2HX8A

Crystal structure of cu(i) azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "csphqgagm", at ph5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCSPHQGAGMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Engineering Copper Sites in Proteins: Loops Confer Native Structures and Properties to Chimeric Cupredoxins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hx8A00
1IBZA 2AVFA 4NERA 2HLEB 4E9SA 2BHFA 2VSMB 1T5KA 1NZRA 2DWSA 2XV2A 4JHVA 4M3HA 2YXVA 2PP8A 1TU2A 2W88A 3WG7B 1L9PA 1N68A 4RH4A 2ZXWB 2BP0A 1WAEA 3FU7B 4BK5C 3EH5B 2B3IA 1KYAA 3TU6A 1A65A 1KDJA 1RCYA 2OCCB 2VSKB 2VW4A 2YARA 5I6KA 1VLXA 4F7KA 2VM3A 3EH4B 1ZDQA 3X1EA 5I6OA 4GP5B 1MZZA 1NIFA 2I7SA 2IDUA 3PLYA 3ABLB 1OE1A 4YVUA 3AZUA 3EF4A 1J9SA 3QJRB 3T6VA 2UXTA 3S3BB 1WS7A 2IDTA 3FQYA 4E9VA 4AKPA 5AFAA 2GC7C 1MG3C 3UAEA 3GXUB 1NIBA 1NTDA 2IH9A 1XB6A 1OCOB 1GY2A 2GC4C 2XYBA 3D12B 2XX1A 3FPYA 1BEXA 3KW7A 3L45A 1GS7A 2PPCA 4GYBA 3WIAA 1YLBB 1GW0A 4AKOA 3SBRA 1L9OA 4BWWA 1ZDSA 1J9QA 4K9JA 4DP1X 4GY4A 3AG3B 5F7AA 1AR1B 1OE2A 2MRYA 3FT0A 1ZIBA 2DWTA 3ERXA 1IUZA 3TBBA 1V10A 2YAPA 4DPAX 1QLEB 1TEFA 3IBOA 1DYZA 1KCBA 2FT6A 5B1BB 2XUWA 1AZRA 1AIZA 2YAHA 3QPKA 4KO5A 1GYCA 4G7SB 3X1BA 1HFUA 3NYKA 3ASNB 2BW5A 3QJUB 4YSEA 5AZUA 4DPBX 4CSZA 1SFHA 2PCYA 4YVNA 2FT8A 3KW8A 4HAKA 5B1JA 3ZDWA 2R7EA 2PPEA 1ASQA 3ZX1A 2ZONA 1E5ZA 4GXFA 1RZPA 1SDDA 1CUOA 1A3ZA 3JTBA 3FYEB 1GR7A 1V54B 3OQRA 2PP9A 2VN3A 1PZCA 1M56B 3HEIB 4DP4X 2OJ1A 1E5YA 3OM3B 2EIKB 1AQ8A 1W6LA 2J57A 1HAWA 3DIVA 2FQDA 1EZLA 2HXAA 2XXFA 5I6PA 2DYRB 2VW7A 3C75A 3IN0A 3UABA 1PLCA 1BXAA 4F2FA 1KDIA 3QJTB 1BQRA 3FQ1A 2VM4A 3FSVA 1OOWA 2WO2B 1X9UA 2YAQA 2EIMB 1OE3A 2PPAA 5AKRA 2GB2A 2I85A 2YAMA 3OD3A 3X2QB 4L0PB 4KO7A 1X9RA 3CVBA 2AFNA 4Q89A 2HRHA 5B1JC 4DP7X 4PCYA 1KV7A 4KO9A 3NJMA 3NJGA 3ZBMA 2BO0A 5I6LA 4X4KA 1AZNA 1RKRA 3WKQA 4QLWA 2AZAA 3FU9A 3NT0A 3FSZA 1ET8A 1R1CA 4A2DA 1E67A 4N4YB 3S3DB 3QJVB 1JXFA 4GP4B 5D4HA 2PCFA 3AG4B 3MBWB 3PXLA 3T6ZA 1E65A 2AANA 5F7BA 2VW6A 1UATA 2VMJA 3DKHA 1URIA 1RZQA 1NIEA 5D4IA 1SJMA 4E9RA 4DP5X 2A3TA 2YAEA 1QHQA 1SFDA 1J9RA 1M9WA 2J5WA 2XV3A 1MG2C 2HZHA 1ET7A 1NWPA 4CSPA 1CYXA 4YSPA 1V55B 4HZ1A 2WSDA 2UXVA 4EF3A 4YSSA 3UAAA 2IH8A 3T6XA 2UXGA 3NJFA 3N55A 4KNTA 4E9XA 3QJSB 4W9ZA 5B7MA 4ZK8A 4HHWA 4DP8X 1J5CA 2QDVA 6PAZA 3QJQB 1NDTA 1XMEB 2FQEA 1BXVA 3IE9A 1AZUA 2N0MA 3JT2A 2HX9A 4HALA 2GIMA 1GSKA 2IAAC 1AACA 2TSBA 1JERA 2DY2A 3NJKA 4A67A 2P80A 2FJSA 3S8GB 2GI0A 4G72B 3SQRA 4AI7A 1SF3A 2XU9A 3FU7A 4FA7B 1FWXA 5TK2A 2PLTA 3MX0B 2YQBA 3FQ2A 4N8UA 3FS9A 2X87A 3T71A 1PNCA 3ASOB 2PP7A 3NJJA 2RACA 1JZFA 5A7EA 1BXUA 1NICA 2PPFA 1JZJA 1NINA 3AG1B 1JZIA 1CYWA 1FA4A 1BQ5A 3UADA 3WKPA 4DP2X 1SNRA 2BZ7A 4A66A 3WI9A 4KNUA 3TA4D 4E9TA 2BWDA 4BXSV 2LLNA 1NIAA 7PCYA 3PAUA 1W8EA 3DTUB 1OCRB 5E9NA 4M4RB 2BP8B 1NPNA 2WO3B 3CDZB 1NWOA 3SBPA 4Q8BA 1ZV2A 5B1AB 1L9TA 1PLAA 2AZUA 4W1TA 1HAUA 4E9YA 1ADWA 3CVCA 4AX3A 1M57B 1AS8A 2BP0B 3WNJA 2CBPA 3CVDA 1L9RA 1PZBA 1ASOA 5ANHA 2HX8A 4A2EA 5D4JA 1BAWA 4NAJA 2ZOOA 2H3XC 1SHXA 3UGEA 3OMAB 2CUAA 2GHZA 2E86A 2H47C 2J55A 3T6WA 3SBQA 1ASPA 5I6NA 1IBYA 2QPDB 1WA0X 1ID2A 2FT7A 1A4AA 4HCFA 2IDFA 4HHGA 2Q9OA 1AG0A 2ZWNA 3BQVA 4NB7A 5TK4A 1AOZA 1NPJA 1JVLA 2GBAA 2GSMB 1GS6X 4A68A 2UX6A 2IWFA 3H4HA 1N70A 3FSWA 1OF0A 2TSAA 1QNIA 4KOCA 1ILSA 1IKOP 3NSYA 4WTQA 4YL4A 1ZPUA 2NRDA 3NJIA 2HX7A 1PY0A 1W6WA 5PAZA 1L9QA 5I28A 3NP4A 2YAOA 2FQFA 3OMNB 2HRGA 4GP8B 1DZ0A 1AS7A 1KBVA 3CDZA 3NJHA 4UF7C 5I6MA 1AANA 5B3SB 3FU8A 2Y69B 2BWIA 4YSCA 1KGYE 5LDUA 3AY2A 2QDWA 4AKQA 3NP3A 1MDAA 4A2FA 5I5MA 2CALA 2EINB 2BZCA 3S8FB 3PAVA 2I7OA 3ABKB 3X1NA 1PF3A 9PCYA 3RYMA 4A2HA 2IWEA 3GDCA 2FTAA 2FWLB 4E9WA 4BDVB 1SF5A 2XWZA 1F56A 4JKNA 1PNDA 1AZCA 4KNSA 2YXWA 1OCCB 4G70B 1XB3A 2Q5BA 1KCWA 2B08A 1PCSA 4YSAA 1JXDA 2Y1AA 1JXGA 3FYIB 2R7EB 4FAAB 5I5JA 8PAZA 1IC0A 1AG6A 3UACA 2H5UA 1JZGA 5B7FA 1A8ZA 1SDDB 1GY1A 1JOIA 2CAKA 2EILB 4YSRA 2JKWA 1AAJA 2JFCA 3V9CA 1E30A 3PAZA 1J5DA 1PZAA 3AG2B 1PMYA 4E9QA 3WNIA 4DPCX 1BYPA 2J56A 1PLBA 4DP6X 2UXFA 1ETJA 1J9TA 4JHUA 1CURA 3G5WA 4TXVB 2X88A 1NIDA 4MFHA 3X1GA 2IDSA 5I5IA 4UAHA 3EHBB 4YSDA 4DP9X 1ET5A 3QQXA 4BWUA 4YSQA 3T9WA 3V9EA 1FFTB 4YSUA 4KO6A 4WKXA 1JVOA 3H56A 2XVBA 5IY5B 1WA1X 2UX7A 2DYSB 2QT6A 4YSTA 1WS8A 2QPEB 2XV0A 4BWTA 1L9SA 4P5RA 3IN2A 1A4CA 4BDVA 1MZYA 2FQGA 2FNWA 5B7EA 5I26A 1ZIAA 3PCYA 4G71B 1JZEA 2PPDA 3NSFA 7PAZA 1CC3A 2CJ3A 1WA2X 3H4FA 2IDQA 3TASA 1I53A 4DP0X 3GYRA 2P80D 3PPSA 1ILUA 1A4BA 6PCYA 1TEGA 5B1KA 2XLLA 3N2JA 4G7QB 3AW5A 3OMIB 2OV0A 5EHFA 1B3IA 4KOBA 3CG8A 1BQKA 3S3CB 2MTAA 1BYOA 1PAZA 3BVDB 3NJNA 4G7RB 1JZHA 2JXMA 3X1FA 3NSDA 3HB3B 4A2GA 1AZBA 3NJLA 3ZIYA 3EH3B 3CZUB 3FPXA 1GS8A 2W8CA 1SHWA 2XX0A 4HCGA 4QKTA 2BW4A 4F2EA 5FC9A 4UANA 4YSOA 3TBCA 3ABGA 3ABMB 3IEAA 1TKWA 2YAFA 4HIPA 4PAZA 5PCYA 3U25A 1OV8A 2XXGA 2EIJB 4HCIA 4P5SA 4BXVA 4ENZA 3NSCA 3FSAA 1KBWA 1EHKB 4AZUA 1AS6A 2CCWA 2IWKA 2DV6A 1XB8A 1OCZB 2BP8A
chains in the Genus database with same CATH superfamily
3STLB 2CMRH 2C7UB 4IM8A 4U0QB 5J3HC 1NCOA 3FT1A 2AJYH 5D1XA 2HLEB 2BHFA 1BG9A 3CSPA 1E9QB 1DHKA 2F53B 4PN6A 3ULVD 1NKGA 4LEOA 1L9MA 2V2TA 2DN7A 1U8IB 3LY6A 4MNHB 2VXVL 4LSUL 1O7DE 3B3IA 2WCSA 4H0LC 4RH4A 4PWGA 3UXFA 3PWPA 1W72A 2QL1A 5I66A 1ONQA 2F68X 3PWNA 1TFPA 1G7QA 3DECA 4L1HA 2FR4A 3GMOA 1PY9A 2VM3A 5LAXA 4OF5A 1KELL 3QUXB 4Z7NF 3QS3A 3X1EA 4RWHA 1N2RA 3CFJA 1E27B 3MRNA 4HS3A 5I19L 4Z7OF 3UJIH 4JFXA 4P99A 1E2WA 1KWGA 5B1CA 3AXLB 3I6LE 1A9BB 4P8QA 4QRQB 4UMGA 4Y2DB 1IEAA 2ZJSL 4OZHE 4DK5A 1JPFB 5ISZB 4O2CB 3VXRA 3REWA 3JV4A 5FPIA 3T0DA 4FMVA 5DQJB 3LZFH 2WK2A 1EEUA 1OCOB 2VMFA 3ZDZF 3KPSB 3D12B 1TTAA 3BFQG 5EEXA 5ABZA 3L45A 1CIUA 1NCCL 3G9VA 3CXDL 2C4FT 4OFVA 3MRGB 1Q90A 4WHCA 3EDJA 4Y16D 2RHEA 5KN5A 2GK2A 2X7LB 3V5DA 3MJWA 2GKIA 3DK0A 4OZGB 2P8MB 2EKSB 3EBGA 2FGWL 3LPWA 3GHBH 4J6IA 4J39A 2JK5B 4LAJH 3V4PB 1INDL 5KSAA 3S8WA 1AGFB 4PRBB 2FIRT 4KC3B 1RZIB 3ERXA 3MV9B 3TBBA 5JR1H 4XO4A 3ARDC 3OHXB 2EDWA 1I1RA 2ZUQC 1JPGB 4FTVE 1P84K 3QPQC 5H35B 4OGXL 2KLTA 3BXNA 1TYJA 1FFRA 4G43A 3X1BA 3O41A 1KB5H 3EDDA 4I48A 1U8PB 3HS8A 4M3KB 5JIKA 3FTSA 1D5IL 1E4KA 5AZUA 3ZHDA 4XHQA 4D3CL 1PW3A 2G5RA 2HA1A 2FT8A 3DVNB 4FRWA 4KK8D 1U2CA 4J5VA 3MCLL 1Z2KA 2CIIA 3R06A 3W11D 1A6AB 3P2TA 1A3ZA 4Y7MA 1N4XL 2IJ0C 4F33A 3G04B 4XNAA 1U8QB 2FX7L 4XWOD 5I1GH 1PZCA 1CD0A 3ZKNC 1DQTA 3ZTNL 3VVVA 3U6RB 3IPFA 1IX2A 3ESUF 1YAIA 1DUYB 3CIQA 2BMKA 1LO2L 3A6CL 5I30H 2XACC 2FQDA 3D85B 1TZAA 2XXFA 4J28A 1QA9B 2DQDH 2VW7A 2NT0A 3C75A 1SDAB 3HJ0A 4WWKB 4XAWL 3UABA 3MROB 2AGJH 3MA9H 2CQVA 5C6PB 1J8HD 1AYRA 4MJ2A 1Z0NA 5LN8A 2MPAL 2OX5A 1QBLH 3LKNB 4J4PC 2Y1VA 1EDHA 3WIFA 4HBCL 5D2LF 5CHNA 4G8EB 4NYLA 3VXTA 5DU7A 3QG7H 2PKDA 1EQWA 1WIUA 3I9PA 1D5XB 1B0GB 1UUNA 3JWOC 1IM3D 4M5YH 2MQ3A 1JK9B 3MNMA 1EZVX 3MA7A 1T03L 2YPVL 2WUBL 3QCUH 3PWJA 5D7IE 1CLCA 3NPSC 4D8PA 2YHGA 3T1FB 4Y5YC 5FWRA 2J2ZA 4LNVA 1J1OH 1N9PA 3LSOA 3WKQA 3EFFB 4WTWA 4U3HA 4PMEA 5B38G 1F13A 3NEEA 1MOEA 4FQ1H 4MA3B 3FSZA 3QIBA 4LFHG 4Q6YA 3QQDB 5HHQB 3W5MA 2I9LA 3CC5B 5EC1B 3LNFA 4L4VE 2E7DA 5EFIB 4O9HL 5AAMC 1JZ6A 2ATKB 5LCVA 4RCAA 5DRXB 1SN5A 3H6AA 2ERJB 2CO6A 1URIA 3T3PF 3ULVC 4E9RA 1P4IL 5DRNA 4R7NA 1FVDB 3RL1A 5LBSH 2D3VA 3WS6C 5IROA 3O4LD 5JZ7D 1T0NA 4H8WH 1IBGL 1ET7A 3LEYL 5DRWB 4Y88A 1I8KB 4YSPA 2BDNH 4CN4A 4FYSA 2Y7OA 3QRGH 4OGYL 4KQ4H 4XXCA 1H3PL 2QDVA 3HNVH 1HXMA 4ZOAA 1TMCB 1AD9A 1IAII 4JZNA 4NC0B 4HS8H 2YLKA 1BX2A 3DIDA 1P84J 5F1IA 4MS8D 1U2YA 2IQAA 3BLBA 4K3JL 3IDYB 4KROD 4L3CB 2QFPA 1DQJB 3S8GB 4G7VL 1DJXA 1MFAL 3DV6A 1PFCA 4I0KA 4PW3A 3UMTA 3QG6A 3PGFL 4FA7B 3MC0A 4Y16C 1H3VA 1IGJB 1PDKA 3L3HB 3CLFH 2VERA 1SEBA 3EH1A 5K9JL 1NQBA 2BSSA 2ZXGA 1E8ZA 4ODTL 1QMUA 1I8IB 4N3UA 5EZOL 2GBUA 1R33A 3EFDH 4K7PY 4G5ZL 2ENSA 3GSOA 3D7PA 1BQ5A 3M1CA 1FA4A 1KIQB 3RGHA 1XD1A 4CNIB 1LXMA 1NIAA 4K2UL 2NY3C 2WINA 2CO4A 5EF2A 2VLLA 3OWRA 5A6LA 1IKNC 1QLRA 1CD1A 3GSQA 3NFNB 2XTJD 4L4TA 4OLZH 4HVBA 2YGPA 3LV3A 1UEYA 4OD1H 1QI4A 4XE5B 3SKNB 2DJSA 3TPUA 3V0JA 4XBGA 5B8CA 3SBPA 4Y5VA 2K45A 2VXUL 4G7YH 5DCCA 4KK8C 5HGDA 5IQ9B 3QNFA 1I7ZB 3UBHA 1FO0H 1PY4A 1G7PB 2BVPA 3DBXA 2YUVA 4U1LB 1GYUA 5K9QI 3MUZ1 4GO8A 3W11C 4QF1B 2R83A 3VD2A 4M6AA 2PNDA 4UU9B 2IQ9L 3AU1A 4S2SA 3WNJA 4BINA 2WTPA 1N64L 3L5XH 1S7UA 4XWOC 4CC0A 4O5LL 1UVQA 5E6UB 1U58B 4JKKA 3CN3A 1HE8A 2DLEA 3MLSL 4OIIH 2BOCA 3CQQA 4P59H 3MO1B 4AL8L 2AXJA 5HVFB 2H47C 2X4TB 2VR9A 5I6NA 3M88A 1QD0A 3EYOB 1ZLSL 3EADA 3EYSH 4PD4K 5CEYA 4PS4H 3ZXAC 3MLVH 3P3TA 3NRFA 3ARVA 5AL0A 4AQ8C 2DQTH 2L7UA 3AS3A 2X3BA 3BQVA 5IMKB 1VA9A 5KSUA 3T77A 5KZCD 5DC4B 5KYYB 1FLRL 2BHUA 3KL5A 1UA7A 1XGYH 3PNRB 5D93B 1E7VA 3ET9F 5LO7A 2C3HA 4X99B 3UBXB 1JK8A 2QTEA 2JJTC 4XMPH 3O11A 3ES6A 3BAEL 3FB6A 5E99L 1PY0A 5FKAB 1JRHI 5D6DC 2Q3AA 3M1BB 3GKWH 2ESVD 5B21A 4DESA 4KGJA 1T1XA 5E00B 3POCA 4HKBA 4X9YA 2JELL 4YSCA 2W9DL 3CN4A 4QRPD 4XP6H 3RBSA 3CFKA 1ZXQA 4UQBA 1MY5A 2ZWSA 4JFTA 4P57A 2VZOA 5CCKL 2BZCA 2VJXA 1VACA 2DKSA 1X4YA 4R90H 4ACPA 3QNYA 4ZUWB 1P7QA 3U36A 3ARWA 4NZDA 4QOKD 4EUPB 4CADB 4PJCE 2DLHA 5BRPA 1JL8A 3H7LA 4UOQA 4Z23A 2Z0BA 1FYTB 4KVCL 1CGWA 1OCCB 4PY8I 4Z7WA 2WVSA 1RZKL 2O93L 5IREA 5JZ7C 3ULUF 2Z92A 1SDYA 3ZE0B 1IGTB 4ENED 3HMXH 1MCOH 1XSOA 3F65A 2X0UA 3FAWA 4JM0A 3HUJA 1KY6A 1SDDB 5E8PB 5KANG 3G6AA 4GRMA 4K5LA 1BEYL 4GMTL 5J9PA 3MI6A 4PJXA 1E30A 5ACZA 1OGTA 2ENPA 3OTTA 1ADQH 3JQOB 3FN9A 3QA3B 3HE7C 1BZ7A 1OAZH 4RRPG 1LILA 3MNVB 3TBYB 2DD8H 2UXFA 4G8GD 3EO0B 1HXKA 4JHUA 4PJEB 5FA3A 5JYLA 3EOTH 4MS8C 3K4ZA 5D1QA 3L7EB 1L6ZA 3QFJD 1CE6A 4H20H 4KROC 4LDEB 5T1KB 1CICD 4X4ZA 4OCSL 4M6NL 5JXAL 1YECL 4TVUA 5JW3H 2GJ6D 1IIIA 2QR0B 1YQVH 2DQEH 1RMFL 4KJYA 5BO1H 4Y1SA 5H37H 4MJID 5CU9A 1N6UA 5A2BA 3FO2A 4JRWA 2DWXA 4QNPF 4G6ML 1GGIL 5D70L 3MRQA 5AVSB 4HG4K 2YSTA 3DUSB 2FNWA 2VISB 5IESH 2RGSA 5ESAB 5IB4B 25C8L 5IB1A 15C8H 1CFNB 4PJCB 3D3VE 2IDQA 3HLAA 4L37A 4Q52A 4N2OA 3CK0H 3D0LA 4LAQH 1X5JA 1M2OA 2O30A 3GXPA 1G0YR 3DXAD 4PD4J 4JFFD 2XLLA 4M1DL 1LWRA 3IDIA 1T20A 2D31A 3APCA 2XTJC 4JQIA 3HNTH 3P54A 4PJGA 3OR7A 5IW3A 1WV7T 4NSKB 5IVXE 4HX1A 2MPVA 2VRAA 4WSGA 1OM3L 2DQ6A 4M43L 1MHCA 4QRTB 3FQUA 5FXCH 4BFGA 1CF8L 3CZUB 5DRZA 2BX5A 5D9SB 3ARDB 4TL5A 3PQYD 4HUKB 4LCYA 1KMGA 2VZVA 5DMIH 4CMHC 3J07A 1NL0L 4KRLB 4XBMA 2N1TE 1MJUL 1TZIB 1BVOA 1KCVH 3DLQR 2P46B 1A1NB 3KS0J 4LK4A 3X14A 1FFPA 4HCRA 3NFPA 1NGWB 4WU5B 4H44C 2XXGA 4FZEH 4PJAA 1OAKL 2GTQA 2ADIA 3SE9L 4FQQB 3ULVE 2AV1B 5FX3A 1OTSD 3UEZA 2ZWZA 1IBZA 3OJDA 3PPEA 4F7EA 4PIBA 4JE0A 1GHFH 3U2JA 4X5RA 1HZHH 5FDYA 4R84A 1NBYB 3F6LA 2DIAA 2HKHH 1EIBA 3F6IA 5GGQL 2EH8H 3VMNA 2XJLA 2QVIA 1N0XH 35C8L 3OKOA 5K1NA 4MAYA 1NAMA 1IGCL 4M00A 4BK5C 3LRMA 1F00I 4QTIL 4RDQG 3ZDZB 4QHNA 5IFHL 2IEPA 1JDDA 1DLFH 1FH2A 3TV8A 1KC5L 2ZKYA 2K7PA 4TNGA 4G9FD 2BP3A 2YD9A 1BZDA 3C08H 3OKKA 1WBXB 2G2RB 4C56E 5HGBA 3UPRA 4GQRA 4FLSA 3TV3L 2LAGB 4B9JA 4MZ3A 2ZX7A 4LQ1A 3NPSB 4OLUH 5DI8A 4Y5YB 5LG6A 1A4KB 5DQ9B 1IEBA 1R75A 4HIHB 1NMCB 3GB7B 5C6TL 5C9JA 2NOYA 4PRAB 3SDYH 1TTGA 5T1LA 3WAKA 3EF7A 4TSCH 3FPYA 2WCGA 1YEGL 4DVBA 1FNGA 4Z5RA 4L8DA 3KYKH 5EU6A 1DUZA 4HG4J 1HOCA 3HHMA 3EGDB 4R26H 5LNDA 2AV7B 4YIQA 1Q0XH 4NUJA 4PYGA 1Z5YD 4AKOA 5DEFB 3SBRA 1ZS8B 3SPJA 4ZNCD 2NUPA 2WXJA 3EOAB 1EDYA 4JM2D 4AM0Q 4NZRL 2X4UA 3RILA 3CX5J 5AKTA 4AW7A 1NLDL 3O2WH 5C0JB 4ZX6A 3E8UL 3NSXA 3DX2A 1IC5H 2DWTA 1A7OH 1N18A 2Z4QA 3N43F 1FZOB 4X7FC 5GGTH 4FQLH 3V0VB 1P0SE 4CMMA 1T2QH 3VCLA 4OQTL 3QZLA 4PSPA 4YDJA 2Z65C 5DO2D 5J1AA 4HPHA 4ZMTA 4GSXA 5EBGA 5KYXA 4K8RD 2J44A 4PGJA 4YSEA 2Y24A 3VXQA 2HKFH 1JNNH 3PDOB 5EU5A 3SDAD 2H0PA 4HISA 3WY1A 3CHRA 3WN5A 5D2LB 3ZR5A 3QHZL 2ADJA 5DJ8A 3WU1A 3ZHNA 2H41A 2QBWA 3NACL 1V54B 1YMMA 4IKKA 4AYMC 5IHUH 1KEGH 1FV1B 4YBHA 2X5PA 2H26A 4QT5A 3CSFA 5KSBF 3KBPA 2WXKA 4H5SB 4XOEA 5MP6H 3AU0A 5IJCC 4JPVH 5B39B 1F11B 5HPOA 3EOYG 4IBUA 3KLSA 1B6UA 1DO5A 1DVFB 3TT3H 3L54A 4F5CE 4LARL 3U2SA 1W0WB 1PKQB 2A77H 1FGNL 3M17A 4XCEA 5TE7H 4CBPA 2CO1A 4ZTOL 1BF5A 4I5BA 2D3LA 3TIEB 3F7LA 2PPAA 3GM0A 4TUKL 4N1CA 1KTCA 3ETSA 1QQDB 1GRWA 4XPBL 3T3PB 3W9EA 4KO7A 1X9RA 5LGHH 5CP7B 3CC1A 1BLNB 4DP7X 3E1F1 1MQ8A 2BC4A 3K4DA 3P30H 1CDCA 4XPFL 4XN2A 2WNXA 1EJ8A 1VSCA 1MF2L 2WQSA 2WM0A 2LU4A 2A6JA 4YHZL 1NLBH 2CHXA 1I85C 2XA8H 3N85L 4KUZH 4Q0XH 4IIQC 2OMNA 1UXMA 4WFGE 3GT6A 4RRPA 3ZTJG 3LAFA 4WY7L 3S3DB 4XOAA 4XTRC 1XQ4A 4M8QA 1OTSC 2XY1A 3ROOA 5JQ6H 4F8NA 1IQDB 2GY7B 4NC2B 1VENA 5ADPH 2NW3B 2OSWA 1UATA 4M6OL 2VMJA 3WY3A 5I6XB 4ZFOL 3C9NA 3ATDA 5J6HB 1PD0A 4PY7A 3FB8B 3JZYA 3LKRA 2ITCB 4OTXH 1E4HA 4U33A 4MJ4A 2NLJB 4JFEB 4HEME 1J9RA 2AXFB 5IIEA 2R2HB 5ESQA 1NBCA 3G6JF 1J8HB 1WZMA 3LS5L 4R97C 2NSQA 1BQLL 4GOSA 4LSSH 2P28B 2AJ3A 1MFCL 4HZ1A 3VW3H 2UXVA 3TLRA 4UTCA 2ICEC 1J18A 3UAAA 3RWCB 4OJCA 1MPAH 5DA0B 3T3ME 4PUBH 3QHFH 4K7PX 5FFGA 1IM3B 2DKUA 2Z31A 4W9ZA 1KJ3H 1QLEH 1NC4A 1WCQA 1HWGB 4JZJC 3EO1B 3QJQB 4L9LC 4CVZA 2IDCA 3EJCA 1MH5B 5GXBB 3BH8B 1JNHB 3HI5L 3S48A 1EFXD 5HHPA 3ARGD 3FO9A 4E2OA 4WDIA 4DVRH 1OPGL 2H32A 1M53A 3MRCB 3PGDA 1KTDB 1MVYA 4YDZA 1NCNA 1T7YA 3EGXA 4PU2A 5D7JD 3SQRA 4AI7A 3ROLA 3BVUA 3IGAA 3RHWK 3MLWH 2PTUA 4HW6A 4FJZA 2YPVA 3C5XA 4OF0A 3WO4C 3TBWA 1SYVB 5L4MA 3QO0B 1ZVSA 4Q9RH 2HJLB 3SGKC 5BPPA 1FNEB 4IRZH 1BXUA 1LVEA 1H19A 1F3JB 4JM2C 3LZPA 1H15A 2B1HH 4ODHL 5GRUL 4DP2X 2NPLX 3O4LB 4AVJA 1D6VL 1AKJA 1LLAA 4AGQA 5I16B 4KNUA 4HA1A 5E8DH 3SPVA 4XNUL 4F57H 3KLLA 1UOVA 7PCYA 3UYRH 4EVNA 4PMFA 5DO2C 3GHEH 3PU7A 4HMCA 1E6OL 1HSBB 3GPSA 3VTTA 4TVPH 2UUDH 4LLWB 3WFHB 1PLAA 4KTDH 3DURA 3SDAC 3GLDA 3QQ4A 5EO1B 3T3MB 5C0EA 3GTTA 2X4SA 4ZOCA 3D39B 3LN5B 2VGLM 1TTRA 3AM8C 2I9TA 2Q7NA 3RY6C 4OLXL 4KROB 3KPMA 1HCZA 4HH8A 3GIZH 3VXSA 5GRVK 4W4OA 5F1NB 3MNWB 3QYMA 3UC0L 3C60B 2J55A 4FNPA 5I82A 3V7AG 1RZJH 2NZIA 3IAPA 3W9DB 3H0TA 1KYUA 3L95B 4P4KB 5JUEH 2EYTB 4KAQH 3JV5A 2HLFD 1AG0A 1MNUL 2Q6WA 4AZ8B 1G5AA 4JCLA 2VLRB 3V4LA 4QEGA 2X12A 2CXKA 2ESVE 3W39A 2IWFA 3H4HA 4JMNA 4P4RA 1TVHB 3VH8B 1GIGL 4BZ1H 2PTVA 3KJ4C 5GSRB 3FFCD 1AGDA 4GI9A 4OGQC 2LU5A 5BOPA 3AGVA 3ARBA 2XTJB 3NA9L 3KPLA 2BVOA 4M4RA 3WAJA 4FXGA 1B4JL 1EMTH 2GT9A 1GZHC 2J6WA 4E36A 1U8OA 2QPSA 4JM4L 3NJHA 3WDHA 1F4YL 4KXCA 1AYOA 4WI0B 3VSVA 4NOBA 4X6BB 5EUKB 3GSUB 1YEFL 1XZ0B 2P26A 2EDNA 2GTWB 2JCCA 4HFUH 1IGYB 4QOKE 1QSFE 2OSYA 4LSTH 4MWFB 4G1EB 4WENB 3IMSA 4MJJA 4OQ1A 3OWEA 4MNGE 4XNMB 4APXB 4N0FB 5CMAA 3OJMB 2D0GA 2DQHH 2JQZA 4JLRB 3ZDXF 3QZPA 2JJVA 3GDCA 2X6BA 5CN2A 4XVSH 4JKNA 2OK0L 2FK9A 1ZHKB 3KM2A 4JY4A 3T8VA 4G70B 3S7GA 1PYWB 5AB1A 4J7RA 2BSCA 2R0WH 1XF3A 2P8PA 3QUMB 4NQUA 5DSCA 2MHAA 2PETA 2RQ8A 1WZAA 2GPZA 3KXFE 4GQ9H 1G7LA 2WXLA 3QJHB 4H1LH 5I2IB 2FVNA 1ICTA 1XF1A 4LL1A 3UACA 4OAWA 3MRRB 5BS0D 1IFHL 1NSNH 2FHCA 2VDNB 2DH2A 3BDYH 4OKVA 4E41A 5HDQL 3A0OA 4GKOA 1EXUA 2KZWA 1IGFL 3PAZA 3Q2CA 3T0WA 1UURA 2ZUXA 3QFJE 4YR6B 3RWIA 4E9QA 3QUZA 2ESVB 4R4BA 1AY1L 1HHKB 4JY6A 4X7SL 5FV1L 1ED3B 1DFBL 2GJ6E 3QXAB 2HH0H 2GJZB 3S88H 4K23L 1H8LA 3O8XD 4OU3A 4RISH 4QRPB 3GBDA 3HIZA 4MJIE 4N3TA 3LH2H 4UDTA 5D7JC 1EHLH 4N28A 5A2JH 1DVZA 3T9WA 4W70A 3GZQA 1UD3A 1LDPL 4R7DB 5IY5B 3OZ9H 5FO9A 4QHUA 3PGCB 3MLXH 4WNSA 1YEDB 4MNGB 4QRRA 1A4CA 5CIPA 3LTVA 4ZSOE 2OZ4A 2CGYA 3DXAE 3IM1A 1ZEAH 1YPZA 3QR1A 4UTBL 2X6MA 5GJSH 7FABL 3QWRA 2VM9A 3LXUX 4PLKD 1A7PL 5C08E 4Y4HD 4Q6KA 2CJ3A 1GMIA 5D1ZI 3HAEH 1BSIA 4WIQA 1NCBL 3TESA 4DKTA 5GIRB 1A2YA 3C6EA 3U83A 5BVPL 1AO7D 4HWZB 3OMIB 3V0GA 3S3CB 3CG8A 4U4IA 4A38A 4KZDL 2MTAA 2JIXA 3LKQA 3BW9B 3SCMD 4J1UA 2WYHA 3KYOB 1U8HA 2ZXCA 3BSZH 4G8FA 1HDMB 2ED6A 3GGWB 1MFDH 1CDYA 1DBKH 3U4EA 3NZHL 3NJLA 5FUZH 4XXDA 3MJ9L 4AQAA 4G8GB 4HJGB 3IS1X 4WRLA 4ZUSA 4YX2H 4ZQKA 3GRBA 4QTHB 2XSKA 1KJVB 2X1PA 4X2UA 1ORQB 1JZ7A 1CICB 1PVHA 1TF4A 2P49B 1HHJB 1F4WH 2BCKA 1PIFA 4FXTA 1D5BA 2DQCL 4JHZA 12E8L 3P1VA 2EEDA 5FGBC 2ZUVA 2XPZA 3EYQD 2OW6A 1NM9A 5M7QA 4OBRA 3A6BL 2GITA 3QAZB 2WPGA 2B77A 3GRWA 2CR3A 3UTPD 2LW3A 4OM0L 4W9DC 5HYJD 1MI5E 2EXYD 1LEKA 2XYCA 2HLFC 1LO3H 1MLBA 3F5WA 2MKWA 4E9SA 8FABA 3MLZL 2WD0A 2Y1YA 3AY4C 4D94A 4HLZH 3DV4B 2EKJA 3BN3B 2QKIC 3OKNB 1I1FA 2P5ED 1WAAA 4XVJL 2PP8A 3DXAB 2J6EH 1TETH 2Z0UA 4JFFB 3IJEB 1DP0A 2VRKA 3JWOL 1ZLEA 5GRJL 4NM8L 5SX5H 4HSCX 4QR7A 4G9FE 4MYWB 3PP4H 3EH5B 2NX5D 3CNKA 3D08A 3GJFB 5GZOD 4ZMVA 3I2CL 1JGEA 1RXLA 4HUXA 2V3FA 1RURH 3APNA 5DEGA 2D73A 1U3YA 3WLBA 4JZOB 2GI7A 4LVNC 1FCCA 3KCPA 4EI5D 3QI9D 3PQYB 4RETB 4MCYB 4F3FB 1EO5A 3FXIC 3DYOA 3ESPA 3PLYA 4EO5A 3AZUA 3T6VA 4ESKA 4R4FH 2KMWA 2H1PL 1R3LA 1P2CA 3M8OH 5H94B 3AB0C 2IWGA 1MRDL 1QFUL 3N43B 3PFQA 3VB8A 3WD5L 4AKPA 4QHPA 3ULVL 3WFEL 3VMOA 1KBGH 4L48A 4UIKL 1PSKL 4HPYL 1ZLVK 3P0GB 1ULVA 5FK9A 1OD9A 3WNNA 3CLEL 1ZV9A 3MUY1 3WIHH 1AQDB 3P4MB 1BGXL 2DQUL 3SJVB 4TQHA 1VGEL 2J43A 3STLA 2F54A 2WOYA 3L4WA 4ODSL 3L3GB 2R2CA 2ZXBA 4H25B 4HKJB 4JQVA 4M61A 3BVNA 3MJGX 2OJZH 4F2MB 1E9QA 1XCQB 3D9AL 4U7SA 2F53A 2COQA 4HGWA 4NNYA 1U8IA 2DB8A 4J3XA 1Z32X 4P9HC 4GRWB 4Q9BA 4L3AA 1SJEA 3OSVA 4DTGL 4U6HA 1I7RB 4GXVL 1JHTB 1FFNB 4ZO6A 2HTKD 4I77H 5D7LA 4Y4FD 4GXUN 3O8XC 3GS0A 2YAHA 3QUXA 3GNMH 3QPKA 4L1TA 4LLDA 1MFEH 4OF8A 4RZCA 3QDMA 2R56H 4ELDA 2OTPA 3V6OA 2EYRB 5IHBA 4L9LB 4PJDF 4JR9H 4P04A 4IKNA 5IMLA 1A66A 2ZQKA 1XL6A 5HHMD 3EGSB 1N5YL 4LGRB 3WJMB 1CUOA 2IH3B 1NGZB 2WB1A 4JO4L 2W0FB 5IB3B 1GPOL 2XN9D 4B0MB 4FD0A 4LCIL 1BPVA 2EIDA 3MRDB 3P9LB 4PLKC 4G6JL 5ALCH 3BYTA 1O6SB 4XP5L 2YEZB 2C7FA 2OJEB 4LQFL 2W95A 3C6LA 2C1OB 4B7IA 2BNUA 1U4EA 1FRGH 2R9HD 3MRGA 3FUJA 1ACZA 3WO4B 1AGEB 4RGOH 3ULUH 2FX9H 2Z8VC 3VD7A 3K0YA 1Q9WA 4ELKA 4OZGA 1FORL 4F7TB 3WJJA 4AGOA 3I02B 2HCZX 4WWNA 3TH2T 4JM2B 3N9GH 3V10A 2JK5A 1UWXH 3LKOB 3FQ1A 1BQSA 2BCMA 3GLZA 4M3JA 2ICWI 1JNLL 5ID1B 1YG9A 5CCJA 1V5JA 1BPLB 2YBGA 1RZIA 5FO2A 2OYLA 4KFMA 3X3GL 1DEDA 4NBYB 1TSRA 2CKBL 1TQBC 4QRRD 2CLZB 2YUXA 4I85A 5CJBA 1JPGA 2X28A 3CXHK 3RURA 5KBPA 4PRNA 1VEPA 2WV3A 5CJ5A 5I6LA 1LP9F 1WWAX 1U8PA 1NCJA 5KAQG 4L18A 1EZSA 4KJPD 3MBEA 5F3BB 3DVNA 4FFVD 3AT9A 1I7TB 4UAOC 4UQEA 4NQCD 3P0VH 4O58H 4N4YB 2EXYC 4Y1AE 4OV6F 4HJTA 4OQTA 5F7HA 3G04A 2ZKHL 3O3AB 4RMWA 4FI6A 4K7PH 1U8QA 1BMGA 3Q44A 4PWEA 4XRCA 4Y4KA 1P1VA 4OZHA 5EBMB 3WY2A 3WUWG 3UH8A 4DUVA 5TH2A 2X1OA 3SGJC 3DRTB 3G5ZB 4X5PA 3D2UB 5KG9B 2Z7WA 3I3EA 4JUSA 3MROA 3ZL1A 4Y2OA 1IKFH 2HVBA 4OZIF 3INUL 2Z93B 3VD5A 1JYNA 1DCLA 5MHSD 1QPXA 3VE0B 1YDPB 3BUDA 1M3IA 4FQXD 4X0KB 2QFRA 4FQPA 2WLIA 4G8EA 4EI5C 4IKJA 1KXVA 3CFDA 4FADA 3FCUB 1B0GA 4NX0A 4B0MM 4ELME 3IMWA 3FK3A 5LGJB 4UT6H 4H0HB 2ZOLA 1JK9A 3HBZA 4JO2L 3B3BA 4TPRH 5DFWH 3SQOL 3N41B 2Z4TA 4NI6A 1YO4A 5AAPA 3MUJA 1MHPL 3H9SB 2EVGA 3O0RL 2XZQL 3LQZB 2CLVA 1P1ZA 2JKJA 4D2NA 1WISA 2CLRA 1MCFA 3EFFA 4FTVA 3ATEA 4NUGL 4BKLB 5HHQA 2YPKB 2E7MA 2VDOL 1YEEL 3CC5A 4XN4A 4JHAH 1GKOA 3RB5A 4IRJC 2ATKA 1FJ1A 1EHAA 2YQBA 5DUML 1VPOL 2EE9A 3T71A 2I26N 1FZKB 3MRHB 1D6EB 4TVPD 4ZFFB 3WEXA 3DO7B 4ABWA 3CUPB 3NJJA 4L1SA 4N90D 4Y5XB 5A7EA 2FWOA 3QEQD 4YXLL 2NXZD 2NNFA 2BIMA 3PHAA 4GUPB 1OAQL 3MV01 4RWYL 1T6WA 4MMYB 5EH1A 1DVXA 3WI9A 2M1KA 2JE8A 3WL9A 5I18H 2O72A 1UM5H 2O6CA 4UNVA 5C07D 2HTKC 1UD4A 1HN1A 2GAZB 3OGCB 5EZIL 1UB6A 1I8KA 1XX9C 1YY8B 3NCCB 4KWUA 1B9KA 4ZFOA 1A02N 3JT0A 2WO3B 1NGYA 3IDMA 5DVKA 5EU7C 2EDRA 2W07B 2FX8H 4XB3A 3DUHA 1UGNA 3QZWB 4Q8BA 3AXIA 3CPLA 4ODVL 4N0CD 4BFFA 2ZNXA 5EIIA 1QFHA 3ILPB 1UKSA 4W1TA 2UY7A 4R7XA 1OAXL 5FB8A 1HAUA 2Q1EA 3P2DA 3ARGB 4ELMB 4PRIB 3CXHJ 1YJDL 4LVOC 3CVHH 4GFXA 3UJJH 4MNQE 3QIWD 1ASOA 5K59F 1DQJA 5AVXB 3AUWB 5BOZG 1RJZB 5D7IA 5DVPA 1SHXA 5JIPA 3NFSH 5DFAA 3KYNB 2GHZA 3O2VL 3I9IA 3L3HA 1IE5A 3ARTA 3OAUL 1BW8A 3QEGL 2AEQH 4X8CA 5EUOB 3SBQA 4L4VA 5DUPL 1FO0B 4JO8A 1Z6JT 1ID2A 2H6PB 3Q6GL 2VR5A 3RA7H 2I60L 4R3SB 4LMQE 1VFAA 2E75C 2FBRA 1UD2A 1RUPH 4X0NA 2CGZA 5I75C 1KIQA 2PTTB 2PYED 2XETA 2ZNWA 4L5FH 5KBDA 1ZK9A 3GSWA 3SDDD 2QLVB 4QRUB 5JPNC 5C2BL 3BLKA 4UB0L 3LNDA 5IV2B 1IO4C 1CWVA 1AD0B 3VYNA 3K6FA 4JFHE 4W9GC 3F04A 4YL4A 3SY6A 3J2PA 3H9HA 4UOJA 2WXNA 5EU3A 3NFNA 4F1SA 2ODIA 1AH1A 5PAZA 2WQVA 2HRGA 3PIQB 3SKNA 2X0WA 3I85A 1B0IA 1IAOB 4P49A 1L6PA 5DYFA 2Y36H 4A2LA 1UG9A 3LZLA 1MAKA 4OD3L 4ANWA 4FFVC 5IQ9A 2F08A 1I7ZA 1WH0A 1HILA 2XIDA 2DL9A 2C9RA 4FFZH 2OMUA 1MDAA 1AGCB 1WSST 2UUDK 4MD0B 3OKLB 3QUML 4XVUD 1G6RB 2WKGA 4UU9A 3BGAA 1DBAH 4N8CL 5D4QA 2MWCA 2TAAA 2V2XB 1BIHA 3QR2A 4H26A 1U58A 3HC3L 4C58B 1ZE3H 4IQHA 1Z3GL 4LSQL 5FM5O 3WKML 5H4YA 2VDNL 4J3OF 2A9AA 5AD0B 5BS0E 4WO4B 3HVNA 3F7VB 3PV6A 2AQRA 1E4XI 4I0PA 4KTEL 3BSGA 2Z35B 4JJ5A 4MRBA 3T0AA 4XNBA 4FQXC 2M83A 5B7FA 1TITA 3RWFA 4JY5L 2XG5B 3J7HA 3FFCB 1XGUB 4PW4A 5ICYB 5L9DH 4NQDE 1I7UB 2HUHA 4KDWA 1PX8A 5AOIA 3UBXA 5SWSE 2Q8BL 1QLFB 3AG2B 1KYOK 4A2MA 2X9WA 4LP4A 4OFYA 2V8LA 5DVOA 2EXWD 1XBRA 1ETJA 4GW4B 3LJ3A 4MFHA 4UNIA 5DJAA 3EH2A 5BXFA 2IDSA 1D2OA 3DA0A 4E5XB 3MKKA 2BP5M 4MMXA 4BWUA 1Q0EA 5EDXA 2IVFC 5IZ7A 2Q2EB 1QSEE 4ONHA 4YSUA 3K91A 1C1EL 1DBMH 1S8DB 1BOYA 3DROB 2L4OA 2MEJB 2UX7A 5BO0D 1I31A 3QO1B 4R7VA 3R4DA 2WJ7A 4NKDA 4DZ8B 4WEBL 4S1QL 4W9JC 1PQZB 1MZYA 1BF2A 3E6FA 1ZT7B 4HC1A 1MJJA 3BX7C 5DS1A 2VO5A 2P4AB 3CMOH 5GZNC 1KGCE 1AO7E 4PLJD 4YXKH 3CFCH 2B16A 3I50H 5MEPB 4DHLA 2E8YA 3S4SB 4X8XA 1T4KB 2Z91B 2J5LC 2VL5A 3K74B 2FBJH 3TJHD 1RVFL 4MSWA 2BS71 4L8SB 4G9DA 3BD4A 4X4ME 4TM9A 5CCHE 1IARB 1L4IA 5L8LB 2PCFB 1RZJC 4PJBF 5DZVA 3WUWA 4KKNA 3V6FA 1EK3A 1BP3B 1BVNT 2E56A 2R2EB 4ONOA 4N0CC 1I82A 4WVRA 3PHSA 3QEUB 3P77A 2ED8A 1YNKH 5EA0L 1WRFA 3ALPA 4B9FA 1CL7L 3BZFB 4GMSL 5CGBA 4AVKA 1JGLL 4LVHC 2W8CA 3IFNL 4G2AA 1MW2A 1LE9A 3O8XB 4RMQA 1IMHC 3L3JB 1HXYA 2DLFL 1UH4A 3QIWC 1X6LA 3UTPE 2WC7A 3WEBA 4NUQA 5HYJE 3U7AA 5K1VA 4PB9L 4ETQA 2BVUA 2DQGH 4HIXH 1E3ZA 3VXMD 2J4WH 4IBVA 2N4IA 1KB9K 4HDIB 2FYYA 5E94B 1CGSL 1MVFA 3EJTA 2W91A 2JB6A 2Y4SA 2P5EE 3P73B 1B2WL 2BVQA 1DSWA 5EOCH 1R6VA 3LKSA 5JA8B 3ATAA 5IB4A 4Y4HB 5F1OB 3B8YA 3RX7A 1J5OH 4C55A 2ZUUA 2NX5E 1QO3A 2CMRL 1CFNA 4PJCA 1I1AD 5DTFB 2FATH 1K6QH 4JVWA 2AJYL 2YQGA 3RIFF 4OIFA 1VKXB 3AUVA 1N68A 3L13A 2GCYA 3IRCA 1GJIA 3OKEB 1OLLA 2BP0A 3SO5A 5AENA 2DDQL 3WSQH 2E7HA 3HPLA 4NT6B 1AFVL 4ZZKA 4UTBA 3SCMB 4HUVA 3SDXF 4JAMB 1J11A 4LPTA 4HAFA 3VU1A 3BQUD 2E46A 2QV4A 4PVNA 4QRTA 2FEEI 4JL1A 5HDBE 4BFRA 1MZZA 1KYOJ 1PL3A 3ARDA 4J3TA 1ZJAA 5DC9B 1CBJA 4XVUC 4P2RD 2XIBA 2Z3FA 4OJFL 2N59A 2IDUA 1NFIA 4CVUA 1MWAA 1RK1A 3D87B 4UT9H 1I9IH 2OL3A 2IH1B 3PABA 1JRHH 3S3BB 1NGWA 3GPEA 3UJIL 2DM4A 3RJDA 1NTDA 2VE6B 4MKTA 2IH9A 3MJ9A 3PWUA 4PP1D 2VDQB 3E8VA 5IK3A 1TJIL 5FF6B 1ZGLP 5D2NE 2AV1A 1EEYB 2EDOA 4PVLA 3OKYA 5EOQL 4AQ1B 1ZA6A 4JPQA 3M1OA 2WLNA 3MKGA 3WIAA 4PSRA 2P5EB 1ECZA 3T4AA 3U0WH 2WMPB 3TO2A 3DRQA 4JG0L 1SVCP 4F8LA 1CFSB 1T66D 3AG3B 2NX5B 1LGVA 3D3VA 1WWBX 2EXWC 3ESMA 3OG4B 4J4PA 5E5MB 2RBLA 2D0FA 1QYGL 2VLME 4LCUB 4GG6F 2D7NA 5JR1L 5HHME 4EI5B 4Z7UF 3QI9B 2X4NA 2BERA 4XMKH 4UQ3B 5GSVB 5IVXA 1S3RA 2G2RA 4FX5A 3F6JA 1T3FA 2XN9E 2J88L 3IU4H 2CZNA 3RGBA 5HXMA 1JN6B 2R7EA 3WFCL 1KB5L 2A6DB 3ZX1A 4LHUG 4NIYE 3DETD 4G3YH 3JTBA 5DGQA 5DQ9A 1OTUD 1S9XB 1GR7A 1KPUB 3V9FA 4MAUL 3GI8H 3IFPB 3CBJB 3U1SH 1N59A 4N86A 2VR3A 4PLJC 1ZK5A 3CTTA 5I0YA 1KB9J 4DOHB 5AW0B 3ARFD 1PU0A 2OBGA 3F58L 1WZLA 5I1GL 5I15H 4YLCA 3SD5A 3TJHC 1RSFA 1CVRA 1OP5H 4JKLA 3U82B 1TPXC 3E6HA 3BVTA 5I6PA 3BKJH 1C12A 3NQKA 2DRUA 2AABH 5SWQB 4XP1H 1T2XA 2BFGA 4K8RL 1KDIA 2FD6L 4IBLT 5CJQH 3PP3H 1M6OB 2DQDL 2E9GA 1ZJBA 3WS6A 4CC4C 4DEWA 2AGJL 5IBUB 4DO4A 3TA3D 3ZZQA 1C5BH 2X4RA 2NY7L 4W93A 1SOXA 1NDMB 4PRPD 1CDIA 4PJ9D 4Y4FB 5DR5H 1DJGA 4L0PB 4EZLA 3PHOA 4Q89A 3QG7L 4DGIL 3ZT5A 3TN0D 5D7SH 3DVIA 1EANA 1OAYH 3MJ7B 3AQDA 4NQCE 3TX4A 4X83A 5HY9A 5AOZA 3IMRA 1UFGA 3KPNB 4X4KA 4NKOA 3SKJH 3QCUL 5FFLA 3HR5B 3FU9A 4MMZC 5L6YH 1EJ6A 3ZK0A 2FIKB 4JRFA 4ICXA 5D72H 4YAQB 4C56A 4IIZA 3OMZA 4POUB 1XSIA 2F1BA 1FV1A 1C08B 4NZTH 2H3NB 1OM9A 2W65A 4V11A 2K70A 4HKZB 3WIIL 4Y16A 3AVEA 4H5SA 1SEQH 3EJQA 3VAEA 3TZVD 1FSKB 1OK8A 3LH8A 2B7DT 1DQMH 4X6DE 2E6JA 5FGCE 1TZHB 4WWOA 1FFOB 5AW3B 5LBSL 1B0WA 3PL6A 1KWKA 4XODA 5I75B 4QCIA 1HJCA 1KIRB 1X5IA 3B4NA 4N9GB 5IM7A 4LLAA 5JPNB 4KKCD 2H9GA 3T6XA 2UXGA 5I1IH 1TVBB 1JYWA 4POYA 3BOVA 2UZIL 2H1LM 2G30A 4QRRB 1ZHNB 5D1XD 1KLFB 2BDNL 3V55A 1IKNA 1BLNA 4Y8AA 3QRGL 2WQXA 3NDZE 1F8TL 2ALAA 1AZUA 2YPLB 5FYLD 4K73A 3HNVL 1HH9A 2IAAC 2IFFH 2TSBA 2ZXEB 4Z7VB 3TBSB 2P80A 4TVPE 2FJSA 2F74B 2VDKB 4PP1C 3TBTB 4Z7NE 1FNSH 3RIKA 4S0TD 1CFVH 5E8OB 2DPKA 2AHIA 2CKBA 2YK1H 3QEQE 2AITA 1K72A 2QSTA 3TONA 1NAKL 4Z7OE 5C2UB 3HZMA 4N8UA 5JHAA 3BGMB 4MDJB 3WLWD 1K8IA 2IFGA 1E90A 3GEWB 2WBKA 3FB8A 1I3UA 3DIFA 4O02A 1NINA 3O6KH 2WBWB 5L0QC 4X80H 5CLYA 3U0PB 3LZRA 1UH3A 2AXFA 2EADA 4AEHH 2OMVA 1I9RH 1QUNB 3WCYA 1BVLA 4AQ8A 2H2PD 4ZMWA 1W8EA 5DVMA 3Q8FA 5F3FA 5DK2B 1A7NH 4FQXB 1XR9A 3KLAA 1EUUA 1YN7B 4F5CA 1QEWB 4N68A 3AC0A 3ASWA 4RESB 2CGRH 2JJTA 4OLZL 1N8ZB 2BS8A 3MLTA 4QHLA 1GTFA 2PR9A 1Y07A 3D06A 4Y0GA 4YNYB 4YK4C 4U6TA 4JNXA 4DT2A 1FAIL 1A9EB 3DETC 1UA3A 1ETZA 1M57B 3CE1A 4U7KA 1OTUC 5ANMB 5KSAD 3WJLC 1FO0L 3FT2A 3PRZA 4R4ND 2ZUTA 4AYEC 4LB8A 3L3DB 1RUQL 3C6SB 3BWUF 3V6BR 5CZRA 4LLMA 4LEEA 1JS4A 3AS1A 4V1DD 4PGCB 3T6WA 4PJ8D 2W81C 3Q2NA 2XBDA 4OIIL 4XNYL 5TDOA 3QEQB 3O3UN 5H8DA 5I24A 1FNEA 4P59L 2NXZB 3QUYD 1NGPH 4ODXB 3RZWA 1FVCB 4UM8B 1F3JA 3TF7C 2B14A 2JVUA 4QRSB 1RPQA 3MLVL 5T1DH 3KD4A 4FXKB 5HVHC 1INQB 4DFHA 3NIDF 5I16A 1PBYA 1E6JL 4L05A 1M1SA 3VM7A 2A9MH 5E4EC 3S37L 5C07B 1QNIA 2P7TB 1IKOP 4PJ9C 4UQIM 5GGVY 4YHLL 3MSPA 1N7MH 1CGVA 2GK0B 4JGNA 3TN0C 4HEMA 3VYOA 1T7ZA 4N2BA 1P7BA 3CBRA 1LDSA 3LEXB 5AWNL 1A7BA 2YD2A 4BIKA 1AANA 4LLWA 3GKWL 4D7PA 5FHAL 3GDBA 2Y69B 3HE7A 4I1PA 3IGFA 4ZW3A 3GMNA 3SE3C 1A9VA 1EGJH 3SYPA 5EO1A 1NCWH 4LVHB 3NP3A 4AIZB 3KPPA 2CALA 1FC2D 3QZNA 2BLFA 3IK2A 1JFQH 5IB2B 4HFWB 1IEHA 2OMXB 3QIWB 1LK3H 4U1NB 3TJPA 1K4DA 1QABA 3WDJA 4AQZA 1YYCA 4R90L 2C3VA 4EI6B 1WBYB 4R83A 3FN3A 3EAKA 5F1NA 4M02A 3N42B 3ZL4H 2R1WB 3TZVC 1M71A 1D7FA 1UJ3A 4LHUA 5BVJB 2OR9H 1HKLH 3GMLA 2EYTA 1A6TA 3V95A 1ZT4B 3JVGC 4YSAA 1G9MH 3MXWH 1QATA 1RERA 3A4DA 5AZEL 2OS7A 2YMOA 4FAAB 3QIBD 4U1JA 2AQTA 1WD9A 2PYEB 1CZ8L 1JZGA 2XG4B 3B9KB 3HE6D 4KY1L 3HMXL 1WTGT 3SDDB 5I1JH 3VJ6A 1GY1A 3MRLB 4KKCC 5TE4H 5BCAA 3DGGA 2R0LH 4ZMPA 1XL4A 3VH8A 2AJVL 5GSRA 3KWWA 2OQJB 4TULH 5JW5B 3A4FA 3V4VB 4LCVA 3MBWA 2ZD0A 1AQKL 5DJYA 5ALBL 1OD7A 2IPTH 2NY4D 3BH9A 1ADQL 2YQ3A 1HCFX 3C5ZD 3GXFA 4LLVA 4MS6A 4B9KC 5BMFH 4P5MB 2F7OA 3UZEC 1RUMH 1OAZL 3MV7E 5EUKA 5IROD 3B34A 5F89A 5KVDH 4N5ED 1XZ0A 2DD8L 4JGMA 4NKMB 2HG0A 1OAUL 1CI5A 5ICZB 2OLDA 4JFDE 1MLCB 3HRZB 4XNMA 4B3VA 4I13B 2IPKB 4CAGA 1OGPA 4PJBB 4DWHA 5FM8A 1JVOA 4FJ6A 1L0YA 4QY8B 1WS8A 5JW3L 3CDYA 4JLRA 5E56A 4UQ2A 1YQVL 5ERWA 4YDKH 4OV5B 1OL0A 1IL1B 5FO7B 3HZYB 1ZHKA 1JV5B 3U9PH 4CUCA 4P9HL 3C09C 3QUMA 1S5IH 2LQRA 5C0AD 2E4TA 5AWNH 3VI3F 2H2PC 3WTWA 3MV8B 1U41A 3GSNH 4U1KA 15C8L 3Q1SL 4DCQA 2FSEA 2E9JA 5IOPA 4M6MH 3AT8A 3AW5A 3CK0L 1B3JA 4LAQL 3UDWA 3RI5F 2KYIA 2IPUG 3HG3A 2IOOA 2LHAA 1QZNA 4WGVB 2VR4A 4ALAH 6FABH 4ABVA 3KWTA 5I8CB 4A2GA 4BK5A 2ESVA 2X0VA 3OL2A 2XA3A 3PXJA 1K8DB 3S34L 4PG2C 4AGPA 1WHOA 3VXME 5C09D 4PGBB 4C57C 1BIIB 3HG2A 4QAWA 1GZPA 4R4NC 1BAGA 4YLBA 2IADA 4FA8A 1K85A 5DMIL 2BH0A 3DX6B 4MCZA 3N91A 1U8KA 4N0UE 1NJ9A 5E2UL 2GUYA 4JL2A 4FP8H 4J3WA 2VN6A 1B9ZA 1DN0B 4PJ8C 3IGUA 2DTMH 1MKFA 1R3KB 3HC4L 1QSFA 4QOKA 4YPGB 5I8EA 3FRUA 3QUYC 4MNGA 3SN6N 2XY2A 2VQ4A 2AQQA 4OIAA 3WHXA 1MAMH 2E76C 5LXGL 4MXVF 3BAKA 1D5ZB 1KENH 3UTQA 2R1XA 3EZ8A 4XB8A 5TE6L 3E7JA 2W0PA 4X42A 2QHRH 5CLWA 5JHLH 1ZE3C 4UZSA 1TPXB 3CSGA 1HZHL 4HWZA 3O6LH 1ES0B 3BFWA 5FCUH 2HKHL 3UAJD 3QARA 2B3IA 4OW6A 5LUMA 3TU6A 3KXFA 1N0XL 1SGKA 4FERA 4P2RE 2WYIA 4FTDA 4MDRA 5I6KA 3FB7A 4NO3A 2DMBA 1DLFL 2V0AA 1OZTG 2WQAA 5JORA 2O61B 1BZQK 3MCKA 1C8PA 2R1YB 2VDQL 4RBPH 4OZFG 5DJZB 3Q3GB 1Q0YH 1TCRB 2K4AA 3BDXA 3QFJA 4J8QA 3RUGE 5CM1A 1DTUA 4FG4A 2CM6A 43C9B 3EF4A 5IF0B 1M1XB 4HEPG 4X6CE 3BP6B 4X5XB 5E9DE 1TQUA 1J0HA 2K6ZA 2YWZA 3VXMB 2GJ6A 3US9A 2C9XA 3JTSB 4QIRA 4A7SA 3OKMB 2C1PA 5DJ6B 4MJIA 4OLUL 3BYYA 4GG6B 5CEZD 3VFWA 2CO7B 5CJOH 4HUCA 3SDYL 2GBVA 2ICWB 2IGLA 3Q5OA 4I88A 3QWQB 4TSCL 3RG1C 2MOGA 3HE6C 2ZUYA 4BCXA 5F0PB 4M7LH 1I1AB 3VFGL 2BNQD 1YLBB 5DD3H 3NAAH 4ZSOA 3DXAA 4TSAH 1P7QD 2X4PA 3B2PA 4R26L 1R19A 4GKSB 2BY1A 1G7HA 5C08A 3S3JA 4PS8A 2Y06H 3FOMB 1HEJC 4D9QE 3KJ6H 3LPOA 3GJFA 2NY4C 1W91A 3BQUB 3C5ZC 3EDEA 4ZDHA 2C34A 4OJEH 1R17A 5T3XH 3K6SB 2FT6A 4ZD3H 4XX5A 3U9WA 1N8OE 3A67H 4N5EC 1NEZB 5GGTL 1P5UB 2CSPA 4FQLL 3BIKA 5EZJB 3PQYA 1BOGA 4W4NA 1T2QL 3U9UB 3BCFA 2H0EA 4N6RA 5JW4Q 1F4XH 1S9VB 5BV7B 3H85A 5GS2D 5IJBC 2AK1L 2QQNH 3HPJA 2Y25A 3DOIA 4GXFA 1JGUL 4W68A 4NNPH 5H94A 2NCMA 2HKFL 1JNNL 1OP3H 4EIUA 4IEFB 3HS0B 5H2BB 1DVUA 1I85A 4LLUB 4IIQA 5LLIC 5CILL 1CO1A 5G4NA 3NIFF 4M62H 2ETWA 1UWGH 4J3OH 4OF7A 4M1CD 3ARPA 3NGBB 5B3JF 1PAMA 1I1YA 1VFUA 4GAYB 1COBA 3SB3A 4F2MA 1MCIA 3PWVB 4QJ4B 3L8QA 1KGXA 3IN0A 3OC5A 5MP6L 1XCQA 4FYRA 4NGHL 3X12A 4XCFH 4PRPE 1T21A 4LLQB 5L0QB 3A6OA 1TIUA 5DJDA 1QPKA 4M8RA 2EIMB 2A5UA 1RHHB 3PF2A 4YLQT 3GUTA 2I85A 2YAMA 3LRSA 1ZVNA 4DJMA 2A73B 3MRJB 4LFHD 3QPXH 2ICEA 3MRKB 1QRNE 4G9FA 1GC1H 3AJ7A 1JYVA 4LBEB 4NO2B 2QGCA 1C7TA 5LGHL 1J1XL 2CWRA 2AJZA 2IV9A 2WKOA 2ZSVB 4JZJA 2EYRA 5ICUA 1TG8A 3ECQA 4L9LA 3UP1A 3UO1L 3HFFA 4BZ2L 1UQSB 2QSQA 1T0OA 2AMGA 2V5RA 3FH7A 2W9EH 4YK4B 2PYFB 4K3DH 3B1UA 5CF3A 5I0DA 5E8NB 4QI3A 4WO0A 4Q0XL 4KUZL 1F1AA 5ILTL 3U46B 1UXSA 3CSYA 4M7ZC 1W80A 3NH7H 5EBWB 1QG3A 4BM7A 1O6SA 2YEZA 1RZQA 3ARFB 4Z7WF 3QWNA 1A22B 2AQPA 4XPHL 3PAYA 5ADPL 1JE6A 3ARUA 1KB5A 3B2UC 1ITBB 3ME0B 5KVGH 2DZEA 2OMWB 4JFUA 4ZJ9A 4P2QB 3JV6A 3ECUA 4KQ3L 4R0LC 5FIEA 3SGKA 3UAJC 5DJXB 1ANUA 3HUJF 3KVQA 3I02A 5T5NF 2QPUA 3B5GA 4DH2A 3EXJA 4Q9CA 5HVHB 5IQMA 4PJXF 3TA3B 3FT3B 1U8MB 4TLKA 1AXSB 2I07B 5D7EA 5FYLE 2VDKL 4PJ9B 5B7MA 3HZVB 4QHKI 1YEIH 3FBKA 6PAZA 4B97A 3TN0B 1MPAL 3QHFL 5JOPE 2UZYB 1QHPA 4P2OB 2N0MA 4HJIA 4RAHA 3L9RA 4NNXA 5EN2A 3EYUL 4EBQL 5KBKA 4U1GC 4LKXB 4IU2A 3TO4D 4A67A 2LVEA 3I3BA 3SDAA 4PP2A 4MAYD 3VRJB 4PGEA 3HG5A 1PEZA 1UD5A 3RWJB 5J12C 1VFOA 3P3SA 1C7SA 2JXMB 3FU7A 1CFMA 1OY3B 4DVRL 3AM8A 2VAAA 2PLTA 4PFEA 3RY6A 2EACA 1XGQB 3V0HA 3HI1B 5I74C 4U05A 4EIGB 3IFOA 3FS9A 1D5MA 2J25A 3MLRH 1CDHA 2HN7B 3IDNB 1CLZH 1NCAH 4HXBH 4K3EL 5AW2B 3FN0L 5FGSA 4Q14A 1AC0A 2PMZA 4Q9RL 2A74C 1CYWA 3WKPA 4PLNC 4FFWC 5KG9A 2F18A 3IE4A 3KVPA 4K07A 3UTSE 5FUCC 4OJYA 2X1WL 1IU1A 1E4WH 4NFDA 2KS0A 1VEOA 3PS6A 4L0ZA 2Z93A 2EO9A 1BAFL 1UJTA 4PJGF 1L7TH 3VE0A 1WPCA 1BQHB 3FRUB 5D5MB 4KH9A 5AOJA 1A8JH 2Y22A 5C92A 5FEBA 4L5FE 5D1XB 5EU6D 3ZLQC 4EXKA 5LGJA 1FBIH 5DJCA 4U1IA 4ZW5A 4U3SA 5D71H 5IHHA 2R8SH 3TIDA 1GZHA 4AIEA 4NFBA 4NPYA 4PCSA 4TVPL 5LBSA 3BRGC 4HWBL 4YXHH 2V2TB 2R0ZH 1U30A 4PY8J 1ADWA 4A63A 4KTDL 2DIEA 4NQVB 2NSXA 4NN7C 3PWPB 4XN9A 1RU9L 3SEPA 4V1DE 5I66B 1ONQB 3G6DH 3PWNB 4JDZA 1ZCRA 3FQRA 4PJAF 1G7QB 4CU7A 3GXMA 3GMOB 4WNQB 4M1CC 5LAXB 2Y3AA 4GAJL 4LASH 1EBAA 4KJWD 3KR3L 1N2RB 3MRHA 4ATWA 4HEPA 3CFJB 3ZDYF 3MRNB 5LBVA 2Y2TA 4URTB 4HS3B 2ZWLT 2D7TL 2OCFD 4Y1AA 3TWCL 4HHGA 4JFXB 2QGEA 1M7DA 2ATAA 4OI9A 1WFOA 3NRQA 5JUEL 2EDMA 4QYAA 2FZ3A 4ZRGA 1IEAB 3FMGH 4A68A 4MMYA 5KSBE 3VXRB 4I89A 3REWB 2V5SA 4GKLA 1GAFH 2DQFA 2YRPA 1JPSL 3CHXA 3O4OC 5C0CD 1OGAD 3Q43A 1YY8A 4GEJA 4MZ2A 1W6WA 5TF0A 1L9QA 4BZ1L 2ZP0T 2W07A 3OPZL 5EWIH 4XCYA 5KN5B 5I6MA 4JFZH 5CO1A 1IC7H 5BQ7A 5DT1L 5LDUA 5IGXH 1U6AL 1EFXA 4BSWB 2JJSA 4ELMA 5KSAB 2EINB 5HYSB 3MUGB 2I7OA 5C7XH 1MIMH 2PWEA 2VNCA 1KCSH 1BM3L 2EDEA 3CVIH 2MCAA 2V33A 5D7JA 4JRYE 4W9EC 1WCBA 2HFEA 4JX0A 3ZTEA 4LSVH 2DQHL 1SF5A 4KNSA 2XQ0A 4V1DB 2EIEA 3BXNB 4HPOL 4PJ8B 4G43B 2H1XA 3O41B 3NCJH 4I48B 4P23D 4XVSL 1FO0A 1RLWA 3IDUA 4KKQA 3V4VL 2Y1AA 3WMPA 1KUMA 1XCTA 1NOFA 5JIQA 1BCIA 4IS6A 4FN0A 2YFNA 2VR7A 2CIIB 3QDJE 3R06B 1X5AA 3KDMB 4GQ9L 3LZNA 4B27A 1BVNP 4F33B 1WLHA 2JKWA 3QB7C 5FYKH 4JG5A 5E1GA 1AQMA 3DJ9A 1AD0A 5F6HI 4FFYL 3GLEA 5KBNC 3MODL 4J2XA 3RPKA 1BYPA 4PV9B 1TZGL 3G6JE 3IFLL 3WTYA 2EIBA 2RALA 2NTFB 5KVEL 2HPOA 3DO4A 3BUIA 3N40P 3O2DL 2NNXA 4R2GD 4TXVB 3TO4C 5J13C 1TTFA 3BJLA 2VC2B 4AV4A 4P5KA 4FGMA 4MAYC 4YSDA 2VZ1A 4F8TA 4PV1C 4X8GA 2HH0L 5GJTL 3UOAB 2OX5B 3OKLA 2CHZA 3EOBA 2LU7A 3LH2L 5F9WC 5CHNB 2AS5M 3QCTL 2XVBA 4NYLB 3VXTB 2KUTA 3HW7A 4RA3A 4D9RD 4KI5D 4XPGH 2W80C 5C0AE 5FGBA 4WWPA 4JO3H 4P5RA 1XO8A 2Q0ZX 1NC4D 4FI7A 1K3IA 4JS7A 4BSJA 3MLXL 3MA7B 2JV6A 5B7EA 3VO0A 4ZMNA 4MNQA 2WUCH 4D8PB 4L1LA 3WFDL 1SZNA 2J2ZB 3F7VA 5GJSL 1MCNA 2XTSA 4FCHA 3LSOB 5IBTH 3T6QC 4AXWA 2XCMC 3GYRA 4HS6B 5KVFL 1WF5A 3QIBB 2GBTA 2BSED 2F19L 2H45A 2OSLA 5KJ4A 2I9LB 2EEBA 2QKIA 5F88B 3BWZA 1P69B 4AIXA 4PR5A 2YBRB 4FL4C 5CR8A 5C09E 2XWRA 1SY6H 5ICYA 1O9WA 2CO6B 1I7UA 5F7EH 2WBXA 3NZ8A 5EOTA 2V17L 1QLFA 2AEOA 3BGFB 4PTTB 4S1SL 4TQ8A 5E2TH 3TXAA 2NY4B 3KEHA 5DRNB 4R7NB 1JGVH 3C5ZB 2IIJA 4WGWB 1OO2A 4GW4A 1MFDL 3RL1B 1DBKL 4QKTA 5TQ0H 3V0WL 3HMXA 4ZW7A 1AKJD 2V37A 3MJ8A 1P4LB 4W9CC 1YHPA 4YX2L 5ABDE 1MELA 3MOQA 4YSOA 4QXUH 4KVNH 5KOVC 3MRFA 2DL2A 4PAZA 2AJXH 5AW1B 5INDA 3LS4H 5AKSA 3FU3A 1VB9A 3RRQA 4BXVA 3QUHA 4KJWC 2C9VA 5ADOL 3FUHA 4ERSH 1ADQA 2OZNA 3QO1A 3PJNA 3DX7A 2NY6D 3HKZA 1HXMB 4ODBD 1AD9B 4YS4A 1QASA 3L4UA 3S5LG 1R3HA 4M29A 3F12A 4YHNA 1BX2B 5IHZB 2A4CA 4LZKA 5F1IB 3DUUB 5C0AB 3W2DH 2IQAB 1A5FL 1T4KA 2OXGB 1L9PA 1JTPA 5EZLA 3E3QC 2J71A 2N7SA 3DV6B 4JRXE 4PJFE 2HJKB 5BS0A 3QG6B 1TZ8A 2JI2A 1T0MB 2XZCL 4ZAKD 1TETL 5H37A 5A1AA 1PDKB 3HHSA 3CV5A 2R2EA 2XZAH 3L2LA 2BSSB 2QELA 2X4OA 2DW5A 4HU2A 1NANH 1KF9B 2QMKA 3BZFA 2XOTA 4KMLB 5MEQA 4CU8A 5LN4A 4NQDA 5CBEA 3L3JA 1JHLH 5SWSA 1Z3RA 4DKDC 4JCWA 4CBZA 3Q06A 3LHAA 1JZ4A 1MVUB 1YEKL 2UXTA 5CEZE 2EAEA 1I3VA 5JIHA 2IDTA 2VUKA 4NZ8A 1YEJH 2WINB 2VLLB 3FQYA 1XCWA 2LE9A 3TYGL 4ACTA 3GSQB 1MN4A 1QLRB 4L4TB 5KSVA 2ZCHH 3TPUB 1CU4L 5B8CB 4XBGB 4P23C 2BNQE 3IT8D 1A3LH 5LWYL 2WZPD 3LD8B 3HB3D 1QSEA 3MUHL 4JJOA 1SQMA 4LSPL 5HGDB 4FQ2H 3DBXB 2XDHA 1TYEB 2BHZA 3WIHL 2ZG2A 4FMFA 2PO6A 5FUCE 3AU1B 4S2SB 5I1HL 1VKXA 1S7UB 4MBRA 4RDBA 2OJZL 5E4IA 3S35H 1AO7A 1UVQB 3DSFH 3OKEA 4GY4A 1A7QH 1YN6A 4OLWH 4R0LB 3C2SA 4ILDA 4ZFZA 1WFNA 3IDGA 4XC3H 4ZO7A 5JOFB 1DQQB 4N1EA 2EH7H 1E4XH 2VDPB 5KVMC 2K9UA 4X4MA 5CEYB 3ZVVA 1NFDE 3IJ8A 1HL4A 3EBHA 4UNTA 1FDLH 3CZJA 3NBNA 4PJ7F 3T77B 4GUCA 4JKPH 5AVWB 3ZDWA 1RD6A 4BFIA 1BZ8A 1SLXA 3EBAA 3VQ1C 2NY1B 4FQJH 4KI5C 4RBPK 2Q8AL 2IH1A 1JK8B 3QQ9C 4U1GB 2HJFA 2VAJA 3O11B 3FB6B 3FFDA 3QH3A 5KTEL 5IVNA 2VE6A 1QW8A 5IQNA 1C8QA 2JMRA 1T1XB 5HYJA 3H42L 4HKBB 3BPNB 3BCDA 4RFNC 5FF6A 1IM9D 4AM0B 4W6XB 3HRPA 4XPTL 5I74B 1AQ8A 3EG9A 3CFKB 1U3JA 4KKLD 1S7QA 1AHMA 2ICCA 5DS8B 2WVVA 4P57B 2BNQB 1FNHA 4JKWA 1VACB 3UBFA 4ZZFA 2P5EA 4HOZA 4WI5A 3QNYB 1P7QB 1DDTA 3SGJA 1EAPA 3U36B 4O4YL 1OOWA 1CFSA 4AYDC 3ZE2F 3V4UH 2NX5A 3B2MA 2P5WD 1AXTH 2J1WA 4WI6A 5GRYA 2YXFA 2OSXA 3A5VA 3ARRA 2MNJB 4JB9H 3DARA 4Z7WB 2GUOA 2AFNA 2Z92B 2EE6A 5BZWA 3NJMA 5F6IC 3SGDI 5HYQA 3MRPA 3ZZSA 4WJ5B 5LXVA 1E3FA 3GBNH 4UM9A 1ZLUH 1QX1A 3G6AB 4GRMB 1JN6A 4WW1A 4Z7QE 3L3IA 4B9PA 5I1CH 5JXEC 4PJXB 1UH2A 4HQQL 1OGTB 3IDXH 2NY6C 4NN7B 4YOKA 4TF4A 1LWHA 2YIHA 3RE0A 1KPUA 3WKNA 5GGTA 1BZ7B 3T6ZA 3P0VL 1M4KA 2BIOA 4O58L 4TRPH 5DUBA 5TDNA 1ZANH 2C4XA 2OP4H 1IT9H 3P3UA 1OP3K 4M8VA 1U4FA 3LMJH 4IRJA 1O7VA 5HBBA 4K7PL 5D1QB 1W15A 1CE6B 2A3TA 2YAEA 5K5YA 1QHQA 4D7BA 1UENA 4HBQA 2YXMA 3WMSA 4YBLC 4EZJA 4AVHA 2IALA 4LCWD 4ZAKC 5SWQA 4KJYB 4QKXB 4GSQA 1DBJH 1M6OA 2ZWYA 4LSRL 5AVRB 4H1LG 2P42B 3B6SA 2RMNA 4HUWB 2JF1A 3B7TA 3G5VB 2WB7A 2NNRA 3V0EA 4E68A 3VGGA 3QSKB 5F7DA 4FNQA 5IB1B 1VHPA 2KQMA 3F84A 3WXVL 1HINL 1PLGH 1BBJA 3BE1H 3ISRA 3Q9PA 4DGVH 3JT2A 5CZVL 4YDVA 3UO8B 2A38A 3KPNA 1T20B 1JERA 2D31B 1VADA 5MERA 3QRLA 4WW2F 1EO7A 1GGUA 3OR7B 4M48L 4RGMB 3MBXH 2V4LA 1JP5A 4G72B 5BW7A 2FIKA 3UL4A 1XD0A 1FWXA 3HB3C 5TK2A 4YAQA 3GS4A 3QT2A 1MHCB 2YR3A 3DHPA 2XN9A 1BECA 3QE5A 1Q72H 3TGXA 4Z7QB 1C08A 5DRZB 1PNCA 3ARZA 5IJKC 1G4RA 1Z9MA 2PP7A 4B95C 1YPZF 3NTCH 1UOWA 1JZFA 4D8OA 4LCYB 4K7FA 3UBXI 3MLYL 4IRSD 1WD8A 2H3KA 1YNTA 3DVGA 5K33A 3H7BA 3X14B 1FFPB 2WQWA 3DMMC 3NFPB 2HFGH 1Q1PA 2W1NA 3VFPA 1S9WB 4BSVA 2YLHA 2ADIB 5FYLL 3S5LA 5KUMA 4QRFA 3FUFA 3HAEG 4IBWA 1KIRA 1P6FA 4IKLA 4UZGA 5KJ7E 3VWJD 2V9UA 4UINH 4L8CB 4OUUA 5BRZD 4AJVA 4F7EB 3OJDB 4ZUUB 2ZCKH 5JLZB 2VDMH 9CGTA 1H8OA 1ZHNA 5IG7A 3CH8A 4WK4B 1IGIH 1GGCL 4Z0BH 2FX8L 3S96B 3HNSL 1XDTT 1B0RA 3U0TA 1YA5A 4ZX5A 1AS8A 4W9IC 3SSGA 5J13B 1H6FA 3OKOB 4MAYB 1NAMB 1L7IL 3GSVB 2F74A 4QHNB 4NQCA 4CGTA 5CWSA 3CVHL 4HT1L 1ERNA 2WWMD 3UJJL 3VXNB 1F86A 1GC1C 2F1AA 1V05A 1SXSA 5F9WB 1D3CA 3FBQA 4FMKA 4PJDE 4N2KA 4QRAA 1KLGB 1X9QA 2WXIA 4MDJA 3NFSL 1RZ7H 4ECNA 5GS3A 3OKKB 3QDMD 2QPDB 4NBXB 2P47B 3UPRB 5C0CE 3D18A 3OB8A 1OGAE 2AEQL 1AGBA 4LOFA 4WCYL 3SGEH 1WAAF 4NQEE 4HJJL 4ONGH 5DI8B 1OIOA 4LNRA 5C9JB 3RA7L 3MFGB 5DWUL 5MENE 1RUPL 1CGUA 1ILSA 3GJEA 4FNTA 4NXKA 4L5FL 5E6ZA 4FQXA 3RIFK 2D8KA 4ETYA 4X6DA 5I71C 2PF6A 2EUWA 1FNGB 2WXOA 4L8DB 4ANXA 1YN7A 4FL4B 4HXAL 1KBVA 4WFHD 4WU7A 1Z5HA 5EU6B 3U7YL 4QWWD 1DUZB 4IRZA 1HOCB 2OM5A 2YQ2A 4EIBA 1UZ6F 1N8ZA 3I84A 4YIQB 1DZBA 4YUEH 3EYFB 5DQDL 4AKQA 4YHOL 2C9AA 2Y36L 4FDWA 2NUPB 2O5YH 1EHXA 3Q0HA 2X4UB 4N2FA 3BZ4A 2R69H 1WGOA 4FFZL 1CT8A 3GSXA 4PS3A 5CLZA 2MCMA 4X7TA 2Z4QB 4YGAB 3RYMA 4XT1C 5KVDE 2IWEA 1MCSA 2D9CA 1LYQA 4CMMB 5C71A 1LP9E 1P6WA 5F96H 1ACYL 4YDJB 5J1AB 4PGCA 5KYXB 1AMYA 3K1DA 5C0IA 2CRIA 1KCWA 3QEQA 5LDSA 5A2KH 5D55A 5DLLA 1JXGA 1WEJH 4IOFD 5EU5B 2AQSA 2QSVA 2XKNB 3BISA 1WWCA 4HIJA 5GZNA 1VIWA 2H0FA 2Q3ZA 1T1ZB 3N04A 4I3SH 4X9FA 5EPMA 3WN5B 3ZZLA 5C0FA 5I5RA 2ADJB 5DJ8B 2VC2L 4OLEA 5AL8A 2I24N 5C0CB 1YMMB 4LT7A 5EIVA 4U1SB 3IJHB 4KHXH 4XCCH 2H26B 1H6TA 1UD6A 4QT5B 3L08A 4Y4KD 2FYVA 2DWEA 2VERN 1H3GA 4D9LH 5L9DL 1MCPH 5FWQA 1F58L 5F7YC 4A1RA 1G94A 1NMAL 4MBOA 4TTDD 4OZIE 2G4EA 3F3HA 2X88A 3SE8H 3SO3C 4D9RE 1J48A 3VGAC 5KW9H 3B2VL 3U2SB 2ZCLL 3RPIB 1KJ2H 2P9RA 3M17B 4XCEB 3D0AA 1QFWH 4TNWK 4AIZA 4YSQA 1P7HL 1NC2A 4I5BB 3L1OH 5IB2A 3FQWB 4BZ1A 5T8IA 3QCVH 3T08A 2O4EA 2RR3A 3I74A 4K71C 5FUOH 3W9EB 2YD7A 3H54A 1WBYA 4BWTA 2V9TA 4IRSC 5LCVL 3FUEA 2R1WA 2BJML 2BC4B 1DSFH 1JPST 2R39A 1JZEA 2NMSA 5GQBA 1QAWA 3CWGA 4P23B 2OW7A 2AEPH 1WA2X 5L4IA 2A6JB 3FTZA 3G5XA 2JTYA 3T0EE 4OZGF 4M9OA 4S10A 4GQPH 4JREC 4N24A 3SPHA 2F5BH 2XG4A 3KAAA 5EHFA 3VWJC 1CD9B 3KYMA 3BVDB 3NJNA 3ZE1E 3X1FA 1OKEA 4P48A 1A14H 3C9NB 3MLUL 5IT2L 5AW7B 1EJOL 3K2MC 4MHHG 1OWRM 1C5DB 3D30A 5GRXG 3TT1H 4DERA 4R2GB 3SDCD 2B3RA 2AK4E 1MCQA 2VDRH 3B8SA 1PD6A 3K72B 4JKMA 5ESQB 4F2EA 5FC9A 4A6YH 4YEFA 1RK0A 3KPRD 3L2NA 2WBJD 2WWMC 3IEAA 1EERB 1NUDA 3G3LA 5PCYA 2L7QA 2AJ3B 3FSOA 1KGJA 3H3PH 4PHZA 3IYLW 2NY0D 3CQPA 3C8HA 4MZIA 5DHYA 3P11H 2Z31B 3TM6A 3O2DA 1NC4B 3FRPA 1Q94A 2VH5L 1ROCA 3V0IA 5FO7A 1ODUA 3BZDA 4M93C 4OZHF 4EDXB 3JYBA 1JBJA 1WUZA 3V52H 5HHPB 2VSMB 4LP8A 2CDFA 4OF6A 3FTGA 2DWSA 4QXVA 2EDKA 1OP9A 2IG2L 2XV2A 4JHVA 3PGDB 4WDIB 4ZW8A 4AGNA 1TNMA 4TOYH 1AJ7H 3SPCA 5CUSH 2WQUA 4U2ZA 2FATL 4XO5A 3ROLB 2D2OA 3IGAB 3OLGA 1NA8A 3QP3A 1MRFH 5EEYA 3IGKA 4QWWC 2BSBA 2B5IB 3TBWB 1Z0MA 4PB0H 1E28B 1ZVSB 2I5YH 4HJ0D 2PW1A 5I8CA 5TPWH 2BHYA 5I6OA 1AR2A 4N22A 3WFBL 1M9SA 1QP1A 3VRIA 1H15B 3VA2C 2LT9A 3HAEA 3ZE1B 5I0XA 4L29A 2AMUA 1I8MA 1AKJB 1KEML 1WDAA 4YHYC 3SPVB 2N01B 2C9PA 5F6IB 3DX6A 3L5WA 3ZGHA 3L48A 4GUQA 4EVNB 4OCNC 4RRPM 3MV7A 3M45A 3GXUB 5ECJE 4UT9L 4CGUB 1GYWA 1UFUA 2FB4H 2ADGA 3NK3A 4MXWH 3BSZA 3C2AH 4DW2H 2RB8A 4JFDA 5KS9E 2ICWJ 1PZUB 2LFEA 1X7QB 2F58L 1CLYL 4IOFC 4JVUA 4ICWA 2RFXB 4EDWH 3QQ4B 5C0EB 2VDPL 2H7WA 4RGNE 4FQCH 1E4JA 4KDTC 3ML9A 1L9OA 2X1QA 3KPMB 2OXHA 1U0QA 3B83A 4ODUB 4Y9FA 4YBLB 4CDGC 1SBBA 4G80A 3VXSB 4A7VA 4TSBL 3DHMA 4Y4KC 4ZAKB 1KLUA 4OB5H 2VQTA 3ZN6A 2B0SH 3U30C 2NQDA 4TTDC 1KIPA 2F1EA 4YHPA 2YA0A 3AWEA 4NENA 3H0TB 4CC4A 5I1EL 3KLDA 3K46A 2O61A 4I0PD 3RL2B 1H3TA 4GINA 1RP9A 2DM7A 3BWSA 5DJZA 4X5WA 2Q6WB 5CEZL 4AG4H 3PJSA 5GISH 2J6EA 2PWFA 3S36H 3W39B 2XQYA 1XSKA 2CBTA 1OT2A 2ENJA 3F01A 4P4RB 1NBVH 1UT1A 2W94A 3SQBB 4UUJB 3IU4L 3VXMA 4XC1H 2F8VA 2OTWA 3ARBB 1NMBH 3KS0H 4FXGB 2CJUL 2GT9B 4MMZA 4KXZI 1QSZA 5KYUB 1U8OB 4XNDA 2GFBA 4JO1L 1INEH 1WO2A 5E70A 3L9YA 5L7XH 1CXHA 4N0UA 2JCCB 2DEYX 2AJSH 4NN6B 2LAAA 3D48R 2OR7A 4XXWC 1G0XA 3EZJB 4YHKH 2P5WE 3J27A 3VFVA 5E51A 5M94B 1PLCA 1ITCA 1FPTH 4UOW1 4WFFD 3GI9H 2KHAA 4K5MA 5CMAB 5HI5D 4MZRA 3BKJL 2BXYA 5EEWA 1W0VA 1FF5A 4GKSA 3AMLA 5H4ZA 5IB5A 4GSDH 5KVGE 1T6BX 3NK4A 5AKRA 4JY4B 3ZGIA 3WIHA 3SDCC 5L88L 3RDTD 3K6SA 1C5BL 2P8PB 3KLKA 5DSCB 3FFOA 1PZ5B 1KV7A 1J0YA 2WBJC 3WMQA 4LSUH 1KBPA 4NM4H 4P2RA 1R46A 3U9UA 3JWNG 1T7VA 4OAWB 5LBGA 2NY0C 1FH5H 4QLWA 2Q7YB 4PCKA 3NT0A 4OKVB 4E41B 2E5EA 4JHWL 1EXUB 1M3JA 3RWIB 4MA1B 4N9OB 4MB1A 1KELH 4WFEE 4X6FA 3RUGA 3DX8B 4R4BB 4LLUA 1J87A 1R3JA 2R27A 4JY6B 4X6CA 5E9DA 1MRCL 2NQCA 4LCWE 2V7HA 4XMLL 4I8DA 2XNAA 2ICES 2Q10A 1NGXA 5I0ZA 3N06B 3VTAA 4UDTB 4GAYA 1SFDA 1T1WA 5IUSA