2HX8A

Crystal structure of cu(i) azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "csphqgagm", at ph5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCSPHQGAGMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Copper Sites in Proteins: Loops Confer Native Structures and Properties to Chimeric Cupredoxins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hx8A00
1NIEA 4JKNA 3U25A 1W8EA 2J5WA 4NERA 2QPDB 3ABMB 3FT0A 4P5RA 5I6OA 4PAZA 2XXFA 4N4YB 1QNIA 4E9QA 1NPNA 1NINA 2GC7C 1JERA 3BQVA 3QQXA 2JXMA 1PCSA 4HIPA 1NPJA 2XU9A 3TASA 1JXFA 7PCYA 4YSSA 2OCCB 2MTAA 3OMIB 4YVUA 2YAQA 1ET5A 1GY2A 4YSDA 3UADA 2CAKA 3EHBB 3WNJA 4KOBA 3GYRA 1ET7A 3JTBA 2UX6A 3PPSA 3T6ZA 1GW0A 3NSDA 4DP4X 3AW5A 1JZFA 1L9OA 2BZ7A 3IEAA 2YXWA 4BXSV 1BQKA 4A66A 3X1FA 1ASOA 3AZUA 1J9TA 2VN3A 2YXVA 2CJ3A 2UX7A 3OQRA 3T6XA 2GI0A 2XUWA 3ZX1A 5F7AA 4DPBX 1L9PA 2P80D 1SDDB 2FT8A 4A2FA 1E67A 4KOCA 3JT2A 3NJNA 4GP5B 5IY5B 3IE9A 5D4HA 3SBQA 4BWUA 1AANA 4DP6X 2AZUA 3EH3B 3KW7A 4DP9X 1BQRA 3FU9A 1PLBA 1M56B 1MDAA 3TU6A 2JKWA 1PF3A 2BP8A 5PCYA 4ZK8A 4E9XA 3IN0A 2GHZA 2PPFA 4QKTA 1F56A 3SBRA 2IAAC 3V9CA 2Q5BA 1KDIA 3CVBA 3DKHA 7PAZA 4W1TA 1NDTA 2EIMB 2UXVA 2B08A 3T9WA 4FA7B 1OE2A 2IDQA 4WKXA 4BWWA 1L9RA 2I85A 2XVBA 3AY2A 3S8FB 2FQEA 4KO9A 3NT0A 2YARA 4Q89A 1JZJA 1XB8A 1AS8A 4HALA 4HCIA 2YAFA 2IDFA 4G70B 4UAHA 4GXFA 4AKQA 1NTDA 2GIMA 1L9SA 2R7EB 1KBWA 1MG2C 3FQYA 1SF5A 1A4BA 1J5DA 2OJ1A 1KYAA 3T6VA 2N0MA 2XV2A 2X88A 4BDVA 3PCYA 3FPYA 1I53A 3SQRA 1AQ8A 3DTUB 3BVDB 3OM3B 1AAJA 1IBZA 1OF0A 3TBCA 1A3ZA 4DP5X 2IDSA 2XXGA 2VMJA 5B1BB 3FSZA 1URIA 3ERXA 4A2HA 1SHWA 3QJUB 3T6WA 2J56A 3OMAB 4GYBA 4YL4A 5AZUA 2NRDA 3MX0B 2LLNA 1OCRB 1JZIA 1RZQA 1DYZA 3RYMA 1CC3A 4EF3A 4KNSA 1SF3A 4HCFA 2QT6A 1V54B 2BW4A 2ZONA 4AKOA 3AG4B 3TBBA 3ABGA 3OMNB 1W6LA 2DYRB 5B7EA 4GP4B 4BK5C 1ASQA 4F7KA 2AZAA 3FQ2A 1GY1A 1CUOA 2GB2A 1BYPA 2CALA 1FFTB 1OCZB 2I7SA 1AS7A 3PXLA 2ZWNA 3HB3B 1MG3C 3EH4B 4AI7A 1ET8A 1PMYA 2AVFA 1IBYA 1NIDA 1ILSA 2QDWA 2WSDA 2EINB 1ASPA 2FJSA 2FT6A 3S3CB 4G72B 4E9SA 1AOZA 2YAPA 4HCGA 1VLXA 3QJQB 4HZ1A 2I7OA 4YSEA 2CBPA 5B1JA 1V55B 1IC0A 1X9RA 1A8ZA 2HX9A 2VW6A 2YAHA 3PAZA 4G7SB 5TK2A 3N2JA 1GYCA 5A7EA 4NAJA 4AZUA 1TEGA 2EILB 3NJIA 4G7RB 1TU2A 2E86A 3FYIB 3IBOA 3H4FA 5AKRA 3CDZB 2WO2B 3PAVA 3X1GA 1AACA 1AZNA 1J9SA 5B3SB 4A68A 1OCCB 3NJHA 2B3IA 3KW8A 2X87A 4A67A 3NSCA 1YLBB 4X4KA 1PZAA 1XMEB 2FQDA 2XYBA 2IWEA 5I26A 1IUZA 5B1KA 1J9QA 3NJKA 4YSQA 1NIAA 4JHVA 1SFDA 1RKRA 1PY0A 1JVOA 2FQGA 4BDVB 1OV8A 2JFCA 2H5UA 4K9JA 3H4HA 3UABA 2IWFA 2AANA 3ZDWA 1OCOB 3WI9A 2EIJB 3S3DB 1L9TA 4YSAA 2ZXWB 3H56A 3ASNB 1AG0A 1B3IA 2BP0B 1BXVA 1ZV2A 3S3BB 3X1BA 2R7EA 3QJVB 2OV0A 1NIFA 1TKWA 2J57A 3CVDA 1ETJA 3FYEB 4Q8BA 1UATA 2CCWA 1SFHA 4BXVA 1WS8A 4HAKA 1NZRA 4DP7X 1HFUA 3GXUB 2VSKB 2PP8A 4N8UA 2EIKB 2HX8A 1NWOA 2Q9OA 2BWDA 3ZIYA 1PNCA 1SJMA 1X9UA 2BWIA 4W9ZA 1BYOA 1ZPUA 3CDZA 3G5WA 2BO0A 2W8CA 4YSTA 1SHXA 3FSVA 5I6KA 1KCWA 2BZCA 3FU7B 2HXAA 2PPCA 1HAUA 1FA4A 3NSFA 8PAZA 1KCBA 3X2QB 3UGEA 2A3TA 1CURA 2PPDA 2UXTA 1NICA 4UF7C 2RACA 4AX3A 1ZIBA 4E9RA 1R1CA 2J55A 1GS8A 1DZ0A 2TSBA 4UANA 3QJSB 3EH5B 1AZBA 2BP8B 1BXUA 2IDTA 1QHQA 1MZYA 2PP9A 1JXGA 1ILUA 1BXAA 1EZLA 3WKQA 3WKPA 2FQFA 5I5IA 3FSWA 3NJFA 1AG6A 1N68A 2BHFA 1AZRA 1GS6X 4HHWA 1AS6A 1PLCA 2XLLA 1T5KA 3NYKA 3CVCA 3NP4A 1ADWA 3ZBMA 1E65A 4HHGA 1SDDA 2FT7A 2Y1AA 2QPEB 1NWPA 3NJJA 5B1JC 5D4IA 1WA1X 4JHUA 3NJGA 4A2EA 2UXGA 4TXVB 4A2DA 2YAMA 1BAWA 1ZDQA 2XV0A 3DIVA 3MBWB 3NJMA 1AZUA 4KNUA 5TK4A 2W88A 2VM4A 3D12B 3V9EA 2PCYA 1PNDA 2TSAA 3FPXA 3IN2A 4DPAX 4KNTA 2VSMB 4E9TA 5PAZA 3UAEA 4G71B 1PLAA 6PAZA 3CG8A 4ENZA 3AG2B 1RCYA 1JZGA 1PZBA 4GY4A 2P80A 3NSYA 1BEXA 4F2FA 3QJTB 4E9YA 1FWXA 2DYSB 3TA4D 3X1NA 2HX7A 1A65A 2PCFA 2HRGA 4GP8B 3ABLB 1KDJA 3AG1B 5B1AB 3ASOB 3NP3A 5E9NA 1AZCA 2HZHA 3HEIB 1JZEA 1ID2A 2DV6A 1N70A 2DY2A 2PLTA 4CSZA 2PPEA 2GSMB 4E9VA 1AR1B 1OE1A 4KO6A 2PPAA 4YSCA 1QLEB 3PAUA 1A4AA 3EF4A 1KBVA 2FWLB 3AG3B 1JXDA 2PP7A 2H47C 3FU8A 1M9WA 2XX0A 2DWTA 2Y69B 2QDVA 4YSOA 1M57B 1JZHA 5I6NA 2VM3A 1J9RA 1V10A 1WA0X 2XV3A 3CZUB 3S8GB 5B7MA 2DWSA 3GDCA 3OD3A 1AIZA 2FTAA 2H3XC 2CUAA 1MZZA 4DP2X 5I28A 3X1EA 2GBAA 4L0PB 1PAZA 4M3HA 1WA2X 1NIBA 4KO7A 1RZPA 3FU7A 3FSAA 3C75A 1WS7A 4DP0X 4DP8X 3UAAA 2YAEA 2HRHA 2HLEB 1ZIAA 2XX1A 4G7QB 1IKOP 3L45A 4MFHA 2YAOA 1OE3A 5LDUA 3QJRB 4QLWA 2BP0A 2IH8A 1BQ5A 5I6LA 1SNRA 1XB6A 5I5MA 4WTQA 4AKPA 2AFNA 1W6WA 1A4CA 2UXFA 5ANHA 1L9QA 3WIAA 4A2GA 2ZOOA 5I6PA 1TEFA 3WG7B 4CSPA 2FNWA 2BW5A 2VW4A 1KV7A 3PLYA 2GC4C 4M4RB 4NB7A 5EHFA 3QPKA 1OOWA 1GS7A 2IWKA 4PCYA 5F7BA 3FS9A 3T71A 4P5SA 1GSKA 1HAWA 2IH9A 3FQ1A 4DP1X 2IDUA 4BWTA 4DPCX 6PCYA 5I5JA 3N55A 4YSPA 3ABKB 2MRYA 1ZDSA 5B7FA 3NJLA 4FAAB 1KGYE 1E30A 1E5YA 1E5ZA 1JOIA 5D4JA 1XB3A 4YVNA 3UACA 1WAEA 4YSRA 1EHKB 1GR7A 5I6MA 1CYWA 4YSUA 1PZCA 4RH4A 2YQBA 9PCYA 4E9WA 1J5CA 4KO5A 3WNIA 2XWZA 5AFAA 1JVLA 5FC9A 1CYXA 2WO3B 3SBPA 4F2EA 2VW7A
chains in the Genus database with same CATH superfamily
1CR9L 2YWZA 2K7QA 3ABMB 3DX8B 4FMVA 3VXUE 4RX4A 3ESNA 1DR9A 4KVCL 2CR3A 2K8MA 5IBTH 4WHYH 1CGUA 5LJYH 1F18A 4OCWH 3ZGHA 2JXMA 1KENL 3ZE2F 3J2PA 1MRFH 4RWYL 1XWVA 1K5NA 4I8DA 5KVGL 3DBXA 3RKPA 4RDQF 1S6NA 3L5WB 5I0DA 1FPTH 4JFFA 3BLBA 2RHEA 3OMIB 3UBGA 3TPUA 2XN0A 4BV1A 4D8OA 3UBXG 3LZFH 2BVQB 4J3OG 4K2UH 3APFA 1MRCL 5FLVA 1UM6L 2ISDA 3RVTC 2IPUG 4IQHA 3FT9A 4XWGH 4V1DA 1MREH 3H9SB 1JZFA 1XGZA 4GBXD 5EZIH 5CGYC 4B9GA 4ZMVA 4R7NA 3FN9A 2F74B 5SWSB 1TFHA 4ZYKA 4MX7B 4YDJB 5TJWK 3WEBA 1LWHA 4I3SH 3FF7A 1GKEA 3NRQA 3ZSSA 3B9AA 1FN4B 3DRQA 5E9DA 4EXPX 3DO3A 2QVTA 4R7XA 3KBPA 3SCMD 1IL1A 1BOGA 3PE9A 2W38A 3BJLA 4PN6A 5KVFE 1FCGA 2ESVD 5AW1B 3WS6A 4HUUB 2BSBA 4ZW6A 4WWKD 2WWKO 2FATL 3BRGC 3E38A 3TIDA 3OKDB 5HYJD 3LPPA 4P2CG 3SBQA 1HI6B 5IOKA 3P2TA 2E4TA 5AVRB 2G3XA 3LN4A 2VDOH 5FKAB 4JEGB 2IGFL 4EZKA 2DQUL 4N2KA 1F56A 4OZGF 2CBOA 4PJIB 2XHNA 1KY6A 3BDYL 2UUDK 3OZ9H 1FP5A 2KT6A 4NKOB 3L16A 4URTB 3IU4H 2UXVA 4X6DB 5DR5H 3T9WA 4Z7OF 4ZMWA 1HZLA 3BAYA 4JPWH 3L1EA 3O4LD 3IVKA 4N8CH 3PDDA 2CKBA 3R0NA 4FFWD 2MHAB 3VXSE 5FYJH 4FQJH 5E8OB 3PXHA 1U8JB 1BBDH 1T3FA 2OMUA 2P1YA 3G3LA 4L9LC 5LGHL 1FORL 2MCPH 4N0CD 2AK4B 1T5WA 2EE3A 1V8HA 5B38A 1UB5A 1YQ2A 4KPHH 5D7KE 1N6UA 3E8UL 3ZZLA 3BRDA 1JYVA 3FQYA 1SF5A 2D9QB 4MCMA 1XF1A 4BA8A 3CX5K 1A7PH 2DLHA 4KVNH 5FHBL 5BV7H 1CI5A 1MCPH 4H7VA 4OJFH 1IAIM 2DTML 2CZNA 1FLRH 1B4JL 3D39E 4O02H 5LBSA 2AF2A 4Z0BL 1AAJA 2EE6A 3EOTH 3VXSD 4D8PA 3TBCA 5FB8B 1TO5A 3QDJD 5HHXL 1KUMA 2H26A 3Q13A 5FO7B 1H6UA 4A55A 1J8HB 4IS6A 4PJHA 4XODA 2NY0C 5HHOA 3RVUC 3UJJH 1SVZA 4WRLA 3ES6B 1OVZA 3CZLA 4RQQB 1IFRA 1OP5K 5AZUA 3RB7A 1NCNA 2W0PA 2NZIA 4AE0A 1ED3A 1ACCA 2E7HA 1EEYA 3VD3A 3MJWA 5LQBH 2NPLX 4Y4FC 3WDHA 4PREA 1LP9B 2NY7H 3OG4B 3MREA 3QNYA 2CBQA 4C59B 2DYRB 3L3JA 2XACC 4LCYB 4LLVB 4XMUA 3U82B 2P46B 1P4IL 2GITB 2VITB 3JVGC 4GFTB 4L8BB 2W1NA 4PGCA 4Y4FD 2Q8AH 5GS1A 4YBQD 5CSGA 1O6SB 4YO0A 3BPOC 2G5BA 1ZLDA 3BUIA 1OCZB 2VDKH 4GSDL 4TLTA 1E4JA 4PRBB 1WWWX 1MG3C 1PZUB 4ZOBA 3B2DC 2LGNA 1IEAA 2YEQA 5MP6H 4G1EB 4BHUA 1EQWA 1NIDA 4KTDL 4W6YB 4I1PA 1ASPA 5I1JH 2IPTL 1W0WA 3ARDD 4EN3B 4UNIA 2YA0A 5KOMC 1ZA6B 3M8OL 4LPCA 4PJIA 3KWUA 5EOQH 1L7TH 4G7SB 3EBIA 2YAHA 3R4RA 4HGWA 4NUPA 3T65A 2IAMA 2VR3A 1CO1A 2FECI 1JCKA 4NAJA 2FX7L 1UASA 2GBUA 5E51A 1F13A 2JKTM 3E6HB 2EEXA 5D70H 3D5OF 3IJYA 4Z0XA 1KTBA 2WVUA 3VW3H 1AZNA 3Q0HA 4BQ6A 1BWMA 1JTOA 4LL1A 2CD0A 2H6UA 3SDDC 3SJVA 4A68A 5I8CA 3KW8A 3MV9E 1F58H 2HVKA 3MBWA 2IWEA 2Q20A 3CZGA 3EZJB 3PPEA 4JHVA 2X89A 4MA7H 4LPYA 2O6CA 4Y1TA 4OV6F 2GK0A 5HDQH 1Y7VA 2NR6D 1CXKA 5ISZB 4HEPG 5AKTA 4HT1L 4G1MA 5DHVA 4WV1C 2L7UA 2D03L 5EEXA 3TFKD 4YSAA 1KBGL 4J8RB 3N44F 3RHWK 4TL5A 5DA4A 1BXVA 1ZV2A 2DD8L 3K4DA 4MWFA 4PP2A 4RAHA 2RFXA 1XQ4A 4A6YA 3O2DL 1M1XB 8FABA 1KCLA 4LCWE 2NXZB 2AQ2A 1ETJA 3V55A 3D09A 3TCTA 2WSPA 1ED3B 4LLQB 4M48H 4QHPA 3IDYC 1NUDA 1NZRA 4M48L 3W0WB 1HFUA 1BLNB 1UADC 1V3LA 3FH8A 4QCIB 1FNFA 1TZGL 4JDVA 1NWOA 4KKNA 5GRJL 4KJWC 3R8QA 2B4CC 5K33A 4ZFOL 2GABA 3MU3A 4EIZC 1KN2H 2F7IA 1U93B 3D18B 2FBJH 2DD8H 4M5TA 2BRRH 1KBGH 1H9DA 3HR6A 1IGYB 2EO1A 4XR8C 2V2WA 5DRZA 1HINH 3RG1C 4BSVB 2IOIA 5E56A 4NZTL 4M8QA 4MB4A 5EU5B 2CU9A 1ACYL 1AI1L 2VCOA 1RJLB 3KWXA 1IEAB 1KIUA 5D2LE 2VR4A 4GAGL 1U8PA 1P7QB 1U6AH 25C8L 4MMZA 5F1SA 2JK5A 5DDHA 3SHSA 1UD6A 3L4VA 2XY2A 2H6PB 4UCFA 3EOAA 3BP6B 3QHZL 4JQIH 1OL0A 5FAAA 1RLBA 2N7AA 3OKLA 3BPLC 4OFYA 1PX3A 4XNXH 4XNAA 3OWEA 3VI4F 4NXKA 4GW4A 4YDJA 3I9GL 4JAMA 4P2OB 2FO8A 2WLKA 3VA2C 5I1JL 4K8RC 1WHOA 1LO3H 3BVVA 4XNUL 3ZDXB 1U4FA 3CPLB 4U1JA 3IRPX 4J3WA 2DZEA 3L9YA 4JFDD 5DVNA 3U0TB 3V9EA 2TSAA 2VLJA 3AXIA 5KAQF 1UC6A 4GAJL 5EZOL 4JUTA 3B56A 1UT9A 3JTSA 4LXFA 1FJ1A 6PAZA 4PJHF 5JYMA 1NEPA 2EDNA 4NBXB 2EO7A 4BH7A 5MEPA 1OGTB 5DJ0B 4DUXA 3O4LE 1JZGA 4WFEE 1MI5A 1G0YR 4P3CH 4PPTA 1EHXA 5GS1C 2K6YA 1E4KA 1MNNA 2QQNL 3B6SA 4DK5A 2CUMA 4JFFE 4A6YB 4F2FA 5J89A 1YJDC 1ZA3B 1RUPH 3L54A 4PJ7B 1HE8A 4GXVH 5HJDA 3EFFA 2MWCA 2HH0H 3ESUF 4OBSA 1MFCL 4ZOCA 4NKOA 2Q7YB 3G5ZB 1U3HD 3ZDZB 4QY8A 5HGHB 1G7LB 1MIEH 4P9MH 4ZUUB 4J1UA 3UJJL 3KJ4C 5BS0D 4RNRB 5IMLA 3D39A 5L8JB 3TTYA 4AITA 1QLEB 3PAUA 3HUJB 4DWHA 4KDWA 2NSQA 4PJDE 2YK1L 4NO0D 3D69A 1M9WA 1XGUB 3BISA 3FHQA 4BSVA 4W9LC 1A6VH 5EU5A 4M4PA 4I4WA 4QRUB 4K3EL 1HOCB 1V10A 5I66B 5FHBH 1JHKL 5BV7L 3ALXA 3Q06A 3B5GA 4NJAH 5GSVB 1FZMB 4U1IB 5I8EA 1OT4A 1GAFL 4JNXA 2G2NA 1HKLL 1JMZA 3D05A 2WWNA 3CBRA 4U1SA 4WI9A 4Z5RB 1GZHC 5DRNB 4NGHH 1RZPA 3W2DL 1JPGA 4ACPA 1F11B 3QISA 5E0FA 4N0RA 3LZNA 2HLEB 1IAKA 4KAQH 3S5LA 3AUVA 4O9HH 5DJYB 4IS6B 4PJHB 2F54B 4AVHA 3H42H 3KWTA 5GZOA 1IKOP 2H3NA 4AG4L 3PWPD 1DEEA 1BIIA 4P4KA 1VENA 2JB5L 3MLSL 5TDOB 2N7BA 4M9PA 4ZQKB 3DYPA 4PM1A 3KPOA 1AR2A 4AYMC 4P3WA 1XBRA 3GHBH 3HBQA 4CA4A 4BZYA 5BZDA 1M05A 4IRSC 4HDIA 5D2LF 3PWUB 3FT2A 2X6CA 2NQDA 3O0RL 1ZLVH 3D2UA 3PLYA 4M4RB 1OK0A 1RIHH 5ANME 2V4LA 3JTSB 2X12A 3ETSA 5GJTH 4HJIA 3BIKB 4PD4J 2IWKA 2A9BA 3F64A 3O3EB 4AK2A 1MHHB 4MJ6B 4PHXA 3PU7A 1U8LB 1NEZA 2MPAH 1E4WL 5F1NA 1JGUL 4ABQA 3MR9B 2AP2A 4DPCX 3MLUH 2FIRT 5IJBC 4UBDD 4DH2A 4YSPA 3ABKB 3F5WA 2ZSVA 4ACTA 4ANUA 3TVMD 1E5YA 3VMOA 1AJ7L 1X4YA 4H8PA 3MFFA 1DLFL 2BVPA 3TFBA 1GR7A 1V27A 3NA4A 3NIFB 5HGHA 2V6HA 1B0GA 3F00A 3L95A 5D6DC 4O2CA 2VLRE 4EOWL 4Z7IA 4FFZL 1CB4A 1H5BB 5GISH 1RUKL 1NGWA 3DV4A 3CSYA 5LXVA 2XSKA 5EIIB 4J6IA 3VCLB 1YC7A 5IJDC 5DUML 3EFDH 1ODAA 4HIHB 4ODXA 2XWBA 1G1CA 3KLHC 3FU0A 2ZCLL 3IDJA 3VE0A 1LO5A 4N4YB 3QUXA 5F9JB 1ACXA 1NPNA 3BQVA 1MJUH 2DW5A 3Q6FA 4WGWB 1ORSB 4OSUL 5DMJB 2UZXB 4M7LL 4IRJD 1NPJA 3CHSA 2ZAGA 4I88A 1VF5C 3GXFA 2F19L 3I2CH 1S7RB 2JE8A 5I19H 5FO8A 2CNZA 3PHOB 5LBSL 1QX1A 2F7QA 1H9VA 1LLAA 3KJ6L 3KPMA 4PCKA 5D7LA 2R1WA 2PO6D 3LXBA 4BCXA 5C09D 3MLYL 4QTHB 1GHFL 3QJFA 5GISL 3UADA 3FB7A 1KZYA 2OL3L 4BKLA 3GYRA 4ZMYA 4P2AA 2R0LH 2PTTB 1YRKA 3I9AA 1MLCA 1MDTA 4XCCL 1ZGLP 5FYKU 3WDIA 1NCIA 2EVGA 4J12A 1TJMA 3NIGB 1WGVA 1TOXA 1OSYA 1S46A 3T5WA 2AV1A 1KPVA 1ASOA 3JUZA 4N24A 2E6QA 3GI8H 1I1FA 4PJXB 2PYFA 2JVUA 2R2HA 2VN3A 4XO3A 2OW6A 4U49A 1X4ZA 2NR6A 2WKOF 3TEZA 3RZWA 3MJ9L 2P80D 2WLNA 3BW9A 1KCRH 1NLDL 3VFTA 2V3EA 4EPSA 1TYEB 3QNZB 2PUQT 4TQHA 5LN8A 4AEIH 4GP5B 5IY5B 2HMID 1S7VB 1IILE 3F85A 3KXFE 3O0RH 3FKUS 4JQXC 1S8DB 3UG3A 4EBQH 4CJ1A 1P5UA 4CN6A 5FCUH 3N0AA 2P5ED 3EYVB 3TBVB 2G9KA 2BP8A 3QFJE 3B2VH 3W56A 1UH3A 1VCBC 5GJSH 4OGYL 1Q9KB 3N06B 2AQPA 1EJOH 4BYHA 2OMVA 1S7TB 1NMAL 2X09A 2P42B 1I8MB 3LPOA 1F6AB 3K6NA 2D4FA 4F2MB 4Z6AT 2H6PA 1QBML 1A7RL 3UCRA 1XCQA 3NT0A 1E6OL 5JOPD 4Q89A 3KYOB 5HYSB 3WNLA 2WCGA 4M6ML 1UOKA 2EH8L 1H5BA 5C0RL 2YD3A 3M17A 4XXDB 4P2OD 1NGWB 1PTZA 4N6QA 4PJCF 3ZE1F 2CDGA 1O0VA 2GIMA 4XVTL 3B3BA 2A4ZA 2R7EB 5B3JF 4S1QH 1UGNA 2Y2WA 1OAUL 5FOBB 1P5VA 3QXDA 1VGEL 3ULUH 4WCYL 4K5NA 3EYQD 2NW2A 2CO4A 2XPGA 1EEYB 2DIEA 4XN4A 1ZKAA 1P7KB 2TRHA 4X98B 3AQXA 5EO0B 4PFEA 4WO4C 1KOAA 4N9GA 2VDQH 4E0RB 3QHTC 4MNHA 2N3JA 3DTUB 1RZIB 5AVUB 3I9IA 4B27A 3D85B 4BQBA 5FO8B 4BRJA 3PJLA 3PQYD 1LILA 1JWSB 4FFYL 3U46B 1G5AA 2FIKB 4EKXA 1QNZL 1QNZH 1UD4A 3KWWA 4Z7WB 3V6ZA 4WW2F 4A2HA 3LAFA 1MCWM 4OZIA 1DFBH 2MFNA 3T6WA 1BM3H 3CUPB 1R3LA 3OVUB 4YL4A 4XI5D 3C5SB 3CJJA 2BJMH 2ICWA 1FL3A 5KZCD 4HYTB 2AJYL 1G0DA 2NYKA 4DVBA 1ECZA 4I77H 4AV5A 1VGEH 3MOQA 5J3HD 1XCWA 5CZVH 2YBRA 4ZFGL 2R2HB 2EACA 4J27A 3KEHA 3CVHH 3VXSA 1M4KA 3VQMA 4G80A 4U4IA 3AWFA 2AZAA 4HEME 4JDTH 4N85A 5HHMD 2KDGA 1VERA 2C4XA 3J07A 1BAFH 2Z35B 3GXIA 1LE9B 1OSEA 2NXZC 2HKAA 4H20L 1MI5D 3I6KA 4R0LB 4GMTL 3MBED 2JKIS 2OR9H 1A9BB 3D1MC 4YHKH 1BCIA 1NFDF 2ATKB 2OJZH 1JNNL 3W9DB 1HOCA 2ED9A 2QDWA 4MBRA 2OS7A 4Q0XL 2FWSA 2HPTA 5GSVA 4HCGA 5K5YA 3GSVA 4FNUA 3OAYK 2D3VA 3FU5A 2OMVB 1CL7L 1V55B 2RB8A 4ZTEA 3O6KL 4Z5RA 1R46A 3N2JA 1IQWL 4AYDC 3GMNB 4PB0L 1W72H 3ULVF 2CKBL 5FXCH 1W9XA 4HQQL 3H85A 1NSNH 3NN8A 3M7FB 5ESQA 2JCCF 4A7TA 3U0PA 2NY6D 4ZW8A 3VFOA 1TTBA 4HC1A 1KCRL 1B9ZA 3T0WA 1Y0LB 4PSPA 4PLKD 3ESPA 5CN3A 2AJZA 3IFPB 3T0ED 4F37K 4HUNB 4ZQKA 1FDLH 1LYQA 1OCCB 4XZUB 4JPSA 2E9WA 4QXTB 1SZNA 25C8H 3VXQB 3HCVA 4CN1A 1RVFH 1O75A 3IJSB 4NCC1 4YH6A 4NQDE 4X5XA 1FIGH 3W0WA 1NIAA 2XA3A 4R7NB 1NCAL 1C12B 4LLWB 5F9DC 3TYGL 1OB1B 3MPCA 4ODSH 1KLFA 2WGXA 3ZL4L 5KVFL 3DI2B 5BS0E 1SXSA 4YQXL 5C0CE 2ZKXA 2PO6A 2JJUA 5DLLA 4JHAL 3DARA 5JHMA 3QORC 5FUCE 3NGBB 3D85A 2EIJB 3ZDWA 3VD9A 1MOEA 2YJQA 5CILH 2DN7A 5A6IA 4DO6A 5CR8A 3ZE2E 4M1DH 4PJFA 5FYLD 1TKWA 4FKKA 4FLRA 4MAZA 5HI5D 2VABB 4YGAB 5AYUL 3UIZA 4CU7A 4ZXBA 2ADGB 1G7JA 5DZ9A 2EVFA 3NFNA 1FF5A 1UATA 3VD2A 4LASH 4PJCE 5LG6A 1EIBA 5AUMB 1DANU 3WE6A 2X2YA 3EFDL 4CDGC 1Q9WB 4GPVA 1G7QB 3G6JA 4JJ5A 3JWOH 4LEOA 4NM4L 2EDBA 3MRRB 4GG6F 1JDCA 3KGTA 4O2CB 4FNLH 1JRHI 1HL4A 4LPUA 4LPVA 4OD3L 1NCWL 2WD0A 1ZPLA 3QGVA 1OWRM 2HXAA 1OD7A 2A2QT 2D03H 3BP6A 3KGRA 3M45A 1BZ9A 4LPTA 5MEOB 4FE9A 5EIIA 5IVXE 1CTNA 1KYOJ 5E8OA 4K94H 1DLFH 2BMKB 1M2VA 3EIFA 1N12A 3DUUA 2WNXA 2Z0BA 5DJXB 4HVBA 2UYLA 1HXMA 5E6RB 4TNWF 5B38B 4JM4H 3FQTB 2A5UA 4M7ZC 2ZP0T 2IDTA 3UXFA 2ICWJ 1H6TA 3I50H 2V7NB 5DURD 2QQLH 4NO5A 1IGIH 4PRNB 3VYNA 3ZTJH 1KEML 3WKPA 4NZUL 5D1XD 3UMTA 1TQBC 2NMSA 4GRLB 3NCWA 4R7DA 2C9AA 2VJ8A 4PV8A 3RGVB 2VLJB 3WO4C 3VFMB 4LSSH 1FH5H 1NGPL 4JFEB 3OGCB 3VYOA 3NPSB 5E8NB 3M7OA 2OA9A 2Q6WB 1MNUH 1OGTA 3UTSD 3NYKA 4GT0A 3EO0B 4PJXE 4ALAC 3BCFA 3EBAA 2J44A 4N0FA 3HA0A 5B8CA 4XWOD 5E8DL 1JYWA 4Q9BA 3NCEB 3N6YA 4HS6A 5MENE 4Y9CA 4IYKA 3U7WH 2MIZA 5IR1A 4CC0A 2V9UA 1RZ7H 2Q1EA 3OXRA 3APNA 3HCVB 4KTDH 1G4MA 1AZUA 2WZAA 3MLTA 1MCLA 2B77A 3PP4L 4NO3B 3FPXA 1AGFA 2V33A 1ITBB 1E2VA 5IZ7A 5DYOA 3BWUF 5DQDL 3NZ8B 4G71B 3EOYG 4OZGE 1M6UA 5SWSE 2PCFB 2WLHA 2YSSA 1SMOA 5G5DA 3U1QA 1ZMYA 4AVJA 4GKZA 4MCNA 4S1RL 2MCG1 1FL6A 1JZ6A 4JL1A 1F5WA 1DJXA 2FYYB 2Y24A 2FJGA 3D3VD 1TFPA 4JM2F 5DZJA 3HHSA 2JCCE 2X2IA 1A65A 2DWEA 2DKMA 2ZKHL 3QRBA 4YC2B 1JG9A 4ANKA 2R9HC 1Q9KA 1XF5A 5TQ2H 4H40A 3N42B 4J3OH 1GGTA 2LTQC 1CK0L 3ASOB 3NP3A 1F6AA 5D2NC 1AQDB 1BFOB 1JPTL 1W0WB 3S36X 3WE6B 4ZTPH 3OC5A 3BRFA 1J8RA 4JJ5B 1AQMA 4LEOB 3AY4A 2CLZB 1NC2D 1IZJA 3AG3B 3MJGX 4KJQD 4C56B 3A4DA 4XBPB 4QGTA 1I8UA 4NWTH 3CGTA 5HI3D 2QDVA 1M2VB 3HLAB 4OFKA 1KEGL 2CM6A 4GBXB 1P4BH 5I6NA 2L7QA 1HXMB 3DROB 1MFCH 4D9QD 3WNOA 4A39A 4ELMB 5T5NG 5ABDE 4WO4A 1G7IA 1C5BL 3FMGL 4MB3A 3DRQB 3RAJL 1LNUB 2HP4A 1OGAD 2GBAA 2BSCA 2PYEA 1RZFH 1AO7E 4Y19D 5BOZG 2CBTA 3UTQA 4Y5VA 4LSQL 3ARFC 1CGTA 2BHUA 1NAMB 2D7MA 1PZ2A 2E46A 2F1AA 3C75A 4LAQL 4MHHI 2ESVB 5F7MC 3KWWB 1MFMA 4Z7WA 5JDJA 4N0UB 5FYJL 2XTJC 1GGIH 5MI0C 3MLVL 3HNTH 4JMNA 2HJFA 4LL4A 4N8CL 4GAJH 2ZIDA 3H55A 3O3EA 4E41E 4EI0A 35C8H 1D5MB 3GF8A 3QJRB 4NPYB 2QSCH 5IROC 5EUOE 1XSKA 5B8CB 2K45A 3BKJH 4MDJB 3TT3H 1PQZB 2CO6B 4H0HB 4CDHA 3BHBA 2DQUH 5BO0D 5T3ZE 3C5ZB 5EN3A 2YHGA 4OI9A 3FCBA 1YMMA 4X5QA 1YDPA 5HDBE 1NGXA 1JDAA 2UXFA 1T0MB 5ANHA 3I75A 3RFZC 2J6EH 3HHRB 4NNPL 3T8MA 2EDEA 4PTTA 5EHFA 1FH5L 3QIBA 3RDTB 1QWHA 4JE0A 4PRIA 1G6RH 4X8GA 1SY6H 2ATPB 4KTYA 2EE9A 3SGEI 5D9SA 4LIQE 1EZSA 1LO5B 4XMPH 3T0EE 5EF2A 3R1GL 3FTGA 1IGCL 4ODUB 2K78A 1R3KA 3AT8A 3DDGA 1FL5A 1QSED 1RZGA 4XTRD 1DVUA 3K2MC 4QDGA 5JXEA 1P7QA 4JK0D 2EXTA 4AW7A 5CJ8A 4WJG3 1UHVA 4V1DD 5DZAA 4BFNA 3HC4H 2LABA 3H7BA 4IBSA 4MNQE 3H3BC 4N90E 5A2JH 5TF0A 5IFJB 1JVLA 2FBJL 2PCXA 1PKQA 5CN2A 1ZLWK 4G43A 4XBPA 4JKNA 3U25A 1KN2L 3DVFA 4W9CC 1K2DA 1MRFL 3F84A 2OLDA 3W3BA 4FRWA 3RTQD 4JGJA 1LE5B 2D0GA 4ZX6A 1AFVH 4XWOC 3N50A 1FZJB 3UAFA 2GUOB 3W38A 2GJZB 1A1MA 5HHME 3TP4A 4H13C 2E7DA 1TVBA 2MMXA 4RIRA 2IWGA 4PJBA 2KZ1B 3FFDA 4YVUA 4L3EA 4Q56A 5T1KB 4UAOB 1C7TA 2IH3B 3STLB 2UZIH 3ZDZF 3WL9A 4R5TA 2IDCA 4F33B 3MRDA 2YUZA 1MFBL 3IJHB 4JHAH 5DRWA 3U83A 2K7PA 1P7BA 2J2ZB 4JFZL 5L2KE 3IXAB 4PV9A 1CE6B 2X70B 3K6FA 4DKFH 2HJFB 1GW0A 4BH7B 1P5UB 2R0ZL 1XBDA 5DJ0A 3NFNB 5BRZE 2JQMA 4W68A 5AB9A 1P5UC 3T4AA 5I1GL 4TQIA 1XH0A 5I1KH 2F54E 3CFTA 4LSUL 1WE5A 3O4LB 4RZCB 2XWCA 1AYRA 1ZA3A 3MOBH 4EI5A 1HJCA 5F3BB 1H8LA 3EJUA 4OM0L 3SE9L 5BQ7B 5J5EA 3QEHB 1O7SA 3QZWG 1IT9L 4YJZL 1U58A 3IDXH 5ILTH 3MRRA 3ZR5A 4WHTA 3G08A 5SWZA 1L9PA 5E2VH 3LKSB 3VU1A 3HE6D 1AXTL 2BSRA 3S8WA 3KYOA 5JQ6L 3IMBA 2Z1PA 1HSBB 4DP6X 3PWNA 1CBJA 1BQRA 1KBPA 2JMRA 3JT0A 3O6KH 3RWJA 3V4PL 4JPVL 5HYJB 2B5IC 4B96A 1OIOA 1CLOL 1TQTA 3F7PC 3ZE0F 3FQTA 1P5VB 1I1YA 2GHZA 4QKTA 4A1RA 3RGVD 3JWNE 4MQXC 3IGAA 4I4WB 1OAKH 3BUBA 3GXNA 4QRUA 3AS1A 1X3DA 2OJZL 2CE6A 2P48B 4OGXL 3GSOB 4OKDA 4U1IA 5I8EB 4YDVA 4JZOB 1RURL 4PWJA 1C08A 3NIDB 5HYEA 5AZ2H 4MD0B 1DBMH 3NA9L 2CHWA 2B2XL 3GRWA 3HI5L 3CVHL 5H94A 5KUKA 2BNRB 3VGAC 3C2AL 3TA3D 5HXMA 5AOZA 3CZFB 3CFDA 4CBZA 2R59A 3DUHA 5I0XA 3OAUH 3AREA 4BZ2A 3U7YH 4Y8DC 5DI8A 3TZVC 5LNGA 2A73B 1ZOXA 3GNMH 4NO3A 4GJTB 5TE7H 1FHNA 4LCWA 4LCWD 5ABZA 1JBJA 3NCBB 2GJZA 4NUGL 3V9FA 1E5CA 1BZ8A 2DQIH 2MQGA 1LEIB 1F86A 1U42A 5J9PB 1MCCA 2GAZB 4B9ZA 2VE6A 4MDIB 1VFMA 1VFBB 3AXHA 1DQVA 2Z31B 2PW2A 1HILA 3LRKA 1RSFA 2BNUB 2UY7B 2J2ZA 5DRWB 1G7HB 1PAMA 2NRDA 4PJCA 1EFQA 1LO4L 1RZQA 3CN1A 4EQ3A 1W8OA 3QUZC 4AT6B 3ZSTA 1DE4B 3KDMB 4OV5B 3HI6L 1UOVA 2PXYA 3SJVE 1XF3A 1ADQL 3E8UH 4NQUA 4PJFE 2QL1A 2OYMA 1P53A 4Y1AE 1ASQA 1OD9A 3TH3T 3FQ2A 4P2YA 4BK5C 1CUOA 4HP5A 5HHPB 2CLZA 5EA0H 1X5HA 1A21A 4GS7B 5L4JA 3HVDA 3UROR 1BBDL 1BBJA 1VZGA 1WP6A 4KV5F 4YDIH 3L95B 1SDYA 2DKSA 2DLGA 5CP7A 2KZKA 2R0WH 1Y0LA 3O6FD 4L4VE 4OCXL 4F7EB 3J7HA 4WW2A 1BVNT 3BSZL 5ALCL 1IARB 3CXFA 5MHSE 3ZHLA 2A9NH 2ZUYA 2C9UA 2FZ3A 2ZYRA 4G7YL 1PL3A 1NFKA 4HWEH 4JAMB 3B2VL 1MW1A 3PL6A 4E5XB 2B59A 4GI6A 1OALA 2A0LD 4HIJA 2X0VA 2IG2H 3WIFB 2HX9A 3OHXC 5IROD 3B8YA 5IOPB 1RH8A 1TU2A 1U8HA 4PJGB 3WHXA 5AKRA 4AEIL 4CU6A 1QRNA 2NY5C 4OLUH 3LEVL 1R5VA 1AACA 1X7QB 5E9DD 5DD0H 1D5MA 4NPYA 3T6QC 4N0YL 2HFTA 5CBAB 1JAEA 3DO4A 1YNTA 3VNYA 3CV5A 3P3UA 3ULVL 2VSCA 2D7NA 2XFGB 3MRBA 3BWAB 1S78D 5GIRB 5F9OL 1U8NA 3P4OA 5JOFB 1PZAA 3BHBB 5FW6A 3GI8L 2DMBA 2ENQA 4YZWA 2C5DC 2EUWA 3VB8A 1JHTA 4N2AA 3DK0A 3OHXB 5EDXA 3KPRD 1MW0A 1SFDA 1NGXB 1Q1JL 2IBGA 2H1PL 4LKCA 3I75B 1ZSHA 1I3RB 3QR1A 3G5ZA 1RL1A 4K9JA 2OR8A 3POHA 4DQOH 2NY1C 3OLDA 3UABA 3F7RA 1KC5L 3BSHA 1OCOB 2ZF9A 4G3YL 1WWCA 32C2A 3MNMA 1AD9A 4JS7A 5E2TH 1T66D 4ORGB 5IHZA 3GMOA 1QEXA 2NCEA 3DJSA 1FPTL 1MUJA 2H0JA 4NM8L 1MH5A 4G7VL 5JPMC 4E42B 4PJ7E 4WUKH 4HZLB 4A6YH 1YEEH 1TUPA 1DQQA 3GLDA 4GS7C 2H6OA 4LVHB 2NXZD 3TNNA 1F1GA 3HE6B 5I66A 1WV7T 4N8UA 3ZMRA 2HX8A 2R2CA 2XQYK 2R0KL 3OJVC 5LAPA 4ZFFA 2ZKYA 3QJXA 4MJID 4ICXA 5JDSA 1AR1D 4YXHH 4QJ4B 1CBVL 2W8CA 3NCMA 1E6JL 1EHLH 2MNUA 3CLEL 3QZWB 1R6VA 3DHPA 4AIXA 5IFJA 3RWIA 2AQQA 4X6DE 1HSAB 3RX5A 4ZSOB 4FQCH 4L2YA 2XBTA 1T20B 2C9SA 1KCKA 1XFPA 2AGJL 2FX9L 1KJMA 3PY9A 3FXIC 4EDWL 4P5KA 4KQ4L 4WW2B 1KTCA 3ISRA 2P5WB 3FT4B 4F1SA 5IHUH 3TO2B 2BLFA 3MLUL 3QJOA 5FF6A 1MIML 3DRTB 4L1LA 4U1KA 1FGNH 5T1KD 3SZ6A 3ULVH 1BXAA 1PLGH 2XN9B 2J71A 4KK8C 3O3BB 1O7DC 2J7LA 3WJJC 4PJBB 1PJWA 1TVHB 5BCAA 5DSCB 3RUGB 1E40A 1QFWI 1F6FB 4O5LH 5C3LD 4ZDHB 2Y25A 3INOA 2JQZA 1NCJA 3MLRH 4P59H 4DZ8A 2GJ6B 2WBJC 2IQAB 2NZ9D 1HXYA 2ZX9A 1UJ3B 4D0CB 5LG1A 2FYYA 4PJ6A 2Y1AA 5AVWB 1WWBX 2FJGB 1JGDA 1NWPA 4J6RH 4POUB 5GS0D 4MAUL 5C7XH 1NEZB 1A3LL 2EXYC 4GW5A 4TVPL 5DC4B 5F1NB 3UBHA 4CU8A 1NFDB 3CUPA 3C8DA 5AYTA 4KKAC 3QUHA 3K81A 3WTVA 4F9PA 2PYED 5DK2A 1AQDA 5B3JE 4M3KB 3MGTB 3T0BA 3W81A 3QQ3B 1IKNA 1J0JA 3IJ7A 1PX4A 1KFAL 3LZOA 3N9GL 3RL2A 2IPKB 4X6BB 3B37A 3L81A 4B7LA 3HZKA 3PWVA 4ZMXA 3GMOB 1YPZF 5HDOA 2YSTA 3IDUA 1NCCH 4M5ZH 1T6BX 2Y2TA 3DYOA 2OMUB 3TVMC 2Y6SC 3IPFA 2HRGA 4UQCA 4UZUA 5GRZA 3W9EA 4JRFA 5IVXB 5GZNA 5L2JB 1I82A 1J1OH 4GAAA 5AKSA 2GEQA 3L4ZA 3FTUA 4XCEA 1ZGLA 2QVFB 3L3HB 4NN5B 1UXSB 2E3VA 2IALB 5CLXA 2DV6A 2VDPB 2PLTA 3SEPA 1IC5H 3GSOA 3ABZA 4GQRA 3RJDA 3TEUA 5JIDA 2FJFB 4YXKH 3T1WA 2LAAA 2VXTH 3QZMA 5AWNH 5GRUH 4OI7A 1OARL 3T04D 4YL9A 1F0LA 2YUXA 1HJBC 3BKMH 3PWLB 4KI5C 2ORBH 3RWIB 4ATTA 4LQFH 1IGMH 2VAAB 3FCTA 4NRXB 1MIEL 1MY7A 2FHFA 4P9ML 5BRZD 4AC2A 3C9NA 1FSKC 4RFEB 5CSZA 1ES0A 1VACA 4EMZA 1KMGA 4P5KB 5J12B 5DZOA 4NQSA 3QP3A 5ADPL 4JFXA 3RFZB 3KPQB 1IM9A 1QSVA 1S78C 3ZT7A 2CUAA 1YECH 3V6OE 2PYFB 3CHOA 4ZTOH 3SKOA 4MVBC 4H88H 4LSRH 2CIIB 4PRHA 4ZJ9A 1C12A 4LLWA 1NIBA 5D7JA 3FU7A 1RIVL 4IKKA 3OKMA 5JHDA 2I27N 3DSFH 4GRWH 2YAEA 2HRHA 3IKCA 2JJVA 4XCFL 5FKPA 2E27L 5F71A 4G6JL 2ADIA 3L9RB 4G7QB 2Q76A 5EZOH 3ALPA 1N0XH 3ARGA 3H0TA 4OGXH 4Y2NA 5F72S 3X14A 3D9AH 3KPNA 4QLWA 2ZX6A 1FFOB 2Y23A 4KFZC 4PJFB 2OCFD 5CD3B 3LKRB 5I6LA 1K6QL 1BZDA 2GCYB 5K1NA 1OW0A 3BN9D 2BSDA 2ADGA 2PXYC 1A14H 1YSOA 1A4CA 3V4PH 1G9NC 4U1GC 1QWNA 3FUKA 3KYNB 4IOIB 2E7LA 2CR6A 2B1AH 5K9QI 3WG7B 5T5FL 5EBWA 1JTPA 1P0SE 2BW5A 4M00A 5ANMA 4NB7A 3L7FB 4JRYE 5EPMA 5C0JA 5GZOC 1X7TA 3DOSB 5AVVB 3H9YA 3M17B 1T1XB 2ZSWA 1FZKB 3IDXL 2EDXA 3TWCH 2OTUB 1GSKA 4HKXB 4Y2OB 1JRHL 1MWAA 5E70A 3O2VH 4OM0H 5GHWH 5T3XL 2Y5EA 4NKIH 3W9EB 3OR7A 2FR4A 2D3NA 5B7FA 1KGYE 1JZ8A 4DPRA 1LE5A 5F7HA 1JOIA 2F74A 3KL3A 5D2NB 3AY4C 1VEMA 3UC0L 4UDTB 5E1AA 3IFLH 1G9HA 1OSPH 2HT3C 5DHXB 3L17A 2X6UA 3GHPA 1JGVL 2QADB 2K8QA 5F88A 3SE3A 5HVHC 5KAQG 2XZCH 3KZ8A 2FJFA 4ZMTA 5C2UB 1A3RH 2A74A 4HS8L 4S11A 2XWZA 3M1BB 3V4VL 1SEBA 3KXFB 5GRXG 2ARJA 2JJTC 3VFMA 2WXGA 1OF2B 3LB6D 1J0KA 4DEPB 3VX1A 2CGRH 2W65B 5E5MB 3CHRA 2XTJB 4PS4H 1BJ1H 1DQML 3CSPA 5I0YA 4ZX3A 2XXFA 1ZWIB 1M3IA 4IBYA 4Z95L 1NINA 3ARBC 4WO4D 5FW7A 4BE6A 1EHAA 1NAML 4IBVA 4IIQA 1YPZE 1UWGH 2PTUA 3G6JE 3NK4A 3E1F1 4UM9D 4M8VA 5F3BA 2J5LC 3B7RL 4FS0A 4Q6IA 2NLJA 3HZYB 3DLQR 1HKFA 2YBRB 3HJEA 1JXFA 4HPYH 3VXSB 3IJ9A 2JI2A 2DBLL 3N42F 1CDYA 2W91A 2WHVA 1MAML 3QIUD 4L1HA 3GO1H 4N2LA 4ETYA 5DYOB 1XL4A 4DGVL 1NANI 4MQTB 2P8LA 2GTWA 1LWRA 3A4AA 5MEQA 3GXTA 4XPTL 5DLMH 2AK4A 3IFNL 4NC0B 1SVCP 1QFUH 3P0YH 4XPFH 3R1GH 4XP4H 4PY7B 3RGVC 4U0RC 1IVTA 1CMOA 3Q8EA 4OUOA 5C70A 1L6ZA 4OZHA 4WSJA 1Z3GH 1I7RB 3HG3A 2ENYA 3QBTB 3JV4A 2IGLA 1U3JA 4JRWA 4JFWA 3SY0B 1UT2A 1SDDB 1KNOA 2HFGL 2IANA 3MA9L 3QZWA 1HWGB 4LLAA 5D70L 4KOCA 1I8KA 3QDMA 1XVSA 1VKXA 3LKOA 4NNPH 2ITEA 1C08B 2K0RA 4LLDB 4TQPA 2J88L 5CHNB 1KJMB 3CN2A 2BY3A 2BFVH 1YNTF 4W4OC 5D1QB 2P24B 3MBEA 3RVVD 5EWIH 2DM3A 4XVJL 4LRIC 4L29A 5DWUL 5FF6B 1MEXL 5F1IA 3OBAA 5TQ0L 4X5RA 3I6GA 2CO7A 4YBHA 3BKJL 3DJZA 4WEMB 5F9AC 4NHUA 2X4PB 1TVHA 4A7GF 1PGRB 1T22B 1VSCA 1XZWA 3I3EA 4M6NL 1JF5A 4M93C 1I8IB 4R97B 4ODTH 4MVBD 3AT9A 4J5VA 4LSTL 2A74B 2Q8AL 5I71C 4G70B 1VFUA 4PJEB 2E9IA 3DMMC 4YO0B 5L2KB 4PY8J 1EWHA 4XNYL 3RU8H 4FI6A 2BCKB 4AIOA 5DUBA 4D9LH 1Z9SA 2J1WA 3UERA 1J5DA 1WEJH 2XV2A 1P84J 3WO4B 5F97E 5TE4H 4XNMB 3BH8A 4P07A 2X88A 5TE6H 2CO6A 4KKQA 1R5IB 1IBZA 3O4OC 4IRSB 1TR7A 4K55A 4LCIL 4XVUC 2IPKA 4P2QE 5IQOA 5E5LA 4TM9A 5EBLB 2IXQB 1UZGA 4FYQA 1JNLL 1URIA 4C8XA 2EDOA 4Z0BH 3OPZL 1UEYA 1DN2A 4H0GA 3MV7A 1GC1L 4G9DA 5K59F 4G42A 4HWBH 1KWKA 4FNTA 5T1LB 3MO1B 1OCRB 2Y6SD 4OCSL 2AC0A 1CC3A 1CD8A 4UM8B 1WEJL 2DWDA 4U4BA 4N8VG 4YHNA 3ZTNL 3I6LD 3K6OA 3Q2CA 4LCCA 4NQVB 4FQIL 2ENSA 3OKNA 4ETQB 3VJ6B 3UGXA 1W6LA 1XD1A 2KZBA 2OBGA 1YVLA 1NDMB 3G9VA 4QWWD 4G5ZH 3VQ1C 3NACL 4LSTH 4TUKH 1BZQK 1EZVY 4WI6A 3ZLQC 3MLXL 1WCBB 4M8RA 1Q4NX 4TUOA 3QRGH 3LKOB 5KYXA 1D9KB 2HWZL 4L8SB 5D1ZB 1ES0B 3DI3B 4PJEF 4HU8A 1PMYA 4JDZA 1NOFA 3BQUA 4I2XA 4LNVA 5KOVC 3MRBB 3W0WD 4TVUA 1YYLL 3U7WL 3F7YA 4JY4B 2G60L 4IMKC 5A2KH 4XVJH 5E8DH 3OJMB 1ZHBB 3DO7A 3EGXA 3IRZA 4YPGB 4MMYA 5E8EA 4E41B 5C0GB 1IGTA 1D7BA 1DFXA 4N2IA 2W95A 3N5AA 5D7JB 3GS0A 43CAB 1XXDC 3K71B 3CVHB 1FI8C 3FYIB 4XN7A 4PJ5A 3PDOA 1EO8H 4XN2A 3SE6A 4LSSL 1U93A 5DD3H 5IMKB 1DN0A 3FUNA 3QA3B 3C60A 3V10A 2YSSB 4P2QB 4C58B 5KSAB 1EGJL 1SDAB 1IGYA 2F15A 2HWZH 5KSVB 3QRGL 1NL0H 2P45B 4UT6H 4N6RB 3I50L 2P44B 4UILH 4DN4H 15C8L 1IUZA 2PWDA 3LKNA 4AV4A 1O6TA 1QFUL 4HBCL 4EO5A 4FJYA 2Z92B 1MREL 3QIUA 5EZIL 2CJUL 5JQHC 5KS9B 1UM6H 2VQTA 2JJWA 1TJGL 4FQIH 3BYYA 1MQKH 5D1QD 2CK0H 3GSNL 1R17A 1FH2A 4OUUB 1WISA 3FRPB 1GSMA 2DQDL 4NENB 1QAWA 3BI9X 2JKNA 4YIQB 2XKNA 5F7EL 5AEAA 5FYJE 1TF4A 1NIFA 3LH2L 4KKRA 4R0LC 4I2XE 1L0QA 2OKMA 3RGBA 2BOLA 4RWYH 1JNLH 1WRFA 1SFHA 2X1XR 4YHIB 5D71H 1BPLB 2WM0A 2P5WA 2ZYIA 2VSKB 2PP8A 2AXGA 2F5BL 3EO1A 3L3DA 2R2BB 2WZPA 5FHAL 1G5GA 4Y4KA 2YRBA 3HIZA 3K2UH 3ZYIA 2L7EA 3M88A 2HKHH 4D9QE 4HH9A 3FQRA 1A3RL 2H9GB 4HS8H 3CFBB 4JO2H 3GRGA 4XP1H 5AB1A 5D7IE 2JB6A 4YDVB 5E4EC 3Q5OA 3LMJH 2MQCA 3DX3A 5D7LB 3AITA 3L4TA 1EAPB 1OB0A 1HL5A 1KTKE 1Z9OA 4ZPVB 2P52A 5T1DH 2ZQKA 4ABWA 5C0CA 4ZAKD 4F7CA 3ZDZE 3CH8A 2HPOA 5GGTH 3O2VL 1MW3A 2JKLA 4WLCA 3LOWA 3C5ZA 5I1CL 2HLFD 3UFIA 1I7UB 5C0GA 2B15A 4OF6A 4X6FA 3ZE0E 1SY6A 4M29A 3S88H 4TQ8A 1HE7A 4AV0A 2Q7YA 4TF4A 4X8JB 3CVHA 1MLBA 1NGZA 4JRYD 5DEJA 4CGTA 4V2BA 4MYPA 4J1UB 3WLBA 4ZZFA 3V0AC 5DCCA 1WDAA 1W72L 3KS0H 3NP4A 1ADWA 3SO5A 3CHQA 2ZOLA 1S9WA 5B1JC 4HULB 1DCEA 4CVXA 4M7LT 1BQLH 5CEXA 3AACA 1I9RH 1JTTA 3VG0H 2AEIT 2LU3A 1UEMA 1N59B 4OAWB 1BQHB 4JG1H 2Y6TE 4PJCB 4KZEH 3BEVB 2HFGH 1NPUA 2BSSB 2WN2A 3ILDA 3QDMD 4PJDA 3OXSA 2X53A 1TZHB 2Y1ZA 3TNMB 1CGWA 4DPAX 5BMFL 3IDNA 2IV8A 4E9TA 2E9GA 3T2PA 4DVRH 3SB3A 1BZ7B 3P1VA 4PJ9D 3KGUA 4YLBA 3GMPB 3IFNH 4ZOEA 5LNEA 3C87A 1CIDA 2VMEA 3PWLA 1F11A 4RZKA 4UOW1 4ZAKC 3QWOB 4KTEH 1BF8A 5DLML 4PLOB 5F0PB 5E9DE 1A6TA 2OL3A 3FO1A 5CSZB 2YPLA 1BMZA 3CMGA 3WFBH 3N43B 5KSAC 3SPVB 3LDBC 2OX5A 4MTMA 3IDIB 5ADPH 5BRZA 5LXGL 2KL6A 3RWGA 5BS0A 4M6AA 2DBLH 3KPOB 1OTSD 2H3KA 1AZCA 2W92A 2VZSA 2ZYHA 1YAZA 1W2KT 2NW3A 1F90L 2PPEA 1YMHA 5DS2A 4E9VA 1XCTA 4KO6A 1JF1A 4ZMAT 4ZXBC 4K9EL 2A9ML 2DQHL 1QA9B 1BHGA 2HG5A 2Z0UA 3BWUC 5ABAA 2C3VA 1JXDA 1YO4A 3HZVB 1TU2B 3PQYE 4PJGA 1NC2B 3D3VE 1MHCB 3ME0A 3Q3GB 1T0NB 1ETZA 2VWEC 3UTSB 3X3GH 1J9RA 3QC6X 4HCRH 4L1SA 3CDGA 4MJ6A 5DD5L 3WKNA 2CQVA 1PIGA 2QPUA 4R8WL 4ZPVA 5I23A 2J1XA 3ULUL 4FQXA 3CZEA 2VMFA 3MR9A 4OGAD 4F7CB 4K5PA 1JGVH 4G8EA 2D0FA 4L0PB 2EYRB 5I18H 3F62A 3AQZA 3T3PE 1WFTA 3S5YA 3SQBA 4NO2A 3FNKA 4OFQA 3TESA 3APMA 3DJ9A 3FU3A 1OTTC 2I69A 3BVNA 1MAKA 4ZPTA 3BX7C 3OQ3B 1KFAH 3CZKA 1IAOA 3MRGA 3QPXH 5IJVB 32C2B 3LKPA 3PQYB 4LZKA 4FXGB 3BAEL 4JZJC 4KJYA 4U6YB 4Y2OA 5KJRL 3B9KC 2BNQE 1XXFC 2NY5L 2VN5A 3FAWA 4R0LA 5F96L 4O2EB 1DQJB 4PGEB 1QYGH 4FZEL 5L4FA 1K4DA 3BZFA 3IDJB 3VWKD 4WK2B 1GZHA 4ALAH 4NDMB 1Q9OB 3WFHA 4AY0A 1KJVB 3VFSA 1EX0A 5E5RB 5T8IA 4G9FA 1Z2KA 4CJ0A 4NQXB 2P8PA 1A14L 3FU6A 4U0QB 2OYPA 4JQVC 4OJYA 3RWCA 1FVDA 1SYSB 3HFMH 5EEWA 2HKFH 1IIKA 3FS9A 1SEBB 3KXFA 3WIHH 4V11A 1DEDA 4RGNE 4Y0GA 3ZN6A 1IU1A 2ADJB 3HZMB 5LGYA 4XNDA 1GOHA 2WXPA 3FO2A 1ETB1 4NBZB 4WEUD 5ESQB 4G82A 1UQSA 5EBGA 4BWTA 2C34A 1G7MA 1T7VA 3RVWD 1GXEA 4TKWA 5CMAB 2NY3C 4CNIA 1ZDSA 3ARGD 2HT4D 4FAAB 4GSRA 1SYVB 4OLVH 4NOBA 1XB3A 4QHUA 4JFYB 4LSRL 3GDBA 2RCSL 1IGFL 4Q6IB 3EOBB 3VG9B 5CCKL 5F7KC 4YSUA 2X7LA 5GS2H 1OGAB 4DZBA 2O5ZL 1T7XA 4HK0B 2B7DT 3VVWA 1U8OA 3SYOA 2OXGA 3QIWC 2HG5B 1QO3A 1E0OB 3WY1A 4NCDA 3G04A 4QRRE 1IM9D 3FSWA 4LVEA 2B1HL 3B3IB 5JO5B 3O8XD 1I8AA 3T0XA 4ERSL 2J5WA 1UENA 3JZ7A 4KRMB 2KPWA 4RGNC 4M03A 1IEHA 1JN6A 4TNVK 3D4GA 4M7LH 3ME0B 5D1QC 3SKNB 1QNIA 2FD6L 2M1KA 5FYJD 3GMLB 4ZUVA 3QQXA 1J8SA 1TKWB 2A9CA 4F7TB 3GINA 2IJ0C 4U2ZA 1I9EA 4K71B 3LPFA 1SMAA 4LU5L 3NTCH 1A7OH 1MCRA 4I87A 4LCVA 1E8XA 1ZY9A 4P2OC 5KUMA 43C9A 5DYFA 5CZXD 5IV2B 1D6EB 2YAQA 3FRPA 4Z3JA 5GGSB 3ULAB 3V0DA 3LTVA 3JWDL 3RA7H 3CFKB 3GM0A 1DLHA 3SJVD 2DKUA 1F02I 2E6JA 1GZQB 4MXQD 4K5MA 3JTBA 4OLEA 4DQOL 1GJWA 1FN4A 3CFIC 1XCXA 4PUBL 4YZFE 3BUQA 4GRMA 1U3HA 3PXJA 2V2TB 1XO8A 3CH1A 5IB4A 4A66A 3FT3B 3UYRH 2E9BA 3VA6A 1LO2H 1PKOA 2QGDA 3DMMD 2N59A 2R2EA 5JIIA 1T6WA 5A2LH 4L4VA 2CLRB 4E5XA 2IH1B 1E4WH 1K4DB 1GW6A 3T6XA 1UOWA 2N56A 2ICEA 2XUWA 5ACMA 4YBQC 1P7KA 2C9RA 3L8QA 3QRLA 4KQ0A 1QACA 4UAOC 4KTGA 2Q10A 2NY3D 3JSSA 1NEUA 1ZS8A 2JIXB 2YOCA 2R29A 2ZT9C 2AAVA 2UZYA 3DHMA 1UH2A 5JNYB 4GRLA 3FO9A 4DP9X 1PLBA 2APSA 3EHBD 3SGKC 3MOAL 4A7VA 2P4AB 3E8VA 2JWYA 4LLMA 4DEPC 4YHZL 3G6AB 1Z9SB 4JFDE 1KB3A 1NLBH 4Y5XA 1YY9C 4ZO7A 1P84K 1N5YH 3HKFA 2R4RL 1Z9LA 3QUML 5F6HJ 5L6YL 4P46C 4JO3L 4WY7H 3IDYB 2QADC 4OCXH 5CINH 4S1DD 1FFNA 1WD8A 2J1YA 3ZHFA 2EH7H 2X9ZA 3SKMB 4KZDL 3ELQA 5KJ7E 4PRHB 4EZMA 3WGVB 3FW6A 3N3EA 2VLRB 2ZNXA 3WS3A 3MGAA 2ROXA 3U30C 1CLYH 2I60L 2LAGB 3QEQB 1CWVA 1DL7H 3NFPA 5K9JH 3EZ8A 2Y7NA 4AK1A 1GAFH 1N10A 4J3OF 2GTZB 3SY6A 3ELAT 4YHLH 2OJ1A 2XN1A 3T6VA 3CLEH 4UT7L 3UG4A 3CE1A 2IQ9H 3FUJA 2DLTA 4A63A 3HS0A 3LKRA 2DQCL 4N2FA 3EUUA 1SXAA 1A6VL 2J43A 4QRAA 1FFQA 4LU5H 4PW9A 2WCSA 1TMCB 1OF0A 3P11H 1CE1H 3EDFA 2OR7A 2WXFA 1EO7A 2UZPA 5IMMA 3F6IA 3G9AB 5HGBB 4RISL 1YAIA 1D2PA 2Z7UA 2FD6H 3GMNA 2BS71 3G7TA 3UCQA 3O0LA 2HLAA 3FCSA 5LO7A 1RJZB 3CXHJ 4JFSA 1HH6B 4ERSH 4NM8H 2XWXA 1Y6MR 2LLNA 1U3HB 1JZIA 3H54A 3TC9A 1YEJH 4ZMLA 3TN0A 3MUGA 3U7YL 2YQ2A 4AIZB 1C5DA 3NIGE 4G3YH 4JKKA 2FX8L 3OKEB 3O3UN 2XJKA 3V0FA 5I17A 3OMNB 1LWJA 3EUDA 1H3UA 3S98A 1CXLA 2IH1A 2QQNH 4Z7OB 1MVYA 3AM8C 2R39A 4JKPH 1H8SA 1GY1A 4EUPA 2B9AA 4P3CL 2JI1A 1VIWA 2YPKA 3TM6A 5I73B 3MV11 2CALA 4H8QA 4AZ8B 1G7IB 4NI3A 5TDNA 3T4AC 3VFWB 3UTSE 1BSIA 2ARJQ 4MJHA 3I02A 3ZKXB 4MD5B 3SGDI 3UMNA 2GJ6A 2EDRA 2VZ1A 4AI7A 2BINA 3ZMNA 2D3JA 2ARJB 4HGWB 3HNVH 2DAVA 2EO9A 3VWJA 4YFLI 5AG9A 1IQDA 4LLMB 4RFOH 4JM0A 4F93B 4W9IC 2C9VA 1CDIA 4G8EB 5HYJE 2APFA 2QLVB 3GMQA 5GPRA 1CLOH 3QAZB 1UWXH 1NCDL 2C4FT 2R8SL 1MY5A 1QRND 2BNQD 2WKGA 3RNQA 4NKQB 6TAAA 5A7EA 3CFCH 2RAMA 1MRDL 4BH8A 3CMOH 2OMNA 4PWFA 2R69H 1RXLA 2Z6FA 4RVBA 2EYTB 3HZKB 3PWVB 1U30A 2JNZA 1ZJBA 3VTTA 1I7ZA 3QPXL 3B2PA 3QO0A 5EORL 5EMYA 5MEOA 5JQIB 3FOLA 3QZLA 1TITA 1AO7A 4KROC 5A43C 3QIBB 5MEQB 3TJEL 2Y7QA 1IBGL 4LSUH 4PRIB 4OQTH 3SDXF 2NNRA 4KK6D 1Z9NA 2FK9A 3L3DB 2CJSA 3SJVB 1NUFA 2HTLD 3QDGE 4DKFL 2IALA 3H4HA 5T5NF 4B9CA 4Y1AB 1M1XA 2V17H 1AQHA 4TTDC 1FVDB 3HC2A 4MJJA 2OZNA 5EU4B 1E90A 3VFUA 4L1BA 2F61A 4HEMA 4BBWA 1GTFA 4N8PA 2OTWA 5AW5B 5I8KL 3WJJA 5L9DL 4RRPA 4NQEB 4F7PA 4G1MB 3KH3A 4UIKL 3S36H 3FCTB 3NG5A 4NRXA 4E9LA 1RJZA 2WXNA 2E5EA 2DMCA 3EO0A 1L0PA 1YHPA 2X1QA 3ZDXE 4UINL 3FULA 1RMFH 4J2QA 2BVOB 3T77B 3US1A 1PKQB 4DP7X 1FNSL 5ESAA 2GQHA 4JFYA 4HISA 1MCOL 2QKIC 3BLPX 2A6KA 4PRIE 1QI3A 1X9UA 3JQOB 4EVNB 1AKPA 5KYYB 1ZPUA 1S9YB 1OK8A 3SKOB 1QLRB 3V5KB 5EUKB 4NHUB 3FU7B 5HYSG 2WLLA 1FBIH 4QYOB 3SOTA 1A0QL 2XIDA 2GUOA 5E2WL 2YA2A 3HG1D 2X4OB 3KPPA 5EB9A 3QDJA 1X5FA 2ID5A 3B3IA 5JO5A 4OGZA 1HS6A 1SOKA 3DHUA 2R23B 3BZDA 4Q9QL 1FYTB 4GLRH 2XN9D 1EANA 5DJAA 3TA3A 4M7ZB 4R4BA 3GMLA 3RJOA 4G8GD 3WOVA 2O5YL 1XSIA 4TSAH 1RURH 3SYQA 1UUNA 3K2IA 4PRID 5DHDA 1MFDH 5IVZB 4BKSC 4MA3B 1NUGA 2YMXL 3D25B 4LNRB 4BINA 4NQCE 4KROD 5EU6D 4HOMA 1KSRA 1HHJA 4HHWA 3RDTD 3JYCA 3KMDA 5CUSL 1U58B 1D7FA 3L7FA 5FO9B 1IO4C 4LVHC 4CMHC 5D96C 1PFOA 4XX1G 2VUOA 5EBLA 4OF5A 5CM1A 5BXFA 5EOQL 3VG9C 4U1LA 3FO1B 3NJGA 1OM3L 2FHBA 4TXVB 4HWNA 3GSNB 4K3HA 4BSWA 1NBZB 4KNUA 4MJ5A 5CJXC 5MP6L 3H3PH 2NY3B 2W88A 3EJQA 4PCTA 5JIQA 4NBYB 5C0EB 4XVSH 35C8L 1MI5B 5LKNA 3OKKA 1I1YB 1IB5A 4F58L 3GT6A 4FFTA 3BT2L 3NGBC 3DECA 1IV8A 4JB9L 2PYEB 4JPIB 1JF6A 4JRXD 3GSUA 2VERA 1J5IA 1I8LA 1LQSR 3D87B 4Y19A 5K39A 3TCLA 3UTQB 1PCXA 1HZHL 1E28B 1IC7H 2X2HA 4ONGL 3RWHB 1EZVX 4JUSA 3TCXA 2ESVA 3CU7A 3MCKA 2YD8A 2OMXA 4KUZL 3VFVB 3LMJL 4Q2ZA 5E5MA 2J25A 5KANG 1QSFA 4FCHA 2JTYA 4X5PA 1SXNA 1FV1B 2NNXA 5JW3L 1ZT4B 3TH4T 3LIZH 5DMKA 5I16B 1A6ZB 1P4BL 4IIQB 3N1MC 4GSQA 4EI6B 1T0PB 5L88L 2HZHA 3QEUB 5DJDA 5K59E 4NWTL 5H37H 3K6SB 2EYRA 2NLJB 3FTYA 3HZYA 3NEEA 2GSMB 5SWZE 5F7UA 5JPNB 4A37A 1IKNC 4FP8L 5E2UL 4ZUSB 5AW3B 1IGTB 3KM2A 2YPLD 1KBVA 3O11A 3V5HA 4CC4C 1JGLL 3O6ML 4R2GC 4B6ZA 3U79A 3RTQA 5DFVC 2C3WA 5ES4B 1DQDL 2XZAL 3GWJA 1OTUD 3F05A 3EDJA 1Q38A 2EZ0D 5IFHL 1F4YL 3MJ9A 4HLZG 2NDFA 3HC4L 1F4WH 3ROLB 1GVIA 4LDLB 2UY7A 2BIPA 3FUHA 3SDDD 4TPRH 4UIMA 3P54A 2XZZA 1DVFB 1F00I 4HXAH 4XPBL 4PJEE 4N2NA 4ODUA 4BFEA 1EAOA 1M7IB 2HJLB 2AXFB 1EFXD 3BP5A 2WQXA 5C0BA 3SY0A 4Z1PA 4G8IB 1E27B 2DB8A 3EBGA 3UAAA 3BPNC 5C92A 3VDBA 5C08E 1KLGA 3IXTA 3Q43A 3QDMB 3HUJE 4LLDA 2VXUL 2JELH 5E1IA 3U48A 1EXHA 1LEGA 3BKYH 4ZD3H 4WSGA 1A7QL 2X4NB 1PYWA 2R29H 1BBJB 2W5PA 4HX1A 3OKEA 4XHJD 2QSQA 4Q6KA 1DEEB 4B9IA 2YKKA 4B5EA 3GSNA 4BSWB 4Z7QB 4ZMOA 2VDOL 4X6EB 3HVNA 2NTFB 2VJXA 3QSKB 1MN4A 1YNLH 4WU5B 4NI6A 2X40A 1UD8A 4IMLA 1SLXA 1R9FA 4HK0A 5IQ9A 1GS7A 5C1MB 3SBWC 3PGFL 4IU2A 4OVVA 1L5GB 4BM7A 1NGQH 2HT4C 3GBDA 4HUVA 3BKYL 3CFBA 4F33A 2YPVA 2X1OA 1ZD6A 2A77L 1XIWA 3QULA 3F7VB 1AGDA 5DUBB 1GGIL 1J0YA 3PAYA 1CD0A 1BVNP 4JRXE 4FZ8L 3N55A 3SKNA 2H2SD 1EEZA 1UCBH 3NJLA 4M7JL 2UWEA 5A6LA 3ETTA 4JM4L 5AOJA 1HU8A 4QJ3B 5CBAA 1HYSD 3ZE2B 3UACA 4A38A 4XH2B 1FNGB 4RSYA 2VZ3A 2YRPA 3CSYB 4XPBH 1VZHA 3TT1H 1RSYA 5FM5M 3T3PB 3UJIH 1C5BH 1FYTD 3HAEH 4RH4A 5BNXD 2B14A 3LZFL 5CJ5A 3KM1A 4DGIH 2KLSA 5KG9B 3G08B 3QEQE 5GGSA 3T2OA 3VE0B 3VO0A 2G9HB 2A6DA 4B0MM 2WN3A 3OF6D 2R51A 3WEMA 1I9IL 1W8EA 1B0GB 4HA1A 1ML0A 2BPBA 1GC1H 3B9KD 3TBTA 5FDWB 2AV7A 2OJEB 1BWWA 3EYUL 4FTVB 4JLRB 4NUQA 5D1XB 3SCMB 3VUAA 2R56H 5ISZE 3QAQA 3LEYH 1HTYA 4HIPA 5E8PA 3TS8A 4HIHA 4ODXB 1GCYA 3ZHDA 3VJ6A 1MLCB 5AAWC 4PEEA 2COQA 1N7MH 1E8WA 2DWXA 4GUPA 3BD4A 3KNBA 1XGTB 1QUPA 2EDFA 2V9TA 1WZ1H 1KXTB 3DX9B 2ZKHH 2VYRE 3DX4A 2OSLA 3TJHC 5IGXL 4F7PB 3DC0A 3TZVD 2UX6A 4PJ8A 1UXWB 1NBYB 4YQXH 5BOPA 3MC0A 5EFIB 5KYXB 3CCHA 3CN0A 3LB6C 4MD0A 2XFXB 1A4JB 1R3IH 1IC7L 2X4NA 4K07A 5EO9B 3HC0B 1BIHA 3U4KA 4PJIF 4D3CL 4JB9H 4GI9A 5LUMA 2YXVA 4UU9B 5GGRA 2ITCA 4F20A 4MZ3A 4RRPG 1J48A 5LGJB 3ZX1A 4KHXH 5DEGB 4PG9A 3RVWC 4PJXA 1AYOA 2B0SH 4KY2A 5IREA 4HIEA 2Z93B 2DI9A 4WTZG 1OQOA 2EABA 1DQTA 4X6CB 5KSBA 4PB0H 4LPXA 3WFZA 4MQXD 1H0DB 5DVLA 2PWGA 3UEQA 3NFPB 4XPGH 3UBFA 4YNYB 1JD7A 4C55A 3IFOA 3RWFA 3SDAA 2E7LC 3BKCL 4NZRH 3IETA 4Q0XH 4RGNB 2ITDB 4NQQA 4TLUA 3MXVL 3UTSA 5HYSA 4PRDB 4TSBH 5HJ3A 3RNKB 2B08A 2IDQA 3SSGA 1CFMA 2I85A 3PUCA 4YHKL 1ZLSH 2Q87A 3K72A 3WMPA 1RIUH 5TH2B 1AS8A 1J5OL 1E3FA 4ZT1A 3WLWD 3WXWH 4JRYA 4M61B 4Y89A 4OLYL 3LJ3A 2VDRL 1B4LA 3QUYC 3TO4C 1MFEH 1OPGH 3WCYA 2WQRA 4HUMB 3REWB 3WHE0 3NAAH 5G4MA 5C09B 5IB5A 1A4BA 3C5XA 3RUGE 2GIYA 3NVQA 1HT6A 4PJAE 3GZPA 5IFAL 2CA3A 3HPJB 4J3OC 1C5DB 4FNLL 4WFFD 4FJZA 4BDVA 1CGSH 5IG7A 4OLXL 5KTEH 2R2BA 2NXYD 1DFBL 2NDGA 4W6XB 5L2JA 2EEFA 4WJKB 1P9MC 1R3LB 1QTYT 4MXWH 4PIRF 4K7FB 3NMEA 4L8SC 5D1ZC 1NAMH 2YZ1A 4LASL 2HLFC 3D7PA 4FFYH 3BZEA 4E0RA 4PS3A 5HY9A 4DVBB 4PRPE 3GS7A 3BO8A 1JYXA 3DOIA 3FO0H 2NX5B 3P9WB 4UIKH 5EC1A 3S36L 4WI0B 3OMAB 3QUKA 2F53E 4AEFA 1KGCE 2ZOKB 4KI5D 4ZXBD 4FG2A 4K8RL 5DD6A 5J6HA 4OZIB 1S9XB 4FXGC 3U4AA 5C0CB 2HVJA 4NKDB 1ZLUK 4JFHD 3H9SE 5GSRB 3W1ZA 4ADIA 3F6LA 2I9TA 4M9OA 3EYFB 1SOSA 2A9DA 4Z7UE 4F7KA 4D9RD 4ODSL 1WZKA 5EU6E 1CGYA 3HG5A 2EH8H 3L2LA 3LQMA 2FLBT 2JCWA 4JJHA 4NKIL 3TJEH 1IFHL 1WIOA 5AW0B 1E3ZA 3GIVB 4UNVA 2P5WE 3KVPA 3FFCE 4S2SB 3OKMB 1EMTH 5CJQH 4GXUM 5C07A 1Q72L 3L9BA 4LP5A 3TBWB 4ZFOA 4P46A 1WBXB 3HC3H 3FUMA 2Y2YA 3QVAA 1L7IH 2ZWYA 3BAWA 1NH6A 2AJVH 2DYPA 3BP7B 4N3TA 5B1JA 2LV4A 5FCUL 2ARWA 2X6VA 2IBZX 1NCDH 4OZFB 4MRBA 4EBQL 2PWFA 3BLKA 1DJSA 4ZFFB 5HJBA 1JJUA 5F7YC 5I1IH 5CZXC 5TH2A 4UQ2B 2IFGA 1EMTL 1H3PH 2FVNA 4R97C 3ETBF 5I30L 5JMOC 1QOKA 2ZX7A 3CLWA 3EF7A 3KL0A 4Y4HD 3LZQA 1PW3A 5ANMB 1LP9A 4H20H 1XR9A 2LT9A 2H1XA 3S35X 5AAMC 4PVMA 1KPRA 2OX5B 5D7HA 1DUZA 2F53A 1FZKA 3E2HC 4PGCB 2WQAA 4X6EA 4YEFA 4JKPL 1CTOA 1JUFB 4L0ZA 4P05A 1SEQH 5CZVL 2QSTA 1SPDA 2E8YA 3IJSA 1UKQA 4M7KL 5D7LD 2KC0A 3MROA 3HE7D 1L9TA 2ICEB 4JREB 5FO2A 2I5YL 3NCCB 2VDLB 3BXNB 3QJVB 1CFTB 1UYWL 3Q2VA 3FZUD 2C1PB 3I2CL 1RUQL 5I19L 1L9MA 3FYEB 4MXVF 4R4BB 1UJ3A 4D0CA 1R0AH 4X7TA 2VXTL 3DWTA 4MNGB 4IKIA 2JH2A 2X4SB 4U0RB 3WTSA 3L3OB 2MKWA 5I1EH 2WZ6A 4QXWA 2VLKB 3U0WH 3IJYB 4YSTA 4NO2B 5KG9A 1J1OL 2BNRD 2QTEA 2NY0D 1WQVT 3QYMA 2G9HA 4A04A 4ZPTB 8PAZA 1DUYB 5I8CB 4NHCH 1HNFA 1Q0YL 1IAOB 3L1OH 3MRGB 3H6AA 4I9WD 4M56A 4UF7C 4BUHA 1DL7L 1Q8MA 4U7KA 2OJEA 3ZW3A 1BOYA 1OAYH 3F58L 4P2RA 1X9LA 3WXWL 4MXQC 4C47A 1OGPA 4LLUB 2YPVL 4YUEL 4XP6L 4JFEA 5L0QC 2C3HA 4JY6A 2O6EA 2VWEE 1MI5E 1E4HA 4Z7VE 5F6IC 1G84A 2MPAL 3P3SA 1GIGH 3CFNA 5HGAB 3M1CA 4B3EA 2MQ3A 3QDHA 4QNPE 2PABA 2LFEA 4J4PD 1CCZA 1EJOL 2WIMA 3WXVH 1N5YL 1F8TH 3IU3B 4J28A 3SPJA 5GJSL 2EDLA 3PYCA 1CFQB 1JI2A 2WXQA 4JKLA 4KKLC 5I24A 2XLLA 3U2SA 1DBBL 4OIIH 1KCVL 5H4ZA 4R3SB 4TVSa 2NY4C 1A6AB 5IBUG 3LS5L 1A4JA 4AQEB 1DBBH 4J4PA 3ZXAC 2P9RA 3FO2B 2LFGA 5A6MA 1HESA 2VQ4A 3GJFB 1WT5C 2XVLA 1FV1A 3J8F7 4HJJH 3D18A 1EGJA 3DXAD 2FO1A 2WXHA 2FL5B 2VISB 1ZVNA 3GXMA 3SGJC 3QEUA 4GKZB 1NC4A 1GC1C 4PG9B 2CRIA 3KR3H 2A38A 4OCMC 1AIFA 4O9HL 4GG6B 2WBJA 1PJ9A 2D7TL 5J6SA 3AG2B 1YY9D 3I85A 3W2DH 1Z5LB 1JGEB 3LH9A 5CWSB 1KIUB 5C6TH 4HJ0D 2KQMA 1YJDH 4DGYH 5BJTA 2WWOA 1BFVL 3COOA 4MMZB 4D7PA 2PCFA 3VXTB 2OL3H 2R4SL 1J18A 1U21A 4WDIA 4WFHD 1CICC 5JHDE 1N18A 3WFCL 4K3EH 2BCKA 1ID2A 1TTRA 4IRJB 4GKOA 2VERN 1N70A 3EOAB 1YUHB 3NTCL 1UACL 1SHMA 3CNKA 4LLYB 4FA6A 4LCUB 1XF4B 4GKNB 4YX2H 3OKLB 3FT1A 2KMWA 2QGBA 1A4AA 1MFAL 5CXPA 5F0MB 2ZCLH 3TLRA 4RSVA 2PP7A 2RALA 1CS6A 3INUL 5HGGS 1U95B 5I1LB 3R06A 2B1HH 1N67A 3UP6A 4WI7A 1M57B 5EPMB 5C0JB 5F7DA 3S8GB 5EOCH 5AD0B 5E2TL 2OMZB 1AIZA 1WBZB 1NKOA 1ZSDA 4I18B 4MJ2A 1RFDL 5T3ZD 3X1EA 3OB8A 5J56B 1FJ1B 3ILQC 2WKLA 4MCYB 3U2IA 4K7FA 2OK0L 3PDGA 1A4KA 2NY4B 4A7QA 4WTWA 1SXCA 4LCCB 4B3VA 2EE2A 3LEXA 4ZW3A 5KSBF 1ZIAA 3NIGF 5GXBB 2J1ZA 3IB4A 1XH3A 5A2BA 4UDUA 1RZKL 4MQ7A 4U3XA 4GG8B 2CMRH 5SWQB 2UZYB 4OFIA 2YGNA 3KPSA 2ZP9A 3P02A 1H3PL 3RB5A 1T0MA 1BQ5A 5DUPL 1FAIH 2W9LA 3HFML 1MKFA 5D5ME 4XXWA 1JZDC 1A02N 5IESL 3EDEA 4NN5C 4WTQA 3VD7A 3G6AA 5IWLA 3X11A 1RIHL 4PSRA 3G5XB 2I9TB 3T09A 3N85L 1M7UA 1GMIA 3LSOB 4ZS7L 3GEWB 2WCPA 3WIAA 2AJVL 1SJVA 3ZYJA 3FOMB 3GQFA 1S7XB 1L7IL 2C26A 2YZ8A 1H3TA 2EC9U 3QPKA 1JPSH 3ARGC 3GMMB 4MS8C 1OOWA 4N8VA 3QWQB 1MCWW 2GT9A 4OCYH 4TNGA 4D0DB 4X8XA 1B6DA 1J5HA 5FGRA 2VXUH 2KI6A 5IBLD 1I1AC 1RZGB 3FB6A 4ZX5A 3FQ1A 2EC9T 3QDGD 1BJ8A 2CK2A 2HA1A 5IMKA 2Y7SA 1BX2B 5E6UB 2OYLA 3HE6C 5EA0L 5GZOD 2ZUXA 2VM9A 1FE8L 3CVIL 4ELMF 4M8UA 5BO1H 1ACYH 1AI1H 2XOTA 1EHKB 5KSVA 2W07A 5HVGB 3ZO0A 1AZVA 1SMDA 3CFEA 4H44C 5I6MA 4N6RA 5ENWB 4TPRL 5GRVK 5EF3A 4Y16C 5JPMB 1O9WA 2EE0A 3ZDXF 3L5XL 2OSWA 3RURA 4ADGA 1LMKA 2AABL 1DQIA 4M5YL 2BRRL 4HGMA 5JIHA 5AFAA 5JHDD 1KNOB 2IANB 3OR6A 3NRFA 3VFGH 5D1QE 3BN9C 2E75C 4N0UE 1CJYA 3FO0L 3FCSB 1OKEA 4P5RA 4HJGB 4HU2A 5GRJH 2FECL 2RIKA 3O6MH 4GUQA 4RRPM 2B9BA 3UP1A 3W11D 2IEPA 4Z3FA 1EJ6A 5MERB 5BZDB 3VRIA 2HTKD 3FT2B 3FN0L 5JR1L 4IOFC 3UBXI 4UU9A 1UURA 5E24E 1B0RB 2FH8A 5DVKA 3BVTA 4UYQA 3PJSA 3R7QA 4IEFA 3V6FA 3VI3A 1E50A 3KH4A 5JW3H 1QLFB 4GXVL 1AGBB 3BVXA 5BVPL 4HJUA 1V7NH 5IM7B 3VFWA 1JPEA 5JHLH 2QJDA 2AAAA 2DQFB 3SPHA 5EN2A 3T3MB 1DDHB 2XBDA 1OW0C 3K91A 4DP4X 3STZA 2WXRA 3B9DA 3KPSB 3GJFK 4BXSV 3IDMA 1CXIA 4RWHA 1M71A 4CW1A 3OLGA 4Y9GA 4IBZA 5ID0B 4LVOB 1QUNA 1KG0A 2XY1A 4PBXA 3IDGB 1AXSB 2JLLA 4KU1A 4U7MA 4XVSL 4DPBX 3Q01A 1UXMA 3MVSA 4QD2E 2CRMA 2NY2D 3EJCA 3KYMB 1T1YB 3Q5TA 3PL6D 4RAVB 5CIPA 4ELDA 3MXVH 4BGDA 5EEUA 4I9XA 2P3YA 3MRCA 3P30L 4EKJA 3VG0L 4DKEL 4DKDC 1BJMA 8CGTA 3MCLL 1OAZH 3MBEC 4JREC 5FA4A 3WFDL 2X10A 1UA6H 2V2XB 2BOCA 3B7SA 4R2GB 3TU6A 3M8OH 4D7BA 4LP8A 3QHZH 4JQIL 4KMQA 3LNIA 1B6UA 4HH8A 4G6ML 4PJ9C 4HG4K 1AXTH 2Y7QB 1E43A 1ZXKA 4TOYH 3QUZB 3MFGB 3TEWA 4OZFG 1INEL 4YHNB 4WKXA 4BWWA 5DVMA 2MOVA 4EDXB 4EJ1C 1BMWA 4KO9A 1MFDL 4ELKA 2LW3A 4GSDH 3EJYC 1MCBA 1IX2A 1FNEB 3MOBL 4Y4FA 2BNRA 1F41A 2DMKA 3P3TA 4FQ2H 4IKNA 5GGTL 3U9UB 5HPMB 1NDMA 4QHLA 3CFDB 4GO6B 3ILQD 1DJGA 4FG0A 2RGSA 3S37L 2BIHA 4PS7A 3QJHB 2Q7NA 3JV6A 1ZT1A 1K72A 1WCBA 4O02B 4L8DB 4PJBF 1S5IH 1U36A 1BZ7A 1LP9F 1BVOA 4NUJA 5LQBL 1C1EH 3WIHA 2L8AA 4URKA 1PG7X 4OZGB 2CG9X 2O26U 2H0EA 2OL3B 1R3HA 1VFBA 1TPXB 5HVFB 2LVCA 3LXUX 4B97A 5IIEA 4PGBB 1WUNT 2DH3A 1MHEB 1UZ6F 2YRLA 1EXGA 3DPBA 4ZO9A 1BVZA 4S1DC 1LHZA 4HKJB 1S8DA 1KYDA 4PV1C 3KYKH 3OAZH 2NTFA 4HV8A 1Z5LA 4E5XG 4LCWB 4R26H 3KPPB 2F5AH 4QJ5B 1FZMA 4GH7B 3QJUB 5IQ7H 4HFUL 3UPRA 4HWUA 3KLHD 1YQVL 4QRTB