2HX8A

Crystal structure of cu(i) azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "csphqgagm", at ph5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCSPHQGAGMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Engineering Copper Sites in Proteins: Loops Confer Native Structures and Properties to Chimeric Cupredoxins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hx8A00
3IN2A 1JZHA 1M57B 3NT0A 4P5SA 1KDJA 3G5WA 1BXAA 2FQFA 3FU9A 1OE2A 2AFNA 1B3IA 1GS6X 2ZONA 1X9RA 2FWLB 2QDWA 2Y69B 6PAZA 4A66A 4M4RB 1R1CA 2YAQA 3EH5B 4K9JA 2OCCB 3KW7A 5F7BA 3QJVB 3KW8A 3L45A 3T6XA 4EF3A 1JVOA 3DIVA 7PCYA 4TXVB 4N8UA 2BWIA 4BK5C 1BQKA 1BQRA 2IDQA 1DZ0A 4CSPA 1N68A 2IWFA 4W1TA 4JKNA 1E65A 1IC0A 4KNUA 2HLEB 2PP9A 2JFCA 3AW5A 1PZAA 2VMJA 1KGYE 4FA7B 5I6NA 1BXUA 2GBAA 4AX3A 4HCFA 4GP8B 1ZDSA 2UXVA 3ABKB 4PCYA 1HAUA 3ZIYA 3FQ2A 3NP4A 4G71B 1UATA 1NIAA 2GI0A 3AG2B 1GS7A 1L9QA 1M56B 3AY2A 3BVDB 3OD3A 1A4AA 3PAVA 1W6WA 4YSRA 4F2EA 4YVUA 3FYIB 1PZBA 4AKQA 1KBWA 3BQVA 1OCCB 3SQRA 1SHWA 3WIAA 5I6LA 2VW6A 2DWTA 5B1AB 1W6LA 3C75A 4GYBA 4KO7A 4DP4X 3ZDWA 1NWOA 1JXGA 2YAOA 3SBPA 5LDUA 3TA4D 4KO9A 1KDIA 5I5IA 2P80D 2UXGA 1MZYA 4YSDA 1NWPA 2I7OA 2JKWA 1KCWA 5I5JA 7PAZA 1URIA 1IKOP 3ZX1A 4YSUA 2BO0A 2XV3A 1OCRB 3EHBB 1A8ZA 4YVNA 4NAJA 2UXTA 4DP9X 1J9RA 2HXAA 2GHZA 3PAUA 1QLEB 2XX1A 3V9CA 1AS7A 2PP7A 3U25A 2IDFA 5I6OA 1J5CA 3CVDA 1AZUA 2BW4A 3QJUB 2BP0B 2HX9A 4BWTA 3FQYA 3WKQA 4KNTA 2MTAA 2YAEA 1PLCA 1XB8A 2DYSB 3T71A 3CZUB 3SBRA 3NYKA 1BXVA 2EINB 3ZBMA 2HX7A 2IDUA 1GY1A 1VLXA 1KV7A 2VM4A 2BP0A 5B1KA 1EZLA 3UACA 1TEFA 2QPDB 2YARA 2R7EB 2YXVA 2RACA 1ET7A 1NIBA 1OV8A 1PLBA 1CUOA 2BW5A 2UXFA 3T6WA 2N0MA 4E9RA 5I28A 1XMEB 2PLTA 2CBPA 4N4YB 5D4IA 1JZFA 5B7MA 1WS8A 4F7KA 2DWSA 1AZRA 1ET8A 2A3TA 1V54B 5F7AA 1HAWA 1MDAA 2IAAC 4HIPA 2R7EA 3FSVA 4HZ1A 2H47C 3QJTB 2OJ1A 1JOIA 1AR1B 2FQEA 2JXMA 1E5ZA 2XX0A 3TASA 1NZRA 4A2HA 2FJSA 2VW4A 4P5RA 3ASOB 3FS9A 2IH9A 1XB6A 3WNIA 2VN3A 3IBOA 4MFHA 2VW7A 2HRHA 3X1BA 2PPAA 1NIDA 3NJGA 1PLAA 3AZUA 3GYRA 3EF4A 3S8FB 1A65A 1PAZA 1QHQA 4DP0X 3TBBA 2ZWNA 1HFUA 2BZCA 4BXSV 4DP5X 4KOCA 2BHFA 1AZCA 1TKWA 1SDDB 5I26A 1BYOA 2IWKA 2XYBA 4F2FA 3WG7B 3PLYA 3NSYA 3S8GB 1YLBB 1F56A 1ZV2A 2EIJB 2YAPA 3GXUB 1OE1A 1CURA 4HCIA 4L0PB 4DP6X 4G72B 3QJQB 2DYRB 1OCZB 3UABA 1PNDA 4A2FA 1SDDA 4DP1X 1BAWA 1NIFA 4A68A 3ABMB 1QNIA 3EH4B 4HCGA 5IY5B 3OQRA 2QT6A 1PY0A 3HB3B 3UGEA 1BEXA 1NDTA 4YSPA 4KNSA 5B7FA 1GY2A 4E9YA 4E9SA 5FC9A 1JZEA 2TSAA 1SF5A 2XU9A 4YSTA 4YSEA 2I7SA 4E9QA 4FAAB 1RKRA 2Q5BA 4ENZA 4HALA 1CYXA 1GW0A 3EH3B 1AS8A 4JHVA 3QJSB 2PPCA 4GY4A 1E30A 1ASQA 1J9QA 5AZUA 2I85A 2X87A 2X88A 1ZIAA 1CYWA 1JXDA 1NIEA 3OMNB 1A3ZA 4DPBX 3FU7B 4A2DA 4WTQA 2PPFA 4G7SB 3FSWA 3NJHA 4JHUA 1JZGA 4M3HA 2IH8A 1ETJA 2LLNA 2J5WA 2CUAA 2XXGA 5E9NA 3OMAB 1E67A 5I6MA 3CDZB 1T5KA 1MG2C 3X1NA 1RCYA 1J9TA 2XLLA 1JZJA 1L9SA 2XV0A 3ASNB 2Q9OA 3FU7A 5AFAA 1L9PA 1AG6A 1GS8A 2GC7C 1DYZA 1FFTB 2CAKA 4PAZA 2QDVA 3CDZA 3NJKA 2VSKB 2BZ7A 3NSFA 3TBCA 3X1GA 3ERXA 4KOBA 4UAHA 3X1EA 2YQBA 4GXFA 1ZIBA 1PCSA 2EIMB 5ANHA 4BDVB 3V9EA 2FTAA 3NJIA 2FQDA 2H5UA 1A4BA 3FU8A 3JT2A 1GSKA 1MZZA 9PCYA 1KYAA 5PAZA 2WO2B 1XB3A 3CVBA 2W88A 3NP3A 1PNCA 1M9WA 1SFHA 3FPXA 4BDVA 1X9UA 1IUZA 3UAEA 2EIKB 3FSZA 3MX0B 1I53A 1JERA 1IBZA 3IE9A 3FT0A 2GIMA 3PCYA 1OE3A 2FT7A 1WA0X 4QLWA 1FA4A 2UX7A 3QJRB 4KO6A 1JXFA 1AS6A 4Q8BA 1GYCA 3X2QB 2FT8A 4G70B 2XUWA 1TEGA 2CALA 2B08A 3WNJA 2BP8B 5I6KA 3WKPA 4YSCA 2HZHA 1AIZA 2HRGA 4A2EA 1PZCA 3ABGA 2WSDA 4A2GA 4HAKA 3H4FA 4HHGA 3N55A 4NB7A 2WO3B 1NTDA 3NJNA 2YAMA 1IBYA 1AACA 2BP8A 4YSAA 2YAFA 3PPSA 2PCYA 4G7QB 2DY2A 3T6ZA 3N2JA 1WAEA 2AANA 3OM3B 1OOWA 1AAJA 3NSDA 4BWUA 1AQ8A 4A67A 1ASPA 4CSZA 2XV2A 4ZK8A 3S3BB 3NSCA 1E5YA 4UANA 6PCYA 2AVFA 4DP8X 2ZXWB 2AZUA 2Y1AA 1PMYA 3T6VA 2H3XC 2PPEA 2FNWA 5I5MA 1PF3A 1TU2A 1BQ5A 3QQXA 4DPAX 1RZPA 1V55B 3ABLB 3AG1B 5TK2A 3CVCA 4E9WA 3TU6A 3DTUB 1JZIA 4AKOA 1NPJA 3PAZA 1RZQA 1KBVA 1ID2A 1L9TA 2PP8A 4Q89A 4HHWA 3S3CB 1J9SA 1NINA 3IN0A 3H4HA 2NRDA 4DP2X 3JTBA 5I6PA 2PCFA 4DPCX 4KO5A 4E9VA 3NJJA 2IWEA 5A7EA 1WA2X 1SNRA 4GP5B 2IDSA 3SBQA 2B3IA 2PPDA 1OF0A 1ASOA 2EILB 4NERA 3IEAA 2YXWA 5B7EA 4GP4B 2ZOOA 4E9TA 1AOZA 3FSAA 5B1JA 3UAAA 2E86A 5EHFA 4YSSA 3RYMA 1EHKB 2GSMB 2VM3A 3CG8A 1SF3A 3H56A 1JVLA 1MG3C 8PAZA 3DKHA 3X1FA 1A4CA 1ILUA 1AANA 1AZNA 5TK4A 1V10A 2W8CA 3MBWB 3WI9A 2DV6A 3D12B 1AZBA 3PXLA 4UF7C 2J56A 2J55A 4RH4A 1L9RA 5PCYA 2IDTA 4YSQA 1NICA 3AG4B 2OV0A 1KCBA 3FPYA 5D4JA 4AI7A 2AZAA 2CJ3A 1SFDA 1FWXA 4QKTA 2YAHA 3FQ1A 3T9WA 4E9XA 3NJMA 2XWZA 1SHXA 2HX8A 3QPKA 1L9OA 4DP7X 2VSMB 4YSOA 2CCWA 1OCOB 1CC3A 4BWWA 2XVBA 1ZDQA 3GDCA 2QPEB 1WA1X 1SJMA 2GB2A 3NJLA 5AKRA 1AG0A 2TSBA 1NPNA 4X4KA 3AG3B 5B1JC 1GR7A 2FT6A 3S3DB 4AKPA 2P80A 1WS7A 4YL4A 1ZPUA 1J5DA 5B3SB 2BWDA 1BYPA 4G7RB 2FQGA 4WKXA 1ADWA 3OMIB 4W9ZA 3NJFA 5D4HA 1ILSA 2GC4C 1ET5A 4AZUA 2MRYA 2XXFA 3HEIB 1W8EA 2J57A 1N70A 4BXVA 3FYEB 5B1BB 3UADA 2UX6A
chains in the Genus database with same CATH superfamily
5T3XH 2J73A 3SEPA 1JV2A 4P5SA 4UQIM 3UTQB 2BPBA 2UY6B 4ONFL 1KGCE 4FFZA 1IFGA 3ZGHA 2WBJB 5A7BA 4ODVH 1I7RB 5GISL 3IFNH 1AVAA 2AFNA 1UD3A 3CVHB 4JPSA 4M56A 3KZ8A 5D5MA 2H6PB 2EO7A 2JJSA 2X4SA 4IRZA 2ED7A 4ZDHA 5F9DC 3ESPA 4ODWA 2J8UB 4WO4C 5DQJB 1CGWA 1Z9LA 3DMMB 1T5XB 3QJVB 4OZGE 2O5ZL 4K3DH 5FB8B 1ZXKA 3J2PA 3WMQA 1RV6X 2RCSL 2XWJB 1FFRA 2ZUQC 4ESKA 3L9BA 1S5IH 2NY2C 3G6DH 3AGVA 4NQXA 1N68A 2H9GA 3IDIA 3GDBA 4MJIB 5GGSA 1MFUA 1P7KB 1WCBB 3T5WA 4FA7B 3ZKXB 5I6NA 3QDJD 3RUGE 2P5WA 3VQLA 3H9SB 4MA3B 3QB7C 5IQLA 4GKZA 2Y1ZA 5BQ7B 4HIHA 3O3UN 4APQD 5I18H 3RVUC 4I1RA 5GGVH 2ICEA 1A6WH 1PG7X 1KNOB 2PYED 3BKJH 4G2AA 2ZTBA 3NP4A 2WKGA 2HVJB 1FH5H 1I9EA 3BVDB 3F05A 3GLDA 1A64A 1MREH 1QW8A 3LNFA 1YEGH 3LPWA 4IRJD 4L1LA 4OZHA 5E5LA 1E27B 2NX5E 2LVCA 2ED8A 1NAMH 2VW6A 4NHCH 2QLYA 3ZL2A 4PYHA 3KXFA 2WVUA 3RFZA 3HN5A 1ZLUH 3SB3A 2H2PC 3SDCC 2BRQA 4KRLB 3VFGL 2OTUA 1F4AA 3PWUB 2CKNA 3C5SB 4C56A 5CEZE 4P2QA 1FFOA 4OSUH 2OR7A 5JW3L 2CLZA 3ESMA 4MB4A 5I5IA 3VXMA 3T3PF 4QRQB 1P5UA 4MQXD 5E08H 5IFAL 2IF7A 1JJUA 3BUTA 4FFVD 5F9JA 2Y5TB 1I8MB 4QO1B 2H0FA 1YCSA 3CVIL 3QJHB 2F18A 2EDJA 2NDGA 3VVVA 1QLEB 5SWQA 1OT1A 3S48A 1DQLL 3ARFC 1S7VA 4OZHF 2GEEA 3VFSB 1GZQB 2IOMA 1NBZA 3A5VA 4L4VE 5C0CA 1WAPA 1U93B 5HDOA 2YEVB 1FHNA 3FSOA 4B3VA 1LVEA 1R3LB 2ZKYA 2DYSB 4KVNL 2HTLD 4OZIE 4IKLA 2EYSA 3NYKA 4YBLB 3T0ED 2CUIA 1KFGA 4ISVB 3V4VL 2WLIA 3QWOA 1YN7A 1G0DA 4JDTH 3C60B 1JPFA 1VLXA 2DYPA 5D9SB 4TL5A 3MLZL 3VRIA 4QOKA 1MCCA 2CA4A 3QWRD 2QKSA 1AZVA 4I2XB 2BW5A 3MLRH 1ZLSH 5EZLA 4CU8A 4ZSOB 3SE9H 5ETUA 2WLLA 3I75A 4BK8A 2Y2YA 2YQ2A 1XF3A 2FSEA 5BZXA 5J3HD 2NMSA 4ZUWB 4I1NB 3G6AB 4U49A 3HNSH 2MCAA 3HZ3A 3MOBH 4KJPC 5HI3D 5KSVB 3FHAA 3K7UA 1I8AA 1ADQL 2GT9A 1MY7A 1P2CA 1Y18A 2R8SL 4NZTH 4A2HA 4YEEA 4YNYA 4PJBA 2IPTH 2F19H 4LNVA 1WF5A 2ZUTA 3VXSE 5IEHB 3U6RA 5C71A 4L1DA 1P84J 4LP4A 5EUKB 5D6DA 3VXQB 3IJYA 1K85A 3KPNA 4PR5A 4F8TA 2BDNH 2BSEA 2EZ0C 3NJGA 5E9DD 1IVLA 1OVZA 3QIUD 1CGYA 1FE8L 2R29A 5DLML 4M48H 4KHTL 1R33A 4UB0H 1U8CA 3UZVB 2EXYD 3WEAA 2EH8L 2G2NA 2RGSA 3NAAL 1TQSA 1QASA 1A8JH 5L9DL 3ZTCC 1S8DB 3CLEH 3FCTB 4HKZB 2K7PA 2N1KA 4TF4A 2DL9A 3B5HA 5DRXB 3QDHA 12E8H 5C0DB 5DQDH 3VGAC 1KJMA 1V7NH 2FX7L 2Q3ZA 4O02H 3LN9A 1PG7W 1T2QH 1CLOL 1JDDA 4YZFE 4XP4L 3GI9H 2YQ3A 3BGMB 3UYPB 3LN5A 4PJBF 3SQBB 4WJG3 3VM5A 4OQTH 4X6CE 2D4DA 3VNZA 1U0QA 2XFXB 1KGWA 3IDGA 4Y4KC 5EIVA 3UGEA 4DKTA 2CD0A 1F1AA 2A9DA 1SOSA 4CDGC 4LCUA 2B2XH 1KELL 4FAAB 4UOW0 2N7SA 3KAAA 4XN8A 1R5VB 4UDTA 2DI7A 3PGDA 3KLSA 2X87A 2X88A 1JSYA 4MCZA 1UD5A 4K5MA 3RVVD 4AYGA 3RB5A 4KKCC 1EFXD 5CZXC 2ICWA 3O6LL 3SGKC 3VWJA 4NKDA 1SUJA 3MRPB 1NOLA 2V4LA 4H1LG 5DHYB 4DPBX 1UXWB 2VR4A 3NFSH 2CO2A 3L5JA 3T8XB 4P99A 2HKFH 5EOCH 1KGJA 1Z6JT 1SUHA 4PJEA 4DQOH 4QR7A 1B4TA 3K91A 1BZDA 3V79C 4BUGA 3ASNB 4UV7L 4IHOA 4KITB 2FBOJ 3MV9B 2D03L 5AW5B 4FLQA 3I6SA 4JFDE 3UGXA 4AEHH 4AYDC 4P59L 5KANG 4X9GA 5E56A 4O00A 3G5YB 1U8JA 1NGYB 4HFWB 3DSNB 2AV7B 1JTOA 4JUTA 1NEUA 4KOBA 2HT4C 1WPCA 1A7OH 5CCJA 1PG7L 1YYLL 2EDMA 4GXFA 3SGEH 1KCVL 2RQ8A 2CM6A 3GMOA 1SEQL 3FTUA 5AW8B 2VDKL 4FQHB 2ZOLA 3NCJH 4FQ2L 1TQBB 1QEWA 2FQDA 4U1KA 5E2TH 2Q3XA 5EH1A 3LIZA 1RK0B 1DBKH 4J6IA 3BEWA 4I1PA 4Q0XL 2GTWA 2QVFB 4ORGB 2RJMA 2QSCH 4QT5A 1JXJA 4PJEF 2IALA 2FL5A 2PTTA 2VDMB 3KPPA 4ADJA 4LEBA 4QRRB 4BFRA 4PG2C 2H1XA 3MAWA 3VQ2C 2PYFB 1RZKH 5E6IA 4AQEB 1VB9A 3F65A 1IGFL 4O5LL 4M43L 5C07E 4D2NA 4EXKA 4OKVB 2VDPB 5D7LB 3V5DA 5JIHA 2NY0D 2PWEA 3CQPA 4M4PA 3PQYD 4KROC 4G9DB 2B1HL 3ZMEA 4L3FA 4D8PA 2QSTA 3FO9B 1JNNH 1TEGA 3MX0A 4ZMXA 3ZDZF 4TVPE 4HV8A 1UZ6F 1ZVYA 1GGBH 1H9VA 2VLJD 1CG9B 3P3SA 4Z3IA 2BRRL 1JFQH 3H85A 5D1QD 4HZAA 5EO9B 1TQCC 1FNGB 1KTCA 4PWEA 1IBHA 3FQ4A 3H4FA 3EJPA 1H6EA 3LV3B 3D4GA 2Z9TA 4FXKC 1NMAL 3QIWB 1AACA 4JFOA 5D72H 1XF4A 4K5NA 3UH8A 2YAFA 2CHXA 1NUNB 2WVVB 1KCUH 3LZLA 1CXHA 3BUDA 2EIZB 3BVUA 3JV4B 5DMKB 2P45B 4BWUA 1AQ8A 1YYMH 4U6XA 4JFQA 2GITB 2BNQD 4HK3J 2V7NA 3CXDH 4LDEB 4PJHB 3DXAB 4R5VA 1UOKA 2J1YA 3BZFA 5LGYA 2KZWA 4NC1E 4LT7A 4YHMH 1T6BX 2X6MA 2MCG1 2NW3B 3QDGA 4LHUG 1MI5D 4CW1A 1GW6A 2D2OA 1G0XA 1U8HB 1Z0MA 2O5XL 3AS0A 4FNSA 4KJYA 4YE4L 5GZND 2OQJB 3JWDC 1WBXA 1HYSD 3D18A 1UFGA 2DTSA 5FXCH 1IAMA 3GMQB 3WFCH 2Z31D 2X6AA 2E4TA 1FZOB 4F7PA 4RIRA 1ID2A 5JW5A 1N10A 3CN2A 4WY7L 3NA4A 5KJRL 4MNHA 3DHPA 1BSIA 1IAIH 1MFCL 2WQWA 1CLYH 5A6IA 3C6EA 3FN0L 1AXTL 1WBZA 2VXVL 3C60D 3GGWB 2FJGA 2SEBB 4I2XE 4GP5B 1NSNH 2NSXA 3VJ6B 1L4IA 2VN7A 3NG5A 4PRAB 4Y8DC 5AL0A 4ZSOE 3DK0A 3MNZB 5DDHB 2J4WL 4U1JA 4NERA 5KBPA 4UQ2B 1S9VA 2VXSL 1JPSH 1B90A 4Y4FA 1D5BA 3RDTD 2UVEA 2Z91B 4J3OC 5IV2A 1JHKH 4G8IA 2P8PB 4JPVH 3D6GA 1FL6B 3DTDA 4GS7B 3DO3A 1CMOA 3R06A 4GMTH 2X0UA 2CKBB 4HZLB 3O11B 4N2GA 3IJSA 1AANA 5DVNA 4KX9A 2BVEA 2OTPA 2BVQA 5FYJE 2GABA 4CVXA 4HUWB 4APQA 1OGTA 4PRNA 5CEZL 3KPMA 3O4LB 5I2IB 1CGSH 1AFVL 4I88A 1CICC 1DVFA 1UJTA 3L4ZA 5KUMA 1CFMA 3UEQA 2PYEA 1UA7A 5HDBB 1FIGH 3DX1A 3HUJA 4BHUI 3ARWA 3PS6A 4IRJA 5DZOA 4D9QE 4N8CH 3MRCB 1KACB 2O5YH 2ZXGA 4H5SA 4NNYB 4L9DA 4MJ5B 2Y07L 1YEJL 4ZW5A 3P11H 4GAYB 1ZAGA 4JJ5B 3UPRA 4U0QB 4PGCB 4U6YA 1M2VA 1BVKB 1CC3A 4BWWA 4ZPVB 1U8KA 3TEXA 3MKKA 1OAUH 5G4NA 1AG0A 4XE0A 3BW9A 1KPUA 1AE6L 4Z3TA 3DX7A 3QCUH 1ZPUA 4FD0A 1F4WH 3NK3A 1C5BL 2L4OA 3U2SA 4BINA 3OMIB 4LCCA 2FO1A 1XIWB 3VYOA 1ACYH 3ZK0A 4HUCA 3HN8A 4JZJA 1YDPB 5LWYL 4KZEH 3HUJF 1BEYH 3NT0A 3WS3B 2VWEE 1EANA 2V2WA 2BERA 2XQYA 3ARBB 4CBZA 3IFLL 5J1AB 1NCBH 4CKVX 2D7TH 3WOVA 2XI9A 3KYMB 3QFDA 4PJXA 3WJLC 4LHUA 3S5LG 3BSGA 3T0EA 5HI5D 5FM5M 4Y8AA 4NC1C 1LO3L 1YNLL 5CLWA 1L0QA 3OKOA 4HC1H 1JVOA 1ZKAA 1QD0A 5AVUB 4N8UA 5L88H 5HGDB 3T0AA 1HWWA 4K0OA 4PJIB 3QWRA 2PR9A 4YFDB 1BZ9A 5J6GB 5JW4M 5HDWA 3GSRB 2WMPB 1RD6A 4U1MB 1B4JH 3B2MA 5ADOH 5KG9A 1BXUA 3MV9E 3QUZC 1RUMH 5DS8B 1SYSA 1XTMA 4CA4A 2O5NA 4JFFE 5F71A 4DZBB 4I13B 3B9AA 1N64H 3VI4F 1QFHA 4PGEA 2CDGB 5CIPA 2HJKB 2NYKA 3GRGA 1E0OB 1I3VA 5F6HJ 2Q2EB 1E3ZA 1UD2A 1KCRL 3G5ZA 4LSUH 2BFVH 1UATA 5IROD 4F20A 1NANI 2YPKA 4YSRA 3MNDA 1DQIA 1UA6H 4GRWH 4PJXF 5BS0E 4NENA 4HJGB 4Y2LA 4P2RD 2O61A 3B8YA 3FBKA 3TBSB 3MTRA 1HVXA 2ED9A 2DQMA 2YD8A 5I6LA 4IOFC 1Q0YH 3SDXB 4NQSB 5E9DA 1XEDA 3QIUA 4KXDA 2J6EA 1Y6NR 2FATH 2IH1B 2B5IB 4HW6A 3EZJB 3FFCB 4MMXB 3PDOA 2R0KH 4P48A 3GJFH 5FLUA 3OKKA 3DDFA 4PWIA 4WGVB 2JJVA 1EDHA 4YDLB 4KQ3L 5D7LE 1HL8A 3V4PH 1SJXA 3D2TA 3MFGB 3HG2A 4GUOA 3RGHA 1M42A 2X70A 4YVNA 2CLVA 5F1IA 2X7LA 4LEXL 4OZ4B 3TO2B 3KL3A 5C70A 2IDFA 1YC8A 5HHVL 3TURA 4JPWL 4DFHA 1AZUA 2QQLL 1NLBL 2O4EA 4M8RA 1JK9A 3IRZA 5C0IA 4KNTA 1L3WA 3O9WC 1WBYB 2LU4A 3QHTC 1MRCL 4C4BA 4GUPA 1LDPL 2DKSA 4TLSA 3D33A 2DEYX 1FJ1B 1TCRB 5JIMA 5I19L 2KZKA 1YEEH 5DJCA 2QSQA 3R7QA 3OAUL 5DD1L 1HCZA 4XBEL 3QVAA 4ATWA 4AGPA 2DQCL 1RMFL 2J8OA 3MLUH 4LNRA 4N2DA 3KJ4C 1ZRUA 4TVSa 5BXFA 2H0PA 2G3NA 2OMNA 2WK2A 4PRDB 1UWYA 3VXPB 1BZQK 3HZVB 3T6WA 4B60A 3IPBA 2YMOA 3MBEC 4NQUA 3BZ4A 4E68A 2OMWB 3MNWB 3V0GA 2K7QA 3IJ7A 1A14L 2FWOA 2X44D 4PJHE 5HYSG 1UD6A 5DRWA 3CX5K 4NZDA 4AJYV 2VWEC 3K71B 3KPQB 5TDNB 1PSKH 3BUYA 2EUZA 5CINH 4HIPA 3DXAD 5D5MB 3WN6A 2QADC 1OAZL 1MLBB 4JVWA 1NCWL 3TYGL 5F1SA 3S5LA 3VYNA 4J2XA 1CFVL 4FERA 2JNZA 1RH8A 3S37H 1HHHB 2VAJA 1G9HA 1HILB 3G5VA 2YSTA 3DJSA 3QEHB 4P5RA 4B96A 4LPVA 3A0OA 1CBJA 1JCKA 3IBOA 1CFQB 4LESA 4R96B 1OSPH 2CHWA 4QHNB 5ADPL 2ROXA 4WFED 4G8FA 3FT3A 4JY6A 1PLGH 1W2KT 1JF1B 4LARL 2OK0L 3BC9A 3LPPA 2PWGA 5CZKA 1OGAE 1UQSB 3FMGH 2GJZA 4N2MA 2XQBH 1AZCA 1G84A 3RIFF 5D1XB 4S1RH 5I26A 2VT0A 3MROB 4HLZH 1DBAH 3V5KB 5F7UA 4DF9A 1EHAA 2DJUA 1E40A 2BOBA 3ME0A 3MJ8A 4TVPL 4Y5YB 3RGVC 1IFHL 3HS8A 1PZ3A 3TIDB 7FABL 4KUCD 1JGUL 4WI0A 1P4BH 5HGHB 4AUJA 3QUXB 2X09A 2YLKA 1CCZA 2IVFC 3NIDB 4J1UB 4HCGA 2QT6A 2Q8AL 3SZ6A 1J88A 3VVWA 3NCYP 2GBVA 3PQYA 5T1DL 5CJXC 3G04B 3CH1B 2YMXL 1IQWH 3D06A 2CLZB 3VDAA 1J8KA 1OP3H 1VEPA 3UCRA 2VLRD 3CSTA 2N59A 4ENZA 3S8WA 2GJ6B 4YWGL 5DLLA 1GW0A 2X2HA 4JHVA 2VLJA 2WM0A 4YDNA 5KS9E 1OM3H 3STZA 5D1QA 5F70A 4ZMAT 2Y0SA 2CU9A 2ZD0A 5E6UB 3TL5A 2J88L 4QGYA 1QLEL 1MH5A 2OP4H 4LLDA 4FEIA 4L8BA 4JQVC 3LRLA 4Y1AB 1HHKB 1JXDA 4PJ6A 2KZBA 1AKJD 4K8RC 1NC4D 3FSWA 1N2RB 4HH9B 5CEXB 4JM2B 2WXFA 2IH8A 3Q8BA 4UZSA 1UACH 3TO4D 4ZMVA 4XVJH 1F3DJ 3DVIA 3QUML 1KYFA 4XCCL 1A3QA 4YX2L 4FABL 2DMKA 2HRPH 4FG6D 2HSIA 4ZQKA 2BNQA 4EOWL 5IMKA 2XV0A 4X6DB 1JPFB 2VMCA 1JWUA 4MJ6B 2LLLA 1CK0H 4KTDL 4WI2A 3IFOB 5FF6A 1RPQA 1L7IH 1MWAH 3BVXA 3PNWB 5E24E 3O4OC 3HG1D 4XPHH 4NO0D 1L9NA 3EGXB 1IL1A 1MI5A 5DEFB 2QKIC 4IBYA 4JY4B 4MNGE 2AK1L 2RFXB 5HYSA 4XX1E 25C8L 3TNMB 4D0DA 3RG1C 4NNPH 1D9KD 2Z31A 5DQ9A 4AE0A 2AKRB 1ND0A 2EYTB 5JPMA 3HTLX 3PDGA 4FCAA 4Y2DB 1AP2A 4J3XA 4DZ8A 3K5SA 2X4QB 1MZZA 5IHZB 3MXVL 4PB0L 2OYPA 3PHAA 3D2UB 1PZ2A 2D31A 4KY1L 4GQ9H 1D5MB 2CPCA 1F6LL 1QBAA 5FYJL 5HY9B 1J5HA 3K3QA 3U6RB 3HE7C 4HXAH 4HQQH 1SLVA 4PRIB 4G43A 3PL6C 1NDMB 4TNGA 1ETZA 4IGBB 2VMDA 4N2FA 4D9RE 3KPLA 5F0PB 4XH2B 4KK9D 4PJDE 5CGYD 5DD0H 3LKNA 1NKGA 4WUUA 2JV6A 4WV1B 1VCBC 3QUYC 2CO3A 2NY5L 4FHJA 3UO1L 1DBMH 2JJWA 3BQUC 4UM8B 4Z7UB 2HVKA 1IAIM 1FNSH 1YHPA 4FQCH 3VFVA 3X2QB 5I6XC 2P42B 2XUWA 4JFYB 4XNDA 2B08A 4JO1L 3WNJA 2ZCHL 2HWZH 4P9HH 3EGDA 3ZZQA 2Q7AA 1T66D 1S46A 1HHJA 4UQ3B 1KN2L 3ABGA 1QUPA 2Y06L 3PXJA 2Q3AA 4HIJB 5I0ZA 4FYTA 3EJYC 2P5PA 43CAB 1NFDA 4FJYA 4H8WH 3TT1L 4MCMA 3DGDA 3MV8A 3OLDA 4JLRA 4ONFH 4W4NA 2GUOA 5CN1A 5J13C 3OKLB 3FFCE 3WEOA 1JGEB 3R4RA 4WEUD 2FWSA 2EKSB 3ELQA 1D5ZA 1AZZC 4NQCB 2QV2A 1JZDC 1I7ZA 1A6ZA 4UIKL 4R83A 4UYQA 5HHOE 1TU2B 2E27L 2FRGP 5DJ6B 4F1ZA 1B0GB 1LO2L 2XTJE 3MLYL 3TA3C 2ZIDA 1R3JB 3QYNA 2RCSH 2ZXWB 4B50A 2HVBA 2L7EA 3ZDYB 3I6GB 2H3XC 1WH0A 3GKWL 3WEXB 1MQKL 1KIQA 3ARUA 1U91A 2FYYB 4LOUC 2YWZA 3L2NA 3L7EA 1SQ2N 2YD5A 4NX0A 1WHPA 1JWSA 4CU6A 2ESVD 4O51B 2P4AB 4FTDA 3QR0A 1IILE 1KF9B 2KBGA 5H35B 1ZHBB 3R18A 4HJ1A 2DLFL 1XGUB 4CC1A 3M1OA 4Y16D 3GK8L 3GIZL 1MCNA 1ES0B 1DO5A 2Y7OA 4KJQD 3UO8B 1OF0A 1RZGB 4KH2A 3PIQA 4TMPA 3IEAA 4YHKL 3ULSA 1OAXL 1YNKL 3DI2B 1MXGA 3RTQA 3ZE2E 3W9DA 2RMNA 1HCVA 3LKRA 4NO5B 4F91B 3QXVA 3FSAA 4TTDC 5D5ME 5B1JA 3TC9A 3KDMB 3VFGH 2BNRB 3D39B 1EHKB 3LZPA 1JDCA 4NRZA 5JW3H 3RGBA 3E1F1 1G7PB 1NEZG 1OTUD 1MG3C 3W1ZA 4P3CL 5AW1B 5IFAH 2WCSA 4WJ5B 5IP4A 1M05B 3UTSA 5TK4A 4KI5D 3GNML 4PHXA 2DWDB 3UAJA 1DQQA 4ZX6A 3CVIH 1XSKA 3W3BA 3QGVA 5IROA 1CPUA 2P5WE 1I9IL 2IDTA 3CCHA 5E4EB 2IOIA 4WU5B 3JV5A 4X0NA 2B15A 4QF1B 2I07A 3F84A 4DEUA 4P2RA 4KVNH 4BQ8A 4MX7A 3N40F 3NRFA 5F2FA 1OT4A 1QBBA 5D1XD 3DROA 3V4VH 4N20A 2Z92A 3N43B 3MLZH 3QFJA 4OLXL 1CFSA 4B53A 3MQIA 4ERSL 4AUYA 3VFRA 3MR9B 5MENA 1ZT4A 2VZVA 4U1HB 1PFOA 1S9XA 5IHWA 1HDMA 1BM7A 4YL4A 4LOVA 2AMGA 1U3HC 3KXFE 3NIDE 4G7RB 1SEBA 3LKQB 4P46D 4M5TA 1ILSA 4C56E 1AHWB 3QQNA 1TZ8A 2A0LD 3FYEB 1BG1A 4R2GC 5C0JA 4KTGA 2GJ6E 2O30A 2O93L 1A22B 4R97B 5FO9A 3X14B 5ACZB 4P23B 1ADQH 3G5WA 1PPIA 3BEVA 4HKXA 3W39A 1K8DA 4DN3L 2R8SH 2VDLL 1DN0A 3WUZA 1ZXQA 2ZONA 3E1ZA 2NUPA 3BAYA 4L5FE 5ERWA 5KBMA 3ZDXF 2XTJC 1FNEB 4ZUSA 3LX9A 3ILDA 3L1FA 1R1CA 4K9JA 3BHBB 3EH5B 1TSRA 4GKNA 1SGKA 2FEDC 4J2QA 5C0CE 1ZE3C 4H1LB 5EU5B 5G4OA 4N2CA 3TP4A 3BIKA 1FVEB 4DGUA 1FE8H 3HS0A 5AVZB 4ZD3L 1T21B 5DLMH 2OM5A 1OXYA 3APDA 4KHTH 5SWZD 3ECWA 4ZMYA 2MTPA 2AAAA 2E7MA 1H8LA 2WW8A 2EH8H 3BX7C 3C5ZA 4JM2D 4N2EA 4XPTL 1O7DC 3NAAH 4U05A 1PEWA 5F93C 4Z7VA 2JFCA 1VSCA 5ALBL 1MFDL 5L9DH 1NCAL 1Y0LA 4X6DE 2HN7B 3UL4A 2LABA 5DZ9A 4GG6B 2AP2A 2ZWYA 4AX3A 1WBZB 4RAUA 1HH6A 4GP8B 3DX8A 2FX7H 2MNUA 5F7MC 4MQ7A 2YGQA 1LXMA 1N4XL 1HKLL 5J9PB 4WFFE 5KYWA 2DEWX 4NQEB 2NYYC 2IH3A 2EDXA 5DJ2A 1A1OA 4G71B 2A6JB 4U1IB 3VCLB 3QHFL 5CP7A 1S9VB 4K07A 4NM8L 3GSVA 4M02A 1MPAH 3B4NA 1X6LA 1Q94B 3TPKA 3CFEA 4K7PY 4ANKA 2EIEA 4YO0A 2JJSC 5FFLA 2ZUUA 1KELH 1TQVA 2CKBL 4MAYC 3RZCB 4HG4J 1J87A 4PN6A 3RL1B 4PJBE 1NWOA 3TPUB 4Z7VF 5ALCL 1RIHL 1Z5LB 2AXGA 3QAQA 4X5PA 4BSWA 4H8VA 5LCVA 2Z34A 4ZUUB 4PRIE 3O0RL 3GXFA 3U4EA 1LEKB 5IJDC 2P5EB 4U7SA 1KLGB 1DVFB 3DRQA 2FO4B 3O6LH 5JHLA 1C16B 1URIA 2XWCA 2WO4A 4ZPTA 5KYYA 3OWRA 3QQ3A 5JYLA 2YD6A 2YBRB 3W9EA 2Y3NA 3STBA 5E8PA 3EHBB 5DVKA 3EKCA 2PCPA 2D7OA 3B7YA 5F6HI 4PJCB 4FMVA 1R9FA 4OJYA 3IFPB 4G3YL 5C3IA 2BVTA 1X5HA 4XC3L 2YZ1A 3RVXC 3TYFA 1HT6A 5DVMA 3UYRL 3F04A 1IAOA 4GAFB 1J7VR 2ICEC 3MYJA 1OQOA 3X3FL 3UTTD 4P4RB 4LP5A 1WO2A 4UV7H 5HHMB 1MHEA 2ZKWA 2YAEA 3TBYB 5DJ8B 2D03H 3T71A 2A74B 2XHNA 3SBRA 1J12A 2R69L 1EIBA 4P59H 4L9LB 2VLRA 3BVNA 1WWBX 4L29B 1BA9A 1ZVSB 4JE0A 4TNWF 4F33B 3S4SG 1KV7A 4KMQA 2WN3A 4LE8A 3WFHB 3RFZC 1P9MA 1UB5B 5DO2C 1PG7H 1YYLH 2DI9A 1WTLA 3N0PB 1ET7A 1KCVH 1MFVA 3FO2A 4JE4B 3QI9A 4OLUL 1SEQH 4NQCD 2PLTA 2VDKH 4FQ2H 1AKJA 1RJZA 3MRRA 4MXQC 2BXYA 4HJUA 1P5UC 1RERA 2ZE0A 1NC4A 4JMXA 4KUCF 3MJ7B 1BF5A 3CZKA 4Y7MA 4Q0XH 4WI7A 4IU2B 5E7FA 3TO4A 4XWGL 3ZDYE 4AGQA 4F7TA 3FSVA 1E4HA 4TUKL 3I9PA 3P4OA 1AR1B 3Q8CA 1IM9B 1QHPA 1T1XB 4N2HA 4WKZA 4RISL 5ESAB 3KYOA 1IGFH 1WWCA 4O5LH 4OCRL 4M43H 4JR9L 3AM8A 1IEAB 1UXSB 3RIKA 2EEBA 4IBTA 4E42A 2QEJA 4ONGL 2VN3A 3H7BA 2RQEA 5TH2A 4HOWA 4EZLA 3IGKA 2FEEL 2OJEA 3HG1A 4NO0A 2Y22A 2YEZB 3X1BA 2IANB 5DC4B 2B1HH 1UOVA 2QFPA 4HT1L 1TZHB 5KEZA 2W65A 3MXWL 1D9KA 1NCOA 4Y9FA 4N87A 4BXSV 2BRRH 1R5WA 5FAAA 3FFDB 2R83A 5FV2A 2GIYA 2A9ML 2VIRA 2XBTA 3P3YA 1CB4A 4JL1A 4N26A 2Q86A 1OOAA 1M4KA 2CDEA 2F74A 3H53A 1ZV2A 1F56A 2AS5M 1NMAH 1MELA 2NR6A 2FSDA 2BNRE 1UZ6E 3D39E 3QJQB 2PW2B 4CVUA 1PZDA 2ZUWA 1KB9K 1M53A 1G6VK 1NFIA 4J3UA 1DQML 2BY1A 2N4IA 1GOFA 2FEEI 4H88H 4OV5B 3WJMB 3AUWB 4UTAA 4G80B 5EN2B 2I32A 2DIAA 3VGFA 4WWKD 5CF3A 3CFIC 1T4KB 4E9YA 3MRJB 3FQWA 5I23A 3VXNA 4Z76A 3Q3GA 3TVMB 1A02N 1SF5A 3U2IA 1L7TL 2VO5A 4FI7A 5D6DC 4HALA 5L4IA 2O5XH 4PS4L 4YE4H 1ZA6A 4XP6L 3P2BA 4A6YL 3Q6FA 3QG6B 4I5BB 4QYOA 3ARDA 3C6LD 4LLUB 3K2KA 4I9XA 4PY7B 4HUNB 1DVZA 1KTDA 5BUPA 3PABA 3NACL 3LOWA 5CU5A 2C1PB 4WY7H 5KJRH 3K6FA 2RTTA 3O6FD 3AC0A 2BY2A 4NUMA 2AV1A 1MFCH 3NJHA 3RL2A 3WTTA 4PBWD 2W91A 1QA9A 1AXTH 3LS4L 1J8HB 4OY9A 4D0BA 4GUPB 2XXGA 2YD3A 3SYPA 4W4OA 4IMKA 2OYKA 3ZMRA 2GY7B 5DJCB 4GAAA 4KX8A 4ANXA 3PP3K 2WQ8A 2J4WH 3GO1L 2WXNA 4JZNB 4YS4A 4ZX3A 4KAQL 1H3GA 4NZJA 1EJ8A 5FKPA 1HCYA 3J07A 1P4LB 2VXSH 4N0UA 4ZXBD 2K4WA 4JY5L 4P0DA 4JG5A 4WQOA 1FN4A 4XO8A 1OAYL 3FCSA 3FQRA 1MFAH 1DUZA 3BZ4B 4ZS6C 3PV6B 5HYEA 4A7VA 2VAAA 4IMLB 4ZW3A 1Q8MA 4DNLA 1XGQA 2WAHA 1A2YB 5I1AA 3CMGA 4X0KB 5GS0C 2A4ZA 1Y6KR 4QXGH 4Y2NA 4XCFL 3T2NL 4ZX5A 5KYNA 3QDGE 4JAMA 5CEZH 2ESVA 4OGAD 4BDVB 2FBRA 4LPXA 1AFVH 2XZAL 4JFWA 1FVDA 3AU1B 4OTXL 4PRPB 1T20A 5KSUB 4IOIA 1WZKA 3VWJC 3FQUB 2FZ3A 4Y16A 4OV6F 1YAIA 1D5IL 1WDAA 4CUCA 4QXWA 3F62A 5IQOA 4GSXA 3KLKA 4G7VL 1G9NL 4NCDA 2R4RL 2CM5A 2Y07H 5E5MB 1YEJH 3T3MB 1JERA 2OA9A 1S78C 2GIMA 3EYFA 5DMJB 5L7XL 4XGZA 2FT7A 2YXMA 3CFCL 1WA0X 5IVZB 5C2BL 5I17B 1EAPB 1KXTB 2CLRB 3AXLA 1PX3A 2GW5A 4JKLA 2F5AH 2FYVA 4PTUB 5F3HA 1JXFA 2D3VA 1AE6H 1VKXB 4Z7WB 1IGYA 1C5BH 3AMLA 3BVWA 1WFTA 1VADB 3UIZA 3HE6B 2GCYA 3KVDD 1LE9A 2X9XA 4KK8C 1E43A 4N2LA 3RTLA 5CLXA 3UZEA 5LWYH 4G83A 3CXHJ 2OAAA 1VGKB 5DRZA 3HNVL 3D1MC 5I16B 4MSWB 1UKQA 3AS1A 4S11A 1A9EB 3KPOA 4MZIA 3IFLH 4M8UA 5FA4A 2DQGL 2VDOB 4ZYKA 4XP9L 5BUAA 4TULL 2ENYA 4G7QB 1XR8A 3T6ZA 2NYZA 5EF2A 2P5EE 1EBPA 1TVHA 4OLZL 2D2CC 2PYEE 3II2A 1NANH 1N8ZB 1G0YR 5LAXA 1EHNA 1YNLH 2ARJA 4GW5B 4OGXL 2WBWB 4MLSA 5E6IC 1NGWB 2G3XA 3MACL 4YGVA 5FHAL 4YHNB 4X4XA 1FG9C 3WHE1 1CI3M 2MHAB 4PW9A 4FLRA 4L5FL 3BCDA 4Q6IA 1U8LB 1U92B 2DJ4A 5FGRA 5MERA 4KI5F 3QNXA 3WGUB 2IAMB 2EDBA 4HDIA 1BV8A 3LJ3A 1NGZA 4PREB 5HHME 1BQ5A 1THCA 4P46A 3W11D 2OMYB 1V55B 3VXRD 4M7ZC 3T08A 5JLZA 1E50A 1C7SA 4WFGD 2C7FA 1JZIA 3PWNB 1NPJA 5F6IC 2CA3A 2E8YA 1M7UA 5TDPA 2D73A 4UILL 3WN5A 3H4HA 3BJ91 3IMTA 3KLHD 1EHXA 4A55A 2AQSA 4Z3HA 1KCRH 1T0OA 4F9PA 4PP1D 2C3GA 1KB9J 4FQPA 2LU7A 4LLQB 3MRLA 2B3IA 2PPDA 3L4XA 1IZJA 2E7HA 5D96C 5TQ2L 3O81A 4B9YA 2CDFA 4K3HA 3MCKA 5B7EA 2R23A 1MJJB 3O3AB 1G6RB 4ABWA 4X6FA 1RZ8B 4MWFB 2DIEA 5SWZA 3W37A 5BVJB 1YMMD 3T0EE 2FECL 1ND0B 3KLLA 1UCBL 3KCPB 4HWZA 3RFRA 4R7DB 3L6FA 4AENA 4GBXA 5IMOB 1IM9D 4HIQA 1PQZA 3MRQB 4KQ3H 1ROWA 4P5KB 2KQNA 3CTTA 4TSBL 4U2YA 3ZY7A 1K5NB 5E1AA 2IANE 1TDQA 2CBTA 1LEIA 3S0PA 4LEXH 1RK7A 1AZBA 1G9MC 1I3RA 3OPZL 3U0PA 5HHVH 4JPWH 4ZUTB 2R29L 4RMTA 2QQLH 1NLBH 2OCJA 3M8OL 3MRDA 1MRCH 1LDPH 1A7PL 2HUHA 2J20A 3UBFA 5I66B 5I19H 4JGMA 5EC1A 4V33A 2HX8A 1D2PA 4XBEH 2FECI 5DD1H 4BFKA 1ZGLA 1EGJA 2DQCH 1T2XA 4NXSA 1RMFH 4KRPD 4Q9BA 3A6BL 4HKJB 1FZJA 2W59A 4Y4FC 4XXWA 4YE0A 3ULVD 4HX1A 4WFHD 3IGUA 4HJTA 2IPKA 2KKQA 4X5XB 3QYMA 4JGJA 3CSYA 5B3SB 2LU5A 1ZHKB 1ADWA 1OTSD 4Z1PA 1A14H 4J3OH 4XHJD 5IWLC 1T7ZA 1G5AA 5GXBB 4APQC 1OAZH 1NCWH 2X4TB 3FTSA 5FOBA 3TVMD 2ADGA 2I9TA 1CFVH 3PP4L 1GYUA 1LE5B 3UTTA 4JQIA 3GB7B 3WGVB 1O6SA 4UQ9A 1LO0L 4IRJC 2ZYIA 5T1JA 2Y69B 4M7LH 3EFDL 1BBJA 2CJUL 5ENWA 5ADPH 4YHOL 3EGSA 2DM2A 2WZ6A 4LARH 2F1EA 2OK0H 1PX8A 3DURB 1K4CB 5AL8A 2R2HB 4WEBL 5IB4A 1BQRA 4HUUA 1BAFL 1J8HD 3GSQB 4PD4K 2PP9A 1U4FA 5EFIA 1INDL 4KKPA 2VMJA 1IM3D 3F7LA 3Q1EA 3SD5A 5DCCA 1YPZA 2O6PA 1JRHI 3DJZA 3GSXB 4MQXC 3CFBB 4TVPH 4LCCC 4FFVC 1IFHH 1HHGB 2WANA 1DFBL 3LXCA 4NIKB 7FABH 5TE6L 1HQRB 5FKAA 4JZJC 1VZHA 1JGUH 4BEIA 1SY6L 4G8GB 3QJXA 4BJLA 2H2SD 4N0FA 2J1KA 1NIAA 3MV7D 2E9JA 1FH2A 1TTUA 1YMHB 1LGVA 4YDJA 3RTQB 3HBPA 1MAKA 3SDDD 3SOTA 2Q8AH 3WNMA 1R19A 1KBWA 4X7EC 2XWXA 5T1DH 2HTLC 4QRBA 4NRZB 2YMXH 1MVUA 1KTKE 2IBGA 5FHBL 3T0EC 3TJHD 2FJFA 3EOAA 1C5DB 3LNHA 4PRPD 4YWGH 2BSRB 3NGBC 4OJFH 1J1XL 2BOLA 2F8OA 1T6WA 3GLAA 3OF6A 5LDUA 3NBNA 4P2YA 1YPZF 2J88H 1DQQB 3T3ME 3WHXB 1KCWA 4BCZA 1IKOP 3ZX1A 2F8VA 2C8NA 4YHIA 5H94B 1ZLEA 4HIEB 4K23L 2ZSVA 2GVYA 1GZPA 5JW4R 4O58H 3QUMH 3WE6A 4KKQA 4L3AA 4FABH 4YX2H 2W80C 2CJTA 3TOPA 3GZQA 2D7QA 3P9WB 5L0QB 1H6TA 3ISWA 2DLGA 3KPRB 4PRBA 4XC1L 5HI3C 1MRFL 4EOWH 4MD5A 4LLYA 4RGMC 4WWKA 4HMDA 4PW4A 3VA2C 3RKPA 3NEXA 1E2WA 3QFJB 4UDUA 3CZUB 5DK3A 3HE6D 3TEWA 3IDUA 5AD0A 4PFEA 2CPUA 5JYMA 1ZS8A 1REIA 2AK1H 5E0QA 1N3NB 2MNJB 2XVKA 3QIUC 4K94C 25C8H 4HUVA 2YARA 3C6LA 1SN5A 3PQYE 1M1XB 1O75A 2HUEA 4RAVA 1PLBA 5KYUB 4JHAL 2EXYC 1CGTA 4PPTA 5TF1L 2EDNA 3B9KD 4IRSB 5HYJD 4ZNEA 2XJLA 3H55A 3O6FA 1XAUA 3P77B 2Z65C 4BBWA 3BD5A 3NN8A 3MXVH 4PB0H 4X6EA 4HKXB 5C9JB 2A3TA 1XH1A 3D51A 4K7PL 5EZOL 4KY1H 3W39B 1DN0B 5FYJH 4G8EA 3ZVVA 1P7BA 2WINA 4DO6A 3A3YB 2QGDA 2VMFA 2JXMA 4K7FB 4OI7A 3QORD 2JQMA 4W68A 5D7IA 5I0DA 2OCFD 4ZXBA 3SDAD 4YFLF 1B0RA 3LRSA 3VU2A 3V6ZA 5IB5A 5A2IH 2NY5H 2EVJA 3UO1H 1MLCA 1CS6A 1U8OB 3KM1A 4QRFA 4WW1A 3OAYK 3V8CA 4ELDA 3TX4A 5ITBL 2BNQE 2K9UA 5D7KD 2NNRA 5TF0A 5B8CB 4NBZB 1CR9L 1A65A 3H8NA 5B39G 1ZHNA 4JO1H 2ZCHH 1KY7A 1FZKA 2OL3B 4DP5X 3FQXB 3V0IA 1XL6A 3UJTL 3RVVC 1KN2H 1XXDC 5AB9A 2NXYB 2Y06H 3A24A 1CN4A 5FOJA 2Y7MA 4PJAB 1AXSB 2XYBA 1D7CA 3V7MA 1QI3A 3TT1H 3WIHA 2A99A 4EKJA 4HMEA 4TQ8A 4Z3JA 5EU3A 5JHDB 4EZJA 3BRDA 4Z7QF 1W15A 1EBAA 1OCZB 4E41B 2ODIA 2YGPA 4FDWA 5D7IF 3VD9A 4LSTL 4IBSA 1AKPA 5CGMA 4AIZB 1JYWA 1ITCA 1NEZB 3EBGA 2E27H 4J4PD 3EG9A 2VLKB 3UROR 5ID0A 3LYRA 3MRNA 1OT2A 5B7FA 1LO2H 1VACA 3GRWA 3MLYH 4J3SA 4E9SA 4HFUL 2GK0B 3CLWA 2I7SA 4XXDA 2Q5BA 1AGBA 2NXZD 3GKWH 1KJ2B 3UG3A 1X5XA 4PJ5B 4W6YB 1MQKH 2FO8A 4WUUE 3K2MC 1R47A 4JFEB 3BWSA 3OR6B 4Q4EA 1DO6A 2JCCB 1AGDA 1N5YL 2WC7A 4XNXL 2BNUB 2CUMA 2DQDL 3MRFA 3QUGA 1JGLL 2Z3FA 2DLFH 5DHXB 4QAWA 5L4JA 2AJVH 2YUZA 1MW2A 3K72B 1AGCB 2DL2A 2EXSA 2ZWKA 3GIZH 5DD3L 1XTLA 3H9HA 1IEHA 1F2QA 1XGRB 2IQAB 4L37B 2OBGA 4L1TA 1KIUB 1NFDE 4ZFOA 4BFNA 2YOCA 4XCNA 2GEQA 2XLLA 3MV8E 4EMZA 2R2BA 4YHKH 1VJSA 2QZQA 1YNKH 3FU7A 1ZTXE 5D70L 4L18A 4WU7A 4M6NL 3ARGA 5C08D 4XI5D 2B1OA 1O0VA 4ELMA 3MRBA 4OZFG 2NY0C 3AB0B 2L3BA 4OW6A 5CZRA 1PZ5B 1TJHL 2VKXA 1HZLA 2DDQL 3CDZA 5E2WL 2L7UA 4KDWA 3GJEA 1XGTA 1D5XB 2B3RA 4P3CH 2YS4A 3VXRA 4GW1B 3FQTB 3BUPA 4ZOEA 3GNMH 1PCXA 4JANB 1EO5A 5D1QC 2VZOA 1IU1A 2D3NA 3C8HA 2P24A 4XNQB 4MZRA 1WGOA 5I1KL 3RWFA 2CO4A 3CUPA 1I9IH 5ID1A 3BN9D 3P30L 4MZ2A 4FL4C 4JO8A 5M94B 2GI7A 1IMHC 2ZYHA 4FFYA 4K8RH 1QLRA 1IBZA 1B2YA 1RJYB 4N0YL 4ELMF 5B39A 5INDB 1MFEL 4XOEA 1JNLL 5AALA 2WZPD 4OLXH 2VN4A 1YMMA 4GINA 1R5WB 1ZHLA 4ICXA 1XH3B 2H8PB 2X6BA 3B3IA 4G8GE 4QMEA 4ERSH 2B59B 2JE8A 1AQMA 5HTSA 3GUTB 2X1PA 3L4UA 4XN9A 4FQIL 4CADA 3D3VA 4DETA 2F74B 5GZNC 1HYSC 1WJ3A 1I9JL 3HAEG 4GI9A 4PJ8B 3UP6A 5IHBA 4OD2A 4XCYA 3RPBA 5F7KC 3EBHA 5GGRB 1FORL 2NTFB 5E4OA 2GSIB 2Z31C 1W72B 2H0JA 3P4NA 2A77L 3N55A 1KJVB 4AM0B 5JPMC 4K94L 2J6EL 3D0VA 1CLVA 3ZU8A 4I85A 1QR1B 3UTSE 4H26B 2NY1B 3EZ8A 3KHOA 4DN3H 1M71B 2VDLH 2X2IA 4ODHL 3RVTD 1QQDA 3A4AA 4AH2A 3Q2VA 5F1NA 1RL1A 1IJNA 2F1BA 4U1GB 3DO7B 4JGNA 1ZLUK 2X1QA 4FYQA 3B6SA 4PGJA 4P04A 1EEZA 4PJ7A 2P7TA 1MNUL 3JSSA 1CFNB 4HKBA 4P4KD 4ZD3H 4QYOB 1ZT1A 1UCTA 1CDUA 1GL4B 2HLAA 3ARDB 3RDTC 4CMHB 1SHMA 2AZUA 3NSXA 5LQBL 4XPTH 1JMXA 3U9UA 4XB3A 2PCFB 5ALBH 1MFDH 1PF3A 1NCAH 1MCHA 5AW0B 4DPAX 3WY1A 3KPRD 5FFOA 3QFJE 4HPHA 4KZDL 3L5XL 5DYOB 3RL2B 4O2EA 1DDHB 1URLA 2QL1A 2JI2A 4OCXL 5MENE 3D50A 4MA1C 1NGXA 1N4XH 1HKLH 2XIIA 3SKOB 3PJSB 4AQ8A 2EDKA 4F15C 2XG4B 3PF2A 1P5VA 3S4SB 3QHFH 4NM8H 4PGBA 1HQ4B 2VQ1A 4OZFA 4PTTA 4MQSB 3LZFL 3ZTNL 5AB1A 2PXYD 3AT0A 3W56A 1CU4L 2EDDA 3ULVF 5CZVL 3HZMB 2BVYA 4JQXA 1IEBB 1WUNT 1RIHH 5ALCH 1D6EA 5HHNA 4EIBA 2J2ZB 3MLWL 3O0RH 4QDGA 4CILA 1SN0A 4RSYA 1IM3A 2C3HA 4M61A 1T20B 5JO5A 1FDLL 1AZNA 4WW2B 4QTFA 1C7TA 5ANMA 3VXUD 2NY7L 3MLSL 1H3XA 1J0IA 3MFFB 3BH8A 2Q2LA 5CD5D 1TTGA 4Z7VE 3D87B 3ECBB 1LP9A 3OG4B 5IREA 4MD0A 2XWBB 5DFWH 4XC3H 1N5AB 3APNA 3NCXA 4U1SB 3T8VA 3UYRH 3MV7A 5PCYA 2MFNA 4NJAH 3IRCA 3SDDA 3TFBA 3IVKA 4H40A 3UTOA 3LVEA 5K39B 1DUYA 2DD8L 3LXUX 3FQ1A 2R69H 2C5DC 3ILPB 5HI5C 3QPKA 1R3IL 1L9OA 2VSMB 1OCOB 1NMCB 1IGYB 5JHDE 3ZE0F 3HAEA 1PD1A 3VU1A 3GDCA 3INUL 3D25B 1A6UL 4HOMA 3NZHL 5B1JC 1F90L 1ZVNA 4C83A 3VRJA 4OLUH 2Q0ZX 4QHKJ 4E41D 3WO4B 4RESB 3S35X 2FQGA 2X9WA 4Z78A 5BV7B 3IGLA 3ALXA 1LP9F 2NTSP 4XRCB 3OHXB 5CEYB 1A1MA 4LCVA 4XWGH 4A2MA 5F7DB 5C0ND 3ZYOA 1G94A 1OZTG 3UAJC 3T65A 3ZL1A 4TUKH 2WXGA 1GYAA 1BVOA 3FXIC 2VE6A 1Q38A 3PG2A 4JFEE 3FO0L 4RISH 4W9GC 4Y1SA 4PGZA 3WL9A 4ONOA 4OCRH 5IROC 4JR9H 3TFKD 4PJ5D 5H37A 2JCCE 1GS6X 4XMKL 3FU3A 2F9BT 4ONGH 4ANVA 4EBQL 2JB6B 1OP9A 3CZGA 1DP0A 2BC4A 1JV5A 4TNVK 4QHPA 1MF2L 3BP4A 4G5ZL 3DIVA 4I4WB 4HT1H 1DLFL 1SXNA 3NCFB 3MXWH 4AXWA 4GO9A 3CGTA 4QTHB 4N8VG 1UWXK 4X7TA 5DK0A 1WFOA 4N8PA 2IC2A 1E65A 1HI6A 2ITFA 3B9KA 1E7VA 2A9MH 5HYJA 2VLRE 4F5CA 1B0IA 1DVXA 2AMUA 1KGYE 1TZOA 3FO1A 1E8YA 1GOGA 5CP3H 2WJ7A 4JFXB 2R2CA 2CK0L 3PHQA 1A6PA 5IFHL 1E2ZA 1RK1A 2J5LB 3O6ML 3ULUD 3LKPA 5CJOL 2X1WL 3RP1A 5JNYA 2JKJA 5JIIA 2DMCA 4OFQA 4DCQA 1DQMH 2CH8A 3SE6A 2HTKD 4BELD 3K8MA 5HYQA 3QORA 3RWIA 4HSCX 3OD3A 4LKXA 4O02B 4XTRD 3SDAA 4DH2A 4JPIA 2Z7WA 5C7XL 2ZWZA 4PWGA 3VTAA 3DVFA 2E7DA 3KGRA 2Z4QB 3N44F 5E8NA 2CIIB 1SLWA 4PS4H 3KPSD 4XP6H 4A6YH 3T0WA 1TZIB 3NK4A 3HS0C 2HG5A 3HG1E 4YPGB 3NACH 2HJFB 1Y07A 4KRNA 3QZOA 5KSBB 1ZE3H 4DOHB 3WTYA 3RQ3A 3FB5B 1QTYT 1JWMB 4JCWA 2NZIA 6FABH 5H2BB 3EF7A 1NCGA 2XV3A 3QUHA 1DBBL 5B21A 3LS4H 1W0VA 4HPOL 2FIKB 3PDDA 3PAUA 3VAEA 2NW2B 3FL7A 1F3DH 5I6OA 3CVDA 1Q9OB 3GMLA 2I9LB 3QJUB 1S6NA 2BSTB 2Y24A 3GO1H 4EIZC 3CDGA 4J4PA 4P8QA 3AVEA 2E9WA 1OAKL 1R17A 3P2DA 3GFUA 4AYFA 3HRZB 4JY5H 1TYEB 4QGTA 3MNVB 4Y4HD 2CIKA 3AQZA 3NQIA 5CMAA 1OAYH 1QWNA 3GQFA 4NZ8A 2YD4A 4JHWL 1UT9A 4RRPG 4DGVL 4FFZH 35C8L 1DL7L 4EUPG 1CT8B 1ZTXL 1EZLA 3ATAA 2Q6WB 3V0WL 3AJ7A 5K93A 4A7SA 2XVGA 5MHSD 4NO3A 4XCFH 5C09D 3T2NH 15C8L 4IRZH 4XNYL 4EI5B 3GSNA 4QRSA 4GRMB 4OTXH 2XZAH 5T3XD 1JZFA 4AIXA 4ECNA 3G08A 1CTOA 4KX7A 3KL0A 1Z2KA 3O45A 1D5IH 3L3KA 2YIHA 4OT1L 2QTVA 2VYRE 4OCWL 4G7VH 1G9NH 3UC0L 1MHPL 4FOMA 1CXEA 2R4RH 1XCTB 5DEGA 2NNXA 3KD4A 1K8IA 2IH9A 3CFCH 2D0HA 5DD6A 3TBTA 1FBIH 5D71L 5C08A 4HUUB 5C2BH 3DHJA 3VGDA 4OGQC 3B37A 1GC1C 1HHIB 4AK1A 4DJMA 2B4CC 4XBGA 3MRKB 3PWJA 3AZUA 3GYRA 4RZCB 4EKXA 3S8FB 2KDYA 3GLEA 4UQCA 4ZMTA 3GHPA 4N0UE 5F89B 3T77B 5BZDA 2ZWNA 3QE5A 4N85A 4QHMB 5DJZA 3JT0A 2DW5A 3US9A 5DJXB 1C5CL 5SX4I 1P9MC 4I9WD 4G59C 3ABZA 3IT8D 4ODUA 4UYPA 2WSKA 3BWZA 3HNVH 3IDNB 4ABVA 2YAPA 2F0CA 3FU6A 4OKDA 2OMUA 3N85L 4WI6A 3U4AA 3M7OA 3VG9B 4Z18A 4AMKL 2DQGH 1EXUA 4QY8A 4XP9H 4TULH 2XC8A 3UABA 5JIQA 4LOFA 1PNDA 3BKML 3TO4C 3TH2T 2PW1A 4OLZH 1NUGA 4RMVA 2DPKA 4UWQB 3RWJB 1RUAL 2DM4A 1GCYA 4FG6C 4XMLL 3S3PA 4QCIA 4PW3A 2WZPA 3MACH 1ORQB 3IKKA 5FHAH 2H32A 3AM8C 3HKZA 2HMID 1F1GA 3L3JA 2UUDH 3PHSA 4ENED 2ZX8A 4L5FH 5C0BB 3QULB 2F54D 5IQMA 2ITCA 1NJ9B 3MA7A 2CGRL 2OXHA 3HIZA 3NESA 1WRFA 4WDIB 4PBVC 1MHCB 3QJSB 5IQ9B 1EFQA 1DFXA 5E6RB 2VR7A 5HI4D 5TD4A 3CHOA 1D9KC 1FL5A 3D85B 4POUB 1JGDA 2WLJA 4JFVA 4YXHL 3WE6B 3ATBA 2IBZX 3LN4B 1AO7B 2P43B 4UILH 1J5OL 3SJVA 1A3ZA 5AVRB 4LVOB 4PRBB 3RY6A 1WFUA 1A9BA 3CZFA 2I26N 5SV4A 3GSOB 5JXED 2JIXA 3EO9L 1WZ1L 1DSFL 2GUYA 4O2CB 4J5VA 2NR6C 2XN9B 4L4TB 4OIIH 5DK2B 1K3ZA 5GRYA 1T5KA 4NUJA 4EN2A 5FYJU 4FS0A 4RRPA 5TQ2H 3SCMA 4Z7NF 2FAUA 4NT6A 5C1MB 4GKSA 1L9PA 3D34A 4DW2L 3OB8A 2GC7C 4P4KA 1RVFL 5JZ7D 1DEEB 3L4YA 5GRWA 3S97C 2EDRA 4AITA 1IC7L 5HVWA 5E8OA 5EOTB 1UCBH 4ZOBA 1WZAA 3KWXA 4PBDA 3ARXA 1I31A 2VSKB 1S7WA 4GXUM 5L2KD 1HSAA 1Y1DA 2G2RB 4TSBH 4ETQA 4N3UA 5EU6D 2VABA 1EXHA 1T66C 5GHWL 4Y9GA 4MD4B 4ZFZA 3QPQD 5F8RC 5CWSB 3KYKL 1KWKA 3O0LA 2AQ2A 2Z93A 4N5ED 3NJIA 3LSOB 5EEYA 1QSEB 1RULL 4FQXA 1GSKA 3OPZH 1JL8A 4X98B 4DTGL 2R29H 3OGOE 3ZHNA 1VZGA 4U1LB 2XZCL 2AJ3B 4LMQE 3M8OH 3B1UA 4JRXB 4UNIA 4Y19D 3X13B 1A7PH 4W4OC 2W07B 4IMKC 4R0LB 1NC2B 4FF9A 2BINA 2PXYA 4LGRB 3N6YA 5C0AA 3PWLB 4UNUA 4MMZB 4P5TB 2WGXA 4N5UA 3A6BH 2VO8A 3IKCA 5BO0D 5D2LA 1MQ8A 2HFEA 3K6SA 2W0FA 3LEYL 2IEPA 5F3BB 4Q8BA 4NFCA 1MDTA 5AOLA 4LVEA 4LCWD 5CCGE 3K4AA 4NKOA 3VXUA 4DVBA 5SWZE 3V0EA 3L3DA 5EU4B 2BIOA 2X3AA 3QO1A 2R1YA 5J89A 1BBDH 1S7QA 1WISA 4ZO7A 3OTTA 4NB7A 2D7MA 3HLAA 1EXGA 4K55A 2EVIA 3DUSA 1ZJAA 3PP4H 1M1SA 2G75A 2QZ5A 2DIJA 2BP8A 1H19A 1ZLWK 1MCQA 4Q56A 2PO6B 1LO0H 1U8PA 4Y16C 5E5UB 5LCVL 3N2JA 5IMLB 1UM6L 4OFKA 1F13A 2DLEA 3K81A 3LKSA 4HEPG 4KJQC 4DO5A 4DOHE 3SDCA 1J86A 1IJ9A 1FZMB 3EFDH 2CJUH 3I9AA 3Q8AA 4YHOH 4YXKL 1WYJA 4AC4A 4FXTA 3RWCB 4NNXB 4JCLA 5D2LF 3IJ8A 1OSZB 2P8LB 2HFFB 5I15L 1E5YA 1X5YA 1QLFA 4WEBH 3GJFK 2BVUA 4KHXL 3QARA 4LZKA 4XHQA 1OF2B 4POZD 3PWPD 5CKAA 4RFEB 3V7AG 1BAFH 1MUJB 3GEFA 3QQDB 3OL2A 2VRQA 3L3HA 1OTUC 3ABLB 2OSLA 3IXTB 4PIBA 4PV9A 2YPVL 2GTZB 4YR6A 3DTUB 4X4YB 2EEDA 1JPTL 2E56A 4KI5C 4WZ9A 1DFBH 2EIDA 4N1CA 5FW6A 3M17A 2B4CL 5TE6H 2HFGL 3UZEC 5DHVB 3NIGF 1SY6H 2ZKMX 4ZFOB 1HYRC 3NA9L 3OX8A 2R1XB 5HGAA 3W0WB 3R0NA 3LDBB 1W0WB 3HI6L 2NQ3A 5EEXA 2GQHA 3F7VA 4MB5A 3UP1A 5EWIL 4L05A 2QQQA 3S88L 1KENL 3FUIA 1JDAA 4PJAF 1E28B 1S7RB 1X7QA 4PIRF 4M7LT 5FECA 4EI5D 5FHBH 1KIPA 1DTUA 2CG9X 3UTTE 1XHHA 4HS6B 4UINL 3BRGC 1XGTB 3L2MA 5IIEA 5FYLE 4YFEA 1V3LA 2VTFA 1ZSHA 4Q2ZB 3U0TA 4A39A 1J1XH 1N0XL 5CSZA 4Y2OA 1KG0A 3IM1A 1F5WA 3C8DA 5JOPE 2XPGB 1EUUA 3H56A 1I8IB 4Q6IC 4F57L 4NHUB 1GSMA 4IBZA 1I75A 2R4SL 2E8ZA 4Z9KB 4P46C 1FV1A 4K23H 3GJFB 4L3CA 1CF8L 2BOCB 2DV6A 4Q74A 3LQAC 2A0LC 3TN0D 3OR7B 1Q1JL 3IGAB 3K4ZA 4PVLA 4RQQB 1YPZE 4AZ8A 3WN5C 3ISYA 4XC1H 3KYNB 5EUOA 3D69B 1MRFH 2DQFA 1N6VA 4AI7A 1OQXA 1HEZA 2VR5A 4F9PC 3D0LB 3WELA 3OKMA 5L2JA 3H54A 4CNIB 5G5DA 1X7TA 5ABDE 3FU5A 3GSUA 4HS3B 1EVUA 5A6LA 4YSOA 2CCWA 5J1TC 5MEQB 3KPSA 3FF8A 1T0MA 2AJUL 2NY3B 3NJVA 3RU8L 4HUXA 1MHHA 1L9MA 3KCWA 2YGOA 1FAIL 2X1XR 4F7CA 5HHPA 3GTNA 4JHAH 5TF1H 2WY3B 1RZIA 3PGFL 4UAOB 5HHQA 1VFAA 3WY3A 1JPGA 1RUQL 4FQQB 2B7DT 1HEHC 1YY8B 4LVHC 4GBXC 3U6XS 2NT1A 3L3IB 1RP8A 4YHPA 1KOAA 5EZOH 3RI5K 3R4DA 4AZUA 5F9WB 1N70A 4S1QL 3AADB 1AD0A 1ZSDA 3AWEA 4N6QA 2Z8VC 5EUOF 3IN2A 1FC2D 1SVBA 3UJIL 1G1KA 1M57B 2GSGA 4Y4KA 3AQDA 3QXTA 2WLHA 4H1LH 3BPLB 3FQNB 1UGKA 3DX6B 5IMMB 2A38A 2KT6A 3ZO9A 4FEMA 4PJ7B 4ZO9A 2Q87A 4L3ED 1HEJC 1OP3K 5FK9A 1G9MH 4Y4HA 1AO7E 1MIML 2UZYA 4M4RB 4W6XB 2X05A 1EHLH 4F8OA 3MODL 5ITBH 5J8OA 1BXXA 1RURL 1S5IL 4K2UL 1CR9H 1N8OE 1U30A 1YECL 2WIIB 5JA9A 2IDQA 4F2MA 4K5PA 2UWEA 4X7FC 1LDSA 5C09A 2V9TA 3QEQD 4UUJA 3O6KH 4BQCA 4XXWC 1SOXA 2XN9D 3QXDA 4JG1L 4OIBA 4ZNCD 2BJMH 1XGPA 3F5WB 4AQOA 4F7MA 1NGPL 2ENJA 3QIBB 3ZR5A 4QPEA 1N59B 1W80A 3UZQB 3VWKB 3GXIA 2F1AA 3B2DC 2EDLA 1QSFD 2KH2B 1F18A 5D1ZB 4ZNEE 1HAUA 4LSTH 5F7HA 3ZIYA 1IGIH 1YEGL 2NZ9D 4JREC 1G7QA 3BPOB 1IZKA 1O9WA 1W6WA 2NY4D 3DHMA 3TWCL 3NZSA 3U48A 1KPVB 5EC2B 3LY6A 4LU5L 1IIKA 1SHWA 4HFUH 3BGFC 1S7SB 2ALAA 2CHDA 4Z7QE 1XF2A 3DRTA 3BPNC 4I18A 5D7IE 3SPJA 1QSED 2UWEF 3C75A 4GYBA 1OSEA 3P1VA 4PJFB 5CKGA 3KL5A 1QYGL 1QUNB 2ATKA 5GRXG 2VERA 4FADA 4JRXD 2BWQA 1DJSA 1N5YH 1Z66A 2DQDH 1LM8V 4PS3A 4N6RA 3NZ8B 5MEPB 1IAKA 1JGLH 1FNHA 3V6FA 4QXUL 4X8GA 1J0YA 4XZUB 1XD1A 3GS0A 4NDMB 4N2IA 3A6CL 1E6JL 3BVTA 1DUYB 1ORSB 5DD3H 2AEPL 1KBKA 2XWTB 2KPWA 3SPGA 3TF4A 1J5CA 1NAMA 3FCUB 3AU0A 5LDSA 3E6FB 3F2LA 3FQYA 4Z6AT 1FNLA 2IOOA 2X6CA 5D70H 3Q06A 4M6AA 2CO6A 1IGTB 5DJAA 4M6NH 3NABL 2G3MA 2Y6TE 2YWYA 2R51A 4PVNA 1S9YB 5GSVA 3ZT6A 4IIQB 4U3SB 1SHSA 3BDXA 2F54A 2VDRB 1LO5B 4AQAA 1TJHH 5BV7L 1J05A 4RBPK 2IDUA 3BYTA 2DDQH 1ODUA 5E2WH 4C4UA 4D0CA 3VW3L 2BP0A 1QAWA 3RPIB 4WAFA 5BQDA 4YHYB 1GYWA 4AEFA 2Y2TA 3BP5A 1SXAA 1ZV5A 3MRMA 2RACA 3TV3L 5TPWL 3CFJB 4ELKA 1BVLA 5F0MB 2BMKA 2ZXCA 3STLB 4U7MA 1AZRA 1BJ1J 2X12A 5E6YA 5I1KH 4WTZG 5JW4Q 3QDMA 4FZ8L 3LS5L 3P30H 1O6TA 2H47C 4PP2B 1X9QA 3HRPA 2OJ1A 5BRZB 5I9QB 1R24A 3SPVB 2XX0A 2V2TB 1F6AB 4P2OB 5EN3A 2GBUA 4YK4B 4YDVB 4M62L 4N0YH 4KBPA 1MFEH 4XZ4A 1JNLH 4WWKC 1LNUA 3EYSL 3U30B 1TENA 3O8XB 3MGAA 4HEME 4P2AA 4XXCA 4I77L 4W9DC 4RETB 1G7HB 2XG5A 1PY9A 2ATPA 5CIPH 2PPAA 3BWUF 3MRHB 2XIBA 4BUHA 4F27A 4LBEA 1ZWIB 2OYMA 4AC2A 2YC1A 4FQIH 3TXAA 5L2KA 1F4XL 5IVXA 3QEUA 1I9JH 4J28A 2LOEA 4WHTA 4KOCA 4ELME 1BD2B 4KVPA 1FORH 1RK1B 3B2XA 3C6LC 2BSSA 3LKPB 2ADIA 1KTLA 1M6OB 1S5HB 2JELH 1SXZA 2IWKA 2A77H 1MAJA 3QXUA 5DQDL 2WQXA 4BFGA 3A21A 3S8GB 2EIJB 2ERJB 3FT2B 3PWVB 4K94H 4PJ9D 2J6EH 3O6FC 5E8EA 4BSVB 4BZYA 5K9KB 2X4PB 4WFGE 3OJMB 1WC7A 4RMQA 3MJGX 3T1FB 1MEXL 3AXHA 4NN7C 4P57A 3IU3B 4ODHH 4Y19A 1HTYA 1ECYA 1IGJA 4HBCL 4OQTL 2ZX5A 1U95B 4K5LA 1JS4A 5DWPA 4NQVA 3HHSB 1E4JA 3VD3A 2ZG1A 5I75C 4OUOA 3UTZA 5HGBA 4KNSA 2ZUYA 2AJZA 5D7HA 2PR4H 4ZXBC 3SOBH 2B14A 4OAWA 1JZEA 5LQBH 2B9AA 1I1AA 1IKNC 1S9WB 5BVPL 2DMBA 4NO2A 1UB6A 4LCWA 3ZKMD 4DK6A 4MA7L 4O2FA 1HXYA 4NN6B 2XETA 3SZKC 1ZLVH 4OJAA 1KPRA 3S7GA 3MRIB 4KZDH 3L5XH 1YMME 1TJMA 3HPLA 1FFPB 4N90E 1A7NL 2YEQA 2Z35A 2P49B 4OCXH 4FXLA 3TM6A 4JBSA 5HDQL 5IOKA 1EDYA 1RLWA 4OGAC 5KW9L 3D3VE 1EGJL 5TDOB 1G5GA 2R1WA 3FUNA 4G5AA 3DX3A 2X4NB 4NRYB 4QJ5B 2Q76A 1KIRB 3CN3A 1E8ZA 4CMMA 5AAWA 3HW7A 2H3NB 2CUAA 4N0RA 1RJLB 4HISA 3IGFA 2NY3D 2ZAIA 1E67A 3LZFH 4MCYA 4APXB 3ZTNH 2A6DB 1LK3L 4JFHD 4ZW6A 5D2NA 5J0BA 1CU4H 3L3GB 5F88B 4IS6A 2ADJA 1WLHA 5CZVH 4Q97A 1FFTB 2CAKA 2HLFD 2AK4A 3MLWH 3X17A 3PWPA 4KZ0A 4GRLD 1MRDL 3VFWB 5J11C 4HETA 1DE4B 1FDLH 2GPZA 4JQIL 3X11A 4PJ7E 5FYLL 2WVTA 4KUZL 4UAHA 2OX5B 2NY7H 3MLSH 4WTZA 1ZIBA 4JRYB 4JDZA 3U83A 3WUWG 3I84A 4GEIA 5HHOB 2H5UA 3BSZA 1DLHA 1J8RA 3OJDB 2QJDA 4YOKA 3WFZA 1QEXA 2DI8A 3BO8A 3NH7L 3FTGB 4ODXB 3S3SA 3FB6A 4N8VB 1WTGT 3F12B 3WFEL 5HPMA 1AY1L 5KAQG 2DD8H 3REVA 3GIVB 5C0EA 2VRAA 3FSZA 3MGTA 1I53A 1I3GL 5IOPA 1R3IH 2QBWA 3UDWA 2X5PA 1ODAA 4GUQA 3FDWA 3FH8A 5F3FA 2DM7A 4QRPD 3QIBD 3INUH 5DJZB 4YMPA 1H0DB 1A6UH 3ARGC 3NZHH 2ILLA 4LFHG 2HJLB 3QUZA 3BH9B 4AOFA 1F90H 3V4VB 5EA0L 3WCYA 5GS1A 3QP3A 2IGLA 3RWEA 4TQIA 3WKPA 1C12B 4YLQT 3OHMB 2OMUB 3LH2L 1R75A 4XVUD 4U1NB 3ZE0E 4A2EA 4HAFA 3TN0A 1PDKA 3H6AA 5IUCA 2WO3B 5E70A 3EJSA 2VQUA 3TGXA 2WPGA 1X4XA 3KLHC 4PJFE 5ANME 4HGWB 2QPFA 3FO0H 4HOXA 5C0FA 4Y9EA 4PP1C 5KWYC 1T22B 2ZUXA 1GZHA 2L8AA 4OCYL 4XMKH 4RGNB 1I4FB 2LTQC 2JLPA 4PI0A 3RWGA 2Y7QA 4EBQH 4AQ1B 4XVTL 2LU3A 3RWHA 3G6JA 4ADIA 2J12B 4TPRL 5K9QI 1U8IB 4F24A 4MNQB 1MF2H 1J0JA 5IB2A 4G5ZH 1CLZL 1DLFH 3FRPA 6PCYA 4ES8A 1OY3B 2UYLA 3NTCL 2WXKA 2Y36L 4XO9A 1UH3A 2OS7A 4LASL 2XBDA 2VISA 2Y1AA 1G7JB 4PCSA 2FNWA 1WD8A 4EVNA 5T1LB 3T0BA 5E4IA 1T1WB 2VZ1A 1LEGA 2A6KB 4NC2B 2C1OA 2K45A 2TRHA 3D8MA 2ZCKL 4OF0A 4E9WA 4OUUB 8FABB 2YRZA 5IFHH 4GT0A 4MRBA 5ABAA 3O6MH 5CJOH 3E3QE 1NINA 5I6PA 3RE0A 3F00A 4I0KA 4EUPB 5AW6B 1MCSA 3FUDA 3G6JF 4L3EA 5C7XH 5HHXL 3VI3B 4X9HA 3MA9L 5FM5O 4HPYL 3ETBJ 1T5WB 1I8KA 5DGRA 3SYQA 3EFOA 2VR6A 3EJCA 1ZT7A 3I2CL 4J12A 4DO4A 3TZVB 4HIXL 3CHQA 4KRPC 4UM9D 1T3FA 4F9LA 1KUMA 1OLZA 5BO1H 1E3FA 2H26B 2ICES 3EO1A 3QEQA 5BRZE 2ZCLH 3TBVB 5MI0C 3HR5A 4ZI8A 3ULVC 5FO8B 4YFLI 4P3DA 3CN1A 4PB9L 4QI3A 4H2CA 1OTSC 5A2BA 3IDJB 4WO4B 1GGIL 1V8HA 1DBBH 4LPYA 1AJ7L 1QSFA 4XHJC 4LKCA 3RIAF 4G42B 4HPOH 1A1NB 2JKLA 4F5CE 4KRMB 4O9HH 4K15A 1FF5A 1RHHA 3LHAA 2ZUQB 4AQ8C 2FUQA 2LLGA 1A6AB 2NY2B 1KZQA 7TAAA 3AG4B 4XMWA 5D4JA 5JR1L 2X4RA 1BD2E 1Z3RA 2AZAA 1A7QL 2WHVA 3HC4L 5AVXB 1OAKH 4RFOL 3MBWA 4HH8A 5CR1A 1Q0XL 4IW4C 3T9WA 1FC1A 3DGGA 3NJMA 1G9EA 4TV3A 2DQ6A 4NQDA 1HSBB 4DGVH 1TSHA 2V2XA 1DL7H 35C8H 3U4KA 5IFJA 2W1NA 1Q72H 1ZTXH 3V0WH 4B97A 2DF3A 5AKRA 5C86A 1NPNA 4QHLA 4JQXC 5IK3A 3AS3A 4WWOA 1LL1A 4AKPA 15C8H 5DVPA 4BH8A 3AAZB 4W6WB 5D7KE 2BWDA 1BYPA 2Z8WC 1ACYL 4OM0L 4PMFA 4AK2A 2A73A 1WT5A 1YVLA 5SX4H 1OB1B 3GRWL 4X4ZA 3SKMA 1N19A 3DX9B 1UD8A 1D7FA 4OT1H 4Y5XA 5EBWB 3UADA 2CSPA 4OCWH 3UC0H 3SDCB 1MHPH 3S34L 1LHZA 1E3XA 2H2SC 4QWWD 3FB8A 2BHYA 4GH7B 1OE2A 2R59A 3SDDC 3MRGA 3U4BL 5D71H 1AGEB 3DVGB 3JYCA 4GPVA 2ZOWA 3DOIA 3V8OA 1QZ1A 5J12C 2HYMA 1LLAA 3WXVL 5J6HB 4KKBD 3L45A 4EF3A 2QR0B 3L3HB 3TJHC 5GGUA 3OV6A 4OB5L 7PCYA 3MUGB 2ZOKA 3RVWD 2FR4A 3QZNA 3ARZA 1B4JL 1HINL 2P46B 4Y5VA 2Y6SD 3GTTA 4BCYA 3ARFB 4JO5A 1C5CH 3H7LA 3QDAA 1OALA 3CC5A 2ZSWA 4ZFOL 3BMWA 3EOTL 3N1FC 5LNGA 3E3QC 2Y7LA 5C0GA 1K6QL 2E7BA 2LAGB 3TJPA 2EEFA 3SYAA 2QVIA 4B9KC 1S7UB 5ICZB 4ZMWA 3N85H 3CPLA 3N1PC 3N3EA 3A4EA 4AJVA 4AMKH 3RX9A 3IDMA 2OYLA 2NUTA 4LSVL 1WZMA 3DPBA 5IB3B 4JDVB 3QJOA 1KCSL 2A2QT 3BKMH 3C8KA 5EOQL 2VDNL 1RUAH 4P9ML 4ZTEA 1L9QA 3PAVA 4XMLH 2C4XA 4NYLB 2F53D 3CNKA 5JXAL 1UT2A 4F2EA 3MGOB 1NFKA 4JRYE 1U33A 4WSKA 4ZAKD 4BA8A 4PV1C 4JN2A 1I1YB 4FZEL 1XF1A 3N40P 2Q7YA 1Q9LA 2G9HA 3HI1B 3KWWB 4R4BB 4BZ1A 4F8PA 2O72A 4MXWL 3N1GC 1LTXA 3ZQWA 4C4KT 1NDGB 1A21A 4XNMB 2CGRH 4OCMC 4MDJB 2R0KL 3HKFA 2YAOA 2VR9A 1SPDA 5EU7E 2G5RA 5C08E 3MLTA 1ZD6A 5AYUL 1R5IA 3FFOA 1SZNA 3A6OA 4R3SA 2I7OA 1ZCRA 1F8TL 3A22A 3DTXB 3B9KC 3O2WL 2L7QA 4FFYL 1RHFA 1J5OH 1YQ2A 1BQLL 4PJ9A 2AF2A 3D4YA 2X0WA 3L81A 1BJMA 5EBMB 4CVWA 5E9AA 1L5GB 4DP9X 3EO9H 1WZ1H 5B22A 1DSFH 3FF7A 1XQ4A 2P1YA 1KBBA 4KWUA 1CDBA 4AV5A 3ROOA 3RUGB 1DBJL 5GRJL 2WNXA 5I1CL 3IDYC 3JQOB 4KQ4L 3QORC 1FVCB 3SDAC 4DW2H 1RVFH 1HOCA 4YBQD 1IC7H 2YD9A 4LF3A 5EBLB 3DO4A 4UZGA 3O41B 1ZMYA 4HU2A 1NGQL 3DBSA 3VGAB 1EJFA 1GY1A 2DWEB 2GJRA 5B3JF 3T1WA 3IRPX 1A4JB 2VM4A 2FLBT 2OMTB 4IYKA 1JTTA 2VLLB 4RGNE 3SY0B 5MEOB 3EYOA 3NZUA 1PU0A 4DWHA 3WXWL 4HU8A 2NX5B 2N0MA 3KYKH 4BKLB 1G7MB 1SVCP 1PKQA 4GRWF 1RULH 2GSGB 3FRUB 2M26A 2YPLB 4B9IA 5AOKA 4JB9L 4DTGH 4FTVD 4XO4A 4MNQD 2CRMA 2F6AA 4I7ZC 2XZCH 3BISA 1G7IA 3HVNA 4XOBA 4HZ1A 2QPSA 2BIPA 4Y88A 5INCB 5F1KC 3JUZA 3SJVE 1AIFB 2A9BA 3WJJA 3FONA 3QXAA 4WVRA 4H0HB 3OB0H 4AIOA 5T1LD 5LGJA 1HX0A 3VFMA 3OXSB 2C9RA 4FN0A 4FKHA 4RMRA 4J4PC 1S2EA 5KSAD 4MFHA 2VW7A 3LEXB 1RY7B 3HFFA 2EVHA 2WWKO 3MUY1 3LEYH 4GRLA 4HUMB 5DJ0B 1HXMA 3QAZC 4NI3A 3HBQA 3SBWA 5SWSD 1XGPB 4C8XA 4F7MB 1TF4A 5E00B 2N1TE 2NXZC 2TRYA 3GRBA 3I6LE 3M1BB 1BLNA 4BFIA 1KBGL 4DVRL 5AB0A 1NOFA 4OZIB 4A37A 4WHCA 3ZTEA 5AKTA 1F3JA 3MJ9L 2N56A 4PRHA 4ZRGA 4Z7OF 1LWRA 5ELIA 4JGUA 4BFFA 4M93C 3C5JB 3RWDB 4H8HA 3VE0B 4FMFA 4BQ9A 1LMKA 5LCVH 5GGTA 3BZEB 3X12B 3CFDA 1UM6H 3U1SL 3N42F 2OMXB 1TITA 4HLJA 4Q9RL 4A68A 3DJRA 2AJXL 3BI9X 2AJSL 5IY5B 4YXKH 3S96B 1NDTA 7CGTA 5I15H 4LCYB 1X44A 1FL3B 4KHXH 5EU7C 3OJVC 2DWYA 4YSTA 4EI0A 4XI5C 3QFGA 1QW9A 3OAYH 3HBGA 3HCVA 1OLLA