3E3QC

Structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
SVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSDPPPLLTFGSGTKVIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 109
sequence length 109
chains with identical sequence D, I, M, R, V, Z, d
ec nomenclature
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3e3qC00
1DEEA 4BKLA 4G7YL 5E2WL 4MQXC 1GGTA 1EJOH 3QUMA 1CLYH 3C6LA 4WI6A 3V0AC 1XCTB 4JPIA 3T0EB 5CINL 4JE4B 4UT9H 3DUUA 3U9PH 3PGFL 2EXYC 3NFNB 4C57C 3O3UN 4XHJD 4NQDB 4FABH 5IBLC 3IDMA 4OV5B 5F7DB 4FXKB 1YEKL 4BFIA 4WI7A 3QDMD 3SPVB 3K2UH 1F4YH 1EX0A 1HH9B 5H94A 2Q86A 2XXCB 4GS7C 1H3UA 4WCYL 1EEZB 4PJIB 4XH2A 5E6IB 3EFFB 4KVNH 3EOAB 1FZKA 1IGTB 4JM4H 5ISZD 1IAIM 1NLDL 5C86A 4HWUA 4P9HH 3HE6D 3L5JA 4JQXC 1CLOL 4NCC1 4JFQB 5BO1L 1AXIB 1U3HA 5E9DA 1FORL 3B2VL 3EHBD 2KPNA 3SKOB 4MQSB 2YD2A 3WCYA 5F7HA 4L8CA 1ZT4B 3V2AR 3MCKA 3PNWA 1G9EA 4AYFA 4YDJA 2VXTH 1KULA 5IROA 3RWFB 1KB5L 3SDYH 4ONGH 4HC1H 2Z9TA 1LVEA 4WFGD 5GGQH 5JPNA 4OF7A 2K1MA 2MOVA 2KDGA 2VITA 4H1LH 4OUUB 1OPGL 4PJ8D 4FTVA 7FABH 2IAMB 2IADB 4G3YH 4HH9A 4YDIH 1BEYL 5SV3A 1H5BB 1OGAE 1V5JA 1MI5B 4X6BB 5IF0A 5EUKA 5F9OH 3VH8B 3FTGB 4URTB 5EFIA 4EDWL 2HG5A 2PTVA 5I17A 5IVZA 4HCRA 5T5FH 4IMLA 3CMGA 1MWAA 3V6OA 2IALB 2COQA 4JVWA 4NKIL 5F8QC 5DO2C 1IVLA 4GXUN 4NZUL 1DANT 4M6OH 3MLRH 4I18C 4IRZL 1MH5B 2ZG3A 4N0UB 2P7TA 3H3BC 3BPCB 1GZPB 1JZ6A 2ADIB 3BZFA 2XTJB 1S7UA 5IV2B 1HQRA 4X80L 4DEPC 3I02B 3BD5A 3OF6A 1QYGH 1BJ1J 3CXHK 2LTQC 1PBYA 3HR5B 3QZWA 5DZOA 5DEFB 1A3QA 1JK8A 2AJZA 2ADGA 3BMVA 1T22B 5BS0B 1FRGL 1U8IA 2WBKA 3SE4A 4UQ2B 4L4VA 5B8CC 1RK1B 3SDXA 3MRPB 5TE7H 5FO7B 3T0DA 3PWVA 4P2OD 1H3WM 2A9NL 1TVBB 2QADB 5LAXB 1R5IA 4PJXA 3NFSL 4GJTB 4G6FB 5C07A 4R2GB 1E28A 1D5IL 1FDLH 3BX7C 3G6JE 5KTEL 3RX7A 2MJWA 1CXFA 2VABB 4V1DE 4MVBC 3OG4B 3VXSB 1E4WL 2WWMC 1MJJB 4I0PA 3REWB 1A5FH 1X44A 4QRPA 5C0NC 1NSNL 5D1XA 2RB8A 3O0RH 4RMWA 5ERWA 4IS6A 3REVA 3QDJB 5GS1C 3RWEA 4X4MA 5CP7B 3D87B 3KPNA 3IFNH 4PY8I 4R4BB 3QWQB 5MENE 3ULUL 2J8OA 4PGBB 3CJJA 4O58H 4JRXE 3DHJA 1IAII 1IBGH 4MNQA 3ZLQC 3SN6N 1IM9B 4GSDH 4OTXL 4UDUA 4E5XB 1T04B 1KCLA 5IOPA 1ETZB 4HIJB 1UJTA 5JA9A 4PP1D 4N5UA 3D39D 1OSZA 4XWOD 1LEIB 2P8LA 4K3HA 3BSZH 1IEBA 4TOYH 5D7JB 5L88L 5BQ7B 3JV4A 4NKMB 1YEGL 1K5NA 3IYLW 3SGJC 2F53B 4PGCB 4ZO9A 1CK0L 4PRIA 4LVEA 3F5WA 2GY5A 3BQUC 1EZVY 4YFDB 5LCVL 4I2XE 3TESA 4PJ9D 3TBYB 3QG7H 2MKWA 5FV2A 1TJGH 3OHXA 4FRWA 4YBQC 1ORQB 1ADQH 1I85A 4JFPB 4OSUH 4X6DE 5GSVB 3CZJA 5HGBB 1JHKL 5IHZB 4G9DB 1F6AB 4NC1E 4D8PA 1MRCH 1MCCA 2I24N 4GMTH 3FMGL 4JFFD 1MHCA 1KB5B 3RVTC 5AUMB 5B4MD 3NABH 4OQTA 2H2PC 1JNLH 2DQDL 5TE6L 2JB6A 3KG5A 2ZSVB 4HUUB 2D0GA 4XGZA 3S4SG 5EO9B 1WWAX 4YHPB 3EYQC 5C1MB 4WUUB 4OF5A 2HKFL 4F9LA 1XGQB 4L3AA 1SEQL 2GKIA 3GO1L 4LHUG 4NO0D 2ICEB 2PTUA 4XMLL 1KC5L 5F1NA 3MRNA 4NN6C 4DGYH 5EWIL 5CD3A 1IKNA 1TJIH 2H9GA 3DSFL 3DX9B 1KNOA 3QWRD 5F21B 3H9ZA 2Q6WB 5BZWA 4YHZL 5JXAH 4RWYH 5GRWA 4PTUB 4ODVL 5TQ0H 1QPXA 5ESQB 1CD1B 3W2DH 5E2UL 1JHLH 4L9LC 4WI3A 1P1ZA 1HDMA 4XPFH 3RZCA 1LNUA 2VLJD 4RIRB 4F15B 3GBNH 2H1PL 2ZJSH 3QDGD 1J1XL 2AJ3A 1KIQB 1A9EA 3T8XA 2E9BA 4WW1B 4FQJL 4UUJB 1B2WH 5D72H 5HGHA 5TDOB 2MTPA 4Z95L 4X5WB 3JV6B 5GJSH 3CXDL 4HT1H 4LSSL 3LEYL 4K9EL 3V7AE 1D6EA 1NUDA 3MRKA 4CVZB 5K9JH 1YNLH 3HZKA 5J12B 1QTYT 3MV8D 3DJ9A 4H1LA 4ZUUA 3GSNL 4Y4FC 5J4MA 5F8RC 1RZ7L 1SHMA 4NO5B 3WUWB 4P4RA 4LASL 4OCMC 1FCCA 2ZUSA 3S37X 3AY4C 3DURA 3WS3B 3RBSA 4KROD 1GJIA 2DLGA 4HAGA 4OLUH 5E5MA 3WJJA 4QNPE 4L3ED 5FYJE 3TA3C 4YXKH 2MCG1 1FCGA 1C5DB 3M1BA 3VRJB 4BH8B 3OKMB 1KF9B 3AREA 1G7JA 3BN3B 4QRRE 3MRHA 5I1KH 4C4KO 4HUXB 4JPVL 2I9TA 3TT3H 2FHCA 5JHDA 3QDMB 1SY6A 2FD6H 2XIDA 5EOTB 2NX5D 2ZPKH 1F8TL 3RI5F 4M6AA 4FS0A 4P2QA 3RVUD 1ACYL 4NP4L 2VLKD 4TTDD 3BXNA 5GS2H 4I3GA 4F8TA 3HE6B 3L3OA 2W9LA 3OJVC 1GGBH 3FB6A 1PKQE 1RZKH 2UWEE 3BMWA 3O9WA 3HC4L 1IGCH 3QNXB 1FNAA 2OXGA 3P4NB 3BPNC 2NXYD 1G9NH 1WBZA 3GBLA 1XIWD 1I9RL 3G6AA 3O3DA 3E6HA 2J1KA 2G5RA 4G8GE 5ANMB 2KQNA 3GJEB 4ETYA 1ZHBA 2XZCL 5AZ2L 3MGTA 1UWGL 4PJ8B 2D31A 2VKXA 5EO1A 4JN1L 4I9WE 4N9GB 2EYSB 4K7PL 2F8VA 2VAAA 4E0RB 1M6OA 4KTYA 4OUOA 4YHIB 4ZPVA 1U41A 4FQXA 5JMRA 4DKFL 5FA4A 4XP6L 3H7LA 3UJJL 5F7EH 3VH8G 3RL1A 3MJ9L 2HTKD 3NIGE 1YEEH 3QG6A 2YEZB 5FO8B 3E8UH 4PJFE 4WY7H 4S11A 3EOBB 1IGFL 5E99L 5HYEA 5FDYA 4JY6A 5EBMB 4D0CB 2YPVH 2GAZB 1P5VA 3B2UC 1YY9D 5GXBB 5T1KA 4OFVA 1GPOH 2DD8L 3E6FB 1UEMA 5E4EC 2BDNL 1UACH 3QFJA 1CFTB 1CXHA 3VFUB 1MCQA 4Z0XA 1OGAD 4P2OB 3CFKB 5FM8A 1V7ML 2JJSA 1BJ8A 4GKNA 3MROA 5J6HB 3CMOH 5I1CL 3FQWA 5INCB 3DETD 2OP4H 3TJEL 1RJYA 1DQQA 2FR4A 1ZHLA 2NY7L 3GMLA 4O2FB 4IDLA 3TV3H 4IRSD 2G60H 3GHBL 3ULUH 3IKKA 1C7TA 1J11A 3TN0D 4JFDE 1SMOA 3IJYB 3QT2A 5GS0L 4O4YH 3WJLA 4ERSH 2VQTA 1OTUC 3T2NH 4ZO6A 2YUXA 1TITA 4YHLH 1ZHKB 6FABL 4Y4HD 3ZKMC 4D3CH 4U7SA 1AGEB 4PJDF 3RDTA 1MFAH 2OL3L 2VIRA 3L3GB 4WHCA 3D39B 1I1FB 1HEZB 1B0RA 1G7QB 3DRTB 5DUML 3L3IB 5I8OL 3CZFB 4AK1A 2EE3A 5DWUH 1KBGL 3V4UL 3BN9C 2DBLL 4LCYB 1FL3B 2D2OA 2FYYA 3EYVA 5C0JB 1H3GA 5C0RH 2GCYA 4V1DD 1I1AA 1NGQH 3GBMH 3HNSH 3BEVA 5CMAB 1ZMYA 3H42L 4G6KH 1RJLA 4PJ9B 2YK1H 1A6VH 3OAYH 1LEGA 2NYYD 3QQ3B 2IH1B 4P5KA 5J06A 5CJXA 1FE8H 2XA3A 1XCQB 3RY6A 4JFFB 2BY3A 5I1LA 5MEND 2MPAH 5F1KC 4XX1G 1A0QL 2DMBA 3D69A 4O02H 1DLHB 5CZXC 4U1IA 1R24A 3L5HA 3P9WB 4XVSH 5A2IH 4YBLC 1IQWH 5I71C 2FEDC 1B3JA 1F6LL 3MCLH 1DJSA 2EZ0C 4RX4D 5JW5A 3TCXA 1JPFA 4JRYE 2X4TA 3N9GL 3AGVA 1KJVB 5FUZH 5AYUL 4BM7A 4AL8H 5T1LA 4YHML 1DL7H 4NO0B 1NDGB 4HIXL 4PV9B 1PSKH 1F6FB 4ZUSB 3OAYK 1FLRH 3B9VA 4R7DB 1IAOB 3ZO0A 3ULVH 1E27A 3TFKD 3MRGB 4LFHG 3D85D 4LLVA 4F7EA 1X5FA 3ZYOA 1QFWL 5CJ5A 3JTTA 4BA8A 1G6RL 1WC7B 5BJTB 1JGLL 1ZE3C 4Y2OA 1R3HA 2H1PH 2FJHA 3G5YB 2AQ2A 4KC3B 5CZVL 1WUNT 1J0KA 2E7LC 4ONFH 2QHRL 1CICD 1CDCA 1JZ8A 3ECBB 3RA7L 2VLJB 1LE5B 1MF2H 1JNHB 4OM1H 4U0RB 4Y5XB 3QDGB 5FFLA 4BSWA 1CIDA 3JVGC 1BGXL 2BVPB 1HHJA 4XCFH 3UJTH 5IMOA 2C4FT 3GHEH 2VXVL 3BESR 4ELKA 2PW1A 4XB7A 4UT6L 5KSAC 4BK4A 4HS3B 4P59H 2CPCA 1B6UA 1LEKB 3MV8B 4JO1H 5CJQH 1AY1H 2R0WL 5IB3A 1R3KB 5IMMB 3V0WL 4P46D 2EDQA 4DZBA 2R1YB 5CEZD 1LDPL 5HI3D 4RGNC 4U31A 2E8YA 3WUWG 4HPYL 5F7LB 3MV11 4QXWA 4JN2B 2F5BH 3NFPA 1QFHA 3U79A 3K4ZA 5D7IA 4JANB 4KROB 1CTNA 3OGCB 1QFUL 4LSRH 3BT2H 4L3EB 3VI4E 2GSIA 1I7ZB 5GGTL 4UTBH 2B2XH 1U6AH 3KR3H 4WFHE 1U92B 3DARA 2AKRA 3DIFA 5DD0H 2CLVA 1I8MB 5IB5A 1DDHA 2Q8AL 3TNNB 1DBAH 4RRPG 2BSSA 2NX5B 5ITBL 1J0JA 1R6VA 1TLKA 3KPOA 4Y89A 3RUGE 1TETL 3WUZA 2C4XA 4MNGB 1WFUA 4E9LA 4JGJA 1N5AA 2VLKB 4KTEL 1OW0C 3ARUA 4X83A 2W65A 5MI0B 3LEXA 3BISA 4KK9D 2R39A 1NCAL 3WIIH 3UDWA 2YUWA 5E9DE 4XVJL 3GMPB 3HKFA 1MJ8H 5KVGL 2NXYB 2QKIA 2DF3A 3HG1A 4PRHA 1A1NB 3D25A 2EE9A 1H3PL 4P9MH 3IFPB 1XIWB 4MQTB 4AEIH 3GRWA 5FYJD 1RPQA 2DQFB 1JWUA 4X9HA 3N1MC 4X9BA 1CGSL 1FVEA 1VENA 3LKRB 3O81A 4OB5H 4QRRD 4M1GL 1VFAB 5DT1L 4PJAE 1P7QA 4FFYH 1CDGA 1QLRB 2BXZA 1KT2B 5HPOA 1N64H 4QHMB 4PJHE 5ALCL 4NZRL 4HS8H 2BNQA 3V6OE 1A3LL 1JE6A 4NNPH 5IKCB 1WWCA 3QHZH 5JTWA 4Q0XH 4N1EA 5EU7E 4APQC 1UJ3C 4DN4L 4UV7H 5GIRA 5TE4L 4XXDA 5BXFB 1OWRM 5ILTL 4PJBA 2IPKB 2BX5A 5KSBA 1V7NH 2FGWH 3UTQA 3C2SA 1EHAA 4G8EB 1UA6H 2JJTC 4ZFZB 1KEML 2R2CA 3S88L 4YO0B 2AEPL 4XNZB 4G8GD 1DBKL 1OCWH 5D6DA 4YDVB 5SWSA 2IBZX 1AIFB 5EIQA 2X42A 3CPLB 2A2QT 2LVCA 3MLTA 4I9WD 4WNQA 5D7SH 3HZYB 5FGRA 4L4VE 3SDXE 1WAAE 3CVHH 1OGAB 1JPGB 1NEUA 3H3PH 5DVNA 2APWA 4WEUD 4C59B 3GHBH 3HZVB 3KS0J 3ZE2E 5C07E 2XWJA 1C08A 1D9KC 5GS3A 3ARVA 1LD9B 4LVNC 4XP1H 3MBXH 3EJYC 4KUCD 4P5MB 4IRSB 4X99B 1WFOA 4QRPE 4JLRA 2IF7A 2AV7B 4JFYB 1OTSC 2WIIB 1RZ8B 4YIQB 1IGMH 3LKSA 4MDIB 3C5ZD 4X4ME 3TN0B 5DUPL 5B39A 5IB2A 2RJMA 1RURH 3VG9C 1A7QL 3NAAL 1QSFA 5E6ZA 1BZQK 1L0QA 1A22B 2XY2A 4LHQB 4I3RL 2ATKB 4X0KB 4J3XA 5DD6B 1VEPA 5BOZG 2XNAA 4EOWL 5DUMH 5JOFA 3G5XB 2M26A 4MNQE 4Y4HB 3UCRA 4Z76B 1G7LA 2NR6C 1BQLH 4L8SB 3GMQA 3SDCC 1J1OL 1SM3H 1E4KC 4PGJA 3DV4A 5HYQA 3S97C 4X6DF 1BECA 1IM3B 3E0GA 3VA6A 3MNVB 1IEAB 1UXSB 1ZVSA 3N0PB 2X4RB 1UM6L 3UXFA 4JFOB 3CFBA 3RY4A 3G6JB 1UM4L 3VW3H 4S0SD 2I26N 4U1JB 4V1DB 3ARGA 5D71L 5EU5A 1BF2A 1S9WB 4RGMC 1RULH 3QUZA 2VSDA 1MCWW 3D2UA 4MMZC 4O00A 2JK5B 3FAXA 1J05B 3EZ8A 4JFDD 2AW2A 2H6PB 4HHAB 4LSVL 1YNKH 3TO4C 2R4SL 3SBWC 5MENB 2R4RL 3MRCB 1JTOA 4NJAH 1X5XA 2GJ6A 1ZVYA 2VL5B 5DA0B 5FYJU 4QF1A 2DQUL 1FGVH 5EN2B 4TNWF 2ILLA 2GTZB 1BX2A 1WWBX 1NGZB 3Q6FB 5FYLL 4M7KL 4ZG1A 5IB4B 3WE6B 2VDNH 4BZYA 2CIKB 2VXSH 4ZXBD 1L0XA 5JW4N 1U3ZA 2BVTA 3TVMA 3SDDC 2CKBB 5IMKB 3GSOB 1U8QB 4OM0H 3NN8B 3D85B 1MEXH 2R1XB 2VISA 1AQDA 4WIQA 4KMTL 2KUTA 4S1QH 4I3SL 5HYSG 5DRXA 2BVUA 3CUPB 5DVLA 4J4PD 3GJFB 1CDJA 2Y7QB 3QH3A 4UINH 4P3CH 4PP2A 5EUOA 3VFGH 2D7PA 2OQJB 2IG2H 4HZLA 5DR5L 3MYJA 2HVKA 3MBED 4JFEA 4EKXA 2Y06L 4NNYB 1F4XL 1T0NB 2Z93A 3J7HA 4Q97A 2P47B 1MLBA 3SE3A 1JMZA 3VFTA 4JRYD 4Z7VA 4LGSB 5GGVY 4PFEA 5TDPA 3X13B 4FNLL 3GIVB 5EORL 3K7UA 4QNPF 3VXTA 1CE6B 3P73B 4HPYH 1HYSC 1UKSA 4LSDA 5TF1L 3QUYA 2DDQL 4P46B 1OVZA 1I75A 3ZKMD 2K9UA 4GQ9L 2D7OA 1Q94B 3B6SB 2NW2B 1W72H 5T3ZD 4X98B 3MOBL 3MRDB 3DVGA 4LVHC 4TSBL 1T7VA 4OF6A 3G5VA 2DLFH 4ZDHB 3LSOB 3A6CH 1QBLH 1R5WB 2VLLB 2XZZA 1K6QL 1S7XA 3WD5L 4GRMA 5DFTA 2CRYA 2DM2A 4OI9A 3QPQD 2UWEF 1U8PB 1U3JA 1I9JL 4FQPA 2YHGA 5JHDE 3RPKA 2VDQH 4ODHH 1NAMH 5FGBA 1HH6B 3FFDA 2YC1A 3MR9B 1VFBB 2OJEB 4PRDB 4TVPH 5JXEA 1NCAH 4GG8A 3WL9B 4ODSH 4Y5VC 3OR7B 5CGYC 4KAQL 3ZKNC 4HS6B 4Y5YA 5DRZB 5HHNA 5BW7A 2AXGA 3KJ6L 1M7XA 1TTFA 5E8EB 1Y18A 4P99A 4TUKH 2R23A 1CE1H 2AXFB 4O2CA 3KPMB 5I66B 3CX5J 2BC4B 3P9MA 3U4EB 1FIGH 4Y88A 4M1GH 4O5LH 3VE0B 3A67H 1JHTA 2YZ8A 3NIGF 3ZTNL 4LLMA 5F9WC 1JGVH 1R3IH 5LBSL 3FO9B 4P0DA 4KUCF 3S35L 4GAGL 1LO2L 4ZO7A 1I7TB 1TMCB 4WFHD 1DN2A 5L8JB 4QRRB 4OF3A 5FF6B 5TFSH 3BYYA 5CSZB 3PGCA 3NZHH 3ARDD 3WKMH 1P7KA 5IGXL 4NFBA 3W9EB 3CU7A 1E0OB 3TBSB 2R0LH 3QUXD 3QWOA 3FOLB 4NYLA 4LSPL 1U36A 4RWHA 4TYUA 2LVEA 3OAUH 1ZS8B 2PYEA 1A1MB 4LPVA 3OJ2C 1FNEA 8FABA 1BQSA 5GISH 1S9XA 4OLXH 5KG9A 2DLIA 4LBEB 5DYOB 5E9DD 3LKNB 5AG8A 4M6NH 4LLYA 3HRZA 1KCVL 3UC0H 4RFOH 1I1RA 1TCRA 3PF2A 2E6QA 2WBWB 3T2PA 3RWJA 5KVDL 3ARFA 4QHNB 2OXHA 5GGUB 1L4IA 3M17B 1YEJH 4JVPA 4M9PA 3GEWB 4MA3B 5T33L 4G8GB 4NCC2 5TH2B 4POZD 3PJSB 4PRPA 4PG9B 4FZEL 2G75A 3CFCH 5JIHA 1ZGLP 3CFJB 2IQAB 3DUSA 4YE4L 5E8PB 2DM3A 1ODAA 3QFJE 2BOBB 3IFLL 3VD5A 1UZ6E 2BRQA 4MWFB 2D9CA 2EDLA 3IAQA 4QO1A 2NY0D 4JREC 1U0QA 1NBZA 4JPWH 2DLHA 3WSQL 3UMTA 3IRPX 4MCZB 3GUTA 4DZ8A 4XNMA 3O3AB 3RU8L 1JN6A 1UWEH 1FV1B 4LIQL 5DJAA 4JO2L 3VD7A 4QRQA 3BZEA 5K9KA 1A7QH 1WJ3A 2VR4A 4DK6A 2DQTL 3GI8H 3WEXA 1QSVA 4PJFB 3C5ZB 2QQNH 3EDEA 3H0TA 1NCWH 2NW3A 4OZHA 3VFWA 4GRWH 4AG4L 4IM8A 2D7MA 4YHKH 3K3QA 3VG0H 4N8VA 4PJEA 4GXVL 2ARWA 3QI9A 4XNXL 5GGSB 4NJ9H 4K3EL 4HK0B 4CMHB 2AGJH 2NTFA 3L5WB 2R29L 2G2RB 4JO3H 2F54A 4U6XB 3UYPA 4EI6A 2EXWD 1MOEA 1U8LB 3AMLA 1IAIL 5CZKA 5GZOD 3K1KC 4PYGA 3I75A 1NFKA 3D3VD 4K71B 1I8IB 3TZVD 5K9OB 4X7DC 5C07D 1UQSB 4KK5D 1BVKA 1ZLUH 1XGPA 4F3FB 3HN3A 3T3PF 5C0BA 4CADB 4XPHH 4WI9A 5KS9B 1CS6A 1BFVL 4LSTL 5D1XD 3NACH 2XKNA 5E24E 1T2QH 3RHWF 4NRYB 1QEWA 5J1AB 4XPBL 4R96B 4JFDB 5DSCB 1WTGT 3QJHA 2C3VB 2EIBA 3BRGC 3T3ME 4LCIL 3P40A 2JJWA 1QBBA 3AU1B 4MNHB 1KCSL 1W72A 2X05A 1GOFA 3G04B 4GMSL 4MNQD 1N8ZA 2J4WH 1FO0A 2V7NA 5EU4B 3ARZA 1QNZL 5K59E 3PHQA 4LCUA 4R90H 2AEQL 1ZLUK 1A02N 3ABZA 1R0AH 3U36B 3S3JA 2Z31C 4Q9CA 4G43B 1HHIA 1EFXA 4ZXBB 1OTTC 3VXPA 1FFPB 1B0GA 1PAMA 1NAMA 4Y19A 3N1QC 3GSVA 4NN5C 2UZIL 5E94B 4M7JL 2AAVA 1YMHB 4HIIB 3S6CA 1W8OA 2ADJB 5T3XL 4RCAA 1ZLWH 5I9QB 5DR5H 4K2UH 3CFIC 5D2LF 1CR9L 5C0IB 2VDRL 1T3FB 3JZ7A 4ODBD 1FZOA 3OXSB 5J13C 1NGXA 4JQIH 1D5BA 3F7QA 1IEHA 3L1OL 3MBEB 3QXWA 3K8KA 2QEJA 5KOMC 2XQBL 5SX4I 3HUJE 4K3JH 3WFEL 1KXVC 4Z77A 4L8BB 3IDIB 2WK2A 4ZTOH 3WLWD 5HY9B 1QR1B 4R4NC 2B1AH 1AE6L 3VXOA 4JRYB 5I1JL 5AD0B 2XV6B 3OKOA 3OWEA 1CD9B 4KQ4L 4U6HB 1J5OH 3O4LE 3ALWA 4OLEA 3S96A 1JYWA 1ZLWK 1NGWB 4F7CA 2WUCL 1N2RA 2P8PB 4UIKL 1MELA 4S1SL 3UTTA 4U7MA 4LKCB 2ADFH 3B9KC 2IQ9H 3BKCL 3DECA 3DXAD 2VDPH 3OXRA 4OI8A 3KS0H 5HJ3B 4TSBH 5K9QG 5IESL 2A0LD 3MLXL 5D9SB 5JDJA 1X6LA 3ARBA 1A2YA 3PABA 4GRLC 4NFDA 4KJWD 1X4ZA 4KXZH 1MCOH 5TDNA 2NMSA 4DUVA 2X4SA 1BQHB 3QXAB 5FKPA 4U1HA 1OAKH 4YHNA 2W9EH 3VWJA 4Y4KD 5E2VH 3QEHB 5HVHB 5IR1A 3LN4B 4U1GC 2KBGA 4LP5A 4J3TA 4N9OB 1AQKL 1PG7H 1WT5A 4V2BA 4NBYB 4KGJA 3P0VL 4R3SB 2AEIT 3GMRA 4M6ML 1DBBL 1VFUA 2V9TA 3FT4A 2X40A 3EYFA 4KJPD 1BFTA 3TO4D 4EJ1C 2CK2A 5F6HI 1S7QB 4HIEA 2AJVH 1HXYB 2FSEA 1GYAA 1U58B 4ZFGH 1EO7A 5A3IC 1NFDB 4EN3C 5EC2B 4KKNA 4JFXB 4A6YL 1LO0H 1FZJA 4PRHE 2W0FB 4GAYB 3SEPA 1P9MC 1VEOA 4BKLB 3M8OH 4YX2L 1Q0XL 1QSEA 2C1OA 3ZDXE 1UZ8A 4BUGA 2XXMB 2APBA 1OL0A 3L3JA 4JO4L 3O41B 4H8WH 3D0LA 5MEPB 4C56E 2A1WH 4HUWA 3MODL 3VI3E 4MCYB 35C8H 1ORSB 5EC1B 4AEHL 1OLLA 1EH9A 1EVTC 3QBTB 3UTSE 4BFIB 2AI0H 1JPSL 3ARDB 5IM7B 1F4WH 3IGAB 3IXTA 1EXUA 1A7PH 2BRRH 1CF8H 3HR6A 2GI7A 3QUXB 5H94B 5F6IC 4G6AC 2OZ4H 3RUGB 3U2SB 4NO3B 3BIBX 4YAQA 1DUYB 2BNQE 4XH2B 3P0YH 1YQVH 3TP4A 5ADOL 3ILPA 4ODUB 1OD9A 4Q7DA 3KLHC 4AIZA 4ONHB 4X6EB 3VFOA 4Q6IC 5E9DB 1X4YA 4TUJA 4M1DH 2X89A 3SDXF 5BV7B 2PN5A 5C8JA 1CIUA 1MFDL 3HZMB 5J7CC 1ZGLM 4CVWA 2YXMA 2HVJA 3U46B 5KSBE 4PJXF 4RQQA 3ZE2F 3S4SA 5J56B 1A1OB 3QJFA 1RIHL 1CGTA 4BZ1L 1HYSD 2ENSA 3VFNA 5SWSE 5JPNB 4NO2A 2IPUG 3R1GH 5SWZA 4UB0H 4K7FA 3F7RA 2PXYA 4FG6D 4LHUA 1T80A 3TIDA 2VXUH 3LD8B 2X10A 4PJAB 4HH9B 1AR1C 2X4UB 2EC9T 5CWSA 3C60C 4YWGH 2NY0B 3N85L 5IF0B 5EUKB 1MCLA 1MRFL 3ORJA 1KCRH 4FQXD 3DYMA 4PJHB 3U6RA 1UKQA 4JZNA 1MCRA 1MWAB 3V9FA 4OGYL 3KJ4C 3DMMC 2O61B 2FO1A 4PUBL 1EGJH 2NY4C 1OAXL 4ALAL 5ADPH 1KLUB 2XRAL 2ZUUA 5F44A 2EH8L 3EOYG 4AMKH 2ICWJ 2O5XL 5DJZB 4HBCH 2L0DA 1VGKB 4CNIB 3RAJL 3QIUC 2P7TB 4YUEH 4BZ2H 4NGHL 1MAKA 4NUGL 1Y0LA 1QSFE 3Q1SL 2O5YL 2VDKH 4ZAKC 1E6OL 1HQRB 3MLZH 2GSGA 5AZEL 3G08A 1KIRA 4YEEA 3ARSA 2HLAA 1H3TA 1Q72L 2IAND 2FH6A 5H35A 4OLYL 3X3FL 1CL7I 3HPJA 4RISL 5ID1A 5IFAH 3QZWB 2NNAA 1I3RA 3MLYH 2Y07L 2HT3D 2X9YA 4ZS7L 2ADGB 2VUYA 4IOFC 3HB3C 3FQRA 1I4FB 1UB6A 1X6NA 4LVOB 5CGMA 5F96L 3SDXB 3AS3A 3SDAA 5A16A 3PWVB 5BRZA 3BO8A 3PL6D 2A6KA 3GSQA 3D3VB 1R5IB 3WNPA 3RVXC 5C3TA 3TZVB 1CD0A 5C07B 4RFEA 2ZCHH 4FHBD 1X5YA 5CBAA 3LS4H 4G6JL 1U8NA 5D1XB 4D94A 5DK2B 5ERWB 4IS6B 3EUUA 3REVB 3LS5H 2AJSH 3RL2A 3T08A 2WWKO 2OR8A 2UYLB 3GIZL 1XCTA 3T0EA 1DFBL 3ES6B 1I9IH 4EBQL 4JZJB 4OV5A 5F7DA 1TDQA 4MNQB 4FXKA 3MUZ1 5GRVK 4UDUB 3S36H 3DV6B 4LGRB 3RDTD 3SPVA 5IOPB 3WFDH 4MD5B 3GM0A 1DQJB 2P42B 4FQ1L 2J6EH 1EEZA 2NQCA 1DEDA 4PJIA 5T1DH 1T21A 3EFFA 4HJ0D 3EOAA 3JV4B 1IGTA 2L4OA 4JR9H 4M43L 1MCIA 1IRAY 1UADC 2B4CC 1CI5A 4HBQA 4JFQA 1NMBH 3G5ZB 2X5PA 2VDRH 3F5WB 4K07A 1I1AD 4XNYL 3KHOA 3RKDD 5CILH 3O45B 2Q1EA 4G5ZH 4QWWD 1ZT4A 4F9PC 1F42A 2A6IB 3OHXB 5JHLL 2CD0A 3TT1H 4KRLB 3F8UB 5EUOE 1SQ2N 3RWFA 1C1EL 4D8PB 3L9RB 4YFLI 5I8KL 4FFZH 4JFEE 5J3HD 3VGDA 5I1JH 1CBVH 2ZUTA 3NPSC 2IADA 3DGGB 3U1SH 2ZCKL 4XGZB 3RRQA 1MI5A 2A73A 4Z7VE 3VH8A 3FTGA 2AVGA 4MA8L 1KPUA 1PDKA 3ZL4L 3O2WH 1SMAA 4HMEA 1JPST 5GGRB 4YZFF 5IESH 1BF8A 2ZUXA 5GGVL 3MRNB 3BP6B 1L7TL 1RUPL 4DWHA 3DXAB 1PYWB 1OM3L 2Q7NA 1MH5A 5ALBL 4N0UA 3F6LA 3OKDB 2ADIA 2BERA 5IV2A 5IHUH 1MCDA 5FHBL 3MFFB 3QCUH 1LNUB 3SCMD 3SGDI 3PE9A 4GUPB 4NOFA 3OG6B 4JDZB 2CMRH 1BQHG 4Y4KB 4OKDA 5DEFA 2AJ3B 4M6MH 1A9EB 3T8XB 5BS0A 5DMYA 3WV0A 5HGHB 4RMSA 4UQ2A 2DQHL 3IT8D 1WK0A 3LRSB 3IJHA 5FO7A 1B9ZA 2MQCA 1KN4L 1UFUA 1TVBA 5LAXA 3UTPE 1D6EB 3W39A 2V9QA 2VRAA 5BVPH 3HZKB 1MLCA 3S37H 3TO4B 3KAAA 3O4LD 4EDXB 2VABA 1CGYA 1BFSA 1TQCB 3VXSA 4DW2L 1MJJA 3ZYJA 4P4RB 5D1QC 3I2CL 4LPYA 1X5AA 1RZFH 3V95A 4Y8AA 2FLRT 4WJ5A 1YEHL 4G8FA 4R4BA 3ELAT 5KVEL 3IXAB 5I74C 1UC6A 4N8CL 4PGBA 4Y0GA 5I1HL 3ZKXC 1GL4B 1EUTA 4E5XA 4PJ7A 1PZ5B 3RTQD 1ETZA 2BOCA 4HIJA 3MRHB 3OJDB 4OLWH 1LEIA 1BM3L 3C6LC 2EIZA 5D7JA 1T89A 3UO1L 4NZDA 2DQJL 2PR4H 1HWHB 2E7BA 1A7NH 3LQAH 5EZIH 2PYEE 3ROLB 3O8XC 3BGMA 1FNGB 5HGDB 1MIML 2EKSB 4AIOA 3L3OB 2DI7A 3EOTH 4DGVH 5IIEA 3MXWH 2B1HH 1ORQA 5HI5D 5GSVA 1NMCC 4QEGA 5HGBA 1UZ6F 5IHZA 2P48B 2EE2A 5HVFB 1F6AA 1MHPL 1QRKA 3WHXA 1KB5A 5AUMA 4JJHA 4GBXA 2JTDA 1XEDA 1U3HC 2X1WL 1QOKA 3CDGB 4EI5A 3FO2B 4FQCL 2M1KA 4PRPE 4C56D 2ZSVA 4JFZL 5EZJA 4HUUA 4PG2A 5IWLA 1DE4B 5EO9A 4D2NA 1NGPH 5D6CB 4YHPA 4MAYC 5EO1B 4WUUA 4OLVH 4QRSB 3UTSD 1LO4H 1P7QD 1XGQA 4CVXB 5ENWB 4U1LA 3RI5K 3GSUB 2ICEA 4HJGA 5F9JB 4YK4B 4ZPVB 1CGVA 4FQXB 3I3DA 1CFSB 1DLFH 4JHAL 2WP3O 4QHKJ 1KELL 1TENA 3RL1B 4ENEC 1NCUA 4U4BA 1U2HA 2XYCA 3WXVL 3IAGC 1F3RB 2YOCA 2Q6WA 3BE1L 2HFFA 3O11B 1GGIH 1OY3B 3C5JB 5ESQA 1P84J 1CD1A 1H9VA 1MFNA 1QFPA 1NANI 1IFHH 4OGAC 4JFHD 5JNYA 4RIRA 1Z6JT 3MXVL 4UQ3B 3S34H 4OCXH 4WUKH 4ZUVA 2IANB 2JB5H 3QHFH 4WW1A 5TDOA 2P5EA 4OZFB 4XPTH 1YUHB 4X5WA 3JV6A 3MC0A 2F54E 2YMXH 2NPLX 4KKBD 3C2AH 1X5KA 1S5IH 4LCCB 2Z8SA 2R8SL 2BJML 3PL6B 1DQML 3T3MF 3MSPA 4H26B 3OR6A 1CG9A 3MROB 3T77B 3WUWA 3FQWB 2FECI 1CYGA 4KZEH 3O6KH 5CJOH 2GFBB 3SE4C 3X3GH 1RJYB 5CFHA 1ZHLB 1HKLH 3GMLB 3PWJB 5I16B 3WS3A 4KDWA 4F7TB 5K59F 1BFOA 3FB7B 1DFBH 4A2MA 4WI5A 3QNYB 4XAWH 3O6FC 2FWOB 4HXAL 4M48H 5FEBA 5LQBL 1QSFD 1ZEAL 4I0PC 1C5DA 3T0XA 3VRJA 4BH8A 2F5AL 4OF0A 1GOHA 4RRPA 4HUXA 1R3LB 2KZWA 3NH7L 3QDMA 5JUEL 5IT2L 1AXSB 1PLGH 4WTZG 3RDTB 2EDDA 1P4LB 5EOTA 2VIRB 2CJUL 1B0RB 1BVLA 1ZHNB 2VZ1A 2VR9A 3HE7A 3MLWH 4HQQL 2APVA 5C9JB 3K74B 4WHDA 4PJCE 1GOGA 4RMTA 3CFDB 2FATH 1FVDB 3BWAB 1I1AB 3ARGD 1FN4A 3QNXA 1XT5A 4LSUH 3W5NA 3QUZD 3MRMA 5I8KH 3T2QA 1SBBA 4CU6A 1G1YA 4JY5H 2R0ZH 3HMXL 4P5KB 4NQSA 5I1LB 2P8MB 1L0YA 2H41A 4Y1AD 3D69B 2VOTA 2C5DC 2W9DH 4D9RE 4NOBA 4U1IB 1R24B 1DSFL 1WF5A 1XGRB 4N9GA 1I85C 2EYSA 2FB4L 1WQVT 1JGUL 5DMGD 1KV3A 4U7KA 4E0RA 5JW5B 1JPFB 4XP4L 4YH6A 2JJVA 5ACZB 5D7IF 2X6MA 1MFBH 1KB9K 1DQLL 2Z0BA 2ITDB 3F58H 1KFAH 3THMH 1AXTL 1LO3H 1HIMH 1BBDL 4GO6B 2WV3A 3L3HB 1I9EA 1OARL 1N0XL 3UTTE 5FO8A 1I7RA 5DRWB 3IFOB 4F8QA 5C70A 2DQCH 4KRMB 2HRPL 4FZ8H 3QRGH 4F9LC 3EOBA 1K4DB 3EO0A 5TQ2L 2R2HB 4JPKH 1R3HB 2OJZL 3UAJC 5EBMA 4D0CA 2QR0B 3DUHA 1OQOA 4M7LL 2GAZA 4AENA 3ARXA 3PXHA 3SCMB 1RUAL 2I5YH 4G6ML 4JFED 1KN4H 2V2WB 1JF1B 4R97B 1NJ9A 4DKEL 3HUJB 4P9HC 3E6FA 1K3IA 1HHJB 2J5LB 2Q3AA 2CSPA 3ZYZA 5D96B 3DVIA 4LMQE 3MLUH 3RZCC 3VFUA 1N4XL 4P2OA 1JF6A 4ODWB 4ELKB 3GSNA 5HHMB 2C3XA 3QCVH 5J6HA 3STLA 3QEQD 3GB7B 4IMKA 5INCA 3O2VH 3O4LB 5DJCB 3O4OC 4EEEA 5D5ME 4P49A 25C8H 4O2FA 4HIHB 4BFGA 3VI3F 4NQXA 5E1HB 2VDOH 4Z9KB 3HNTH 3GM8A 1G7HA 1CZ8H 3IJYA 1INDL 1T2XA 1XF3B 2NY3D 3H9HA 4JG1L 1KPVB 3HHRB 3K0WA 5A2KH 2VMFA 1J0HA 4UV4H 3QEUA 1AGBB 1WSST 1I1CA 1ZHKA 2EYRB 2ICCA 5E08L 1AGEA 3RTQB 3I84A 1ZLVH 3L3GA 3D39A 2DS4A 2AJYH 1I1FA 1HEZA 3ZHDA 5I18H 3DRTA 5DEGB 3L3IA 4H0GA 1QFOA 4PJBF 4MAUL 2QV2A 3CZFA 1DDHB 3UTPD 3DO3A 3F7VA 5KSBF 1U8MB 5I15L 5ICXA 5JXED 3AREC 4LCYA 2XZAL 4XPGH 4P23C 2A77H 1RFDL 1T0MB 2EDOA 3QQ9D 1MCSA 1RUKL 2HFGL 1KXTB 1M7IB 1MAMH 1OD7A 2L7UA 4GW1A 2R9HC 3F65A 1CFVL 1FSKB 4LKXB 1OAZL 1MCWM 1CD8A 1YA5A 2RIKA 2DWEA 3D25B 4JFFA 3MQIA 1ED3A 15C8H 1ZLVK 1DLHA 3K81A 3WIFB 4MD0B 2V17L 4GOSA 1Z2KA 2NY6C 1F5WA 5SV4A 3ESUF 3F62A 5FUCE 4C56B 4PD4K 3BGFB 5SWZE 2H2SD 4LAQL 5LGHH 5IMLB 1T1ZB 5EPMA 2J88L 3UTSB 1P7QB 5HVWA 5KZCD 3SHSA 4TSCH 4NHCL 3ULVF 3BE1H 4K23L 1IQDA 2DB8A 4OCRL 1JZ3A 3MJ9A 4ZUSA 4R7DA 3UBXI 1IAOA 4MGXA 5DHVB 4LEXL 2PYED 4P4KC 3MRGA 4MSWB 5HYSA 5FYKE 3QWRA 1WZ1H 4XNUH 1V8HA 5IFJA 2Q8BH 1VPOL 1RZJH 2UVEA 4HWEL 4YBHA 5BJTA 3LQZB 2C9AA 3G5YA 2GTWB 3N1PC 3GSRB 3SO5A 1UCTA 5KSUA 4L9DA 5IJKA 4K3DH 4QXUH 3ECBA 5KSBB 1O0VA 2O5ZH 4NQUA 1LE5A 3MRIA 1A3RH 1JNHA 3ARFD 3RGHA 4L1DA 2Y36L 3EYSH 1Q1JL 4E41E 2BVPA 1AFVH 3NZ8A 4PRPD 3I3EA 3SE9H 5I19H 4PJGB 4OZFG 3VWKD 1NCBH 1ZT1B 4K8RD 4HS3A 5F7WC 1L7IH 1JRHH 1LEKA 3LHPL 4KHTH 5BRZE 4M4PA 1A7RH 5JQ6L 3RZWA 3P9LA 5HHVL 1R3KA 2QJDA 4EIGB 3SE8H 5IMMA 3F6IA 1C08B 2HWZL 3MMEB 4LQFL 4K94H 4Q9QL 4JN2A 2VNCA 3O6MH 2JJSC 1EDQA 3Q48A 2VH5H 1F90L 5FCSH 3W81A 1IGYB 3OGCA 1QLFB 3WFHB 5HHOD 1M71B 4OLZH 1U95B 4N5EC 3T0EE 1QSFB 5FCUH 4FQHB 4UTAH 3WFCH 3NA4A 1IGIL 3OGOE 1HHKB 2CJUH 1Z3GH 4PRNB 4HUVB 5JOFB 1J1PL 3EO9L 2B4CL 3O8XD 5EDXA 2FBJH 1CXLA 4F33B 1GVIA 4ZFFB 1AGDB 1G7LB 1VA9A 5EA0H 1I8MA 1XH3B 2CKBH 1KTDB 4YDKL 3WJLC 2ICWA 5KBNC 1KJMA 2K3TA 1UWXH 3TNNA 4Z7NE 2WSKA 3DV4B 4LRNL 5HYQB 4MNGA 5EUOF 1IILE 4JVUA 5C0DA 1ZVSB 2VLKA 1WBXB 5D2NE 4NZTH 5IBTH 4U1MB 4KZDH 2HFEA 4ZFOL 4KJQC 5F3HA 2HTLD 1PJ9A 3HMXH 3GMPA 3ARGB 3IU4H 4LLDB 5CSGA 1RU9L 3TYGH 2UY6A 2VAJA 1A1NA 1BOYA 3QUZB 4G9FB 4Z7VF 5KVFH 3IFPA 5TGBB 2YN5A 4KV5E 1XIWA 4L5FL 1IKFL 3U82B 2MCPH 5AAMA 1U8OB 2DQFA 3OMZA 4Y1AB 2R2EB 1FQ9C 5HTSA 1UWXK 3MACH 4RAUB 2VZ3A 2UUDH 3KYNB 1YEIL 4QXGL 3WIHL 1VFAA 2JKXA 2WLZA 2OMBA 4XC1L 4QF1B 2IFGA 5CJXC 3VXRA 1BIHA 3MUGA 3RY6C 1ZTXH 1QLRA 1QKZH 1BX2B 4GG6B 5M94B 5CEZH 3QIWD 1P4IH 5K33A 1JGEB 4QHMA 2YUZA 3IDNA 4KPHH 1F58H 5DQDH 4HD9A 1EFXD 1VDGA 5IKCA 4NN7C 1C16B 3ZKSD 3O6LH 3WNLA 4KKAC 2HJFB 3GZKA 1ZANL 1KGCD 3RIFK 4GKSB 1AI1H 2YRZA 3HFMH 5BXFA 4MXQC 4HXBL 3SJVA 1G6RA 5EIIB 2HMIC 2VISB 5IHBA 1MCPH 4U3HA 4N0UE 2IPKA 1CT8A 3RWIA 4G8EA 3FAWA 1G1CA 5EUOB 1IC7L 3QH3B 3UZQA 4YO0A 3HPLA 2Y9RT 3BZ4B 4HKJA 3MYJB 4GW4B 1I8LC 4XBPB 4D9RD 4C55A 3E3QE 3CPLA 2GIYA 4B0MM 4TNWK 2XOTA 5FV1L 3SOBH 3HZYA 4ZYKA 3BEWA 4G8IB 4AY0A 1RZKC 1OGAA 1N26A 2BXYA 3HLAA 3ZT7A 4Z7VB 4RFNB 5TDPB 2DTML 2IH3B 4PS4L 4CGTA 4R0LC 4YXLL 1G9NC 1MJUH 3MJ7A 5ACLA 3QEQB 2ORBH 3WO4B 4LPCA 3VXTB 3HI5H 1LD9A 4DQOL 3I50L 1A64A 4P5MA 4X99A 1UM5H 2AV7A 5FYJH 4IRJD 1RZ8A 3CVIH 3FB8A 4MDIA 5AWNL 2VWEE 3TN0A 1A4KB 4HF5H 4JG0L 2NY3B 3QUML 4LNRB 2V5TA 4X7SH 4YDLB 1EA9C 4AH2B 5INDB 4YHOH 3L7FB 2ATKA 2EC8A 4WO4C 1Q8MA 5DD6A 4HJJH 4OGXH 3G5XA 5L7XH 4MAUH 4Y4HA 5DVOA 1S7XB 2R56L 1NL0H 4Z76A 2XA8H 4PJ7E 1DZBA 2FBOJ 1OAYL 3VWJD 5C08D 4KQ3H 3ZHKA 4H88L 1BZ9B 2LV4A 4NFCA 1YEDA 3BKJL 4O51A 3PIQB 1UEYA 4PV8B 1IM3A 3MNVA 5J6GB 1IEAA 3FFDB 2X4RA 3UJIL 1CGXA 1WCBA 2FX7L 1KUMA 4JFOA 4D0DB 4HLJA 2XWBB 4KI5F 4Y16D 3VGAC 3G6JA 4DCQA 1RMFL 4U1JA 4NWTH 5E70A 4V1DA 3D9AH 5HHNB 3ZKQD 4I0CC 1S9WA 3GI9H 1RUML 3S3PA 4IHOB 1CU4H 3EJJX 3NPSB 4WU5B 1EUUA 1Y18B 4MB4A 2H6PA 3BDXA 4XX1E 4HHAA 5FM5O 4A2LA 5H8DA 1MNUL 5MENA 3MRCA 1HILB 3LH2H 1CFNA 3MZTA 2OR7A 1K8IB 1IT9H 3UDWC 2J88H 3M07A 1DBJH 3SKJL 1KIUA 4J7RA 5F1SA 5GHWL 5F1OB 4RX4A 5EN2A 2OR9L 1ROWA 2GTZA 3U7YH 1NGZA 3C09B 4I18A 5D7LA 3Q6FA 4OI7A 4WUUE 3BAEL 3PGCB 5IB4A 4Z0BH 1UVQB 3ULUC 1JYXA 1KJ3H 1P7KB 4XNQA 3K8MA 2WUBL 4MA7H 5FHAL 4UIMA 2CIKA 1WGOA 4HCRL 3HMWH 3QWOB 3HC0B 2JELL 4UDTA 5H37G 4YHYB 3PXJA 2CKBA 3EJZC 5IMKA 2F58H 3GSOA 1U8QA 2PYEB 3NN8A 4QGTA 2EH7L 3L7EA 3D85A 2R1XA 1M05A 4FMFA 3QFDB 5I6XC 1INEL 4LU5H 1H15A 2KKQA 1U8HA 3LPWA 5HSFA 1AHWB 2YN3A 3CUPA 4GXUM 1AD0A 3GJFA 4WTXA 5B8CA 1RIUL 2HRLA 2OQJA 5IVXA 4PB0L 1G7PB 5M7QA 1LP9A 4MMXC 3RWJB 3ARFB 1WFTA 4HPOL 1NBVH 2I07B 5DJXB 2BHZA 4M1CD 4ZMAT 4O9HL 1T0NA 2EEAA 2P5EE 2ZKHH 4PRPB 1PEZA 3BKYH 4XI5D 3RVWD 3BGAA 3TWCH 4X4XB 3QULB 3LZFH 8CGTA 1CDUA 3VWKB 3DUSB 3X13A 1RIVH 2A9MH 3V8OA 3GIVA 3TBVB 2Y72A 2RCSH 1CE6A 3P73A 5D6DC 4DTGL 3WDHA 1EMTL 3GUTB 4DZ8B 3OV6A 4XNMB 5E2TL 4HGKC 1DBML 3WLBA 4X7EC 2K7QA 1D6VL 5FYKD 2ED9A 3B6SA 1GGCL 2NW2A 1NMAL 3BZEB 5K9KB 3K46A 1IGIH 5IFHH 3U0WH 4FQIH 5CBEA 5HHOB 3QUKA 2ZCLL 1R5WA 1IC5H 2VLLA 3HAEG 1U3YA 1VKXB 1N6QH 2OI9C 4E41D 5IQ9A 4R8WH 1U8PA 2BP3A 3O8XB 1CVSC 2NY2C 5HI4D 3INUL 2NTFB 3Q6GL 3ULVC 1HH6A 3V5KB 3MR9A 1U9KA 3HC3H 2OJEA 3BWUC 4PRDA 1AKJD 1N5YL 4MQ7B 1QVOB 3OR7A 5EBLB 4MJ4A 1LK3H 5BRZD 4UAOB 3QIBC 4HS6A 5DRZA 2WNGA 5I30H 1JYVA 4DUXA 4F57H 4QGYA 1ACZA 2ZUWA 2DQGL 3AS2A 3AROA 2XKNB 1F2QA 3KPMA 1FAIH 1OAUL 3NCJH 3U4EA 2CDFB 2EIDA 3QJHB 3VE0A 3JV0A 3Q3GA 4WI2A 4WFGE 1NDMA 2Y25A 3FO9A 2ZUQB 1S7RB 4GQPH 1I7TA 1EJOL 5FUOH 1CLYL 2EDWA 2VXQH 4P4KD 5FF6A 1A7OH 1N8ZB 5CSZA 1FO0B 2ZUYA 5JQHC 4UT9L 3U9PL 1YN7B 5BMFH 3TBSA 4MD4B 3QIWB 5I1IH 2P49B 4FABL 3D18A 3FOLA 1FYHB 3MLSH 3X12A 4M93C 1ZS8A 3KPSE 1A1MA 1OWWA 1S7SB 3K2UL 1F4YL 4ESKA 5C3LD 3VXPB 4PJCB 5DD5H 3NTCH 3W11D 4XC3H 4OCNC 3UYRH 3GSVB 4FFVC 1KJ2B 4LBEA 4EIZC 4PTTB 3LKNA 3U0TB 4KVNL 3LN5B 4JM4L 5JPMB 5IVOA 4P9HL 2E27H 2BNUB 3C9NA 3P30H 1OB1B 1NAKH 4U0QB 3TVMC 1HI6A 5GGUA 4POUB 3M17A 4KVCH 2NZ9D 4FA8A 3QPXH 4MJID 4XAKE 4Q9RH 3PJSA 4PG9A 4R7NA 4ZS6D 3CFJA 4WRLA 1NCCH 5DZNA 2VXTL 1OGTA 2IQAA 5E8PA 3UPAA 3SDYL 4ONGL 4HC1L 3S9DB 2BOBA 3AY4A 4HEPG 5GGQL 5I1EH 1ZA3B 2B0SH 3HI6H 2XFXA 7FABL 1DQDH 4MCZA 2R1WB 5JOEA 3O3AA 4G3YL 3OKOB 4YDIL 3TA3A 2OCFD 1FV1A 3AVEA 1FL6B 2R69H 1HOCA 4PJ5D 1T6VN 5F9OL 4GRWF 1FP5A 3GKZA 3RWHB 4JKLA 4IRJB 1MCBA 3OXRB 4PJFA 5T5FL 3LEVH 1VEMA 1FL5B 5DQ9B 2DKUA 3Q5OA 3GMOB 1Z9OA 3LB6C 4LDOB 3QUYC 4M6OL 3MLRL 3ZMRA 2JCCA 5TDNB 4HWNA 1KYOJ 5GGSA 2CUIA 1YN6B 4FQLH 3RNQB 1QO3B 2J7LA 3VMPA 4YHNB 3LN9A 4HUKB 4U6XA 5C08B 3MRJB 5IR1B 5L0QC 1X5JA 1U8LA 3QAZB 1QYGL 5I73B 3ZSSA 1BREA 2PETA 2KZ1B 3FQTB 1Z9SA 3GNMH 5ACMA 3V7MA 1CDYA 1I8IA 1WEJH 3LVEA 4Y16B 3FT4B 5BV7H 2YSSB 3EYFB 3I9GL 5TE7L 4X6CB 1R5VB 3MNZB 4F3FA 5D5MB 1F13A 5FGBC 4CADA 5KS9A 1ZGLB 4H25A 2ED8A 4LK4A 3LKPB 4NRYA 1FDLL 4R96A 4X9FA 5DSCA 1HXMB 4QHKI 2W07A 3FN9A 4GKOA 2ZSWB 2C3VA 4Y5YC 3SKJH 3AM8A 1FGNH 2C1OB 4JFFE 1UZ8B 3O0RL 1OP3H 2LQRA 4UOJA 3AU1A 4LPXA 4MNHA 2DJ4A 1J8KA 3IFNL 3G04A 1T7XA 4M61A 2NY5H 4O58L 1MWAH 3B5HA 2QSVA 5IJVB 5DD1H 4RAVB 1IBGL 3U36A 4MLSA 2ARJQ 2B8OT 2CLZA 4G43A 2XTLA 4GSDL 5F3BA 4ZXBA 1FFPA 4YAQB 1J10A 3DVNB 3BSZL 5E94A 4TOYL 1YMHA 1DANU 1Y6MR 4HIIA 4XXCC 2ADJA 3BDYH 3TCLB 1X5HA 1ES0B 1OP3K 4AIZB 3VFOB 1UG9A 5C0IA 5MERB 4GAFB 3U7AA 1B0WA 1TVDA 3NA9H 5D1ZC 3HRPA 2FNBA 4OKVB 1Z9LA 3QG7L 3GMMA 4FP8H 4H20H 1TJGL 5E7BA 4GBXD 2VO5A 1ADQL 1HSBA 4OSUL 2OX5A 2WINB 4EI5D 3QJFB 5I75C 2FLBT 4AIXA 2X44D 3IDIA 1MRCL 4L8BA 4GMTL 3VFNB 1QHPA 3NABL 3ALPA 5B21A 4JRYA 2ZOKB 2HLFD 1JNLL 4KI5C 4OQ1A 5AYQA 4U6HA 5DEZA 3QO0A 2HH0H 1NGWA 2Y6SC 4KMLB 2P8PA 2VYRE 4WO4D 2IC2A 2AK1H 2BMKB 3RWGB 5JLZA 4KTDH 4YXHH 3SO3C 2ZCLH 5C0EA 4ZQKB 1TVHB 4DGYL 3RGVC 4Z7NF 1TJIL 1WBYB 2EDKA 5E5UB 2FECL 2HT4D 4ONOA 4PJIF 3TYFA 1BQHA 4KRPC 1Z9MA 3INUH 5DFVC 5JXAL 4RWYL 5TQ0L 3QXAA 1MQ8A 5F89B 3W2DL 3G08B 1KIRB 2DTSA 4P5TD 1N5YH 2HLAB 4E41B 3CSPA 4XPFL 4WDIB 1LHZA 2P5ED 5C6WH 5JA8B 3GBNL 2X1XR 4U6YB 4ELMA 2ZJSL 4R3SA 3FQRB 1AKJB 3QI9C 1B2WL 5D72L 3D0VB 5GJSL 1UXWB 3KXFA 2VLKE 5BRZB 3EW3B 1S7QA 4HT1L 2A6KB 4WFED 3JV5A 5I76A 1U58A 5K9JL 4NRXA 1NFDA 3PP4L 1YNLL 5ID0A 5EC2A 4JFXA 2UV3A 1FFNA 1U8NB 2MQ3A 4OQTH 1VHPA 2W0FA 4GAYA 5ICZB 1WIPA 4JM2D 4KXZI 3ALXA 4NRZB 4NQCD 3BVNB 4V2CB 3ULUD 3V8CA 4Y2DD 4WEMB 1OOAA 4EZMA 3O41A 3RL2B 5MEPA 3P0GB 4KKCC 2BSTA 3J8F7 5C09A 3BH8A 5EBWB 4JY4B 4OLUL 1X5ZA 4MCYA 1ORSA 4P4KB 5EC1A 4IJ3B 3G9VA 4YXKL 3ARDA 5IM7A 2Q7YB 3VXRE 4QKXB 3IGAA 4I5BB 4I77H 4S0TD 1VCAA 3QUXA 4LPTA 4DGIH 5I1KL 3RUGA 3U2SA 1UCBH 4NO3A 3TT3L 2NZIA 3HE7D 1DUYA 1T21B 5D2NB 2FD6L 1TTGA 1QLEH 2X4OA 4ODUA 2EDRA 5CP3H 2ZPKL 3GK8H 4ONHA 3JVGA 3DRQB 4X6EA 2QHLA 3EO1B 5GRYA 5DURD 3SJVE 4MXVE 3OKLA 4KDTC 2GW5A 3HZMA 3PDGA 1GGBL 2OM5A 3U46A 1I3GH 2IPTH 4IIQC 1RZKL 2OLDA 1IGCL 2AK4D 5GPRA 1A1OA 4KK8C 1G9NL 3DOSA 4MJIB 4XP5H 4DN3H 5D7KE 3PWUB 2B39A 4JAMB 3KYKH 4BUHA 5FB8B 4JQVA 2ZWLT 4PJAA 3W82A 4BSVB 2X4UA 3IDXH 2E8ZA 1K9TA 2A73B 3GMNB 1QPPA 1HZHH 2W0PA 3FN0H 1KPUB 4L8DB 2X4PB 4PJHA 2VLRD 3BP7A 3KPSD 5GZNC 2Q20A 2O61A 4PJ5B 1EEQA 4PJ7F 1KLUA 2FX8H 4LCWA 1KIPA 2A74B 4S1RH 3DPBA 5F7EL 5DJZA 1VGKA 4CNIA 1YEEL 2ZUVA 4X8JA 1S5HB 2VN4A 1FNLA 3E8UL 3WHE1 3JTSA 1YY8B 1SY6H 4NQVB 4WY7L 2DWDB 2VDMH 4XAKD 4WW2C 1FPTH 4MA1B 1URLA 2D7TH 3L95B 4MDJB 3ARBC 3KLDA 3C8HA 4KKLC 1A14H 4LNVA 1ZAGA 3ET9F 5GJTH 2YPVL 1I4FA 4S2SB 4DVRH 3I9GH 3IJHB 2VUOA 4I13B 1WAAA 2OK0H 1GPOL 3D3VA 3W39B 1MCEA 3TZVA 1RZGA 1MLCB 1UACL 3CNKA 3UP1A 3P4OA 5IW6B 4UNTA 3T4YB 4S1DC 4QCIA 1UYWH 1KN2H 5DK2A 3CMOL 3SGEH 5HHXH 1MSPA 1HQ4B 3L5XH 2OP4L 5EZLB 4WJ5B 3X17A 4G8FB 2UVFA 3TV3L 5JZ7D 5JIIA 2UYLA 5L9DH 2G60L 3ES6A 3H9SA 4LOUC 1MAJA 4WTZA 1T1XB 3VGFA 1JTPA 4JZJA 4O4YL 1F3DH 4PJ7B 2FX9H 4ERSL 3DV6A 3MRFB 2BOCB 3T2NL 4MD5A 3B8YA 1DQJA 3V4PL 3NIDE 5D7LE 2NY1C 2PO6D 4YHLL 1FFOA 1EAPB 3TPUA 4D3CL 2EDTA 2EIZB 4QRUB 1H3VA 1MFAL 2LAAA 5I8EB 1U42A 3F7PC 4UZGA 2CXKA 5EOCH 2CIIB 4J3SA 5FO9A 3RVVC 4U3CA 3G5ZA 1GIGH 1F3JB 5DXWA 3BGMB 1EO5A 5DWUL 2N1KA 3O45A 5IIEB 4CVUA 2A6IA 4OZFH 5FA3A 1A6WH 1X7QA 5C0RL 4OD2B 1NCTA 1NGQL 2IJ0C 3GBML 3HNSL 1B6DA 4G6KL 3L9RA 4XTRD 5DC0A 5IVXE 3WHXB 4R0LB 2YK1L 1A6VL 1LP9E 4GBXB 3FQXA 1D9KA 4JB9H 4KK6C 4EI5B 4MJ5B 3TH3T 2DQIH 3DGGA 1FE8L 1KCUH 4DAGH 2X4NB 3BKMH 1WZMA 4M4RA 5GRZA 5EZJB 2MPAL 4O02L 1MCJA 2AJUH 4M9OA 3NCMA 4XVSL 1SJEB 3ILQD 1IQWL 3U48A 2WBJC 2V5MA 3MCLL 4LPUA 4U1LB 4HMCA 5GGRA 5E6YA 1QRNB 4HJGB 3AMKA 2DM4A 3BP6A 3NPZB 4WO4B 4L3CB 5FUZL 2BVEA 2PXYC 3DXAA 1PYWA 4AL8L 2AABH 5CEZE 1DL7L 4W70A 1PSKL 2HFFB 3SDCA 1YMME 1FLRL 2VZUA 3D1MC 1ZXQA 3OKDA 1A21A 5D8JH 5CP3A 3ULVL 3BW9B 2P43B 4XB8A 4WWKD 2D7QA 3VDCA 5I2IB 3MFFA 1ZWIB 5JNYB 1V05A 2ARJB 4GUPA 1DTUA 3KPLA 4JDZA 1MPAH 4Y4KA 3T04D 4P5TB 3H3KA 4RMUA 1JPTH 4ZUVB 1N7MH 3JWDH 1DVFD 4ONFL 1ZKAA 2P5EB 1LK2B 1WZLA 2VC2H 3LRSA 5J8OA 1UH2A 3UPRB 4G7VL 5L6YH 1MF2L 4OM1L 4F7MB 4OZIA 4H5SA 3PP4H 4XCFL 3UJTL 3TO4A 3W0WD 3GHEL 3SBWA 5C2BH 5ABDE 4EDXA 5JO5B 3OR6B 4WV1C 1CG9B 1MFCH 4P59L 3IDGB 4JO1L 4KUZH 3KPPB 5CJQL 3HCVB 1AY1L 3SDAC 4B7IA 4JM2B 1BFOB 3IXAA 5GS0D 4F58L 2Y5EA 4NQCB 1F02I 3FQUA 4Y2DB 1LE9A 4Y8DC 2YWYA 1OSPH 2F5BL 3C8KB 3FT2B 1PZ5A 3SDDA 4XCCH 4U1NB 1HWGB 2IBGA 4LSRL 4GLRH 1G0DA 3BT2L 3OJDA 2WANA 3L3DB 5C92A 1B4JH 3IDYB 4UTBL 5FYLE 2B2XL 2R0KH 4QOKE 2DL9A 1U6AL 3KR3L 2XZQH 4QY8A 3T0EC 1GC1H 3CDYA 1BVLB 1CN4A 1KXQE 1CFQB 1NGYB 1T66C 3HE7B 3WFZA 4JHBA 5DD0L 3EDKA 3H6JA 2IGFH 3ROLA 1C5CL 2MQ0A 3V6ZA 1FNGA 1RHHA 4ZUTA 1DBAL 2EKSA 5HGDA 5FGSA 4MXWL 1A4JA 4EVNB 1X3DA 5DURB 2B5IB 5JW4M 5K93A 2BY1A 1FN4B 4CW1B 3QEGH 3DI3B 1IC4H 1OT2A 5E6IC 3UBXB 5J9PB 4F37K 3MRMB 4N1HB 5FM4A 4Z7OE 3O3EA 3WIIL 4NQSB 3F7YB 2AK4B 1MJ8L 3CDGA 4PB9H 4ZPTA 5FECB 2XQYK 2YD4A 3FO2A 3WN5B 4NQEE 1WIUA 4P9ML 1T2JA 3KNBA 1DE4A 3V52H 1KTLB 1ONQA 2C4FU 4AEIL 5D6CA 5F6HJ 4QRSA 3E2HB 1PD6A 3VRIB 4NPYB 4CKVX 4CVXA 3VXRD 5ENWA 1FG9C 3RGVD 3GSUA 5F9JA 3I6LD 4DJMA 4OB5L 3AS1A 1CFSA 2VLRB 2R15A 2C3WA 2IAMC 3QDHA 4FFYL 5CLTA 3KPSB 3LCYA 5IVNA 4PLKC 1H5BC 1G9MH 1I7RB 3O11A 1VGEH 3C5JA 4H8WC 2YD3A 1N64L 3G6DH 4HS8L 3SY0A 5AAWA 1QG3A 4NNPL 4WVRA 3SJVD 3QHZL 3EO0B 4LP4A 4Q0XL 1T03H 1N6UA 3SKMB 4UV7L 5T5NG 5DHXB 4UBDD 2AERT 2JCCE 4UQ3A 2Z35B 4AENB 2IANA 4X4YB 2CGRH 5KW9H 2Z91B 4IOIB 1CQYA 4OZFA 3SQOH 1YUHA 3VXMB 4HG4K 1NBQA 4N0CC 5D7KD 3KWWB 1V7NL 2FGWL 5E8NA 3WFBH 1NJ9B 5HDQL 1UA6L 1BHGA 1S78C 2XTJC 4PLJC 4UILH 4XCNB 5L2KA 1OCWL 1O7SA 4LCCA 5EULV 3X11B 3PL6A 2EYTB 3VD3A 3NIFF 5BVJB 2W59A 3GSNB 4MQXD 5HHQB 4H26A 5IB1B 3C87A 1BIIA 3MA7A 2DM7A 2VZOA 3T77A 5D7SL 3STLB 1TQBB 1CDIA 2GFBA 1OF2A 3CVHL 5KN5B 4GFTB 3H3PL 2EXYD 3QB7C 3PWJA 1YYLH 5I16A 5KS9E 4NQXB 2QADC 3GRWH 4F7TA 5IBLD 3FB7A 1H3XA 5CD5C 1G7HB 3MV7A 4HFUL 2HT2C 3QNYA 3BUYB 3IAPA 4R2GC 5KAQG 4XP1L 3MBXL 4MS8C 5E8DH 3H9HB 1MQKH 2FWOA 2CQVA 5H37H 4J3WA 3QEUB 1IGML 4OV6F 3V4PH 2CK0H 5TPWH 3OPZH 2VWEC 4U3XA 1RURL 1R3LA 1AXSA 1MRDH 3U9UB 4K7PX 3BI9X 1P4LA 3U30B 3ZTJG 4TSAH 4CN4A 1CXIA 2PO6B 1ZHNA 2WAHA 5D93B 3B9EA 3MRRB 4PBVC 1BQLL 1C12B 5C9JA 1L6XA 1Q9LB 3F7VB 1D5ZB 5ICXB 1SM3L 3CFDA 2GJZB 1FVDA 5E5RB 3BWAA 4NSKA 5D7JC 3PHOB 1T89C 2MKLC 3MO1B 4S10A 1E4JA 4Z78B 4GW1B 3VW3L 4CN6A 3VXUE 4XZUB 4MZ3A 2DWEB 4U49A 3CLFH 3UTZA 3W5MA 1RULL 2P8MA 5JW3H 1ED3B 3FZUC 5HD8C 1NCDH 4AJ0A 1JNNH 3W9DA 1XGRA 1YNKL 5DO2D 2RHEA 5H2BB 1KG0B 3CC5A 3E1F1 2V5RA 3BHBB 3L6FA 4NJAL 3U7WH 5ACZA 5D7LD 3ZDZF 1I7UB 3B5TA 5EPMB 3FRUA 2ITDA 5F97E 2YBRA 1GH7A 5DD3L 2YKLH 4OT1H 3QP3A 1FGVL 3L3HA 4M8QA 5MEOB 1IQDB 4YQXH 1BWWA 5DRWA 3IFOA 3NCCB 1L6ZA 2VDNL 5HYSB 2VXSL 2V7HB 1K4DA 3OX8A 3T0VA 4DOHE 5IFJB 2R2HA 5T3ZE 5MEQA 2F74B 4NT6B 3PP3H 4OM0L 2QR0A 5D70H 2I25N 1MEXL 5KSUB 1OP5H 4WWKB 4AT6B 4TQEH 4XMPH 1HINH 3SCMA 3UPCA 4S1QL 5FK9B 2P45B 3MRIB 4G7VH 2V2WA 1JF1A 1NEZB 4UINL 4P3CL 3HUJA 1DVFB 4MVBD 4HGMA 1A9BA 3VFGL 3NZ8B 2AXHA 2IG2L 2WWMD 2F19H 5DI8B 1Y6KR 5C0ND 4ODWA 1BJ1H 4ELME 4F15C 5L8KB 4Z7WA 3GB7A 1TNNA 3KXFE 3W0WB 1JGDB 3O4LA 5DJCA 1AGCB 2Z8WC 3P9LB 3DO7A 4RDQG 2XG4A 4HIHA 2VN7A 3PP3K 2UZYB 1NFDE 4F58H 1OP5K 2IMNA 4LSQH 5DHYB 4NZJA 5J12C 3TJHC 4RA3A 5DZLA 4XPAH 1XF3A 1YMMD 1KPVA 3RY5A 1AD9B 4N0FB 3VFSB 1AGBA 5CJ8A 4MJ6B 1W72L 4NKQB 4U6VH 2EYRA 3O2DH 3RTQA 2DBJA 2RAMA 2HKHH 5C09E 3CDCA 1QBMH 1W2KT 4PRBA 5J0BA 1UB5B 4E42B 2DLFL 1MUJA 3BQUD 4NBZB 2OL3B 1O7VA 1J9CT 1QBLL 3A6CL 4MXVF 5DEGA 3GGWB 3BPOB 1C5CH 3QXDB 5DJ2B 2ICWB 1KJMB 4HW6A 3DTXB 4MXWH 4YBQD 1U8MA 3MA9H 5DUBA 4XHJC 5JIKA 5C0DB 2VDQL 4ODHL 1NAML 1T0MA 5DJ0A 2PTTA 4TULH 1XAUA 1M7IA 2OBGA 3M45A 3RVTD 3STZB 4TVPL 2HFEB 4ZSOA 3DX7A 2J12B 3BDBA 3HNVL 1TPXC 2H2PD 5F70A 4ODSL 4YC2B 3FO1B 5F3HB 3AB0B 4LHJB 4LKXA 2BZDA 1PQZB 2ZOLB 3MREB 3EYQD 1MIEH 3HE6C 2AJXH 1QSZA 3UBXG 3WIFA 4MD0A 1MFEH 3CXHJ 1LO5A 4B50A 3L3KB 3EHBC 4TUKL 4Y7MA 4JHWH 1NC4A 1CE1L 4C56A 3VCLA 1K4CB 1T6WA 1FIGL 4H0IA 1MCFA 1U8JB 3VFRB 5IMLA 2P1YA 4O5LL 1T1ZA 3A67L 3SO3B 2IFFH 4HWBH 3UTSA 5FYLD 4QOKD 3VXRB 1JGVL 1R3IL 3MUGB 1DN0A 3RGVB 3RX5A 3OBAA 4C4KT 5EOQH 3BPLB 1YDPB 3WDIA 5GRJH 5TFSL 3IDNB 4PJ8C 5ESAA 3NZHL 5DRNB 3WKML 5DHVA 4MSWA 1MCHA 2ERJB 2VDLH 2R0LL 5FKAA 4LCWE 3RKPA 3LDBC 3IS0X 3LQZA 3OAUL 3GSRA 2GTWA 3SJVB 5IUSA 1G6RB 3V0VB 5MP6H 4GAJH 1CT8B 5GISL 3EYUL 4NBXB 1T20B 4OLXL 3RWIB 5IW1B 5HDQH 2CXGA 4L29B 4M6NL 3IRZA 4MHHG 3G6JF 4Y4FD 1X5IA 3HPLB 3UC0L 3UZVB 1VSCA 4HKJB 5LXGH 1JIBA 4NQED 4BQBA 4RFOL 3MRQA 1FFQA 3LQAC 4PJGA 2G9HA 1ZOXA 1NFIB 1YEJL 1ZT1A 1CLCA 5I1AB 4ZYKB 5GRUH 3BEWB 1P9MA 3CFCL 3HLAB 3CH1B 4G80B 3D3VE 1XR8A 3MJ7B 5KSVA 4LAJH 1KOAA 3OKYA 1JWSB 5DJDB 3TA3D 4HFUH 1F11B 2YRPA 3MMEA 4JPWL 3OKEB 1AGFB 4ZO8A 4P2OC 1NBYB 1XGTA 1P2CB 1PEWA 2FJFA 1FIEA 1M1SA 3NIDF 2BY0A 3FB8B 1IGYA 1UWEL 1QLFA 3HAEA 3WFHA 1M71A 4EQ2A 2WIMA 1U95A 2H32B 1TTUA 4GS7B 2QSCH 3GI8L 4FQHA 3H9SE 1C5BH 5I1GH 1HHKA 4PRNA 5EZOH 4HUVA 2QQNL 1NCWL 1Z0NA 1SYSB 4F33A 4ZFFA 1AGDA 3P4MB 4YHKL 3VG0L 1XH3A 2QQKH 1KTDA 3JWOH 3R06A 3CH8A 4NIKB 3MOAH 3ETBF 2W1NA 3GSWB 1YEDB 4O51B 4NJ9L 1FBIL 2XN9D 1WBXA 3DROB 2AGJL 5IVXF 2J2ZA 4JO3L 1WCBB 4M7ZC 4U1MA 1LP9F 3B4NA 2Y4SA 2C1PB 1TZIB 4PP1C 4MX7B 4DCQB 4WFFE 4M03A 4XWOC 3TC9A 3BIKB 3RIFF 4LLDA 4M3JA 1MCKA 1TNMA 4G9FA 2VQ1B 2I9LB 4CDHA 1EBAA 4B53A 5TGBA 5HYIA 2C26A 3EDJA 2AV1A 4ORGB 3CCHB 4JHZA 4K7PY 4XPHL 1U8OA 3FONB 4Y1AA 2R2EA 3NACL 1QHOA 1T2QL 1VFOA 4K8RH 1CFNB 4RAUA 4PJ9C 3KYNA 1N3NB 4XBGB 4OGZA 3I6GB 4OCYH 5DD3H 4DFIA 1MREH 1P6AB 1JJUA 2E6JA 4GG6A 4I18B 3K1DA 3PQYD 5D7LB 5B4MC 3O2DA 1JGEA 2AQ1A 5IQ7H 2J4WL 2NXZC 4XNQB 4UIMB 1C16A 3QQ4B 4UDTB 4R90L 2HJFA 1TJHH 4LARH 4DEPB 1YZZA 2A83A 2X70B 1LGVA 4NCDA 1R0AL 4KY1L 2VKWA 4GKSA 3DXAE 3TPKA 2LTQB 1VERA 3B2UD 3L7EB 1M05B 4N0CD 5EIIA 4R26H 1H15B 3LV3A 1U8HB 3VMOA 1JZ7A 4ZD3H 4PLJD 4P2YA 5C0CA 2ED7A 2X1QA 3VFPA 5C0GB 1AD0B 5B8CB 4YNYB 3VXUD 4JKPH 4M3KB 4ZTPH 5IVXB 1T1YB 3BZ4A 4K2UL 5E8OA 4HH8A 4GW4A 1LP9B 4FQ2H 4M5ZH 4XBPA 2FGZA 3S5LB 2LE9A 3P11H 4JQIL 2VLME 5IK3A 1NEZG 4G8IA 4TRPH 3KPRE 5KJRH 3FB5B 2Q76A 4R4FH 4OZIE 5GS1B 2IH3A 1HK6A 4U0RC 4Y5XC 4K3JL 3QEQA 1YQ2A 4ZTOL 1Q0YH 1JL8A 2B1AL 1OTUD 1U91B 1MY5A 3QISA 4HWBA 1J88A 3B43A 3PGDB 3LMJH 5CLWA 3FCTA 3WLBB 3BP4B 4BQ9A 3FJTA 1J5OL 4RGOH 1A4KA 1EZVX 1YMMB 4JJ5B 4LNRA 2ADFL 2IQ9L 1JYNA 4AH2A 5INDA 2VDPL 1FO0H 2WM0A 4IDJH 5CBEB 3L7FA 1A6UH 3D5OF 3ZYIA 1A8JH 3QUKB 4XWGL 2PYFB 3BN9D 3WNNA 1MCOL 3V4VH 1EHLH 3CLEH 2A6JA 4KROC 1BZ9A 5IQ9B 3BQUB 1RJZB 3T65A 3PIQA 4PV8A 5C7XH 1XF5A 5J6GA 1OAKL 4F9PA 2W9EL 4Z7OF 1KJ2H 3Q0HA 5E2VL 3LPFA 3ULSA 4D0DA 3HNVH 4OCWH 2XWBA 4M5YH 1IZJA 1R3JB 2BVQB 2WQRA 3KXFD 1PG7L 4ZFOA 4PJDE 1FZMA 5CZXD 4HULB 4IHOA 2DLTA 1JZ5A 4WU5A 2FEDD 3ZE0E 3RVUC 2EZ0D 4TTDC 2AJVL 3ESVF 4ZFGL 3LIZH 5MI0C 1HILA 1YJDH 3HI1B 1MVFA 1PKOA 4UU9A 1K8IA 1S9VB 2ZNWA 1LO0L 3Q3GB 1FNSH 5EO0B 3WIHA 1CL7H 1NDMB 3M8OL 2NXYC 4NN6B 3LAFA 3TGXA 5C09D 4Z7QE 5C0FB 4WHTB 4PJFF 1GGYA 1EO8H 4HK3N 1XIWC 4UT7H 4H8WL 3FFCB 4J2XA 1UVQA 4QOKB 3MJ8B 1S7WA 2A1WL 3DYOA 1KEGH 4L9LB 35C8L 1F2XK 3HC0A 3D18B 5EG6C 2JCCF 3X12B 2AI0L 1F4WL 1A7PL 2BRRL 1CF8L 2OSLB 2VB5A 2E5EA 2V9RA 2Z92A 3FT3B 3QFDA 5ITFB 2OZ4L 3EYUH 5T3XD 3P0YL 1AHWA 1YQVL 4NM8H 1E6JH 4AQOA 5F71A 4EUPB 2HTKC 3C9NB 4FQQB 1G7PA 5KSAD 2H8PA 1HI6B 4OF8A 2I07A 4Y4FB 5DJXA 4M1DL 5F9DC 2DMKA 2DQEH 2IANE 4M62H 1KENH 4NQEB 4R7NB 5EU6E 2ENYA 5KS9F 4XCEB 1UH4A 4X4XA 5D1QA 1P7HL 3QULA 1OGTB 3VWKA 3QR2A 5EBGA 4RBPH 4RGND 5L2KE 3UZEA 3QXUA 3TBVA 4XNZC 1YY9C 3R1GL 4UB0L 2M8XA 1T83C 1UKTA 2XFXB 2VXUL 3AUVA 3TA3B 4BELD 1J7VR 2KL6A 3MTRA 4YWGL 1HOCB 3B83A 1W0YT 3KDMB 1ZSDB 1KCRL 3IU3B 2W0LA 1Z5LB 4LCWD 1NKRA 3RPIB 5C6TH 3MV7E 1AJ7H 3DETC 5HHOA 1E4XH 1EGJL 4BQ8A 1RVFH 5ADPL 2IBZY 2H26A 4IRSC 4AMKL 2JCCB 1VKXA 1GAFH 4RBPK 2YRLA 3S35X 4HBCL 4Z8FH 2VE6A 1RUQL 4JDVA 4HAFA 3O8XA 2XG5A 2QQLH 3TN0C 1YYMH 4YUEL 4BZ2L 1FBIH 1YEFH 4TPRL 2VDKL 1YECH 4J23A 3V5KA 3MLZL 1RHFA 3MNWA 3C6SB 5JORB 4TNVF 2V5SA 4MQ7A 3BPNB 1QVOA 5EBLA 5IFAL 1RZJC 1JZ2A 2XN9B 2FCBA 3MLYL 4Y4HC 4GH7B 3KYOB 2N4IA 2D3VA 4XP9H 4L8SC 3VD9A 3Q5TA 5DC9B 1X5LA 3CFEB 5GRVL 4J6RH 4OD3H 3MOQA 5J1TC 3PHSA 4H25B 2Q87A 4MAYA 3CK0H 2ZCHL 1KACB 4LQ1A 2CDFA 4CUCA 2W60B 3LS4L 2XKSA 3SGDH 1S7RA 2BVOB 3H9SD 4NUJB 5DDHB 1RI8A 3U4BH 2NYYC 3LS5L 2D7NA 2AJSL 1KSRA 3V79C 4APQD 4M61B 1TZGH 2D03H 1SJHB 1YN7A 2YWZA 4PRAB 2G5BB 2EC9U 4UNUA 1I9IL 4MD4A 3PQYB 3QIWA 1T1WB 4K94C 5FYKH 4KY1H 2PNDA 4CJ1A 4X6FB 1FYTA 2CLZB 5F3BB 4ORZC 5TJWK 3S36L 3T4AB 1S7SA 43CAB 3MLVH 3WFDL 4MYWB 4PJCA 2EE6A 3KYAA 4FXLA 2J6EL 12E8H 1KJ2A 3BRDA 4WFFD 4PTTA 1RD6A 3KPTA 5T1DL 3U0TA 3IKCB 3LN5A 4JR9L 5JPMA 1GHFH 2MSPA 1ZK9A 1J8HE 5E1AB 3RIAK 5IP4A 2BNUA 4L4JA 4ELMF 1OB1A 4ODTH 5JW4Q 5E4EB 1NMBL 2CDGB 3VXUB 3TFKC 4QYOA 5CILL 1AO7A 4G5ZL 4QTIH 3CD4A 3GMMB 43C9B 1XGYH 5E7FA 1HSBB 1D9KD 1NFDF 3VJ6B 3TT1L 5A2JH 2D0HA 3EJYD 2K7PA 1CICC 4FFZL 4NC1C 2ESVD 1OTSD 1CLZH 3S5LG 1ZA3A 2N56A 1P6FA 4Z7WE 5HHME 1CBVL 2R1WA 4AZ8A 5JR1L 3U1SL 3VI4F 3O6FA 4JDTH 3QO0B 1JWMA 1FL6A 3EKCA 1WV7T 4BH7B 1JNJA 3IDJA 3SKNA 3VDAA 4RA0C 5HDLA 3RWHA 1QBAA 3O2WL 4IRJA 5JLZB 2NR6D 1FL5A 5DQ9A 4XVTH 5C0EB 2CH8A 2IWGA 3SDCD 5CIPA 4DOHB 3GMOA 4XWGH 3MV9A 3RUGF 4P2CG 4P46C 3TBWA 3TYFB 2W38A 1YN6A 1V3MA 5HI3C 4WEBH 3ZZ1A 3RNQA 1QO3A 4W4OC 3NMEA 4N0YH 1SBSH 4HKXA 5C08A 5IHUL 3MRJA 2DN7A 2XICA 2VLMD 3QCUL 2X4QB 3GKWH 4ELMB 3KPRD 3FQTA 2CMRL 3S36X 4D9LH 4Y16A 1RK0B 5JDSB 2LU3A 2YSSA 3KXFB 4BJLA 1I3UA 4X6CA 1R5VA 3MNZA 3WS6A 5D5MA 5AEAA 5I76B 4I0KA 3EFDH 4PGZA 4ZSOE 1ZGLA 4NRXB 5BVPL 4YBLB 3LKPA 3DNKA 5ID0B 4XBEH 3S37L 3QCTH 5DMIL 5I71B 4OZGA 1P4BH 4Z7UA 4PJAF 1FFNB 1HXMA 1NANH 2ZSWA 4NM4H 3WXWL 5GQBA 3RNKA 4KK9C 5L2JB 4PJHF 2NXZD 2BFVH 5ELIA 5LWYH 1RZFL 3PWPD 1NLBH 4CMMB 3ARYA 2BSTB 4KHXH 1BQUA 3SDDD 4ZUWA 5C09B 3OZ9H 3BH8B 2V6HA 3CDFA 3QO1B 5IJVA 2DIBA 4RAVA 1F97A 4YPGB 1PFCA 2BK8A 2BCKB 5CCKH 2DMCA 2NLJB 1BZ7A 1S3KH 4OLWL 1WTLA 3DVNA 1S9KC 5C71A 4LF3B 2X4OB 2CLRB 5M95B 5ESVB 3LRHA 5DQJB 3TCLA 2P46B 2PR4L 4NWUH 1ES0A 3C5SB 2ZNXA 4P3DB 1A7NL 4UI2A 5DLMH 5MERA 3LQAL 5CEYB 5EZIL 4XCYB 3OKLB 2I60H 1WAAF 2HFTA 5C0AE 3EOTL 4DGVL 4JFHE 4OKVA 5KSAB 4EUPG 3MXWL 2B1HL 2CDEB 2WINA 5MHSE 1JV5B 1FC2D 5FM5M 1ZLSH 3ARWA 5HDBE 3KLAB 4HC1A 4PJGE 2ZOKA 1XF2A 4RGNB 5CUSH 1NGPL 4G7YH 5E2WH 2GYSA 4NKOB 4OLVL 4HKBB 1LO4L 1JP5A 3BP7B 4RNRB 4NKDB 2BMKA 3AFLA 3RWGA 1G84A 5DJYB 5GRXG 3WDJA 1FJ1B 5CINH 3NVQA 4ZQKA 1TVHA 1CXEA 3PGFH 4LCWB 1KIPB 1DLFL 5GGSY 4U33A 1WBYA 3ZTJH 3OKKA 1RUQH 3MV01 1YEKH 2RBLA 5FDWB 4D9QD 2ITCB 4X8JB 1GGIL 4TPRH 5F89A 4P23A 3JTSB 5JIPA 3L5IA 2FJGB 4WCYH 5CGYD 4Q2ZB 3ZKND 4E41A 1MJ7L 3C5ZC 4WDIA 1IFHL 2RQ8A 5EU6D 1TPXB 2VQUA 1NLDH 4AEEA 5CKAA 5I0DA 4U6YA 1CLOH 2E9JA 5F7FA 3ZT6A 3S34L 4OCXL 1AKJA 1SJVA 5BO1H 4WUKL 5GSRB 5TF0A 5L2KD 2JB5L 3QHFL 1FORH 3B2VH 5IEKB 3D0VA 4XPTL 4MB5A 1UXWA 5ISZB 1IC1A 4CMHC 2YMXL 3C2AL 1U2CA 1RZGB 4Z5RB 1S5IL 2PKDA 3RQ3A 3P4OB 4YR6A 4ZNCD 2P4AB 1KB5H 4QCIB 3D6GA 1P5UA 1G7IB 2HP4A 4A6YB 2FEEI 4X9GA 4G9FE 5ICZA 1J87A 4K71C 4KZEL 1OPGH 3O6KL 4NRZA 5CJOL 3MV7D 3BVNA 3X3GL 2VERN 4YGVB 1HKLL 1BEYH 3MYZA 4Y1AE 3MZGB 3H9SB 4EDWH 5EBWA 4JY4A 4U2ZA 4P4KA 2HA1A 4XAWL 1I1YB 4APQB 1UJ3B 2Q7YA 4M48L 4NKIH 3AM8C 4I5BA 3LDBB 4NZUH 4GG6E 3KYMB 3EGSB 1FFOB 3MRBB 5IBUB 4IRZH 3TPUB 1YNTB 5D2NA 1PLGL 1IJ9A 3STBA 4HGWB 1HCVA 4CJ0A 3LKOB 5FO9B 3DRQA 4X80H 3EO1A 1PG7W 4GW5B 3MLWL 3VFVB 1G6VK 3KVQA 4X8XA 2FHFA 2RR3A 4ZXBC 3CIQA 1XR9B 3RWDA 4OZIF 2FATL 4OAWB 5C0CE 1IGJA 5FA3B 1X7QB 1FRGH 3CX5K 4OFYA 1CWVA 4LSUL 1ADQA 4MJIA 4P2RE 5DJ6A 2A9NH 2MHAA 3DLQR 5I9QC 2F9BT 3I3BA 4JY5L 2R0ZL 3FQXB 3PWUA 5L8LB