2HX8A

Crystal structure of cu(i) azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "csphqgagm", at ph5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCSPHQGAGMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Copper Sites in Proteins: Loops Confer Native Structures and Properties to Chimeric Cupredoxins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hx8A00
1IKOP 2FJSA 2HRGA 2HZHA 1PY0A 2RACA 2XLLA 1SFDA 1AACA 1EHKB 1A3ZA 1GW0A 4E9XA 3S3CB 4BXSV 3FPXA 1PAZA 4M4RB 3TASA 3U25A 2YAHA 2VMJA 1E67A 2HRHA 1CUOA 3FSZA 1RZPA 1PZCA 2CALA 2GBAA 2EINB 3NJGA 2PPAA 1JXDA 5B1BB 2GSMB 2NRDA 4HCIA 1A8ZA 2W8CA 4WTQA 3NJHA 1JZFA 1JERA 1PNCA 4DP9X 1GY1A 3PAUA 2FTAA 3ZDWA 3FSAA 2BP8A 1J5CA 2BP0A 3OQRA 4YSUA 4E9TA 2HX7A 2X88A 2R7EA 3T9WA 1GY2A 2HLEB 4YVUA 1AS7A 2I7SA 1B3IA 3S8GB 1NICA 2UX6A 2IDQA 4G7SB 3SBQA 5I6PA 4DP7X 3WKQA 1ET7A 1IUZA 2CBPA 5EHFA 8PAZA 3AZUA 1A4CA 2WO3B 1T5KA 4F2EA 3BVDB 3HB3B 2VM3A 1V10A 3NSFA 1MDAA 1F56A 2XUWA 5B7FA 1IC0A 1WAEA 4ENZA 3UAEA 4Q8BA 3QJVB 1QHQA 2YAMA 2Q5BA 4E9RA 1E65A 3FT0A 4RH4A 1NTDA 3X2QB 2J55A 3KW7A 1TKWA 4YL4A 2J57A 1J9RA 1L9PA 3FQ1A 3HEIB 3MX0B 1EZLA 1KBWA 2GC4C 2LLNA 2EIMB 4AX3A 5TK4A 3NJKA 1AAJA 2B3IA 3EH5B 1KCWA 3IN0A 3N2JA 2GI0A 3ABLB 4GP8B 5PCYA 4DPAX 2DYSB 3NT0A 1V54B 1OCRB 4BWTA 3OMAB 1N70A 1XB6A 4DP4X 2YQBA 2FQFA 4YSPA 1J9QA 1RZQA 4FA7B 2VN3A 1WS7A 2XXFA 4KO9A 2PP7A 2VSKB 2BO0A 5LDUA 1MZZA 1NINA 5D4HA 3FQ2A 1BYOA 5B1AB 4KNUA 1JVLA 2MRYA 1BXAA 1NDTA 1KCBA 3IEAA 3FU7B 3ABGA 3ABKB 3NJFA 4KNSA 1BEXA 3ZX1A 4PAZA 3UADA 2CUAA 2UXFA 5B1JC 4YSEA 4E9SA 2ZWNA 2DYRB 3NP3A 2IWFA 3GXUB 3TBCA 4JKNA 4KO5A 5I6MA 2I85A 2IAAC 2GIMA 1AS6A 1CYXA 2FT8A 4YVNA 1NWOA 4DP5X 6PAZA 1IBYA 5PAZA 4HIPA 1SNRA 2IDSA 4W1TA 2PPFA 5B1KA 1DZ0A 1OE3A 1WA2X 4QLWA 2BW4A 1JVOA 1ASQA 1AQ8A 2MTAA 4BWUA 1KDJA 3PAZA 1NIEA 5AZUA 1J9SA 1KBVA 1URIA 1NPNA 4E9QA 1PLAA 3D12B 5TK2A 1XMEB 2Q9OA 3AG3B 1OE1A 4CSPA 4A2HA 4YSOA 3FSWA 3X1EA 4YSSA 5I6OA 1CURA 1L9OA 3CVDA 4KO7A 1FWXA 1ZDSA 5ANHA 1BAWA 5B3SB 2IDTA 2Y69B 4HHWA 3T6ZA 1M9WA 3SBRA 1M57B 1UATA 3QJQB 1BQRA 3EF4A 3S3BB 2YAPA 2IH8A 2GC7C 3G5WA 1SHXA 3UACA 3WIAA 4A2EA 1NIDA 2IDUA 2Y1AA 1N68A 4QKTA 4FAAB 1QNIA 3IE9A 1AS8A 1OF0A 3T6WA 1YLBB 4AKQA 4AZUA 4KO6A 2OCCB 4MFHA 2PP8A 1HAWA 1RCYA 2YXVA 3IBOA 3NSYA 3JT2A 2UXVA 1GYCA 3L45A 2WO2B 3EH4B 1PF3A 2IWKA 1JZHA 1L9RA 2J56A 1SF3A 1BYPA 5AKRA 3X1NA 2R7EB 7PAZA 3S3DB 4GYBA 1A4BA 1QLEB 3TA4D 1AIZA 4HCFA 1OCCB 2XX0A 1M56B 3GDCA 2XWZA 3QPKA 1GSKA 3EH3B 4DP0X 5B1JA 1CC3A 1BQKA 3KW8A 1X9UA 3DTUB 2FQDA 4AKOA 2JKWA 3TU6A 2BW5A 3T6XA 1ZDQA 2EIKB 1OV8A 4NB7A 1L9SA 2OJ1A 3ABMB 3QJSB 4W9ZA 2YAFA 4BK5C 1A4AA 4M3HA 1AOZA 2DY2A 4BDVB 1ET5A 3WG7B 3NJIA 3OM3B 4Q89A 3FPYA 4CSZA 2EILB 4E9YA 1AZCA 5I6LA 1MG3C 1AG6A 1E5ZA 1ILUA 2QDWA 1PMYA 3EHBB 4K9JA 5A7EA 2PPEA 1JXFA 1ETJA 4N8UA 1CYWA 1TU2A 1WA0X 2HXAA 1ASOA 2YAEA 1ZIAA 5FC9A 1W8EA 3H4HA 1NWPA 2XV0A 2FQGA 4NAJA 1ID2A 2JFCA 4GP5B 2B08A 2PLTA 3V9EA 1BQ5A 2BWIA 3JTBA 4P5SA 1I53A 1SJMA 4GXFA 4PCYA 2WSDA 3FYEB 4DP8X 2CAKA 5AFAA 3PLYA 1X9RA 3CVBA 2BZCA 3NJMA 2P80A 1FA4A 1AZRA 3PPSA 5I28A 2BWDA 5F7AA 3CDZB 1W6LA 1JZEA 2ZONA 3WNJA 2FT6A 3NSCA 1NIBA 3GYRA 1AZNA 1JZGA 1OCOB 3S8FB 3DKHA 1SHWA 2CCWA 3IN2A 1TEGA 1NIFA 2PPDA 3NJNA 2N0MA 3AY2A 1OE2A 2I7OA 2XYBA 2QPDB 4DP2X 4G71B 1ILSA 2H5UA 4X4KA 1W6WA 2UX7A 4JHVA 1NZRA 3ERXA 4UAHA 2A3TA 2TSBA 4KOBA 4AKPA 2UXTA 2PCYA 5E9NA 1TEFA 3CDZA 1ASPA 4YSQA 3AG1B 5I5JA 4E9VA 2GHZA 4F7KA 1ADWA 1SDDB 1JZIA 1WS8A 4EF3A 2JXMA 2YAQA 2PPCA 3BQVA 3FU8A 3MBWB 4NERA 3UABA 1IBZA 2P80D 3T71A 3PXLA 3V9CA 2XU9A 3FU7A 4A2DA 4YSCA 1ZV2A 4HALA 1ZPUA 2VW6A 3QJUB 4E9WA 2HX8A 2FQEA 2QT6A 2DWTA 4A67A 2XV2A 4YSDA 2AVFA 1XB8A 3NSDA 1JZJA 3AG2B 5I5MA 4A66A 4G70B 4UANA 3SBPA 3ZBMA 1ET8A 4G7RB 4GP4B 3X1GA 2FWLB 2YXWA 4HHGA 4AI7A 3H4FA 2TSAA 1DYZA 3ASNB 4BXVA 3NP4A 1OCZB 3OMNB 2DWSA 1J5DA 3PCYA 5D4JA 2XXGA 4BDVA 4DPCX 1AR1B 2VW7A 1KV7A 4WKXA 1AG0A 2BP8B 1GS7A 1PZAA 2VW4A 5I6KA 1KGYE 3CG8A 5I6NA 2EIJB 4KOCA 4TXVB 4BWWA 1ZIBA 4A2GA 1JXGA 2ZXWB 1KDIA 1VLXA 2PP9A 2QDVA 1PNDA 4DPBX 4YSAA 2VSMB 1AANA 2ZOOA 1JOIA 2CJ3A 4G7QB 4P5RA 3OMIB 1RKRA 4G72B 3AG4B 1GS8A 3SQRA 1XB3A 2UXGA 2FNWA 2AZUA 3OD3A 3H56A 3RYMA 3FS9A 3NJJA 4DP6X 3CVCA 2H3XC 2BHFA 4KNTA 4YSTA 1E5YA 2BZ7A 4GY4A 5D4IA 3X1FA 3FYIB 3FU9A 1HAUA 3TBBA 1FFTB 1PLCA 3FQYA 4L0PB 1NPJA 2YARA 1BXVA 5B7MA 5B7EA 6PCYA 4YSRA 2VM4A 1SF5A 5I5IA 2AANA 1J9TA 3QQXA 3DIVA 5I26A 1A65A 3FSVA 2E86A 3X1BA 2X87A 1MG2C 2W88A 1R1CA 1SDDA 1AZBA 4HAKA 1MZYA 2H47C 3CZUB 3T6VA 3WNIA 3ZIYA 1GS6X 4HZ1A 1PZBA 2DV6A 2OV0A 4A2FA 2AZAA 2AFNA 3C75A 4JHUA 2GB2A 4N4YB 1AZUA 1L9TA 3N55A 3QJRB 2HX9A 1WA1X 1HFUA 3NYKA 2J5WA 2IWEA 1GR7A 2IH9A 1PCSA 7PCYA 3QJTB 4DP1X 4A68A 3AW5A 2QPEB 5F7BA 2XV3A 3WI9A 1SFHA 1BXUA 1KYAA 2BP0B 4F2FA 3UGEA 2FT7A 4UF7C 3UAAA 2PCFA 2IDFA 2XVBA 1NIAA 3PAVA 9PCYA 2YAOA 3ASOB 2XX1A 3WKPA 1V55B 1E30A 1L9QA 3NJLA 1OOWA 4ZK8A 5IY5B 1PLBA 4HCGA
chains in the Genus database with same CATH superfamily
4TNGA 4F9LC 2E7MA 3WL9B 4LVNC 4P2OA 3BWAB 3ZJAA 1OTSC 4ZMWA 1NUFA 3QXAA 4XC1H 1R75A 2K3HA 1A3ZA 2Y72A 5KYUA 4MJ5A 4D8PA 4POZD 1J5OL 1WWAX 5AYQA 4XZUB 3KYKL 4MB3A 4W4OC 3MJ9H 4JRLA 1U6AL 2Z8RA 3SDCA 5I16A 2RR3A 1YNTB 4AUYA 4GXVL 1OM9A 2R2BA 3ML9A 4LSSL 5K39B 2Z4QB 4N0FB 4L8SA 2G4GA 3KEDA 4CNIB 5KYWB 3DJRA 2CIKB 1X7SA 4ORGB 4CUCA 4IRSB 2NRDA 1A8ZA 3FTGB 2DYPD 1KTLA 3DV4B 3BZEB 1T1YB 4C4KT 3LKNB 35C8H 3G5VB 4UTAL 4MRBA 1M05A 3H53A 4JAMB 2X88A 2R7EA 4J6IA 4PP2A 4LKXB 5DZLA 4W93A 2N1KA 4W9JC 2F8IA 3BO8A 4WW1A 3GJFA 3HZYA 4X6BA 3ELAT 5SWQA 3VNYA 3AFLA 1VGKB 2F5AL 2XG5B 3B34A 4J3UA 4PJ7A 1IUZA 3M86A 3HI6L 3UX9B 3ILQC 3MZTA 2VDPH 2UZXA 3UZQA 5BUPA 3ARFA 1Q38A 4N8VG 1MNUH 4B3VA 4PJGB 1WT5C 1MDAA 1AXIB 2WKGA 4UM9B 2CLRA 3RX5A 4OF3A 3Q9QA 4F57H 5GS0D 1XDTT 1BFVL 1D5MA 4ANWA 4QTIL 4QRFA 2VMDA 3U30C 3WIHL 1DQIA 4LBEB 4JFDA 3EHBC 3LKPB 4W9KC 4MAYC 1DBKH 2SODB 4BE5A 4GRLD 4NM4L 2NY7H 1J1OL 1NGZB 3BGFC 4LCYA 3QFJA 4WV1A 1Y7VA 3Q48A 3S35L 2GI0A 2OZNA 3M45A 1SXBA 3EFOB 5FGCB 2V6HA 4AJ0A 3ZQXA 3FQUA 3F7VA 5KS9E 1KCLA 1U33A 1EANA 1UKQA 2OPCA 1F4HA 5DHDA 1Y07A 1A1MA 3D3VE 1MFAH 2YEVB 1NEPA 3S36H 4KUZH 3Q3GB 1UVQB 5C09A 1RIVL 1PLGL 3EYSH 4MDRA 3T4AB 4RIRA 5CEZD 5A2IH 2Z7YA 3UC0H 2V2TB 3TBSB 4HKXA 1RUKH 2YPVH 2NW2B 1WTLA 2HVKB 3P73B 3PIQB 5AOIA 1YEFH 2FEEI 5D7LD 3GSUA 4JPKH 1G0YR 3RL2A 4EN3C 1BF5A 1S9WB 1KEML 2NY4B 2CR3A 1EJFA 3QI9B 4IDJL 4ZMPA 3KNBB 2CBOA 5DJ2A 3M1BB 4NENA 2J44A 3AS2A 2J25A 3FTYA 4N6RA 1ZWIA 2QQLH 3BN9D 3JUZA 3WE6A 2IWFA 5CBEB 5A40E 4N85A 1NBZA 5M94B 2OQJA 4HK0A 3GSUB 3RNKB 2FT8A 3TBVA 1JCKA 3OJVC 2IBGA 3L3DA 5EUKB 3SYQA 5C0EB 2WTRA 4NQEE 4JCMA 4Y2OA 1ODAA 3BSZA 1WA2X 1BGXL 3LD8B 1KTBA 1NDGA 3LXAA 3M7FB 3QO1A 5F96H 3OPZH 3WTVA 1QW9A 2J8UF 1NCUA 2V33A 4ODXB 2XXMB 5IVZB 5IB1B 1GGBH 3O0RH 1DE4B 4X80L 1KIPB 1GZQA 1G7MA 2CNYA 4NHCH 5EBLB 3WLBA 3I50H 5GGRY 1MDTA 5HHOD 4I3SH 4C55A 1NAMB 3MDJA 5DGRA 2ZKHH 3E7JA 2F54D 2V17L 1TXKA 5GS0H 1FFOB 2CO7B 2ZUSA 5E7BA 3E38A 3OAYH 3PJNA 1OW0A 2FUTA 3RGVC 1HXKA 1JXKA 3NZ8B 2BVEA 4HHWA 3TO4C 3VU2A 4ZD3H 1ZLVK 4AMWA 1YYCA 4FQXD 2ZWLT 2W65B 1RUMH 4LSTL 4MNHB 1AKPA 2IQ9L 2BNUA 2HJFB 1B6UA 3KPRA 4J6RL 4M1CC 5IFHL 3QJZA 3H9SA 4LKXA 1IL1A 5J6HB 1KJ2A 1UD8A 3GXIA 1SYVB 4MAYD 5AKVA 1PBYA 2EDBA 3O6KH 2C8NA 5LXGL 5C0BD 6TAAA 4M02A 4UNUA 4WWOA 1CR9H 3X3GL 1ZJBA 4FQ2L 3UFIA 3CFDA 5DO2D 4ESKA 4RGND 4LSQH 3IJHA 4KMQA 1F3DH 1QYGL 4FA8A 4YLBA 2P48B 3VGAB 3WY2A 4GYBA 2A6JA 4I3RL 3ILQD 4P2OC 3F83A 2Z31A 2R2HB 2MCPH 1GHFL 5I30L 1T1WB 5F8RC 2X0WA 3AUWB 4LF3B 1JPTH 1CC3A 4OJDH 4D2NA 2CNZA 3VJ6A 1OAYL 2VKXA 4AV5A 4CU7A 2CIKA 1XGYH 2YQ2A 3VXSE 4EI5C 1SJEA 4RRPM 1G84A 3U9UB 5DURB 2EIKB 4UT6L 5MEQB 1WCBB 4PCSA 4E42B 4YXLL 2OP4L 1UM5H 1W91A 4CMHB 5INDB 4U7SA 2X4RB 1LEIB 1WO2A 5C8JB 4JZOA 3KYNA 5CHNA 5JXAL 1NCAH 3DPBB 3MSPA 3UBHA 3NFPB 2FWOB 3OWRA 1PQZB 4M3KB 5I1HL 2VE6A 5DR5H 3PF2A 5BV7H 5IT2H 4OZGF 1U8OB 4XGZA 4ANKA 3BPLB 4ALAL 3VGEA 3AROA 4XODA 1JE6A 3CFEB 3APDA 5DRZB 5IGXH 4I77L 4ZAKB 2VR3A 1MCEA 2W0FB 3S2CA 1VACB 1T20B 3IDNA 2FEDC 2LTQB 1XVSA 2CJUH 1CI5A 4ODHH 4I0CC 4I2XA 2FD6L 4EIZC 4IU3B 4QKXB 3JZYA 3R06B 4JMXA 3BLBA 4U0QB 3NZSA 3CIQA 2VXVH 1T03H 2R1XB 5DK2B 4Y1SA 1E4XH 4HKZA 1P69B 4WAFA 4PRPE 5FGBA 1N4XL 3R0MA 5DT1H 4OLXH 1T83A 3ULUH 4AWJC 5J6GB 4GO6B 4GFTB 4U1HA 5CJXC 1QEWA 3PWPE 2X2YA 1XCQA 3JWOC 4G8GB 4DVBA 4MYWB 3K7UA 4UM9D 2OYPA 4RRPA 2VDOH 4PW4A 1F4WL 4JHAL 4OZFH 1TEGA 2VXUL 3VXQB 4DUXA 1OLLA 3AY2A 1K8IB 1TSHA 4JFWA 4A7VA 1A7PL 1BJ1J 2VJXA 1QLEL 1Y18B 5C08B 1N67A 4AQEA 4PG9B 5DZPA 1SM3L 2HFGH 2JB5H 2AJXL 3IMRA 2A6KB 3IXTB 1UWXK 3ATFA 2D2CC 3NIDE 4APQB 1KV3A 5JORB 4AKPA 6CGTA 4IRSC 3WHXA 5C0GB 4URKA 3KPSE 1HYSD 4D7PA 1HL8A 3MA7B 2C4FU 1FZKA 1JNNL 2F8OA 2VLKE 5I6XB 2GJ6D 4GXUM 3UGXA 1CGWA 2G9HB 4OD3L 5FYKH 5IESH 2IQAA 1CGSH 2EDOA 4ZFOA 2J6EL 3CPLB 5DK2A 1EZSA 5DLLA 5HYJE 4D3CH 2HVBA 1KPUB 3CC5A 5DUPH 3QAZB 4DW2L 1RLBA 2VW6A 2FQEA 5FUCE 4LLMB 1GKOA 4GLRH 3T8VA 2AEQH 4HWEL 1JGEB 4L1SA 4V1DE 3P2DA 4A66A 5A1AA 4UANA 2JKNA 1RAMA 1X5ZA 2B77A 3E9TA 4F8PA 3H4FA 4XXCA 3O6FC 5IBUG 4WFHD 4XRCA 4I18C 3NZHL 2WXFA 2DN7A 1PG7W 4ZZKA 4JN1L 1EVUA 3WTWA 4GW4B 3X3FH 1T4KA 5DJZB 4BFKA 1K85A 3TVMD 3GB7A 5KSAA 1YJDH 1GJUA 3BISA 4GW5A 3GXTA 4OLZH 4S1RH 2EKSA 1TR7A 2JELL 1XF4B 5EOQH 4YIQA 1F1DA 4NQSB 1MRDL 4NOBA 5FX3A 5T3XH 3V0JA 4QHNB 3V5DA 2HYMA 2VO8A 2P46B 5MEQA 4QRSA 1TQTA 2BHYA 2EDXA 4HXBL 4DPBX 4YSAA 5KVEE 3O4LE 1OT2A 1F5WA 1J48A 3O6LH 4UNTA 4A6YL 4HOMA 3IDUA 5I74C 2ZXGA 1H6FA 1F58H 1P6WA 2DKMA 3ARDD 3GMRB 2X70B 4UV4L 2H4EA 1D6VL 4B95C 3NGBB 5MEOA 4FTVD 2EECA 4G72B 4ZRGA 2KLTA 1TT6A 3A6BH 4QHNA 3VG9B 2BNRE 4UM8B 4BFFA 2B5IC 1ZKAA 2BHZA 15C8L 2R1WB 4QCIA 1WAAF 1WDAA 3B1TA 2AZUA 4HUUA 1RFDL 2CGZA 3WV0A 3RWFB 1MN4A 3K2UL 3MRCA 3B6SA 1S8DA 1ND0B 3C5ZC 3OB0H 2HLFC 4FOMA 4HC1H 4KJWD 3QZMA 4P49A 4S1DC 4LHQB 4PI0A 4KKBC 5JHBA 3Q2CA 5A2KH 3VSVA 4QXUH 4IYKA 4LBAA 1IEBB 1QI3A 4PJ5B 2VM4A 1M2OA 4ZMNA 1B4JH 3OWEA 2CHXA 3BZDA 3L9RA 1QI5A 1QFPA 2OI9B 5CUSL 4GG8A 5KBLA 1FFPB 2FRGP 5IR1B 5J13C 2VLKD 1KJVA 2HG0A 4UAOB 1MG2C 3L3JB 4KBPA 3LZQA 4S0TD 4ZMVA 5K1NA 2P28B 1AXTL 3ZO9A 4F8NA 3EBGA 1RZIB 2IQAB 2X1QA 4FQCL 2GHWB 4LP5A 5KVGL 4J27A 5JNYA 2QGDA 3QFDB 1HHGB 1FFOA 3LN9A 2J20A 1EQWA 3O8XC 4Q9BA 4CBPA 3LQMA 1JPFB 1ZSHA 4GEIA 5GGQL 3IVKA 1DCLA 4LO9A 4OZ4B 5IFAH 2IWEA 4YDJA 3I3EA 3V6OE 3UXFA 4JFPB 4PJXF 4AJWA 1MCPH 3FT3A 4KKRA 5D5MB 1XBRA 3L3IB 2A73B 3OLIA 3NDZE 4JB9L 4C54A 3UAAA 5DVPA 1BHGA 1YNLL 5DDHA 1VFOA 5T1DH 1LILA 4LOVA 5D1XB 1PKQE 3C5SA 3MFFA 1TFPA 1RJLA 3QORB 3NJLA 2D7MA 4Q6KA 3WYRA 3BGMB 4N0UB 2R4RL 4PI2A 3SCMC 4DGVL 1QNZH 3ZTDC 4ZPTA 1RD6A 5AVVB 1VF5C 4PBVC 1DQQA 4LHUB 3BC9A 4HBQA 1DEEB 1HTYA 2XTJD 1GW0A 3EBAA 1JGDB 1SJHB 5KSAC 3MLSL 1UURA 3U48A 1PY4A 3HG1D 5CJ8A 1F6AA 4AEHL 1TZGH 2GABA 1CDIA 4MAYA 3N40F 1IFHL 4G6FB 4Z7OF 2IAMD 2HRHA 4XP9H 5CWSB 5D7KE 2WB7A 1QTSA 4Y16C 1U3YA 2AITA 2VDLL 5E9DA 1DBBL 2ZSVA 5T33H 2JH2A 3FFDB 4Y4HD 3MGTA 5L2KD 5JHMA 4Z95H 3WFEL 3D69A 4HYTB 4P3CH 3WY4A 4FN0A 3QIBC 4MMXA 3VE0B 2FTAA 5KSVA 2BP8A 2FEDD 3GS7A 3STZA 1RZFH 3CPUA 4YDKH 3D08A 1XCTB 4DKDC 1ACZA 2V2WA 4QRBA 1FZMB 4Z7VA 1AS7A 2I7SA 3DPBA 1DO6A 3TIDB 5JW3L 2OMZB 4Y7MA 3MV7B 2CO4A 4ZO9A 3IGKA 4GJTB 5DMKA 3DDFA 5EU7C 3ROLB 1IC7H 4OQTA 3S34L 1MI5E 3GINA 4DQOH 2CBPA 2F5BL 2V5RA 3QFJE 4FADA 5I1GL 4NRYB 4G8FA 3TZVC 1N3NB 3MUHL 4Y2LA 3SE9L 2JJVA 4C56B 4IBYA 4RDQG 4F15C 1O9ZA 3HG5A 1R5VB 4PGZA 2XUWA 4XCNA 2EYTA 1FBIH 1G43A 5I1KH 1R6VA 5E5MB 1W72H 3UP6A 4L37A 4FQQA 3H7BA 4K3JH 2J55A 4NQXB 2ZOTA 4Z8FL 3O4LB 2J57A 5C09E 1UG9A 1Q94B 4XMKH 2P7TB 5G2NA 3LJ3A 2YXMA 2LLNA 4O2CA 2FCBA 3EH5B 3W81A 1YYLL 4K07A 5EWIL 2VDMH 3IFNH 2E46A 5DJ8B 5L8LB 2BVOA 1KT2A 2EYRB 5EEXA 4FFYL 1XB6A 2AV1B 2CO3A 4NFCA 3KJ6L 2J72A 4FC3E 3CH1A 3UTTB 1X5HA 5HVHC 2OYLA 1D5BB 4MNQE 4LPYA 4YPGB 3UTSE 3VW3H 5KJRL 4ONGL 2Z91B 3O2DH 5BPPA 4JMNA 3QRFM 1V7MH 1Q9LA 1KWKA 3CK0L 5LGHH 2L7UA 2UWEE 3IJYA 4H7VA 4IHOA 3UBXB 5T3XE 3AQXA 3FW6A 5FECB 1J05A 2QR0B 4BUQA 3CHSA 4UTBH 2XN1A 4KKCD 2J4WL 3PFUA 4MMYB 2KYIA 3ZMEA 2IOMA 1E3ZA 1G7QA 1N0LB 3BZ4B 5AL8A 1OK8A 4KDWA 4A7SA 2HJLA 1Q72H 1HNYA 4P23A 5AW2B 1LP9B 3OKNA 5HHXH 2ZOKB 5GGRB 4ATWA 4YVNA 4HMCA 3BUIA 3IS1X 3FULA 4EZMA 5ACZB 1Q0YL 3MJ7A 3BKYH 5IROC 3G7TA 4G7YL 4MXVF 3LQZB 4HISA 3T2PA 4EUPG 4LVNB 4ODWA 2RQ8A 1F6LL 5E4OA 1ZHBB 4NQDE 4WEBL 3QHFL 5AZUA 3FL7A 3RI5K 4OIAA 3JVGA 4HJGA 4R4FH 5FYJU 4K2UH 3DUHA 4TUOB 4K71C 3FO0L 1YPZB 2L7JA 4FJYA 4JVUA 5DQ9A 4FYSA 2X6VA 4CAGA 5HHMB 3VYOA 3EYUL 2DQFB 5ESVB 3WJLC 4PLJC 1JWSB 3B9KC 4Y19A 3HZMB 3IKCA 1JL8A 3P2TA 4HV8B 2VTFA 5D72H 3SE4C 1MW2A 1Z9LA 2WWOA 3E8UH 1J8HD 2NYYC 3C2AL 2G0KA 1CF8L 5K9JH 3WS3B 1HU8A 5B3SB 1BBJA 3V0FA 1DQJB 1VESA 4LPVA 1R3LA 2Y69B 4N5UA 1LD9B 1M9WA 1MFDL 2BSTA 4Y2DD 3SBRA 2XQYA 1CICC 4H88L 4WFGD 3ZR6A 2V9RA 3N04A 1QA9A 4U49A 2IV8A 1PG7H 3FUDA 2OTUB 1NAKH 2XZCH 1RVFH 1HVXA 2QPUA 2Z8VC 2CHNA 4OJEH 4WWKD 1QR1B 4ABQA 1MSPA 1Z5HA 4GMSH 2QV2A 3NN8B 2AJSL 4AKQA 2GCYB 1NMBH 3I9GL 4UBDC 5D93B 3PHSA 3RY4A 4WHCA 4JGMA 4BGLA 2BXYA 2KKQA 2OCCB 1RJCA 2PP8A 5IM7B 4PVLA 1D5RA 2C3WA 5D96C 3T2NL 4U6YA 4LLYA 4XNYH 1DSFH 3GSOB 4PJAA 5GJSH 4CSSA 2C4FT 1FN4A 4XH2A 1W15A 4K23H 5AKRA 2E6PA 4TSAH 1IKFH 2YMXL 4Y4KA 2UUDH 5AWNL 4PLNC 1QI4A 1TYJA 5EA0L 2A9DA 2QKIB 3UAJC 5C7XH 1BZ8A 1Z32X 4WI4A 1QFWM 2XC8A 1S7XA 5CWSA 3GSXB 3N1MC 3KR3H 4DKEH 5MI0B 3TU6A 4CKQA 4URTB 3LZNA 1BX2A 3EG9A 4KRPC 2NXZD 5AG8A 1JHLH 2ZXQA 1UA7A 2OI9C 4YZFF 4ZTOH 5JOFB 3LZLA 4E9LA 1VGKA 3UMTA 2B1OA 3LN5A 4RMSA 4LSVL 3SCMA 4RGMB 1XBDA 4MA8L 3QUMA 4BZ2A 4CSZA 3WU1A 1YJDC 3ZE1E 5I6LA 3CLEL 1MQKH 1XF3A 2X4TA 3RTQB 2D2OA 2OTWB 1X5YA 3FB7A 3LIZL 4MHHI 4N8UA 1CYWA 4ODWB 4N2LA 3HRZA 2GITB 4N1EA 1FZOA 1WA0X 4CJ0A 5E2VH 4FRWA 2NSQA 3IF1A 2OMVB 2JWYA 2YZ8A 5IHLB 1NWPA 4XH2B 3IBEA 5KYXA 4NAJA 1BZQK 1OCWL 3E6FB 4YEEA 1XF2B 1H8NA 4EI6A 3BZ4A 1XTLA 3V8OA 4Z7IA 3VXOB 1SXSA 3EGDB 1ZHLB 1E40A 1YPZE 4NWUH 3PLYA 1X9RA 4PS4L 4LLUA 3MV8A 2Q8AL 5DU7A 2Q86A 3G5XB 2PXYD 1YEJH 3I6KA 3KDMB 1L0XA 3S5LG 3CDZB 4WFGE 2Q1EA 2C7UB 3TESA 3NCMA 4I3GA 4J4PD 4WV1C 1UXSB 1RK1A 4ZPVB 3KJ4B 2O61A 1OQOA 4EDXA 3EGSA 1SVCP 2E7LC 3MOAH 5ADPH 4XVSL 5DXWA 2X44D 2CXKA 2N0MA 4ZO8A 2DQDH 3D5OF 3L4VA 3FFCE 4X6CE 3BUTA 4LLMA 5JDJA 1KBBA 3CVHL 3HZYB 4FG4A 4M93B 4X6BB 1E5AA 3IMTA 1JP5A 1Q9OA 4NKDA 3MRIA 5FFGA 2NR6C 4HJEA 1FVDB 1VZGA 2NUTB 2Y1YA 1IGTA 3OXRA 5CEYA 5C2BL 3TWCH 3VRJB 2NCEA 5CJ5A 1KCVL 3D4GA 2FWUA 3LS5L 3TFBA 4R96B 4YDVB 5BMFL 4QRAA 4L3CB 5D1QE 3VYNA 3O3AA 4FTVA 2WUCH 4H20H 3HFMH 5EUOA 3D0LB 1N2RB 1O9VA 3DVFA 3MNZB 4H5SA 3TEUA 3UOAB 4WJ5A 2QGEA 2NY1C 3EFFB 3R7QA 2QADD 3LKSA 5GZND 2VLJA 3GIZL 4PJXE 5FB8B 4R8WH 2G0LA 3MC0A 1K8DB 4PRDA 1T80A 5F9DC 4YXKL 5DD5L 5I8OL 2BK8A 3HNSL 3H9YA 3MXVL 1QQDB 4YK4B 3REVA 4K73A 4LSRH 2I60L 3V6ZA 4GP4B 1R46A 2CRMA 4FYTA 1YC8A 4UILL 5LUMA 3Q6GH 3WEMA 1LYQA 2VUYA 5I1JH 1S7WA 5LKNA 5A2BA 2ZOUA 4BDVA 5JA9A 2OSXA 3VGBA 4WZ9A 4AEIH 3NGBC 4QY8A 4WKXA 4U4IA 2WK2A 5H37G 2EIJB 1ODUA 2FIKA 1RMFH 4HQQL 3ZHNA 4L4TD 4Y5VC 1O75A 4RCAA 4FNLL 3LZRA 3WFDL 4HZAA 4I9XA 1CT8B 1DQDL 1A14H 2P8MA 3AG4B 4G8IB 4XCFL 1UB6B 3P9MA 3SQRA 1IM3D 4JJ5A 4EZLA 5I8CA 3HMXH 1XB3A 4ATTA 4PJDF 2BCKA 2JMRA 4OT1H 2AF2A 2XN2A 3U7YL 4PQXA 3MRLA 4PJEE 2BZ7A 1AYOA 2HB0A 1NMCC 3QFGA 3MBXL 4EIBA 4FHKA 2D9CA 2YARA 5DA4A 2QLYA 1IAIH 5F7EH 5DJXA 4KPHH 2DMHA 5D7JD 2AK4E 5CGTA 1U8CB 3LSOB 4XXWA 5CCHE 3WIIL 4N1HB 3HUJA 2L4OA 3DIVA 1A6WL 1MWAA 1A65A 2Q7YB 3X1BA 1YEDA 3D1MC 4XPFH 5DEFA 5DQJA 4O02B 5KUKA 4Q2ZA 1REIA 3VWJD 4F57L 1MZYA 2H47C 3BAIA 3MV9E 3CHXA 1MIML 1PZBA 4TQIA 2GIXA 3TF4A 1MFCL 1MW3A 1P4BL 4B6ZA 1FYHB 2UVEA 1I7RB 3GUTB 5HI5D 5L2KA 1TJHL 3BRDA 1WA1X 1HFUA 1TPXC 3S35H 1M1XB 2HTLD 3RDTD 1A6TA 4Y16B 4PHXA 3QJHA 1C16A 1NFDE 1NDMA 2NY0C 2QPEB 1G7LB 4HEPG 5F7BA 5GRVL 2Y1ZA 5B39G 4F5CE 3A24A 5IJKC 4E41A 5MENE 1U42A 4HJUA 5HDBB 4OGZA 4YHML 4Y7OC 2OMBA 2MPAL 3UGEA 1K5NB 2NPLX 4KQ3L 2YLKA 4NLAA 4BQ6A 3H9SD 2DI8A 4L3FA 3LHPL 2C7UA 5I19L 3RWIA 2BXZA 4P9HH 4G3YH 3FFCB 4ZK8A 3QAQA 3STLB 4RAHA 4HCGA 1WBZA 2ZSWB 2GUYA 2HPOA 2Q86B 5E6YA 3FCSB 1Z9PA 1IKOP 1WJ3A 3DSNA 1F1AA 4Y2DA 4JDVB 3WBDA 5HDQL 4BZ1A 2WVSA 4DN4H 1YNKL 2GIYA 4KJYB 2HT4C 2VRQA 2X4UB 3ALWA 2MKWA 4Q0XH 5MP6H 5MEOB 1CLYH 1P1ZB 2Z64C 4P4KC 5GRUH 2DEXX 2O5YH 5IW6A 3PU7A 5A3ID 4H40A 3AWGA 4FNUA 2VQ4A 2ZYSA 4M4RB 4OM1H 2HLAB 3CFKB 4A7GA 1FYTE 3PNWB 3CZJA 1OP5H 3QWOA 3IVKB 1UM4L 3FQNB 4F7TB 3WUWA 1ZT4A 3FUEA 1CGXA 3ABZA 3C8DA 4NQSA 4O58L 5LGYA 1UZ8B 1JXDA 4OZIF 2GSMB 3EZJB 5L4FA 1UQSB 1H5BA 3IT8D 3ZHKA 1PZSA 4EXPX 1FNLA 3QS2A 4MD5A 4JE4B 4MLSA 5IVOA 3AXIA 5E4AA 3QUKB 4BUHA 4I9WD 3NA4A 2IPUK 1H3VA 4M7JL 1WEJL 3ETSA 4XPTL 3AACA 2X9YA 4QJ3B 3T65A 5JZ7C 2HLFD 5GXBB 3C5ZD 4XAWL 2V17H 2C7FA 4U31A 2H2SD 1X7QB 2EP6A 3SDYL 2IG2H 1XF1A 4OFPA 4HKJA 3JTSA 2PO6D 3BH8A 3ARVA 5C97A 2B14A 3ARSA 4J5VA 3UO1H 1JWMB 3IMSA 5TPWH 4YWGH 5IQ9A 2AXJA 1JG9A 2WXPA 3G04B 5ANMA 5I75B 4PD4J 1I82A 1IBHA 5IMLB 3CQFA 4UZSA 1I3GL 4ZS6C 1MOEA 5LAXA 5C0ND 2CK0L 3DGCR 4G6KL 3W1ZA 2Z92B 1JPEA 3N44F 3AXHA 5CNHA 4KKNA 1HIML 4BSJA 3MJGX 4X7CC 3CN3A 1UA3A 5CEZL 4D9RD 3ZKXB 4LQFH 4UZUA 4OV5A 4FQ2H 3ILEA 1NANI 3ZE0F 4ADGA 1WZKA 2CIIB 1I7ZA 4PJIA 4MGXA 3C5JA 2WTRB 4NO5A 4H8QA 5C0CB 3OPUA 5AW7B 4OLVH 2NCMA 1JRHH 3TH4T 4PBDA 1GHFH 5I30H 4WWKC 2JJSA 1T4KB 1QLFB 4W6XB 3TV8A 4ODVH 2XNAB 3DBXB 1D2PA 4KAQL 3UYPA 1BIIB 4NHUA 1LDPL 1TQCB 4G5ZH 4XXDB 3VXRB 5F3HA 2XFXB 4Y4FA 2KPNA 2W92A 1JVLA 4TLKA 3VGGA 2IPUG 3QUZD 1G7HA 1S7QB 4D9QD 3TIEA 3PP4L 1JXJA 4YXLH 3ZX1A 1AGDB 3AWEA 4JO1H 4NQDA 5KVFL 4KVPA 3UADA 1U91A 5D7LA 2YD3A 3H3PH 4WWNA 3B7YA 4JRYA 1H8OA 3AWFA 1NCBL 3NABH 4KO5A 4QTHB 2YEQA 5C92A 1I7TB 1KZQA 2QMJA 1QSFD 3QVAA 3I6LE 3IYLW 5CGYC 2P8LA 4IRSD 2CE6A 4GAJH 1E2WA 5C9KA 1A1MB 3EUUA 2FYVA 2G9HA 5DZ9A 3ZPDA 4WI8A 4JO2L 2ARJA 4Z7OE 1XWVA 1Q90A 1DVFA 1KCSH 4L8SB 1EHXA 1YEDB 4YHYC 4XNUL 4BWUA 4J3SA 2G5UA 3W57A 3HC3L 5CGMA 2DL2A 4ODHL 2XSKA 4TM9A 5D8JH 2ZUYA 3A4DA 5DQDH 3AREA 3B4NA 1RPQA 4NQCA 2VLJD 3IJEB 5FHBH 1UXWA 2VXVL 5EIVA 2SEBA 5I1EL 4CSPA 3N41F 3U1SH 1FE8H 3DX1A 4OI8A 2ZOWA 5DCCA 4FABL 1FNFA 4JPQA 1AD9A 3CVDA 4GSDL 4LSDA 1L5GA 4UDTB 5F1OB 5IROA 5SV3A 1NC2D 4OI7A 1VFBB 1VKXA 2ALAA 4XXCC 2I07B 5HI3C 3NCEB 1TZOA 3VXPA 3OR7A 4YHIB 2FIRT 2EE2A 4QEGA 1JGUH 4PRPB 2Y1VA 4UUJB 3WFHB 2ZTBA 1KT2B 3PPEA 3SY0B 2Y1AA 4QKTA 3IJHB 2Z8SA 5DC2A 1ZXKA 2AJ3B 5SWZB 1JYVA 4TUOA 4MHHG 1VAHA 4ELMA 5DGQA 1ZGLA 3Q1SH 2F53A 5CS7A 3GLDA 5I18H 2XFGB 2L04A 2ZKYA 3H7BB 1OAQH 2J56A 2AGJH 4PRIA 5DS8B 5HHQA 1BVZA 5EDSA 5LCVA 4HJTA 2H8PB 3UPRB 1K2DA 4PREB 5FYKL 5H8DA 2ODHA 4QR7A 5IW3A 5IESL 5CO1A 3RVUD 4AW7A 3IDXH 2YGPA 5GGUB 4MA3B 1E8XA 2J6EH 3H3BC 4Z7NB 3GJEB 4MAZA 3V95A 3QQ4A 4M61A 4AYID 4D3CL 4DVRL 5CU9A 3F12B 1THCA 1YNTA 5DUPL 5JHAA 4LQ1A 1UB5A 4PWIA 4R0LA 3CVHB 2IOOA 2XA3A 4UT9L 4ZMTA 3SY6A 3IPBA 2Y7LA 4LCWA 3E2HC 3TIDA 3TF7C 1WAPA 1DANU 4LLWA 4PRAB 4XVJH 1CBVH 4YC2C 1J8HB 2EDKA 3W9EB 4GT7A 2Z91A 1RERA 2UZIH 1QHPA 2H2PD 4YDLB 4E9YA 3SDAD 5K59F 3BW9A 2FJGA 3RVXC 1P2CB 2VNCA 3EBHA 4IRZA 2Z31B 4YHKL 2MOGA 4YDVA 4OCRL 2FVNA 5I8KH 2XG4B 4PJGF 4P5TB 2RTTA 1P7KA 1AR2A 3A67L 4BELD 2PO6A 1HXMA 2OMXA 1WC7A 3O41B 3F85A 3HI5H 3ECVA 3UCRA 2IVFC 3O6LL 4LIQL 4M1CD 2WQAA 1SN0A 4MJHA 2ZP0T 2OZ4L 4PJCE 5EH1A 1SJMA 3T08A 3NIGB 4PCYA 3QQDB 5D7IF 5HVHB 2GI7A 1N6UA 1D6VH 3HHMA 2P80A 4HCRH 5E6SB 1JD7A 4D94A 3QGVA 1QATA 2ATAA 3HVNA 3QXDB 5TDOB 2FHFA 1DUZB 2A9AA 2C1PA 1N3NA 1AJ7H 4H8VA 1JZEA 4AV4A 4R6UA 1U3HB 3DX7A 3R4DA 4OSUL 5HPOA 3DK2A 1TQSA 3GPEA 2CO6A 2H32H 1LL1A 4M7LH 5DLML 4NHUB 1WFIA 1GC1L 1KLFB 1T1XB 3IN2A 5H35B 4XWOC 4F20A 4TUJB 2IAMA 3DV6B 5IW1B 5IFJB 3IE4A 3LPWA 5GSVB 5KW9H 1PX4A 5J12C 4Y0GA 2RA1A 5E2UH 1FNGB 1A7OL 1XD0A 4XPBL 1E9QB 2HKFH 3KYOB 4AH2A 4KY2A 3LPOA 2LAAA 1CXEA 4K9EL 4UQBA 4JQIA 5H35A 1FORH 4MCYB 1JF6A 4K5OA 1FYTB 1WBYA 3AG1B 4OB5L 2GHZA 4KZEH 1JMZA 5G4MA 5IG7A 1CFQB 3W9DB 4TMPA 3UIYA 3NIDF 1BZ7A 5DYOB 3JTSB 3K2KA 4R5VA 3EFDL 3AB0B 4WUKL 3KDPB 3FQXB 5D9SA 5FHAH 4XNDA 1ZXQA 1MRFH 1O7DC 4PS7A 4DNLA 1HI6A 4LAQH 3ARPA 3MLYL 5IQ9B 2X09A 2F61A 5EU7E 4KV5E 3VFOB 1D6EB 1HKLH 1NANH 4BRJA 3EJSA 2YO3A 1JZJA 2VR8A 3IWUA 4XMLL 2V37A 2AQRA 4G70B 1HKFA 2B16A 3KD4A 3Q8BA 3VXMB 1GXEA 3MO1A 2X1WL 5T1DL 2IADA 4PB0L 4M5YH 1DYZA 5BO1L 3S48A 1G1CA 3NP4A 4HUUB 5DFVD 4JFSA 4U6VL 4IOSD 2V3FA 2VM9A 4L1DA 5DD3H 3T0XA 4YGAB 4J1UB 2WWNA 4W6WB 5ACLA 2X4NA 3BXNA 3ECUA 3MOBL 1GGIL 1A6ZA 5J1AA 1CXLA 4N9GB 4FG0A 4G9FA 2DLFH 3EO9L 5J3HC 2CDGA 1MCJA 4Z7WF 3K72B 1U8KA 3DO4A 4KGJA 2BNQE 4MQSB 2ZX8A 5C0RL 2C26A 3LB6C 1AANA 2A1WH 3RDTA 3KLAA 1NFIA 2O93L 1RKRA 5AVTB 1YZZA 1ZA3B 1HSBB 1C8PA 3DMMA 3WFEH 1A9EB 4KK8C 1KXHA 1U3HA 5CINH 2WZ6A 1KEGH 2ZCKH 1VZHA 5GGUA 3BIKB 3G6JA 3CVCA 1ZLWK 4OLYL 2W94A 4YSTA 3ULVC 1WBZB 3WJJA 5AZEL 1YG9A 4XHJC 4E0RB 3MO1B 2BJMH 3ES6A 3WIHA 3T65B 2HT3D 4YDZA 1WWCA 4YBQD 5I1DA 4K7PX 3OKMA 4M8UA 5JW3H 1VGEL 3RPBA 5EO1A 1NKRA 4HWBA 4PY8J 4WW1B 1FL6A 2VLKB 4RAVB 2HTLC 3VFUA 3CDGB 3MNVA 5EU6A 4X5LA 4JREC 1AD0B 1CFVL 5JIPA 4LLAA 3O4LA 2R1WA 3UEZA 2NY0B 4I1PA 2D3LA 4HIIB 1DQVA 5ACZA 5HYEA 2J6WA 3L4XA 4X50A 4PGEB 2CMRL 3RZCB 2WV3A 5J11C 1D5XA 4BFGA 4M8RA 1KELH 5BS0B 1U8NB 2WCPA 4MXQD 3U83A 3VH8B 1L9TA 4UDTA 4Q14A 1W72A 4JL1A 4OCSH 3H8NA 3TO2B 3Q5TA 3H6AA 2GW5A 3QJTB 2VDML 5H37H 7PCYA 1O5DT 5A6LA 4IRJD 4AQ1B 3B3BA 5BVJA 3KPOB 1A02N 1TU2B 4OJAA 1QBLH 3ATDA 3QIWB 2ZNXA 1JZ2A 5HDOA 3BP7B 1AZVA 3ZL4H 5KJ4A 5K59E 2EAEA 1NIAA 1HSAB 3MBEA 3ZO0A 9PCYA 2YAOA 2E5EA 1H8SA 2OSWA 2Y06L 5KSVB 3X11A 3O2DL 1OOWA 1XIWD 3B43A 4XC3L 2BHUA 4NKQB 2RFXA 5DS8A 5GS1C 4EQ2A 4RISH 4HUWA 2OXGB 5KS9B 1J87A 3WIHH 1V3KA 3OBAA 3S35X 2J4WH 4ZTPH 1RZJC 2OR7A 3WHE1 1HOCA 4RQQA 4QNPE 1AKJB 1J1OH 3RB7A 1J10A 1IM9A 3L95A 4FQJL 4MMZA 3O11B 3HOGA 3VI4A 2WTOA 3OQ3B 4OU3A 3TEXA 2FLBT 1XO8A 1HDMA 5C3IA 1CUOA 2ED9A 2MCG1 3W0WA 4DGYH 2APSA 4B7IA 3BKYL 1YSOA 1BD2A 3P30L 2UWEB 4EBQH 2R4SL 3BGMA 2FUQA 1KIRB 1PLGH 3EYSL 2WLMA 4Y4HA 4YSUA 3CH8A 1LP9E 4K2UL 4LNRB 3TBYB 1CZ8L 3NIFE 2PR9A 3N85L 1KJMB 2XBDA 2YPVL 2DWDA 3UC2A 2BFVL 3BKML 2WQUA 1IBFA 4RFEA 2EQDA 2Z7WA 3GKWL 3V5KA 5AAMC 2O6EA 3QZWB 5D5MA 5AB9A 4FG6C 3DO3A 4M29A 4RGNC 2J5LC 4ABVA 5D72L 3DX9B 1MJ8H 3VFPB 3WKQA 5K9JL 2HWZL 3RL1A 5GZNC 3VXTB 1KYOK 1I9RH 2ZAIA 4XCEB 3M1CA 1UWEL 3AZUA 2QGBA 5IIEA 3V4PH 3DUSA 4HU8A 3RE0A 3N1QC 2V3DA 3KG5A 1BPVA 3TA3B 1Z9SB 1NJ9B 4WK4B 5JHLH 4DZ8A 1IC0A 2EADA 4ENZA 2C9SA 1H3XA 2WINB 4LE8A 2X4PB 5HI3D 3H3KA 4E9RA 2V2XB 4LVHC 5EUOB 4DAGH 1CDYA 2V4LA 2XIIA 5HDBF 5HI4C 1L9PA 1P5VB 2QVTA 2YZ1A 1EZLA 1OP4A 2BSBA 3TO4D 4U3CA 4YFEA 1XD1A 4XBMA 1KGCD 3P3SA 1DLHB 1TJGL 5DO2C 2B3IA 5CZKA 2P5WA 2Y36H 2EXWC 4XNYL 5MEPB 3HG1B 3NT0A 5EU6B 1OGTB 1EAPA 4JFHD 3NEOA 4JGNA 1ETA1 3OMAB 2C9UA 1CFSB 2IF7A 4W9IC 3KBHE 2CKBH 1AZZC 4OUUB 1D5IL 4G7VH 3VA2C 2ICEB 4XCCH 1HSAA 3MBEB 4EDWH 1HCZA 4NP9A 4QYOA 2W07A 3NSXA 4P3DA 1A9EA 2ZAGA 4UQIM 1BDYA 5CMAA 1A1OB 2XXFA 5FUZL 5L4JA 3KR3L 1KLGB 1R3IH 2NDGA 2ICWA 4EDXB 2JLPA 2HG5A 5L8JB 5I5RA 5AB1A 5F0MB 4CMMB 3TZVB 2HKHH 1RHFA 1NDTA 2Y2WA 3QC6X 2DQEH 3PJSA 3T04D 5LGJA 3GXNA 2DKSA 5D6CA 4EVNA 1BEXA 1JNJA 5TH2B 3QEQE 2LVCA 5C0IB 5DMYA 1T5WB 3BDYL 1GZPB 3JTTB 2EC9U 3HI6H 5ABZA 5DMGD 2VDPL 3FB6B 4H1LA 3X3GH 4N1CA 1QSZA 1GSMA 3L3OA 4FG2A 1HXYA 2I85A 2GIMA 3K6NA 5I2IA 1CDJA 1XH3A 1KF9B 4WEUD 5PAZA 4MWFB 1TVBB 1B0RA 3PV6A 5B1KA 4CVWA 2WW8A 1NCOA 2YRBA 4HKJB 5JXED 1C5DB 2ZUQB 4AMKL 2OTWA 1GMEA 1PJ9A 1R24A 2W60A 2PF6A 3MTRA 1ACYH 4QHLB 3VTAA 4YDNA 1XR9B 1ZHKA 3EJYC 1SVZA 1DFBL 1NDMB 2HFFA 1IAII 1AGDA 4ZPVA 2O61B 2YUXA 1HILB 2NW2A 1G7JB 1RL1A 1EXUA 5FA3B 1EMTH 1M4KA 4KDTA 4QT5A 3VFOA 5ES4B 5JW4Q 1NCAL 2X89D 5C09B 1G94A 4AC2A 1T21A 2X4OB 1CTMA 3O3BB 1UATA 1XF5B 1RZKC 3VQ1C 1S9VB 3D39E 2YAPA 3CTTA 3MOAL 4FQ1H 4TPRL 4ALAH 4RZKA 3EXLA 1DN0A 3G5WA 4FULA 4JPKL 3RB5A 1KEMH 4MCNA 4ONHB 3T0EE 4FAAB 5E5LA 1RUAH 4PFEA 1NKOA 4LCIH 1T89C 1IE5A 5EU6D 1UTDA 4NJ9H 2YXVA 5DD1H 3BUDA 3BVTA 3IETA 3PG2A 5TDNB 3I2CL 5C9JB 2CDEB 4RDQF 1YYMH 4UDUA 2Q6WB 3OLGA 1NOAA 1QSFB 2OBGA 4LCWE 4Z7UA 3L4YA 1SF3A 4FHJA 4NS0A 4N2CA 3E2HB 1E4XL 5AAPA 1OT4A 2W0PA 1KIUB 4CW1B 1WAAA 5I8EA 1CICD 5GZOA 1DUZA 1BBJB 1XCXA 5HXMA 2BCKB 1BGXH 1M56B 3HFML 4MD4A 3RQ3A 2ALWA 3US1A 1GIGH 3F00A 1P5UC 3IAQA 2ATPA 4PWGA 2HT4D 1F42A 1CO1A 3B1UA 1X9UA 2VDOL 4IMKA 4OY9A 4X8JB 4XO9A 4NHCL 2B0SL 1S2EA 1J11A 5F89B 1QZNA 5IQOA 4B9ZA 2D7PA 4W9DC 4Q52A 5D2NE 4D0CB 4P5TC 3MXVH 2CA4A 3MMEB 4JW3A 3VFNB 3ELQA 3NH7H 2JB5L 2AJXH 4IIQC 1TTFA 3NJIA 4H1LH 1MUJB 1ORSA 2BH0A 1JAEA 3TXAA 2W91A 3HE7A 1DZBA 4G8AC 4ZMAT 3FUHA 3VQMA 4ZD3L 1IMHC 3RFZC 2ADJB 4AK2A 2I9TA 1XR8A 3EOBB 4AEIL 1DHKA 2VDKB 5C0FB 4TTDC 2GJ6B 4OD3H 4TNWK 1ZT7B 4X7TA 5FC9A 5CN1A 2A4EA 2XV0A 1RMFL 1PJWA 2F68X 1USQA 4PJ8A 3SE3C 4D8OA 1KC5L 3O6KL 4NP4L 3T0WA 5LXGH 4DW2H 1KXQE 5C0IA 4JFDE 4GKZB 4AM0A 4FNLH 2FX7L 2ZG3A 3QIWC 1HHIB 3CFTA 4NRXB 2BOCA 5DHVH 4OF6A 2CAKA 5AFAA 5CD5D 1W72B 1FO0B 1AZRA 1RZKH 3HMXL 4L8CA 4NZRH 4GQZA 4OZIE 3UYRH 1C12B 4QRTA 2VZUA 4TQPA 2FZ3A 4JN1H 3NSCA 1KXTA 2JXMB 3VWJC 3MBED 4F8TA 4M5ZH 4YHYB 3QQDA 2WNKA 3DKHA 5LNGA 1OAYH 4PWKA 3ARUA 3MRJB 1O6VA 2ADYA 1YJDL 1UZGA 3HCVA 1RUPL 5BRZE 4HKZB 4S1RL 5F7EL 5EC2B 1MJJB 5JIHA 1OE2A 2DB8A 1PZUB 4L2YA 3PP3H 1H8LA 1FNEA 5C6PB 3VH8G 3IFPB 3OAWA 2JJTC 5KVGE 2FR4A 1M05B 2DTMH 3L1GA 4A6YH 3LKNA 1DJWA 5EDXA 4Z7UF 2R9HC 2IPTH 2EDNA 1BJ1H 1T0MA 2I26N 5DJCB 5BV7L 5IT2L 2HN7A 5DJ6B 1JZIA 1WS8A 1QZ1A 2G2NA 1MPAL 4NZDA 2CA3A 4XXWC 3L1OL 2BOCB 2EDMA 2ATPB 1N0LA 4FG6D 4X4ME 2M83A 5AZ2H 4BFEA 1VHPA 1IGCH 4JANA 3VD9A 3ZTNL 2K8QA 1Q9KA 2VDKL 4R4BB 3NG5A 2XWBA 3RFZA 2FD6H 3KAAA 4N22A 1G1YA 4HGWA 3V0GA 2ZWYA 4ZODA 4QXUL 4X9YA 1GJIA 4P8QA 1J86A 2APBA 4KQ3H 1JHTA 2O5NA 4DKFL 1KIPA 4G7RB 5F7DA 3ULUL 1AHWC 1O5PA 3OLEA 4Q6IA 3QUMH 2VLME 5CBAA 4G3YL 3SGEI 1FH5L 3PCYA 3RY5A 5J3HD 3FB7B 2GJ6A 1ORQA 2ZICA 3VXUD 5HDQH 1LHZA 3O4LD 4MZIA 1EHLH 2BP8B 1I8IB 3QP3A 4I5BB 1JN6A 3IK2A 4FQXB 1F18A 3LRMA 3BKJL 4KKZA 3BVXA 3C08H 1JXGA 5IFAL 4IRJB 2PR4H 1KDIA 5C0AB 5D1XE 3Q2WA 3UTPD 1Z3GH 1UM4H 3RZCC 2B9BA 4MAYB 3HG1E 25C8L 4P46A 5KVEH 5C0CD 5SV4A 4JUTA 4R2GD 1HWWA 4OJYA 4NRYA 2UXGA 1EPFA 4LL4A 4JFFE 1R5IA 1ITCA 2V7HA 2YPLA 4N5EC 3H56A 5B22A 4FNRA 5EZJB 1S7WB 1BIIA 5DVLA 4JCLA 3V4VL 5AEAA 5K1VA 4AQ8C 3K4ZA 3TBBA 1WEJH 2BSED 1QNZL 5I8EB 5H4ZA 3KPLA 3CZFB 1CD1B 3KWTA 5KN5B 3SKJL 2NR6D 1DJIA 1F3DJ 1HCFX 3WNLA 1JDAA 1EFXA 5ICYA 3TT1H 1I9EA 3ME0B 2OR8A 4MJ6B 2H1LM 5LAXB 1OSZA 3JWDC 3MRNA 1HHGA 2P45B 3UO1L 1TZGL 4ELDA 1IQWH 1IFHH 1L0QA 2ADIA 4X7SH 4ODXA 1Q4NX 3E3QC 4XP9L 1UCTA 3RU8L 3DHPA 2Q76A 3A4AA 4KXBA 1SJXA 4HH9B 4C47A 5KOVC 4HAFA 4EZJA 2EZ0D 3WNIA 4M62H 1V05A 2FJFA 4Z95L 5HYJD 1HILA 3DYMA 3TH2T 4U7MA 3V0IA 4KKLC 3V4UH 2E27H 4WNSA 5IJBC 4PRHE 5FIEA 3N5AA 4PMFA 4A7UA 3F7QA 5JPNC 1I1AA 4OBSA 4KHTH 2VQUA 5B8CC 4PJ9B 1VCBC 3AREC 1E4HA 1CI3M 4OIIL 1T7WA 4DGUA 3ZTEA 5IKCB 1UEMA 1NCTA 2L7QA 3Q01A 1KYAA 4F2FA 3ZDZB 3V4LA 1IGIH 2XV6B 4WDIB 4CDHA 1IC7L 1ZS2A 2W60B 5M7QA 4NT6A 2N59A 1IM3B 1OTTD 4PY7B 3L1EA 4KAQH 2XPZA 1L9QA 3V7AG 4G5ZL 1T1YA 5IY5B 1F0LA 2HLAA 3CFKA 5I1KL 5EU3A 1T5WA 1SBSH 4K3JL 3U46B 4POUB 1K4CB 3KPQB 1E28A 1UZ8A 4KRMB 4YUEH 2AJZB 4Z7WE 2V5MA 2NNAB 3O2DA 4ZUVA 1T7XA 3FPXA 3HRZC 3MV8E 4OLEA 5GGSA 1W0VA 2NXZC 4BFOA 5IHZA 5HYSA 1FL5A 2Q0ZX 2N01B 2XWEA 4KXZI 1NCBH 3NABL 5C0CE 4HKBA 3U25A 5C3LD 1DLFL 1RHHB 2VMJA 4A63A 1QSEB 1YEHL 4LVHB 1G9ML 3MLWL 4YEFA 1A3QA 4MBRA 2KDYA 5I0DA 3T1WA 5B1BB 5JHDD 2MHAA 1BW8A 4PYGA 1UXLA 3RY6A 2H6PB 5I0VA 4J8RA 3FFCA 1PKOA 3STLA 2YD1A 4ONGH 1G9MC 1I1FA 3QWRA 3QEUA 3SBWC 1EAJA 1NGYA 2A74B 4P4KA 1GY2A 1C16B 4YVUA 1YQ2A 1EEZB 3GM8A 3H2WA 5FHBL 2UX6A 4POYA 1FNEB 2DQHH 4OZHB 5CXPA 5JOFA 3GMLA 5EG6C 4BFRA 1JNHA 4W4NA 4XBEL 3S96B 1GYAA 1SLWA 2WY3B 3CHPA 1Y0LB 4JB9H 4KVNL 4K7FB 2CU9A 4X6DB 2VZTA 3L7EB 1EFQA 4UUJA 4ZQKB 2MPVA 4IOFD 1Q72L 3QDGB 4O2FB 2FSDA 5DHYA 4I0PB 4HPOH 3KLHD 2X40A 3FQNA 1DJHA 4UMSA 1LDSA 3NIFF 5H4YA 4C4UA 4Z3TA 5DZAA 3V0HA 2WHVA 3QJVB 3OJMB 4PRHD 1XGZA 3T09A 1IAOB 4IKIA 4OTXL 3QDJA 2BSRA 4GUPA 5FKPB 1Q9WB 2JQZA 3HC0B 3MX0B 3DUSB 3GI8H 5ID1A 1KBWA 2D7NA 2DWDB 3H54A 3ALXA 4BFIA 4FFWD 1Q1JL 4YK4C 5D7IA 4PW9A 1WFUA 1FJ1B 4MNQD 3UTSD 3LEVL 4BWTA 1DBBH 2D8KA 2EXWD 1I8LC 3WL9A 4ZW7A 2WUBL 2VL4A 3RUGB 5T3XD 5F6IC 1WS7A 3AXLB 5E6IB 3CFJA 3MAWA 3R4RA 4E41B 3S4SB 1MCQA 5EO9A 1RZFL 5EZIL 4RNRA 3QNYA 3VQLA 3KWXA 3VFTA 3HMWL 1BXAA 2W9EH 2VR7A 5J4MA 3J07A 5DTFB 4ZMYA 2DBLL 4U33A 3TEYA 1RSFA 1WPCA 3MRMB 4K94C 1O9WA 2UXFA 1IKNC 3TNMA 3HE7C 4YHOL 3H9HA 2QQNH 4C58B 5K93A 4O51B 3CDGA 1LNUA 3ZKQD 1OZTG 3B8YA 3GT6A 1E5CA 1DSFL 2UUDK 3S37H 3SE9H 1WUZA 3G5ZB 3VXUA 1FBIL 4TSAL 1IKFL 1ZLWH 2Z1PA 4JLRA 4MD0B 4ZS7H 3T3ME 4WFEE 4XAKD 1K4DB 4Z8FH 3A67H 4FL4B 4KQ4L 3EJCA 1NIEA 4DZBB 5JOEA 1J9SA 3WJMB 4O5LL 4P23B 5HHOB 4PWJA 3GRGA 3SGEH 1FCCA 4OKVB 1ZLDA 3PUCA 1NLBH 1ROCA 4NO0D 1ZY9A 1M42A 2JQMA 4U1JB 1CXKA 3AG3B 4PGDA 4WJKB 3HPLA 4HKBB 4NNXA 3BI9X 3SDXA 3AQZA 1KTKE 4LSPH 3F64A 4OZHE 4BV1A 1ZGLM 3FQTA 4U7KA 1M57B 4B53A 4M7LL 4F7EB 1HHJA 3KCPB 1SGKA 4PLOB 3TZVD 3QARA 2X4NB 5C09D 1TPXB 3U6RA 3VAEA 1G7JA 1NBYB 1U8IA 1IC5L 1SHXA 4XPAL 4WSKA 5DEZA 4XMTA 5HHQB 5IVXE 1NFDA 1EEZA 3DUUA 1OM3H 1VEPA 1ACCA 1KCRH 1CFMA 1T20A 3IFPA 5E1GA 3HBQA 5C70A 2XZAL 2G9KA 2GBUA 4AXWA 1CGTA 3ARBD 1PYWA 1S7VB 4OFKA 5IWLC 3MNWA 4JZNA 1MCSA 5DJYB 3L45A 4G6ML 4LHUA 4MNHA 2P52A 2WPGA 2ITEA 2ZAHA 4N0CD 3TPUB 4MD5B 4YH6A 3DO7B 3B6SB 3OKMB 3Q44A 4OF7A 2GEEA 1Q0YH 2F18A 3MLTA 2JKIS 3OR7B 5E5MA 1PS3A 1T2JA 4PRNB 4Z78A 5F7LB 2VDMB 2K0RA 3MGAA 5EZPA 2VABB 3PWJB 4KX7A 1KGJA 1MRFL 5DJAB 3RWCB 1LE5B 3SGJC 4LAQL 3FO0H 2CR0A 3PL6D 4Y9FA 4RZCB 3FH5A 4BH8A 2BW5A 4AEEA 4CC4C 4KXDA 1AQDA 1P84J 1E27B 5LBGA 1XZWA 4MCMA 3WKNA 4W9ZA 1JNLH 2D31B 1KG0A 4B50A 4MLIA 1YQVL 3C87A 5EN3A 1CF8H 1TCRB 3OM3B 3QO1B 4WCYL 2X0UA 2NNRA 3QFDA 3QDMB 2JQAA 1OAUH 5IVNA 1QRND 1MI5A 5GSVA 1G7MB 4H88H 1EJOH 5GRZA 2WQSA 3NA9H 1VZIA 1HE7A 3QO0A 2APFA 1GGIH 5F1NB 5LBSL 5BMFH 1NAKL 2XZCL 3LN5B 2HXAA 4MB5A 2XVLA 3CVIH 3ARGD 2WWMD 5I1CH 2EIZB 3O8XD 2WLIA 3GIVB 1DTUA 3FK3A 3CJJA 5ECJE 5C0RH 3QYNA 1BQ5A 3FTWA 3QUYC 1DLHA 4R8WL 1G9NL 2QHLA 3T2NH 3VXME 3US9A 2EICA 4CADA 3ZW3A 3FYEB 3RBSA 4PR5B 3QDHA 3AT0A 2LU4A 1ZTXE 4X8JA 1V8HA 4JO8A 5I8OH 2CD0A 3E1ZA 1TJMA 3ZDZE 4AQAB 3AQDA 2W81C 5E95B 2JKTM 1M3IA 5C7XL 1W6LA 3F2LA 2NYYD 3FFCD 5LNEA 4EKJA 4WGVB 1AMYA 2X5PA 5C1MB 3L2LA 1FFNA 2W59A 3ME0A 2E7HA 4LGRB 3T8MA 1EVTC 4ZFZB 2WMPB 5JPNA 2Q6WA 2CIIA 4ZOEA 1LO4H 3E6FA 1XF2A 1L0YA 1D3CA 2N3JA 4YXHH 2I7OA 4LCYB 1B9ZA 2WVVB 4IBTA 4OD1L 4G71B 4QRSB 2XPGA 2VC2H 2LV4A 4LP4A 2G2RA 1FZOB 1W6WA 2UX7A 2OMTB 2XY1A 3SGKA 3DOSA 2NNFA 4UNIA 5J0BA 1VFUA 1DN0B 1VEMA 4JQIL 1LO0H 4XP5L 2IH1A 3ZN6A 3QQ3A 2ORBL 2CMRH 4K5NA 3VI4F 3FOMB 4HIJB 4ALAC 2ZE0A 5CM1A 4OIBA 5E6ID 2OTUA 3CFNA 1BM7A 3GK8L 1Z66A 4DO4A 4FI8A 2PPCA 3BQVA 3GJEA 2BOLA 3ARGB 3D0AA 2YPKB 3BH8B 3NPSB 4GQPH 3MBXH 3BH4A 1FP5A 2HX8A 1FG2B 1MHCB 1JCVA 2A9MH 1XR9A 1ZHKB 3D30A 3RI5F 4PTTB 3CCHA 5A6IA 4I1NB 1I9JL 2W9DL 1ZHBA 3NSDA 1DUYB 4PJ7B 3HMXA 2FR4B 2NZ1A 5ESAA 4QWWD 3X1GA 4LSUH 4H26B 4ZAKA 3WSQL 3HZVB 3CMOL 1UWYA 5SX5H 4KNQA 1ZLSL 4PGJA 1NAML 1NFAA 4XWOD 3WTSA 4TLUA 1AR1B 2WNWA 4HX1B 1PGRB 3CFMA 5MERB 5JORA 5I16B 4PYHA 4X5XA 4JZOB 2AXGA 3MGOB 4ONOA 3RBGA 2N7SA 3EUDA 3FO1B 2QMKA 2N56A 2R1YB 4E42A 4J3OC 4RGOH 2PP9A 2I5YH 4G9FD 1DDHB 1EH9A 4BIKA 1DQKA 2H1XA 4EE2A 4P2OB 3POHA 4GSXA 1A3RH 5C2BH 1OTSD 1PG7X 3TC9A 5CIPH 3UG4A 5G5DB 1DFXA 3V4VB 5KG9B 1IAKB 1F4AA 1DVSA 1KCVH 3LS5H 4KK9C 2YRZA 1J05B 1QEWB 2QR0A 2UYLA 3JWDH 4L3CA 4N0YL 4UIMB 1Q1PA 1GYVA 4LFHD 5E03A 1P4LB 4DP6X 4LDLB 3VM7A 5I19H 1G7IB 3FAXA 4P9HL 4NQEA 2CCVA 3LOWA 3SPVA 4L0PB 2OW7A 3BPOC 3VDCA 3K5SA 1YNKH 2G2PA 5B7EA 3FO9B 1OQXA 1MFBL 2F53E 3QS3A 5HI5C 4ZXBD 5DD5H 1JK9A 2O5YL 2OMUB 2HWZH 4YGVB 4S2SB 4QRRA 5I5IA 2H2PC 3DXAB 3KM2A 3C9NB 4U1IA 1H3PL 3FB8A 4L4TA 5DWUL 3RNQB 3MLRL 4OM1L 1A6UL 2GSIB 2B7DT 2XIBA 4HUWB 4OQTL 3NMEA 5EC2A 4MXWH 4FNQA 2WWKT 4O58H 4HOZA 1KGXA 5FOBB 4MVBC 3GZPA 1MREL 4G1MA 1PVHA 5FM4A 3T6VA 3JYBA 1GS6X 4HZ1A 1IV8A 1J5IA 1L9NA 2E75C 4DF9A 2F9BT 2YPVA 1F3RB 4U4BA 2DWEB 2BS9A 1NEUA 3MUGA 4CSTA 3FMGL 4MJ5B 3EADA 1WFJA 4AZ8B 1L5GB 3TGXA 1FZMA 2K4AA 4ODTH 3V4PB 5AAWA 2A6KA 3IXTA 4XPTH 2VAAA 2VZ3A 4XAWH 1S3RA 1X3DA 4OCNC 4XTRC 1TVDA 2EIEA 1CN4A 2ITDB 2JCCA 2BSSA 2PYEA 1PKQB 1P0SE 4PV1C 3IJ8A 2DQTH 1M7DA 4BGDA 4QRPD 4XNMB 3PREA 4WY7L 1WZLA 3NJVA 3GSNL 4TVPH 3U7YH 5IF0A 4NNPH 2KPWA 4Q4IA 4Y4FC 1XCQB 4Y8DC 4FMFA 1LO2H 3B2DC 4JM2F 4PS3A 5AW0B 1EEUA 4R84A 4O51A 5HGAA 5I1IL 2ESVA 2CK0H 4H8WC 4PJCA 3RAJH 4NBZB 1E3XA 1U8QB 4KPHL 1AQKH 1QABA 1CFBA 2K4WA 3GBMH 1FL6B 3S3CB 1PAZA 3KLLA 4N87A 1A6WH 4ZQTA 4PJBB 4D0DB 3VD0A 4AIEA 4OF0A 3K4AA 3FT2A 4N90E 4DPRA 2H26A 2R2EB 5HVGB 3RL2B 1PZDA 3FSZA 3G5YB 5KZCB 5EBWA 2Q3AA 3ENEA 3ZDYB 5KSBE 1UC6A 4RBPH 4M48H 1BQHG 4L9LA 1MLBB 3ILDA 5AW5B 3EYVB 1CDUA 3HIZA 1V3MA 2BVYA 3PAUA 1I8LA 2J71A 1J5CA 2GAZA 5F88A 3HE6D 2AXFB 1FN4B 2HFEA 3ZYIA 3F7PC 4QRQB 1KBKA 4F8LA 2HLEB 2K6WA 3K8KA 3S8GB 3O6FB 4AQ1A 2CLVB 4JO4L 4J2XA 3PL6A 5CP7B 2VDQL 2GJPA 2GY7B 4JUSA 3GRWH 4YHMH 5GJTH 3N40P 1IARB 4IKJA 3KWVA 1RIHH 3MRQB 3D4YA 1FVCA 3GLEA 3L3JA 3PJSB 2Q2EB 4XE5B 3NSFA 4X98A 1UGKA 3U4EA 1R3HA 4U3XA 3UAEA 2EEBA 1MI5D 4Y2DB 3RGBA 4PRBB 5I23A 1DBJH 4UV7L 3L9RB 4G5AA 3K1KC 3MYJB 4U1MB 1KTDB 3N9GH 1RUAL 2NNCA 3RGVB 5FF6B 4BK8A 1KCSL 3ZRCC 2JNZA 3UBGA 2K9UA 3CFDB 2W07B 3CZKA 2XWJB 4XWGL 4PJFB 4R97C 5DQDL 2CG9X 5MEND 1EAQA 3T2OA 1ETZA 1YYML 3O8XA 2GT9B 1RZJL 1QLRA 4GG8B 3VRLE 4I13B 1V54B 4L8BA 3TO4A 2JE8A 4U1KA 2WQRA 3SDDA 1KTDA 1DR9A 3L9YA 2OMYB 3EGSB 4DOHE 5FM8A 4FABH 3C8KA 2JJSC 4OZFB 3VM5A 3S97C 2ZNWA 4HGKC 4D9QE 4FKKA 3C6EA 4BKTC 3UPAA 2IGTA 5I1AB 2NX5D 4FI6A 2YEZB 1UCBL 3JTTA 1VFMA 2A83A 3D2UA 2V2XA 1I7RA 4KKAD 1HHJB 4NCC1 4GG6E 3I74A 3QUYD 4NZTL 1NFIB 1WIOA 3DOIA 2C5DC 3CZEA 1P1ZA 4XN9A 1SYSB 5GRJH 3IEAA 3FU7B 4NPJA 3NJFA 4KNSA 4AJVA 3IGUA 4LCWB 4NCC2 1P4IL 1PIFA 3ZVVA 4X99A 2P1YA 4UT7H 1JV2B 2ZWNA 1BZDA 2R69A 3NP3A 4UQ2B 1RPKA 2FB4L 2KH2B 2OMVA 4TTGA 1KJVB 1NWOA 1RZGA 1ZGLP 2QSCL 2V7HB 3HC2A 1CQYA 5CLZA 2P3YA 1LVEA 4PRNA 3IDXL 2VLJE 4Y5XC 3SDAC 3O3EA 5D4QA 5JW4N 3Q8AA 3QXDA 5AB0A 4IGBD 4N2HA 2R59A 1URIA 4UOQA 3MRFB 2HFTA 5CZXC 5C0AD 4H25A 2FX7H 2O26U 4OW6A 2NXZB 3ESMA 4UT9H 2DIAA 2VDNH 4MJIB 1EAPB 2TRHA 2QLVB 3VD1A 3QI9A 5AD0A 1X9LA 4NQDD 3Q6FA 3N1GC 1LQSR 3MXWH 3MRMA 4LVOC 5DVMA 4ZMOA 3TOPA 1QASA 1TF4A 4V2CB 5FYLD 1JRHL 5DEFB 5HGBA 4LRIA 4M5ZL 4ODVL 1JV5B 3A6CH 2AQSA 3TN0C 1ZMYA 2FK9A 5BRQA 4PJEF 2G3ZA 3RTLA 3U2SA 5EU5B 1H3GA 2FO4A 5K5YA 3WIAA 1ZA6B 4CVXA 2AV7B 4FXKB 4NUGL 3TLRA 2DJSA 3PP4H 2Q3XA 3ZHDA 2MQCA 4ZFQA 4JO1L 1EFXB 3DX4A 3HI5L 3L3HA 1QFHA 4NQCD 1ID5I 3MRLB 1BAGA 3LS4L 2IPTL 1I3RB 3DBSA 2IFFH 2NY0D 2VDOB 3DROA 5DSCB 2WXKA 4X5RA 1AGBA 2G75B 1TQBC 3GMNA 3T1FB 7PAZA 5LWYH 1QLEB 3SYPA 1OCCB 4ZOCA 4ZDHA 2OZ4A 5AZ2L 3D06A 2XWZA 1NMCB 1J9CT 2B1AH 3MNZA 4XNUH 5IEHA 5E08H 3C6SA 2EVJA 3GMMA 3EYOB 4CU6A 2ZKMX 1R0AL 3OL2A 1KJ3H 3P9MB 2JI1A 1BSIA 3GBNH 3DA0A 5T3ZE 1F1GA 4TSBH 2DQIH 3MV01 4S10A 4C56E 3VRLF 2P44B 4XPBH 4BDVB 5I71C 3MRIB 1BLNB 5ISZB 1U2HA 3QUML 2XN9D 3IJSB 4FNSA 2RCSL 5DK0A 4YFDB 4F9PA 1AG6A 1E5ZA 1FH5H 1MJ7L 2N0KA 3ULSB 1A6VL 3QPXL 1T89A 5DZNA 3FN3A 5E8PA 4KZEL 3UBXG 4JFEB 2OKMA 4MQXC 2WKOA 1JGUL 4W4OA 4CN1A 1I4FB 1A8JH 2UY7B 4HFWB 4L23A 5CGYD 2DBJA 5BVJB 3QT2A 5LXVA 1RK1B 1S78D 3FJTA 4NFBA 5IJCC 1PZ5B 1W8EA 4FFWC 3DROB 1FSKC 4KTYA 3EFDH 3EXJA 1CBJA 5JTWA 5DJ0B 3V7MA 3JSSA 2XWXA 1RU9H 3BP7A 2VLJB 4N6QA 2AK1L 3CFBA 5HHNA 1SJEB 1X5XA 1UXWB 4OGYL 4EEEA 3LDBB 4XI5D 4NQCB 2J8HA 2FATL 3BHBB 1EJ6A 5GRWA 4LLDB 4DTGH 2ETWA 1WGOA 3ARDB 3ZZQA 2JCWA 3GMOB 1T0OA 3GXMA 2BWDA 3ZL2A 1MCBA 2A2QT 1E28B 3DJSA 4JY4A 4RMWA 5J57B 4PB0H 1I8KB 1FDLL 2ZWSA 3G04A 3MQIA 5I17A 4J3BA 3T0BA 4KI5F 1P1VA 2YXFA 3F01A 4M8QB 3CZSA 2J88H 2I9TB 5A2AA 2BVQA 3DX6A 9CGTA 1BVOA 3AY4A 4J8QA 4UOW1 2CJTA 1WQVT 5IR1A 3KGRA 5H2BA 4MB4A 2KZKA 1C1EH 4R26H 1TOXA 3M8OL 4XNXH 3MOQA 2JTDA 3AS3A 4MNGA 1UACL 4L8DA 4X4KA 1QLRB 3QUZB 1E43A 2P8PA 4UAHA 3KVDD 4X7SL 3OB8A 3UYOD 4DN3H 5AW8B 2QHRH 1AR1C 2IBBA 1OALA 3A4EA 1UD5A 4MQ7A 1NC4B 1PD1A 1PQZA 4P4KB 3FONA 3HLAA 3QWRD 1DVXA 2QFPA 2P24B 3F7RA 3CN1A 5I5JA 1OK0A 2AHIA 1R9FA 1LEGA 1JPSL 3MRKA 1TQUA 2GUOB 1C12A 1SQMA 5KUMA 3RWJB 4UMGA 2ARJQ 5CINL 3ZTCC 3I85A 3WN6A 1KEGL 4HF5L 1ACXA 1EUUA 2CUHA 1MCWM 4XPHH 3O3DB 2XWDA 3UABA 1MIEL 1IBZA 3MRBA 3SDCD 2Q8BH 3VFMA 1RPUA 2XU9A 1HSBA 5E6ZA 2WQ8A 2F0CA 2BJML 1FCGA 4LPXA 1X7TA 1T5XA 3I75A 4LF3A 1QRKA 3UJIL 1M9SA 3DVNB 4J1UA 1IGIL 1ADQA 3ARDC 3S37X 3HRZB 1NDGB 3QR0A 2VIRA 2WMPA 3SBPA 2NY3D 3HB3C 3FCSA 1Y6MR 2NX5A 5JPMC 1XF3B 3CHRA 3D2UD 1YA5A 3QIUD 4OSUH 4APXB 1AOHA 2IAMC 3LPFA 4OGXH 1JK8A 2E4TA 4WFFE 1QD0A 4BYHA 1N6QL 4UCFA 4EUPA 2HMIC 3CXDH 4MNQA 3UTSA 2GYSA 3OKKA 3I84A 2VW4A 2OMYA 4LDEB 12E8H 3CFCH 3NCXA 1J7VR 4GIPD 2WXMA 3SDDB 3EYQC 4WTZA 5I66A 1M7XA 1S9WA 3EDJA 1RZ8A 3CUPA 2P5EA 1A7RL 3CSYA 3QJHB 1YEWA 2EH8L 3LIZA 3OKLB 1MF2H 3SCMB 5DYFA 2YD8A 3HN8A 1I1CA 4MASA 4Y19B 1JPGA 5FO2A 2QBWA 3BPCB 3SB3A 1JZ7A 1T22A 2XCMC 4FEIA 5SWSA 2GK0A 3VG0L 4MDIB 5EN2A 4L4VE 3B3IB 3RURA 3ZL4L 4LCVA 3UPCA 1KYDA 4TV3A 4OFVA 1TVBA 2WWMC 3I3BA 3KPRE 2F15A 3R1GL 3MCG1 4R7DA 1S9XA 2O5ZL 2ZPKH 1YUHB 2BHFA 3OMZA 3WLWC 4M5TA 5AW9B 3X1FA 3DOSB 4TLTA 2OL3B 4JQXC 3VDAA 3MLYH 4KXCA 3I02B 4TQEL 3GLZA 1DE4A 4WWKB 4TUJA 6PCYA 1XH1A 2R29L 4NDMA 4QXTB 4DK5A 1TLKA 3DGGA 3FO2B 1MLCB 1SF5A 2X6UA 4AH2B 2BSEA 5GGVL 5IMOB 2DDQL 3MNMA 5D2LE 4HPOL 4CVZB 2C1PB 4YFLF 5AYUL 1VRSA 3RNKA 4ZOBA 3RWGB 4ZO7A 1P6AB 1X5LA 4YNYB 4PCKA 1R1CA 3IDMB 5DD3L 1W8NA 3K6OA 4HK3J 4X2UA 3O9WA 3J2PA 5H94B 4OTXH 3UTZB 1HOEA 4L0YA 4P2YA 3P30H 1R5IB 1KTCA 2YPLB 3QQ4B 4M61B 3ISYA 4JHUA 1KZYA 2CSPA 3S4SG 2R1XA 4FXTA 1M71A 2B1HL 3N85H 2KT6A 4NO0B 4X6DE 5TQ2H 5KYNA 4FQPA 2PYFA 1JF1B 3PHQB 5L0QB 4NN7B 1BOGB 2YA2A 1KB5L 2LVEA 1JK9B 4QRRB 1H3TA 4RGNB 1U58A 3CLFL 1XGPA 5SWZA 2PCXA 4J2QA 5A2CA 2OLDA 2R51A 2ZCKL 3WKPA 4GIAA 1XH3B 4B60A 4OLYH 2XRAH 1SVBA 5HVWA 4N20A 1TETL 2HRPL 3QW9A 4P9MH 5AZEH 1M7IA 3LX9A 2WC7A 3GZQA 3RILA 2RD0A 5EF3A 2E9JA 3I6SA 2DBLH 3L5WA 5E8NA 2I07A 4JY6B 4XO8A 4IDLA 4NC1C 3TX4A 4HS6A 4GRWF 4YHOH 5D6CB 4ERSL 4EVNB 2YK1L 2ED7A 3LRSB 4G11A 1U8JB 2ZZUT 1ED3A 1HHHA 1TJGH 1JGVH 3V4PA 4EZKA 3X14A 1KYUA 2CLRB 4P2RE 2Z0BA 4U6XA 4QRUA 2H0PA 1CFVH 1E9OB 1ICTA 1R3KB 2VDRB 4JFTA 3VCLB 2NOYA 3PAYA 2W0LA 4X6CF 1Q9KB 2CALA 2CKBL 3KPRD 3HN3A 5TGBA 3CFIC 1UWFA 4R96A 1KELL 3QULA 4PJDA 4F24A 3NQIA 3IDIB 5FUZH 3VYPA 3FU5A 2BP0A 2JIXA 3S7GA 4AUJA 4L4VB 2WZAA 4K3DL 4M6NL 2AABL 5ISZA 3BVUA 3IPEA 4QNPF 1S7RB 2IO5A 4QD2E 4GUOA 3R19A 3ZGHA 3JT0A 4JN2B 3F8UB 4XN1A 3D85D 1V5JA 3V2AR 1BVKB 5FW8A 5L2JB 2NTFB 2R23A 4M1DL 1EEYB 2IXQB 4RDBA 4KXZH 3O45A 4XMUA 4KRLB 1KGUA 3MBWA 2R8SH 3EYOA 1U91B 2WQXA 5HHOE 1F13A 4QOKD 3QNYB 2E7BA 2EC8A 3GUTA 1HYSC 3FZUC 2PWHA 4KKCC 2C1OA 4F2EA 3SY0A 1U95A 4XI5C 3CNKA 3MLVL 3PHOA 3QE5A 5H37A 3U36A 4EIUA 5D2LB 1CE6B 1KXTB 1CLOH 1WH0A 3WY1A 1JDDA 4XPAH 4MD4B 1E65A 1XEUA 4JFEE 4NN6C 2FSEB 1PDKB 4YL4A 3VGHA 5BNXD 5JYMA 4CC0A 3GD1C 2BNQB 4WHTB 1H0DB 2IBZX 2X3AA 1FO0A 4Z7VB 4O02H 3VD7A 3DI2B 3ULUE 2NW3B 4AYGA 4KK5C 4K8RH 4LRIC 2DYSB 4B97A 4WLCA 3VFSA 4IGBA 2E8YA 4I89A 3IETB 4PV9A 5TDNA 3OKYA 4Y2NA 5C9JA 2OMZA 5CEZE 3TCTA 3O2VL 4LNRA 5C0BE 2ATKB 4DGYL 4P2AA 1X5MA 2FQFA 3G6DL 3FUIA 4LIQE 1BVLB 1EMTL 5D7LE 4A6YA 3HG2A 4P2QE 5EBGA 5ESQB 4JQVC 2VSKB 3STZB 1S5IL 1XR8B 1BLIA 4K0OA 5DHXB 4RLDA 1IILE 5B39A 4XMPL 2WKOF 2IANB 4EXKA 4QT5B 1S3KL 2ZSVB 2WBJD 2ZF8A 4KVCH 1T6WA 1YVLA 2Q7NA 3VXSD 2WTPA 4HU2A 1W0WA 1MJ8L 4PTTA 3OKLA 4ECNA 4M56A 3PGFH 1D7DA 4D0CA 3LNGA 2XNAA 4X6FA 3GSWB 4YSEA 4E9SA 2BP5M 5DD1L 3CZNA 4Q56A 3I2CH 1UWEH 3MV9B 5IEKB 1J0HA 2WXQA 2YPKA 4PVMA 2D9QB 3TBCA 3ZXAC 5BOJA 5AOLA 4HJ1A 1EJOL 3N42F 4OR1A 4R3SA 4NC2B 3X11B 4BUGA 1FNSH 5JHDB 3PDOB 1KENH 1DVZA 1JHKL 5DUBA 1QLFA 1JZ6A 4ZX6A 4O9HL 2K6ZA 1GZHC 1HINH 3HG3A 3H0TA 3TYFA 5MENB 3QDAA 1A22B 2B0SH 3OX8A 3QDGE 3GI9H 1HS6A 2E56A 4TNEA 4U1LB 3GSRB 2B2XL 3AUVA 3SBWA 1I8UA 3ARBA 3X1EA 1UD2A 2AXHA 3EFFA 4OJFH 2AQTA 3Q06A 4JG9A 3ZOAA 4X7DC 4GKNA 3II3A 1FWXA 1OGAB 1A6ZB 2F7RA 3O6ML 4RZCA 3H42H 3PS6A 4K94H 5LGJB 3MPCA 4OZ4A 5IUSA 1PY9A 3FBQA 4F7MB 4HIIA 3DNKA 4PRPD 3V5DB 2XICA 4I0PA 4F8OA 3U0PB 2VABA 2X9ZA 3EHBD 5FUOL 4ANUA 4H8WL 4PJHA 4GAYA 5C07D 1JFQL 3P3UA 3MLZH 4ZI8A 2HKHL 4WNQB 1T22B 2DQEL 5E8EA 2NUTA 3BPCA 4P2RB 3ULUD 4UTCA 4P04A 5BXFA 3NTCH 3QC5X 4Z5RA 3L3OC 4KO6A 5ESVA 3VSTA 3QUZA 5F7MC 5DQ9B 1FL3A 4LL9A 3SIKA 4ABUA 2JKLA 3DWTA 3LEXB 1F3JB 2AKRA 3FXIC 5J56B 1BWWA 2I69A 4O4YH 4H13C 2IWKA 4J8RB 1JZHA 1L9RA 3PWPB 1DL7L 4GMTH 1N8ZA 1BYPA 4NWTL 1CL7L 3FT9A 3IGLA 1MHHA 1ZT4B 1RZKL 3IJ9A 1JF5A 3FF7A 4IJ3B 4NZUL