VE 2DI8A 4RH4A 1JHKL 1RIUL 4FFWC 2YARA 3T0DA 2HG5A 5SX5K 1JWUB 3IGFA 3ARFB 1NCUA 4HUCA 1HZLA 1BZ9A 1HZKA 3ZPDA 2UUDK 1A7NL 1UADC 2XTJE 4GKLA 1NCBL 1T0PB 1L7TL 3DX8B 1MVFA 5F89A 2NY5H 4HMEA 3BVTA 4GW1A 3SOBH 3WFBH 1T3FB 2TSBA 4F2FA 2EUXA 2HX8A 1G6RA 1UJ3A 3LQZB 4N5UA 2L7JA 3BKJL 2EEXA 2VXQL 2YQ3A 4PJ8B 3NP3A 3DTUB 2FX7L 4HT1H 4FP8H 3RBSA 4EN3A 3G5YB 1TFPA 4A63A 2A77H 3QIWB 2JB5H 5KVMC 1RK1A 1T22B 4IRZH 5MENB 4W9JC 2NY2B 3BFWA 4PJ5E 4X4YB 1GMIA 2EC8A 1NFDB 3FYIB 1VACB 1LP9E 4JO4H 1QYGL 1L6XA 1G0YR 2X4UA 2YSSB 3IN0A 4K3JH 2E74C 3GI8L 4RMBA 5MERA 1ZE3C 1I3GH 2X6VA 3IEAA 2KPNA 2XA8H 1JZ6A 2IO5A 2Q2LA 3KYKL 2ZOKB 3D9AL 4WDIB 1ESOA 1WITA 2CKNA 3BMVA 4PMEA 5I28A 2KS0A 1EXUA 2HFTA 1H0DB 3BVWA 5IFAL 1U8JA 1W0WB 2A9MH 2V0AA 5HDLA 3DA0A 3IJSB 1ZD6A 1WEJL 4O51B 1GJIA 4HXBL 5AB1A 4PGEB 3UX9B 4PCSA 4LFHG 1QA9B 5DA4A 2ITEA 4RAVA 3QQDB 5DJCB 3M8OH 4IOFC 2A6DA 4NLHA 1CIUA 2WIIA 1ZLSH 4BH7A 5C0CB 3ZO0A 1Q38A 3ECVA 1DN2A 3CSFA 5DVOA 3P9WB 2NW2A 2FNBA 4S1DC 5T1JA 4LIQE 5I23A 5BO1H 1A25A 2C3VB 4ZK8A 4PH8A 1RZFL 3LQAL 4LP4A 3L2MA 3OWRA 5HYEA 3RWJA 4KRMB 4XCFH 2AV7B 1YEJH 5JUEL 2NUTA 5IT2L 4XMLH 1CBVH 1REIA 2LHAA 3K74B 4NWUL 4PJXB 2R0WL 4PUBL 4JKKA 4QOKA 4UANA 2P28B 4BZ2L 2KI6A 1IFRA 3NIGF 1OTSD 4HOXA 1A2YB 1GGBH 2R69L 2CWRA 2QDWA 4HOMA 3BHBB 2CJUH 3FB8A 3BKCH 3SQBA 5ISZA 3QFJB 1U41A 5CKGA 3V5KA 2DPKA 3UGUA 4M7LL 4YXHH 2ODHA 1JD9A 2WLYA 4MNHA 3O45A 4KZDL 3NT0A 4HC1A 5AVSB 4R0LB 2AQRA 2DM2A 1DFXA 3RDTB 3FU9A 4WKXA 1PBYA 1A65A 2ZTBA 4HUNB 2ORBH 3QP3A 2GW5A 3GJEB 3BPOB 1KYDA 3C8KA 4ANKA 4NXSA 3MBXL 1NAML 4X0KA 3ZKXC 3DUUA 3UACA 4I7ZC 5FYKH 4ANVA 1MJ8L 1KN4H 5F6IB 3EZJB 3QG6B 3QW9A 1BVKA 2BFVH 1JCVA 1WPCA 3LKNB 5BOZG 5IP4A 1CD8A 5I6KA 3ZL1A 1WT5A 1EH9A 4DGUA 3IDJB 5BXFB 5K9KA 1ZJBA 4A6YL 3CFTA 2BS8A 7PAZA 5CP7B 4RLDA 3F64A 4LEOB 4XZUA 1A4KA 4V1DA 2F5BL 2NT0A 5L9DH 1I85C 3T4AC 4KUCF 3RKPA 1AY1H 3OG4B 2IPTH 4U1NB 2M83A 5I8CA 3OHXC 2DIJA 3QIUC 5HDRA 4AEIL 1IILE 3QDMD 1AOZA 1PTZA 5HYJD 4AEHH 2IALA 5D7KE 4M6MH 2ARWA 4Y2LA 1SY6L 2VN4A 3B37A 4I9WE 5AENA 4M1GL 4K7FB 2FECL 2XX0A 3MAWA 3QZWA 5I1IL 4ENED 5T1KD 1EEUA 4JHWH 2OYPA 3WIAA 5EBLA 4M9PA 4RMVA 1D5MB 43CAA 4ZQTA 1DP0A 4I89A 4JVUA 4ZD3L 4LLWB 3UMNA 2WJ7A 4R26H 4GBXA 3HFML 4K2UL 2OMWB 3VJ6A 3QUMH 4H0IA 4PRBB 4FCHA 2FO4B 4APXA 3LXUX 1WLHA 3RVUC 2CCLA 4HPYL 2MNUA 3HVNA 4JG0L 1N12A 4MMXC 2Z31A 4FA7B 4LPYA 4NQED 2VXTL 1FCGA 3NJJA 3C6LC 3KLLA 1A1NB 3PDOA 1RQ5A 5ACZB 3FTGA 1CL7L 4YMPA 3O11B 1UA3A 3UPCA 2L04A 3L3DB 3K2IA 2MKLC 4ZOAA 2C4FT 5JOEA 3AB0B 3CLEH 3REVB 2A73A 5TDPA 1TPXB 2GJ6B 2X4RB 4AV0A 4XMTA 3BSZH 3T0EA 1WAPA 3ISRA 3IFOA 2FJFA 1QFPA 3E1F1 3LNHA 4OUUA 2WUBL 1BQKA 3EBHA 3KLAA 3CDZB 4JDTH 3MODH 3IMBA 4FFYL 1EEZA 1NCCH 2JCCF 3QR1A 3D3VE 3U9UB 3D39B 4E5XA 4BUGA 3VWJB 2IVFC 2YEZA 3BW9B 4OGYH 1ZCRA 3CTTA 3QJRB 3SJVD 4I2XE 5I19H 4RAUA 4OFQA 3B8YA 1UWEL 2NZ1A 1IU1A 1Q1JH 4ODTH 4QCIB 4UM8A 4Y8AA 2F54D 4M6NH 3CPUA 1IO4C 1T0NA 1Z5HA 3CFBA 1A4JB 2OL3L 2Y1VA 2R15A 2JJWA 3D2UB 4UQAA 3JVFC 4IQHA 3LNDA 5HGAA 2HYMA 4NN6B 4UM9D 3GMPB 1P5UC 2A9DA 1LQBC 2RB8A 3BZEB 4ZYKA 5D96B 3SPGA 4Z7VE 4G8FA 3QJSB 1FDLL 4KTEL 2C9PA 4KGJA 2LFGA 2XNAA 4WNQA 1YEIL 3FCSB 3MRLB 1FZOA 4KXZH 3AITA 1HN1A 3ROLA 1INEH 1XCQA 1D6EB 1UCTA 4N4YB 2ICWA 1JWMB 3OC8A 5HHVH 2V17H 1GS6X 4EUPA 5EOTA 1GPOH 1RURH 2PPCA 4PJAA 3ULUC 2OTPA 1MRCL 1LEIA 4P04A 3FTYA 5C0ND 4Z7OF 1W2KT 4HMDA 4Y5VC 5I9QB 3QIBB 3CNKA 5CEZD 4NHUB 5JHDA 2BSSB 2TSAA 4N0FA 4YZWA 4JM2A 1IGJA 5DCCA 5JIPA 1D7BA 5D93B 3DJZA 1AZZC 1AGCA 1RZKL 5AVZB 3QBTB 1AO7B 4DJMA 4PY8J 4P07A 2WUCH 4MBRA 3QQ9C 4NZDA 1LWRA 4NHCH 2OMZB 1YNKH 3EJYD 4JPWH 5FHAL 4BK5A 5HHNA 4EF3A 3IBOA 3ESOA 1TEGA 1J1PH 2Q6WA 4Y4FC 3WOVA 3DVIA 3X3FH 4GSDH 3CHXA 1D5IH 3QUMB 3RGVB 3SE8H 2P7TA 3PWJB 1JMXA 4KO9A 3TT3L 1XF4B 1FVDA 1D6VH 5H35A 1G5AA 2F61A 2XIIA 1Z2KA 2X89A 4E9QA 3LPOA 3Q0HA 2MQGA 1N2RA 4Q97A 3EDKA 4OQTL 4DVRL 5T3XL 3FW6A 5IOPA 2R7EB 4U0RB 3SE3C 2AJXH 3CQFA 5D5MF 1NGYB 2WSPA 3ATAA 4HGWA 4D9QE 4Y1AD 4CBZA 2O93L 4U1MA 3K2MC 4WWPA 4U1GC 4JHBA 1KYAA 5CEYA 1A9VA 3B5HA 1S2EA 1GSMA 1ZVYA 3UTQB 3CQQA 4JGJA 5HDBE 1NDMB 4AUUA 2ZXWB 1I8IB 2MJWA 2Z65C 3DYOA 3IWVA 5DJAA 1KCSH 9PCYA 4HJJH 3BQUC 4LCCC 4KROC 2BO0A 1PJ9A 1NGQH 2VM9A 4JRLA 2XBZA 2NT1A 3QI9B 1LO2H 3L3OA 4YIQB 4D9RD 4GQRA 1SLXA 1JUFB 2Z4QB 3FT9A 3GRWH 5FA4B 3T71A 2YMOA 1S7UA 4QHUA 4JPKH 2VZOA 4JY6B 3CZLA 4Q7DA 1F3JB 5FYJU 2MSPA 5J1SC 3TEYA 3B9DA 3TH3T 2YK1H 4PLJD 4P9HH 1A4AA 1K4CB 1RZ7H 2CCWA 1U8HA 4AJVA 1XAKA 3MREA 1ONQA 2R8SL 1DBJL 1E5YA 2VLME 3H4FA 4FFZH 5D9SB 1UJ3C 3HKFA 4FXGC 4YE4L 4ZI8A 3DHPA 1V3LA 2PYFA 5DEGB 4R83A 1TTUA 2UX6A 1VFUA 3TZVB 4YS4A 2FRGP 3UC0L 2LQRA 5CSZA 3BP5A 4EQ3A 4GUPA 2D4DA 4R4FL 4OFYD 1CFSB 5D72L 4MNQD 2P5EE 5BVJA 5EUKB 4QRPE 3P4NA 4I18A 3AS1A 3G04B 2B1HH 2BVOB 5HHXH 4S11A 4JPVL 1T0OA 1GS7A 3GSRB 2PCPA 1DVSA 3F7PC 3NFNB 4KTYA 1J9TA 4GKSB 3C60A 3IPBA 3GO1H 2NY7H 5F6HJ 4RWHA 2NX5B 2X3AA 1CFVL 3KLKA 3WNMA 5IVXA 2PTTA 2A4CA 4F7CB 1N9PA 3II2A 4OZGE 5DVKA 3CVBA 2BOBB 5F72S 5MP6H 3VI3A 3SDXF 1UXWA 1U93A 1M2VB 3OKOB 4X98B 1IM3A 4AGNA 1RJLB 1KCUH 1XBRA 1PX4A 4OLWH 2ZF8A 4Z7WE 5DLML 3AM8A 4YHPB 3W3BA 3QNXB 1VFOA 3CDFA 4FQ2L 2O61B 4GAYB 3F7RA 3SY0A 1NOAA 3IMWA 3W11C 4CVZA 1GGYA 4F9LA 4CDHA 4YLCA 3L3JB 3WTXA 4YSQA 2V7NA 3QO0B 1P7BA 2FH6A 3QEHB 4FQXA 4TSBL 1NC2B 1UH2A 3U6XS 3SOTA 3KL3A 3IKCA 3MA7A 4B9JA 4AE0A 1OP3H 4Z7UB 3QJFA 1W0YT 3UZQA 5JW5A 4RFOL 1R46A 1VZGA 4OAWA 2XUWA 1BFVH 3FCTB 4XOAA 2HKFH 2ATPA 5ELIA 2E56A 5DJ0B 3B3IA 1HSAA 1DL7L 3FHAA 4HWBH 2ZCZA 2OYMA 3WS6A 2CBOA 1OK8A 1QPPA 4LKCA 3FU7B 2Y5TB 3W57A 3DK2A 3NCJH 1BMZA 1MFCL 1Q0YH 3BIBX 3PP4H 4IS6A 4ELME 5I5RA 3FF7A 3OR7A 3L08A 4Q14A 4R8WH 3EGSB 3E9TA 4KRPD 3BYYA 2EIBA 1SJVA 2R2EB 3G3LA 1I1FB 3Q1SL 1TJHL 2NY5L 2XRAH 4IGBA 3L4WA 1Z0MA 4JR9H 2FX8H 3WFBL 3SOBL 2WNXA 3GKZA 4X9FA 1S7WB 4TTDC 4N8VG 4NJ9H 4HT1L 5DUBB 5DO8A 12E8H 5AKVA 1L6ZA 2MTPA 3MNVA 2A77L 2L0DA 2JB5L 4D8PA 5HYIA 2IH9A 3HNSH 4UB0H 5JLZB 4I1RA 3CU7A 4AKPA 3VG9B 2XETA 1ND0B 1F4YH 5AW1B 3WDIA 4ZX3A 2JKJA 4JO4L 6PCYA 1UQSB 3B34A 3EUUA 4K3JL 3BXNA 4ONOA 2XPGB 1QW9A 5CEZE 5I1JH 4NP9A 5DJ6A 3V0JA 2EKJA 2FATL 5A40E 1ZHNB 1M7DB 2PXYA 1M2OA 2YBRA 2A9ML 4F7TB 1Y07A 4H88L 5E9DA 4ZMTA 4ZW5A 3I9PA 3OSKA 4W9LC 3WENA 5C08A 3BP7A 1NKGA 3R1GH 1EFXB 2WK2A 4IBLT 2OMUA 2YD3A 4WW1B 5FGCB 5IQMA 1L0PA 4U3CA 5JNYB 4MS8D 2EDQA 4AX3A 4HKBB 4O4YH 2ARJQ 3ZE0F 4TUUA 4KHTL 5FOBB 1MVUA 5IMMB 4JANA 3VFUA 4PTUA 1ZLSL 1RU9H 4YQXH 4E9RA 4L3AA 5E8PA 4PJFF 5EFIB 3RIAF 2VXVH 5IHUL 2JELL 4DO5A 5DEFA 1PU0A 3E1ZA 5FCSH 1OM3H 4IU3B 4J3SA 4Z7NF 2ZP8A 5D7IA 1PLCA 4L1LA 3P9MA 1PLGH 1YEJL 1MJ7H 4Y1AE 3ATEA 4BWWA 1X5IA 5IQOA 3UBXA 1KYOK 1NGZA 3O3AB 3U4BH 1YC8A 1DBMH 3DOSA 5AL8A 3HHSA 1NIBA 2PPAA 3FNKA 4QXTA 1RUPH 1QVOA 4N85A 2DLFH 3QUHA 4JHZA 4HEPA 3RWEB 4DZ8B 3RWFB 3F6JA 1C5DB 5DQDL 2CJUL 3DSFL 4KTGA 2BWIA 4KOCA 4JGUA 4JL1A 5F7EH 4HP5A 5F88B 5ICYA 3L2LA 3V5HA 1JZ3A 4G82A 4XNMB 4A37A 4BXVA 2PF6A 4YXHL 4XWGH 3O3DB 1JPFB 3DXAA 4IDJH 4JRXB 2I26N 1ZTXH 2Q8BL 4L3EE 3AWEA 2D31B 3UBFA 4Z3EA 4ALAH 5DS1A 2ERJB 2BNRD 2EH8H 2ORBL 3OB0K 3VRIB 5B39A 3DDGA 1YECH 3TTSA 3L1OH 4MAUH 2JE8A 3VFSB 5JMOC 3L9YA 3BCDA 3V9FA 4GO8A 3SGDI 3HG2A 1OSPH 5HP5A 3SO5A 4WV1B 4FMFA 1I7RA 1MELA 3L81A 5D5MB 4Z0BH 2ZOTA 1KN4L 4A2MA 4N9GA 3T2LA 2ZPKH 2XQYK 2ADJA 4V2CB 1XGUB 2AEQH 2G3XA 5DSCB 3GB7B 1QTSA 3RJQB 1E3XA 3GXUB 2R2HB 3HS8A 4PJDB 4TQEH 3ZKNC 1TR7A 4GI8A 3U0PB 3UIYA 5EZJB 1U8QB 5T33H 4KPHH 2XLLA 4QHLB 2BCKA 3GUFA 4WFGD 3KW8A 5JQ6H 1WISA 3SCMA 3P3YA 1AY1L 3VXUE 1WAEA 5IB3B 5EU3B 3R4DA 4MX7A 2IPTL 4FHJA 4RDQG 4YN3A 1P7QA 1QEXA 4N1HB 2O5YH 4RGNC 3KHQA 3LIUA 4LK4A 2MCAA 5DJYB 2UVFA 4M6ML 4B97A 1HCYA 1IAIM 5EEUA 1PD0A 1BEYL 1ADQH 5DS2A 4HPOH 3UIZA 1ASOA 1KIPA 3MUJA 4ZRGA 4TPRL 5JOFA 1SJEB 4HIHA 3MLZH 4X7TA 3S3BB 2BOLA 3BESR 3GNML 3ZT7A 2DWDB 4N2BA 2V5TA 4Z0XB 4PLNC 4Z3TA 3QIUD 5EC1B 4R26L 4XC3H 3INUL 4GXUN 4U1JB 4F3FA 3QO1B 1MCQA 2ZX8A 3MRRB 1T1YA 3X1FA 4IBZA 4LSTH 4Z8FH 3NIDB 3C08H 3MNZB 3O6FB 3SPHA 3L9RB 1T1XB 5E7BA 1JVOA 2Y2YA 4YO0B 3BVVA 4IRJA 4MSWB 1BF5A 1SDDB 1KJMA 2ADIA 3EOAA 1ZDQA 5KAQG 4JFDA 2OMYA 4BFGA 3B2DC 2WZ5A 3LXCA 3CLEL 3GTNA 4YHIB 1EX0A 1AZBA 1XH0A 1BBJA 1ZK9A 2BNQA 4XMZA 2VSMB 2BIPA 3FO9B 3RFRA 3RVUD 1YUHA 3BT0A 3Q5YA 5IMOA 3S37X 1MCCA 4POZC 3MODL 3MRIB 2VZUA 2J8HA 3CBKB 3FFCA 1S7XA 2CDEB 3CFCH 1CFNB 1TO5A 2NY1B 1OD9A 1PKQA 4M8RA 3R8BB 3JTTB 5D7HA 1XGTB 3IDMA 3HN5A 5E5LA 1ZSDA 3MCG1 4LHJB 4CNIA 5JW4Q 1ZANH 3UAAA 4ESKA 1J8HA 4G9DA 3AXIA 3CHOA 3KBEA 4ODTL 1Q1JL 4QPEA 2XN2A 4OIFA 1XB6A 5KUKA 5DRZB 4M6NL 5B3SB 3LXBA 2AJSL 1MFNA 4HHAA 4YHZL 5LGJA 1LNUA 1P7KB 4ONFL 1XR8A 2EVIA 4DP1X 1T20A 5AW2B 4HLJA 5ID1B 4LLVB 3WIFA 1JK9A 4NM4H 2DMHA 3I6KB 4EKJA 4Q0XH 1LEKB 2YRBA 4GI6A 2J73A 1IT9H 3L3OC 3PDGA 2V17L 3DX2A 5EO1B 3ABLB 4MZRA 1GPOL 4GUCA 1DSFH 4YR6B 2MIZA 1NPJA 1RURL 1JP5A 2FE0A 3LKSA 3VD3A 5B1AB 3EH4B 5DMGC 4S1RL 5DYOA 2GFBB 3NMEA 4JFHD 3BN9C 4UNVA 2DEXX 3RWCA 4G8EB 1LWHA 2ENJA 4GSRA 1KELH 5EG6C 1YEDA 3T6VA 5C0BE 2DJSA 1J88A 2OX5B 3GDBA 2DWYA 2VOTA 2YUXA 5IHZA 4O00A 3RI5K 2NTFB 5GIRB 2HFFB 1IVLA 3BWUF 2WUCL 1QLEB 3KPSB 5F1IA 2H8PB 4LSUH 4DEWA 1BVNT 1P6FA 1FN4A 4HF5L 3EIFA 1YNKL 5CJ5A 3ULUD 4RX4D 1BF8A 3S35X 4RIRA 4PGCB 1ACZA 2EKSA 3CD4A 1D5IL 3TO4B 5T3ZH 5IF0A 3TJPA 4HJSA 3DJRA 1D6VL 1O9VA 3ZDXE 3PL6D 3C60C 2IANB 2V2XA 2BSED 2PPFA 1JRHH 3VWKB 4I3SH 1HL5A 3QC5X 3QQ9D 1P4LA 3KPNB 2WXJA 4TF4A 1UZ6E 2VXQA 3CX5K 2QELA 1FL3B 3TO2B 4P2RD 4Y4FD 2AJXL 3C5ZA 3HZKB 2Z7WA 5J11C 5ANMB 2QGCA 4F2MB 1G94A 5EN3A 3RX7A 3BAWA 4TNVF 4N28A 2F58H 4NUJB 3ZDZE 2F7OA 2YD6A 4OM1H 1MVYA 4F9LC 2VLKD 4PJFB 3ARBB 2A9AA 3MLWL 4QHMA 2LLNA 5DD5H 3QA3B 3OJ2C 4JRFA 1YMMD 2DQDH 4J5VA 5AVRB 1U91A 2VRKA 5CXPA 1KCSL 1ZOXA 3NCBB 4HJJL 3DMMB 3BUIA 4ONHB 2A4EA 3CXFA 4ELKA 5BW7C 2NY6B 1NGQL 2AK4E 1DCLA 1U8IB 2AJ3B 4AKQA 4JFQB 2ZP0T 4D0BA 3KLDA 4PGDB 3WS6C 3VQLA 5C7XH 4QTFA 1L9QA 4HEME 2OR9L 2ZJSL 2KLSA 5FGSA 4LESA 1DQJA 3EOBA 4PJ7B 4JPKL 4XPGH 1WF5A 2VM3A 5CGYC 1OQXA 5CGMA 2D4FA 3I75A 4HZLA 3QSKB 4BKTC 4WFGE 4P9HL 1OWRM 3IDUA 4PJGA 1AD9B 1FC1A 3N1MC 1R5IB 4Y5YA 3O8XD 1BD2E 1E4XI 3L3IB 3FCGA 2RIKA 4FFZL 4LLMB 4R97B 5IQNA 1MKFA 1Q90A 3QUXD 1FO0H 2JCWA 3G7TA 4Z7VF 4PW9A 4Z76B 1HZHH 3PXLA 1OVZA 4Z5RB 4K9EH 2FT8A 2I69A 1RHHB 2FBRA 2W60A 4YDLC 3FTVA 1FFRA 3AW5A 5EU6E 2GBVA 3VFGH 1NUNB 5IHBA 5IESH 3X14A 2B1HL 1FC2D 1N59A 2J7LA 3WG7B 2RJMA 1G0XA 4IKJA 4KKNA 4JZOA 1KCKA 5E4IA 3OL2A 3L3GB 5HHOA 4M6OH 4BZ2A 2OMVB 1AOHA 1F4XL 4HFWA 3TBTA 3UJIH 2CG9X 2IAMB 2R69A 2NY7L 3GO1L 4U1IB 3E8UH 3ESUF 5F9OH 1EO5A 1FG2B 2QBWA 4XNYH 3P9LB 4L8SA 4C47A 32C2B 3FQNB 4NO2A 3MV9B 3RIFK 4WVRA 2AW2A 5MP6L 1R3LA 5HJBA 4EN3D 5J1TC 4BQCA 1II4E 1MH5A 1MLCB 1MNUL 2ZKMX 4LPXA 5JDSA 5TTRA 3V0DA 3ZW3A 5BOJA 1B4RA 3VSQA 5EIIB 4XMKL 1F56A 3HAEG 2FEDD 1TFHA 2A6JA 2EEFA 1GJUA 2QQLH 1DJGA 2B1AH 5I0VA 5KVGH 4G6AD 4RFEB 1NWOA 4PQXA 3O0RL 3WS3A 1B3JA 4JZNB 3ULVH 1TU2A 5TE6L 4U6XB 1PQZB 2WKLA 5EOQH 3KXFB 1K5NB 3U6RB 1FFQA 1HU8A 2PYEA 3DX9A 3NAAH 1NAMA 4MBOA 1A3LH 4NNYB 5B1KA 4ES9A 5EBWA 2AAVA 1BLNA 3IXAB 3TS8A 4HWBL 4XP9H 4ZZFA 2BM3A 5I75C 1SLVA 4W9HC 4LAQH 3PP4L 1Q0YL 2NY0C 2FWOA 2QVFB 4GNKB 3WY2A 5AWNH 1SYVB 4A6YA 4LPWA 2GJJA 4OZHF 3HI6H 4B60A 4R8WL 4YSEA 3MRMA 4BHUI 1RV6X 3PGDB 1EAOA 2WXGA 1WZKA 2XRAL 2YD8A 2K4WA 4Q2ZA 4PV8A 5LCVH 2CKBH 4JR9L 3NN8A 4EI5B 3QWQB 3QEQB 4Y2OA 1ORSB 4GEJA 3MUZ1 2Y7LA 3S97C 1DQIA 3A6CH 2GB2A 1KTBA 4U1LA 3Q2WA 1QZ1A 3FUKA 4NJ9L 4WO4D 4XXWA 4DFHA 4NENB 5DK2A 3EBIA 3MRGA 2JXMB 1BOGB 1SY6A 2J6EL 2WQXA 4N20A 1NJ9B 3DURB 3FAWA 1D5RA 2HP4A 2FUQA 1AKPA 1CDCA 4PG2A 3VCLB 3HNSL 4BXSV 2WTRA 3A4FA 4K0OA 5E1AB 4AQEA 4QOKD 1F4YL 5EBMB 4F7MB 4I5BB 3QEUB 4P2YA 2H9GA 4H0GA 2E6JA 2IFGA 5F44A 5HDOA 4KO7A 4M6AA 5DMYA 4PJIA 3NZSA 1JK8B 3N06B 4IJ3B 4TTDD 2Q86B 5E08L 5I1JL 2E6QA 4NRYB 2DS4A 4BSWB 3ATFA 2V2WA 4W9IC 2QTEA 4Y16B 4AKOA 1JFQH 2X7LB 3CLWA 1KBGL 1UXMA 1KGXA 5BQ7A 4X9YA 3HAEH 4W93A 5ICZA 1L3WA 5JXEC 4P4RB 4LCWA 1E8XA 3DX7A 5AB2A 3UGXA 3REWA 3R1GL 2P42B 3ARDB 1RJZA 3L9EA 5KOMC 3VH8B 3CZGA 2J55A 2FHCA 1KTDA 4PB0L 1WTLA 4URKA 4NAQA 2EILB 3BPLC 5JYMA 5FB8B 4E9WA 3UZVB 5KSBE 1A0QL 1BF2A 1RU9L 1T6VN 4FFYA 4JFFB 3P4OA 1SUHA 1Z9LA 3P11H 4NAJA 1XXFC 5HHQA 4P2OA 5GSRA 4WGKA 5D71H 1TG8A 3TWYA 1YG9A 2I7SA 3NZ8A 4PRHB 4TVPE 2EC9U 3CVCA 1RIVH 3AQXA 2HB0A 4K5LA 1JGLH 1XSKA 4V1DD 3O2VH 1PLGL 1MJ7L 4JFXB 3GSXB 3VXSA 2WXKA 3FS9A 5LDUA 2A7BA 2QR0A 3GM0A 1DBML 2GTZB 3VGEA 3NCYS 2PMZA 2OL3A 2DLFL 2G2RB 3O2DH 2DDQH 5AQ0A 1QWHA 5C07B 3U83A 3GSQB 2C1PB 3VFMA 4G1EB 2D7MA 1JPTH 3KPLA 4UT6L 5F7EL 3TF7C 3QYMA 2IC2A 2OSLA 3JQOB 5F3HB 4EIUA 3ZQXA 4UT7L 5I30H 1NAKH 2DLHA 2WSKA 3QDGA 4Q52A 4X5PA 4XWGL 4C56A 4IDJL 3VMOA 3LPFA 1HX0A 2ZXQA 4XBGA 3CVHH 1HWGB 4NQSA 3AG3B 4MXQC 4ELMF 5JZ7C 2H3NA 3PQYE 2JKXA 1WVZA 3NOIA 4GBXD 3B4NA 4FHKA 2GUOA 3L1OL 4MAUL 5FKPA 4FABH 4PRIA 4X80H 2CKBB 1HHGA 1OSPL 4AUYA 2Z31D 1KT2A 4ANUA 2MMXA 3HZYA 3G08A 3QYCA 3NCWA 4P57B 1FNEA 5INCB 2G3NA 1NBVH 2BVQB 4ZUWA 3SO3B 4E42B 1U8NB 1D5XA 3ZKMC 2BP0B 3KEHA 3WO3B 3KVDD 4JN2B 4BFNA 5KS9A 1S4IA 3F8UB 1JXKA 1GC1H 2AXWA 3UYOD 3SDAA 5ICXB 1XT5A 3HB3C 2DB8A 2PO6A 5T33L 3T0ED 3WTSA 2P5WD 5HJGA 1U8OA 2LTQB 2YD9A 3R06B 3RX8A 3D50A 1CG9B 3JSSA 2MHAA 2XZCH 3O4OB 3OJDB 1UXSA 3T5WA 3UTOA 2WXQA 2XC8A 3HR6A 3OKEA 4KMTL 5E6YA 4FNUA 5J1AA 1FHGA 5AD0B 3MRKB 3PWVB 3Q8EA 5CO1A 3NGBB 3MXVL 4OQTA 3FZUD 1MCPH 1W0VB 3GSUB 5EOCJ 3BUYA 3Q2CA 5KJ4A 1ADQL 3X12A 4BCZA 4HPOL 3FH7A 4F92B 1KPRA 1IAOA 3G6DH 1IEAB 4NKIH 1MRFH 1IC1A 3H4HA 4R7NA 5D6CA 1E27B 3E8VA 3KNBB 1CYWA 1CK0H 2VDLL 2W9EH 4R2GD 3SKMB 1JWUA 2JIXA 4XC3L 1JTOA 1KZQA 4Z7VB 1U3YA 4JQVA 2GABA 3OXSA 3F12B 3UPAA 4WI0B 2WKOA 1EZVX 2GBAA 4LSTL 3C75A 4Z8FL 3C08L 1JF1A 3WIIL 5C92A 1PZCA 3CSYB 1S3RA 1AZNA 2EIJB 2YPVH 1O7SA 4KJYA 4O5LH 1UD6A 4QUOA 2VLJE 1WP6A 3IETA 3T8MA 3S6CA 3HE6B 4YUEL 3IDGB 1T22A 4BFOA 2VISB 5FK9B 4NUGH 3WEAA 4M61B 2I5YH 5JHDD 4FLHA 4NNPH 5MEPB 1EAPB 1GYVA 4NKDB 5F1NB 3NPZB 2ITCB 4XWOD 4JM2D 4Y4KA 3BH8B 3TIEB 1QSEA 3GSWB 4WTZA 4DO4A 4MDJA 5EBGA 4MTMA 1EFQA 5LBGA 1TCMA 2AK1L 1MG3C 3CFCL 4BKLA 4ANWA 4WDIA 1HYRC 1F11B 4KOBA 1IGMH 2H7WA 2DM7A 2R39A 5H8DA 2F18A 1N8ZB 1ZANL 1PZUB 1FYTA 3IJSA 2ZOUA 2ZXDA 2COQA 4O51A 1SQ2N 3FFDB 4IK6A 4FQQB 4PJ9A 3GZQA 4PGEA 4QOKE 4WWKC 3G9VA 2IEPA 2X89D 1BAFH 2WWMD 2D7TH 1BGXH 2YKLL 1AFVH 5C0DA 4R5VA 5I24A 4M5YH 5I0DA 4N2HA 5ISZE 1DUYB 3CH1B 4KV5E 1YCSA 1Z3GH 4OLEA 2ZWNA 3VDAA 4MD4A 4KXBA 4MMZC 4OZHB 4QLWA 4NM4L 5GGTH 2XV2A 4APQA 1QSFE 4HS6A 1Q9WB 3LPWA 4YDVA 3JV0A 1IT9L 4YK4B 3FU0A 4S1SH 1HHHA 2C3VA 2OQJA 4LPUA 2FJUB 1HK6A 1IGFH 1S7RA 3ILDA 3CX2A 1DSFL 4PIBA 4KY2A 2FQGA 3CFJB 1E43A 5FHBH 2NCEA 2VAJA 2A1WH 1ZS8A 2E7DA 5CBAB 1ICTA 1OM9A 3T0VA 3OKLB 3NA9L 5DK0B 3ZHNA 4FD0A 2OW6A 1JNLL 1IJ9A 4OGQC 5FV2A 2Z4TA 1CR9H 3IE4A 3TCXA 4F8QA 3GMRB 4DP6X 1WAAE 1PL3A 1T21A 4UINH 2DQFA 2LW3A 5GHWH 5B21A 5AVXB 2Q7YB 4NQXB 7TAAA 4POYA 1WCQA 4FL4C 3IK2A 3LQAC 2CSPA 4FULA 2OR7A 4DGYH 5FYJD 4OGAC 5DMGD 1D7FA 1DEEA 1V7NH 4HLZG 4AMXA 3OR6B 3LS5H 5GRZA 3C5JB 3L1FA 3KE0A 3QDMB 4FLRA 2D9QB 4S0SD 4UIMB 5HYJB 2YMXH 1CE6B 4KI5D 4WK4B 4X6EA 5E4AA 1JRHL 2QLYA 4I3SL 3QJXA 2J56A 4EI6A 3H54A 5F0JB 2CLZB 2GSMB 5BV7H 3QG6A 5T1KB 1PCSA 4H8PA 3BH9B 5E6IC 2WVVB 4FGMA 3RUGA 3WKQA 3BD5A 4R7VA 4WK0B 5SV4A 1P5VA 4GB9A 2NQDA 3IDJA 2EIMB 3PWNA 2WLLB 2A74A 3DX4A 2GBTA 1MCKA 2F58L 4HSCX 2C1OB 1EK3A 5CP7A 4RNRB 5IW6B 1VEOA 4OM1L 2ICCA 4M93B 5ESAB 4WUUE 5D1QC 2YHGA 3C60D 1CXLA 3STBA 5L8KB 1H3PH 5L2KE 2DQDL 4U1NA 5ALCL 1T4KA 3MGOB 4NQEB 4HPHA 1UT2A 4PRDA 4BSVA 4JK0D 4OLXH 1XIWA 3LCYA 5IMLB 1LJMA 1NCDH 1VGEL 1IM3D 2ICEC 3V52H 3IGKA 3KYOA 4TNWK 3BUQA 4WWOA 1U2CA 4QI3A 4N0YH 4R7DB 5GRJH 3TGXA 1ZJAA 4AGQA 1KXTA 1AZVA 4OKVB 2Y06H 5D2LE 3GBLA 2VDOB 2YGOA 3D06A 4XPGL 4FQXD 4YNYB 2H41A 3KAAA 5IB5B 3TA3A 2A2QT 2QSVA 2YPLE 3L7FA 1QFWH 1HHKB 5E2UL 4PRBA 1U8LB 1TVBA 2FO4A 1KXQE 5E99L 5FUZH 1JOIA 4HH9A 1G9MC 4K8RD 4P06A 3WUWA 1HL8A 1AVAA 1FO0L 4JUTA 3QHTC 3A5VA 3CN0A 1IB5A 3OGCA 5ILTH 3SJVB 2N1KA 3NEXA 4K9EL 3IGAB 4TLSA 2ZUQC 1HQ4A 5ACZA 4DW2H 4H13C 1N3NA 3O11A 4CW1A 2F54B 4LBAA 4PG2C 1U3NA 5F9AC 5HYQB 4ONGH 5ADOH 1ZHKA 1QQDA 1HEZB 4IGBD 4W4OC 5I1GH 4UM9B 4OJAA 4B5EA 4LL9A 1OW0C 4RGNE 5F9OL 3E8UL 1WBZA 3IMRA 4XNYL 3NSDA 4NCC2 4AL8H 2LAAA 1Z5LA 5DVMA 5E6RB 4MQXC 3IGUA 4Y4HA 4AMWA 4KMQA 3AGWA 1JSYA 3U9UA 4AQ1B 1DJZA 3A67H 1BQRA 3LV3A 3KL5A 1QR1B 1GZQA 2FZ3B 2G30A 2QQLL 1RJCA 2B1AL 3A4DA 4GY4A 3Q8CA 4JPSA 3CDCA 3PY9A 4QCIA 3ULVL 1OSYA 1S5IH 3P1VA 5I76A 5EOQL 3TJHD 4JVPA 1CVRA 5J6HA 1CDHA 3NAAL 1A3LL 2ESVE 2VDQH 2CPCA 4OW6A 1WBXA 3IDYB 5E95B 3ZDXF 4AQ8C 2QVKA 3S7GA 1W72H 1B2WL 5BV7B 4QRRE 1RZ8B 3K0YA 5TE7L 2ITFA 5C0EB 1LD9B 3ILQD 3T65A 4FQCH 2PXYD 5I2IB 1BVOA 1UZ6F 1E42A 4K73A 2H4EA 1LMIA 2ALAA 4LAQL 4L9LC 4QO1A 5DHDA 5E9DD 5F6HI 5C08D 1TQSA 5FYLE 2I27N 2BX5A 1NDGB 3IF1B 5D6DA 3HI6L 4HWUA 1DR9A 3A4EA 3F04A 3ARED 1UEYA 2EYTB 1W8OA 1P84K 4WJKB 3ZDZF 3HLKA 1KCRL 2C5DC 2DOCA 3JVGA 1IVTA 1AP2B 2UWEE 2KLTA 4TQPA 4Z7IA 5LCVL 3EXLA 3GIVB 1IQDA 4PCYA 2D7PA 3T8XB 1A14H 4BFEA 5PCYA 2FGWL 3ZZLA 3A6CL 1A5FH 3M45A 2WV3A 4LCVA 2Y7SA 2NY0D 2PWDA 1O9WA 4ZBJA 1G7JA 1DEDA 5C9JB 3W56A 1JIBA 4FN0A 4Y1AB 3OLDA 3NACL 1K4DA 1KFAH 2MCMA 1NM4A 3S37H 2Y23A 1DJIA 4WEMB 3O6MH 1CT8A 4WJ5B 5GRUH 4F8OA 2L7EA 3K8MA 2HA1A 3DSNB 1G9NL 2WD0A 1KEMH 3HG4A 4KNSA 2YXFA 4FFVC 4JHVA 4TSAL 3WSQL 3IFLH 1YAIA 3JUZA 3QUMA 1IC5L 4KO6A 2G4GA 3PWJA 5SX4H 4HSAC 4UCFA 3GMNA 2DM3A 1CGWA 1UEMA 2K1MA 4ZOBA 5D2NC 4B9GA 4M4RA 3DXAD 4PP2B 2HLAB 4FYRA 1O6TA 1MFUA 2Z3FA 5IB4A 1RZIB 5JORA 1JFQL 4OI7A 3FT4B 4OVUA 5MEQA 5B8CC 3RE0A 4RMRA 3OVUB 3SDAC 3IXTB 1MLBA 1XFPA 1IGYB 1KNOA 2E7MA 5DVNA 5CMAB 2V9QA 2CA3A 2IH1B 4S2SB 5FR3A 5JPNB 1M7XA 3DPBB 3LRKA 1CUOA 1T2QH 4UQ9A 1HKFA 1M42A 1ZT7A 3P11L 5AYQA 2JKTM 3JWDC 4ZFOL 1OT1A 2Q8AH 3TNNB 4L8CB 3FONB 4LLYB 1EHAA 4MNQB 3OSVA 3HUJE 3L3HB 3VFVB 1RIVL 3GBMH 3S96A 3ZUCA 4W6WB 4TN9A 15C8L 4YIQA 4DPCX 2QADC 4XBMA 3KBFA 4MJIE 3O2VL 4XPFH 1J1OH 3EDDA 5GS1A 2IGLA 4NRXB 4ZFFA 3SCMD 2ZG3A 4Y9EA 3B1TA 1OD7A 1SFHA 1J9SA 2KL6A 1P7QD 2DI7A 3AU1B 3PV6A 3ZHKA 3ARFC 1WGVA 3L4ZA 5DQ9B 5GGSY 3A6OA 5L0QC 5LKNA 2YXWA 2DDQL 3INOA 2VDQB 5HGDA 1HDMA 2XY1A 2WQSA 2B1OA 1GR7A 3J8F7 4N24A 3IRCA 4HWZA 1KTCA 5E8NA 1FJ1A 3S35H 3FSZA 4AQAA 1NAKL 3L1GA 4L1TA 3VI3E 3TYFB 5HJDA 5T5NF 2E7HA 4PJ8C 3RTLA 3RIKA 3VNZA 3CVHL 5AUMB 2LLGA 3RFZB 3BIKA 4XH2A 2O5NA 2PCFB 3I6LE 3L4UA 2EE3A 4PW4A 1F2QA 1SEQH 4FX5A 2DQGH 1W91A 2NY2C 4GIAA 1NEZB 4FABL 3L4XA 1MCWM 1YVLA 4X80L 1BFOB 3IMSA 2P49B 1SDYA 5CLZA 4GKSA 2EIDA 5FDWB 4XPHL 1U3JA 1U4FA 1J9QA 4X6CE 3TEWA 4IRJD 3K2KA 3MC0A 5FA3B 4IIQA 4FYTA 4MXQD 5E00A 2CRMA 1KBKA 4JFDD 4CJ1A 3SYCA 1GC1L 1M2VA 2MEJB 2VQ1B 3OKOA 1RJLA 4IMLB 1MFEH 4KRPB 2BNQD 3P40A 4ODVL 2IAAC 4J3WA 1TCRA 2JI1A 4JFZH 5L4IA 5F96L 2ZG1A 2PW2B 4JNXA 5EZPA 3RX5A 3S36X 4BFIB 4AYGA 5F7HA 3HE7A 1SYSA 2RGSA 2EXTA 1MHPH 2OMTB 2BNUA 4GKZB 2ITDB 3ZIYA 4JN1L 3LKOB 1Y0LB 1MCPL 2HJKA 3QDJA 2VN3A 4N2OA 3VFRB 4AYDC 4KDVA 1IAII 4NBYB 3V4VB 4XB8A 1J8HD 3FT2A 5C86A 1SBSH 2VR3A 3KWWA 5CD3B 2AQPA 3EYVB 3H42L 1KFGA 2AANA 2K7QA 1MRFL 3NZHH 4NKIL 4UDUB 1OANA 2I07B 3V0GA 8PAZA 4NT6A 1CK0L 4MJ6B 3ULUF 3EFDH 1N6UA 4I13B 3BDBA 3JWNC 3HZ3A 4G6FD 4LCYB 3IAPA 3KPRE 3UTSA 3UTTD 2ICES 5B4MC 3NRFA 1EJFA 4X4ME 4WSKA 1FI8C 3FUIA 2NYYD 3O6LH 4N6RB 2M1KA 2LR4A 1BQUA 3GBDA 2YPVL 4HAKA 2I60H 4YSUA 4O5LL 3QC6X 4G5AA 1DSYA 1M7IA 4NLAA 1MUJB 4F20A 3K46A 4R0LC 4Z95H 5IK3A 4GUOA 3MCLH 3VYPA 5JLZA 3RDTC 4U3SB 2XWXA 3S8GB 4Y2DD 3X3GL 3CSGA 1QW8A 1URLA 3KDMB 2Y5QA 4FG0A 4Q9CA 4XP1H 3BPOC 1UQSA 4BZ1H 3V0VA 2NY5C 3HG1E 1D5ZB 1CJYA 1E90A 1ET8A 2XPGA 1CQKA 5D4JA 4FFZA 1A7OH 1BX2A 1L0XA 3DJTA 4GKNB 1AQDB 5F6IC 3F6LA 4WNJA 1B6UA 2BRRL 4N9OB 4AEFA 1ZHNA 4LCIH 5ESVB 2C3HA 1M7DA 4JEGB 2VL5A 5D1ZD 5F7DB 2ZCHH 4X6DF 2A74C 3AXHA 1N10A 3WGUB 2YD7A 1I1CA 1TSRA 1EFXA 1KIQB 4RMTA 1I4FB 2EO9A 3TXAA 1CIDA 3F5WB 5KYUA 1BAFL 4PJBA 2VUYA 1AFVL 3ZDWA 1CGUA 1XTLA 2FL5A 3B6SA 2J1WA 4M5YL 3U25A 5GGUA 1NIFA 1TKWA 1U8CA 1BDYA 3DV6A 4QWWC 3U1QA 4CAGA 4KITB 2BJMH 4FQJH 2BIOA 2C3GA 2CBMA 5AVQB 4AYSA 1J5CA 3IDNB 4HJUA 3VRLE 3C5ZD 3FFOA 1FNAA 1KIUA 1M3IA 3L17A 4HJ0C 1G9EA 1WG3A 1EHNA 3DBXB 3F2LA 4H1LG 5TFSL 2BNRB 4S1SL 4UU9B 5I0YA 3FQ2A 3M1CA 4GQQA 4RRPG 4AYID 2AQQA 2YA0A 5IGXL 1L9PA 3RG1C 4DTGH 1IGFL 3KVQA 5LGYA 1YEEH 3IJ7A 1C5BH 3ZL2A 4KDTA 1FPTH 2A1WL 4QYOB 4MLSA 3SODB 1J18A 5FW7A 2I7OA 4AK1A 4X8CA 1HYSC 1ODUA 3RVVD 3RA7H 2EO1A 3DV4B 2YD2A 4MZ2A 1C5DA 1MCNA 1UGNA 3LNEA 5CCKH 2B59A 2OXHB 1KACB 1M56B 3L3KB 4URTB 2BW4A 2LVCA 3O4LA 3BSHA 4HWBA 1JXGA 3QXWA 1CR9L 5H2BB 3QUKA 4GQ9L 3O3DA 2DQIH 2VJ0A 3VB9A 2V2TB 1QLRA 5GHWL 1L5GA 2BP8A 1IGCH 1NFIA 1JG9A 1TIUA 2R0LL 4Z3HA 5CKAA 2YQGA 2JQMA 3GM8A 1V7NL 5DDHA 2WCGA 5TF0A 3LS5L 5GJTL 3RVTC 2G0LA 3AB0C 4TMPA 1EV2E 5CUSH 3OBAA 1TPXC 5L4MA 5G2NA 1AZCA 2O6FA 5DMKB 2O72A 1WC7A 2YS4A 3B8SA 6FABH 4U05A 2FYYA 4DUXA 4MA1B 1NMAH 3EFFB 3LZQA 2OMNA 1UB5A 3DC0A 4P46A 4FEMA 2OMXA 4WAFA 2V5YA 2J6EA 1XGUA 5H94B 3BZFB 4N5EC 3Q43A 3VWJC 4U6YA 2XJKA 4HIIA 4NI6A 1I9JH 3TV3H 2Q3AA 5FGBA 3EGXA 1I8KA 3MV7A 1I9EA 4CADA 1BG9A 5DFWH 5HHOD 3CSTA 1X4XA 4CSTA 4YHYB 1R5VA 2UZXA 3CFKB 4L1HA 1XMEB 4FQ1H 1NCGA 4F9PC 3K4AA 2FSDA 4XPBH 2N7AA 2XWBA 4P5MA 4YOKA 3WGVB 4OLXL 4DKEL 5CJQH 4G9FE 3KZ8A 4NN6C 2V7HB 3V52L 5D96C 1ZLWK 3ARSA 4NO3B 1Q4NX 2CQVA 4QTHA 1DJSA 1HFUA 1CDYA 4BYHA 2BCMA 2E7BA 5IJKC 3RL1A 5D6DC 3MACH 2BNQE 2AXFB 4KK9C 2GUYA 2DWDA 2L8AA 4HK0A 4F33A 4UV4H 4DAGH 2B3IA 1J8RA 4H26A 1QFWL 4AVKA 1JHTA 2MNWA 5IV2B 3HZMA 1EXGA 3QIBC 3QO1A 2PWFA 1BVLA 3MRRA 3FFCE 4HIJA 1IC0A 4J39A 4GPVA 3T08A 4I4WB 5D93C 4AVHA 2HRGA 1CDUA 3TL5A 4PJEE 3BVXA 4YO0A 3RZWA 4K7PX 4FC3E 5FOJA 3DX3A 2KZ1B 1OF0A 4CKVX 1HEJC 3NJNA 4TUOA 4JDZB 3EG9A 1CLOL 4ONGL 5ADOL 3RWGA 4QKTA 4PP1C 3L16A 4TUKH 2HCZX 5I1KH 1AH1A 1T1WB 3UJJH 1KGJA 5I1GL 2ZX5A 2V3EA 3FO9A 3VI4A 5DRWB 3EJZC 5JHAA 5EIVA 1GA2A 3RGVC 5K39B 1AS8A 5JYLA 4AL8L 4UT6A 1QRKA 4HWEL 1WHPA 3P30L 5AOIA 3U46B 3QGVA 2FWLB 5CGTA 1R19A 1CFNA 4KTDH 4M48L 5ADPH 4YXKL 3BZ5A 2Q10A 3Q1EA 4Z23A 2J6WA 1AMXA 3A67L 2HMIC 1WAAF 3JTTA 1XGTA 3LN4B 3PIQB 1G1OA 4P49A 3N41B 1DDHA 4U0RC 3EYSL 4ZO9A 1MZZA 4P5KA 3V0HA 1C5CH 2VR5A 5IM7A 2JMRA 4PJHE 3ARXA 5LAXB 4WFHD 1RUKH 4XZ4A 4AXWB 5I1DB 1IL1A 4MQXD 4YL4A 3V6FB 4DKAA 2OA9A 4QXUL 1AE6L 4NC1C 3LKRA 2XSKA 5BS0A 3KDPB 1W72L 4OKDA 3RHWF 1XF2A 3D05A 4YSPA 4FQCL 4X42A 4XNQA 4O58H 4LCWD 4AVIA 2OK0L 3HJEA 3QI9C 2PP9A 4KFZC 3S8WA 3VGAB 2V9UA 4HZ1A 4WTWA 5GS1C 2FWUA 3JWOH 1ZT1A 3E38A 3FRPG 4OD3L 3R0MA 3PL6B 5KW9H 1L9NA 5B38B 1WS7A 4LSQH 1OCRB 2GFBA 5E4EB 5IIEB 2X2UA 4PJCA 2XG5A 2WSDA 2ZWKA 5EO0B 4P2OD 4XPTH 2QKSA 5AAMA 4ZDHA 4Y7OC 3ULSB 4AJ0A 4P2RB 2FO1A 4Y4FB 1Q9KA 2WXIA 3BZDA 1ETZA 3CFEA 3OKMA 3DK0A 3HLAA 2CHDA 1LO0L 1ADQA 2ZOOA 5GSVA 4AWJC 3TZVC 1HILB 3NIFE 3KPSA 4Z6AT 3VXSD 3N40F 4P2AA 5D1XA 2VXUH 1AI1H 3IMTA 2VLKB 3ZHLA 3O6ML 3T2OA 4NQCA 3GXDA 4MNGE 3BWSA 3PAYA 3VD5A 3K5SA 3OQRA 3OX8B 5BZDB 2E46A 1I7ZA 4WFFD 5C0GA 1KEML 1SVBA 1LVEA 1YMMB 2HT3C 1Z7JA 2V3FA 1FRGH 2F7RA 4BRJA 1YC7A 3BGMB 3R7RA 4NZUL 3AS3A 3LRLA 1G7HA 2IANA 3QDGD 1UT9A 2O5XH 4C56D 1NLDL 3PWPB 4HULB 3VWKA 1JNJA 3NABL 1YUKB 3QXAB 4X6DB 1IAMA 1XF3B 1YRKA 3GSOA 4IIQC 2EVHA 1L9OA 4K23H 2OXGA 5CZXD 5A2JH 1RH8A 4N87A 2QFPA 1AANA 1KLUB 1UB6A 5KSUB 1UC6A 1QNZH 4FFVD 1M71B 4CBPA 3GXFA 4PRID 1I82A 4UV7H 3QCVH 4X5QA 2EVGA 4HJGA 4GAGL 4J8RB 4N2AA 5J0BA 4FZ8H 5LQBL 3O8XB 4YBQD 1A1MB 1AD0A 4G83A 2KKQA 4FCAA 3C9NB 1FL6A 3BT2L 3QUXB 4OFDA 1WCBB 2WYIA 4YHOL 4NAMA 3GSVA 1EZUA 5AVWB 1BZ7A 2Y7QB 5E8DL 3VFPB 4ONHA 2DKUA 2HG5B 1G1KA 3SDAD 1U8IA 2DMCA 3GBML 2PO6D 3MVSA 1GAFH 4I1NB 2XBDA 5F89B 1FE8L 2O1AA 3VM5A 5KVFE 4GW1B 5FFOA 4CC4C 4YDJB 3EUDA 4Z7AA 5KSVB 2XHNA 4PJAF 2X9WA 1NANI 5HVFB 2YAOA 3F7VB 4MKTA 3KBHE 4ISVA 4K07A 1VSCA 3S34L 1AD9A 1KTKE 1R5IA 4H8WH 4EN3B 1VF5C 4Y9BA 5T3XD 4JM2F 1AKJA 3L3IA 5AOMA 5AW3B 4A7QA 2APBA 3S35L 1RK1B 1T89A 3B1UA 3H9SA 4LLMA 1V54B 3NDYE 4JO3H 4GG6E 2E86A 4WGVB 5TD4A 3VFNA 1MIMH 3RIAK 3SKUD 4Z5RA 2C7FA 1RVFL 2X4UB 3QXTA 3VMPA 4D0CA 1DLFH 2JIXD 5D1QE 3SN6N 5JW4N 1NGPL 2A9BA 1KSRA 5FO7A 3SZKC 3BZ4A 3VG9C 1P1ZB 2UZIH 3BCFA 2ICWI 2Y6TE 2PYEE 3L3GA 4OT1L 2IH3A 3C87A 3WO4B 1XGYH 1F6AA 2UWEF 4BA8A 1TITA 3K71A 2VR4A 2IAMA 1EXUB 1LO4H 1PZAA 1U8JB 4KZ0A 2CGYA 2XYCA 3DVFA 4NO0D 1OCOB 2MWCA 32C2A 3FQNA 2FD6L 3KGUA 3WNOA 1BPVA 4OIIH 3N6YA 4KDWA 4AIZA 3MLVH 1WO2A 4Y19D 4HIEA 4BM7A 3KLHC 2NY2D 1PJWA 1MFEL 4RAVB 2NW3A 3OD3A 3V0FA 2VC2H 4Q9QH 2A6DB 4UDTA 2WIIB 4Y4KD 3J7HA 4BH7B 3H8NA 4KWUA 1UUNA 1QSED 2VR8A 1PQZA 3CH8A 5I1KL 2E47A 2NW2B 3LRHA 5D55A 3RAJH 4WO4B 4JO2H 4ES8A 5C0RH 5I66A 2YOCA 2W92A 1NMBH 2NUTB 1H6UA 1Q72H 1NCHA 1FYTD 1YPZA 1I3RA 3MFFA 4IBTA 4QOKB 5IWLA 3NZHL 3UYRH 4PJ9D 4GMSH 2X2JA 3PFQA 1HESA 3FB8B 2P3YA 3SQBB 4AVJA 3GXTA 1BZQK 4XOEA 3KJ4C 1AQHA 3V5KB 4B7IA 1QI3A 2BXYA 1TZ8A 4PS7A 4OV5A 4MMYA 3ILPB 2VXSH 1KUMA 2RA1A 3V8OA 4MNHB 3O45B 4ZSOB 1T0MB 3VXMA 4YHLL 4B27A 3PDDA 4APQD 2CRZA 2Z91A 3O6LL 3KH3A 2VL4A 4A1RA 3II1A 2QGBA 4OV6F 4BE6A 1AXTL 1MWAH 3RL2B 2I60L 2XT1B 2NY4D 1Z9NA 1YEGH 3C8KB 3HEIB 1TJMA 3PG2A 3FB6A 3WU1A 5F3BA 1EIBA 4U1SA 5A2BA 3MCLL 2XICA 3VCLA 3I6GB 2KHAA 3K4ZA 4X0KB 3I9IA 3DUUB 2ERJC 3I9GH 1JPSL 4JCWA 4QJ5B 1BVKB 1QRNE 5GGSA 1T5WB 5IVZA 3CXHK 3B9VA 1DVFA 2ZWYA 3H56A 3Q6GH 4WV1C 2RACA 5IVXF 2IDQA 1A7OL 2H6UA 5K9KB 1IC7H 1N64L 3X1BA 1KENL 1FO0A 2AQ3A 1NOLA 4EUPH 3MN8A 4X4KA 1UWGL 1A4KB 3OM3B 1Y1DA 4RBPK 4NPKA 4V1DB 4XZUB 1DUZA 2X7LA 1MFBH 1PPIA 4LCIL 4OUOA 5DC4B 3VI3F 3N1PC 2CU9A 5IFHL 2WNKA 1NM9A 2GQHA 3VXSE 2ENPA 2R1YB 2ZCHL 4MA8L 4QRQA 5DMJB 2B08A 1DQMH 4B41A 3PP3H 4G3YH 3WL9A 2IALB 1G43A 2HX7A 2W9LA 3DBSA 3P0GB 3ZZ1A 2KC0A 1IC4H 1QASA 3AMKA 3QULA 4AM0Q 1IM9D 2BY1A 3RILA 2BJML 5DUMH 1UJTA 4HOWA 2JH2A 3P77A 4JFFA 5EBLB 3QDGE 2VUKA 4C56E 2BH0A 1UZGA 4HUVA 2D8KA 2KDYA 43CAB 3RY6A 2C9XA 3V4LA 4X6BB 1XSIA 4GBXB 5BNXD 3HRZA 1NC4A 3VJ6B 3CV5A 3NJGA 3FL7A 1QPKA 5GRVK 4HK3J 4APXB 1SNRA 1YEEL 3WKMH 1JVKA 4F5CA 3M7FB 2CLVA 3A22A 3FO0H 2Z31B 3BE1H 4P4KA 1MFAH 1M9WA 3MLXH 1GS8A 4ODSL 3RA7L 1XIWD 4GFXA 4CSZA 3KD4A 4H44C 2JLPA 4ZS6D 5D2NE 3FTGB 4XX5A 5CCKL 1EQWA 4G1EA 4XX1E 4N2MA 4R4BA 2HPOA 1E4XH 5KS9E 5EF2A 3V6OC 4ACTA 2DQIL 2A73B 4F7PA 3UMTA 3GHPA 1H3XA 1GHFL 3B2VH 4HUXA 1IGCL 2X3BA 3T0EB 2P5WB 3IFOB 5CM1A 2FJFB 4FQIH 1HNYA 4OUUB 4XB3A 3OC5A 5L6YL 4QJ3B 3TA3D 2ZE0A 3QCTH 5IFJA 1HYSD 4TL4A 1L9SA 4J3UA 1WA2X 5CUSL 5I18H 1DZBA 5FCUH 3KPTA 3WFCH 5LCVA 1URIA 4E5XB 2CKBA 2R4SH 2YEZB 5KVEE 3ZYZA 4YX2L 1JF6A 5EOCH 1U33A 4RAUB 3LNIA 1NMAL 2NR6A 3UBHA 2IQ9H 2ED7A 2PCXA 2W8CA 2QZQA 1MJJA 1KBPA 2J8UA 3B9EA 3CBJB 1PZ3A 3BLKA 1HNGA 3AG1B 4UM8B 1B4JL 2ISDA 1I1AA 2NY1C 3HI1A 3NCCB 1GGIH 1ZVHA 1I9JL 5FYJH 4M29A 3CFBB 4LOFA 4R2GB 1SXBA 2V8MA 3S88L 4XNUH 4ALAC 5HGAB 2EE6A 1RY7B 3S3JA 1DQVA 2OSXA 4TNEA 3BAYA 2HTKC 4GI9A 4WFEE 1TETH 4G8FB 1NDTA 4FQ1L 3OJDA 1KGUA 2AGJL 2XNAB 3MJ8A 4WNQB 1IFHH 1FZOB 4J3OG 3ROLB 3IFNH 2P24A 4Y4HD 1XCQB 4OH2A 3BSGA 5CJQL 2IPKA 1HH6B 3C6SA 3MRKA 3QJZA 1WYJA 4EUPB 3GFUA 5EOTB 2BP3A 2K3HA 2E9JA 4KH2A 3U0TA 4DKDC 5J7CC 3Q2NA 4PJAB 2CR6A 2G2NA 1CFQA 1L6PA 1E8YA 3HAEA 3K6SA 1LEIB 1V8HA 3ETBJ 1G5GA 5D7IF 1ZKAA 5JHDB 5MENE 1KPVA 3WKNA 2BC4A 5EEYA 4N0FB 5LN8A 4JM2B 1UOWA 3QDHA 1IGJB 1VJSA 1NFDE 1RULH 4TNVK 5I1CH 4DAGL 5KYWA 3LEYH 2YZ1A 1AGCB 3GHEH 4IBQA 4I87A 1BIIB 1MHCA 4LT7A 3IDXH 1T5KA 3QNYA 2CHXA 3P73B 5HHNB 4E9SA 3OAZH 4ZFOA 2Q6WB 3LAFA 4I77H 3VRLF 2IQAA 1UXLA 3MRQA 3TPUA 4UBDC 3DGGB 5JIDA 3DX6A 2JJSA 4U31A 4L48A 4JO1H 2X40A 2P7TB 1UH3A 4LFHD 4N2GA 1FVDB 1P2CA 3HE6A 1N18A 5H35B 3BD4A 4AYFB 4PBXA 1A3RH 1E2WA 3CFDA 4OU3A 4XMUA 1B0RA 3AT9A 2W0LA 3KLQA 3U1PA 1N2RB 3FCUB 2UVEA 3D18A 2GG1A 2BFGA 4NKDA 3TO4C 1INDH 3NH7H 5IOPB 3TIEA 4K8RH 2DQEH 2I32A 2VJXA 3AACA 3ASWA 1CTNA 4HGWB 4WI2A 3P4LA 4U1MB 5C0CE 1G7PA 5SV3A 3VWKC 5CEYB 1WE5A 1K2DA 1FGVH 4FTVD 3CVHA 4WKZA 5BZWA 5L88H 3BDXA 1X4ZA 4IBSA 4PN6A 5J12B 3SBPA 3IJ9A 2X09A 5DJAB 3MYJA 3JWNE 4M7ZC 1KB9J 1FH5L 2Q3XA 4PWHA 2Y6SD 1QBMH 4FI8A 3ARBC 1XR9B 1XZ0A 2DL2A 2CDGB 2UXGA 4G2AA 4GT0A 4XMPH 1IGIH 1VFBA 3KYMA 2QSTA 1I8UA 3SBRA 3CDYA 2HMID 1S7UB 3JUYA 4DQOH 5F7UA 3DMMC 4QHUB 5AW5B 2NY6C 3AROA 3UJTH 3POHA 4Z9KB 1LDPH 1OCZB 4K3GA 3EAKA 4AE1A 4WJG3 3EADA 1MRDH 1U8HB 4C54A 5FM8A 2DY2A 1N0XL 3MREB 1ED3A 2F0CA 3AWGA 4XP6H 2FBJH 2OBGA 5IJCC 5AB0A 1Z9MA 3SDYL 1FAIH 3BP5B 3BO8A 4R7XA 4GUPB 4XPTL 3R18A 3FN9A 5KBKA 5IBUB 2WVSA 3G5ZA 5BVJB 4ECNA 3P4NB 1U4EA 4I18B 1N5AA 4MASA 5DJ8A 1T89C 1XGQA 4R97C 1UM5L 1R24A 1AG0A 2PUQT 3GMRA 1MXDA 2PCPB 5DXWA 5JHLH 3ZTCC 3DHMA 1W16A 1AI1L 5DA0B 2G9HA 2W1NA 2Y22A 3C60B 4W9EC 1CI5A 4W9DC 3WMQA 3CZEA 5IVXB 2PTTB 3PYCA 4AGOA 4WLCA 3K6DA 1YYLH 3NSJA 4HKXA 1TZHA 3RWDB 1U93B 3C2SA 3IFPA 2E7LA 2IAMC 1IM3B 1SXZA 4JREC 2X87A 3MBEA 3HNVH 1NFKA 1KGYE 4CVZB 3WJMA 2YPVA 4K23L 1W8NA 3PGCA 4GLRH 2V7NB 3DUHA 1RP9A 3FN0L 5HGBB 2EE2A 5C3TA 4FQXB 1LWJA 2J5WA 5ALBH 4UV7L 3MA7B 4EIZC 1EZLA 3QCVL 4JE0A 3QJFB 1FNHA 3UZQB 3H2WA 5JW5B 4FZ8L 4OAWB 3FQRA 4PLOB 4XE0A 3B3IB 1CS6A 1HSAB 1MCHA 2YUWA 3W37A 4XBPA 2RCSH 2EE9A 2XN9A 4LKCB 2OFQA 2YGVA 4QTIL 5FO9A 1OB1A 4IS6B 3P3TA 4DH2A 4NQEA 3VXRA 2AV1A 1B0GA 5HYSA 5HI4C 5I74B 3OZLA 5T1DL 1LEGA 2CLRA 4F58H 4PRAA 4EXPX 5C2BL 4IGBB 2APSA 5IWLC 1SN2A 4OKVA 5DC0A 3E2HB 4ATTA 3OZKA 1PNCA 4TRPH 2OJEA 2GJ6E 3HE7D 3WIHH 4AENA 3MTXA 2K45A 3RVXD 3NEOA 4KKLD 2CXGA 3L54A 1HL9A 1RJYA 2DQUL 5TDNB 4H8WL 1GXEA 3QDJD 1CDIA 1KY7A 3MNVB 3ATDA 4EI5C 3U4EA 4D8PB 3HZVB 2VT0A 4JO3L 3D39E 1TNMA 2P46B 1DYZA 1MIML 4ZAKA 3PF2A 4LSRH 1E9PA 1L9MA 2YC1A 2NZ9D 3IGAA 3NZUA 3BXNB 4XNAA 1DLFL 1USZA 3ARUA 1BOYA 2F54A 2IADA 4R7LA 4NQDA 4CVXA 3CN3A 2IXQA 3LVTA 3NQKA 5ETUA 4PG9A 4AV4A 3B9AA 5DJ6B 3UTSD 1OZTG 2UZIL 1YYCA 2C7UB 5KJ7E 4YAQA 3L45A 1TSHA 3H9YA 3LB6D 5FYKE 1A3QA 2X4OA 1ZY9A 2PXYB 4FKKA 2YBRB 1YEHH 4L3CA 3MRPB 5TPWH 4DEPB 4IJ3C 2F8IA 1KWKA 4YXLL 4HCRL 5E9DB 3U4AA 4XMXA 5C08B 3BP7B 4L18A 4FXKB 3MLVL 4Y16C 2RQEA 3TBSA 4YSAA 2OI9B 1PLBA 3LS4H 3AREB 4K9EC 1OT4A 3NIFF 1TZOA 4ZTOL 5DD1H 1OTUC 2VC2L 4IM8A 4UQEA 3U7AA 1QR1A 3N40P 1MVUB 4Q9QL 4JANB 3VFUB 2I9TA 4PTUB 1HSBB 2P44B 3PXJA 4HUMB 5E8PB 5K1VA 3NK3A 4HLEA 3ARDC 4S0HA 4U0QB 2ZP9A 5GISL 1AR1D 2X9ZA 5DEFB 4LIQL 1IBGH 3RAJL 2NY0B 1A7QH 4JO2L 2CHWA 3WXWL 3TVMA 2X2IA 5IB1A 5C0RL 5D7IB 1QMUA 3ISYA 3GPSA 3P9MB 2W07A 3ZTJG 3APFA 3CQPA 1RZ8A 1AO7E 3UBXB 5I2IA 1NGZB 1Q72L 3IJEA 3C6EA 5I5JA 1B6DA 1WV7T 3DOSB 1B0WA 5HYFA 3HHSB 1VAHA 1QVOB 2ZXEB 1EZVY 1NDGA 2ZNWA 3D30A 4G8IA 4JBSA 5ICYB 3V5HB 1KCVH 1E28A 4P4KC 3T2NH 5GRVL 2VXSL 4U2ZA 2R9HC 5DZAA 3DXAB 4K7PH 2NXYD 2DZEA 4OCLC 2J1XA 4AGLA 3GIVA 3D0VA 2YLKA 2UV3A 3BWUC 3IS0X 2Z7YA 4M8QA 3TJEH 5LLIC 5FUOH 3OAUL 3RVWD 2ADGA 2ED8A 5B39B 5EH1A 5JHMA 1MWAL 2DKSA 3SDCA 1IIIA 2KBGA 1YEGL 2XWJA 3TIDA 4FLSA 2DMBA 3IJYA 1ERNA 3C5SB 4ZFGH 2CHZA 2DV6A 2MPAL 3QZPA 1SOXA 4TQ8A 2V5MA 1EHKB 2YWZA 3O81A 1H6TA 4OCXL 2VCOA 4N9GB 4ZMZA 2O6DA 2W94A 4NC1E 3HKZA 2ADJB 4R90L 1MCOH 1RZPA 2CRYA 3Q6GL 3O4LD 4JY5H 4Z3GA 1RUMH 1IC7L 1M1SA 2EZ0D 5A2KH 2H0EA 1XEDA 4H20H 2HLAA 1DE4A 5DGRA 3SO3C 4ENZA 2YD1A 4UIKH 5C0AA 2BCKB 1LGVA 1NKRA 2WBJA 3NK4A 4FTDA 4GG6F 2VM4A 3SCMB 4GO6B 2XWZA 3DJSA 2BZ7A 1P7QB 2CUAA 1FF5A 3NSYA 1EJ6A 2CGRL 3SGEI 4E9YA 2A0LD 4BDVA 1RZJC 3ZLQC 3ZGHA 2LTQC 1EUUA 3P0VH 2WP3O 1J0IA 4KK8D 4LPVA 1IC4L 1MCBA 5CJOL 2IH1A 1SVZA 3O4OC 1X9UA 3JV5A 3NVQA 4C4UA 4NPYA 2J57A 4TUJA 1KIPB 4P46D 5I5MA 4XXCC 1ET5A 2XZQL 5JOFB 4HIHB 1R3HB 3TBCA 4F91B 1KIRA 3E6HA 1N26A 3NGBC 3S5ZA 1SHXA 5AG8A 2D3VA 1JHKH 1RIUH