3CSPA

Crystal structure of the dm2 mutant of myelin oligodendrocyte glycoprotein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
121
structure length
121
Chain Sequence
GQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDAEYQEEAAVELKVEDPFYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Myelin-oligodendrocyte glycoprotein
publication title Demyelinating myelin oligodendrocyte glycoprotein-specific autoantibody response is focused on one dominant conformational epitope region in rodents
pubmed rcsb
source organism Rattus norvegicus
total genus 33
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cspA00
1OD7A 5EZIL 1NUFA 3ORJA 1NUGA 5TDOB 5IOPA 4XCEA 4JDZA 1R3HA 4XPFH 1K3ZA 1QQDA 2OTPA 3MLTA 3NPZB 5GGRA 1KCRH 3E6HB 2H32A 3EBAA 1MHHB 4CL7A 5K59F 5HI3C 3WN5A 4P2RD 5TQ0L 5MEOB 1GHFL 3QRGH 3PV6A 2HVJA 3EOAB 1VESA 3LB6D 3MR9B 1SYVB 4HX1A 1CF8H 2DLTA 3WS6A 3QWOA 4HKJA 4DWHA 2L4OA 5MENE 2AJ3B 1ITBB 4NFCA 1OW0C 2JJTC 4UAOB 1VFUA 2VERN 1FGNH 5EIIB 2VDQL 3FB5A 1K8DB 4OZFA 5F7FA 5FO7A 1ZHBA 5D7SL 1CFSB 4QRRA 2DQTL 3QRFM 2ZUQC 3RIAF 1MAJA 4G6KL 1G84A 2ICCA 3F7YB 4XVTH 3ZO0A 3DIFB 4NFBA 1OARH 2ZJSL 2PYEA 5E6ZA 1I3RB 3UTZA 4NWUL 3KPQB 3TNMB 3IF1B 4FQXA 3K8LA 5FUOH 3KDMA 2Z31A 3LKQA 4X6CE 1UWEL 3MBEB 3DV4A 1ZEAH 1IBGL 1UXSA 2LAGB 5DA4A 4EXPX 3VXNA 3G5VB 1P1ZB 5I16B 2ADJB 4M3KB 3TYFA 1IC7L 3EHBC 4I77H 3C60C 4P5TA 3DSNA 1OPGH 5ESAA 3NIDE 1D5MB 3FFCD 4K71C 4AG4L 1D9KD 3C5JB 1GIGL 4OM0H 2CH8A 1X5HA 4R3SB 1WV7T 2DL9A 5HPMB 2VDRH 1XR9B 5I0ZA 2ZCLL 3IKKA 5D4QA 1QSZA 1PY9A 3G08B 2YC1B 3EO1A 3QNYB 2D7QA 1P6FA 3I6KB 4KMTL 3CD4A 2VAJA 3EDFA 4QTHA 4ZTPH 4HMDA 2Y23A 3LSOA 3MZTA 1OAUH 4YDLC 1ZKAA 2WSKA 3RP1A 2G2RB 3ARBD 4ZAKB 1NSNH 1WC7B 4I4WB 2E7LA 1A02N 4TSAL 4EQ2A 1XF3B 4JG1L 2DN7A 4GKNA 1UXWA 3HMWL 3QIUC 4LP5A 4P4KA 4OCWL 4AIOA 4LFHG 4X6EA 3NCCB 1WTGT 1E4KC 3MRDB 3U4EB 3OAZK 5F7MC 4DKEH 2FWOA 2WV3A 3MA7B 2V7NB 4KWUA 5EPMB 2M26A 5ANMA 3UTTD 5MEPB 4PV8B 1JZ3A 2OZ4L 3FB7A 1J87A 2GTZA 4MSWB 2YD8A 4JFFD 5I8KL 3VWKD 1XGPB 4JANA 4Q9RL 5IW1A 4N9GB 4HD9A 4R6UA 5H2BB 3VXQA 5AUMA 4RQQA 4BSWA 4HK0B 4F9LC 1UQSB 1QVOB 3QYCA 4HUKB 4JO1H 5D7LB 1ZVYA 4ZTOL 4HDIB 4TQEL 4XPAL 3FO0L 3MFFA 2YWZA 2J6EL 3HN3A 3LRSA 2XWTB 3RVTC 4ZO8A 2C4FT 3HZKB 4HMCA 3QFJD 3TBSA 3B5GA 4F7PA 1T2JA 5GS0H 3B3IB 3G5XA 2OR7A 4KVCL 2XKSA 3CU7A 1BZ7A 4PPTA 4JRXD 3VXPB 3IFNH 5CEYB 1F13A 1I7TA 3V2AR 2R4SH 3LEXB 5MP6H 3MCKB 3BYYA 2CKBA 2CRMA 4HWEH 1ZANL 2O5ZL 4BZ2H 3ARYA 1IMHC 4L8DA 2L0DA 5A40E 5L8KB 1R3IH 2IFGA 2OCFD 2YPVL 2AS5M 4XNXH 2F5AH 1EEYB 2EYTB 4CGTA 1GZQA 2X2YA 2DQUL 4ERSL 2F53E 1CGYA 4MAYA 4UV7L 5DD3L 3ZE2E 3DPBA 2LE9A 5EORH 2A2QT 1I8KA 1YDPB 1FE8L 4X83A 5E6YA 4H88L 2GTWB 4IRJB 4AK1A 3CXDH 4DK6A 2DQEH 3PDGA 4KI1A 5C3TA 4U0RC 2PTUA 3BXNA 4BKLA 1U6AL 1FZJA 4K7FB 4NQVB 2Q8AL 1DQML 3SDDC 4JPWH 1CCZA 1J05A 3KPSD 2DF3A 1AE6H 4XCCL 3EYVB 1OLLA 4NUGL 5T1LD 2BVOA 1K9TA 3QEUA 4XXCA 2BMKA 3I02B 2C3GA 1T1XA 2YMXH 3ARGA 3M1BB 1W8NA 1J1PL 3PWJB 4PJHA 1FPTH 4N0YL 4CDHA 5EU6A 1OTTD 1Q0YL 5DJ0B 1IQWH 3IETB 2GYSA 1I1AB 4KK9D 4R7DA 1HHIB 3BP5A 3KJ6L 5ISZA 1JGVL 4P3CL 5BV7H 2MOVA 35C8L 1WQVT 5JR1L 3P0YL 1DBBH 3U9UB 1Q9OA 4F7MB 4OCXL 3UAJD 4Z7NE 2QR0A 1NLDL 4E41E 1O0VA 2B4CC 5BS0E 2MQCA 4YXLL 1GAFL 1JZ4A 2X9XA 1WJ3A 1VGKB 1HILA 2W9EL 4PGBA 1UFUA 1TPXC 2ITCA 4GKZB 5F7EH 4OT1L 5I1CL 5I17B 4U1GC 4Y5VC 5IMKA 2OJEB 2CKNA 2LAAA 2G9HB 1YQVH 4LKCA 4LAQH 1BECA 1HXMA 5IVNA 4ONHA 1OB1A 1ODAA 1XGUB 3GSUB 5HHXH 1FLRH 4OZHA 3LV3A 4FQIL 4X6DB 4PRHD 1RD6A 3QIBB 5BMFH 5EU4B 5ESQA 4E0RA 2A83B 4MLSA 4RFNC 3JVGA 2EDKA 3QI9C 4N8VG 1XCTA 5DC9B 3SE3C 1T2QL 3BW9A 1BFOA 1KF9B 4LQFH 3S5LG 2V17L 3TA3C 5ID0A 2VDNL 3GSRA 4LPWA 2IMMA 1Z5LA 5GS1C 2ENSA 5F89B 1K8IB 3L7FA 3RTQD 2VSDA 4GAFB 2FL5B 2QSVA 3MACL 2EZ0D 1ACZA 1WZKA 4FFYH 3C6SB 5TGBB 3FONB 2GT9B 4L3AA 1BFVL 2BCKB 3QUYA 4YHPA 3KXFD 1NLBH 4P99A 1JGUH 1LE9A 2F5BL 4F15C 5CIPB 5E8DL 3LN9A 3IAGC 1OSZA 2DIAA 3HPLA 4JY5L 1EZVY 1YJDC 3WFCH 2BSED 2OX5A 5IFJA 2ESVA 1QACA 4CVZB 1JWMB 4Y4FD 1WT5C 4ELKB 1HYRC 4V2BA 3QHZH 3PV7A 4TN9A 4WCYH 4X7FC 4GW5B 3TN0A 1T6VN 3BMWA 2H6PA 5FOJA 1M7DB 2IQ9L 4K94C 5GIRB 3IXAB 1OP3K 3IU3B 1TZHB 5CS7A 4Z7WA 2ICWB 4PY8I 3U0PB 4NO3B 1F4XL 4MXVF 4RAHA 3VD4A 2Z93A 4HH9B 2B2XL 3WFHA 3PDOA 4MD5A 2IPTL 1FFPB 1CICB 2CKBL 3FB8A 5CJXA 2JE8A 5DD6A 4JKKA 1QRNB 5EU7C 1F8TL 3SKNA 5B3NA 4DKFL 5KVGL 3VCLB 4AM0B 2ID5A 3PQYB 5HGHB 1ZMYA 5B38G 4R7NB 2HG5B 2V7HB 1DBJL 3QDGB 1ETZA 1ZTXL 2H2SC 3D85B 5D1QC 3IJYB 4ZPVB 4OCRL 4M5ZL 5C70A 1DQDL 1YEDA 3TBTA 4OKVB 1F6AB 2P8LA 1H3XA 2R9HD 3WSQH 2VXSL 4KXZH 4HJ0D 5L0QC 1JL8A 3D39B 3FQRB 2Q3ZA 4IHOA 5DFTA 5A2LH 2FGWL 2VIRA 3E2HC 1AQKH 5MEND 3GSQA 3OG4B 2YBRB 1QO3B 1MCWM 2PYEE 3TZVB 4Z76B 1CLYH 4G7YH 1T80A 4WV1C 5M95B 4OIIH 1AY1H 4ISVA 4PFEA 4L8BB 3M8OL 4M6OL 3ARRA 4H5SB 1HHHB 3AMLA 2R2HA 3DBXB 1OD9A 1BJ1J 3BKJL 1CD8A 3CDFA 4G9FA 5CINH 5KN5B 4OQTH 3G04B 3PABB 1YYMH 1W72A 3DO7A 3O3AB 2AI0L 4ODUA 5ICXB 5HI4D 1A7NL 3NTCH 1JVKA 4X80H 1HHKB 4FS0A 4JHAH 3P73B 1B4JL 3B5TA 3EFFA 3WNNA 3G5ZA 1Q72L 3QJFA 2DLGA 3TIEB 2NYYD 4QWWD 3VFTA 1QR1B 3REWB 3O6MH 3OKOB 4C56A 5JORA 4OV5A 3TBYB 4MNHA 4AMKL 3EO9H 3HNTH 1H8SA 2R0KH 4NC2B 2VISA 4XH2A 4TULL 5GSVB 4ZMAT 1ES0B 1N2RA 5CCKL 4LSSL 4HULB 3L3DA 3R0NA 4XBGA 3DRQA 4B7LA 5GRUL 2HJFA 2CPCA 4Z7VF 4KJYB 5C08A 4ZNEA 5E2TL 4G6JL 4QF1A 4MQ7A 3BH8B 3T77B 1JF1A 1LDSA 3IDYB 1A1NA 5INDB 3M07A 4PJ9A 4X7DC 3Q6GL 4JN2A 3DVFA 1EGJH 4KJQC 1Z0NA 1NCDH 5EO9B 5ANME 3NABH 3BEWB 2DL2A 3M17A 4LCWB 1EX0A 3KPMB 2NW2A 1E27A 3MNZB 3B8YA 3QPQC 3T2OA 3MV8A 4QXGL 3BP4A 3MC0A 1OWRM 1F4HA 1VACA 3MODL 4X5XA 1EFXA 2AXHA 3SGEH 1NGYB 3A6OA 4OGYH 1HKLL 4QXTA 2A9MH 1A3QA 2BZDA 3H9ZA 4JN1L 1OT1A 1YEHL 1EA9C 1KXQE 3KLDA 4YPJA 3RX7A 3MO1B 1DEEA 4ZOAA 4HAFA 3C2AL 4B5EA 5JW3L 1LP9A 4MVBD 3SKMA 5AG9A 1WEJL 5IB5A 4ETYA 2VN7A 1CLOL 4LVOB 5IMMA 1VADA 1WBZB 4JKLA 1U58B 3CJJA 4YBQC 5E2WH 3U36A 3LY6A 4HKXA 1P7QA 5DJYA 3ELAT 1NBZA 2AK4B 1HNFA 2P4AB 1KLFA 1LK2B 1QBAA 4D0DA 5GRXG 5DT1H 5T1KA 5I0DA 4HS8L 3WUZA 3HUJF 4RGNB 4XC3L 3GMOA 2BJML 3LPFA 1BVKA 1RZKH 1TJIH 4S1DC 5I8CA 1R5VA 12E8L 1H5BC 5KVDL 4RDQG 1B6UA 5T33H 3ROLA 3RL1B 4M48L 4EN3D 2O61B 2VYRE 5LQBH 2XA8L 1QSVA 2YN5A 2EO9A 5D7JA 3TM6A 2FX9L 1KBGL 1JPTL 2NTFA 5GS2H 4XP5H 1UA6L 4LMQE 4UQ3A 3ARXA 4HUXB 4PJ7B 1KCSH 1W0WA 4L3CB 5FO9A 3RGVA 1WWWX 4NPYA 1TXKA 1YY9D 1T20A 4I18C 2FJHB 4PR5B 3RPKA 3WEXB 1CD1A 2F53D 4LOUC 3TBVA 5DYOA 5DO2C 1ED3B 2HKFH 1CFTA 3KPRE 3ZE0E 3RJDA 2Z0BA 1MPAH 2ATKB 4P23B 4PJHE 1YN7A 1Q94A 2OS7A 2CMRL 1ROWA 1X5LA 3V5DB 5EU6E 5EWIH 4F58L 4ZSOA 5FB8B 4HIJA 4Y5XA 5M94B 3BX7C 5C6WH 4NCC2 1LHZA 1M71A 4OGXH 5F6HI 2MCPL 3O3BB 3V5HB 5ISZE 4KROC 2ZUXA 5KSUB 3MUGB 3BIKA 1RHFA 1KJVB 2VWEE 4AEFA 4UU9A 5DJDB 3AREC 4XWGH 5DQJB 4QY8B 2VDKH 2H3NA 3MRMB 4OLZH 4U1NA 3N9GH 3DX7B 1P2CA 2IALB 1YNKL 2UZXB 4U6VL 4ZD3L 1IZJA 3LEVH 4NM8L 5MEOA 3K8MA 3ARDD 3HE7D 4DQOL 3CSYB 1EXUB 2QL1A 4KI5F 4WFHE 5LBSH 3S7GA 4Z9KB 4LCUB 4R97B 1I9RL 1DDHB 1SYVA 3IDMB 4RRPA 3SDCD 1NGQH 1W72L 1RMFL 4G3YL 4CNIA 3RWGA 2KPNA 4XWOC 2GIYA 2AJ3A 3RZCC 2ARJA 4OGZA 4D3CH 3MOAH 5FGBC 2JB5L 1FNSH 5KZCD 4RA0C 1TJHL 2VDPH 4HC1A 1KJ3L 5EIIA 2WIMA 4P59L 4MA1C 1K8DA 2LVCA 3DI2B 4E41D 4X5WB 4M8QB 5BS0D 3NIDF 1CFSA 3O6LL 4M7ZC 5C86A 4V1DB 5CSBA 1CQKA 1IGMH 1X5GA 1A5FH 43CAB 5DK0B 5HY9B 5GRWA 1AD0B 3DIFA 2PXYD 4JO4H 3S3PA 5GSRA 2OK0L 1I3RA 1QP1A 4H20L 2V9TA 1TJGH 3KPQA 5C0GB 2X89A 2P5WA 1UB6B 2PO6C 4U3XA 1KSRA 1U3HD 1X5XA 1W0VB 3MBEA 1HXYB 3HTLX 3MXWH 4KAQL 3LAFA 3RWHB 4O5LH 4PGJA 1P1ZA 2BOCB 2ATPA 1OAZH 3OKLA 4WVRA 3GMNB 4JREB 3VJ6A 2OJZH 2H1PH 1A14L 4I0PB 2B4CH 3RWIA 1D5MA 4K23L 1MCPL 1AHWB 4M93B 3NZ8B 4YK4C 4N5EC 4P9ML 4LCIL 3MOQA 1FH5H 1E6JL 1A6PA 5HPMA 5F3BB 1EBAA 1XR9A 3C6LC 3FCTB 5GJTH 2ESVE 4XPBL 3W82A 2ITDA 1KN4H 1KTRL 3H7BB 3OB8A 3QNYA 3QB7C 4S0TD 4NIKB 1T0PB 1CD9B 5IFHH 1IEHA 3DARA 4UV4L 1UH3A 3INUL 4MZ2A 2G2RA 2UVFA 1UGNA 4Z7WE 1TCMA 1WC7A 2QADD 4I4WA 3K74B 1QBLH 2E6QA 5E95B 4L4VE 4JG0L 4XHJD 3UMTA 4MAUH 5K9QG 2QJDA 1VEMA 3MRDA 1VGEL 3QNZB 2V7NA 5EPMA 5MEPA 4PV8A 3BYTA 3BSZH 4GRLC 2FIKB 1HOCB 4GW1B 3B9DA 2WBJC 2FYYB 3GSNH 4OUUB 4H25A 4MSWA 1D5XB 2EDBA 4GS7B 5K9OB 2FJGB 4JFZH 3O2WL 2Q1EA 5KSBF 5I1EL 5H2BA 3VFUB 1CDYA 3AS2A 4HK0A 2W38A 3PXHA 2ERJC 1CE6B 1UQSA 3QEGH 1QVOA 3MRCB 4NO2B 5D7LA 4HDIA 4PP1C 3ZE2F 1B2WH 4PJ8A 3EOBA 4M03A 2VC2H 2UZIH 1FL6A 3DMMB 2XWTA 4X5LA 3HZKA 1YJDH 3WUWG 5EOQH 4HUUB 5E99H 3QZWG 1J1OH 3B3IA 2WIIB 2NQCA 4PJAB 4K8RC 4GXUM 1IC4L 3QDMA 4FFWC 3VXPA 1OQXA 1GGIL 1S9VB 3LEXA 4PLJC 3MBXL 3MCKA 4QRRD 5I1LB 2O5XL 4G9FE 2IBGA 1MRDL 3MLVH 5EO0B 1LGVA 4K94H 2KKQA 2OI9C 4QRTB 4HIXH 3E3QC 3WD5L 5FGCB 4TSBL 2GW5A 3P30L 1BVLA 5JHLL 4N1CA 2PYED 2EYTA 3PWUA 2HKHL 4GQPH 3E6FB 3HZYB 4JGUA 4WWKC 4NT6B 2W0FA 2VO5A 3V6FB 3FQWB 4FQXD 4XBEH 5CSZA 3F65A 2Z31D 4ODXB 2VR5A 4C56E 5J13B 2GTWA 1HHGB 4LBEB 4YHNA 4XI5C 1TLKA 4P5TD 5CGMA 3C5ZB 4Z7NF 4K7FA 4NQVA 1AFVH 5E1HB 2AK1H 1R0AH 3HI6L 2Q7NA 5C08E 3S36X 2GKIA 2CO6B 1PYWB 4ZNEE 2NY2B 3A6CL 2DRUA 2KQMA 2HJLB 1AI1H 3BJLA 2I24N 5TQ2L 2P8PB 3LS4L 4NQXB 1XZ0A 4LSVH 4WUKL 3U7YH 1RULH 5CGYD 1INEL 1KIUA 5BXFB 4HC1L 3PL6B 3PWJA 3VG0L 2NY0D 4IOIB 2V9RA 4X4YB 3U30C 1GGBH 4KK6D 3IETA 2IQAA 2P1YA 4HAGA 4Z8FH 1I1AA 3NBNA 2QQNH 1RZ7H 4TOYH 3RFZC 5L2JA 3IAQA 1G7LB 4LQ1A 5I75C 5AYQA 1UM5L 4LAJH 3TO4B 3U9UA 1FN4A 1RUAL 2K3TA 4F7MA 4P4KD 1T1WB 1BAFL 3MJ9H 4UTBH 2V5RA 1KENL 3AS3A 1R24A 4YFDB 5HJ3B 4XGZB 2IANB 4EIGB 1UH2A 3NCJL 1DVFB 4GKZA 3RL2B 2QQQA 1J12A 3H9SA 1LP9E 4HW6A 2OJEA 3R0MA 3W9EB 1KIQB 4RWYL 1BWWA 3QHFH 5A2KH 1F2XK 4TVPH 5HDBF 1EUTA 1QRKA 1XGUA 4YDIH 5DD1H 1IC1A 1WAAA 4X6DA 1FFOA 4FQHA 3ZYOA 4NCC1 1A7PH 3BJ91 1HWGB 4TYUA 2WLYA 4NQSB 2A83A 3QR2A 5FYKL 1V3LA 2XRAL 3MYZA 4I3SH 2Q8BL 1L0XA 2ICWJ 4OLVL 4JFQB 5HDQL 1JN6B 3DNKA 5DD0L 4LLWB 5F89A 3ZKXB 1K8IA 4OQ1A 2FL5A 2F74B 2G5BA 3HC0A 5FA3B 2NZ9D 5JXEA 1AXIB 5TGBA 5KANI 2D03H 3FONA 2UZYB 5EUKA 1FL3B 3SPVB 1KPVA 4MAYD 4PP2B 4YLQT 1FAIL 3UC0H 4FP8L 3P9MB 5FUCC 5CIPA 1J1XL 1TZIA 4DGIH 4K07A 3D69B 5IQ7H 4EDWL 1OGAB 4M6MH 3QULB 4LRNL 1R3JA 4ZSOE 4IDLA 4WTZA 1HNGA 1JWMA 4KKLD 4ELKA 1CR9L 3T3PE 5FUZH 1QFPA 4P2OB 5C3LD 4XB7A 4GW5A 1FVCB 3MRGB 1M7DA 5HDLA 4QYOB 3VI4F 3BEVB 3KPRD 3IXAA 5EZOL 3IU3A 1AGCA 1T4KB 3U0PA 4NO3A 3ARGD 3BP7B 1KTDB 1JZ6A 5GGQL 2AEQL 4ZFOB 1MREL 5EZJB 1HH9B 5EU6D 1CL7H 4ZFGL 1T7YA 1CICA 3OAUL 3WNMA 3AFLA 3LB6C 1YA5A 3MLZL 5IWLC 5ISZD 1MWAH 3R8BB 1P4BL 4MX7B 1QRNA 3N1FC 3QXWA 5F71A 5A2JH 3VCLA 2VZVA 4AM0A 2HT3D 4R7NA 2V7HA 3QDGA 3D85A 3RNQB 3VG9B 5I19L 2FZ3A 4ZPVA 5TJWK 4APQB 4GG6A 4JDVB 4XMKH 3VE0B 4OTXH 1DBKH 4OLWH 1YUHB 1IJ9A 4POZD 3SO3B 4YDJA 3VRLE 2ICEA 4WFHD 4ZODA 5ALCH 4FQPA 1I8IA 3W5MA 1I9JL 3LS5L 3SDAB 4KDVA 4LLYB 3D39A 4D94A 3FQRA 3KR3L 4O58H 2D0HA 5C0EB 2BNRB 3DROB 1MJJB 4Z76A 3I50H 3NCMA 1RIHH 1FIEA 1AR1D 2IBZY 2P5WE 4H5SA 4N8PA 1HHHA 3RZWA 1K85A 4MB3A 5KN5A 1Z9SA 3PABA 4CU6A 3CDGB 3O3AA 4WU7B 3LEYL 4XNYL 1RZGB 1S5HB 1J0JA 1KIPB 1HHKA 3LIZH 1MRFL 4L3EE 3FL7A 2B1AL 4P49A 1GCFA 1D9KC 1QR1A 2MWCA 3TIEA 3UBXG 3B9AA 3REWA 5KBNC 4CADB 1F4YH 5DUMH 3DUUA 3OKOA 1MIML 2VLLB 1JYVA 4N8VB 2OR9H 4OCYH 4PJFB 4YX2L 2AJXH 5C9JA 5DR5L 2JCCF 2APWA 1I7RA 4YQXH 1A21A 3LOWA 5GSVA 4CKVX 1P84K 3CFCL 5DC4B 3S5LB 4M62H 4PRBB 1KEMH 2E8YA 3HMXL 5IF0B 1CZ8L 4X4MA 3S96B 2VLRB 3QAZC 5JQ6L 3QUYD 4JO3L 3B8SA 3CVHB 4KJYA 3ARBC 3LPGA 1PVHA 1UKTA 4ODSL 2BDNL 4ZUWB 2X9WA 1WWBX 1OF2B 3KLSA 3T0VA 4OD2A 2ESVD 5INDA 5TE4L 4NHCH 4DOHB 3P4MB 3DX6B 3TWCH 5C2BL 3TN0D 3BEWA 1VA9A 3F7QA 3KPMA 5D72L 1CFVL 4XP6L 3SDYH 3MNZA 2J1KA 3GKWH 1J0ZA 4JPVH 5HGGS 3AM8A 3P2TA 4ZUSB 3BT2H 3AXLA 3VWKC 1VFOA 5B3JE 4HHAB 3S35H 4M7LT 4FNLH 1YEGL 1T04B 1NGYA 1FIGH 5D7LE 3TPUA 2ED9A 4WO4D 2PW1A 2FEEL 4LCCB 5IBLD 4TPRH 3QSKB 5I1JL 3EOTL 1NFDB 4NQUA 3VXMB 4UBDD 2FHFA 3LH2L 2CDEB 5DD5L 3QDME 1WBZA 4LASL 4KTDH 1SBSL 3QIWD 4CMMB 4DUXA 3WNLA 5D2NB 2VDOL 4HBCH 4PBVC 4NC1E 1O7SA 2AK4A 4UUJA 1RIUL 1LK2A 4MQXD 3ZE0F 1A2YB 5B38B 3AU1A 3C87A 4UILH 1D6VH 2VLJA 1S8DB 4NN7B 3Q5YA 2NX5A 4S2SB 4PJHF 1PX4A 3S4SG 3W11D 3LQAL 4NN5B 1BF8A 3C09C 2XY1A 4FABL 4HFUL 3GIZH 3BZEA 4G7VH 1I3GH 3SE4A 4PJIB 3RL1A 2O61A 2DQFB 4G9FD 3MGTA 4NZUL 1GC1C 1UYWL 3NH7H 3O8XB 4Y1AA 5KOMC 3IFLH 4HUXA 4KU1A 4M61B 4L3CA 4PJ7A 4RX4A 4Y4KB 3RUGB 3DECA 4Y8DC 1LO4H 3WEXA 2DM4A 2FJHA 4PR5A 4E42A 3P4NB 4NNPL 3MRKB 4RMVA 2XWBB 3ZDXF 2DQIH 1I85A 1NBVL 1HKFA 4L4TB 3O2DA 4ELMB 4W6YB 4C56D 2ATKA 5E8NB 1F6FB 4JHWL 3W9DB 3O45B 3VXSE 3GMMB 3V5DA 4Z77B 3UTQB 2D4DA 1J5OH 1EAPB 5FB8A 1OTTC 2X1QA 3WHE0 4KK9C 3V5HA 5KSUA 1VEOA 4PRDB 5C08D 1KJVA 4ODWA 5DJDA 5LJYH 4QY8A 5E8OB 2MPAH 3DX7A 4PJCE 3UAJC 4PJ9D 1YMMB 1RJCA 3IAPA 3CUPB 2CJUH 4XPGH 4F7CA 1EXUA 3I75B 4U1MA 2Y36H 2QSQA 3B9KB 2H8PB 2YRZA 1JMZA 1DDHA 3L3OB 3IDMA 4QTIL 3SBWC 3H9SE 1N8ZA 1M71B 3HG1A 1WIUA 4QRUB 5GQBA 4Z0BL 1WBXB 5CJ8A 3M45A 1EFXD 2CRIA 4X5WA 3QQ4B 4M8QA 1WAAE 4X6DE 3ZT5A 2B8OT 1MFCL 5F9WB 1RVFL 4M7LL 4V1DA 2X1XR 3U9PL 4HUMB 5C1MB 1H3UA 2KZWA 4NJAL 1RJYB 1K3IA 5C0BE 43CAA 5IFAH 5HY9A 1AD0A 3WYRA 1XIWA 3SE8L 1A3LH 2EH8H 5E7FA 5J1AA 2GJ6A 4YJZL 2ADFL 4OSUL 5C0GA 5BVPH 1P7QD 3LMJH 1W0VA 3RTQC 4ZXBB 5T1KD 2EDLA 4R96A 4Z7WF 2DKSA 2BOCA 2EZ0C 1ZS8A 4QHUA 3U48A 3CXHJ 3GMNA 3QHTC 4FMKA 4NQEB 4X7EC 2OLDA 4I0PA 4U31A 5B22A 5I9QB 1AHWA 3FN3A 3NZ8A 4KHXL 4J23A 4JZNB 1MQKL 5D7JD 5F3BA 1Z9MA 2NY6D 5F1KC 3S34H 4I0CC 1CGTA 3CFDB 5EA0H 3RGVD 2VKWA 3T0BA 3QWRA 4Y4FC 2XFXA 4Z5RB 4YPGA 3VFOB 4GXVL 5E2UL 2GITB 4MD4B 4DUWA 2FDBP 3HB3D 3MRJA 2APVA 5E2VL 3F12B 4IJ3C 1KC5L 3OKMB 4EOWL 1LEGB 2DYPB 3RAJL 3GK8H 1ITCA 3IU4L 3GUTB 2B5IC 2FIKA 1PG7L 1T0NA 1TCRB 4GW1A 5MI0C 3VA6A 3WKNA 2FYYA 1FBIH 4OUUA 5CLWA 5K9OA 3D2UA 1N64H 4GG6E 5I8EB 1FNEB 3UX9B 5ADPH 1KELH 4LLUB 3VFUA 4PS4H 1CE6A 4ZYKB 4NO2A 1IM3B 5DJ6B 1INQB 2R9HC 4Y89A 3BDYH 5BW7C 1NUDA 5C0CB 4HJ0C 2A1WL 4JO2L 2D7TL 4FMFA 4LPUA 5LKNA 1FLTX 4F37K 3D39E 3DMMA 4OFDA 2B20A 3KPOB 4NUJB 4HUUA 3X11A 3ARFB 5BV7B 3WFDH 1J0KA 1JZ5A 4R0LC 5IB4A 5AWNH 4U1SA 1VPOL 4ZUUA 3UZVB 2DKUA 2NY7H 5I1LA 4CN4A 1A1OA 2AJSL 1G0XA 1MF2H 4QRTA 3EYOB 4GBXD 5HI4C 3V4UL 3I2CL 3I84A 5FECA 1C5BL 3CCHB 3E6FA 5DJ8A 4NGHH 2P49B 4JM2F 4V2CB 2X89D 3I9GH 2P5WD 3V6FA 3FQWA 5ELIA 2NYYC 4QWWC 4BQBA 4ODXA 1Y18B 2A6KB 3MBED 3T3ME 1JYNA 1HEZB 2C26A 1G6RH 4CVUA 1HHGA 1QFWL 5D96B 3WBDA 4LBEA 5HYSG 5B8CB 4X4ME 3R1GH 4L3ED 2AEIT 1PYWA 4DN3H 4ONOA 4IBLT 1V8HA 2HJLA 2IAMB 5L6YH 3HNSH 5JIPA 1IKFL 3N85H 1LP9F 4XNZC 5CILH 2ORBH 2J88H 5BXFA 4D9LH 1U8KB 1WCBA 4IOIA 3QXAB 2DMKA 1L6XA 4U05A 1JRHL 2CGRH 1FRGL 4FQCH 4UQ2B 3KHQA 3IDGA 1G7LA 1VHPA 4KKBD 5AZEL 4N8CL 4WTWA 3V6OA 4NO5B 3V0VA 4AENB 2IBBA 3NCBB 2YPKB 3L3IB 1BM3L 2FEDD 2I60L 1T1WA 2B1HL 4X98B 1KB5H 4M5YH 4L29B 3L9RA 1JHTB 5DZLA 1ZA3A 4GMSL 2EH7L 4ODVL 4XGZA 1JPST 2IANA 3IVKA 2YA2A 4MDIA 2KL6A 1DVFA 5J12B 5IB1A 1LK3H 1D5ZB 3RL2A 1ZT7A 2W60B 5KJRL 4MVBC 4LP4A 3WIHH 1BQLL 4MNQA 1KIQA 1MUJA 3V5KB 4MJ5B 1Q1JL 5H35B 2CR3A 2I27N 3H7LA 4LGRB 2PTTA 4HWZB 3CGTA 3RY5A 4RFOH 1NAMH 2DMCA 4JZJC 1D5IL 4P57A 5D7LD 2EIEA 3UXFA 1AO7B 4DVRL 4K9EL 1UM4H 2AK4E 3MV9B 4PJ8D 4GQ9H 3T0EB 3S88H 5D5MB 3LVEA 4QXUL 2VLJE 4RGNE 2NX5E 1MHPL 4C54A 4Y19A 3HE6B 4P2CG 3FHAA 2E7BA 3IS1X 3QDMD 5I15L 3VFRB 3T4YA 2V9QA 1FC2D 1JN6A 3T3PF 4L8CB 4F33B 4XRCA 1CXLA 1F58H 4OLYL 4P5MB 4YWGL 5SWZA 4EN3C 2GK0B 5CBAB 4LLWA 4Z78B 4WI9A 3D5OF 4IRZL 4Y1AE 3EJZD 3QQ3B 3WUWB 3RA7H 3U0WL 4R4BB 1ZVHA 3QZWB 4NNYB 3KS0J 5C6TH 3GMRB 1L7IL 5DZNA 1B9ZA 3P40A 1YY9C 2BRRH 3LDBB 4WFGE 5FM5M 3T2PA 2FX7L 1FL3A 2XT1B 4Q0XH 5EDXA 4LGPB 3RI5K 2VL5B 2R69L 5C07E 1CN4A 3RWFA 3P9MA 3BKCH 1YMHB 4N68A 3ALWA 4JFEB 1QR4A 1A7BA 3D69A 3TIDB 1OGAA 4HLJA 1XF2B 3TJEL 4Y5YA 4X6FB 4DGYL 4LSPL 1RZ8B 3REVA 3T65B 5E1AA 3BHBB 1MJUH 4WTXA 1TQCC 5TDPA 3CX2A 3MJ7A 3VD7A 4K55A 1FVCA 3VRLF 4XZUB 1GOGA 2YEZB 1RUMH 3BEVA 4BH7B 1MSPA 1T4KA 4Y16A 3SGDI 3GHEL 4G6ML 1U36A 4PJ5E 5LWYH 3BP7A 3VW3H 3BPOC 4ZFOA 4O2EB 5EZJA 3WNOA 1J86A 5E9DB 3B6SB 5D1ZA 3ARDC 3HE7C 4IMKA 4KV5F 1I1AD 2WQRA 5J8OA 3ECBB 2X4SB 3QG7H 1T6WA 1AGBB 3LN5B 4O2FA 3SDCC 3HG1E 3F8UB 3RGHA 3BAEL 3LCYA 2DQHH 2ZUQB 1VENA 5IQ9B 1NEZA 4PRNA 3RNQA 4WDIA 3J8F7 3IS0X 5AAMA 3VE0A 3OR7B 1IGFH 1EEUA 3HZMB 1YUHA 4V1DE 5FF6B 1MFBH 1CGVA 3H9SD 3BPLC 1G9NH 3L5WA 1JGDA 3OX8B 4GKOA 4LLYA 4XVJH 3BUTA 1JPSL 1EMTL 2YZ1A 3FO9A 5C0EA 2PXYC 2BNRA 3DROA 1MJJA 2GJ6E 2AKRA 3EYUH 4K2UL 4YHOH 3FTGA 2QSCL 3C60B 3JTTB 5DVMA 4DW2H 2R0LH 1LVEA 1U3HC 1QG3A 5DEGA 4GAJL 5DK2B 3HZVB 3CDGA 4OGAD 4WU7A 5C0BD 1KIPA 2OR8A 4JFXB 5EBWB 3THML 5GGTH 1CI5A 2MCG1 3MV01 2AJYL 1IAOB 1KTKE 5H94B 1NCNA 1WCQA 2NY5C 4CADA 1YPZE 2LABA 3RIAK 4MGXA 3HRZB 1V7MH 1PW3A 2VR4A 4RAUA 5JXED 2VSCA 5FDWA 3TV3H 4WI7A 2YKLL 1FNLA 4PRBA 1NC2B 1TQBC 5JA9A 1JWUA 1ZT4B 3O4LB 3QIUB 4HZLA 5SX4I 4LVEA 4LRIC 4XVSL 5E00A 3MRQB 4WFEE 4XVUD 3CVHA 1G9ML 1T03L 2ZSWA 3V52H 1A7RH 3WLWD 1B0WA 2QADC 5E94B 2EIDA 1QLFB 1ACYH 2BVYA 4ZUWA 1M6OA 2EDHA 5DJAB 4OLXL 5J56B 1UWGH 3FB6B 4XHJC 1NGPL 4R90L 1NMBL 5TF1L 3DGGA 1RUQL 3NA9L 3P4MA 3DX6A 5DWUL 4YXHL 1P7HL 4WEBH 3ZYIA 5EULV 3FOLB 5IGXL 5D71H 2BHYA 1RK0B 1AXTH 1XEDA 1I4FA 1HQRB 4NKQB 1H8NA 3V8OA 5E4EB 5CEZL 1IGJB 2G5RA 4ZUSA 3FQTB 3A67H 4HHAA 3LN4B 3WN5C 4JJ5A 1BD2E 1TETH 4GKSA 2HRPH 3V95A 1T04A 3QCTH 4OAWB 3U7WH 1Q9KB 4PUBL 5F7HA 5F9JA 1SEQL 1U91A 3ZKSD 2FD6H 4XAWH 4PLNC 3WS6C 3ZDYF 1GGTA 4LCCA 5I1DB 5JNYB 2NXYD 2HVKA 4BM7A 3I6GB 3QDGD 3D85D 3MROB 4QGTA 3CFEB 4KFZC 1G7MB 1CU4L 1PLGH 5DUBB 4LEXH 2CDEA 2ZWLT 4X8JA 3EIFA 5J11C 1IQDB 4CMMA 1I1YB 4KHTH 5D2NA 4B7IA 4YH6A 3D9AL 4ODHH 5FHBH 1KFAL 5FGCE 4OM1H 1A2YA 5B38A 3D39D 4U1LB 1F3JA 4XC1L 3HC4H 2DTML 4S2SA 5GZND 4YDKL 3U83A 2VITA 2VUYA 4ZFZB 1WWCA 3IYLW 4PRIA 5HYIA 1KCUL 2N1KA 1UADC 2VR9A 2JIXB 5HHVH 1VFBB 5I66B 4NNXB 4FQXC 5HGDA 2Z31C 2QLVB 3SDDB 3WXWH 4F7TB 4WW1B 1MCSA 1R3KB 5IG7B 2YK1L 1RZJH 3O8XA 4QT5B 4ZFOL 3QDAA 1CG9A 4PJCF 3QCVH 4P5TC 4F2MA 2VXTL 4ZNCD 4Y4KA 3X12A 4RGMB 3WO4B 1JFQH 3P11L 1X44A 1L4IA 3FN0L 1X3DA 3P4NA 1JUFB 3MRKA 4U6HB 2B39A 3MQIA 4XP9L 3WKMH 1KOAA 2XWBA 3NIGE 3QPXH 5GRJL 4L4TA 1N6QL 3UEZA 3UJIH 5E8NA 3HC3H 3W9DA 4JFOB 1UACL 1BBJB 4JQXA 5CGYC 3V6ZB 4YUEL 3O45A 3GMMA 4Z77A 3RQ3A 2NY0C 3GNML 3UTQA 3CK0L 1EAPA 5I74C 4KK6C 3FFDA 4KQ4L 3UBXB 4PRDA 3O0RH 1WAAF 1N5AB 3BQUB 3V6OE 3OKNB 1T66D 4JDTH 3EFDH 2E7LC 1QPXA 1IM9A 4IS6A 5E8OA 5HXMA 1TPXB 4P4KC 5LGJB 1WVZA 1KT2A 4J3TA 2ZCKL 5IEKB 2LTQC 2FEEI 1IFHL 5HDOA 1NDGA 1YNTA 2IANE 3STLB 5DJ2A 3B9KA 4QHLB 2H8PA 1F90H 3NPSB 4EIZC 4U33A 4GRWE 5DQDH 2DDQH 2E8ZA 4QRUA 3L1OH 3O3EB 4MNQE 3OGCB 5EIVA 5IESH 1EJOH 3OAYH 1AH1A 3QI9B 3SEPA 3MMEA 4KUZL 3QQ4A 1D5BB 2RGSA 3GSXB 1MFAL 4JY4A 2WMPA 3TA3B 4F3FA 3VGDA 4P9HC 5CEZE 4KY1H 1RJYA 5GS1B 4Y19E 2HTLD 4JJHA 1LEKB 4ZPTA 3GSNB 1GPOH 5CZXD 4XCFH 2C3XA 4OZIF 3RDTA 2HFFB 3BWAB 1R5IB 4LNVA 1P9MC 4QGYA 5SWZE 4BZ1L 5JHDB 2W65B 3VD9A 3BPCB 3QT2A 2Z91B 2AK4D 5FEBA 4ZXBA 5KVFH 1U92B 3RU8L 4C59B 2VLJD 3TH4T 2XZAL 4RGND 2NZ9C 2NX5D 4OFPA 4PJDF 3MRPB 3SOBH 3V4PL 1XH3B 4M7KL 3OPZH 2BSSB 1HCFX 2AJZB 1B90A 4HWBA 4MAYC 5F88B 5E5RB 3TT1H 5T5FH 1CS6A 4FQQA 2RJMA 2P7TB 4M43L 3NACL 1EO7A 1MJ7L 4Z7UB 1M05B 3CIQA 1K4DB 4W81A 4EZMA 5EBLB 2BVPB 4Y1AD 5KSAA 1DBMH 2MQ3A 4UOW0 1MFDL 3S4SB 5CBEB 3CFDA 1C1EH 4X7TB 1J0IA 4RX4D 3HLAA 4KKLC 4GG6F 4U1IB 2ZUUA 2KH2B 4JKPH 4KUCD 4WFGD 3TEUA 4FXGB 3BH9B 4R2GD 5EZIH 5I2IB 5C07D 4XXCC 4U7KA 1AQDA 3GO1L 4MJ6B 4XNMA 2DICA 3ARGC 3VGBA 1LEGA 1C12B 1NC4B 2X4OB 3HI1A 4CUCA 4OCNC 3WE6B 2DYPA 5TQ0H 3WL9B 2YS4A 1S9YB 3MA9L 5D1QB 3ZDZE 2RFXB 1GHFH 1SJHB 3SY0B 2VWEC 2NXZD 1ZGLM 2APFA 3C5SB 1X6LA 4GFTB 3VXRB 3LKOA 2HT3C 3TCXA 1BX2B 5I8EA 5F9AC 4LLUA 1QZ1A 4EQ3A 2VDQH 3PNWA 4MJIA 3UROR 1IEAA 4ZYKA 1IM3A 4POZC 3UPAA 1INQA 2PTVA 5D7SH 3QG6B 1FFNA 5C0CA 3H6JA 2CRYA 4G6FB 1DL7L 3GJFH 3HG1D 2DQTH 1ADQL 3A6BL 4IOSD 4NUJA 5D1XB 2W91A 2BNRE 4PREB 3ARFA 4G6KH 5EFIB 5JIIA 1AKJB 3EYSL 1DANU 3B5HA 1ZLSL 2PCPB 2ZJSH 4YO0A 5GRVK 1UWXH 1AR1C 4XP4L 4L1DA 2P45B 4NWUH 3QXDB 4V1DD 3STZB 1UWEH 2H45A 2N4IA 3JVGC 4GLRI 2AP2A 3EYOA 2CR6A 3F7PC 1XIWD 2AXJA 1IC7H 3CZJA 4NHUA 3QUZB 2GJ6D 3L3KB 5ETUB 1KIRB 3DUHA 3OMZA 1NFIB 4ONFL 4AG4H 4IOFD 1GIGH 1Y18A 2A6KA 4HPYL 1KPUB 1SY6A 1CYGA 2H9GB 2BXYA 4UZGA 4KZDL 2BVQA 2ZCLH 1E4WL 3O9WA 2FR4B 3BIAX 5B8CA 4H1LH 4I0PD 4OBRA 4KMTH 5J6GB 3DOSA 3QUYC 2Z35B 2FJFB 5B4MD 3LZFL 4K8RL 2H2PD 5MHSE 3LKNB 5A16B 3VFSB 1GGUA 2X4QB 4WHTB 3LRHA 4FHBD 3ALPA 4TSAH 4GJTB 4JG1H 3HMWH 3QWRD 4OCWH 3L95B 2P8MA 3HAEH 3TN0C 4POYA 2QHRL 5DGQA 3ZKQD 4RFEB 4WFED 1BJMA 5CP7B 4G8IB 4NO5A 2OZ4H 2WAHA 2MKWA 4QOKB 2OXHA 3VGAC 2YPKA 2X9YA 5I8KH 3R06B 3QUXB 4X98A 4Q9RH 2HT2D 1ZHLB 1JHTA 1OL0A 5F1IB 1G9EA 4WO4C 5CJXC 1KCLA 1JMXA 4ZTOH 1IL1A 4TQEH 4JO1L 3OKEB 4XPAH 5I76B 3C08H 3FO0H 4NKMA 5IBLC 5MERB 2J6EH 5C0IB 1IGIL 1UG9A 2W60A 2XPGB 2X4PB 4UBDC 3D2UD 1QA9B 4MJ5A 5DFWH 5H35A 4YXKH 4HWZA 4UI2A 4HWBL 4KVCH 1BD2D 1KEGL 3TH3T 5D2NE 4KUCF 3QIWC 1OY3B 3AY4A 1AO7A 8FABA 3MV9A 4F7EA 1OT2A 5D5MA 1H5BB 4MQXC 4WEUD 1ZANH 3DMMD 1OGTB 2O5ZH 1Q9LB 3FOMA 4PRPB 3VDAA 1MWAB 1FYTB 1CDBA 2YPVH 3W11C 1IAKB 3MRHA 4PRIE 2BOBB 3ZTJG 4JFHE 2DQUH 2DJ4A 4ERSH 2CRZA 4L8CA 3B83A 1MELA 3K4ZA 4UV7H 4P5MA 5DD3H 2R1WA 1CFBA 4I18B 1QFWI 2FCBA 3JWDC 4LHUA 3BMVA 4LK4A 2GSIB 1SJXA 3MLUL 2J5LC 5TF0A 1WSST 3WUWA 5D7IB 1FE8H 4R4BA 3QZWA 4NNYA 4H88H 5BZWB 4M4RA 3DX8A 5ADOL 3GMRA 1ZLWH 4WUUA 1U6AH 2WUBL 2Q8AH 1DQMH 2VL5A 4NO0B 4L4TE 2E6PA 4XCCH 4NUGH 3GSOB 4JFEA 2Q87A 4GUPA 1XF2A 1NJ9A 1S5IL 3GIVB 1BLNB 3AREB 3SGJA 1ND0B 1EBPA 1JRHI 1N0XL 2QBWA 4OQTA 3W81A 1UB5B 3T65A 1J1PH 3BHBA 3H2WA 4N0YH 4OZFH 3RNKA 3OGOE 1Q0YH 4D8PB 4LLVB 3KJ6H 1B0GB 5KS9B 3T0AA 2YEZA 4NQCB 1JGVH 4L9DA 4P3CH 4WGVB 1P4IL 3UTPE 1CK0L 3H42L 35C8H 5JR1H 3JV5A 3P0YH 3PDDA 5HYSB 1YQ2A 4O2EA 4PJ9C 3MLSL 4EDXB 4OCXH 5E9DA 1BEYL 3B6SA 2OMBA 1NLDH 5C09B 3GSVB 2JJTA 3ECBA 4YXLH 1GAFH 3RIFF 2IH1B 2FECL 3C9NA 1AGBA 4BK4A 5C0DB 1RZIB 5LCVL 1PAMA 2W9EH 1CTNA 4OT1H 4M7ZB 4NRXA 5I1CH 1NCUA 1MH5A 5IQ9A 5EU5B 1OCWL 3IB4A 4AJ0A 2YD1A 4YHZH 3EYQD 2J12B 3BGFC 1QLRB 3HZMA 2IAND 2GSGB 5F7NC 1EGJA 5FF6A 1DVFD 4FQIH 3CFIC 1SY6L 3QFDA 3RWJB 4HJJL 1NCAL 1YPZF 3HNVL 2PO6B 5BMFL 3OB0H 3KWWA 4MNQD 4LFHD 4I8DA 1G0YR 2J8UB 1GZPB 2DLFL 1BWMA 1T2QH 3WIIL 3HS0B 4Y4HA 2V17H 2Z4QB 2VDNH 5DHXB 3PGCB 4A2LA 4Y7MA 3ROOB 2P24B 4N0UA 5DK2A 5CEZD 2HFEA 3MACH 4Y19D 4X9HA 5JW4Q 2W0KA 4RMUA 5E08L 5T3ZL 4O02L 3PJSB 4YR6A 3OAYK 2OM5A 3Q5TA 1TTUA 3QJHB 1BFVH 4MNGB 5SWZD 1IAOA 3NN8B 1A3RL 2F5BH 5D7JC 5L2KB 5E8DH 5CHNB 2NY6C 5DVLA 4CVXB 3HRZA 1H0DA 4JY5H 1ONQB 3G6JB 2C3VB 3RGVC 3WFBL 5JO5A 1NC2A 5I8OL 3WHXB 1SEBB 4EUPG 1Q0XL 3QHZL 2X70A 3FQXA 3HB3C 5C7XL 3BO8B 4PJGB 1FL5B 1S7SB 5E94A 1QLFA 2IQ9H 4RIRA 3MJ8B 5IEHA 5DJAA 3SQBA 3T1FB 3FB6A 2WBWB 1F4XH 1MCIA 2R23B 5ACZA 4QRPE 4Y5XC 2B2XH 3RVWD 1RK0A 3ABZA 2IPTH 2KQNA 2CKBH 4HIHA 1HQRA 2RCSL 5FHAL 1XCQB 1IGJA 1F8TH 4Y16D 4DKFH 5KVGH 3X14A 3FQTA 2DWEB 3CZFA 4GMTL 1DBJH 4H26B 1ZTXH 3KLAA 3VGFA 2BVTA 4MJIE 4OCRH 5D1ZD 4MCYA 3N1GC 4JCLA 4M5ZH 4UB0L 1Q9KA 1EHLL 5C0CE 2IH3B 3MOBL 1DP0A 2ZOLB 4KRPD 3BRDA 2VXSH 1P84J 3WSQL 2P43B 4ZO6A 4Z95L 5GGSA 3RVXD 1MCWW 5JNYA 1S3KL 1BIIA 2WW8A 4M1DL 2FGWH 3I6GA 5ESVA 4UAOC 3RPIA 2OI9B 3MROA 3S35X 2P47B 3CFEA 5KOVC 3PWPB 5CEXA 1J8KA 1I9IL 2X7LA 4G7YL 3SKOA 1PZ5A 1IQDA 3FN9A 3M8OH 4M6OH 4UNUA 3NIGF 1BVZA 2R2EA 4WWKB 4Z0XA 3BKJH 4U1LA 3TC9A 4GBXC 3I3DA 3QO0A 2GAZB 2AI0H 1L0QA 1KPRA 2BNRD 1A7NH 4CRPA 2JB6B 1A9BB 1B4JH 2EYRA 2WINB 2XQBL 1CFQB 1KLGB 1VFBA 3IDIB 4AH2B 5FYLL 4C4KO 3SJVB 4MCZB 3MBEC 1Q72H 1SVZA 3GJFK 4JFDA 4QT5A 3FKUS 3ZTNL 25C8L 3DHMA 1NGWA 2IGFL 4AMKH 3EO9L 1NGXA 4TULH 1VFMA 3X13A 3OKYA 2ZPKL 5CCKH 1FZKA 1JUFA 4LSSH 4U6HA 4NWTL 1DQJB 5GRUH 3EDEA 1INDH 4H1LG 4L9LB 5E2TH 4G6JH 3SO5A 3RVVD 4GRWF 4JFOA 3DRTB 5GGSY 3CFKA 4G8FB 3GI8L 5I75B 4K7PY 4NM4L 2X1PA 4LLMB 4W6XB 5T3ZE 3Q6GH 1G7IA 2ED8A 1LQSR 2F8OA 5J6HA 3NFSL 3RKPA 2DQDH 1N5AA 3BQUA 4KKBC 1NMAL 2XN9A 1IT9L 5MHSD 3HAEG 4QXGH 5I1HL 2FEDC 1WZMA 5JUEL 1GSMA 1U8NB 5D2LB 2YD7A 3MODH 4CDGC 1A6TA 2CDGB 2DJSA 3STLA 1U8OA 3PGFL 1HKLH 1KV3A 2I26N 4A6YL 5IJVB 4JN1H 1YEHH 2P5EA 1MIEL 2YPLB 3GHBL 3UPCA 1G7JA 3C2AH 5JW3H 3OGCA 1WEJH 2DMBA 4NSKB 4CMHB 1EVUA 1CLOH 3VXUA 2YXMA 2X40A 3T2NL 1ZGLB 4EKXA 1AO7E 4JR9L 4NRYB 3WV0A 5E2JA 4DTGL 1D5BA 3MV9E 5D5ME 4PJ8C 1X5JA 1T21B 5IMLB 1FVEB 5DI8B 3X3GL 4QO1A 1KJ2A 3AS1A 2EYSB 4HS8H 1P69B 1F3RB 1OAQL 4XC3H 1Z3GL 3E1F1 2Q3AA 2BJMH 2BNUB 4DKDC 3BWAA 2W1NA 12E8H 1R5IA 5JHDA 5KVDH 2W65A 3BPCA 2Z91A 4WI5A 2OTWB 4NC1C 1OM3L 4M48H 3QA3A 5EUOA 3EJZC 4PJEA 4OF3A 3OAZH 2XA8H 3SCMA 1U92A 2Q76B 3AVEA 3H0TB 5IKCB 2FX9H 1KBGH 1JPTH 3MRPA 1UA6H 4WUUE 4PRID 2AJZA 4JFHD 3CX5K 4J6RL 2O5YL 1I7UB 1DN2A 3WDIA 5C0RL 4JFEE 4YAQB 5IVXE 1K4DA 3OKDA 1HK6A 1F00I 3T8XB 2BVPA 4Q58C 5ICYB 4JPKL 5IW6B 1J8HB 3EO0A 3IFPA 5CBEA 4X7TA 5DHVB 5KANG 4Y4KD 4ZUVB 4F58H 4LDOB 4F37F 5F44A 2A6IB 2B0SL 5IVZB 3BH9A 4FFZL 4G8EA 4P2RB 4WWID 2MCPH 2HAZA 5FYLE 5I2IA 4YBLC 2Y72A 2C1PB 4L4TD 4OCMC 5F8QC 4K7PL 3T4AA 1X5AA 1EHXA 5GZOD 1G6RB 1C12A 4U6VH 4ZD3H 1ZLWK 3WE6A 2HMID 5A43C 1F4AA 3WL9A 4NM8H 1S9YA 1I1AC 4W68A 2RFXA 4DQOH 1SJHA 5IV2B 3Q5OA 4OI7A 3SY0A 1T3FB 5ID1B 1I9RH 5FGSA 5BVJA 1F02I 2H41A 4NKDB 1RMFH 1DBAL 1IM9D 1X5FA 3C5SA 4OFVA 3VXRA 3UTPD 1BJ8A 3MV7A 5J1TC 4OD1L 1KXTB 3B2VL 4IM8A 3UP1A 1BX2A 1OTSD 2JB5H 1IAIM 1TJHH 1KJ3H 4P59H 3KVQA 1FO0A 4MA3B 1C5DB 3QG6A 3OBAA 4X7SL 3B9KD 2MFNA 2VH5H 3O6LH 5EOTB 4EI6A 1G7HB 1CT8B 1AXSB 3GEWB 4PTUB 3OTTA 5D1XA 4PBXA 1CE1H 3IKCB 3O11B 2PCPA 5E56A 3P0VL 2XZQL 5AG8A 3CU1A 1NANI 1X7QB 2OK0H 3F58L 4H20H 1KB5B 2CLRB 3MLRL 3GMQB 4O9HL 3L3JA 5F7LB 3QXDA 5JMOC 5B39G 4M00A 4N0UE 3STZA 5HYEA 1D9KB 1KB9K 2APBA 4KAQH 3DHJA 3D0LB 4OGAC 43C9A 4J3VA 2E7CA 2XIDA 4UOW1 1UJTA 3EDJA 4ACPA 3QUZA 3RDTD 1MI5A 1A14H 5ETUA 1X5YA 2BSRB 2MTPA 3NCFB 4K23H 1MCPH 1NFIA 1P4LB 1CLZL 1S7VB 1XR8A 4WU5B 5C0ND 1NAMB 4P9MH 2LVEA 4LCIH 3QAZB 1RFDL 1FH5L 1U41A 3C8KB 4LIQL 2H9GA 5JXEC 4ODBD 3GSWB 4XPBH 1XMWA 4KC3B 1AP2A 2ZKHL 3H9YA 1U8PA 4WGWB 5IB3A 4U6XA 1U8IB 4DN4L 4GO6B 4XVUC 4UV4H 5IFHL 3WLWC 4QHKI 3INUH 4H8WC 1BFTA 1Y0LB 5DJZB 3VFSA 3TNNB 1CIDA 1EHAA 5KSAD 1OAYL 5AAWA 2X4QA 4WHTA 3MNWB 4K3JL 3U1SL 3PHQB 4JG0H 4O51B 4WNQB 3LQAC 1CDCA 1MAML 4FQ2L 5KVMC 1UVQB 1VGEH 5KG9B 1S7UB 5CP7A 1U8MB 3DUSB 4G8IA 5HVHC 1KJ2L 5FM5O 1JCKA 2OXGA 4YDVA 3EYFB 3JV6B 4QOKA 4QRQB 3RWEB 1E28B 2WQ8A 3QUXA 3O2WH 1PQZB 1NKRA 5CJQL 5I1EH 3SDXA 5DRXB 5F1IA 1GOFA 5SWSE 4FQ1L 4JRXB 3OKEA 4M6NL 4AT6B 1FC1A 5MERA 3MRIB 1MEXL 2DM7A 1A4JB 2VXUL 3ZKND 5DDHB 1YECL 3QXVA 5C0IA 2NXYC 4OZ4B 2XPGA 2X4PA 1AGEB 2HN7B 5L7XL 1ZA6B 4BFGA 1QA9A 3EJYD 1ZVSA 1IC4H 4MJID 1DANT 1DN0B 3FQUA 3DVNB 3PWVB 4YEEA 3WO3B 1BPVA 4KK8D 1YEFL 3K2UL 5C0CD 2V2TA 3MBXH 1EK3A 2O5XH 4HQQH 1OGTA 3ZHDA 1MRDH 1FJ1A 4PRPA 2HFGL 1MWAA 4KPHH 1FYTA 3WD5H 1BZ9A 3ARFD 4TSBH 4DVBB 5GZNC 3P30H 2Z9TA 3IDXL 5JHLH 2BOBA 2JLLA 3NGBC 2I07A 1K2DA 1SJVA 2VJXA 2HKHH 4MA7L 1OP3H 5F3HA 5E8EB 1OVZA 1HINL 1PD6A 2P48B 5J06A 5SWQA 5IR1A 4I18A 3KPSB 4JFDE 4J3OC 2VABB 5D7IA 4QNPE 4JRYE 4JVWA 4KKAD 2DB8A 5T1LB 5FGRA 3PWLB 1NAKL 1X5IA 1RK1A 4OCLC 2R56L 3ET9F 4RMRA 4XNUL 5DRZB 3HI6H 1G7QA 3C8DA 2L7UA 1NL0L 4PD4K 1H9VA 4R9HA 5TQ2H 3DLQR 3LS4H 3GIVA 3Q1SL 4WUKH 1BLNA 2CQVA 2E9WA 4OD3L 1ND0A 3OHXA 4LSVL 3O9WD 1UB5A 2Q6WB 1INEH 2OP4L 3VG0H 5BQ7B 1EFQA 1FO0L 2A6JB 3MRRB 4KRMB 4D8PA 1GGBL 1A6VL 3G6AB 2HLFD 2D9CA 4O2CB 4JFYA 3UYOD 2XN9E 2FH6A 1T66C 5LXGL 1B0GA 4NQCA 3IDNA 3VWJB 15C8H 5J4MA 4LIQE 2PW2B 1UM5H 3IDYC 4P4RB 5HYSA 1RUAH 2WM0A 2EE3A 3HRPA 1BAFH 2PNDA 5T3ZD 3SGDH 3GSVA 1KYOK 1HSAA 5I30L 1KENH 3MLYL 1BBDL 2P5EE 2PR4L 5C0DA 4HT1L 3W0WA 3AM8C 4Z7VB 1FFRA 3CLEL 1FDLL 3GMLA 5EU5A 4LPYA 5F1OB 3VXUE 2EKSB 4BQ6A 2X42A 4MS8D 3WCYA 4RWYH 2VRAA 1QLRA 2GSGA 3HR6A 2DQCL 2AQ2A 3SE9H 4F57L 1KNOB 1T1YB 3ILQD 3EGSB 3FT3A 2PO6A 1QKZL 2HTLC 5JPMA 3FZUD 5F6IB 1E4XL 5FYKH 5CZXC 4LVOC 2XRAH 5EO1B 1PFCA 3HS0A 2Q8BH 5F7WC 4OLVH 5JHDE 1AO7D 5HDQH 2Z4QA 3MV9D 2MNUA 3PGCA 2VQ1A 2XTJE 3D1MC 5EUOE 4PJEE 4TUOB 1WIOA 5GGRY 5DD0H 3ROOA 3KXFB 1R3LB 4OZGA 4RGNC 5JXAL 1M7IB 3S6CA 3QQ9D 1MHEB 4GG8B 4TUJB 4BFIB 3PJSA 1CGXA 4XPTL 4MNGA 4ALAL 3SE4C 4UIMB 1FAIH 1JNJA 3NN8A 4FP8H 4LHUD 4OF6A 2BNQB 3QEHA 5L2KA 2XKUA 5CHNA 1J1XH 4EJ1C 1U8JA 1ONQA 4EDWH 3G6JA 3U7AA 2C3VA 4LRNH 1G6VK 5JOFA 3CSBA 3HUJB 4WUUD 4BSJA 5EBMB 3WHXA 2ENYA 1SEBA 1CR9H 4R2GC 3KPNB 2G75B 1ZT1A 1I85C 3BO8A 7CGTA 2VTFA 1FL5A 4PJGA 1S7SA 5SX4H 4JFED 2BHZA 4K3GA 4XCNB 3MJ8A 5EZOH 3PHOB 5E5UB 5DK3A 2B5IB 3BKML 5MI0B 5HGBB 1QNZL 2A9NH 5GGQH 2MHAB 2FECI 2R23A 4QEGA 4QRSA 1HWHB 1QSFA 4ZFGH 4BK5A 5F9DC 4FTVA 3OAUH 5GXBB 5FYLD 3MLZH 4P5KB 2NXZC 1P4BH 2DLEA 3VXRE 1XCQA 3MV7E 5IMOB 4CW1B 2DWEA 4PLKD 5EBGA 3V7MA 3MYJA 4WHDA 5DSCA 4PGCB 4K3EL 5LGKA 1P7KA 3DO3A 2NY5L 4FRWA 1CGSL 1JZ8A 3PIQB 1HQ4A 4U0QB 4JLRB 1SMOA 4ZFFB 4R97C 2IH3A 5FOBB 3UO1L 1JHLL 1I9JH 3LS5H 2J8OA 3UPRB 3MJ6A 1ZLVK 4PJXA 3KR3H 3UDWA 5FCSH 1X4XA 4RNRA 3I50L 2BP3A 4S1SL 5I18L 4D9RE 3W2DL 3JUZA 4U1KA 4DEPC 1S7WB 5IUSA 1V05A 4XNYH 1XIWC 3LEYH 3LKSB 2JB6A 5T1MA 4MQTB 1LO2L 1MI5E 1A9BA 3ES6B 1RY7B 3DTXB 3IDUA 2WINA 5BRZB 4Y4HD 1CFQA 1KLGA 1MRFH 3IDIA 2B1AH 3SJVA 4IOFC 4MWFB 2HP4A 4MCZA 5F70A 4NRZB 2YD4A 3FT4B 3VFWB 1ZAGA 4U3HA 5IBUG 3GM0A 1F3DH 2X5PA 4XPHL 1TNMA 4CJ1A 4JZOB 1NDMB 1AD9B 1MIMH 1L0YA 1YEEL 4YX2H 5JOPE 4ZUTB 5DR5H 2OR9L 5IROA 1RAMA 4Y2DB 4JREC 3OJVC 3WNKA 3WNPA 6CGTA 1KTLA 3K7UA 1MCHA 3GMPB 3CFCH 3ZYZA 5L88L 5F7DB 4XNZB 2AXGB 1AHWC 3HMXH 5L9DL 1CZ8H 4FZ8L 3PWNA 4N0CD 5JQ6H 1DQJA 4S10A 4K9EC 5B4MC 1KLUB 4JO3H 2H2PC 1FNFA 5C0AA 4L9LA 1MFNA 4ODSH 2BDNH 3KYKL 1WLHA 1XGRA 3VDCA 4LLMA 5TE4H 1NC2D 2CIKA 5HYFA 1QFUH 1ZK9A 5C2BH 2YN3A 1DSFL 3CVIL 4K3HA 1G7PB 4I5BA 4IMLB 5D72H 4Z7QE 1CFVH 4XP6H 4QOKE 1YNLL 1UM6L 1A6ZA 1A9EB 2CXGA 4HUWB 1FORL 3D3VB 2HT2C 3WMSA 4P46B 3SDXE 1U8NA 5D2LA 4EUPB 1WISA 5GS2D 1YEGH 4NQDA 5IIEB 3TT3L 5IJVA 2ADIA 3GM8A 2Z8VC 3TPKA 2OQJB 4JZJB 3RWDB 4Q6YA 3N1QC 2YPLA 3V0AC 5I1JH 4GS7C 3MRFB 3BPNB 5CWSA 1PX3A 3I3EA 4B53A 3LH2H 3LQZB 3NAAL 5DD5H 4JKMA 1YN6B 4YGVB 1ZGLA 3NIFE 1XGQA 4LASH 1SBSH 4PGEB 1DQLL 2VDOH 1JHKL 5SWSD 5CIPH 5IJKA 3ARUA 3DMMC 1T21A 5IMLA 4PRPE 1V5JA 1RIUH 2W92A 4UMGA 5IVXF 1FYTE 2AEWA 2X1OA 2PETA 1IC5L 2XACC 2UWEF 1QLEL 1TVHB 2YWYA 4JY6A 5KTEL 4FABH 5KSBB 3O2VL 4HFUH 2R0WL 4HS6B 1QYGL 2X09A 5C8JA 1FGVL 2F53B 1U93B 5D7IE 3VRIB 4NZUH 3DXAA 1UYWH 4WW2A 4KQ3L 4KDWA 3GJFB 3H0TA 3UJTL 5IKCA 4J8RA 3U2SB 3TCLB 1II4E 2EEDA 4NNPH 1K5NB 5DTFA 4L8SA 1TQCB 2BY2A 4UDTB 4YAQA 1Q9WB 4OCSL 3AMKA 1NBVH 1TVBA 5GGVY 4JFDD 2CUIA 4LNRB 3T8XA 1JTTA 5ICYA 3D48R 5IW6A 1J8HA 2GQHA 3QDHA 3DSFL 4JHWH 2XICA 4JRYD 5EOCL 5DHVA 1UJ3A 4P9HL 5CLTA 3BPOB 4D0CB 4X4XA 5IVZA 3ZSTA 3LHPL 3ARDB 2AJUL 4NQCE 1JI2A 1F45A 2Y6SD 5FM8A 5IWLA 2IPKB 3SDCB 4A2MA 2XWJA 3GZKA 5I1IL 4OFKA 1N59B 2YZ8A 2YUVA 2AV1B 3PHSA 2WK2A 4PRAB 5KZCB 3F5WB 4AZ8A 5IV2A 4H1LB 1BQSA 3CSGA 4Z18A 3BQUD 3W0WE 4G42B 2XN9D 3V6OC 4GSDL 5ID1A 4PB9L 4QTIH 2C4XA 4NKDA 4G6AD 1L7TL 4LSTL 4Z0BH 3WFEL 4QRRE 1S78C 3BPLB 3PGDB 1QFHA 3EYQC 3I3BA 2GEEA 4GAGL 1JPGB 1HSBA 5FM4A 1C5DA 4GH7B 3S37X 3TH2T 1MFCH 3MRLB 1RVFH 1G9MC 3HAEB 4M7LH 5EOTA 1G7HA 1CT8A 2P5ED 2OSLB 5JTWA 4PTUA 5GHWL 4NJAH 5EC2B 2LFGA 1H3VA 3RJQB 4HXBL 4IEFB 1S9WB 1I7ZB 3SE8H 3O11A 3VXUD 1X7QA 4JHBA 2CIIA 3VFVB 2ADFH 1BQHG 4OSUH 1KB5A 2AABL 3GMQA 3OR6B 1Y6KR 4XMPL 4B0MM 1HHJB 4OZGE 1N4XL 3NOIA 2R1XB 1J10A 3QUKA 3D0LA 3FO1B 1TENA 1PDKA 1WZLA 4G9DB 4Q97A 3WIHA 4GLRH 1AR2A 1I8MB 1NGZB 3EDKA 4MNGE 4NZJA 5JHDD 3FRUB 3EZ8A 1P4LA 3N06B 1D6EB 5L2KE 4KHXH 2XTJD 4QHNB 2DLHA 3SCMD 5JW4N 1MQKH 1Z2KA 3CSPA 3VFMA 3G6JE 1P6AB 5IT2L 2QADB 2HJKB 1DE4A 3GSWA 4WHYH 4J3SA 5EU3A 4C58B 5M7QA 3DETD 5GGUB 2J4WL 1WZ1L 3D0VB 4P3DB 1UEYA 4JPIB 5JZ7D 5GGVL 1ZOXA 1FG2B 4GXVH 5E2UH 4HCRA 4PJGE 4OJFL 1Y0LA 5DJZA 3VGGA 5E2VH 3TNNA 5IOPB 4XCEB 2X6MA 3ULSB 1R3HB 1LO0L 4Y5YC 2C9AA 1KC5H 5ACLA 4PY8J 4EOWH 5KSVB 5KVEL 3TFKD 3PHQA 3MLTB 1QSFE 5HHQB 4WNQA 4FTVE 3RVWC 3RAJH 2F9BT 4EVNA 2NY4D 1FCCA 2GFBB 5KG9A 1S7UA 3IU4H 3X3FL 1PG7H 2HVJB 1U8MA 3V8CA 4Y16C 1CVRA 2Y5EA 3EYFA 4FQJH 4QRQA 3QWOB 4LEOA 1E28A 4HKJB 2JELL 5D1ZC 5HHOB 3P9LB 4IMKC 1C16A 1PKQB 3HPJA 3FB5B 2K1MA 5FO7B 4G8GA 3P77B 4KRPC 4AT6A 2A1WH 4JO2H 2D7TH 3MRIA 4YNYB 1A4JA 3RVXC 5DDHA 1JNNL 1FZOA 3VXRD 4PJXE 3MV7D 4OZ4A 3L6FA 2HN7A 1AGEA 4J2XA 1DQQB 1ZA6A 4QNPF 1HI6A 5F1NA 2NNAB 1H8OA 1SMAA 2FX8L 5DMJB 1DN0A 3DVNA 2PYEB 1VPOH 1AGFB 3UTZB 3VRJA 4YHLL 1FYHB 3JZ7A 5C9KA 2AJSH 3QP3A 3QH3A 4U7MA 3KDMB 2Z31B 1K4CA 5D1XD 2VZOA 1UXSB 4DVBA 3VH8G 3V4UH 3I2CH 5FKAB 1C5BH 1MCBA 2PUQT 5E8EA 4D9RD 5ALBL 1WFNA 1MNUL 1NCWL 2WLZA 4YC2C 2DAVA 1NMCC 1XT5A 2IFFL 2VABA 1XF4A 5DJCA 3ARSA 3O6FB 3PWLA 1QFWH 2AEPL 1MY7A 3CDCA 3QUZD 5BZDA 5CD5D 1MI5D 1MVFA 2DKMA 5F9OH 5B39B 5I74B 5C0AE 1WTLA 2EDWA 3RVVC 3NFNB 1UZ6E 4X7CC 1IKFH 3H8NA 3QDJB 5JOPD 2Q6WA 1ERNA 5TDOA 5BQ7A 2J88L 2A6JA 3MRRA 3BDBA 4X6EB 1MLBB 2VXVL 1JRHH 4O2CA 1FRGH 3E6HA 5GISL 2FWOB 1MHHA 4O4YL 5AZEH 4N8CH 4LSUL 5F7YC 3ILPB 1I75A 3VWJA 1WFOA 2PW2A 4XX1E 3FB7B 1OWWA 3EOAA 5D2LE 2GTZB 1BM3H 3JWDL 3MR9A 2I60H 1T22B 2MSPA 2JCCB 2B1HH 5I1KL 4X6CF 2ZG2A 5IW1B 1QHOA 3BGAA 4NQDE 4GMSH 2EH7H 4ODVH 4LSQL 3VXQB 5AUMB 4PG2A 4RQQB 1RU9H 4BSWB 3U6RB 3ZKMD 2YPLE 5EUOF 4PJEF 4PGZA 3HR5B 4QOKD 4OZHE 5KJRH 3PP4L 3QUXD 1BQLH 3WDJA 1HZHL 1XF5B 3WIHL 1Q1JH 2EKSA 1FHGA 4F7PB 2YOCA 2NZIA 3BZFB 1D5IH 1CQYA 3GDBA 3F7YA 4K9EH 4NZDA 5I71C 1JI1A 1FNAA 1FNGB 4LCCC 5JW5B 4QXUH 1T1YA 2CKBB 3EGSA 1MHPH 3EKCA 5FKPB 3TNMA 2J8HA 3IF1A 2EIZB 3DYMA 3MLXL 2VMFA 1T1ZB 4I3RL 1IGYB 5I15H 5D2NC 4HCRL 4GT7A 1GZQB 3G5VA 5I16A 2ADJA 4OLYH 4YWGH 2YHGA 3DXAE 4TSCL 2RAMA 1IEBB 4PRPD 1IKNA 1DFBL 3GBNH 3U0WH 1FYTD 1M7IA 4D2NA 1HE7A 2WWKO 3C5JA 2OL3B 4GG8A 1W8OA 1L7IH 4BFIA 1SJEB 4R3SA 5DEZA 2A74B 4XT1C 2FX7H 3BXNB 4BKLB 4FG6C 2R69H 5CD3B 1J05B 2DQJL 3G08A 2BNQA 2YC1A 1EEQA 3I6KA 5DMYA 3GBLA 1J8HE 4XMLL 4JB9L 4WIQA 3QEUB 4HF5L 3KPRB 5LG1A 1IARB 5IHUL 4DGYH 4Y4KC 4LSPH 4HGKC 1T1XB 3ARGB 4ZAKA 5EBMA 3RKDD 4PJHB 1QHPA 2QKIB 2DQGL 4WHCA 5FYJU 3MX0A 1XF3A 3KPNA 5E5MB 3KPPB 2G75A 5F6HJ 2WWKT 5IP4A 1DJSA 4UIKH 4R7DB 3BP5B 4XCNA 1VB9A 4L5FL 5TE6L 5ISZB 4JQXC 3U4EA 5DRWB 2E5EA 3GHEH 1H3GA 3MA7A 5GZOC 5HGBA 4N1HB 4BFBD 2MHAA 2HMIC 5DUPL 2W0PA 5I73B 1Q9OB 2QQKL 3IRZA 1MJ8L 1MCOL 2QR0B 3QUMH 2HTKD 2APTA 2FHCA 4P5KA 1XGPA 2APXA 4S0SD 4N9GA 4NQCD 5J7CC 4WI3A 1HILB 5IMOA 3BAEH 4CW1A 2ITCB 2MQ0A 2EXYD 4S11A 3DI3B 4PGCA 2ZP0T 1OTSC 3NCYP 3NZHL 5DHYB 3B9KC 4ZFFA 2EDJA 4LSDA 2DM3A 3W0WD 1E4XI 1OB1B 2GI7A 3NMEA 1SM3L 1OAXH 5CEYA 1JPSH 4UT9L 4XVJL 1EMTH 2YRLA 4P48A 5ESQB 2HFTA 4LSRL 4XXDB 2G60L 1XCTB 3BW9B 1A6WL 4K2UH 2QSCH 1FG9C 1MCCA 3VD5A 2DD8L 4S1QH 5E0QA 5ID0B 1EEYA 4GAJH 1KULA 2SEBB 3STBA 3L7FB 4FQLL 3LKSA 3LD8C 3THMH 3ES6A 3RDTC 3DTXA 3BKYL 5BRZA 1YDPA 2DOCA 1PSKL 3PUCA 4IRJA 4LHQB 3TVMB 5C0NC 4MWFA 2AJYH 1RURL 1N7ML 2BFVL 4ODTL 4NRZA 3FT4A 3QUYB 1H3WM 4ZDHB 1NDMA 1AD9A 6FABL 4ZUTA 3HPLB 4Y2DA 4YIQB 3EYVA 2YKLH 2ESVB 3SDXF 2AXGA 5I9QC 1LNUB 3I02A 1JNHB 4WHYG 4XVSH 5ILTH 3M1BA 4EEEA 1G9MH 1REIA 4ENED 5L2KD 1T03H 1F42A 1U42A 2H6PB 5HI5D 4GRWH 5KSAC 5DJ0A 4OLXH 1HHIA 2GY5A 2PN5A 4R90H 1NMBH 5TF1H 5HGAB 1RUQH 3NA9H 4ZOEA 3MV8E 3A0OA 5DWUH 3KJ4C 4YXHH 4HUVB 4L4VB 1EVTC 3NIFF 3WFHB 5IGXH 5MEQB 5HHMB 4EI5B 2X4RB 4JM4H 4IMLA 4WO4B 1G1YA 5CEZH 4LVNC 5K9JH 1A9EA 5E6IB 4J7RA 4RMQA 3D3VA 1VGKA 4P46A 4EUPA 1QSFD 3CH8A 3TLRA 5I17A 4FTVD 4G8GE 4PUBH 5IIEA 1SEQH 2G9HA 2RQ8A 3Q0HA 3TBTB 3QIWB 2P8LB 2OQJA 1IZKA 3ZKNC 4KTEL 5D7IF 1E0OB 3MRFA 4OF7A 2Y07L 3BESR 3EJYC 3GSUA 4M7JL 4AIXA 1FZMB 1CU4H 2VIRB 3HCVB 4NJ9L 1YN6A 4YGVA 1YEKL 3QIBA 5EU4A 4KK8C 4Y88A 1B3JA 4ORGB 1UKQA 3F7VB 3D9AH 3RX5A 1KFAH 1TFHA 4ODHL 5FHBL 3ARFC 4G9FB 2J5LB 4XC1H 2DTMH 4YDKH 1U8LB 2L7JA 2X4NB 4XP1L 1TVHA 1KCUH 5KSBA 1KN2H 3EFFB 4QXWA 2NTSP 2ZUWA 3G5ZB 3VRIA 3C6SA 3VFTB 2YK1H 2R8SL 4KKAC 2GT9A 5DC0A 1MLCB 1XGYL 2BCKA 5JORB 4OV5B 3U2SA 2J7LA 3TCLA 5JLZB 2VXTH 4MNHB 1BGXL 3RY6A 3P11H 2VISB 4AEHL 3FN0H 1N2RB 2WNGA 1K5NA 4XP9H 1U3JA 4UDTA 3DRQB 3MNVB 1EO8L 5GRJH 4CVZA 5GRZA 4PBWD 2XI9A 3FMGL 4LNRA 5C08B 1N6QH 4TUKL 3AROA 4ZS7L 5D96C 2LU7A 2BVEA 4QF1B 1UACH 3O9WC 3K8KA 4MQ7B 1NCBL 5B8CC 4YUEH 2C3WA 3KPTA 3GNMH 1JF1B 3CK0H 1A1NB 5GIRA 3PG2A 4D0CA 1TZHA 2HLFC 4KQ4H 2ICWA 4XAKE 4DGVL 1NBQA 4JM2B 5GJSL 1TITA 5IBUB 5C0AD 3VFGL 4HH9A 2DIBA 2R39A 3L5XL 2NW2B 2JKXA 1E27B 1FFPA 3SGKC 1N59A 2R2BB 5F7KC 2ZCKH 4NOFA 2HWZL 1IFHH 4PRAA 1VACB 2DI8A 3PQYA 5HGHA 1BREA 4X5XB 4AEIL 3F5WA 4TNWF 2HG5A 2QQLH 1MY5A 3IJYA 2VDML 4OZGF 4DFHA 1J0HA 4TRPL 2Y9RT 4KVNL 4OKVA 3CX5J 1F6AA 1OSPL 4NDMB 3K1KC 1LP9B 4MS8C 3SKMB 5IB5B 1JPGA 3BDXA 3TYGL 4NQDD 4KUZH 1H3PL 2DBLL 5J12C 1MFAH 2BRQA 2YBRA 5GS3A 1QO3A 3TZVA 4RMWA 3ILQC 1X5KA 2YPLD 4HKXB 1L9MA 2BSTB 2LQRA 1Y6MR 1EUUA 3FZUC 4NP4L 4D0DB 4L8BA 4PB0L 3G6JF 4KDTA 1GVIA 1S9WA 1I7ZA 4DZBB 3AGVA 3V4VL 3DBXA 2BC4B 4LGSB 3AY4C 3G04A 3VFVA 2FATL 1R5VB 4BZ1H 1DZBA 3RIFK 5ICXA 3VDBA 5HTSA 1HHJA 2AQ3A 3K4DA 4PJGF 1NANH 3P73A 3OL2A 4G80B 1LWRA 3RU8H 3QQ9C 1LO5B 2EDQA 2XZAH 2VN4A 3FO1A 4JFPB 2C7UB 2NTFB 3V4PH 4LARL 4UQ3B 4BFEA 1RV6X 4M7KH 1NGZA 3QCUL 3RGVB 2K9UA 3FRUA 3OPZL 3TBYA 1OAKL 5EC1B 4RCAA 4WY7L 1IILE 2BNQE 4M43H 4QHNA 3NACH 1MJ7H 4HXAL 1ES0A 3DXAD 2JJUA 1CFTB 1NCCL 4OB5L 3X17A 2HJKA 2Q86B 1DBML 1MFDH 3PE9A 3ULUL 1C1EL 3LDBC 2GY7B 1YN7B 1I8LA 3V79C 2OBGA 3D0VA 4P3DA 4JPIA 4Q6IB 5CJOL 3BH8A 3T77A 4KGJA 4Y5XB 2N56A 2XTLA 1WWAX 2GHWB 4F9PA 3BIKB 2W9LA 3GO1H 4R26L 3ULSA 1VFAB 5EO9A 4OLEA 1K6QL 4UU9B 1J8HD 3SGJC 4PJXF 1A0QL 5KSVA 2Y7QB 1MQ8A 1EPFA 2H3NB 2VL4A 4LCWA 4U1NB 1CLCA 1P5VA 5HHQA 1P2CB 1RUPL 3QBTB 1T83A 1KB9J 4YFEA 3MA9H 2GFBA 1IAIL 4R4FL 3S37L 3CXHK 4AQ1B 4PLKC 5HHNB 2OYPA 4CNIB 3RWGB 2HH0L 3GBML 4H0IA 3JWNC 3FO2B 3P9LA 5HHOA 3TBWB 5K9KB 1KCVL 2ARJB 2D7PA 4LMQI 3MO1A 4LL9A 1PKQA 2NY1B 4N90E 2E27L 5FYKU 1YYLL 1T7WA 2K7PA 3P77A 1DL7H 4YNYA 1J9CT 1ADQH 3A6BH 1U58A 1DQQA 5DLML 4CU8A 2V2XB 2NNAA 3EYSH 1ZLSH 4GBXB 4H8WL 2D9QB 1CGUA 1VDGA 4M1GL 5GSRB 3KPLB 4XP4H 1AGFA 2D0GA 3WDHA 1LEIB 4KI5E 2QSTA 2EDDA 2P5WB 1LILA 2GK2A 5TFSL 1UZ6F 3FQNB 1YEJL 5FKAA 3WXVL 2ATPB 3ZSSA 5BRZE 3OKLB 4Y4HC 3VI3E 3VJ6B 4UTAL 4C83B 2ARJQ 1VERA 1N5YL 4ONFH 3RWIB 2GUOB 3BWUC 4L3EB 4YHKL 3G6DL 2XKNB 5TE7H 2D2OA 4HPYH 5I1GL 3ALXA 3O6FA 4UINL 5C0JB 5LVEA 4KZDH 5J0BA 1E4WH 1ED3A 2N7BA 5D2LF 2ITDB 4M9PA 5EOCJ 4DK3A 1BQHB 4N0CC 5DXWA 5B39A 4P23A 2R0ZH 5D70L 3LZFH 4K8RH 4P0DA 2XXMB 3E8UL 1QFWM 1RSFA 3NFNA 3EZJB 3QDJA 1KACB 2FRGP 3O3BA 1URLA 5T5NG 4OZHF 3MUGA 1CXKA 1VSCA 2CK0L 2JJWA 3PXJA 5DQJA 1ZWIB 5IHZB 4IIQC 1MLBA 1RZKC 3MRMA 2QHRH 2IALA 1T7VA 3S3JA 3P4LA 1FAKT 3ILPA 1EJ6A 3CSYA 3D3VE 3K2MC 4H25B 2CXKA 4LCUA 1T22A 1JZ7A 3CMOL 2JCCA 4NCDA 3ULUE 2UY6A 3SQOL 4HPOL 3MV8D 2NW3B 3B43A 1C08B 1F97A 1S7XB 3U6RA 2XZCL 5E4EC 3C08L 3UYPA 4PJ8B 4WW2F 3EOBB 3HR5A 1FL6B 1IGIH 4PGDB 4AL8L 1V7NL 1XF5A 3HHRB 4PD4J 4HWBH 4YXKL 1KEGH 4DFIA 3BZFA 5DK0A 3QDMB 1LO3L 2M1KA 4G8GD 1FNGA 1P9MA 5JW5A 2DBJA 5FKPA 4BH8B 1QBBA 2EIZA 2ZNXA 2J2ZA 2VZTA 1TMCB 1UB6A 2FB4L 5HD8D 1T1ZA 1GL4B 5KSBE 1BVLB 5EIQA 1HXYA 3K81A 3V7AG 1IGYA 3RWHA 3RRQA 3PWUB 2DI9A 4HH8A 3H3PL 2VZ1A 2W0FB 4OUOA 3MLUH 5CSZB 5FIEA 1WFUA 1IEBA 1KYOJ 4UT7L 4LVHB 4RMTA 3V0WL 5ADOH 1DUZB 2EDYA 2OL3A 1SJEA 4YHNB 4R8WL 2A74A 2WUBH 2EDFA 3FCTA 2VDLL 5CD3A 3H7BA 2RIKA 2ZZUT 2F19L 1JGLL 2E9JA 1PGRB 4LF3B 4YBLB 3VH8B 3KPRA 1S5IH 1N0XH 1XZ0B 4RGMC 3WO4C 5DFVD 2QKIA 1NEZG 3VXSB 5DS8B 4S1RL 5E5MA 4RGOL 3KPPA 5I1AB 4YHML 2IQAB 2C5DC 3K80A 5DMGD 3ZMRA 2Y6SC 5L2JB 3GFUA 4OIBA 2GCYB 1CWVA 1P4IH 5DRWA 1CK0H 3H42H 5D8JH 3QNZA 1AGDB 2I5YH 1A1MB 5D6CB 4HGMA 1QRNE 3MLSH 1HOCA 1FN4B 2AGJL 4KJWD 1BEYH 5F97E 3PQYE 4PJCB 3VU2A 2VLME 2AVGA 3NA4A 1D5XA 3QDGE 5FV2A 3BQUC 4K3DL 4XAKD 2FJGA 1RZFL 1R24B 1FSKB 5LCVH 3VWJD 4G6AC 1TVDA 4DKAA 3IRPX 4DAGL 4HWUA 3GI9L 3MRCA 3H9SB 4QLRA 1YEIL 1OCWH 5DQ9B 3ZL4L 1U3YA 4YHZL 5DHYA 2RR3A 4MA8L 5KAQF 2WIIA 3NPSC 1S7TB 1X4ZA 4PJAA 1SY6H 1RIVL 2NY3B 4RWHA 3KYMB 1UZ8B 4HJJH 1FFOB 1NCAH 3Q3GB 4FQHB 3HNVH 3S9DB 1S9VA 1DLFL 4YHYB 3O2DL 4XXDA 2DLFH 5C0BB 5EO0A 3WIIH 4MYWB 2VXQL 1UCBL 4HSQA 3CH1B 4FZEL 4HIIB 3HZYA 4IRSB 4B41A 2SEBA 2NR6D 4NT6A 3ARTA 5D93B 1QBML 2QHLA 5CGTA 2G5BB 3HC0B 5E08H 5T3ZH 3N50A 4O02H 4KZEL 1TIUA 3TESA 3JTSB 4U49A 3TVMA 1OOAA 2D7MA 5HDBE 5EUKB 3O81A 1KPVB 2XTJC 1NBYB 5TPWL 3BN9D 3C5ZA 3SCMC 4ZDHA 1A3RH 2UYLB 3OZ9L 4M1CD 1HIML 1OLZA 1TZIB 4YIQA 3DETC 1BMGA 4MQSB 3WFBH 1R3JB 5I8OH 5JZ7C 2P8PA 1LNUA 5D9SB 2Q7YB 1JNHA 4NQXA 4OZIB 1Q0XH 3PL6A 2BNQD 5C7XH 4RBPK 3JV4B 4X4YA 1U95B 4RZCB 2DJUA 1GGCL 1N0LA 3TFKC 1AGCB 4LCWE 5HVHB 1N26A 5HGAA 4ZAKD 4PJDB 5INCB 1D3CA 4HUVA 4L4VA 2NY4C 2BY3A 5CSGA 4TTGA 5DVKA 5MEQA 4EI5A 3TO4A 2ED7A 2X4RA 4WO4A 4HKZB 1H15B 1T0MB 2XG4A 2RCSH 5FHAH 1FCGA 3AB0C 4HZAA 2KDGA 3BP6B 5HJ3A 32C2B 5E6IA 5HHOE 4GMTH 2NXYB 4NN6C 1PKQE 2FZ3B 4UB0H 4GG6B 3UZQA 1EHLH 3W9EA 5HSFA 3GRWA 3QIWA 5CKAA 3MOBH 4YDJB 2ICEB 2BY1A 4Z95H 3VI4E 1I8IB 4ONGL 4BZYA 2OL3L 1S3KH 5F72S 4M1DH 3MXVL 2XG5A 1FZMA 3HCVA 1I9IH 1WICA 3N0PB 2AJVL 4NQSA 3CFJB