1BMGA

Crystal structure of bovine beta2-microglobulin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
b'IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA=2=-MICROGLOBULIN
molecule tags Histocompatibility antigen
publication title Three-dimensional structure of beta 2-microglobulin.
pubmed doi rcsb
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bmgA00
2XN9E 3JVGC 4IS6B 5IKCA 1LEGB 3CZFB 2HYMA 1OTUD 3LH2L 1XF3B 3NAAL 3U0PA 3TH3T 4Y4KD 4YEEA 4NQEE 4DEPC 2P48B 4YK4B 4F2MB 5FYLD 3TPUA 3S5LA 4KDWA 2VL5A 3SN6N 1P1ZB 5T1DH 4UTAH 2DJUA 5C0BA 4YH6A 5L6YL 4HS8H 1UZ6E 4Y4HB 1OTTD 4LIQH 3EOTH 5C0AA 3WIHH 1CXEA 5AD0A 1Y18A 4P2RD 3BKJH 4UV7L 3HZVB 2ZJSH 3DV6B 4CN4A 2IADA 3QZWG 5FCUH 4PTTA 4I2XA 5IMOA 1K9TA 4JCLA 43CAB 1S7RB 4NC2B 4K8RL 1F3JA 3VFGL 1NAMH 1OAUL 1A47A 1QBAA 3OKKB 4QGTA 5JIKA 4Y5YC 4Y1AA 2ADIB 2X4PB 3D69B 4B53A 3V0AC 2HFGH 1HINH 4JO3L 3ZDZF 2H9GB 2GITA 3QP3A 4XNMA 4LHQB 5HY9B 4DGVH 1QO3B 4ZOEA 4ALAL 3NFSL 4Z76B 1OTTC 2LV4A 4IRJC 3BGFC 4MCYB 4FFZL 5DD5H 5DR5L 4K2UL 3AM8C 1KBGL 5IW6A 3BIBX 1TPXC 4RAVB 2FEEI 4L8CA 4FQHA 1FQ9C 1RZGB 3ALWA 4P4KB 2DMBA 3CSBA 3OBAA 5GS0D 4P4KD 1PY9A 2EDXA 2X4OB 3V6OC 2X41A 3VXSA 3P3YA 1G9NC 3W0WD 3VG9C 3OL2A 3E8UH 2QHRH 3ROOB 3UTTD 5DQJB 5L6YH 2XPGB 1WISA 2DIBA 4IIQC 2JCCE 4XNUH 2NMSA 2H8PA 4LLAA 1KLUB 1H3PH 4OFYD 2DIJA 4PY8J 3CCHA 3D85A 1B2WH 1DE4A 3BJLA 3GSVA 4WUKH 1OGAD 1S5IH 1SJHA 5DQ9A 3BMWA 3CXDL 4R0LA 2Y7QB 3GRWH 3KLAB 2XY1A 3QUML 6FABL 4PRIB 2DQEL 3QXAB 1U95B 4H88L 1HILA 1VEMA 4Y8AA 1AXSA 1BZ7A 2AABL 3NOIA 1SJEA 4JY5H 8CGTA 4M00A 2I9LB 1P5VA 4HX1B 3RGVB 3TVMD 2YN3A 1S78D 3FQXB 3CK0H 3BZEB 3T09A 5EFIB 2PN5A 3P9WB 5HYJB 4QRSA 3MODH 3MRBB 5E4EC 3K3QA 2HKFH 4R8WH 2P5EB 2R2EB 3BUYB 3NFSH 3MUGB 5DJZA 4LMQI 5I73B 1P4LA 1IGFL 2E8YA 2R4RH 1UKQA 2AKRB 4XCEA 5GRUH 1OLZA 1ZGLB 1DEEA 3KR3L 1IAKB 4GRWF 2QADC 4JFDB 4YBLC 3VWKB 2XTLA 5EO9A 3BPCB 1NFIB 2JB6A 5JIHA 1FN4A 5GRJL 4LCUB 3GMQA 5FV2A 5CJOH 1MIMH 3FOMB 1U3HD 1QFWI 2BK8A 3QXTA 3JTTB 4FXKB 1CG9A 1FRGH 2WZPD 2NXYC 1AFVL 3IJSB 1IVLA 1WZLA 4X7EC 1HOCB 2GKIA 1BAFL 4FTVD 3WIIL 5IR1B 5EULV 3U46B 5E1HB 4M5YH 4LLVB 2VDLL 4UZGA 3V6OE 5IB1A 2EEDA 2BY0A 5KJRL 1P4IL 5EC1B 1Y6MR 3UJIL 2YXFA 4U4BA 2DWEB 4JRXA 4EN3A 1QA9B 12E8L 3PWUB 4IMKC 1DL7H 4IRSC 2VDOH 1WFUA 3GSNL 3FT3A 5L2JB 5D1QB 1G7MA 2EDDA 3HI1A 3S3SA 1FVCA 1EEZB 1NMAH 4PJXA 1N59B 4E41E 1PKQB 5GS2H 3QNXB 2F19L 5IHZB 5DRZB 5KOVC 5D8JH 1HNFA 3MNVA 4K7FA 1DANU 4M61A 1DBJL 4NYLB 4ZOBA 3KNBB 2XA8L 1Z0NA 5FIEA 1ZVSA 4Z7UB 2VZUA 1RZKC 5EU7C 3I3DA 4NQDB 4CMMA 5FDWA 3ULUD 5JA9A 1I1AB 5AUMA 3VFPA 3KPLB 5D6DA 2VDQL 2R69H 4AL8H 1ZLVK 2ADGB 5FXCH 4L8DB 3WLBA 2IMNA 1KC5H 4NN7C 1HHGA 2B0SL 4ZXBA 3VFRB 2EDKA 1VEOA 4OLXL 4AEEA 4Z7WA 3L5HA 4MNGB 5ITBL 2AK4A 3PQYA 5I1GL 3HUJE 3TYGH 3WFBH 1QFWH 3JWOH 5DC4B 1XIWB 4OD2A 3FQUB 1A1MA 5IVXA 3EO1B 4OCSL 3QPQC 4NKDB 2ZUTA 2NW3B 5IHUH 3MJ6A 4NQVB 5FGBA 2K7QA 1YEFH 4HKBA 5IESL 1IEAA 2NY0B 3RVVD 4RQQB 4KMLB 3QEGL 3IXTB 1CICD 2VDNL 4G7YL 3PL6C 1MAMH 1HI6B 3H2WA 1RIUL 1M4KA 1YEJL 4FXGA 4B0MM 4LLUA 3IVKB 3DUSA 1GH7A 1J8KA 2V5TA 3HNTH 3QDJE 4AJ0A 4KI5F 4Y4FD 1UVQB 2G2RA 4M93B 4M1GH 3G5ZB 1NDGB 5ESAA 2OI9C 4HUVA 4QCIA 4PJXF 1AGEA 5E8DH 3X12B 4PP2A 3NFPB 3OG6B 5ESQA 2X2YA 2VLJA 2X4SB 3T2NH 1A6AB 1CFBA 1ERNA 2HMIC 2RFXB 1UA6H 2IBZY 1YYML 4CNIB 4F7EA 4ZUWB 4NZUH 2DQFB 4PJ5B 1I9IH 4LSUH 1KC5L 5CWSB 5KVGL 4R26L 4X6DF 4XNQB 2K9UA 4UT6L 3QAZC 2FX7H 4P57A 1NGQL 3DYMA 4FQXD 2DLTA 5HVHB 3L5IA 2DQDH 2M26A 4DUXA 1FCGA 1JF6A 2APFA 3NCFB 1BVKB 5D7JD 5D1XD 4U1LA 2CIKA 4WCYL 5GHWH 1SBBA 3GBMH 3DURA 2KQNA 4UQ2A 4P5TD 1QEWB 5L0QB 1VFAB 5JHLH 5DTFB 3EJYD 2V5YA 3H42H 5EU4B 1A3QA 4GRMB 3IXAB 3WFCH 4ENED 5GGRY 5FO8B 4NOFA 4UBDC 1CQKA 4P5MA 1MLBA 3TZVD 5I15H 2W9DL 4IJ3B 1M7IB 5C07D 1AQKL 1GOGA 3L3DA 4O2EA 2WSKA 5GS0L 5IBLD 1QKZH 4H26A 5DI8A 5I30H 3L7FB 3MXWL 3SDCA 3D39D 4HGMA 2CPCA 5JO5B 2XTJB 4DGYL 4FTVB 4MHHG 4QRUB 5EC2B 4F57L 1B3JA 5A2JH 3MRFB 3FMGL 4JHAH 4X6EA 3FL7A 3QIUB 1WBXB 4NJ9L 3T2NL 1DDHB 3MV8D 3UYPA 2WINB 3CVHH 1YMMA 3QUYC 1CXLA 2VLKA 4MDJA 4TTDD 1OT2A 4P59L 3IFOA 5C09E 3C60C 5J11B 2Y5TB 1ETZA 3B3IB 3BKMH 3EOAB 3E1F1 1G7JA 3E6HB 4LRNL 3EW3B 3VWKD 5BOZG 1E0OB 4DOHE 4LLMA 3OV6A 1KXQE 4LSPH 1CXFA 2LU3A 3MMEB 3DGGA 4EXKA 5KSVB 1ZANH 3HAEB 5CMAA 3WDJA 1D6EB 3EOTL 4MSWA 1TNMA 3OKNA 2F5AH 2ICEB 1H15B 3O2WH 1FL5A 1UXWB 4MNQD 3F7YB 4Z0BL 1JBJA 1X5AA 2GJ6D 4UINL 3H42L 4HFWB 2ZWLT 3U30C 4BQ9A 2WQ8A 4AEFA 1II4E 2YD9A 3VXSE 4NCC2 2R1YB 5EZOL 1WLHA 1QNZL 3C5SB 2C1PB 4HMDA 4PPTA 4RIRA 5F9WC 2DL9A 4LDLB 3W0WE 5CCKL 2JE8A 4LSSL 1GC1C 3B8SA 4PTTB 1FLRL 1ROWA 2H3NA 3GGWB 3QCTL 5ID0B 1S7RA 2X44D 4E0RA 3GUTB 2HJKB 1F11A 2FBOJ 2Q1EA 2Z91B 2B8OT 5SWSB 2P5WB 4WHTB 2VLRB 2PYEE 4S0SD 3S98A 1RIHH 3MNZA 2YBRB 4NWUL 4MLIA 4PJ5D 3IDGA 4K2UH 5I16B 4HAFA 5AEAA 1QG3A 3BPLB 1NSNL 3QJFB 4JY6A 2OL3A 1QO3A 3Q1SL 5I1KH 3E2HB 4ODWB 1DQTA 3FZUC 1E6OL 4YHZH 3RKDD 3N9GL 1G7IA 3QA3B 5C0CE 3V52L 2CUHA 3VGAB 3BDYH 1OAXL 4PJCE 4P46C 5FKAA 2FSEA 3QH3B 4N1HB 3RTQA 3GB7B 4M1CD 1FV1A 4TSBL 4KVNH 4PBVC 5F9JA 4UMGA 1FCCA 3U2SB 4Q9RH 1OSZA 1I8IA 4NN6C 2NTFB 3KYKL 3QG6A 2VQUA 1FJ1A 3PGFH 3E3QE 3CFBA 3SKOA 4LRIA 3N1QC 3RPIB 2APBA 3Q5YA 3WD5L 4F37F 4YAQA 1DE4B 5C70A 5CEZD 3T65A 5IFJA 1WZ1L 5HHPA 1T2XA 2A6IA 4G8IA 2CQVA 4XMLL 2NY2D 3DJ9A 3R0NA 3NABL 3LMJH 3MRIA 3QIWB 5A3ID 4GMSH 3MBXL 4ODTL 3HI6H 4ZUTA 1XF5A 1CWVA 4PJFB 5IEKA 4DZBA 4X6BB 4WJ5B 1EXUB 3SKNA 2I9LA 5L2KA 3LEXA 4M1CC 2YUZA 1HN1A 3FQXA 1YDPA 5MEND 1KG0A 4ODSL 4QRSB 1LGVA 1X7QB 2R56L 2XZAL 2VWEC 3KLHD 2FX8H 4JM2D 3VXOB 4I0PA 1FNGA 1TXKA 2R2CA 3IAPA 4NBXB 1LILA 3WUWA 3FCTA 4OF8A 3T0EB 4MWFA 3WYRA 1P4LB 4DQOL 2F58H 3OAUL 1BHGA 3SJVE 4RWYH 1J1PH 3MCKB 5B3JE 4YXLL 1UXSA 4KROD 4QT5B 3SGEI 4Q97A 1NLDL 4R3SA 1PSKH 5JDJA 3THML 4BQCA 1AFVH 4EUPH 4O5LH 4MAYA 4JM2F 4JKKA 4WNQB 4PGZA 4FXKA 3JTTA 1DQJB 4GAGH 3KXFA 5I1LB 1RJCA 1XF2B 3EDEA 4IIQA 5T1LA 2WWKT 4NCDA 5E9DE 5C0IA 3QQNA 4CL7A 1QLRB 5D70L 4HBQA 1KIRB 4MA8L 3DMMB 4K3JH 3KPRE 4JZNA 4NQCB 1OM3H 4YC2C 4WHYH 1X3DA 5IEHB 5FDYA 3HCVB 1R3HA 3BP5A 3PWLB 5HHMD 4TSAL 3VXMD 1V3MA 3UTTA 1INQA 3R0MA 1N7MH 2CKBL 3RU8L 1UB5A 1ORQB 1S9YB 3B9KD 1QA9A 5DRWB 3PG2A 1NL0H 3FB6B 8FABA 4QOKE 1AXTL 4OIAA 3S5LB 1P7QA 1F8TH 1WIUA 3GJFK 1G7MB 4H1LH 4QWWD 1CE6B 4JE4B 5FUZL 3S5LG 4YDJB 5DD3L 1GOFA 3KYNA 2VXSH 2C3VB 2IPUG 1YNLL 3L3JA 4OLVL 2AJ3B 5KW9H 4U1SB 2QADB 4YBLB 5ID1B 1D5XB 4WV1C 1PEZA 1PKQA 4XH2B 3C08L 3NACL 1NH6A 3MNVB 1QP1A 2EYSA 3BX7C 4I2XB 5DO2C 1K8IB 5E99H 1ND0A 43CAA 1JK8B 3Q3GA 3L95A 4XBEH 4WEBL 5ICYB 1FNSH 5IJVA 3OKKA 4G9FA 3OAYH 4Q9QL 3ARXA 5ACZA 1AO7A 1CFTA 4WGWB 3IJHA 3VFNA 5C2BH 5H8DA 5L9DL 3PHOA 2ZCLL 2VE6B 2E9WA 1RSFA 3V2AR 5FGCB 4PV8B 5D7LA 2ZUUA 3EIFA 2BNQD 2DF3A 2YEZA 4JJ5A 1A6UL 1S7QB 2WWMC 1KT2B 4Q0XH 3SE4A 3FB8B 4P2QB 4UBDD 4XC3L 4YFLI 2R0WH 1BJ1J 1F6LL 4J3SA 2PR4H 2GSIB 3DX8A 4GKZA 1XGYL 4Z7QE 1NEUA 3RJQB 3HNVH 4WUUE 3VXSB 4G5ZH 3PHQB 4EOWH 1FZMB 2FYYB 4XX1G 3ROOA 4OQTH 3ULVE 3GO1L 5K59F 4ZSOB 2N56A 3MCLL 2BNQE 2QHRL 3ULUE 3X13B 3VGFA 4F7MB 1WWCA 1I1AC 1ZEAH 4OZFG 3IETA 4JY4B 4NGHL 3HC3H 4ZD3L 3WNLA 3ZKSD 4OF5A 3WJJA 3DO7B 2DQHL 3QIBB 4MB5A 5DLMH 1A6AA 4RGMB 3RDTA 4BKLA 3L9RB 5HGAB 2UUDH 1JGVL 3FFDA 2EIBA 4F7EB 4PJBB 1HILB 5IB4B 3K74B 1SBSH 2D4DA 4FABH 2X1QA 3MLVL 2AJXL 1FC1A 4X9HA 4YHIA 1BOGB 5HXMA 4P46A 1SEQL 1H3TA 2FECL 4JFEE 4MAYC 5CP7B 3K4DA 2VLRE 2OCFD 3A6CH 3TO4A 1MHCB 4M8VA 1ZLWH 3NZ8B 3AS0A 2XTJE 5IMMB 3OAZK 3PL6D 3H3PL 1S7VB 4XCEB 3TNNB 3PL6B 1S8DB 3MRNB 1QSFD 4JRYB 5TF0A 4JFDA 2R0WL 1HDMA 2FNBA 5IBTL 4K94H 4MJ5A 2PR4L 4F8TA 5GS0H 1JTOA 4IOFC 5FYKD 4R4FH 4KK6D 3OXSB 1BF8A 3LKPB 1OF2A 3GK8L 1CVRA 5CIPA 4R7NB 2V6HA 1O7VA 3O3UN 2A9NH 1SYSA 4L29B 4O2EB 4HK0A 4EOWL 1RULL 5EU5B 5D7IE 3MJ9H 4TUKL 3FMGH 4JHAL 4J8RB 4G6JL 3U1SL 5CSBA 3V4PH 2Y9RT 2FB4L 2VR9A 5MP6L 4XNYH 3FB7A 3RZWA 4UV4L 1AC0A 3EYFB 5KVEH 3QEQD 4NQSA 1F97A 1T0PB 2BVOA 4O9HH 3UBXI 1X44A 1XGRA 2SEBB 3FRUA 1CXIA 1FZKB 1ZLUK 4GG6E 1GGCL 3QYCA 4JPIA 4L8SC 1OW0A 3MLYL 1UCBL 4P3DB 3KDMA 3MOQA 3ZE2E 1T1ZB 4OLUH 5B38A 5E95B 1ETZB 1MAKA 5I1EL 5L2JA 1EHLH 1AGDB 3HR5A 3UJJH 2ID5A 1OT1A 2EDJA 4QXUL 1IL1A 5DUBB 5CJBA 2HWZH 2QBWA 5D4QA 4RISH 2VABB 3DGGB 4PB9H 1NDMA 5E8OB 5DVNA 2FJFB 4AEIH 3U4AA 3IDMA 1DBAL 2Z8VC 4CJ1A 2Z8SA 3BKCL 2FD6L 3B6SA 3DTXB 3KPQA 4K9EL 3MV9D 1IE5A 3TPKA 1DVFB 2H6PB 1C08B 1QFUH 3CAFA 1CICB 3VMPA 1B88A 1X4ZA 4FQXA 1HYSC 4KPHL 3VGBA 1MRDH 2DD8L 4OLZH 3TEUA 5AAWA 3MGTA 1OAKH 2DRUA 2BHZA 3C5SA 5DEGB 4PRPD 3OR7A 1EO8L 2W65A 4PJ9A 3N1FC 1RY7B 3N1MC 2XTJC 3VFRA 1KIPB 2D7MA 4NCC1 2VXQH 3QDHA 4W4OA 4GXVL 3TESA 5J3HD 2R0LH 2AK4B 4MXWH 5CZXC 4KTEH 4ZMAT 3O6LH 5JPMA 2DQCH 3W9EA 1NUDA 4XNXH 3F7VB 4BUHA 4ZAKD 5MP6H 5C0RH 5HYFA 1WCBA 4OFYA 2B1AL 1HCFX 4NQCE 4KJWC 3ZHDA 2EH8L 3EGSB 3SKUD 5BRZE 3KJ4B 1ED3B 4NKDA 4GSDL 2J3SA 3RWGA 1IEBA 2G75A 1KENH 4OCSH 5H94A 2YBRA 4HKBB 4QTHA 3UJTL 3SEPA 1BGXL 4H20L 1U8PB 4OGXH 2CKBA 2EE9A 1NCAL 4J1UA 2Y4SA 4ZTOL 4NQXA 5LGJA 3FAWA 5C0BD 1N6UA 2Q86A 3MV8A 3O9WD 4GG6B 5IB5A 1UVQA 3TBYB 4JN2B 4L4TA 3ULVC 2ORBL 4NO0D 4ETQA 4DGIH 4BUGA 1WIOA 4OZHF 4GMTH 2O5YH 3KYMB 3FQRB 4LKXA 4L3ED 5M7QA 4OCXH 1I8IB 2IADB 2YRLA 4KUZL 5FYKL 3LZFL 5I8OL 1I8KB 4HUWB 5EO0B 1YYMH 3MV8E 5T3XH 1C1EH 5J6GB 4X7SH 4Q6YA 4TVPE 5TJWK 1MJ7H 4QO1A 2CR6A 2NXZD 1U8NB 3P30H 3ARDC 3TWCL 3D3VA 4K7PH 1QSVA 4RFEA 4AENB 3VXUE 1ZA6A 2B5IC 5JHDE 3QJHA 5JW5A 4YHKH 5I6XC 2FGWL 3LKOA 5I1CL 4G8GE 1C16B 1H3WM 7FABH 1BFVH 5E7BA 4OAWB 1RZ7H 2J6EL 3HN3A 3BKJL 4M7LT 1Q1JH 1F2QA 2GT9A 4OKVB 4QOKA 4MZ2A 2R9HD 2EZ0C 1OGAE 1GAFH 3BKYL 1Z5LB 3ALPA 2XV6B 1CFNB 4WW2C 5D7IB 4P4KA 5A16B 2VLJE 2W0KA 4HPYH 5E4IA 1JZ4A 5C08A 1I3GL 4CBPA 4QT5A 2EC9U 4KQ3H 4NKOA 2D31B 4Z7UE 3RWIA 5DHVA 3RNQA 4P9HC 2NY1B 4JZOA 3VD3A 3OF6A 1KLUA 2AV7A 1MFCH 2R1XB 3K4ZA 4JRYE 2NYYD 2YS4A 3ILPA 1KGCE 3NCJL 4DGYH 1MRFH 1BPVA 3TH4T 2YA0A 4BH7B 2BOBB 1QLEL 1FZOA 3O4LE 3KLAA 1C12B 3RRQA 3KLDA 4WV1A 5KANG 3CVHL 4D9RD 4P23C 1NBZA 4Z95L 1ZS8B 1C1EL 2D0GA 1RZIA 3B3IA 3BEWB 3KS0J 5JXEA 4EBQH 1ACYH 1F6FB 4YZFF 4HX1A 3EOYG 3MXVL 2AK4D 1P6FA 4RWHA 5EFIA 4LRNH 1Q9OB 4HWBL 5F7NC 3MRBA 5D93C 1G6VK 4HIJA 1P6AB 4OLVH 5KW9L 4MSWB 4QRPA 4O2FB 3DI3B 1BEYL 1QOKA 2VYRE 1UXWA 2YWYA 3T0EC 4NFBA 4XVJL 1KCLA 5DEFA 1U2CA 3TNMB 3MREB 5EWIL 4U1NB 3HMXH 5IMLB 4FQCH 3SPVB 4U1SA 3F7PC 2OR9L 1S3KH 1MSPA 1Q0YL 1TFHA 4JPVL 1H5BC 4Y19B 2MTPA 4XH2A 3RWEB 1A7NL 1UT9A 3OKLA 4PLKD 1U8KA 4ZPVA 2AK4E 3KPNA 3MRQB 3L3GB 2B4CL 4E9LA 5AZ2L 1NEZG 5IVOA 2GJ6B 5DK3A 3QUXB 1AY1L 4PJIE 3MLSH 4OD1L 2EDTA 4WTZA 5C8JB 5HYSG 2X5PA 4X9BA 1JPSL 2CJUL 4TNVF 2Z91A 3OMZA 5F1KC 4G6KH 3SOBH 4LLVA 1HWHB 3T0BA 3O11A 4NZRL 3MV11 4YDVA 4ZO9A 4QY8B 2PXYB 1IGJB 1MNUH 2NXZB 4R7DA 1CGSH 1WZMA 3OKMA 4OF3A 1RK0B 3DXAE 3HNVL 2W91A 4IM8A 3ZE0F 1NUNB 4HWBH 3MLXH 5IOPA 3PWVA 4L4VE 4JB9H 4YXKH 4ONHB 4ZQKB 4GKZB 3UPCA 4XBPB 4L5FH 1DZBA 1INEL 2FZ3A 4FQ1L 5F70A 2H26A 3BVNB 1DBKH 5HGDA 3WIHA 4H25A 3WIIH 4GT7A 2HJLA 3BYYA 2BDNL 5LJYH 4WHDA 4Q9RL 3BZDA 2FIKB 2OS7A 4JFEB 4TRPH 3GBNL 3HS0A 4X0KB 5E1AA 4YAQB 1WQVT 5MEPB 3KPLA 3ARGB 1M71B 3TZVB 1AJ7L 3UC0H 1SBSL 3VFSA 1ITBB 1LO2H 4JRWA 1VACB 1MFNA 1L6ZA 1YY8A 2W9EL 3H9SE 4BKLB 5ILTL 4DOHB 4DN4L 4U7MA 4IBLT 3GSNH 2ITDA 3BH9A 3CDYA 4KUCF 2IGFH 1IAII 5BQ7B 2OP4H 1E28A 3FQUA 2VR5A 4YHIB 3VGEA 2BSSB 3AY4C 1BD2B 1D6VL 4R90H 2FJGB 1B0GA 3CMOL 3CSPA 4YE4L 1B4JL 1JNLL 3DV4A 3H7BB 1YMMD 4XTRC 1RJYA 1D9KA 5CP7A 4YDLB 2MSPA 1UWEL 3VXOA 3KG5A 5E2TL 2EDRA 5IK3B 1U8MB 4XVSH 4W4OC 5BVJB 3NZ8A 5F8QC 4XP5L 3GM8A 1CLCA 4G9FD 3TNNA 5ISZA 1AP2A 3LV3B 2X4OA 5GZOC 4O2CB 3V6OA 2NX5B 3DUSB 4GXUN 2R2BB 1T1YB 4K7PY 2MHAB 4R4ND 4QHLA 1AGFB 5ESAB 5FECA 1A6WL 3MV9B 3ISWA 3GSVB 3WFDL 3C5ZA 1H3PL 1WUNT 1CGUA 4IIQB 2AJYL 3O41B 2VDRL 5DJ8B 3QIBC 4JFQA 3VA2C 4KKBC 2MOVA 3UTSB 1X4XA 2EYTA 5INDA 3HPLA 1T03L 1QBLH 5DURD 4PRDA 2J8UA 5DRNB 2WIMA 5I9QC 3ROLA 2CH8A 1FYHB 4KKAC 4WWKB 1A2YB 2I07B 4ODHH 4WWKD 4PUBL 5KAQG 2QSCL 4CADB 4P2OB 3RGVC 5GGQL 4O58H 3ZDZE 1LEKB 3I9GL 32C2B 2FL5B 2J7LA 5GPRA 2EECA 1HSBB 3D6GA 5HGBB 3U9PH 1VGEL 3FB5A 4URTB 4LMQE 3QFDA 4UIMA 4JO4H 1OP3K 4DVBB 1OTSC 1U91B 1GGYA 1MRCH 4OIBA 3ZTJG 1M7IA 4RFNC 3E6FB 1C08A 4FHBD 3B2VH 1LO4H 4S1DD 3EOBB 2V17H 4HH8A 5KVGH 3QDAA 4MXWL 4NT6A 3GMLA 4PB0L 2VO5A 4UNTA 5CS7A 5DEGA 3B8YA 5ICYA 5I18L 3S4SB 3QPXH 1XFPA 1WK0A 4DAGL 2NXYB 4K7PX 2H1PH 5CD5D 5J57B 1X5LA 2NY3D 4RDQG 4YDKL 3V6FB 1NFDA 2PTVA 3NCEB 3F7VA 3NTCH 1YMMB 5EZLA 1RHHA 2VLKD 3PHSA 2VMFA 4LLWB 4EN3B 1RZKH 2LU4A 1HSAB 4JJ5B 4Q6IB 1U8LB 2FH8A 1BFTA 2OZ4H 4NRXB 3PWUA 5TQ0L 3B5GA 2ICWB 5H94B 2GCYA 4QTHB 5JHDA 1Z2KA 2KPNA 5FO7B 4LOUC 4MS8D 1N5YL 4BH8B 1QUNA 2DDQL 3HI1B 5INCB 4MJ6B 4NKQB 5JQ6L 4ODVL 3FFCA 4WU5A 3FO0H 2DTML 4EI6B 5DYOA 3PHQA 3MJ7A 1IZKA 3T0EE 3JWOC 1YECL 4V2BA 5C09B 2DL2A 2Y6SD 3CX2A 3P4MB 4MQ7A 4OIIH 35C8H 4YFEA 1RZFH 3DETC 4NYLA 1WAAF 4JZJA 4OCYH 3SCMA 1ZOXA 3MBEC 5FYKH 1EFXA 5IMKA 2AEWA 3D0VA 4PJ8C 5L88L 4UTBL 1YJDL 3SDDA 2CDFB 3RP1A 3KPPB 4P59H 3B2VL 4EKXA 2PO6B 3TYFA 1P84J 3VDAA 1LP9F 2IEPA 4PJ8A 5ELIA 4E41A 5CAYB 2VLLB 4P4RA 3X3GH 1RD6A 1U42A 2QQNL 5BJTB 4QXGL 3WUZA 1G9EA 1LK3H 5C0CD 4RGNB 4NHUA 4NQUA 1FG9C 4OUOA 1CD9B 2FO4A 5HI4D 1KEMH 4NJAH 5T3XE 3B2UD 3HKFA 3TBVA 3WJLC 1GYAA 3V5DA 4D9RE 2A6DA 1YMHA 1RUMH 1S7UB 1MHCA 1YEFL 2GIYA 3S88L 4YHNB 3IDIA 3ZSSA 1BJ8A 2BHYA 1UZ8B 4FA8A 4GRLC 4X7TA 1YQVH 4YUEL 2UWEA 5BXFA 4NKMB 5EZOH 5KAQF 3IVKA 1QSFB 2GT9B 4GXUM 5F7WC 2DMCA 4QOKB 2HRPH 2W60B 3GI9H 4Z77B 5EOQL 3AREB 5B4MD 5C0AE 3SKMB 3G5ZA 3OWEA 5FKAB 3FO9A 5T3XD 5CBEB 1OARL 4FFWC 1FV1B 2EXYD 1MFCL 4PJGE 3D0LA 4HWZB 1YYLL 3PQYD 1JWUA 3IB4A 5DEZA 5E94B 1BWWA 2IJ0C 1JHKH 5DHVB 1D5ZA 4P0DA 4UILL 4YQXH 3RL1A 2DJSA 1JZ6A 4HAGA 5KS9E 3CFBB 3A6OA 4Y2DA 3ARFC 3RPIA 1IQDB 4RRPA 1X6NA 4JHWH 5HHPB 3FHAA 5KOMC 2LVCA 3VFUB 3VI3E 5IM7B 1BQUA 1J0HA 1ZLSH 1IFHL 2YZ1A 4LSUL 1I4FB 4L8BB 5ICZA 4NBYB 2OSLB 3NMEA 3IDJB 1IBGH 4OLWH 3MRMB 1T1ZA 2QSQA 3T1FA 1J1XH 4MXVE 4KV5E 4PJ9C 2B5IB 3OX8A 1MHPL 1FNFA 5L2KB 3EZ8A 4HGWB 3DURB 5EH1A 4HT1H 1L7IL 3F6IA 4YO0A 1UG9A 5DTFA 4FOMA 4POYA 4KVNL 2X40A 1IAIM 4X99A 1H8SA 4FQCL 2EIDA 2GI7A 4QRPB 3V5KB 4UUJB 4GBXC 3B6SB 4YWGH 3UYRL 3JUYA 2UZIL 2O5ZL 2AJZB 1J0JA 4X5LA 1EDQA 1F45A 4KKLD 3ZYZA 2PW1B 4JDVA 1H0DA 3TBWB 5C07B 3ULUL 1YEKL 4FFZH 2GEEA 1E4XL 4M6ML 1Q72L 2BNQB 3GMNB 4PGJA 1FIEA 2NY6B 3MXWH 4ODTH 2C26A 5I1HL 4I3SL 1FFQA 1JF1B 1UGNA 3G9VA 2W07A 1XEDA 4XP6H 1E4KC 5T3ZL 3L6FA 2VSDA 1G7HA 3PP4H 1VADA 5C92A 2ESVE 1MQ8A 1WBYA 1JGDB 2EO9A 4QHUB 3CPLB 3EGSA 4X4YA 1JFQH 4P5TA 5BO1L 2DWDB 4OZ4B 2FX8L 2VITA 5D1ZD 4JEGB 5D7KD 3JWDC 4M5ZH 4WEMB 3F12A 3HUJB 5J11C 2BP3A 2RGSA 2ZP0T 4YBQD 2KH2B 5KSVA 3DHJA 1D6EA 1MWAB 5EU7E 1HHKB 5HHVH 4J1UB 1RK0A 5IWLC 4XVTH 1FYTA 3FJTA 1H15A 4PJFF 1UEMA 3MA9H 1JNHA 1L7IH 5C0EA 3DWTA 1G0XA 4XC1H 5B38G 4L4TB 1O5DT 4MX7A 3L3JB 4MYWB 5FM5M 5CJXC 1GOHA 4LHUB 2CGRL 1UM4H 4TN9A 3FQRA 4LKXB 1KYOJ 1DQDL 4LGPB 4K3JL 2CLRA 1JPST 4G8EA 5JW4M 4P2OD 1A5FH 3PWPE 5IB2B 1CGTA 4OCXL 4GH7B 5DUML 5TF1H 1ND0B 4FFVC 5LAXA 1IAOA 4QRPD 1OQOA 43C9B 5EIVA 3EO9L 4O51A 1F11B 2I60L 4M4RA 3AC0A 3ILQC 4RGOL 5C86A 3OQ3B 2AJVH 2D7TH 3QDGB 3VFNB 3VFOB 1SM3L 2VDPL 3LKQA 4NO3A 3RWJB 1F8TL 5I16A 4JFYA 1IGFH 4U6TA 2WWKO 5K9QI 5CEZE 2A74B 2PXYC 1C16A 1A4KA 2DYPA 5EPMB 3CFCH 4NQDD 2E27L 4AG4H 3H7BA 2ZG1A 3MA7B 1D9KB 4Y2DC 3E2HC 1BFOB 2C7UA 4NWTH 2CLZB 4XCNB 1KPRA 1ORSB 4OD3H 3Q2CA 3S34L 3WN5C 1KJ2H 1FNEB 1JZ2A 4ONOA 3FKUS 3VFMA 1QPXA 1JP5A 1T66D 5DXWA 2HG5B 4TSBH 4FQLH 5FUCE 3MUJA 1OOAA 4TNWF 1MFEL 4ONFL 4Y5XC 3RNQB 4U1MB 2F8XC 3QG6B 5HYEA 4L9LA 1A9EB 3OJMB 1P69B 1AGFA 4FG6C 2VDLH 2Y1VA 3MTRA 4H0GA 4JPWH 4HF5H 3MV9A 4F58L 1AKJB 4NN6B 3UZVB 3LQZA 4ZOAA 4U1KA 1AE6H 4JFXA 3O41A 4M9OA 3RDTD 4ZNEE 1A6PA 4P49A 3MO1B 4AM0A 1B0WA 4PRPA 3HMWL 1EMTH 3MBXH 1KJVB 4X6BA 4FZEH 5A2IH 4XP1L 3QIWC 3QUZD 4O58L 4LLQB 4HC1A 5FO9B 5F6HJ 5HI5D 3BWUC 1JRHI 4MJIE 3ET9F 2UVFA 1YY9D 2APVA 1C8PA 2AJVL 2C5DC 1FGNH 3WMSA 1RU9H 2I07A 4B7LA 4TSCH 2XKNA 4I5BB 4JHZA 3DYOA 2BNUA 3RL2B 1FO0B 1X7QA 4OLXH 3T0AA 1LEKA 2BVYA 5IWLA 4MA7H 4NDMA 1YNKH 5J9PB 3ZT7A 1MFDL 4OKDA 3RVTC 2R39A 1MCCA 2J12B 5GS2D 3MCLH 5IV2B 1MFBH 3VJ6B 4BZYA 4EVNB 2E7HA 1IGTB 3W9DB 3HC0A 4LBEB 5KVDH 4JFDD 3PGDB 5GRWA 4P23A 1RUQL 4HJJL 4DUWA 4WI5A 4GG6F 1QQDB 5BZWB 2H32B 3ES6B 4CVXB 2XNAB 3PF2A 3ULSA 2MQ0A 3AAZA 4L29A 4J3XA 1N2RA 4PJ7A 3KXFB 3MLVH 2H1PL 3V4VH 4NBZB 4J8RA 4JG1H 1IQWL 4WDIA 3BMVA 5LBSH 1A7QL 4HJGA 4NO5A 4JZNB 1IGCL 4IRZH 5ESVA 3AXLB 5CZKA 3BHBB 1Q9KB 1H9VA 4POUB 3WE6B 3DMMC 5EUOB 2QQLH 4G8GB 4J6RH 5E00A 1IEHA 3SDAD 1DFBH 1OGAB 2AXGB 4YC2B 2P24A 1H8OA 1CLYH 5D5MA 2IANA 3TM6A 5HSFA 3OKMB 4P5KB 4YZFE 2AAVA 3HG1B 5KSUA 1EEYB 2GCYB 3VXTA 5IW1B 5SWSE 1H3XA 1CE6A 4Y19D 5JMRA 3SQOH 4ONHA 3W0WB 5INCA 2VABA 3F6LA 3ZT5A 4DFHA 1A21A 1UZ6F 2B2XL 3HE6B 5T1DL 5DVOA 3HC4L 1EUUA 1TVHB 1XR8B 4Y0GA 4EI5D 4U49A 4KJQC 1U3YA 1DVFA 2IPUK 5D72H 4XP4H 4LSDA 4JFEA 1F4YL 4JG0L 2KKQA 4TOYL 3RI5F 1JVKA 3EJJX 2IQ9L 4GKSB 4BM7A 5IJVB 2PO6A 2ZOLA 2P42B 3BPOB 1R24A 4XHJD 3IJHB 1T5WB 1S9VB 3VRJA 1G7QB 3PHOB 4PRNA 1NGWA 5GGSB 4DN4H 2VLKE 2QKIB 2Y06L 5BJTA 5SV4A 3DXAA 4QRRE 1Q8MA 4TUOB 3C5JA 2F8OA 5GS1C 4EN3C 2BSTB 4D0CB 3HRZB 4C4KT 3O3EA 1A1NA 2O5XL 2G75B 3FB8A 2IALA 3DX9A 4KZEL 3P0YL 4F9PA 3TGXA 4OZGE 2OXHA 4ALAH 3O3DA 5JIIA 1MVUA 1QTYT 4PGDA 4Z7VA 4F3FA 1NLBH 3GI9L 3IDIB 1XH3B 3UPRB 1PZUB 3D9AL 5ISZB 3SGKA 1BIIA 2NY3B 3BZ4A 4YPGB 3REWA 1XGYH 4V1DB 5F8RC 4MNQE 4JGUA 3TH2T 1JN6B 5E2JA 4AQ1B 1F00I 1A6VH 2QV2A 5ANME 4F7MA 1ADQL 4ETQB 2C9AA 3OKOB 3QCVL 5CBEA 1N0LA 3E8UL 2EDBA 1SMAA 2PYFA 3H9SA 4JY4A 1ZANL 2ZCHL 3C5ZB 3FO2A 1JWUB 1VSCA 2F5AL 5EUKB 3P4OA 4YHYC 2DQJL 4GSDH 5CD3B 2PO6C 4IHOB 2EYTB 2BHUA 5INDB 3RZCD 3BKML 1I8KA 3I2CH 4HUWA 5C7XH 4JVWA 3VFUA 5J6GA 2NY4B 1I3UA 5FK9B 3QUYA 4X6CE 3ROLB 2CR3A 3SGJC 3AB0B 4RGNC 4PGBA 3E3QC 5ADOH 4F80A 1KCSH 1S7TB 1WFTA 2YUWA 32C2A 1RUAH 2BC4B 1Q38A 1T80A 3BEVB 3ESVF 1Z3GL 1HCVA 3O2VL 3R8BB 3BAEH 4CDGC 5IMMA 3ZKXC 1NKRA 3TIEA 3VMNA 4D3CH 2VAAA 1E6JH 4LCYA 1A14L 3FQTB 4WFGE 4OKVA 2V2TA 3PWNB 1N6VA 4I3RL 5FOJA 1GHFL 3NAAH 3EOBA 3BP7B 5EU5A 4HJ0D 5J1SC 2D31A 1L0QA 1E6OH 2V17L 4RSVA 3NCMA 3X3FL 2D03H 2WANA 4ELMF 2NCMA 3A6BH 1BFSA 4M7ZB 3BZFB 1XIWD 3V4PL 3LQMA 4L3CA 3QPXL 3L6FB 3MLRH 5FA4A 5JUEL 1NFKA 3T2QA 3K4AA 2CXKA 4M6AA 4UV7H 5DT1L 5F97E 3HG1E 3L7EB 5FYKU 3KDMB 4X8JA 1YA5A 2HTLC 5CSZA 3IRPX 1FL6A 2Q7NA 3C8KA 4N90E 3UJIH 4CMHB 2VXVL 4PP1D 5IKCB 2BNRA 1J7VR 1LEGA 2QSVA 2P8LA 5ERWA 5TGBA 4BH8A 4Z6AT 1ZHLA 4ZSOE 1FFOB 1W0VB 1Q9OA 4DKEL 1KCSL 4O00A 3SDXF 4WU5B 5DMGC 3NGBB 2NY4D 3MJ7B 1FYTB 4WFEE 2XN9B 2FATH 3DBXB 4GBXB 4Q7DA 1WICA 4FS0A 2B1HL 4B5EA 4S1SH 4RMTA 3LSOA 3TA3C 3D2UB 3QFJB 3Q6GL 4HKZB 4GJTB 1AD9B 4LHUD 5I1IH 4NP4L 3S7GA 1UKSA 3MCG1 3F58L 1GHFH 4H5SA 1LO5A 1OAKL 5FGCE 1J86A 4G8EB 4E42B 2I60H 4HUNB 4EDWH 1QRNA 1U41A 4J4PC 3VWJD 4E41B 3BPNC 1S7WB 3GIZL 5LAXB 3ZO0A 2EXWC 4C56E 2YC1A 4XB8A 1G9MH 5B3JF 4I4WB 1BLNA 4TPRH 1WCQA 5IW3A 1ZGLM 3DVFA 2R56H 5FA3B 3N1PC 4G3YL 3QDGA 1FIGH 4WUUB 1N6QH 1F4WL 1T2JA 2EKSB 2AS5M 3WIHL 1K6QH 2NQCA 5HYJD 1OQXA 3QDMD 5E8NB 2ICES 1UZ8A 3CC5B 4YJZL 2CKBB 4LLYA 4OD3L 2X9YA 4ZDHB 4LAQL 1T0NB 4KDTC 2EIEA 5DJ6B 5SWQA 3UAJC 1T83C 2CSPA 2YMXL 3LKSB 5D7SL 1CS6A 4JFPB 1KPRB 1PKQE 3GJEB 1HQ4A 2X1OA 3ARED 3VRLE 5JOFB 1BWMA 2APWA 3C87A 3OGCB 3GMOB 5DWUH 4N1CA 2EYRB 4JVUA 4IEFB 4R8WL 1JPSH 5ENWA 1P4BL 4TULH 1I7RB 4R2GD 1FBIH 4I1NB 2ZUYA 3G6JA 1JHKL 2FR4B 5I8KL 3T04D 3WS6C 1CFQA 3O8XC 3L5XL 5IQ7L 4RZCA 5JW4N 4EDXB 3P4LA 2FEEL 1BBDH 3RX5A 4DK3A 5DD5L 4R0LB 3KJ6H 1N7ML 2CKBH 3RU8H 1T7XA 2P5EE 4GW1B 4RCAA 4F9LA 4WFFE 4I9WE 4F37K 1SJEB 4XPHH 5JW5B 1GJIA 3WN5A 3ARDB 1E28B 1XF1A 5LKNA 3OKEA 1RZJC 3KPSB 3W39A 4G3YH 1P9MC 4HHAA 1N6QL 3TBTA 4M62H 4NO2A 4OGAC 4PREB 3STZB 3QRGH 4G80A 4NO0A 5B8CA 5I6XB 3ZKNC 4NUGH 5DS8A 1FNLA 4MD5A 4NDMB 5FYJD 4OQ1A 1CIUA 2P5EA 2R2EA 3BUYA 4XHQA 3SDYL 4G9DB 3VJ6A 4QHKJ 3EYQD 2H41A 1W0WA 1IAKA 1H0DB 2XFXA 5C08B 4X6FB 5J06A 4WFFD 4PY8I 3J8F7 4XP9H 4Q58C 4XPAL 4WW2B 4Z7OF 2I9TB 1I1YA 1HKLH 4PR5A 1EVUA 1CDYA 3GMNA 3V4VL 2JJSC 3GMQB 1DTUA 4JZOB 3OZ9H 5CEXA 1IQWH 4RNRB 3AAZB 3L3KB 1MWAH 3X14A 1B6DA 1OP9A 3RNKA 4OBRA 4Y5XA 1TTFA 3BSZH 3NCJH 1CXKA 2DLEA 4YXHH 3CPLA 3LRSB 2P8MA 1U8OB 2DWDA 4KK5D 2LE9A 4OZ4A 4PJGB 5KSAC 1RZIB 2WAHA 4G8FA 1J9CT 3BHBA 2GUOA 1MREL 3JXAA 2WBWB 4QRTA 4KVCH 3RWDA 1PAMA 3QDJA 4Y89A 1MJJA 4QRRA 4WWKA 4WO4C 1A2YA 4ZNCD 5IROA 5C0JA 1YC8A 1FGVH 1JGVH 3QRFM 4MD4B 3FT3B 3GO1H 1KCVL 5HGBA 3S35X 3VGGA 3EBAA 1CXHA 5IFHL 3WXVL 1NBVL 4YX2H 3TJEL 5HD8C 4MX7B 4XP4L 3QI9A 1KN2L 4NGHH 5I1AB 2CK0H 5FGRA 1B90A 3FRPG 3RWEA 2Q3AA 5DRZA 1A6TA 5IG7A 4GKOA 1J1OL 2DI9A 3QXDB 3E6FA 3ZDXE 4OI9A 4JFFA 5A43C 1H5BB 5DDHB 5IB2A 1WGOA 1QNZH 5FDWB 3S37L 4CMMB 5GISL 4I8DA 1IAOB 1LE9B 5JXED 4O51B 1CK0L 4XWOC 3BN3B 2FLBT 1WWBX 1FFNA 1R24B 4C57C 3C6SA 2O61A 2FO1A 4L1HA 5MEQB 5I8CB 5DVKA 3RTQC 1NMAL 1I1CA 3IU3A 1A3LL 5E7FA 4POZC 4RBPK 4KK9C 2HJFA 2X70B 3C5JB 3VE0A 1P9MA 5ABDE 2XQYG 4H8WH 4GUPB 2LABA 1TITA 4ELMB 3QQ9C 1A1NB 4UDUA 2IALB 3DX9B 3GIVB 1BM3H 3Q1SH 2VLRD 4BSWB 3MLTA 5IOPB 4K8RC 1J87A 4RAUA 2R69L 4KWUA 1JHTA 3W11D 2HT2D 1JUFB 3U0TA 4Z8FL 4FRWA 5AYUH 4X6DE 1IGMH 2VLMD 4EI6A 4PV9B 3M1BB 1QFHA 4ZUVA 2J8UE 3OGOE 2DM7A 1FE8H 2HFFB 5K9JL 3M8OH 2VERN 2XWBB 1JN6A 2F9BT 1QBBA 2FIKA 4FQ2L 1RURL 1DP0A 4KI5E 1FO0H 3VXUB 1CGYA 1W72L 2IAND 5IMKB 1RUKH 3AMLA 3PWJA 4TRPL 3X12A 3QNZA 3SDDD 1I3RB 4WW2F 1DBAH 5ESQB 4PJXE 1N4XH 1GGBL 2J5LC 4N5UA 5KTEH 1N3NA 5F1IB 4MNHB 3BPOC 4ZUWA 1KPVB 3VXMB 5DJYA 4OCRH 1MAML 3UJJL 1V7NL 1QHOA 3HRPA 1NAMA 3MRKA 4XNZC 5F9OL 4N8VG 5DJDB 2H32H 3EDFA 1CD1B 2IGFL 1VFOA 3DX6B 1IARB 3TFKD 2EH7H 3WLWC 1P84K 1CDJA 5HHOE 3BJ91 1W72B 1ZLWK 1DBBH 5TQ2H 4L9LC 3U6RA 1RJYB 2H2SD 4GXVH 3T4YA 4U1LB 2OTPA 1U8MA 3WNOA 4XCYB 3VXNB 5J4MA 3W11C 5HGGS 5DR5H 4MCZB 5DJ2B 1PGRB 3ZKMC 2Z8WC 1RMFL 4YDLC 2V2XA 1VFUA 3RHWK 4O2CA 1BM3L 4UTBH 1A4JB 3S36H 4LIQE 3GRWA 4PJIB 3PNWA 5CKGA 1CD0A 1KUMA 15C8L 3D85D 3O81A 2Z31D 4WTZG 4JANB 5H2BA 2A6JB 1T7ZA 3G5VA 5CGYD 4PJ7B 1UFUA 4HC1H 2OLDA 1BVZA 3TJHD 2MMXA 4KK8D 3ARPA 2DQTL 4ZTOH 4KDVA 2BVQA 3HE7D 3HZMA 5CJ5A 5FM5O 4YHYB 5JO5A 3IT8D 1W72H 3PIQB 1D5BA 3GBML 4Y16D 5D96C 5FHAL 3RWCA 1ULVA 4MJIA 5FYJH 3S96B 4HWUA 3P9LB 4U0RC 5F93C 4G6AC 4DCQA 4RMVA 1XAUA 3V6ZA 5IM7A 4PRDB 1DDHA 5DRNA 1G7PB 5EUOA 5I15L 3RVWC 5ICZB 3D48R 4KC3B 1I7ZB 4KRNA 1F4XL 4PJCA 2XZCH 4J12A 4HW6A 3IDJA 3MSPA 3QWRD 4CADA 4N0UE 4ODXA 4DZ8A 4KUZH 3TVMB 3ULUF 4G7VH 1S9XB 4MA1C 2F54D 3BQUC 3O6KH 4X7SL 3VXRB 3ZKXB 5DJ0A 4AQOA 4XI5D 5J12C 3CFDA 3DLQR 3EFDL 2V2WB 3PDGA 3VD9A 2ICEA 5GRUL 3PWPA 1M7DB 4WO4D 1I8LC 5FGBC 1JI1A 3LZFH 2AJZA 4LPTA 2QTEA 2YA2A 1FFPA 1YN7A 2OL3H 3S36L 3LSOB 3DSFH 4EDWL 5E6YA 3MACL 3UTQB 3ZL4H 1ZT4B 2XOTA 1BJMA 3S4SA 4X80H 4KFZC 2NNAA 5DZNA 1IBGL 1OAXH 4CJ0A 3MYJB 2AVGA 3MRPA 1JE6A 1U3ZA 1UKTA 1LEIA 3V6FA 3SQBA 3B9VA 3Q5TA 5HYQA 3NIGE 4YDKH 3HG1D 4R96A 1BLNB 3V0VA 5SWSA 4F7TB 3VRLF 1U8HB 1TVBB 4O02H 1K5NB 5DFVC 5FOBA 4WUUA 4NNYA 5F3BB 4OI8A 1TQBB 3O3DB 3D39B 3IDGB 1ITCA 5KVFH 3CZFA 4AT6B 5F7UA 1XZ0B 4UOW1 2Q76B 2OL3B 1SY6L 5E8NA 3HUJA 1KCUL 4HFUL 1W8OA 3CC5A 1AKJD 2EDQA 3NZHH 5GGRA 1RJLA 2XG5A 1MWAA 1YEKH 3QUXD 4YHML 3ZKND 3REWB 3LQAC 4PD4K 1ES0B 1T0NA 5GJTH 1FLRH 4LEOA 5C09A 3EZJB 5HHXL 3C6LD 1NMBL 1PLGL 1YZZA 1E27A 5I76A 4JFPA 4PG2A 5LXGH 4N8VA 2AJUL 3I85A 3UTZB 3GSXB 1TZHB 5F9JB 4JKPH 4B41A 2EYRA 4NQTA 5L88H 2CLRB 1T6VN 1FJ1B 3UP1A 1JF5A 4PJ8B 1GCFA 4I0PC 1EFQA 1CFQB 1MHHB 4P4RB 4DJMA 5E08H 1QFWM 4G8IB 2VZSA 1A1OA 5GRYA 4YHOL 2FO4B 1S5HA 1UQSA 4YR6A 4JM4L 4D8PB 3LHPL 4F9LC 2YD6A 2V9RA 4PLNC 2ZUQB 2AW2A 2BJML 3IDNB 4NJAL 4X5WA 1YMHB 5T5FL 1IC1A 2H9GA 4JFYB 4NUGL 4XPGL 3OKEB 3MLSL 1RUAL 2V7HA 1WZKA 4M3JA 3VI4E 4EJ1C 3UAJD 3GMRA 4QKXB 1OAZL 2F15A 4NO2B 1BVLA 5B8CC 2XRAL 3MA7A 1Z0MA 4NZRH 1JYWA 1RZGA 1CL7I 3BFOA 3SKMA 1FVEB 4TSAH 2HRPL 1W2KT 4Y1AD 3QNYA 1J88A 3ARGD 1W0WB 4G43A 3MV7D 3LEVH 4U2YA 4XGZA 4F7CB 4OD1H 1WT5A 4NIKB 5IHLB 4HKXB 2OQJA 3DX7B 4RGOH 1XCQB 2O93L 1CL7H 4BZ1L 1I1RA 2W38A 3O8XB 5CGMA 3D1MC 2FB4H 4J4PD 3VWJC 1ZSDA 4RAHA 3TT1H 2CUMA 1MREH 2QQKH 3K80A 1RPQA 3L7EA 3O4OC 4DTGL 4K9EC 3MRMA 3T1FB 4IDLA 4PJGA 1MY5A 1FGVL 3SKJL 4G8FB 5HYJE 1ZT1A 2BNRB 4Z7VF 2BVTA 1JNNL 2P49B 3SDCC 1IRAY 3OKDB 3RY6A 4H88H 1MJJB 5IROC 3O3AA 5A2KH 4HT1L 3TJEH 5FYJE 4O5LL 2PNDA 3BD4A 3H0TA 5DMGD 4BELD 3CK0L 1UJTA 3K8LA 4OZHA 4WUKL 1NANH 1DEEB 4JPWL 2HT3D 2R2HB 3D2UA 2IPKA 2XXCB 3PGDA 4FQIH 1M6OA 1WWWX 1NMCB 3H7LA 1PFCA 2AABH 4PRHD 4H5SB 3QEQB 2GK0B 2YPLB 4HXAL 3FT4A 4XVSL 4OJFH 5JOEA 2WBKA 4EUPB 5GZNC 1D5MA 3MODL 4JKMA 5DK2B 3BD3A 2NY6C 4GLRI 1KEGL 3R1GL 3NPSC 4QTIH 5FEBA 2ZPKL 5T3ZH 3BN9C 3L95B 2CUIA 1BZQK 3K81A 2V5RA 1ZGLP 4G9FB 4PFEA 5ALCL 1FRGL 3VGDA 2DQCL 4U7KA 3W81A 1XGTA 3VXPA 4H8WL 3ULVL 3OSKA 5I8CA 2UY6A 1UM6L 4X4XB 3EHBC 4X6DB 1OP5K 4YHLL 3L3OA 4XP5H 5EIQA 3QSKB 1I7TA 5D1ZB 1FFRA 1IJ9A 1F4WH 1HH6A 4DTGH 2P24B 3SCMC 4WO4B 2ESVB 2AK1H 3KHOA 4OZIA 3KYAA 2QQQA 3P40A 1IGYA 1X5HA 5AYUL 1U92B 2Z9TA 1LP9A 2P4AB 2RQ8A 1EEYA 4D94A 1FAIH 3VRIA 5KN5A 2X7LA 5EORH 4OCWH 5T33H 2J2ZA 3NN8B 3MOAH 2AERT 4CDHA 1IT9H 4WEBH 2WW8A 5F1NB 1S7SA 4AEHL 3BESR 3QNXA 2OTUB 1BJ1H 4ZUVB 1DVFD 3WIFA 4I77L 4NRYB 4JFED 3PV6B 1KTLA 3QG7L 4QRRD 3G6JB 3WKNA 1JPGB 1MCHA 4TULL 3VXUA 1BIHA 3JWDL 4J6RL 1BZ9B 2HFTA 3SO3B 4L8DA 3WLBB 4QXTB 1LDPH 5L8JB 3LKNA 3NH7H 2PO6D 1F3DH 3VA6A 4PJCF 1MI5B 1OY3B 3EO9H 2ZSWB 2HTKD 1N0XH 5EU3A 1DBBL 1FPTH 1XIWA 3MROA 2LAGB 1TJHH 2F74B 4X7DC 1NAMB 4EXPX 1MCWM 5DJDA 1BOGA 4ISVB 3EO1A 1I9JH 4V1DE 1CD8A 4HLZH 5D71L 4LVNC 5K93A 1A4KB 1MCWW 2VC2L 3QIUD 1F6AA 2PETA 4HLJA 3MNWB 2EDHA 3JTSB 5JZ7C 4Q2ZB 3KPOA 4F15B 4Z7VB 3O6FD 4ZXBD 4H1LG 1XH3A 1N8ZB 1D9KC 5K9KA 1J0ZA 3I6LE 4JRYA 5KS9B 3GSUB 1LO3H 1GAFL 3BKYH 4OCWL 4OLUL 4ONGL 4V1DA 4A6YL 3RQ3A 1A7OL 4DW2L 4OTXH 3ZE2F 2X1WL 1PG7H 1W8NA 1T3FA 1MCDA 1Q0XH 4UNVA 4Y5XB 4U1KB 1RZJL 5D7IF 4N5EC 5D2NB 3O6ML 2AEPH 2YD5A 5IESH 5C0FB 3UTOA 5GGUB 1OB1B 5E5MB 2RFXA 5I66B 3LRSA 5DSCA 2BNRE 1F4XH 3DRQB 1MJUH 2JLLA 4XMLH 4MB3A 2DYPD 4YGVA 1MLCA 1N5YH 2RB8A 3V6ZB 4RBPH 5JTWA 1RIUH 4UB0L 3FRUB 1QYGH 3LVEA 5HDOA 4U6VH 3GHEL 4JO1H 1OCWL 4Y4FA 4PGBB 3OHXA 4S0TD 4JR9L 4L4TE 1V3JA 2IC2A 4XRCA 4WU7A 5EB9A 4JFOA 1YECH 5B38B 2HT4C 1CDHA 4MD4A 1ACZA 2X9XA 2V9TA 1I9JL 1X5KA 3KGRA 4MA7L 4AIOA 1IGTA 5F7HA 3HC0B 4LBEA 2XZAH 3U4BH 2D0FA 4DVRL 3OPZH 1UA6L 1EJ6A 2BMKA 3IDMB 1G1CA 4U1GC 2WBJC 2IFFH 1B6UA 2AJSL 6CGTA 5KVEL 3UX9B 1U8QA 1QQDA 4RWYL 4HUXA 1RAMA 4WFHD 1N2RB 4X9IA 5FCUL 3JBG7 1VGKB 1Z9MA 2A6KA 2NY5L 1MCOL 4JKLA 1F3DJ 2IPTH 3LB6D 1U93A 2VAJA 1REIA 2V7NA 3QZWA 4M43L 5CINL 3QUZA 3PXJA 4NO5B 3NVQA 2HLFD 3MYJA 1MAJA 4RRPG 4RISL 4U0RB 5EOTB 4QHNB 5DA0B 3ZE1F 1KSRA 1CGWA 2KQMA 5EU6A 1R5WB 3IJYB 3D69A 5ANMA 3LS5H 4DGVL 5CILL 3SE8H 4U2ZA 2HVJB 4UDUB 4L3EE 2CK2A 5C08E 5AWNL 4ZXBC 1A8JH 1JTPA 2CKNA 3HZKA 1UEYA 3QO0B 3D39A 3BQUB 3O45B 1HEZB 4CRPA 4RAUB 1QVOA 4DUVA 3KPRB 3MRHA 5TDPA 1RJLB 1L4IA 1NCCH 3C6LB 5E9DB 4XPTL 3OKNB 3KPTA 4CVZB 2BVUA 1KNOA 1IKNC 1TVHA 3CNKA 1WV7T 4GRWH 4DN3H 1J8HD 1MJ8L 3C09B 3CDGB 3BE1L 1JPTH 3HE6C 2HTKC 5F89B 5M95B 1C5BL 1K85A 4YGAB 5DQJA 2XG4A 2PW2B 3K2MC 4Y1AE 4YDIL 1OWRM 1IFHH 4GKSA 3A67L 2CRZA 4RIRB 2YKLH 1WF5A 2FBJL 3JWNC 3QDME 3DSNA 5E5UB 1T5WA 2DQEH 4GKNA 2NZ9C 2Y7QA 5EO0A 4PRNB 5GGSA 4D9LH 4U1IB 3T0XA 1U95A 1EERB 2NZ9D 4I4WA 5K59E 2AGJH 1U8NA 2WK2A 5DJCB 3D3VB 5D1QD 1NCUA 4WHTA 5FA3A 1ZT7B 1W72A 1T89C 4I3SH 5BZDB 1LDSA 5CHNA 4NC0B 1MVUB 5BV7C 5HYJA 2P8PB 3P0YH 3D18B 1A6UH 1DN0B 4YFLF 2X42A 3EO0A 3BOVA 1RIHL 2V2XB 4NWUH 1Z6JT 3W2DL 4Z95H 3LEVL 5B39G 3LH2H 5DJ6A 3PXHA 5EA0L 2R4SL 1CU4L 3EHBD 2D7OA 4ORGA 4JANA 5H2BB 3DIFB 1X5XA 5JOFA 3IFNH 4XGZB 3H3BC 3T77B 4F7CA 2CO6B 2MKLC 1DQQA 3BDYL 3M45A 4Q9BA 1T21B 1KJ3H 5ENWB 3GKWH 3QQ4A 4XXCC 2NX5D 5GGTH 2NTFA 1QACA 3LY6A 5BS0E 4GFTB 4L9DA 3C5ZC 2BOCA 5I1CH 3O8XA 4RZCB 1R3JA 2AQ1A 1BP3B 4ZFOA 2K3TA 1DQDH 4GW1A 5E24E 1I9RH 3WD5H 3BIAX 1NBZB 2HT3C 5IEKB 3TVMA 3LB6C 2EKJA 3BEVA 3MR9B 3WBDA 1SEQH 3K8MA 2BFVH 2NX5E 4I18A 5BVPH 3JV6A 5DJ0B 3PABB 4KH2A 2AP2A 4LCYB 3QEUB 2CJUH 1AD0A 3OR6A 5B8CB 4JLRA 2V2TB 1FNHA 1FNGB 4XCCL 2WBJD 5BOPA 5L7XL 4MWFB 3IKKA 1A7PL 1GZPB 1MCKA 2WUCH 1C7SA 3W2DH 3UO1H 1NANI 5K9OB 5IMLA 1KBGH 2IPKB 5J1TC 3SPVA 4M03A 1UACH 3GZKA 2E27H 4PJ7F 4AG4L 2DI7A 3STLB 1I1YB 5CJQH 3QEQA 3ELAT 4JDTL 1MOEA 3KPNB 4ZS7L 1I1AA 3DROA 3FHQA 4EI5B 2GJ6A 3X14B 4Z7NF 1NLDH 5I1LA 1KIQA 5E8EA 4I0PD 1RZ8A 3THMH 5FUOH 2QJDA 4YHLH 5C8JA 4MNGA 3GMPA 1BEYH 3CFCL 3I6GB 3O4OB 3G04B 4DQOH 1K5NA 4PGEA 3B9AA 4OD2B 3MV7A 3CXDH 3OXRA 3ZTJH 1R3HB 4HZAA 2OTWA 1FORH 4PJGF 3FO1B 3G5YB 1AE6L 5F7DB 4APQD 4MXQD 1JWMB 4U33A 3G5XA 1CGVA 4N0YL 8FABB 2B4CH 1YEDA 4MB4A 1CLOL 2HWZL 5T1LD 4GAGL 2HVKA 3K0WA 2WUBL 2GAZB 3N85H 3MUZ1 2J8OA 1E27B 3MRLB 5I76B 5ADPL 2DTMH 2GTWB 3MV7E 5GSVA 4N8VB 1AGBA 1AD9A 4PJ9D 1O0VA 1TZHA 1S7SB 5JZ7D 1ZXQA 2BVPA 1A0QL 1IC4L 2JCCF 5E2TH 1FVDA 5IG7B 1AC6A 4NRYA 4A2LA 2QR0B 5EN2B 3Q6FA 4LDEB 4JFFB 4FZEL 4XVUD 3X11B 1MQKH 4DEPB 3ARFD 5CJQL 3SY0A 4ELME 1UWGH 1WT5C 3VG9B 3DVGB 2VB5A 2G60L 5CWSA 2DJ4A 2CDGB 4GQ9H 3IDNA 4XMPH 4HUUA 3U9UA 2OJZH 3RX8A 4PRHA 4HV8A 3U7WL 2HJFB 1L7TL 1B0GB 4MQXC 4WI4A 1K6QL 4WHYG 4LLYB 1S7QA 4KKCD 4ELMA 2YWZA 4QEGA 3BIKB 3D3VE 5IT2H 1YPZE 3LN5A 4W81A 3K1DA 3LKSA 3RVXC 3SDXE 1D7FA 5CUSL 2VDKH 5I74B 1PG7L 1N8ZA 1JUFA 4ZOCA 5E6ZA 3SHSA 3STBA 5HI3C 3U0TB 5T3ZD 5FO8A 3O2DH 3HB3C 5KS9A 1CDGA 4PGCB 1UWXH 3IFLL 3VH8B 5ITFA 1Q94A 3AUVA 5MENA 2QSTA 4PRHE 4AIXA 5T5NF 3N85L 4D0DB 3B2UC 3TV3H 4ZTPL 2HFFA 3HNSH 1HZHL 2XWBA 1RZJH 1NUGA 5D7LD 4N9GB 1IGCH 3O6MH 1PY4A 1T3FB 1AGCB 4PLJD 1I1FA 2D4FA 2JTDA 4FMFA 4Y4HD 4ZFZA 4C58B 4Y16C 3BGFB 3SDXA 5I8OH 1R5IA 5DJ8A 3HE7C 5C0FA 4JFZH 1MVFA 3D25B 3UTSA 4HWEH 2OMNA 3TN0B 1NGZA 5IF0A 1DSFL 4R0LC 3G6DH 1VPOL 4YGVB 1JGUH 1PG7W 4ZS6C 3MBED 1UH4A 1CD1A 3KPSA 3RY6C 5GZND 3W39B 5C1MB 4OLWL 1F58H 1OPGL 4LVNB 2CDEB 2JB5H 1A9BA 5D1XA 4XRCB 3O4LA 2W0FB 4LSPL 4JFOB 3WHXB 2B7DT 2IG2H 4PJBF 2UV3A 4S1QH 5DS8B 5KBNC 4HQQH 5SWSD 3D39E 4MQSB 3VXNA 4LKCA 3CH8A 3O2WL 4JAMA 5IHUL 3HAEA 3BGMA 5DQDL 2RBLA 1FH5L 2R2HA 3BUTA 3F7YA 3MQIA 2BMKB 4RMRA 3P77A 2OZ4L 4I0CC 3MRDA 3PNWB 2O5ZH 1A3RH 3MPCA 1U91A 4G7YH 4N8CL 3S8WA 3C9NB 2R1YA 3G5VB 3SDCD 5JQ6H 4W68A 4HPOH 1VGKA 5DK2A 3EKCA 5TE4H 1B0RB 4OGZA 1CT8B 1U93B 2NR6C 3TJHC 4XP6L 3AU1A 4AH2A 2D9CA 1U8JA 4Z78B 1U8OA 1MELA 3CLEL 2X1PA 4DKDC 1R3IH 2UWEE 3QHFL 4X4XA 4QHNA 1NLBL 3H9YA 3I3BA 4NNXA 1RIVL 5IBTH 3P9MB 4V1DD 1JGEA 3UBXB 3IJYA 4RMQA 4TNVK 3MNZB 3FQWB 1JWSB 2X4RB 1XCTA 4JY6B 2LTQC 2F54A 2AK1L 2XZQH 1AH1A 1PDKA 3N9GH 1VB9A 3BQUA 4MVBD 1NGQH 2IBBA 4HK3N 4PB0H 1EIBA 1DCLA 1P1ZA 3QHZH 3WLWD 4TVPH 4F7PB 1UH2A 5F1NA 5DYOB 2WBJB 1KN2H 4PJAA 2YSSA 4H1LB 4PD4J 3QH3A 3CGTA 3CVHA 5E2VL 4LFHD 1KTLB 4H8WC 1UENA 2CGRH 1J1OH 5T1KA 4IRJA 3DOSA 3UCRA 2NR6D 2XKSA 4NFCA 5GSRB 1S7XA 5I0DA 1QLFA 2HKHL 1SY6A 5EOQH 3QIBD 3V0WH 2UVEA 1FG2A 4LQ1A 2GQHA 2A6IB 2ZSWA 2DDQH 1CK0H 1HHIB 4Q9CA 3MRIB 2MPAH 5HYQB 4UQ3B 1YYLH 3RWHA 2ADIA 2X4PA 4ZUTB 3S9DB 2L7JA 3VE0B 4F57H 3FN3A 1PX4A 4RMSA 1UADC 1U8HA 3WL9A 1IEBB 4KMQA 2HT2C 5HY9A 5BZDA 1QR1B 3INUL 2NW2A 4K8RD 1TZGH 3EYSH 1T22A 3KPOB 1W0YT 1YEIL 2GHWB 3QFJD 4ERSL 1DLHB 1IGIH 3LPGA 1NFDE 2FX9L 2KZ1B 5BXFB 4PV9A 3C6LC 1J1PL 1PYWB 3QAZB 1AR1C 1ZHKA 3LOWA 2VXUL 2YPLE 3MV8B 2Q86B 3RTQD 3FAXA 3MLPA 4JN2A 3QHZL 1WVZA 2B1AH 2EEAA 1JMZA 3ORJA 4S1RL 5KSAD 3FOLB 3VCLB 4KK5C 4Z0BH 4P9ML 2A9ML 4YIQB 5L0QC 1KENL 5IVZA 1T21A 1T7WA 4WVRA 1QRNE 2DAVA 3QQ4B 4WNQA 4PJAF 2NY0C 5D9SB 2UZIH 1KPVA 3LRHA 5ALBH 1LO2L 4AIZA 4Z9KB 5IQ9A 5C0IB 1IM3A 4NC1E 1DBML 2VWEE 5T1MA 4W6WB 5I1IL 3QXAA 4C56D 4CU6A 3ULUH 1VDGA 2ITCA 3O9WA 4M6MH 5D7JB 1AXSB 1BZ7B 2BFVL 2NY0D 1NCWH 4X4ZA 2WMPA 3P73A 4U6VL 3BP5B 5HD8D 2MPAL 3T4YB 3NBNA 3RX7A 1JZ7A 2VR4A 1UJ3A 1DQLH 3FRPA 1Z9LA 2CRMA 4LCWB 1QHPA 1GVIA 1ORQA 1JNLH 1S9YA 5EZIH 4HWBA 1MH5A 2BZDA 1J8HB 4MQXD 3QEUA 5EBMA 3WSQH 4GAYB 4JKPL 5BO1H 1YNLH 3C2AH 5DMIH 4AMKL 3V5KA 3RIAF 2PYEB 1U8QB 5T3XL 4UAOB 2OXGA 5EO9B 2AJSH 2R29H 3IDYC 5D6CB 3KPRD 2PW1A 3GSQA 5KZCB 2A6KB 4Y88A 4KAQH 2W1NA 3MA9L 1EAPA 4XAKE 4QNPF 1D5BB 1RQ5A 3IJSA 4HUKB 5J1AA 3Q3GB 4TVPD 4XPFL 1HOCA 1GIGH 5E8PB 1J18A 4KRLB 5JOPE 2XY2A 1NPUA 4ZFFB 3VXUD 1R5WA 5C6WH 4QHUA 5FUCC 3O3BA 4L4JA 5DA4A 1QR4A 4P5TB 4ODXB 1Y6NR 4DZ8B 2ATKB 2BY2A 4KHXH 3C8DA 2JK5B 5JXAL 3MV7B 2XZCL 5FF6B 4KK8C 1EHXA 4PV8A 3F7QA 5D7LB 4U7SA 2CLVA 4GMSL 5EBLB 5SWZD 1HEZA 1IZJA 5CGYC 1JWMA 1AR1D 4NC1C 4MXQC 3G5XB 1HHKA 5E9DA 1FLTX 4X98A 5JR1L 5KZCD 5KSBB 1CGXA 2HVKB 2VKXA 1NCBH 4P2QE 3CSYB 3GMMA 1OAYL 4MVBC 3RBSA 3BT2L 3CDCA 4K7FB 5D7KE 3C60B 5T3ZE 2UYLB 1CQYA 3TN0D 3ZHKA 3HHRB 2R29L 2Z92B 3VXME 2P45B 4CU8A 3DV6A 3WHE1 3DHMA 4IDJL 5FKPA 2DQHH 5HVGB 1E4XI 3TFKC 4M5ZL 2Z8RA 4XPHL 5DVLA 3BDBA 3MX0A 1MF2L 2IAMA 1QFPA 3QUMA 3SGKC 4HG4J 1MCNA 3QXUA 1ZHBB 5HHVL 5DD1H 4PJBA 2YPKB 3CU7A 5DJCA 1A7RH 2E3VA 4Y1AB 2ATPB 2BCKB 3LPWA 4NO3B 3RWJA 4O02L 4YDVB 3TO2B 2ZNWA 3U30B 5HVWA 3N1GC 2MCG1 1XZ0A 4LARH 2NPLX 4I3GA 3WFHB 5JPNB 4OZGF 3WNMA 1IAMA 2Q3ZA 4WO4A 3SOBL 2EO1A 3CJJA 4R7DB 1VFMA 1KCUH 3TO4B 5DURB 1U92A 3PJSB 5TFSL 1XF4A 1KFAH 1UYWL 2DN7A 1HI6A 2C3XA 2JELH 3LAFA 4FZ8L 5KN5B 1AY1H 4PRID 3O2DA 3IU4H 4LVOB 4NN5B 3NN8A 4FXGB 1TMCB 5HHXH 3DUUB 3GSXA 3HI5H 2FZ3B 2H26B 4NHCL 3VFMB 1EEUA 5LGKA 5E03A 5HGDB 3CMGA 1YNKL 3GSRA 3MJ9L 1MFDH 3QQ9D 4TUKH 3CXHJ 3QULB 2VXSL 4QCIB 3WIFB 1HKFA 1GXEA 4HIXH 4G6JH 3U1SH 1U6AH 1A9EA 4FNLH 3TP4A 3HS0B 5IFHH 1I1FB 1OLLA 4OCNC 2VUYA 4JFXB 1VACA 3MFFB 2GY7B 4K07A 3WNPA 4NM4H 1K3IA 4LF3A 2JJVA 4HJ0C 3CIQA 3TC9A 4OSUL 2A2QT 2YK1L 2VKWA 3MROB 4JPIB 3WXVH 3T8XB 3ULVD 1A7RL 1BD2A 1M05A 2CDEA 4XPGH 1G1YA 1NJ9A 3CVIL 4MNQB 3GSWA 1J0IA 5GQBA 5EU6D 1RUML 1WSST 4M02A 3LRGA 3VI3F 3ARFA 4FFYL 5EIIA 3MV01 3O6FA 4G6FD 4PP1C 5BMFL 5DJZB 2YUVA 3P11L 2FJFA 4X4MA 4K9EH 3W9DA 3QNYB 4P5MB 1IKFH 2VIRB 1RVFL 2VRAA 5DHYB 3BPCA 5F1SA 2JCCA 3IU4L 3STLA 1ZKAA 4KKCC 1XCQA 4XZUA 2GY5A 1E4JA 2X89D 5F96L 4LFHG 3MGTB 3IFPB 3SJVA 1LO0H 3I02B 4ZS7H 4ESKA 4PS4H 1KIQB 5E8EB 1CL7L 1RZ8B 4BZ1H 4YK4C 5EC2A 2XTJD 4HULB 5E5MA 5K9JH 1K8DB 3GHBH 4PJDE 3E0GA 1EH9A 1QSFE 2QQKL 3HE6D 2E9IA 2WINA 4Y4HC 3AFLA 1MLCB 2PTUA 3BRFA 3QCUL 5I19L 3W5MA 2IQAB 5DD6B 5E00B 4K23L 3QWOA 2YD1A 2XICA 3MRGB 2DWEA 4JRXB 5FYLH 4JQXC 5HHOD 5CZVL 1MHPH 4PJEB 3MRJB 4GAJL 4LLMB 5HI3D 2F54B 1U8PA 5D1QA 3MMEA 4PRPE 4PJDA 1DL7L 4QRQA 1UB6B 2XZZA 1RUKL 5E2VH 3QDMB 4JZJC 4DVBA 5TE7H 1OHQA 2Z35B 5H37H 4GG6A 3GSOA 3P11H 4CU7A 2O5YL 3DO3A 3H3PH 4HD9A 5JA8B 2W59A 1EJOH 1T1WB 3H8NA 1AHWA 1U0QA 5GGTA 1YEGL 2HLFC 4JO4L 3IGAA 3I50H 3X11A 3F58H 5DRXB 1X5JA 5LVEA 4IRJB 4RMWA 3VFPB 1EX0A 1QSEE 5CLWA 4XHJC 5GSRA 1NAKL 1YUHB 4EZMA 3P0VL 5ICXB 3U9PL 5DC0A 4KGJA 2YHGA 4RA0C 3NPSB 4XVUC 3VXQB 1S9KC 3L3OB 4LDOB 1DLFH 1KF9B 2AV1B 4OFDA 1I7TB 5I18H 4XPBL 3RWHB 4GQ9L 5F6HI 3O8XD 1KTDA 4KJQD 2FGWH 3H6JA 4Z7OE 1IGIL 2HVJA 5D72L 1T7YA 1T5XB 4V2CB 5JDSB 4RGMC 4K23H 2X7LB 4BK5A 1KJ2A 1KV3A 3MLYH 4F3FB 5F44A 1YNTA 2GK2A 2HT4D 4MJ6A 1VKXA 4NPYA 5BS0B 3MRHB 5TDPB 2W92A 3VG0H 1L0XA 5SX4H 1BIIB 4YPGA 2IPTL 4PTUB 2JIXD 3SGJA 5D7SH 3SBWC 2VSCA 4NQCD 2RR3A 3SDAC 5BRZD 4BA8A 1JCKA 4ZTPH 5F89A 5FAAA 1AGCA 5DJAB 3RIAK 5ALBL 1J05B 4M1GL 4BYHA 1T1XA 4KI1A 1KB9K 4N5ED 3SDXB 4QXTA 3SDDB 1T7VA 3LKNB 5IB3B 1R5IB 3IRZA 3L5XH 5IQ7H 5IFJB 1T0MB 1AI1H 3EJZD 5D9SA 4BH7A 2DD8H 4OFPA 1KB5H 1NGZB 5IF0B 2R8SL 5IQ9B 1I1AD 3DSFL 1KXTB 3CUPB 2YRPA 3FO0L 4N68A 3C5ZD 4NHUB 4DZBB 2JJSA 3P73B 1KLFA 3BEWA 1ONQA 2HA1A 1WJ3A 3DVNB 4RX4A 1T89A 4PJ5E 2JB5L 4XPBH 4ELKA 4EQ3A 1NEZA 3JTSA 2A6DB 3EYVA 3MLRL 3N0PB 3DNKA 5CBAB 3EO0B 2ZCHH 1ZWIA 2OL3L 3TA3D 3JV0A 3TIEB 2I5YL 3VH8G 2CIIA 4YDIH 3VFVA 3T0EA 3IXAA 4APQA 1K4CA 1Q9LA 4L8SB 5MI0C 5DEFB 4Z77A 3I2CL 3NIDE 1QRKA 2ZUSA 3TF7C 4YUEH 2AI0H 1CZ8L 2NY2B 2PF6A 3MRQA 4MAYB 3NIFF 4IRSB 5D1QC 1U3JA 3MC0A 3PGCA 5C0NC 2BOCB 4K3DH 1IILE 1INDL 5E4EB 5FA4B 3QIUA 1DVFC 2VISA 3U48A 2ZKHL 4NNXB 2OMBA 1YPZB 3BISA 4JQVC 4CVUA 3HCVA 4PY7A 1JWSA 3OKYA 5LGHH 5CSZB 1NKOA 1S9WA 2Y5TA 1TDQA 1A02N 5FF6A 1CU4H 4QY8A 1G7JB 2P1YA 3P30L 1FHGA 2KUTA 1FZJA 1ZAGA 2AJUH 5D2LF 2XZQL 5FUZH 4NN7B 1TQCC 4CGTA 4Y2DD 5C9JB 4UILH 5EZJA 3P4NA 3FQNA 4FQQB 2R23A 5GRVL 1SJXA 3PWVB 2WBJA 4U3HA 2EDOA 4FQ1H 4PJAB 2PXYD 1PZ5B 4MAUL 4XBGB 5E56A 2P5WD 2CK0L 3CSYA 1MUJB 4PRBB 3BVNA 3IDYB 1ZLSL 1Q1JL 3TBWA 4I13B 1DQML 2FRGP 3FFCD 1DUZA 2UYLA 2EYSB 1S7XB 4YPJA 1G6RA 3S37H 4DWHA 4KXZI 5C0BE 2BJMH 1VERA 4FG6D 4JY5L 5DGQA 3VFSB 5J6HA 5EOTA 5T5FH 1VADB 1EUTA 5C0ND 5C2BL 1ZHBA 4PG9B 3RZCC 5F9AC 3GMPB 3LIZH 4X4YB 1OAZH 5HDLA 2UWEF 4HIEA 3G04A 1F02I 3PP4L 2BCKA 4F9PC 5D2LA 4NSKA 1A3LH 4I2XE 5CILH 5GS3A 1H3GA 4WTWA 1F3RB 1RUPH 3VW3L 1T22B 2YR3A 1QD0A 3QJFA 5F7DA 3AROA 3KR3H 4K3GA 2P43B 2MNUA 3MBEA 3FONA 3FN9A 2AEQH 3KPSD 4BFBD 5BVJA 4CVZA 2VOTA 3AMKA 2ENSA 2GAZA 4WY7H 5DVMA 4G6ML 4LCCB 5C0GA 5GSVB 1JTTA 1WFOA 2HH0H 1NGXB 1T1YA 4G8GD 4Z7VE 3KJ4C 4JFDE 4TQEH 4ZSOA 1Y18B 3VCLA 4FMKA 1BBJB 3VFTB 3C09C 3JUZA 1OSZB 4XC1L 4Z5RA 5F3HB 4LGSB 5SWZA 1OD9A 3SDYH 1SMOA 4M7JH 3IYLW 2FR4A 1QSEB 3S4SG 3SKOB 1EAJA 4KTDL 5JOPD 1GGBH 3EJZC 3T65B 1WTLA 3EYUH 5HGAA 3T0WA 2E9BA 1LHZA 5TE6H 5AZ2H 3QIWA 4M6NL 1NAML 3HPLB 3MRRA 3U7AA 2NY7H 1X5FA 2J8UB 2WUBH 2COQA 5SWZE 3H9HA 3ARDA 3U9UB 3KPMA 4PRHB 3LN9A 4Z76A 4Q74A 4P2OA 4M93C 4KQ4L 5C0DB 4HXBL 1DQLL 1R3KB 2OI9B 1LP9E 1J8HA 2NTSP 4GQPH 5IW6B 2XWJA 3PDDA 1S8DA 2FH6A 1BFOA 1LE5B 4KVCL 3H9SD 2R1WA 2R4SH 5B39B 1HH9A 3MCKA 1FNEA 2XKUA 3KJ6L 3F5WB 2VDQH 4OV5B 4JDZA 2HAZA 3U36B 4R3SB 1SYSB 5D93B 2X4NA 4XZUB 5HVHC 5I1GH 3QISA 4PJIF 3SJVB 4D2NA 5JW3L 3I02A 1GGUA 5JLZB 1Q9WB 5FHBL 4GOSA 1XGUB 1R6VA 3CFEA 3EYFA 5DHVH 2DOCA 3QCUH 4OLEA 4PRIA 1S5IL 5I19H 3KWWB 3UTSD 4BQ8A 4L3EB 4JHBA 2Y5EA 3HMXA 1FSKC 2W9LA 2UZYB 2P8MB 3MO1A 4HF5L 4AM0B 5D70H 5EOCJ 1FZKA 2OZ4A 2DQGL 3S6CA 5HHMB 3G6JE 1GGIH 5EBLA 2IQAA 5DD6A 2BXZA 2ERJC 3JV6B 3QUXC 4IJ3C 5CLTA 3MRGA 5TDOA 3IFLH 2D7NA 4RFOH 5C0JB 2L4OA 5D1XB 3OZ9L 5BVPL 3HR5B 2Q8AL 3BH8B 3D5OF 4DKFL 4WHCA 4AEIL 3BXNB 1NDMB 1FGNL 1CTNA 2AKRA 3GMMB 1B4JH 2Q20A 3BSZL 1G7LB 2C3VA 5AYQA 5D71H 1ZK9A 2GSGA 2IBGA 3P0GB 1MCPL 5E8DL 3R8QA 1D5XA 1V8HA 3P77B 3QIUC 4P23B 1OAQH 4JQVA 2H32A 3ES6A 4LP5A 4TTDC 4CVXA 3FOMA 1OW0C 1EFXB 4P99A 4ZAKB 1BD2D 1AHWB 4L4VD 3ZYIA 3U7YH 4XMKH 1CT8A 1YUHA 3MGOA 5I2IB 4ONGH 4ZNEA 5C0RL 4P9HH 2VC2H 3I6GA 3VGAC 2VLME 1OP5H 3NIGF 1TJIH 3AXLA 1FNSL 3BN9D 3LKRB 3M17A 5E70A 5B4MC 3WE6A 1JYNA 3IU3B 3UBXA 3TT3L 3UJTH 1RUQH 1KTDB 3IDXH 5KTEL 3TZVC 1XR9A 3HLAA 4C56A 2VXVH 3UROR 1QBLL 3MOBL 3T4AA 4P2QA 4DW2H 1NCAH 3BQUD 3VXRE 3MLTB 3NZHL 4MNGE 1JL8A 1CLOH 1U8IB 4XC3H 4NKMA 2QSCH 3K46A 4LOUD 4MD0B 4NQXB 1TNNA 5TDNA 3RHWF 2C1OB 2ORBH 5FB8B 5IGXH 3HE6A 3RVWD 5GJSH 2BVPB 5DUPH 1TIUA 4JVPA 3SCMD 3GSRB 5DMKA 2Z93B 2F19H 2QR0A 5EN2A 2IF7A 3RUGE 3VDCA 1ADQA 3PDOB 1MIEL 4HUMB 1M1SA 1AQDB 1CLYL 1RMFH 5CD5C 3L3HA 2PYED 3ARQA 3IETB 3SY0B 1AO7E 1QLFB 3QIBA 3F62A 4PJ8D 1F4HA 1IQDA 1FG2B 3CX5J 5HDQH 1UWGL 3KYOB 5E08L 4M1DL 5DJYB 1G7QA 5D7LE 4S1DC 2YD8A 4L8BA 4Z0XA 4FFVD 2Y36H 3CUPA 5A1AA 2LQRA 4UQ3A 3MFGB 5HHNB 1GGTA 4XXDB 4Y4FC 5GGVY 1WC7B 4FABL 4P46B 1OTSD 4ZUUA 4OZGB 3QJHB 3FTGA 3GSWB 3M8OL 1IC7L 1ONQB 3TIDA 5SV3A 2E7MA 5CKAA 3LKOB 4G42B 2J6EH 3SGDH 2DLHA 1P2CA 3MUY1 4PGDB 4ODBD 3IDXL 4MGXA 3ARGC 1X6LA 1ZWIB 5GXBB 3QEGH 5ITFB 3V4UL 4OB5H 2Y07H 1VCAA 4APQB 4WWKC 4HMCA 4WW1B 4KKAD 1OF2B 5CIPB 4ETYA 1KTRL 1N5AA 2G2RB 2LU7A 5C07A 2Y06H 4K71C 1E4WL 2E5EA 2LVEA 3CLFL 2Q6WA 2I25N 5ISZE 5GJSL 4HUVB 2WP3T 4HLZG 1KIUA 2CRYA 2APTA 3FO2B 1INDH 2J6EA 4BQBA 1T2QH 3DGCR 3SDDC 2VLJB 2X4SA 4ZUSA 4JN1H 4I0KA 4IHOA 4Y16B 3ARWA 3TN0A 4OFIA 5AZEH 4N9OB 1SHMA 1JFQL 5HDBE 3BP4A 5TPWL 3MJ8A 1JGDA 1EHAA 3WDIA 3RKPA 4JQIL 4RFNB 4WV1B 5C07E 1G7PA 1C7TA 5C0AD 3TN0C 1EZVX 5HDQL 2Q7YA 1IM9A 3VDBA 4PJCB 3O4LB 4I18C 4IS6A 2FX7L 2V5SA 3MRJA 5H37G 1KLGA 4HS6B 4MJ4A 1AGDA 4LCWA 4JAMB 4HIJB 5FYJU 1FZJB 4LEXL 2PTTB 1UB6A 4MAUH 4PYGA 2Q87A 1BQLL 2BSED 4F2MA 4N0FB 4UT7L 5C9JA 5E8OA 4GAYA 2VXTH 4KK9D 3UPAA 4R97B 4GBXD 3NFNB 1FH5H 5MI0B 3GSOB 4PB9L 4Y4HA 5FHAH 1MHEB 4U1NA 3L5JA 3KPSE 4ZODA 5KVMC 5DMJB 2H6PA 1MUJA 4Y19A 5I9QB 4ZFOL 2FD6H 1A14H 5F7LB 3BP7A 5DRXA 1CVSC 5JXEC 5DUMH 1B0RA 2B39A 4EIGB 3NABH 5IUSA 4AH2B 1UCTA 2OBGA 5J1AB 1TCMA 2NXYD 4W4NA 4LLDB 5J6HB 1G0DA 4HIIA 3O4LD 3JV4B 2D03L 1JGEB 5EZIL 1U3HC 1YN6B 3O6LL 1KCKA 3VFOA 4MDJB 3LKQB 1RIVH 3VXSD 5GGTL 4X8JB 1J5OH 1TVBA 4HIEB 1JJUA 2X4RA 4XNMB 2JK5A 4NSKB 2QADD 1TETH 1H8NA 5TGBB 1ZHLB 3B5TA 1YNTB 3OAUH 4K94C 4XCFH 1W0VA 2J1KA 1F5WA 2O26U 1FYTD 2LTQB 4L8CB 1RJZA 3CH1B 2ZCKH 3LHPH 4PTUA 3ARRA 1BREA 5DK0A 4C59B 1ORSA 2HLAA 5LCVH 3EDKA 3G6AB 3R06B 4M7LL 2VXTL 4PRAA 1IMHC 4XPFH