1BMGA

Crystal structure of bovine beta2-microglobulin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Histocompatibility antigen
molecule keywords BETA=2=-MICROGLOBULIN
publication title Three-dimensional structure of beta 2-microglobulin.
pubmed doi rcsb
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bmgA00
1A6WH 2J6EA 2BC4A 4U3HA 5CP7B 1MEXH 4EI5D 2HTKC 3TNMB 4GXUM 4QRPB 3PHOB 1FNSL 4JFYA 3NCJL 3BZEB 3B8YA 2VDOL 4XMKL 1KFAH 4M6NL 4WEBL 4ZUWA 1BMGA 2J6EH 4I18B 1TJGH 1F6AA 2G9HB 3QFJA 3P4NB 1YEGL 3O3EA 5DRNB 5IJVB 2NX5E 1FFRA 5IVXB 1H5BA 4XXDA 1G9EA 1EVTC 3JWOC 5F93C 3BZDA 2AJSH 3DPBA 5T1KD 2FX9H 3KPTA 4R0LC 1BBJA 2E27L 1YEHH 1NSNH 2W60B 1N6VA 2VJXA 2IBBA 4UV7L 3VFMA 3MO1A 4C54A 4ZPVB 3WIHL 3IFNH 4P3DA 1C7TA 1UXWA 3BGFC 5KN5A 1MRFL 4NN5C 1GIGH 4DUXA 4I3SL 5EC1A 1X44A 1U3JA 4N9GA 2IH3B 4L4VB 4RGNE 3EYFA 5EU3A 2VWEC 3MLZL 1ND0A 3MJGX 3O2DA 3LB6C 4HGWB 4XX1G 2GKIA 2ZNXA 1KJ3H 1KLUA 3DI3B 3KPRD 2P8PB 5DK2B 3H9YA 4QCIA 2HVKA 4JFOB 3DXAA 3O2DH 1I1AD 5LCVH 3NTCL 4ZOEA 4HK0B 5HHOB 1IARB 4ZODA 2BMKB 1U2HA 5E7FA 2W9DL 1MHHA 2AK4B 4OUOA 3LN5B 2IANA 3L5HA 3U6RA 3ZL4L 2O61A 2CUIA 5IHLB 5I8KH 4HC1A 1JPST 1CGSH 3NFNB 1QHOA 1YMHB 3GMNA 1WV7T 4P99A 4EDXB 1UC6A 2FNBA 2QQLL 4AIOA 4LU5H 3EOBB 2IG2L 4HLZH 1AI1L 3HC4L 1FYTA 2OZ4A 4P2OA 5C0CD 4HC1H 1TVHA 4UU9B 3ZT5A 1T7XA 3R0NA 4OLUH 2PO6D 5GRJL 1RZKC 4MA7L 3GI8L 3BKCH 4GAFB 5KVFH 4YBLC 2V2WA 3MV8A 1D6EA 2A77H 3FQUB 4QRQA 5GGSY 4K7PL 2HG5A 3D3VA 3CX5J 3MUZ1 2OZ4H 4NYLB 4OJFL 3VGAC 4B5EA 1HK6A 3IETB 3QRFM 3B43A 3D39A 5HPMB 3CFCH 3UTSA 4PJHE 5SWZD 2OCFD 2YRZA 1HOCA 4AEIL 4XHJC 4KVNL 1YN6A 5EZOL 3LKOB 4NNXB 1WQVT 3ESUF 9CGTA 1ZSDB 4HXAL 1KPUA 4U1SB 1DQJB 1RK1B 1KPVA 4JFFB 3RGVC 1ZKAA 4HIHA 4JHAH 1EEYA 4C4KT 3E8UL 1GOFA 1NAML 3IDYC 3MRLB 4OCWH 2CR6A 2ZP0T 2C1OB 3ZMRA 1DUZB 2NTSP 3Q3GB 1JPGB 2OP4L 2WBWB 5E4IA 2FB4L 2V17L 3QXUA 3SGJC 2R2CA 3ZYJA 1TZHB 1OCWL 3BP6B 3ILPB 4K71C 2P4AB 32C2B 5FM5M 3GIVB 1FNGB 4JO3H 2ED9A 1P2CA 5EWIH 3KLAA 1QSEB 4UDTA 4XVSH 1KCSL 3BGAA 5TH2B 2ATPA 1RULH 4AK1A 3WHXB 4NQDD 2XTJE 3QFDB 2QEJA 4HWEL 4K3DH 2WP3T 3MNZB 3GSQB 4PRDB 4TRPL 2VLME 4ETQA 1A6PA 3EOTH 5E8EA 4NQCD 3T1FB 2IALA 4M8VA 3PV7A 3Q6GL 3U4BL 2V5TA 1ED3A 4LNVA 2GTWB 3O9WB 3QEUA 2DL2A 5BV7H 4Z76A 2F5BH 1DP0A 3CSYB 3DGCR 5I74C 5KSBF 3BH9A 4PS4L 4ACPA 5HDLA 3OAUL 2FIRT 3N50A 4XPFL 3WCYA 4WFFE 1QLRB 4QXUH 2KQMA 5E94B 1UH3A 2NY5L 5HGDA 2BHZA 4EBQH 5IK3A 1AJ7L 3VFPB 5C3LD 3EFDL 3BIBX 4G8GE 3IAQA 5J0BA 5HYSG 3WLBA 4DGVH 2EE6A 1TPXC 1TZGL 3B5HA 3DIFB 2FATH 4L8SA 3SQBA 1LE5A 2DQJH 4L9LC 1QPPA 4BSJA 1FO0B 2D0FA 4X4ZA 3P4LA 1CGTA 4WV1A 5IMMB 3VFGH 1SMOA 3FONA 1MHCB 1T04B 1BZ9B 5F8QC 4RWHA 4XCEB 1SYVB 4MXQC 5J1TC 5HYSB 3FB5B 2JTDA 3ZDZF 1UJ3B 3PHQA 3CLEH 1IGYA 4QXGH 2HMIC 3HCVA 1JGDA 4CJ1A 5KSBA 1S7QA 2XN9B 4YK4C 5DEFA 5DJYA 1I8KA 2LTQC 5TGBB 2VDKH 4LCCC 1CVRA 1M4KA 2ZUXA 3RNQA 2XTJC 1QVOA 5DGRA 2UZYB 4YHKL 3RKPA 1MVUA 3HMXL 1YUHB 3MV7A 1WEJL 4GG6B 5C1MB 3T77A 3U7YL 1G7MA 4P57B 3REWA 3H6JA 3QXTA 4WJ5B 5EUOE 3INUH 1QHPA 1Q1JH 2FD6L 2HJKB 3RTQA 5F9OH 2YPVH 5IESL 4O51A 5D7JC 1AGDA 4XNUL 4MHHG 5FECB 1HHKA 3CSBA 3SDCA 1L0XA 4NFBA 3F7YA 3ULSA 3QIWD 1A6WL 3C8KB 3MRRB 3MJ8B 4HS3A 5BQ7A 5DUPL 2JJSC 4L8BB 2UY6A 1BOGA 1N0XH 1WITA 5LAXB 2EYTA 1QBAA 4R96A 4RFNB 3WL9A 1KFAL 5KSUA 3BGFB 2J6EL 4AEEA 5FB8B 4IS6B 3H9SB 5C08D 1TJGL 3S88H 4KJWD 3R4DA 3H0TA 4JQXC 3UPCA 4DGYH 2AJSL 3LN4A 4MGXA 2XA8L 1E27B 4PRPB 1UADC 2FX9L 3MRGB 4HV8A 4O4YH 1YEHL 3W82A 1NSNL 2BY3A 4ZS6D 4MD4A 1EHLH 3H3BC 3AUVA 1S5IH 2PUQT 3IAPA 4KTDH 3IFNL 4KTYA 1U6AL 3QI9A 1RJYB 4HUXB 5J1SC 3F5WA 2BSTB 4YC2B 1UM4L 1HSAB 2DDQL 2V7NB 2J5LB 5EPMB 2GIYA 2MPAH 4FQCH 4CW1A 3EYOA 5I19L 3O8XA 1MLCB 4RAUA 5I30L 3HTLX 1RUAH 2NX5B 1FORH 1CGVA 1T03H 3FCTA 2VL4A 3O2DL 3VWJC 1P7KA 1N4XL 3HI6H 4NZRH 4HKZA 4OM1L 4K9EC 1KLGA 4NM4L 3BAEH 1ERNA 3SO3C 4K7FB 3D85D 4GO6B 2YOCA 3NOIA 2E3VA 4JFDE 5DMIH 2NZ9D 1GRWA 2YPKB 5I8KL 2VLKB 1I8IA 2C7UA 2I60L 4GRLB 5EIIB 5C0BB 3SO5A 3ALPA 4RGNB 1XF3B 3WXWL 4DKEH 4OZHF 3U9UA 4L5FH 5FYJH 1EEZA 3TV3L 5T1LD 4P4RB 3EGSA 4RGMC 3BKCL 5KVFL 1HYSC 2A77L 1MAMH 1OP9A 5E2TL 3Q5OA 1WAAF 4FQJH 3EBAA 2ZUQC 5GS0H 3HMWH 4XPBL 1K8DA 5IBLD 2MWCA 3NIGE 3KYMB 3QYCA 1EFXD 5GRYA 5I1HL 5GZNC 5IEKB 4JKLA 4X9FA 1I3RB 1Q8MA 3QNXA 3S8WA 5ERWA 4WO4A 3SDDA 4Q9QL 1CU4H 4OSUH 1BFOA 2XFXA 2Z35A 4G6FD 1EDQA 4JHAL 2C3HA 3B8SA 1VEPA 4OCWL 4BQ6A 1F4AA 3VD5A 4OZHA 5I76B 3W0WD 3NCFB 4S0TD 3EFFA 3BFOA 1TLKA 4Q6IB 3OX8A 1NCNA 1TZIB 5JNYB 4HDIA 1UXSB 1AD0A 4P2QA 3LZFL 5BW7A 1WAAA 4JO3L 4GKSB 5EWIL 2EDQA 3A67H 5DJ2A 1RSFA 3A6CH 2ARJQ 4JFXA 5DVOA 4F2MB 2UV3A 2V5MA 5F8RC 3KPRE 4YLQT 5L8LB 1TXKA 4K3DL 1OAKH 1QZ1A 3MRKB 4FQ1L 4D3CH 3L3GB 3O3AB 4NCDA 4EI6B 4UOW1 3EOTL 1CL7I 1A7NL 1TPXB 1MNUL 1Z9SA 5EFIA 1JYXA 5TDPA 3WBDA 5L6YH 4L9LB 2X4TA 1YA5A 4ZUSA 5BV7L 2F5BL 4N0UE 5CIPA 3GB7A 3K8LA 3TIEB 1FG2B 1U58B 2E5EA 4HLJA 2CIIA 4OAWB 1MQKH 4QXUL 3CC5A 3TCLA 1YYMH 3AFLA 5B38G 4EBQL 5IFHH 5EBMA 3U46A 5CIPH 1H3VA 1ULVA 4UOJA 4QHUA 4AM0A 1B90A 1Q0YL 1R3HB 4DZBA 4UT9H 4DGVL 2HJLA 5C0CE 2VNCA 3TFKD 3QG6B 2FATL 2YD8A 3BEVB 4LCCB 4X98A 1OTTD 2DQJL 2W0PA 4DFHA 4QRRD 4LCYB 5B38B 5IBTH 3VFGL 5CCKL 1VGEL 1ZANL 1A9EB 4MA1C 3V4PH 1BZ7A 5DZLA 4OQTA 2QADD 5DVKA 2ZSWA 2DBLH 4DQOH 5GIRB 2YEZB 4G80A 4BYHA 5SWZE 1T89C 3HI1A 1JHTB 4KRMB 4UTBL 1AO7D 1U95B 1WZKA 1AFVL 5D7JB 1QBMH 2VDKL 4MQ7A 1CLYH 3BYTA 2XQYG 1C16A 3WLWD 1RJLA 5D7IF 1I1AC 4G8GB 5J4MA 3ZSTA 4LEOA 1WFOA 3FQNB 1BX2A 1ZT1A 5BVPL 5D71H 3C60A 1K8IB 1AH1A 3PJSB 3KJ6H 1BIHA 1A47A 3QUXA 3VFUA 3DTXA 3UPRA 1Q1JL 3EJZD 3CPLB 2H1PH 3NPZB 5HYQA 5F9OL 5FGRA 1HZHH 1MHPH 3KPOB 2FX8H 4K3HA 4CVXB 1I4FA 4OF5A 4WHYH 4NQDE 5CJ8A 4W4OA 4FXGA 5K9OA 4J8RA 5DJAB 1N59A 4S0SD 3UJJH 5MERA 3LD8C 3JTSA 2GJ6B 1XZ0A 1TETL 4HKJB 1U3ZA 1G6RB 4ZFFA 2DRUA 2UUDH 4JN2B 1AHWA 2L7UA 5D7IA 4KKAD 3S88L 2X40A 1QOKA 2G5BA 5D1XA 1JTPA 3M07A 4JKMA 1IGJA 1JWMB 2VLLB 1DTUA 3EDJA 1NLBH 1JL8A 4UAOC 4NSKA 5ICYB 5E0QA 3QEQA 4DZ8A 2O93L 3RVXC 1GXEA 1T80A 1EHLL 1S5IL 3TZVD 2YR3A 1U8PB 3UTPD 4YPGA 3BRFA 4NO0A 3ES6B 2O5XH 5C0IA 5C0GA 2NY3B 5GSVB 3X12A 5GISH 1ZS8A 2FX7L 1K9TA 1LD9A 1HHHB 2V7HB 5EU5A 2MPAL 4FQCL 5CJOL 1U8KA 5HSFA 3RPIB 5IIEA 5H35B 2P8LA 1U8OA 1NC2B 1U0QA 5T3ZD 2Q3AA 2QLVB 3DUSB 1MIMH 1WBXA 2AJZB 2NY7H 2NY4D 1XCTB 3UCRA 4G9DA 1D5ZA 3GGWB 4NZRL 1T1ZB 1UYWH 2NW2B 3BAEL 4RGMB 1IAIM 5CBEB 3OR6B 5GHWL 3O41A 4E41D 5HYIA 3OGCB 2ZUQB 1XCQB 2X1QA 2AEPH 4G5ZL 4PJGE 3JTTB 2YBRB 3SOBH 4QHMA 2CLZB 2QBWA 4G43A 4ODSH 3ZE0F 4JLRA 5K9QG 4OTXH 2DQGL 4G9FB 4XVTL 1B2WH 4OKVA 3E6HA 2IAMD 4DKEL 2HRLA 3S3JA 4L5FL 1JVKA 3GSNB 2V9RA 3EYSH 4OCRH 2NXZD 5D1QB 1PLGH 2B5IC 5F3BA 1KJVB 4PG2C 4OD3H 5EZJB 4FQJL 4PGDA 1HIMH 3B6SB 1JE6A 4KV5E 3HMWL 1TTFA 1BQSA 5C08E 3TBVA 1FZJA 3GSUA 5HGBA 3LRSB 1LDPH 2HVJB 4DUVA 3LKSA 2QV2A 1LO3H 2F54A 3LKNA 1FDLH 1AC0A 3QDGA 3FQWA 5J1AA 4NNYA 2WMPA 4NKOB 3OG4B 4LRNH 5FO9A 5BRZD 2OTPA 4MNHA 4ODTH 3S35L 4OF7A 4BH8A 3MRFA 4HXBL 3RHWF 4EI5B 4PGEA 1DUYA 3CDGB 3L9RB 3E6FB 1P4BH 1CICD 3A67L 1CQKA 2VLRB 3UBXI 2MOVA 4F15C 4FMFA 4PJ7E 2ZOLB 1OAKL 2OL3L 5FYLH 4EN3A 2ZCKH 4D3CL 3D87B 1JWUA 4DTGL 1AGBB 5DT1H 4LHJB 4UT7H 3QIWC 3PF2A 5DFWH 2E6PA 3J7HA 2XXCB 4M3KB 5L6YL 5KVGL 2EKSB 3MGTA 3TBTB 4JZOB 4ODHH 4IRSD 3B5TA 3QCVH 3C5SB 4GOSA 1FV1A 4J12A 5GRXG 4HULB 5IFHL 4KJWC 2ATKB 4R4NC 1FIEA 3QUKB 4MJ5A 4Z77A 3ARUA 1J1XH 2YUZA 4MLIA 1FVDA 5CJXC 5KVEH 3RZCA 3GIZL 4M62L 1S9VB 4EJ1C 4UT9L 3CFBA 4Y5VB 1XGTA 3LH2H 4YFEA 4TUJB 5F1SA 3KPRB 5CKGA 4ZS6C 5IEHB 5IKCA 5C0RL 3FT4A 1A6UH 2BC4B 1CXKA 3QPXL 4HBCH 3IRZA 3GRWA 3NZHL 1G7QA 3V4PL 1XGYH 3ET9F 3QNYB 2W9EL 2MKWA 4BZ2H 2DBLL 3BKJH 5FYLD 1NC4D 2DN7A 2OR7A 1YMMA 3OJVC 3OKEA 4LASH 4M8QA 1FPTL 4N8VA 5EU7E 3D69A 4N0UB 4OCYL 1NDGB 1F6AB 4XP4L 3FT2B 4OQTL 5DD5L 4QKXB 5E5UB 1F8TH 1H5BB 2HAZA 1TJIH 4QTIH 4QHLB 4Z9KB 2VL5A 5B3JF 3C2AL 2EEBA 3LQMA 2XTLA 1P69B 2EZ0D 4E5XA 1MOEA 1R3JA 4TTDD 3LD8B 1DEEA 3W0WE 4J3TA 2EDBA 4YDIH 4TN9A 5D71L 5DUMH 2PO6B 5C0DA 2FWOA 3SJVD 3KJ6L 4MX7A 3IKKA 4I5BB 2W65B 1UXWB 3TESA 2AW2A 5KN5B 4QYOB 4IMKC 1BFVH 3BZFA 3VXRA 2H1PL 4AQ1B 2NZ9C 3SHSA 3LS5H 2FX8L 1ZLVH 1FFOB 4DCQB 3EYFB 5D5MF 2GYSA 1MLBA 5CWSA 2LAGB 1UCTA 4G7VH 5I1CH 1PAMA 4XCFH 4MQXD 5SWZB 2DQEH 4K8RH 5AD0A 3BX7C 4ZAKD 3UJJL 1KLUB 4Y5XC 4S2SA 1K3ZA 3IAGC 1FN4A 1DVFD 3FOMB 1EEUA 2HVKB 1I3VA 3UTQA 1UWEH 1QP1A 4HLZG 1KUMA 1JI1A 5LGJA 4H88L 4RA3A 1A8JH 4LBEA 5C0ND 1DN0A 1IM3B 4MAUH 4ZXBD 5IBLC 5EU7C 3OKOA 1J0HA 2EYRA 5DD1H 3DGGB 3KLHD 3QR2A 1NMCC 5D5MA 4MAYD 5FO7A 3UROR 2QR0A 3C5JB 2VDRH 4P2OB 1D5BB 3OKDA 2FEEI 4QRRE 4X7EC 4YFLI 1MJ7L 3ARBD 2O5XL 5IT2L 1T1XB 1S7VB 3VFRA 3SDAA 4QRQB 4Y16D 3RQ3A 3WO4B 4ZNEE 4NQCB 3KYAA 4MMXC 1CFQB 4M61B 1AO7E 3UTSB 1HOCB 1MIML 3ME0A 4JVWA 5F7HA 4X5XB 1HHIB 2NY7L 1F3JB 4D2NA 4YHOH 1J8HD 2KZWA 2GSIB 1KELH 3BWUC 2X70B 1EEYB 2GJJA 2D03L 1OD7A 3L6FB 4YHPB 1ACZA 4Q2ZA 4E0RB 3OHXA 2GEEA 1L7TH 5IM7B 3SKOA 5ISZA 1JZ2A 3EDKA 4BH7B 3MLUH 1CT8A 1KCVH 4RDQF 5CGMA 3ZHKA 1KCKA 2CRZA 2WIIA 3SOBL 3BH8A 3SGEI 5IB5A 4ODSL 3CVHH 4OTXL 1CTNA 4OIBA 1AP2B 4AENA 1B2WL 2QQKH 1P2CB 4LP5A 3KLAB 3Q6FB 1XAUA 3LEVL 1RJZB 3BPLB 4J3VA 1BHGA 2XWJB 5JW4Q 1I8LA 1K5NA 3EYSL 3VXSA 2AXFB 3H7BB 5IBUG 2F53A 3TFKC 3PGDA 4I9WD 3TO2B 5CHNB 3RY6A 5IR1A 2H9GB 1OTTC 4X99A 1HIML 1A7BA 1RUPH 3ZT6A 4G8IB 4WEMB 5GPRA 3C6LA 4I13B 1ED3B 1XH3A 1MCEA 2QADC 1JNLH 4Y5YA 2YD4A 5IBUB 1GH7A 1WJ3A 1UZ6F 4M02A 4NQED 1RZ7L 4PJGB 1MAKA 5T3XH 4NO2A 2D0HA 1FDLL 1NBZA 2IC2A 4MWFA 1EIBA 3R06B 4LFHD 1IEAA 1SJEA 3GBMH 3UTPE 2B4CC 3WNPA 3QIWB 2W9LA 1S7UA 2FIKB 3MMEA 1MFAH 2E6JA 3K1DA 2Y5TA 3IGAB 2VDPH 4LLQA 2EXWD 5DD3H 4GBXA 1P4BL 1X5XA 3WD5H 4LPCA 2VZOA 4U1NA 5C0EB 5KSAD 2XKUA 2ITDA 4KXZI 5C08B 3PHQB 2L4OA 5EU6D 2AEIT 1HILA 3MACH 5T3ZE 4J4PD 4PY7B 1BIIB 4MQSB 2OTUA 1JGDB 1VEOA 3T0XA 2XPGA 5DT1L 1I8KB 5DVMA 1NGWA 4DWHA 3RNQB 4FA8A 5L8JB 3QQ4B 1MVUB 3PWJB 4IJ3C 4E41E 4WY7H 4PV8B 1ZHKB 1G7MB 4KKAC 2X4NA 1SEQL 3G5XA 1CYGA 4HWZA 4P9ML 2EIZB 3MUJA 4GW1B 4Z0XB 4S1QL 3DV6B 3KAAA 5FK9B 2EDHA 3RTQB 4K94C 2VLJD 2ED7A 3U30B 2KPNA 4F37K 5GGSB 4M9OA 4BQ8A 4Y4FD 4HGKC 5CEXB 3ULSB 2CLRA 3TZVC 5SV4A 1A6UL 2BRRH 5BQ7B 4OGYL 2K1MA 5KSVB 1XIWA 2NY1B 2AAVA 4W68A 1ORSA 3UJTL 3TO4D 2D4DA 1WLHA 1KIRB 3SY0B 1Q94A 6CGTA 1OAXH 3BKJL 4I3GA 4R96B 4F9LC 3WL9B 4LASL 5E99H 4NO3B 2Q86A 3D85B 3GRWL 4U1LB 3RAJH 1S9KC 2B7DT 3K0WA 1F8TL 1ZEAH 4QTIL 1FSKB 4QRUB 2X4UB 5C8JA 2JK5A 2NY4C 1X5AA 3MCG1 1AGFA 4Y5XB 3MXWH 43C9B 3PL6A 1MWAB 4YDIL 5C0FA 4NWUH 1QFWM 5BRZE 5T1LB 1PZUB 5DJZA 4OLYH 3DWTA 5AWNL 4X9IA 3CUPA 4MB4A 2CDFA 4AH2A 2B1AH 2I07B 3VXQA 2F8XC 3LS5L 3F6LA 1I8MB 4RMSA 3IT8D 5GZOC 1DN2A 1MH5B 5I1CL 1T3FB 4IRJA 5JIPA 3MTRA 1HKFA 3FB7B 4CW1B 1EFXB 3NZ8B 5HPOA 2DQEL 3RJQB 3RWIB 4K8RL 2O26U 4LLDA 2OX5A 5I1DB 4S10A 4RAUB 1MHEA 3I9GL 4JRYA 3DO7B 1NMCB 3O3UN 3BE1H 3OJDA 1UWEL 3FCTB 3ARED 3LVEA 4G6FB 5F9WB 5JIIA 2NXZC 3IJHA 4GSDH 4ZO9A 5AG9A 1UZ8B 4NZTL 3B2UD 4ZS7L 3AXLB 1JMXA 2G2RA 5E70A 5DRXA 4MAUL 4YJZL 3W0WB 5HBBA 4JRXD 4CBPA 4PLJC 1U91A 4CN6A 1DR9A 2I24N 4NRXA 4XP9H 5DD1L 2LE9A 3KPSB 3GNML 5JHDB 2DQFA 4ZFOA 3IF1A 4KWUA 4JO2L 4Y1AA 5JIHA 2VDRL 5CJQL 2Y07H 4X4XB 1LNUB 3BVNB 4DUWA 4B7LA 2HWZH 5IMKA 5LG1A 3UEZA 4OZIE 5BZWB 1MIEL 3MA9L 1CDHA 2AKRA 2KBGA 5HGAA 2EDEA 4OT1H 5B21A 5E2JA 3K46A 2GSGB 4HH9B 3RIFF 1CICC 4D9RD 3LHPH 2ICWJ 2N56A 1E4WH 4TVPL 4N8PA 1FNHA 5E9DA 5ERWB 3FZUC 1H3WM 2AJUH 2DL9A 3SE8L 1BFOB 1K4CB 4XP1H 3QB7C 3QZWA 2XRAH 4JY4B 3SJVE 1L7TL 4QRRB 1KCVL 3RDTD 4ZD3H 4BKLA 1NCAL 4HHAA 3OX8B 2ZCHL 3GI9H 2YUVA 2MHAA 1JUFA 1BD2E 4IRSC 3S9DB 1QA9A 2NR6D 5CGTA 2QADB 1DCLA 3PP3H 2H3NA 4P2QB 4V2CB 1A2YB 3DURA 4KPHH 2RBLA 1T0MB 1RU9H 3CCHB 5I9QC 3SCMA 5C6TL 1PQZA 3LEXA 3HZMB 3DYPA 1F42A 3ORJA 4KI1A 3PDOA 1DSFH 5IQ7H 4HIIA 1W0VA 3OG6B 3L3DB 4HIEB 4JANB 2DICA 2I9TA 2AJ3A 2Z31A 1S9WB 4UBDD 5T5NF 5IB4A 1A6TB 5T3XL 2YZ8A 4CADA 1FYTD 3HA0A 2R9HD 2XY1A 3OXSB 4QHUB 1CD9B 3QUMA 2VYRE 3CFKA 4ODXA 1FNEB 5CS7A 3VCLB 2WBJD 4XNZC 4M1DL 3DJ9A 4JJHA 3EYVA 4X98B 2NTFB 1MCKA 3MLRH 3S37H 2AXGA 5I71C 2VDPL 5L2KD 3MCKA 4KKBD 4AYFA 1A6ZA 3MBXH 5DD3L 3QUMH 1RUMH 2WM0A 1NH6A 1IC4L 1BWWA 1UACH 5IQ9B 4IJ3B 2XZQH 4U6XA 3WD5L 4AIZB 4JJ5A 4ZOCA 4JREC 4QNPF 1FBIL 4P23A 3FQRB 5F7UA 2OS7A 1C08A 2YXFA 4G80B 1XGRA 3MACL 1R24B 4I0PC 4UUJA 1CFBA 4YNYA 2WUCL 4U1GC 2AGJL 3SE9H 4MQXC 4WDIA 3EHBD 4OI7A 1OSZA 1GHFH 4LLYA 1J8HE 4ZAKC 3PNWA 5LGHL 4KMTH 1MI5A 4WHYG 1DVFC 2E7HA 1U9KA 2J1KA 4JPIA 2EECA 3TZVB 1RJLB 4N5ED 1YEFH 3MRNA 5C0NC 5MI0B 1BX2B 5HDBE 4P5KB 1CF8H 4BSVA 2VISA 4FQHA 3TP4A 5EOTA 4M6AA 3VFUB 4LLWB 2ZUWA 3DTXB 3UPRB 2O5ZH 3FMGH 5E2UH 1MRCL 4ZXBC 4DEPB 2AJVH 5HYQB 4LCUA 3T0BA 1DBKL 4RIRA 3KLHC 1KENH 1T0NB 1I4FB 2F9BT 3P2TA 1E4KA 3S3SA 1R3IL 2Z9TA 2GT9A 3VJ6A 3UTTA 2G60L 5DMGD 4MAYC 3FRUB 5F7YC 3SDXF 1SYSA 4I9WE 4PGZA 5A16A 4H20H 1JIBA 4MNQE 5JDSA 5MERB 4XCYB 4F7TB 3ULVH 1I7TA 1XZ0B 4BELD 1PW3A 3MLWH 4XXCA 4XTRD 5C2UB 3FFDB 4Y16C 4NN6B 3LMJH 3PABB 1AHWB 4LNRA 4FQIH 2JIXA 5IMLA 2FL5A 2VXUH 5D1XB 3D18B 4G8FB 3RAJL 3QNZA 4L4TA 1BM3L 5CMAB 3VWKD 4NQEE 4FTVE 3TH3T 4UQ2B 3ALWA 5JQHC 1ZEAL 4NUJB 5JPNA 1WCQA 3JWDH 3ZTJH 5CKAA 2J4WH 4NSKB 4J2XA 5K33A 1NGQL 2IAMB 1CDIA 1BLNA 1FZOB 5MEND 1YN7A 5MEQB 3RWHB 4IDLA 3RL2B 2DQUH 2MQ0A 3TM6A 4WI5A 5A3ID 3EYUH 1W0WA 2NXZB 4H5SB 4DFIA 3O6KL 3QA3A 4F7MA 2NW3A 3W5NA 3SDXA 5LQBH 1NMBH 1X3DA 5FKPB 5I15L 2B1AL 2BSED 1AXSA 1UWGH 4OV5B 1F5WA 4HMDA 1LD9B 5EU5B 5EU6E 1U8KB 1Y6KR 3LKQA 4JAMB 1JNJA 2HFEA 2Z0BA 2Z4QB 2UVEA 5MP6H 2P8LB 1U8OB 4ORGB 3BE1L 4KZDH 1RIVH 3MV7D 2Y06L 4O2CA 3QEHA 4JN1H 5DQDL 4GSDL 3ECBB 4OI9A 4N0FA 4PP1D 4B53A 3SQOH 4I2XA 4UIMA 5B39A 4RWYH 5KS9B 3EOAA 4IIQB 5AYUL 5HDOA 4PJBF 3MFGB 3SDYL 4XP9L 1KIQB 3G9VA 1HINH 3MGOB 4UV4L 4OF3A 3RPKA 3F58L 3V0VA 4G6JH 4L8DB 3VDCA 3KYNA 1CICB 3ARDD 1H3TA 2VLJE 1H3GA 4PJ9D 4XRCA 2LU7A 3E6HB 2WUBH 3OKYA 2MCG1 2HJFA 5GGUB 1S7TB 3WFCH 2IPKA 4MA8H 4K23H 4PRHA 4HS8L 3DLQR 4OGXH 2ICWI 2CDEA 3ULUH 4YHYC 4JDZA 1LEGA 4PGDB 5EO9B 2EXWC 3H2WA 2BNUA 4WUUA 1FZJB 2DAVA 4S1SH 3DI2B 2HRPH 5KSAC 1FJ1B 3BUYB 4PJBA 4GKNA 3F7PC 4LVHC 3U83A 4OF0A 1WBYB 1KN4L 1VKXA 2BK8A 2AJUL 4J4PC 1CDBA 4AT6A 3LKNB 4JFPA 3VXNA 4XP1L 2SEBB 2XRAL 3KLSA 3RWFA 1I1FA 3FQWB 5F9JA 5HDQH 2ADFH 4KJPC 1JPFB 4F8QA 4XBEH 3DMMA 3HC3H 5KVDL 4R9HA 4ZD3L 4OZIB 3HS0B 3LQAH 3GI9L 1TMCB 1WFUA 3OAYH 1R5VA 4LEXH 2K3TA 4KPHL 1I9JH 1AKJD 1NC4B 3VH8A 1V7MH 1EV2E 1Z5LB 2M2DA 4QOKA 4JFED 1IGML 2NY6B 2CQVA 3PWPD 2VB5A 2IPUG 2R2HA 1DQDH 5ACZA 4TSCH 2OJEA 5I75C 3GJFA 3BO8A 1M6OA 1OM3L 1T0PB 5IQ7L 3BI9X 4U6HB 1U8JA 5D93C 4HUWA 4HX1B 5BO1H 4MXWL 2NY5C 3DRTA 4CMMB 3TO4C 3GJFH 1JGEB 4PJFF 4JRXE 1IEHA 1VGKB 3SJVB 3PP4H 4WTWA 1T20A 3IU3B 1MCFA 3ROLA 4JREB 2X89D 3SPVB 2VAAA 3L5XL 4QRSA 3BP4A 3G5YB 1S5HB 1WK0A 3W11D 4CRPA 4X4YA 1FNLA 4U1GB 4Z77B 5C2BH 3U0WH 4GXVL 5JTWA 3RZCB 3TT3H 3VXPA 1U3YA 1P1ZB 2C1PA 4X6CF 1KJMA 1U42A 3BW9A 3C5ZA 4YAQA 4ZAKB 3QJFB 4M1GH 4GQPH 4XI5D 4YXHH 1IKNA 3S37L 3OF6A 3L1OH 1O7SA 1RUML 3QFJE 1YY8A 5SX5H 2XZQL 4PP2B 4PJAE 4QT5B 4M7LH 1IAKB 1D9KD 1ZTXL 3GMPA 3QULB 4JM2F 4XPTL 5DTFB 4WO4D 4D9RE 3R8QA 4POUB 2QSVA 3OKEB 4PJFA 4UB0L 3V5DA 1FFPB 4BQCA 4ZXBB 3SE9L 3SKNB 3I6KB 1NLDH 5DZNA 2GK2A 2I27N 3TJEH 3ZT7A 5DS8A 5FFLA 4KMTL 4U49A 4D0CA 2YSSA 5J6HB 2VL5B 2GAZB 2XG4A 3NCYP 1L7IH 3AREC 4MAYB 1MCLA 1NFDF 3O6FD 1Y0LA 1W72B 3W9EA 1TIUA 4MMZC 3B2UC 4X6CA 4NC0B 2IWGA 3ARBB 1A1NA 3MJ7B 1CF8L 2FWOB 2DYPB 3H7LA 1FGNL 1AIFA 2B1HL 2VDNH 3TPKA 1IQWH 5D96C 2O5ZL 5E2UL 3VXRB 2AJVL 3AROA 3TYFA 3HHRB 1KENL 5KANI 5EUKB 1ZT4B 1S3KL 1MLBB 2V9QA 3DYMA 4PRAA 1XGUA 4PJEF 3MBEA 4U0QB 1C5BH 5GSRB 2BVPB 3IFLH 3IJYA 4NOFA 1MQ8A 4H20L 2DM3A 4WU5A 4S2SB 1DBJL 1EAPB 3BEWA 1FN4B 1J8HB 4MQTB 5ITFA 4WIQA 1A1OB 4RA0C 1XR9B 4WCYH 5LWYH 2DI7A 4AL8L 1HNFA 3PIQA 4MHHI 1NFDA 3MNVA 4OQ1A 2IADB 2WWKO 1OGAA 4HBQA 1B4RA 3C8DA 1MFEH 1FYTE 4HWUA 4BUHA 4GQ9H 2J4WL 2PYED 4QY8A 2ZUVA 3GM0A 1NCBH 4CUCA 3MV8E 3Q1SH 2V5SA 1I3GH 3DVNB 3VXTA 3E2HC 4NFDA 5FO7B 3O6LH 4GUPA 1LE9A 3IXAB 4PJEA 1OLZA 4EUPA 5HYJD 4R7NA 1T1YA 2E9JA 2MQCA 1MELA 3BQUD 5L2KE 5LQBL 4O58L 2VERN 5HD8D 1U8IA 4YGVA 5EORH 4H0HB 5F3HA 2FJGB 3O4LD 5JORB 1FL5B 4M7JH 3VFRB 2VR9A 5JLZA 3RDTC 4U05A 3IDJA 1R0AL 3ARFD 8FABB 4EUPH 1Q9LB 2XXMB 2VXQL 3S5LB 2NR6C 4AG4L 2H2SD 3QQNA 1KEGL 5TQ0H 5MP6L 4HEME 4PRBB 2A9NH 4NQEB 4J1UB 4CAGA 4GMSH 2QSCH 3OPZH 2JF1A 4QHKJ 5KG9B 1RIVL 3TBWB 1F90H 4PTUB 4NZUL 4KJQD 5E5MA 1U8LB 4WGVB 3C60D 1JV5A 4UDUA 3QUXD 1Y18A 4RWYL 1IILE 2H45A 3BP5B 1B4JH 3CVHB 5C0JB 3MJ9A 3HZYA 4Z5RA 4YHYB 3JXAA 5DD0L 5FIEA 5ISZB 2EO1A 1MSPA 1HINL 2MSPA 5I1JH 4AIXA 4G6JL 1NMAH 4ZTOL 3VD3A 2F74A 1VFBA 1A7PL 1IZJA 2VABA 4POZD 3MJ9H 4B50A 1CFNB 3P9LA 1EGJA 4P4KD 2WUBL 4BSWA 2I9LA 5EU6B 2R9HC 3WFCL 4FFVC 1K5NB 4P48A 4OIAA 1F58H 5F6HJ 4JFZH 4OGXL 4GFTB 1EGJH 5C9JA 4X99B 3QHZL 4LSRH 1NKOA 3G6AB 3CGTA 2J8UF 4KKBC 5D2LF 3H3KA 4N0YH 3NA4A 5F88B 5A2LH 5KOVC 1RHFA 4S1SL 2FZ3B 1XF2A 3IXTB 2OK0L 4U6TA 1M1SA 4NO2B 1YYLH 1UVQA 1P9MC 2FGWH 3EHBC 4G3YH 5C07A 1WZMA 5MENE 1IGFL 5I75B 4PTTA 1H15A 1UQSB 3T0DA 1CE1H 4Y4FB 5DXWA 3WFHB 5HDQL 5D93B 1MJ8H 1VFAA 5DJ6B 4XBEL 5E2VL 2VXTH 3HC3L 5FDYA 4BZYA 3MMEB 4JQIH 4N5EC 1G0YR 5CILH 4YGAB 3LQAL 4Z7OF 4FNLH 2EDRA 4RAHA 5E8DH 3L3OB 5GS1A 4NFCA 1F2QA 3K2UH 3EYQD 3MROB 1ZE3C 1V7ML 1IM9D 2J8UA 5D2LA 4XPAH 2IFFH 4PJXF 3HUJF 3HAEH 1HKLH 1FH5H 4FN0A 4B7IA 1DQDL 3DVGB 1NBYA 1HILB 2PKDA 4TSCL 5I1KH 4M93B 2X5PA 1BAFH 3IDMA 3U0PB 1A1MA 4ZUTB 3MV7E 1WTGT 3QUZD 3MGAA 1OP3H 4TSAL 2VSDA 4FFWD 2R2EA 3TCXA 4JDVA 3AMLA 1KPRB 1RIHH 4X8JB 1QSFD 5GRZA 1IT9L 25C8H 3PP4L 3D2UD 3UO1H 1Y6MR 4XTRC 4P5TD 5I1IH 2BOBA 1JHLH 5CEYA 5DJXA 3VWKC 1IAOB 5C2BL 3U0WL 1U8NA 4R6UA 1ZA6B 1KOAA 2OBGA 1R3KA 3LEYL 3TT3L 3WUWA 4OD2A 4PJCE 4PJXA 4U1HB 3HUJA 2LU4A 1JHKH 4L8SC 5DJ0B 4ZYKB 3L1OL 3DX7A 4WV1C 5F6IC 3TVMA 5IB3B 1XF1A 5IV2A 3KNBA 3W9DB 3AREB 5A3IC 2VSCA 1X4XA 3MLVL 4ELKA 2NY0D 3MV9A 4JRWA 4BFEA 1ZT7A 5ALCH 4M7LL 1Q94B 5M95B 3QWOA 4UZGA 4HJGA 2X1PA 1KTDA 3QT2A 2Y72A 4JRXB 5D96B 4PJ5D 1D6VH 1FFQA 3DX8A 3W2DH 5AZ2L 2XWBB 1KLFA 1JZ4A 4HD9A 1PD6A 4U0RB 1BFTA 2Y5EA 5LXGH 4X7TB 2COQA 4CNIB 3WS3A 1I7ZA 1EEQA 4KTEH 3G6JB 4OZGE 4PP1C 3QIBB 1LK2A 5T1DL 3VFOA 5I16A 3IRPX 2VDNL 4PJ8D 3L3HA 1S9YB 1L0QA 3NFPB 4PJAB 3STLB 5FCSH 3AVEA 3W39A 4R8WH 4JFEE 5TE7H 1R3LA 4HS6A 4EN3D 1U8QA 3ARDC 4FQXA 1NFIB 5E95B 1C5BL 1G7LA 3A6BH 4JRYB 2PTTB 1MJJB 4PGBB 4UI2A 5DD6B 2R2BB 2PW1B 3E2HB 1TITA 4R7DA 3LKPA 4H0IA 3UDWA 2CUMA 1QLEL 3UXFA 5ICZB 5J06A 1J05B 3KS0H 1CDYA 4P59L 3GK8L 2ICEB 1WZLA 3VGGA 5DRXB 2X05A 3EAKA 3LQZB 4RBPK 5CSBA 5LBSH 1KB9K 2P5WA 3RDTB 3PHSA 1QNZH 1MFEL 1JZ8A 1KNOA 5CEZH 1G0XA 2QHRH 1PKQA 1S7SB 4RNRA 1NCBL 2AJYL 3MRDB 1F3DH 4ZFOB 1ZOXA 1I3GL 4R90L 3VFTB 1X7QA 4NRYB 3ZKQD 4TULH 2MCPH 4NJAL 4E42B 5DRZA 1MJUH 1JWSA 3AAZA 2A9MH 5F7NC 4WI3A 2EIEA 4N1CA 5DJ8A 3NACH 1CXEA 5FKAB 3HE6B 4X5WA 4W6XB 3CAFA 1DBMH 1PZ5A 1V3LA 4OM0H 3WFEL 4GG8B 4QHKI 4KQ4H 2R0LH 1JGVH 2HH0H 4OZ4B 4Y2OA 3O8XC 3R8BB 1AGEA 3CDYA 3GMMA 1KB5H 3EW3B 1UB6A 2A9NL 5DC9B 5T5FL 2QSCL 1MRDL 2VR5A 1FGVH 1LILA 4JG0H 4O5LH 4MYWB 3IDGA 5F9AC 4GW4A 5BMFL 5C6PB 2JB6B 1VB9A 5I6XC 4QEGA 3X11A 2ARWA 2WBJB 5B4MD 1WAAE 5CP7A 4YHMH 1NBVL 3TNMA 4NC2B 4QRPA 5ANMB 5L2KB 3PHOA 1EMTH 2ZZUT 4BUGA 5I1JL 3VE0A 3HC0B 1NMAL 3SE3C 4BKLB 2JJVA 4U2ZA 3BZEA 4HHAB 4LHUD 5F6HI 4JPKH 4ZNCD 2C4XA 3WE6B 4I18A 1FIGH 1KCUH 3P4NA 5CINL 1ZA3B 4RZCB 3W11C 3V7AE 4NKMB 5DRNA 5IJVA 3SCMB 1C1EL 3OKNB 4Z7NF 3CDCA 4LDEB 2O5YL 4KY1L 1UGNA 1XF4B 1MPAH 5ADPH 1HYRC 2BNQD 1F6FB 3L95B 4PG9A 4XI5C 5F1NB 5KW9H 4XBGB 1A5FH 3OR7B 2W60A 5E8NB 3C87A 4LSRL 4NWTL 3EJYD 4ZPVA 3V6ZB 8CGTA 4ZDHB 1WIUA 5HJ3B 1FG9C 5CZXD 3HB3C 5GGTH 5B3NA 3IDXH 5I18H 4X9BA 1IJ9A 4WO4C 2F58L 4L1HA 2IH3A 4L4VA 4PD4K 5A2FA 2PYEE 4TUKH 4WHCA 1YYLL 3WEXB 4GRMB 4HGWA 4ZG1A 5BXFA 1I7RB 4Y2DB 4BZ1H 1C5DB 3QAZB 3MA7B 3QIUD 4NHCH 1CE1L 4BK5A 3QUMB 2P8PA 3CFKB 5DK2A 5HYJE 1MJ8L 5D1ZD 5JOFB 3FFCD 3I50H 4TVPD 4U7SA 3O6FC 4JFOA 4JQIL 2Z8VC 2AQ1A 5AZEH 3WFDH 3CK0H 2A1WH 5T5NG 3HG1B 5HHOA 1G9NH 4OCLC 1GZQB 3K2UL 5DJDB 4LGRB 2BMKA 2YKLL 4Z7VE 4ONGH 4XPAL 4JJ5B 1HKLL 1FH5L 2AK4A 3O2VH 1G0DA 3LN5A 2G5RA 1I75A 1C08B 1Z6JT 2ZJSH 1RMFH 1XGRB 3VWKB 5BCAA 1MCOL 1CWVA 5JW3H 1KJ2B 5MEOB 1CQYA 1YMHA 2FSEA 4EDXA 2UUDK 4LLYB 2HLAA 3PWNB 1TQBB 3U4AA 1MI5B 3PWLB 4LSUL 3LPWA 4UU9A 5IHUH 1BVKB 2HFFB 3UO1L 5HYEA 4K7PX 4LPUA 2B20A 4XPGL 5IOPB 5I1IL 3QWRA 3FQUA 3VFNB 1D5MB 3GM8A 1CXIA 4KQ3L 4LCIH 1HQRB 4NYLA 1YQVH 3OZ9L 5I1GL 3IETA 3VXSD 1FLRH 4HUKB 1IEBB 5HPMA 2AEQH 3UZVB 5L8KB 4YDJA 1JHKL 4NNXA 3VG0H 4JQVC 1ZSDA 3ZTJG 3VJ6B 4U1SA 1RK1A 4QLRA 4JFFA 5A16B 1ORQB 3EZ8A 4Q0XH 4ALAH 5D2NB 2VXVH 3F8UB 5DK0B 2DTMH 3BQUC 4PB0L 3MRLA 4XMLH 2GHWB 1FVEA 2DBJA 1DUZA 2V5RA 3BPNB 4Y7MA 1DBAL 1JPGA 3OSKA 3QHFH 5GJSH 3RL1A 4CN1A 5IJKA 3ARFC 1TZHA 1A3LH 4K3JH 2DTSA 3BP6A 3ILPA 1DQQB 5GJTH 32C2A 4ZUUB 2H2SC 3GIVA 4W6WB 1FNGA 5E24E 4HGMA 1CG9B 2X9XA 3ARDB 5T33H 5CAYB 5LXGL 4WI8A 4PJ9B 2DQHL 5TH2A 1T22B 2LFGA 2OLDA 3GEWB 3WHXA 1BLNB 1A6VH 3QEGH 4KJQC 1S8DA 1TFHA 3FQTB 3HI5H 3C60C 4KTEL 5JXED 1U3HB 3QFDA 3NA9H 3WMSA 5FHAL 1J1PH 2R29L 3QUXC 3MNZA 1ONQB 4PRDA 4F7MB 3RZWA 4U4BA 3UYRL 2DMBA 2AQ3A 2VXSH 2J2ZA 2JCCB 4GRWB 3T1FA 1MCQA 3HR6A 3Q5TA 1BWMA 4NN7C 2DB8A 2FBJH 15C8H 4PJDE 2GTWA 3O9WA 4R8WL 5AUMA 4A2MA 3NGBB 4W4OC 4POZC 2HFEB 5B39G 3A6BL 1QLRA 5E94A 3BSZL 1ITBB 4X7FC 4F33A 5M94B 2I25N 3AC0A 1A4JB 4KRNA 1NGZA 3JV4B 3SGKA 2ILLA 3O0RH 1EX0A 3VFPA 3CMGA 4RMRA 4NBXB 1QSFE 3OXRB 3DIFA 1VACB 5J7CC 5AYQA 4H8WH 3LRGA 5B39B 5E7BA 3K2MC 2EYSA 2IMNA 4OZGB 4F7PB 1CL7H 3RNKB 2A6KA 3QXAB 1QNZL 1MCBA 4N0CD 4M48H 1MHCA 1VFOA 1T04A 2CSPA 1BZ9A 4MJ4A 5CEZL 2QHRL 4UINL 4XCEA 1SYVA 1Z9MA 5D6CB 3V0VB 1HI6A 3FB5A 3UP1A 3IB4A 2BCKB 1UJ3A 1AKJB 4DKFL 4AEFA 2ERJC 3CSGA 3I6GB 5TF1L 3PWPB 3CDFA 1I85C 4P9HH 4TULL 4FQPA 3T0VA 3O6ML 2XN9A 4MA3B 1J7VR 1JI2A 2A9ML 4P2RA 1SY6A 5TGBA 2R23B 1U36A 3DNKA 4G8EB 4HT1H 4U1MA 4WW2B 3VRJB 1N5YH 3NACL 1B0RB 2YC1B 1N5AB 2MNUA 5TE4L 2CDEB 4IMLB 4OM0L 1YUHA 4KQ4L 2YD9A 1JGVL 1SY6H 2F54E 5FA4B 1AGCB 4P57A 4WJ5A 5F21B 4WUUB 3EYQC 1RUKH 4DVBA 1H9VA 1QRND 2ITCB 4GLRI 2HJKA 2A6DB 3QDGE 4OD1H 1Q0XH 4L1DA 3PL6D 1FGVL 3C09B 1OAUH 2ZSVB 4C57C 4UNVA 4KK8D 3QUZC 2P7TB 5FECA 1KB9J 3SKMB 4FFWC 4LARL 4LMQE 3MRRA 1EA9C 3MJ8A 3VFWB 3VH8G 4YHML 4R0LA 4L8BA 1KC5H 1V3KA 4V1DD 1Z0NA 1MCPL 1Y6NR 5LAXA 1BQHB 3JWOH 2NY2B 1U8MB 4HPOL 1LO2H 4KRLB 4JPKL 5B8CB 5FB8A 1R5VB 4JCLA 1D9KB 4MSWB 3H9SA 1FIGL 1KCUL 4HZLA 3TA3D 5ETUB 3ZKXB 1TJHH 2LV4A 1WT5A 5DMKB 1E6OL 5D7LD 2ID5A 1NQBA 2B39A 3CXDL 2OJEB 1MPAL 1E27A 2X10A 4PRPA 3AS2A 1M6OB 3MRGA 5KW9L 1A5FL 5F70A 2M8XA 5H2BB 4UT6L 5FHBH 1ZVSB 4WI6A 3O6FB 4JE4B 4QGYA 2NY0C 3DRTB 4U3CA 1FVCB 4P5MB 5CP3H 2ORBL 4HUXA 3QJHB 1WGOA 2IH1B 3M17B 2BSTA 1FZMB 1T7YA 1T20B 1HSAA 1G9MH 2V7NA 5E4EC 1OAZH 5EPMA 4JO4H 2VAAB 2OXGA 4QRSB 3UJIH 1OOAA 1C12B 4TNVF 4BZ1L 4FZ8H 1FP5A 4YR6B 1MLCA 3MLTB 4NHCL 1M7DB 2VQUA 3FN0L 1INQB 1S9XA 4YHNA 2NX5A 3I50L 2DLTA 3C5ZB 4YAQB 2IQ9H 5AZEL 3WFDL 3CK0L 2F5AH 1K6QL 1ZLVK 2A1WL 3NABL 2VN4A 4HK3J 2BVEA 2NMSA 2BOCB 3PGCB 3HNSH 4ONGL 2VQTA 4NQSB 4K7FA 4NM8H 4PJ8C 4JGJA 3ZKSD 3O2VL 5DO2C 4ODBD 1F11B 4EQ3A 1NCTA 1RMFL 3MQIA 5L7XH 2YPKA 4EN3C 2BJMH 2VLKA 1GPOH 5EIIA 4GRLA 2PYEB 2R4RH 1XF3A 1ODAA 5F7EH 3WUZA 1GVIA 1WCBB 2YSSB 4HKXB 1A7OH 3AM8A 3RGVA 4R4BB 5IHUL 3W9EB 1Y0LB 4NO5B 4P4RA 4PD4J 5HYJB 3FN3A 2EC8A 1Q72H 3BQUB 5IWLC 3TBSB 1YJDC 5JR1L 4PIRF 1ZHNB 4IDJH 1PEZA 4LCIL 1YQVL 3O4LB 4P3CH 1IGIL 1AIFB 3SGJA 2EE2A 1FLRL 2DJ4A 4LSTL 2AEQL 4WI7A 4Z7VB 3KXFD 4X6BA 3KYMA 2P5EB 5IEKA 3VG0L 3ARGB 1I3RA 3B3IB 3I84A 1RD6A 3CFJB 4K2UH 3QXVA 1B6DA 5EBLB 3TWCL 2BNQE 2WINB 2Q8AH 4ALAL 1ADQA 5E1HB 3U9PL 4BQBA 2DTML 2ICCA 3CU7A 1VPOH 5ITFB 3HLAA 3KPLB 2XWTB 5I76A 2CRMA 5GJSL 4ODWB 1IZKA 4QXTA 3H8NA 3EO9H 1A3LL 4WI2A 4X5LA 4Q6IA 1ADQH 3WFBL 4NN7B 5JNYA 5D5ME 5GJTL 1EXUB 4HFWB 4AY0A 4EUPG 4RAVB 2KZ1B 4GW5A 3JV6B 1DFBH 4DOHE 5F7KC 2D4FA 1JF1B 4F2MA 4YUEL 1FL3A 2R0ZL 4P4KB 4X7SH 1A6VL 1NL0H 3HI5L 3ALXA 3H3PL 3FFCE 1JGUH 4TVPE 1OP5K 4WHTB 1FCGA 1J1PL 3IDNB 3MRKA 4GUPB 3L3GA 3O3AA 3RWJB 3U82B 3NIDF 4EI6A 2LABA 5B4MC 3GMRB 4HWBA 2VXSL 2YA0A 2FBJL 4O02L 4PV9B 15C8L 4L9LA 3GMQB 5F7MC 1JRHL 5JLZB 3IDJB 3MFFB 4KK5C 1TNNA 4J3OC 2ARJB 3TH4T 3TIEA 1FG2A 1X4YA 3FB6B 1JF5A 1U58A 2AABL 3QDMB 4OAWA 2IGFH 3KVQA 4NZJA 5FGCE 4P46D 1FZKA 1AXTH 5EC2B 3O0RL 4NPYB 3ZYOA 1R3HA 3KYOB 1JV5B 1V7NH 3QCTH 3BEVA 3EO1B 4LCCA 4JKPH 1Y18B 3MRMA 2R69L 1CL7L 3CVIH 3CLFL 4Z5RB 2CMRH 3CIQA 4GAGH 4L3CA 1JBJA 1A9EA 2PYFB 3JUYA 3LN9A 5CZXC 3ZE1F 3HPLB 4I4WA 3VXSE 5HVFB 5GIRA 3UTTD 5I8CB 2YEZA 3T2NL 1IM9B 4PJDB 2VABB 1FO0L 3B9AA 1JHTA 5D7KD 1EZVY 5HVHC 3BRDA 1U95A 4P9HL 1HH9B 1PDKA 5D7JA 1I9IH 3QIUC 3QO1A 3QUZB 1CVSC 3ARXA 4HUNB 4JFHD 1WZ1H 4P2CG 2Q1EA 4X80H 3PQYD 4L4TD 1JZ3A 4G8GA 1HCFX 4OLVH 2VE6B 3B9KD 1QSFB 2JJSA 3FQNA 4PJIB 1UFUA 1K8IA 3PJSA 3T0EB 3D2UB 1RUKL 4P5TB 4RFOH 4OD1L 3CPLA 1Q0XL 4Z7WB 1JNHB 3KPOA 4QO1A 4CVXA 3HAEG 2YUWA 5I8OH 2KL6A 4QXWA 5DJAA 4JY5H 2BNRB 4PTTB 5EA0L 3QSKB 1WC7B 1OARH 3QPQC 4MJID 2EDLA 3HAEB 4HKJA 4YX2L 3JWOL 2V9TA 1G6RA 1H3UA 2NY0B 3WNLA 1LO2L 1XGPB 4JN2A 3L3KB 1UM5H 1SJXA 4TSBL 2VLLA 1JWMA 5E4EB 4YFLF 4PJ5B 5HI4D 4KHTH 4YBQD 3UZQA 2W38A 4FQ2H 2CK0H 1JJUA 3RY6C 1CK0H 1P84K 3MLYH 5ICYA 3BESR 5EBWB 3MJ6A 3RBGA 1CFVH 3TPUB 1CDJA 2CLVB 1GC1L 3C6LC 2X2YA 1U8PA 2H2PD 2APVA 4R3SB 4Y5YC 4C58B 3ES6A 3WUWG 4XAWH 3KR3L 1G9ML 5GSVA 4XPHH 1RFDL 4FQLH 1DQTA 2V2XB 3O3BB 1X5FA 5CEYB 1GGYA 5JXAH 1HHHA 2V7HA 3N1PC 1NDMB 3RPIA 4FZ8L 3VGDA 4K3EH 4K9EH 5DUBB 5H35A 2X4PA 3ETBF 4S11A 3WUWB 1NC2A 4OD2B 5EIVA 3DUSA 4PYGA 2IQ9L 5ESAA 1XCTA 1JPTH 3GGWA 5JXEC 1T1ZA 3RWEB 3KNBB 4GBXC 1K85A 5FM4A 3DRQB 1CGWA 4G42B 5CBEA 1ZT7B 3OR6A 3V5HB 4NM8L 4HCRA 3P73B 1H8NA 4LDOB 2PXYD 1VFMA 1KTDB 1SVZA 3OGCA 1XCQA 2M1KA 5HHNA 3OKMB 1YECH 3JTTA 2CLZA 5GGVL 1GPOL 5DZOA 1LK3L 2XQBH 2R4RL 4GS7B 2XKNB 1T7VA 4HCRH 4KKNA 1CR9H 5EO1B 5D72H 2BSSB 1A9BB 2FRGP 4KUZH 3GSNA 2Z8RA 3R0MA 4LVNB 3VWJD 5D1QA 2XOTA 1Q72L 2GITB 1KJVA 1RZJC 4V1DE 5EZJA 3F7VB 4P3CL 4QOKD 2PTUA 1KEMH 3GSNH 3B6SA 1YEIH 1KV3A 3MREA 4N0CC 1PG7L 4BK4A 5KJRL 1CIDA 2Y7QB 3NIGF 4ZFGH 1FRGH 1G7IB 5DVLA 4Y4HD 3SGEH 1R3LB 1U8QB 4JFDA 4K3GA 4PUBL 3GMLB 5E8PB 1MCWM 5ACLA 1CS6A 4GKZB 2VKXA 3WNMA 3SEPA 4YEFA 4LK4A 3LKPB 4NKOA 4PRID 3S35X 4XP6H 1QKZH 2VUOA 3EO9L 4EI5A 2ADIB 4ZTPL 4CU7A 4MJ2A 1TQCC 3CDGA 3WS6C 3O11B 4LHUB 3V4VH 2IPTH 4ERSH 5JOEA 2VC2L 5A40E 3PL6C 4X7SL 1OL0A 1NL0L 2Q76B 2UZIL 2ZOLA 5FYKU 4KK8C 1PKOA 1JGUL 2OQJB 1YPZB 4Q97A 5I1EH 5E5RB 1AGBA 5CUSL 1JWSB 2BNQB 3REVB 4NQXB 1KB5B 3CZFB 5ACMA 4X5WB 2EKSA 5E9DE 3TBTA 4AMKH 4JZOA 5FUOH 5FYKL 4L8CB 4O2EB 2D3VA 4HWBL 2IJ0C 3WXVH 3C5SA 2IGFL 3TA3C 5JMRA 1UB6B 4KDTC 1JK8A 5J6GB 2ATKA 3RIFK 3QUKA 1F4WL 1AXTL 4KXZH 4PFEA 2BFVL 1SM3L 2WLZA 6FABL 3BISA 1PY4A 3S34H 1S9VA 4Y5VA 1V7NL 3T4AB 3QIUB 3S4SB 1IE5A 3KPRA 5D1ZB 3FFCB 3CVIL 3WNOA 1F2XK 2CMRL 1EBAA 2A74B 1EFQA 4JM2D 3SGDI 4A6YH 3QNYA 3VE0B 3VG9C 3KXFE 3NAAH 3FO2B 4N0UA 1GAFL 1NDGA 3TN0B 1WBZB 3MV01 3U0TB 5JMOC 2JE8A 2A6IB 4KDVA 3FT2A 1EO5A 1I9IL 2DLHA 4XH2A 1CN4A 4QHLA 1WZ1L 4X80L 4LLAA 4HSQA 4Q9BA 3BT2L 4PG9B 3NCEB 4F57L 2WBKA 2PO6A 1HHJB 4I5BA 1CGUA 2W65A 1CXHA 3OV6A 2A0LD 4GAYA 4QYOA 1T83C 2VDLL 5F9DC 2AI0H 1CXLA 1IQDB 1FFOA 4DCQA 3I2CL 5I8OL 1G7JB 3CH1B 5SWZA 1QQDB 4Y4KB 5BXFB 5F89B 5IB1B 4JY5L 2GY5A 5KOMC 3P0YL 2EEAA 1ES0B 1OARL 2DQCH 3FOMA 4RQQB 5I1LB 1XGQB 1N2RB 1OB1B 1OAYH 4NKDB 2LQRA 2DQTH 2ESVB 2G75B 3BXNA 3QUYD 4A2LA 2WQRA 1TTGA 4PBWD 3KYKH 1KXQE 4NP4H 1IM3A 3WIIL 5F97E 4LMQI 4ODVH 1RQ5A 5D7SH 3WJJC 1G6RL 3H9ZA 2DS4A 4KHTL 2GI7A 1OWWA 2CK0L 2Q3ZA 3RFZC 3DGGA 1BJ1J 3MLYL 1XFPA 3WN5C 4ELMB 2ADJB 3S36L 4WHDA 4R4FH 2FSEB 4PBXA 3MOAH 5F7WC 3LRHA 2HLAB 4NQUA 2FJHB 1F4YL 3C5JA 1D5BA 4TPRL 4YDKL 4OUUB 3A0OA 1T1XA 2HKHH 1S7VA 1YEJH 4XPHL 4QNPE 3TT1L 2OJZL 2YD2A 4NQCA 1GYAA 3V0WH 5JXAL 3UTTE 2Z93A 1CFQA 1Q9OB 1CD1A 3BOVA 4K3EL 4JG1H 4M61A 5FOBB 5D7KE 2EXYD 4YDJB 1HQ4B 3N1FC 2W0LA 4X5XA 1HHIA 4G6MH 1FHGA 1Q9KB 1JPTL 4HAGA 2ZKHH 1F3JA 3VXMB 4JFHE 3RVXD 4EZMA 3MRJB 3P30H 3V6OE 2GSIA 4DK3A 3PQYE 2X70A 4NT6A 3S96B 5IMOB 4L4TE 3K4ZA 3L6FA 4YHPA 4RSVA 5EU4B 1FVEB 4E0RA 4XC3L 2LU3A 5IM7A 4M5ZH 1P84J 1LEIA 3B5GA 5DQJB 4BH7A 3RL1B 3UC0H 4PJGF 3FO1B 5C07D 1F4XL 4J3XA 4CN4A 1OPGH 4XWOC 4TTGA 2D7TL 4HCRL 1AP2A 1CR9L 4FZEL 1DBBH 4NHUB 4P46C 3Q6FA 2XYCA 1RJZA 3SDXE 1KT2A 2XWJA 5DLMH 1OVZA 5FA3B 2NLJA 3CFDB 4LIQE 2AXFA 3H7BA 2YD7A 1H0DB 5C3TA 1S8DB 3GO1L 4L4JA 5ICXB 2LVCA 1AQKH 5CHNA 4MJIE 3TO2A 3ZDYF 3O45B 2H9GA 1U41A 3TYGH 2VITB 3GSNL 1QLFA 4JCMA 1RURH 4KV5F 3PV6B 4G8IA 1YNKH 4HMCA 1E4KC 3U1SL 4ZFGL 1FRGL 5FGSA 3LIZH 5AUMB 4UNUA 1X5LA 5CD3B 3MODH 1QRNB 3B9VA 5LGKA 4PJGA 1IAMA 4NQTA 5EIQA 5A2KH 4YDVB 4F33B 3R06A 1NGZB 4WI4A 4XXCC 2BVQB 2ZOKB 1B0WA 2FHBA 3NFSH 3V6OC 5IB2B 1QKZL 2APXA 3QIWA 3U36B 3SN6N 5GGRY 2FIKA 2BVYA 2CKBB 4QWWD 3B9KC 4LDLB 3IGAA 2EYSB 5D8JL 2FECI 4LKCA 2EH8L 2A6KB 3KPPB 1OQOA 4LPWA 4RISH 2Y4SA 3V4VL 2IPTL 4OI8A 5C0EA 4ERSL 1HI6B 1FFNB 4R97C 5C08A 5IF0B 4PJ7F 3TA3B 3TVMD 1RUQH 4O00A 3QWQB 4MXVF 4PY7A 1BIIA 4X4MA 3M45A 5CJXA 5D7LB 5I1EL 2F19L 4FFYH 3EO0B 4P2RB 3X14B 1KF9B 3OAYK 3P0VL 5J11B 4U1MB 2J88L 2E7LC 3NBNA 3NPSC 4PJBE 3QQ4A 3PWJA 4AMKL 1Z3GH 4GMTH 2R0KL 1X5HA 4PV8A 1ZHKA 1KG0B 3WXVL 1JGLL 1WVZA 1OHQA 4DVBB 5F71A 1E28A 2EIZA 4KVCH 4GW1A 4X6DE 4Z0XA 4NDMB 3DV6A 5FK9A 5HI4C 4YBQC 4JO1H 1OSPH 5ID1B 1NCWL 5DVNA 4XC1H 3S34L 4XP5L 4M5YH 5J57B 3O3DB 1VADA 4J6RL 5GGSA 4PJ7A 1H3PL 1A14H 5CEXA 3IVKA 4N1EA 3OKLB 1MEXL 2H2PC 3BMVA 4R0LB 5KSVA 5JHLH 2PCPB 4QOKE 3NCYS 1MF2H 1KIRA 5JIKA 3SY0A 4YE4H 1LMKA 1X6LA 2DI8A 3Q48A 4F8TA 4NO3A 4D0BB 3D85A 4IMKA 4NN5B 4QRTB 2HN7B 4U1LA 4HZLB 3OKKB 5IVZB 3MYJA 4JVUA 4R4ND 4YXLH 2GQHA 2A6JB 4Y19D 1JP5A 2OMNA 3HNTH 2X4UA 4QRUA 1MUJB 1JTOA 5JDJA 2YPLD 4Y5XA 43C9A 4LF3A 4PRIE 1MWAA 1SMAA 5I0DA 3O81A 1EJOH 1J0KA 1V3JA 4FP8H 4NUGH 5T1LA 2AJXH 5D70H 1EHAA 3BKYH 1GIGL 1QFHA 2XA3A 2UZXB 2PXYC 1MWAH 2I07A 1BREA 2AI0L 1I8MA 2PN5A 3K74B 5A1AA 1MH5A 1DQMH 1T3FA 3LQAC 3KXFB 5CZKA 3FB7A 1EFXA 1ZWIB 3NZ8A 3RWIA 1TDQA 4JPWH 4N9OB 4UILH 1KJ3L 3WN5B 5GRVK 5I1DA 2I26N 3DO7A 1S9XB 4RMUA 4YHNB 1U8HB 1KULA 2Q8BH 1UJTA 1P7QD 1OAYL 3U7WH 1CZ8H 4O2FB 5LCVL 1UZ8A 1EO7A 3AXLA 5EOQH 3KYKL 3B2VH 3W0WA 5E00A 2W91A 4YBLB 5J8OA 5D7SL 4ZOBA 4PGCB 3VGAB 4Y4HC 3KPSA 4UMGA 1CGSL 1KSRA 4R4FL 5JHDA 3MOAL 4LU5L 1UENA 2RGSA 5C0AD 1I7UA 4QRPD 3DVFA 4X4XA 2CXKA 1LNUA 3BVNA 4HC1L 4OLUL 3RGVB 1CCZA 3X13B 5BZWA 1YEJL 3STZB 3IDYB 1NEZG 2CGRH 2QQQA 4WFGD 1M71A 5DA4A 2OZ4L 1A7RH 3CD4A 4H1LB 4N8CH 4XWGH 2GSGA 4QTHB 4HH9A 3CFCL 3W81A 4X6BB 2ICES 4K71B 1RV6X 4MNGE 1AR1D 2ZKHL 1NEZB 2XT1B 4P46B 3P30L 2C4FU 2ICWA 4NQVB 1K4CA 3OAZK 2X1WL 3IJSB 4MS8D 3IFPB 5JO5B 3HLAB 4JY4A 2E9IA 1DL7H 4N0RA 3ZO0A 4M5ZL 5DHVB 4LKXB 4QRRA 2VO5A 3UC0L 3T04D 4QXTB 5ESQB 1B9ZA 1YEDB 2R0WH 4ZNEA 1S7WB 1PBYA 1A2YA 4XB7A 4GW5B 1T0MA 5I74B 3QDJD 4XVSL 3CCHA 1HXMB 2PR4H 4DGIH 1RULL 1FL3B 3HZMA 4PJHB 4OBSA 1Z0MA 3UBXG 4Q9RH 5I8EB 3MSPA 2D7QA 2FH6A 4F7EB 1PYWB 3MRBB 2WNGA 2AK4D 3L3DA 4HIEA 4JANA 5EDXA 5J9PB 3PQYB 1L9MA 1RURL 4RMQA 1HHGB 5TFSH 1YNKL 3SKJH 1J11A 4EIZC 3B9KB 4JM2C 3F7QA 3MR9B 3UBXB 3HE7D 1S9WA 2B4CH 1A6TA 1RVFH 1MFDH 1W0YT 4R97B 5DEGB 2R1YA 1FZKB 4M7KH 1KBGH 3OXSA 1XF5B 4RRPA 5EZLB 3NFSL 4YK4B 1O0VA 3N0PB 3GSWB 2LTQB 4LSSH 5CSZB 1FNEA 5IROA 2OMBA 3VCLA 3T4YA 1OD9A 2NTFA 3NIFE 2XTJB 3MRMB 1URLA 5DRWB 5K59F 1WIOA 4MJIB 4UTAH 2PNDA 4RISL 4L3CB 5IQ9A 4S1DD 1J1OH 4AIZA 2A0LC 2EH7H 4I4WB 3PDDA 4WWKD 3FQRA 4Y89A 3DHJA 3CLEL 1DE4A 5IGXH 3G6DH 3RVWD 1R24A 4QXGL 2BRQA 7CGTA 1B6UA 2BVOB 1IGTB 4YQXH 2VIRB 4FFYL 1ZLWH 4CVZB 3U4EB 3QO1B 1H8SA 2YA2A 4NGHH 2L0DA 3P11H 4PYHA 3I85A 3TZVA 5DHYB 5BOPA 4K94H 3QUYC 4KI5F 3L3IB 4P5KA 3AS3A 1QSED 2X44D 3INUL 5C07E 1X5KA 5MEPB 1SVCP 4KVCL 4F9LA 4LLWA 5JW4N 4RFEB 1YEEH 4NOBA 4JO1L 4KUCF 2QQNH 1OSPL 1KIPA 2YPVL 1CLCA 1T0NA 2PW2A 3O4OC 1A3RH 1A14L 4KKLC 3FRUA 4Z8FH 1T21A 4F7TA 4XCYA 5BS0D 2J8UE 5D2LE 5JHLL 1N0XL 3BN9D 1MF2L 4YE4L 5T3ZH 1QTYT 3ZYIA 3FFDA 1JZ7A 4ISVB 4APQD 3PABA 4F37F 2PXYB 3D18A 4G8FA 1E0OB 5CMAA 5D6DA 3VDAA 2UVFA 2D31B 5E08H 1CBVH 5EUOB 5IFAH 4UQ2A 4NUJA 2EXYC 3EIFA 1WF5A 3RRQA 3HNTL 4DGYL 2IMMA 2YHGA 1YDPB 1LP9E 2IAMA 2EE9A 5F96H 4O4YL 5BJTB 1FZOA 1SBBA 5MEQA 3RWHA 4M00A 4URTB 5KS9F 3RL2A 2AJXL 5CSGA 4Z7OE 1UCBH 5D70L 3VWJB 4H5SA 4KTDL 1K4DA 5I1AB 1RK0B 5FKPA 1MWAL 4PJXE 3HUJE 3CU1A 3SO3B 3J8F7 5DHXB 1QEWA 4OV5A 2H32B 3N06B 2C5DC 3KJ4C 2YRPA 1DQML 5I66B 3BD3A 2IBZX 3QQ9D 5K9KB 2X4QA 4JAMA 4JPWL 4Y4HB 2Z4QA 4UILL 2X4PB 4ZUVB 4ORGA 2DWEB 4DAGH 1M7IB 1RUAL 1FORL 2F15A 1T03L 4HH8A 3HRPA 1UB5B 5ESAB 1CZ8L 4XMPH 4GT7A 5C09D 3HI6L 3ECBA 4LVOC 5GS1C 1U92B 2Z92B 4NIKB 5EOQL 4MZ2A 3HPJB 3B2VL 4PRIB 5KS9A 3T0AA 1JCKA 4LCWD 5SWSD 4IIQA 5BRZA 5FYJU 4AEHH 1T6VN 3QG7H 4IOFD 4X7DC 3FRPA 5DA0B 4IRZH 1KIQA 5DMIL 2R8SH 5HHNB 3MGOA 2V6HA 4L8DA 5GZOD 1CICA 4X6EB 3BIKB 1INEH 4M4PA 5IVOA 1YNTB 5GGUA 1S7TA 5L0QC 1XEDA 5HI5D 5FYJL 1JPSH 2C4FT 1GJIA 4OZIF 5CBAB 3N1GC 1UH4A 1RHHB 1MAML 2CGRL 5L9DH 2Q7YB 4QWWC 4B0MM 4XGZB 5EO9A 5GS0L 4XWGL 4PLJD 5C9KA 3MREB 3DECA 4Q6YA 4TYUA 1FJ1A 5DGQA 3BUYA 1NUNB 3IU4H 4OLZH 4JFDB 4Y19E 1CD8A 3BIAX 4KK9D 3TVMC 2R4SH 1WBYA 1FC2D 1CU4L 3N85H 4OSUL 2MQ3A 1DZBA 1R5WB 1C5CH 1HXYB 2YPLE 5AAMA 5C6WH 2SEBA 4PBVC 5TDOB 3V5KB 1PSKH 2OR9H 5DYOB 1HWHB 4HPYH 1PKQE 1JPFA 3H42H 2VMFA 5I73C 3GHBH 4OZIA 3HS0A 1T5WA 1BBDH 4JHBA 4LSQH 4F9PC 2HT2C 4OGAC 1NC4A 3DUUB 1Z5LA 3A6CL 2PR4L 4MD0A 1BFSA 3ZTNH 3AU1A 3MYZA 4Q9RL 3FZUD 2CRIA 4HIXH 5JPMB 5H94B 4U6HA 3VMOA 1ZLSH 3P9MB 4HX1A 4TOYH 1QYGH 5T1KB 3SKJL 1CDCA 4CMMA 4K7PY 3SBWC 1IBGH 2OI9C 1JGEA 4XBPB 3RBSA 1MVFA 1VGKA 3SJVA 3AY4A 4GRLD 5C0BD 2B4CL 3IU3A 5J13C 4MA1B 4ZSOE 3FOLB 1G7HB 2BHUA 3SPVA 1MQKL 4GJTB 1QD0A 5IHBA 1YYML 1JK8B 3FB8B 3G5YA 1S5HA 1KBGL 2VDQH 3UDWC 3VRLF 5C0AE 2ZNWA 1NAKH 1Q9WA 1SJVA 3T3PF 1INDH 4QRPE 1P1ZA 3MC0A 2YWYA 3F7RA 1RI8A 1CGXA 5CJBA 4A6YB 4ZAKA 3QJFA 4XHQA 1SJHB 3Q5YA 1QO3B 5E6ZA 2Y36H 5IBTL 2WIMA 4UTAL 1FQ9C 2E7MA 5I2IB 4WFGE 1I1AB 2X41A 3BD5A 4PLOB 3QUYB 2EDJA 3OB0K 3RGHA 5E2WH 4PP2A 4QT5A 5IVXE 4CJ0A 2EH7L 4HKBB 1IAKA 3QULA 5DTFA 4DQOL 2C3VB 5IGXL 1FFPA 4KDWA 4ZXBA 3SKNA 4LLUB 3I6KA 1KACB 2CO7B 1QBML 3O4OB 2NNAB 3MRHA 4I48B 1F13A 1CLYL 4NGHL 3GDBA 4XH2B 5J6HA 3RWCB 2GAZA 1QFPA 3LKRB 4MAYA 1W72A 4K94L 3HRZB 2X4SB 5C0CB 3ARBA 3MJ7A 1I9RH 3GSXB 3P77B 2DYPA 4WTZA 5ID0B 4M6NH 3LPGA 4OLXH 3RX8A 4GAYB 1W72H 1YEEL 1L0YA 1BD2D 3QDJE 3P4MA 4EXPX 1HZHL 1MHPL 4Z7NE 4I0PD 1X5ZA 4M7ZC 5EUKA 1ZT4A 1A3RL 4WU7B 4YHZH 4XX1E 4UAOB 3PWVB 4RMWA 5GSRA 5EB9A 2BVPA 1VHPA 2FO1A 3KWWB 4YIQB 4FHBD 1E4XI 2XICA 1EAPA 1LVEA 1J8HA 3WIHH 2AK4E 1RZ8B 1A1OA 5TPWH 1XR9A 5T3ZL 1DDHB 3BXNB 4I18C 1V8HA 3WKNA 4I3SH 1FCCA 4U6VH 2H41A 2IADA 1DQLH 4XZUA 3MLZH 5E08L 1UEMA 4OBRA 1NLBL 4L3ED 3ZDXE 1UH2A 5F96L 1AR1C 2CDGB 3DVNA 3WFZA 4H26B 3IXAA 1UCBL 3NTCH 4NQDB 1DLHB 4MS8C 2BY0A 5CFHA 3FTGB 5ENWB 1RIUH 2FJGA 5JORA 1FL5A 1S7XB 5GISL 1CFSB 3MRQB 2DIAA 3F12B 8FABA 4M1CD 4PR5B 1Q9LA 3HZKB 3S5LA 1FE8H 2I5YH 2Z93B 4WNQB 5GS2D 1OQXA 1CD1B 4JFFE 2VDMH 1BJMA 4PRBA 4DAGL 4NQEA 4J1UA 1BF2A 2IG2H 1AI1H 5KG9A 2C3GA 3HC4H 3TBWA 4PTUA 4XMPL 1U8LA 5L0QB 3D6GA 1LP9B 1I9EA 5GRJH 1UYWL 5DFTA 3GI8H 4NT6B 2NPLX 1H8OA 3DSFH 4K7PH 2B5IB 2FGZA 3BP5A 3CVHA 5C0JA 3IS0X 4AEHL 2YWZA 4OJFH 1QSEE 4IRZL 1LEIB 1EBPA 2AEPL 3HE7C 4Z6AT 3LV3A 5EZOH 4W6YB 1NAMA 4HWNA 1JYVA 1CFNA 2A83B 5EU6A 2GJ6D 1MREH 1KT2B 4JGUA 1FLTX 2NLJB 1JPSL 1BEYH 4OCRL 3X17A 5HHXH 1NAMH 1PLGL 4YO0B 5BS0E 1KXTB 3KPMB 4LLVA 4OD3L 4MNQD 2DQDH 2V17H 3OWEA 3G6AA 1QLFB 3C6SB 5KVMC 5KTEH 1H3XA 5F88A 4S1DC 4LQFH 1LEKA 2FZ3A 1LDPL 4WWKC 4E9LA 3IXTA 1NGPH 1ZLUK 2R4SL 3RVWC 4Z78B 3FO9B 4ZPTB 4PB9H 4FTVD 2X9YA 3N85L 1LO3L 4F15B 1PFCA 1C5CL 1P4LB 2VLJA 4RMVA 1PSKL 1UQSA 2NY3D 4TRPH 4Y4FA 1HCVA 3WFHA 4LRNL 5DJ6A 4ODTL 1X4ZA 4FXKB 1R6VA 3MRIB 3Q6GH 5E56A 3GHBL 2YN5A 3U4BH 4LKCB 1ITCA 3L3OA 2RIKA 4XNYH 3BZ4B 3AMKA 2XN9E 3MROA 4PS4H 5J13B 1NANI 4I3RH 3D0LB 4LRIC 1D5XA 2NY5H 5EN2B 3DVGA 2YRLA 2WWMD 1AJ7H 3G04B 4Y19B 3DVIA 3U0PA 4ZUTA 1IAII 5FYLL 4GG6E 2ZCKL 4L9DA 5C09E 2B0SH 4TOYL 5JUEH 3DV4B 4UT7L 4ODUB 5E1AB 2YPLB 3O9WC 1KPRA 3D25B 4X8JA 35C8H 3BN9C 4KJPD 4LCWE 5SWSE 1T4KB 2Q6WB 3QH3B 4OZFH 3TJHD 4G9FD 4ODHL 4D0DA 4KHXH 4APQC 3QCVL 1N7MH 5EULV 1E28B 3SGKC 1IAOA 1P6FA 4C59B 1J1XL 1ZA6A 1NAKL 5KVEL 1J0JA 1INDL 3JVGC 4OIIH 2VOTA 4U1HA 5FO8A 5HHQA 1GSMA 1VADB 3LH2L 3G6JF 1IFHH 3EKCA 5DJ0A 4PJ7B 2K7QA 4MDJB 4ZYKA 4YHKH 4X8XA 5E6ID 5IB3A 3GMOB 3W9DA 3IVKB 3AREA 4P9HC 5C71A 4HBCL 1G7PB 4MCZB 1XGYL 4PJAF 3TH2T 1UJ3C 5ECJE 4BZ2L 1P4IH 2Y6SD 4R2GD 5INDA 4JRXA 2FD6H 2Q87A 4PRPE 2AS5M 3IFOA 4OF6A 1VESA 5FGBC 5IESH 3QQ9C 4M43H 2XWBA 3MYJB 2XZCH 1TJIL 3FQXA 1PJ9A 4UIKH 4X7TA 1GOGA 3LCYA 4DN3H 4C56D 5C0AB 5DUPH 4CNIA 5BVJA 4LF3B 3I02B 3G6JA 2ZG3A 5DUML 3QIBA 1I9RL 3CFIC 1HEZB 2VLRD 4OLXL 3VI3E 5ELIA 3G08B 1BFVL 1W72L 1S9YA 2P8MA 4IOFC 1T5XB 2WZPD 1J0YA 1BECA 3NFPA 3TIDB 4PJAA 3STLA 3ZKMD 4NBZB 4G7VL 4YHZL 4XCFL 2XA8H 1NFIA 1UKTA 2VQ1A 5IVNA 5ADOH 1EJ6A 2PTTA 1MJJA 1RZGA 4PGBA 4TNVK 3LSOA 5HI5C 5DD6A 2ZUSA 2R2BA 2X7LA 2PW1A 2W92A 5BZDA 1OW0C 3WJLC 3GKWH 4RFNC 5TPWL 1KTKE 1U6AH 3G5VB 1V05A 3KG5A 5HVWA 3VRIB 5ICZA 2VLKE 1J05A 1UM4H 4U6VL 2ICEA 4RGOH 2DDQH 3LQZA 5C0BE 5E00B 3NN8A 4Q7DA 1DQLL 2GTZB 1GC1C 1WT5C 2IQAA 3RDTA 4NC1E 5I19H 3DX9B 4AZ8A 4OFYD 4J3WA 2DI9A 5I30H 1S7SA 3RKDD 2CKNA 4KK9C 4MJ6B 4IEFB 3QDJB 3MRDA 1G9MC 2MJWA 2WQ8A 3MNWB 5F7DA 5GGRB 3VXUD 3VFTA 4NRYA 1I7UB 1N4XH 5JW4M 4Z7UE 4E42A 3EDEA 5DI8B 4OM1H 1ZVYA 4NM4H 4YC2C 1VCAA 1NUGA 5DWUH 1RIUL 1S7RB 5FKAA 2J5LC 3HE6A 3QFJD 4RCAA 3NCMA 4GG8A 1M71B 1FE8L 3LY6A 2I5YL 4OZ4A 3A6OA 2DJUA 2EEDA 2VDML 3HE7B 2I60H 4U1JB 4ONHB 3WXWH 1ZGLP 5JQ6H 2EIBA 4HJJH 4YHOL 3K1KC 3TV3H 2ICWB 1KELL 2JB6A 3DSFL 1EPFA 5E2TH 3V79C 2WBJA 5HGGS 4C83B 4JKKA 5ANMA 1ROWA 5L2KA 4DVRH 3MLUL 4XPBH 3HC0A 3U48A 4GRLC 1NFKA 3V95A 4RGNC 1QBLH 5I1HH 1GGTA 3CVHL 3WE6A 4NC1C 2QQKL 4WWKB 4Q9QH 3AM8C 5FYKE 1ZA3A 4GLRH 1MREL 2BHYA 4RZCA 1P53A 4NKMA 3DXAD 3OKNA 1AO7B 1BEYL 3DX6B 1P9MA 5HHXL 1XF4A 4XNMA 3L95A 5F1NA 4XBGA 1CDUA 2DQDL 3OR7A 5E8NA 4BA8A 1RUPL 3BYYA 3GSOB 4FABH 2IAND 3E3QE 3V6ZA 5KTEL 2E9BA 4ZDHA 4LQFL 5HJ3A 1JNLL 3LZFH 3BMWA 4RRPG 1NGPL 5KAQF 4L3EE 4PB9L 2YMXH 4JKWA 2J7LA 3QHTC 3WEXA 4P2OD 2R1YB 4GRMA 1I7RA 4Y2DA 1C5DA 4FFVD 3MA7A 4O9HH 2Z8SA 4FQ1H 3GBML 3NIDE 3MV8D 4TQEH 5JOFA 3D3VD 5F1OB 1A7NH 3OJ2C 1MNUH 4Q6IC 1HE7A 2DIBA 1GGCH 3T4YB 3TBYB 4YHIB 1MFAL 1Z2KA 5BS0B 3VA2C 5IHZB 3D39D 3HG1A 4XNYL 1VA9A 1HN1A 1GZQA 3UTSD 5DJDA 2XQYK 4APQB 3ULVF 4I3RL 2W0FA 2YK1H 2IF7A 3QO0B 1DE4B 1WTLA 3VWKA 2DMKA 1KJ2A 5MEOA 2VR4A 1Q0YH 1OF2B 2B0SL 5JUEL 2APTA 3PWNA 3KHQA 2P48B 1QACA 3P4OB 4H25B 3RJDA 1DANU 5MENA 3PWLA 2XNAA 3UTZA 35C8L 1KJ2H 5CCKH 1VGEH 1ZANH 1BVKA 2UWEE 3CFEA 3NCBB 1WWWX 2HFFA 4I77H 3ZE1E 4WY7L 1DLFH 4TUOA 5IOPA 4KHXL 3E3QC 4HUUB 4OF8A 1N7ML 3VFNA 4ENED 1D5MA 5E8OA 3DYOA 1HQRA 1WWAX 4UTBH 4I1NB 4JZJC 1OWRM 1AFVH 1IEBA 2ZUYA 3IKCB 2GJ6E 1KIPB 4OIIL 4PJCF 2PW2B 4KRPD 4HFUH 1IFHL 4JZNB 2H26B 3VGEA 5KANG 1KYOK 1T21B 2BRRL 2NY4B 1A64A 1ORQA 3HR5B 5C09B 2JCCF 4GRWF 5D2NA 5DK0A 1A7QH 5EOCH 5BVPH 4BQ9A 3WDIA 1OAXL 1P4IL 3EOYG 5DR5H 3FKUS 5E99L 4LCWB 5SWSB 1QFOA 4M1CC 4E41B 5SX4I 1DQQA 4M43L 4ZUUA 3MRPB 3GBLA 3P9WB 2XZCL 4JY6A 3KDMB 2HP4A 1CG9A 1F97A 2FCBA 3DOSA 3ARDA 1OT1A 4UIKL 4PJ9A 3UYPA 1T22A 4KAQH 4DN3L 4WI9A 2RJMA 1KTRL 3MXWL 4PJCA 1CXFA 1TETH 3FQTA 4CDHA 4NWUL 2FH8A 1U3HA 4FRWA 4OZGF 2MMXA 2X4OB 3ZHDA 1ONQA 1K4DB 2X6MA 4OLYL 1P6AB 3RWDB 3VFSB 2JCCA 3BP7B 3VD7A 2FJFB 1QEWB 3HN3A 4NKIH 4MCYB 5HI3D 3ULUF 1QR1B 1ZGLB 2X4QB 2ADGB 1XT5A 4GRWH 4X0KB 5ADOL 4WW2F 3BHBB 1PGRB 1NJ9B 1KTLB 3E0GA 1A4JA 2P46B 3EUUA 3JV4A 3FRPG 3GKWL 1OLLA 4IHOB 3P40A 1MCDA 4V2BA 4WW1B 4YDLC 4I0CC 3OXRA 3T8XB 1VACA 4RGOL 4G9FE 2FX7H 4OZGA 1J5OH 4F7PA 3L5WB 5BRZB 3RNKA 3QXAA 3RTQD 4MDIB 5CJOH 4X83A 2P24A 5DQ9B 1MCSA 1AQDB 3QRGH 5D6CA 4HJ0D 2BCKA 1X6NA 1AKJA 3SDCD 4KJYA 2OSLA 3T0WA 4JFEA 4KC3B 3I6GA 3PWPA 2NY1D 4AJ0A 2J8OA 4MA3A 2Y07L 2R23A 2HWZL 4G8EA 2NY3C 3VRJA 4WW2A 5DWUL 2P47B 4ZFOL 5GHWH 1B0RA 2YC1A 1N5AA 3GSVB 2QKIB 4IMLA 3RUGE 5E6YA 4OT1L 5IFJB 1M7XA 1JF6A 4G5ZH 5J12C 5FA4A 1AGCA 3SE3A 1ZHLB 3LHPL 2DQGH 2V2TB 2ITCA 1E4WL 4XVTH 4IRSB 4X7CC 2A6DA 2X89A 3D0VA 5JQ6L 5F1KC 2ZSVA 4HJJL 2WWMC 1QFWI 5I9QB 4C56E 5EO0B 2P7TA 3QI9D 1K2DB 5JOPD 3SKMA 3BGMB 5EBGA 5F1IB 3VFWA 4I8DA 4Z7UB 1UWXK 2QJDA 4XNQB 2VLRE 4DVRL 1A02N 2OYPA 3OJMB 1BQHA 2W0KA 3TJHC 1QBLL 1U8MA 3PG2A 1T5WB 1FC1A 3I75A 3O8XD 5B8CA 1D9KA 4MSWA 1J0IA 4RBPH 5D9SB 1RU9L 4LP4A 5ETUA 4MD0B 5D1QC 5DMKA 2DKMA 3AU1B 3HNVH