3CSPA

Crystal structure of the dm2 mutant of myelin oligodendrocyte glycoprotein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
121
structure length
121
Chain Sequence
GQFRVIGPGHPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDEGGYTCFFRDAEYQEEAAVELKVEDPFYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myelin-oligodendrocyte glycoprotein
publication title Demyelinating myelin oligodendrocyte glycoprotein-specific autoantibody response is focused on one dominant conformational epitope region in rodents
pubmed rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 33
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2008-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cspA00
3ZE0E 1D6VL 4YDJA 4TPRH 4OGYL 4M4PA 4PJ5E 5EA0L 4MAUH 3V7MA 3ROOA 2DRUA 2VWEE 2X09A 2YK1H 3HG1E 1HYRC 5IROA 1U93A 1T3FB 2P8LA 3OR7A 1CBVH 2VR4A 3ILPB 5DUPH 5I66A 3IU4H 5GSVA 4RFOH 1MAJA 4KAQL 4AM0B 5CBEA 1V8HA 3DWTA 3QFJE 4F2MA 4ONGL 4AL8L 2E3VA 5E2VL 5C7XH 2XTLA 3M8OH 4YDLC 3T2NL 3PL6A 1RUKL 4JGMA 2H26B 2I24N 4EIZC 1MFEL 1JIBA 2VXTH 4GKSB 2GI7A 1M7IB 1AIFA 2VL5A 4F8TA 2G60L 3MLTA 2EC9T 4MCZA 1WBYB 3BIAX 4AQ1B 3TN0B 1K5NA 1I9RL 4MQXD 1PDKA 4NJ9L 5JW5A 4JFPA 4D9RD 1FNSL 1OY3B 4I48B 4AMKL 4MMXC 3MLXL 4U7MA 4AEHL 3IF1A 5T33H 1QSFE 1A8JH 4YIQA 4AG4H 3GIVA 4WW1B 1MH5B 4U1LA 3KGRA 3WS3B 3R8QA 2OL3B 1MHEA 3I84A 4NC2B 5F8QC 4PJFB 2IBZY 2W65A 5D4QA 5E8DL 1F58L 1JPTH 4Y5VB 2N7BA 3MODH 3S3SA 4L9LC 1WFNA 3S34H 1VESA 3KYNB 2IH3A 4MNQE 3VI3E 4ZNEE 3LKPA 1SJHA 4TVPD 2CGRH 1NCAH 3MRGA 5FAAA 4Z18A 1N59A 4ZFFB 1R5VB 4J8RA 5E08H 1QFUH 4FFVD 5A3ID 5JMOC 2W59A 4ELKB 1I8MA 3UTSB 1FNGA 2BSTB 2R1WB 4F7TA 1LE5B 4P2YA 4L3AA 4K3GA 3BYTA 1JYNA 3GSOB 4W81A 4WVRA 4N8VA 3MV7E 4H1LH 3BGAA 1PG7L 1D3CA 1HQ4A 5C0GA 2JB6A 4P4KA 2HRPL 2FIRT 2R0KL 3K8MA 4G6FB 3EOAA 1WBXA 4XPTL 4JJ5B 2OR7A 4NFBA 4JB9H 2IPUG 3EJJX 3MLUH 4DOHB 3WKML 1JI1A 4IRSB 2WNGA 3KJ4B 3EYQD 5JHDA 2DQIL 3IJSA 4UT9L 2CR3A 3C60C 2BSED 4ZFOA 1INQA 1XZ0A 4P2RE 7FABH 2R4RL 1U8MA 4LSSL 1VKXA 4WO4B 1IC4H 1ZE3C 1D5IH 2NX5A 3B9AA 5EUKA 5GS1C 5MERA 1ONQA 1N5YL 1HXYA 5JORB 3B2VH 3GZKA 1IEBA 1YQVH 4UOW1 4MXVF 3V4PL 4CAGA 3HKFA 3NFPB 4X6CE 3ULSA 2BNRB 3JVGA 5D2NA 3MBEA 4KTEL 5INCB 1S3KL 1A6UH 3KPSB 3CMOH 5DEZA 2F5AH 2NY2D 4L4VE 4UUJB 2PUQT 2QSTA 5FF6B 3P4MB 3H9SE 2WQ8A 4M48H 4LKCA 5HI4D 2JJUA 2OK0H 2RBLA 1BWWA 3N9GH 4WY7H 5IMLA 3X12B 4YHPA 3AB0B 3ALXA 5C0JA 4XWOC 4RGMC 1FO0H 4MMZC 4JG1L 5IEKB 1H0DB 5I1JL 2IAMC 2MKWA 2YZ8A 3Q3GA 2VLJE 4X5WA 3IVKB 4WUKL 2DQCH 3F7RA 2APXA 4ODSH 1KIQB 4OZFH 4I4WA 3PDOA 4KJYA 3T3ME 1CLOH 4XAKE 5IW1B 5EC1A 4U2YA 3MUGA 1L9NA 3H0TA 4P9MH 5ISZA 4ZOCA 4LEXL 5B8CB 1KCSH 3O6ML 2PXYC 2VERN 4YPGB 3S8WA 2YXMA 5EUOE 1U41A 5CLTA 3HPJA 4P9HL 4QNPF 4GRLC 3WSQH 1QKZL 4NZRL 3QEHB 1WCBB 2YD5A 4JM4L 2CIIA 3MOAL 1I8IA 5GRJH 2WM0A 2MQCA 5FO8A 5CUSH 1HHGA 1F11A 1OAKL 4XP1L 1XGTB 3BDYH 1KCUH 1URLA 1JHLH 3KPTA 5D7LE 5K9KA 6FABH 3RWJB 5HSFA 2VSDA 5DLML 3VXUE 5JTWA 2XN9B 1CDIA 5C9JA 1V3MA 2VDNL 3CUPB 5BO1L 1GAFL 4PRBA 4J4PD 1EBAA 1AR2A 4S1DC 4EXKA 1SY6H 2D0HA 5E00A 4U6VH 3O8XA 1GC1C 4OFDA 1JF1A 4TUJA 3FQTA 4JFEB 1QR1A 2KUTA 3HNVL 1LD9B 4R4ND 2HG5B 3VFVA 3WXWL 3OKMA 4P23D 2B20A 3OKOB 3QG6B 4Y8AA 3LIZH 3QXDA 1HOCB 2PCPA 1J05A 4PLJD 3TCLA 1P9MA 4UINH 5FV2A 1ZT4B 3GMRA 4ZDHA 4G8GE 1MLBA 1YN7A 5CSZA 2HFFB 1DEDA 2R29L 1LO2H 1DBBH 5EBMB 5I1GH 5IB1B 1FZMB 5KTEH 4J23A 1VPOL 2R23B 3NIGF 3MCG1 3WFEH 2C7UB 2X42A 3TJEL 4XBEL 4A6YH 2FWOB 2F5BL 4QHKI 4M1GL 2NY3D 2ICCA 2AJVL 5GRZA 3G6JE 1MCSA 2FRGP 3SDDA 5E2TH 5JXEC 5F7LB 1MVUA 2CDFA 2PKDA 3VXMD 1TZHA 4OM1H 4X7SH 4FQQB 1YEGL 4YHIA 3C6SA 3RWGB 5KOMC 4NO5A 4MYWB 5C3TA 4QHNA 1ADQH 1P4LB 4NDMB 4LARH 4NOFA 1BAFH 1G7PA 5CEZD 3IFNH 1VB9A 1NBZA 4RNRA 3H3KA 3RWIA 4F7MA 1FFQA 3IJYB 4J3TA 4LAJH 2WUBL 3MV8D 4G6AC 4JHBA 4YO0B 4JY6B 2V9TA 5ALCH 4JPKL 2W0PA 3P0VH 4WHYH 2XICA 2ICWJ 5I1EL 2Q3AA 3ESVF 3GRWL 4JREC 4K94H 1MFAH 1NAMH 5HHNB 5D5ME 3BWAA 3OKEA 3ARRA 4FP8L 4MGXA 3SDCD 1BJ8A 3GSVB 3KLSA 4PJEB 4JFZH 1MCEA 4FFYH 2JCCA 4X5XB 3MZTA 4HWBH 1KN4L 3SDAA 2CMRL 5J0BA 2A0LC 1LO4H 5KSAA 1FL3B 1C8PA 1U3HA 5SWSB 4ZAKD 4PB0H 4Y4HD 5D7JD 4R97B 4PJGA 1A14H 5F6IB 1MRFH 3TPKA 1Z9LA 3QYCA 3ARTA 4UU9A 2FO1A 2JIXA 4GJTB 5GGVY 2W0FB 1FFRA 3EFFB 2VWEC 2X70A 3SGEH 2OQJA 1YDPB 3FOLA 2G5RA 4OTXL 5F7NC 3WFDL 4L29A 1Z5LA 4LHUD 1S5IL 4LBEA 5JQ6H 3FQUA 3B4NA 4G8IB 2YMXL 1NGXB 4LKXB 2W1NA 2EDYA 4HGWA 2BSRA 4NQED 3GIZH 5TF1H 3BQUD 3RU8H 4WUUE 1A7BA 3I50H 4KROC 1U91A 2PTTB 4MSWB 2VLRD 5BJTB 1MCDA 1WZ1H 5D7SL 5TQ2L 3CPLA 3CU7A 5JW4M 1MCIA 4FXKA 4KRPC 3HFMH 2EYSA 2VISB 4PJ8A 1VADB 1CFTA 5F21B 1R5IA 1UYWL 4YGVA 4DN3H 4M02A 1DE4A 3X17A 4DKFL 2AV1B 3RHWK 2W9EH 3NH7L 5FGBC 3IB4A 5KN5A 1KJ2B 3SKOB 4NHCL 4IS6B 2OXGA 3ARFC 5DUMH 4P57B 3F7VB 2DLEA 1FVDA 3CZFA 1AI1H 4M7JL 1RIVL 4Q9RL 1BREA 4MA3B 4GW4B 2XQYK 5CLWA 1EA9C 4XCNB 1BX2B 2KQNA 1WK0A 3VG9C 4DCQA 3SDXF 2AXJA 2DD8H 4OUUA 4G6ML 3HMXL 1NC4B 1R3KB 3QUYC 3H7LA 5F1NA 4U6TA 4G8EB 2J5LC 3LS5H 3MRIA 5I9QB 3HC3L 2OSLA 1M05B 3DX7A 4NQCA 5TF0A 4EKXA 4V2CB 3UTTA 3NCEB 1ORSB 3SKMB 1IQDB 1J5OH 4XWGL 4H25A 1JF6A 4OLWH 3OQ3B 3P30L 2AVGA 5IV2B 2FBJL 2NW3A 3PWPD 1ETZB 3WYRA 5LQBL 1BIIB 3QDMD 3W0WA 1D6EB 3ZKSD 3WN5B 1JMXA 3BESR 4MJIA 1B6DA 1I1RA 1CFQA 5TE6L 3O2DA 4OZHB 4FTVA 5I74B 2HN7B 3FCTA 1OT2A 2YEZA 4P5MA 4JFDD 4LIQH 4OF3A 5KJRH 2IFGA 5BV7B 1AKJA 3QIUD 3G9AB 1G0XA 2HMIC 1N8ZA 3VXNA 3QEUB 4MA1C 4XBGB 4NPYB 3RPKA 2UYLA 4EI5D 1EH9A 2AJ3A 2XZZA 1IM9A 3PIQB 4ERSL 4LASL 4P2QA 1YNTB 1QA9B 4FRWA 4JO2L 5IFAL 1MAMH 4RFNB 2QR0A 5C0IA 2WUCH 1IKFH 1R3HA 3BDXA 5I6XC 4J3XA 4R7DB 4OKDA 1IKNC 3S88L 2W0LA 2BY0A 2XN9E 2VXVH 5TFSH 4EQ3A 5JOPD 3WUWB 4RA0C 4HK0B 4KK6C 2AQ2A 3M45A 2EXYC 3LPGA 5FKAA 1FCGA 5DC4B 4EUPG 1MJ8L 3O9WC 1QFWL 3DI3B 1TETH 2APFA 3VWKD 1UKQA 5F71A 1TXKA 3TFKD 3BZ4A 3JV5A 3ARDA 3BJ91 3NBNA 2BFVH 3GMQB 1EZVY 2J3SA 2FJFB 3O3BB 4YFEA 2X4PB 4TTGA 5FYJL 1YYMH 3D48R 3OKKA 4NJAL 1KPUA 2CO7B 4JRYB 5D6CA 1DN2A 2NLJA 3L5HA 4UQ2B 5IQ9A 1EK3A 2FR4A 1RD6A 1U8OB 4LCCA 3RX7A 2FJHA 5F9JA 4S11A 1P4BL 4E42A 2PW2A 1N0XL 1HSBB 5MEND 3M17B 1IGML 1PG7X 3PHQA 3LPWA 1JTOA 3VGBA 2ED8A 3QO0B 2NTSP 3LKSA 2YOCA 3Q1SL 1R5WB 5EB9A 5HDQL 1PX4A 2Q7NA 1T89C 4LSQH 5TQ0L 5DRWA 1I7TB 4F7EB 2DICA 1FAKT 1KC5L 4XVUD 5DJZB 3OR6A 1A22B 4MVBD 5GGRB 5MEPA 3CU1A 4LCIH 1T5WA 2D7TL 3BGFB 1G6RB 3QPQD 1M71A 4Z0XA 5KZCD 1HWHB 5FYLL 5L2JA 4R8WH 3GUTB 4E5XB 3AS1A 4OF7A 1C5BH 3GSNA 4Z5RA 4BFEA 1BZ7B 3DUUA 4WEBH 4PP2A 2HJLA 2VAJA 3HE7A 4HIJB 3HE6D 4QRRD 1OTTD 1YMHB 1G9EA 5EO1A 1PZ5A 5HGDA 2VUOA 1T0MA 5HHVH 1QLEL 1R0AL 2EDWA 4GAJH 3O3EB 1I7RA 4H8WC 4N5EC 5CBAB 5HVWA 3CFEA 2NNAA 5ID1A 1RFDL 2VITA 4NQXB 3MRRB 2VE6B 1ZGLP 1NL0H 2X4OA 3WL9A 1LO5B 2B1HL 1OAQL 3D2UD 4OUOA 2EEAA 5E1AA 4C56B 1MUJA 2G75A 2XA8H 5KS9B 5CSBA 5L0QC 4LDEB 1T7WA 4S0TD 3P0GB 4PS4H 3FN0H 1EMTH 1K2DB 3G08B 4APQC 2EC8A 4X8JB 1RZFL 2F53D 2ZSWB 1I85C 1I1YB 4M03A 5IGXH 4K71B 5I1HH 4HG4J 1E4XL 1WEJL 3K4AA 3L3GB 3P4LA 1Z3GH 1CFVH 3S3JA 2R0WL 5IB3A 5DJXB 2YA0A 1QQDB 1VACA 2DQGH 4HSQA 5D1QD 4P4RB 1W0VB 4BQCA 4D0BA 1ZVYA 5DHVB 5FM5M 5JIPA 1NANI 1EHLH 3GSXA 4JZNB 4E41D 3CVHH 1GGUA 3CSYA 3QEGH 1LVEA 4PJ9D 1KEMH 4N8CH 1IAOB 3TN0C 5I73C 1JNLL 5IHBA 4U1HB 4WI7A 3WDIA 3IDMA 2OZ4L 1W72L 4P5TD 3L9RB 5EPMA 5LVEA 4HKZA 4XCEB 3S9DB 3I75A 2FSEB 1FBIH 4WHTB 1B9ZA 1TVBA 2BNUB 4BFGA 4GRWH 2X1WL 1T1XB 4HWEL 4O58L 5LGJB 4Y8DC 1YEFL 5J1TC 4HXBL 5K9JH 1MHCA 1IILE 3GMMB 1NLBL 4QRPE 1ZLVH 4MWFA 4K7PL 2ARJA 1Q0YH 2GJ6D 4NP4L 1JI2A 1GHFH 5HYJB 1PY9A 5FDWB 4I0CC 2R2HB 1JTPA 1ZSDB 5GGSY 1LO0L 3JWDL 3BIKA 2OMBA 1MIEH 4K3HA 4C59B 3LKOB 3P9LB 4U3HA 4FS0A 1ZEAH 1NBYA 5F6HJ 4J12A 2NY6D 3UPAA 4RWYL 4PLNC 2XWJB 5KW9H 4D0DA 1KTLA 1II4E 2EDTA 1J0HA 4OFYD 4G7YL 5IIEA 5HHQB 4UNTA 4M7ZB 2KDGA 3QO1A 1OAXL 3QJFA 3KLHD 3MXVH 3KJ4C 4TSCL 4MCYA 2P8MA 5AD0B 3SKJL 2NW2A 1FGNL 1LO3H 4EUPA 3S37H 5JR1L 1FNFA 3GSQB 1A6ZB 3ARBC 4ODTH 1ZKAA 3VD4A 1JPST 4Z95L 4BH8A 4DZBB 5F44A 4O4YL 4N9GB 4WO4C 3IJHB 5L7XH 4FQHB 1R6VA 1BD2D 2NTFB 4RIRA 4HD9A 4YPJA 4EDXB 1CN4A 2AJYL 5E94B 4JR9L 1DVFA 4OZ4B 1P7KA 5DI8B 3O4LE 3MCLL 1AXIB 4LVOB 1NGYA 4NUJB 3UTZA 4JQVC 1FNEB 1XGYL 1QSED 3UEZA 1J7VR 2CXKA 3CFDB 1K8DB 1CICA 1UADC 3HNSL 4X7EC 4HLZG 3BKCL 1C16B 5TE7H 2V17H 4KTYA 4YNYA 2FH6A 3SO5A 1CT8A 1KXTB 1EJOH 1UWEH 5ALBL 5ENWB 3D39D 2XZQL 5HGAA 1HK6A 4POZC 2EE6A 1XT5A 4RAUA 4UILL 1Z0MA 1AR1C 4HIXL 3UJTL 1JBJA 1KJ3L 1CXLA 1AQDB 4ZQKB 3OMZA 4ONOA 5F9OH 3BSZH 4Y2DB 4I13B 5C1MB 2Q8BL 2HVJA 1KT2B 3SDXA 3PP3H 3MRCA 3GBNH 4G9DA 1J1XL 2RGSA 1FDLH 4YAQA 3RL2B 1WFOA 2HT3C 4Z0BH 5JDJA 3MRDA 4CMMA 5GGSA 3LQZA 5B8CC 3U7WL 2V7HA 3NCYP 3ULVL 2HA1A 3KR3L 5C0FB 2AJZA 2P5EB 5DMIH 3T4YA 5JO5A 2MPAL 4AQOA 2PYEE 5E03A 1JN6A 3HAEB 3NABL 3P40A 4FQ1H 5KVFH 3KPNA 1KUMA 2ID5A 5H35A 3OAUH 4I0KA 1EEYA 3MCKA 5I8KL 3VFNB 1ED3A 5E2UL 5A2KH 2DYPD 2X40A 3OX8A 2X4SB 4CVXB 3MXWL 2EO1A 3GM8A 2BOBB 1QTYT 5BRZE 5IM7A 2EIDA 3HI5H 1AO7D 3C5SB 3BPLB 4X6CF 3RL1A 1A6TB 5DJ2B 1AD9B 2KKQA 3AAZB 3GSWB 2AV7A 1NCTA 5D1XD 3FQNB 3FQXB 3VFPB 5ID0B 2YPLB 3STLB 1BECA 3O41B 1RUQL 3L6FA 1P53A 4PRHD 3GHBH 2C1PB 1QFWI 4XI5D 5IQ7H 2UVEA 1YY8A 5DUBB 4M62L 4L8CB 3HZVA 1IGTA 4C56E 4FQ2L 4NKOA 3NGBB 2CH8A 2BDNL 1K9TA 5KSVA 4CKVX 2NXYB 2QSVA 5DTFA 2OTPA 1CD8A 2R8SL 1MCPL 15C8H 2DMCA 1T7VA 1RPQA 5F7UA 3LHPL 4WI2A 3U83A 1UB5A 4M7LL 2WSKA 4JFXA 4HUUB 1F4WH 2IPTH 5HHPA 1U8PA 4YHOH 5D7IF 1ZT1A 4JRWA 4WI3A 1V05A 4K9EL 1YEIL 1ZHBB 4K23L 5F88A 2VDMH 3GI9L 1I7UB 4LSDA 4G8FA 2Z4QA 3T65A 2EECA 1N5AA 4HJJH 5FOJA 3DRTB 1DBKH 2FLRT 4OQTA 1S7RB 3PNWB 5BS0D 2ADIA 1RZJC 2VQTA 1R3IL 1ZA3A 3NFSL 3W81A 3NACL 3S3PA 2FHCA 1BZQK 1A6VH 3EOTL 3PWJB 4GS7B 1GZQB 4KHXH 2D7PA 5J6GA 2NXZC 4WI8A 4XNXL 3TJHD 2XQBH 1B90A 4FABL 5DD0H 4P3DB 1TTFA 1F3DH 1QVOB 4WDIA 3PQYE 1XGQA 2PXYA 4X6DE 1RZKC 2IAND 43CAA 1OAUH 1W8OA 5T3ZL 1WUNT 3WNKA 4PD4J 4X7TA 4GRLA 5EU6B 4UTAH 4Y19E 4PRAA 3U7AA 3O2DH 1KB9K 4OV5A 4RGOL 1M7DB 3FHAA 1FE8H 3MLSL 2HWZL 3KJ6L 4Z78A 2FL5B 4F15B 2QQKL 3QG7L 5F89A 3P9MB 1ULVA 4XP4H 3DSFL 4Y4FC 5D72H 3MRHB 5I8CB 4R97C 2MTPA 2Q76B 3R0MA 4QHLB 4G7VH 2EDDA 2EZ0C 3B5TA 4PTTA 1U8QA 1Q94B 5F6IC 2D7QA 5LAXB 1FC1A 1XCQA 1A6AA 3NTCH 1FPTL 5JW3H 3QQ9D 3TVMD 2X9WA 5DJDA 1EDQA 4H5SA 4WCYH 2B1AL 4JPWL 1CDGA 4QHUB 5ETUA 1PD6A 4LP5A 5C09A 1KNOA 1BFOB 1MFBH 5E8PB 3QUXB 3STZA 1H3UA 3EHBC 3FRPA 1JPGB 4RQQA 4QXGH 4WI9A 1I4FA 4KKCD 2E9IA 2I5YL 4OM0H 1CDJA 1ZLUH 4V1DA 5IMKA 1N4XL 2FX9H 5L2KD 1DQLH 1BFVL 4GT7A 3RWFB 2BHUA 2ZOKB 5C2BL 3TBVA 1OARL 5EIVA 2HKFH 2ILLA 1JFQL 4JPVH 1JTTA 1BQSA 1OSZA 1QRNB 1ZV5A 3FT2B 4X7CC 2YBRB 3GMPA 3IKKA 3VGGA 4MXQC 3SCMB 1YYLH 5FGSA 1FVCA 4OCMC 2G9HA 2GAZA 5HYEA 1I8LA 32C2A 2DQFA 2DQJL 2EYTA 4QXTB 3CZJA 1DDHA 3N85H 4MNHA 3ZDYE 5E24E 1JWUB 1F2XK 4J6RH 1AGFA 4JKPL 4NO3B 4XC1L 1KLGB 1AD0A 3U1SL 5TGBA 1QOKA 3PP4L 4QRUB 2UY7A 1BM3L 3QFJD 4TVSa 4U1IA 4Y1AA 5B22A 5C9KA 4NSKA 4Y16C 1IARB 3KYMA 5HYSB 4RRPG 1AFVL 3VFSA 4PJFF 5E9DD 3T8XB 4DKDC 4HDIB 5I9QC 4IRZL 2IWGA 5ICYA 5HDBF 4LF3B 5IVNA 1R24A 3MV9A 3GRWA 5JNYA 4WJ5A 4X4MA 3B9EA 5CMAA 3L3OB 2VZUA 2FX8L 3WN5C 4LSTH 2GSIB 3SDYL 3T3PF 4FQXD 3H7BA 3DXAE 1MJJB 2AXFA 4K2UH 3SOBL 3GSNH 3UBXB 3NFNB 4Q0XL 4ZTOL 1NH6A 2NX5D 2NPLX 1ORQB 3QDGD 1HHIA 4PYGA 1PYWA 4BK5A 3TWCL 5GXBB 1KOAA 2VQ1B 4CN1A 2AEQH 1VCAA 2XWBB 2VC2H 5JOEA 2Q6WA 3QRFM 4XCCH 1AP2A 5BV7C 1D5ZB 1MFCH 3K74B 5EZJB 2C1OA 5FB8A 4O02H 4QYOA 4AEIH 4JY5H 4X6BB 1RSFA 4OF8A 3BKMH 3LN9A 2GCYA 1OSPL 3U0WL 2QJDA 3KS0J 2E9JA 4LHQB 4I77H 4WGWB 3U4BL 1VGEL 4CJ0A 5K9QG 3T0BA 3V8OA 3IXAA 1S7VA 4RFNC 2B2XH 5DJ6B 4M4RA 1DLHB 2WMPA 3ZL4H 4KK9C 3HG1A 4YDKL 4N0UB 4YHML 1C12A 1V7NH 3B43A 2DTML 1PEWA 4PRPB 5DRNA 4R9HA 1EXUB 1F02I 1U3YA 3MJ7B 4LLYB 1AJ7L 5CZKA 5EN2B 3TBWA 1WAAE 1PGRB 3V5HB 1K6QH 2DQUH 4JFFB 5LBSH 2OX5A 3TGXA 4S1RL 1AGDB 1TVDA 3F62A 3X11B 4UQ3A 2YWYA 4DKEH 2NZ9C 1LE9A 2YPLE 5AWNH 1H3VA 2AK1H 3UPRA 3HRZB 4YUEL 5HYQB 4OCSH 1U8NB 1JGUL 2XKNA 4LLUA 3CFCL 3JTTB 1QD0A 5C6PB 1VGKA 4HT1H 4MLSA 3TYFA 4CMHB 4RFEB 4QTIL 1FL5A 5ISZD 4WFHD 1DQJB 3VGFA 4PV9B 2HTLC 4NQDE 3CDGA 4YEEA 4JZOB 3EOBA 5DMKB 4JLRB 4WW2B 2NY7H 5BZWA 1ZA6B 2UWEF 3C5ZD 4K3DL 4TUKL 3GMOA 3PWUA 2EXWD 4JGJA 2QQLH 4CVZA 1XGRB 3ZE2E 2R1YA 4YWGL 1GJIA 1T66C 3VWJB 3NAAL 2VOTA 3OKDA 4X6EB 1S9WB 4MNQA 4ZNEA 2EDHA 4NHUB 4OLVH 5CP7B 2BMKA 4U6XB 2EE3A 3T08A 4HKJB 4PBWD 1DZBA 1I1AB 1XR8A 4N0YH 2FNBA 1N7ML 2DAVA 4ORGA 3MBXH 5FA3A 4NWTL 4G6KH 3U9PL 5J3HC 4I5BB 5T3XL 2FB4H 2ZUQC 1UEYA 2VIRB 3BUYA 5IVZB 1JZ4A 4TTDC 1A7OL 3H42L 1OTSC 4LCWE 2RHEA 5LCVH 3LRSA 2UZXB 1D5MB 2BOCA 4XPHL 4X0KA 2UV3A 3LH2H 2WAHA 2AAVA 2OJZL 2GIYA 1T04A 4XGZA 1GGCH 4OZGB 2H3NA 5IBTH 3HNTL 3ARGB 2Z35B 5H8DA 3CSGA 3V0VA 4L3CB 3NVQA 4XRCB 1S5HA 3T0WA 3CH1A 3EJZC 4NQVB 2WV3A 5D93B 4F80A 4JO1H 5I0ZA 3ARWA 2DLFL 1C5CL 5DD3L 1TENA 4EUPH 4PJXB 1MPAH 5CZXC 3FAWA 5ESQA 3SDDD 4AY0A 3QQNA 3QI9D 1D6VH 3DX9A 2BC4B 4OGYH 5C07E 3ARQA 3E6HB 2WK2A 5I8EB 3DX6B 4X6CA 1YMMA 2AW2A 1N2RB 2OJEA 4WU5A 2IG2L 1ZT7B 1JCKA 4QRSA 4M1CD 1FG9C 5CSGA 4JAMA 3WMSA 5I1DB 4L4VA 3O9WA 3BO8B 4N5UA 2AGJL 3QQ3B 4AL8H 5E2VH 3FOMA 4X80L 2ORBH 4F3FB 3IU3A 3T2NH 1KEGL 3KG5A 2JTDA 4HWNA 3RTQA 4IOFC 3BEVB 1B3JA 2EKSA 2G60H 4XCYB 1HDMB 1SJXA 4RRPA 3EYFB 1KXVC 1RZGB 3WO4B 1QRNE 5IT2H 1I9RH 4NJ9H 1J88A 2Y06L 1J8HD 5DEGA 1FNSH 2V2WA 5D7IA 3MLXH 2EEDA 2IQAB 4AEHH 1T5XA 2ZKHL 4XNUL 1EFXA 3IS0X 5FOBA 4EN3B 3SDAD 4KVCL 1N0LA 4U1NA 2EKJA 1HHJA 3I3DA 1DJSA 4Z7UB 1U3HD 2WANA 1CGWA 1T1WA 4AH2A 4D3CL 2DQDH 1K8IB 1FZKB 1BVLA 5E8DH 1F58H 4U1SA 1NMAL 3PHOB 1A02N 4IRJD 5HBBA 3QIBB 1NAKL 2ADGA 4WGVB 2JIXD 1FLRL 2Y5EA 5FHBL 1VDGA 4PJEF 4WHCA 2A73B 4DFHA 4OZIF 1FRGH 3RVUC 4YHZL 3AREB 1LMKA 1YN6A 5D1ZC 5D7LA 3SY0A 1QFHA 4YFLF 1UXWA 4HWZB 3WDJA 3PDDA 5LGKA 4PJIB 1GIGL 1U92B 4HIIA 1NFIB 3L5WB 1NDMA 3NIDF 5E4IA 1HHHB 2ZUYA 4KK5C 1FCCA 1PG7H 1UH3A 4B0MM 2E8YA 2DDQL 2RB8A 2HRPH 2E7MA 2R0KH 3UTOA 2XTJD 4XPTH 5IF0B 2BVOA 1A5FL 2GEEA 4M7ZC 4WEMB 1EV2E 2VLKE 3R0NA 2DQEL 1JPSL 1JPFA 5F1IA 4PP1D 1BPVA 1G7LB 3G5VB 5GIRB 4ENED 2DS4A 2DQIH 2W9DL 4WI4A 2HLAB 2XZAL 4ALAL 1NKOA 2R4RH 2NCMA 2OS7A 4LEOB 4LSSH 3LN5B 3P2TA 4G8GA 2XRAL 3RVWD 3DMMC 5LGHH 2H41A 3OXSB 5FFLA 4KRNA 1NCDL 1N5YH 4BSJA 3N1FC 4I2XB 4HV8B 1S7TB 2EH7L 1I85A 3HB3D 3AC0A 3ALWA 4HFUL 4JDTL 4CU6A 3CSBA 2DIBA 3ILPA 1CF8L 3RP1A 3ZKQD 5J1SC 4KTEH 1CGXA 1S3KH 2Q8AL 3ULUE 1UKTA 2HJKB 4R2GB 3P73B 4AM0A 3LB6D 4MAUL 5DMGC 2BNQB 3RFZC 3W39B 3QHTC 5CKAA 2XG4A 2G5BB 3RDTD 5CD3B 1G7MB 3UTTD 4LPUA 5JQHC 2XFXB 2H26A 1I3RB 4GKSA 1CBVL 1M7IA 4JQXC 4HAFA 5CGTA 1IL1B 3IU4L 3MRFB 3W0WD 2P7TB 1WBYA 3FO1A 4XXCC 3VXPB 4GAFB 4WTZG 5I1JH 3K3QA 4MJID 1XEDA 3VXSB 4KH2A 5C7XL 1PW3A 4H26B 4I48A 2VDOH 5JOFA 2VDLL 5B3NA 1L0XA 5EOTB 5IBLC 2VXTL 4Y2DC 1MH5A 3X3GH 1AKJD 2ICWA 4BZYA 3WS3A 5EOCJ 5JDSA 3WBDA 3DUSB 2OL3A 3RY6C 3TO4C 4E0RA 3Q5OA 1A9EB 4PJFA 4LEXH 4NC1E 1FYTB 5F6HI 5HHOA 1SYVB 3GI8H 1IM9D 4Y5VA 4GAGH 4IDJH 3OXRB 1TQBB 5T33L 4AG4L 1FNLA 5HY9B 2X4QB 3QFDB 3QJHB 3SE3A 1X4ZA 2AEPH 1WICA 5KSBF 3KYNA 4NZRH 1MWAL 2HT2C 3D3VB 3L3HB 4JM4H 1IAIH 4KXZH 4OZHF 4ZFFA 2H6PB 5BW7A 4ELKA 3UTSA 2BSTA 2R1WA 5AZEL 5DDHB 4LK4A 4DN4L 1LE5A 2HAZA 1OAKH 1X5ZA 2Z92B 4XP1H 3GSOA 1MHPL 1S7SB 5KVGH 1GOGA 3VW3L 5DLMH 3LEVL 1QFUL 3OB8A 2VDNH 5BO1H 4Z7QE 1GAFH 1A7RL 4U05A 3O45B 4MAYC 5DT1H 5I17A 4EDWL 2BERA 2HTKC 4IRSA 1P7QB 1Y18A 1FNHA 3NZ8B 3BPLC 1UM4H 1AY1L 4PTUB 1GC1H 3QUMB 2V5YA 4BKLA 3RI5F 3HNVH 5A40E 1MNUL 2IFFH 3WXWH 1HILB 2GTWB 1DTUA 4HCRL 4BFBD 1A3RL 1G9ML 2NY2B 4WO4A 2VXSH 1OGTB 1W0WB 3MLUL 4PJXE 5JORA 2PW1B 5E2JA 3RWHB 4PLKD 4HUXB 3NGBC 4GFTB 2R29H 4HHAB 3CCHB 1VPOH 2ARWA 4N1EA 2BNRA 2NY4D 4HUWB 3TJEH 4QXUH 4XBEH 4JQVA 1D5IL 5INCA 5ANMB 2J8UB 2AJVH 3AGVA 3B2VL 3KPSA 2XWTA 1EJ6A 1YQVL 3GBML 4I3SL 2D7MA 4Z77B 1MRCH 5FF6A 3TF7C 4LOUC 3P4MA 1YEGH 4R0LC 2DM7A 1NANH 2GY7B 5EU4B 5CJQL 3P9WB 3VXRE 5IEKA 1H0DA 3CMOL 3O6FB 2O93L 4IMKC 2OCFD 2F5AL 3QDJD 1F4AA 4GS7C 5SV3A 2UWEA 3IVKA 3I3BA 4U0RC 1KIQA 4NGHL 4RMTA 4L4TD 4WY7L 1BVKB 3I02A 4KDVA 3ET9F 4ZOAA 1HYSC 3LQAC 2WUBH 5IW1A 1FO0L 4HQQL 4JPKH 5I1EH 5IOPB 4Z7UE 4DJMA 2CKBL 3GRWH 4BQBA 3QDHA 5ACLA 1RUAH 5B8CA 4FP8H 4HX1B 4YPGA 4QOKB 2ZCLL 1BBDH 1T7ZA 4BZ1L 3L7EB 4IOSD 4DGYH 1OTUD 3QUZD 1WSST 4WI5A 3QEHA 1WCBA 5FCUL 1KN4H 2LU3A 2VKWA 2QBWA 3CDCA 4D9QE 2CMRH 4F15C 3VXQB 4P9ML 3OKYA 2AXGB 5EU3B 4P23B 2E6QA 3GBLA 2CUIA 4OD2B 4PJIE 1GCFA 2XN9A 3MGTB 5K33A 3MMEB 3CUPA 3DETD 5CUSL 4PJHB 5KS9F 4OTXH 1W8NA 3BDYL 4QRQB 1KCUL 1OOAA 4KI5C 1S5IH 4MHHI 4CDGC 3BMWA 1INEH 3ZDXF 4JFEA 2NY3B 1LD9A 2HG5A 4B7IA 3OKOA 1H8NA 4GH7B 3QG6A 3V5DB 1HOCA 5D2LE 1N26A 5CJXA 3VXMB 2YPVH 1ZLSL 1SY6L 4PY8J 1ZT4A 2PO6B 4N0CC 1J1OL 5D7SH 4MS8D 2HFFA 1YPZB 4YDIH 3A6CL 5IB1A 1F90L 5EBMA 3V2AR 5E6IB 1FZMA 3D0VB 4GBXB 4WTZA 1RIHL 4ZTPL 3FO2B 4NYLB 1UYWH 2C7UA 3LQMA 1P6FA 1UACH 3LSOB 3WUWG 4DKFH 3LIZL 1BFTA 3NA4A 5CILH 3V6OE 5ACZB 5F7WC 1G7QB 3NH7H 1BF2A 4UINL 4JQIH 4LGSB 4NHCH 5DD1L 4D9RE 2VSCA 5I1GL 1LO2L 4XCFL 4CJ1A 5KTEL 3MV8B 3T4AB 4FQQA 4Q9RH 3ZZ1A 1F4XL 3RWGA 3ZKNC 3C9NA 1BZ9B 1KYOJ 2VTFA 2XG5A 4OD1L 1A47A 4G6MH 4XH2B 3HLAB 3HMXH 2C3GA 5E2TL 5EIQA 2R9HC 2WIMA 1LDPL 3DLQR 3HC3H 3VFMB 4OM1L 4GMSH 5SX5K 3BZFA 2FBOJ 1RJCA 2CKNA 1JWMB 4TVPE 4ZFGL 4XWGH 3IJYA 2VZOA 3P30H 4LQFH 4ZAKB 3BKYL 2HFEB 5D7JB 4ODVL 4JY6A 5IW3A 1G9NC 4LARL 5LQBH 3SGKC 4XTRD 2QADD 3W9DB 5HHNA 4F9LC 5H94B 3WFBH 3IAGC 3D5OF 2F54A 3GSVA 1NFDE 4JPIB 4LLMB 4OAWB 4PJEA 4OZIA 3W11C 4X5XA 5F3BB 1PKQE 5EZIL 1YZZA 3L3KB 3L3JB 2V9QA 5ICXB 2Q7YB 5CD5C 4F33B 4LHUB 2XA3A 1FL3A 4K94L 5SWSA 1MFAL 1DVFD 4O51A 4FQLH 4NQEB 3HC4H 4QRPD 1CDUA 2HFTA 3BQUB 5BXFB 3DO7B 2OP4L 3MACL 4LASH 3HTLX 3BAEL 3MRLB 3MRJA 4FFYL 5IFAH 1CICD 4JO2H 2VLRB 2W0FA 3MRPB 3EFFA 1LO4L 3WFHB 2CSPA 1U8IA 1YDPA 4Y4KC 1W2KT 4RAVB 1X5AA 1ZTXL 3KPLA 3IS1X 2V5SA 1ZANL 3VFOB 4CDHA 4BUGA 2OXHA 1EHXA 4G8IA 1NGXA 3ULUC 4NRZA 2MKLC 3A6BH 2FECL 3VCLB 1PEZA 4L8DB 5BMFL 1MJ8H 3C8HA 2VB5A 1OHQA 3TA3B 1WFUA 2PTTA 3NCYS 5BJTA 5FYKH 4P46B 1UM6L 4UDTB 3O11B 5FYJH 1K4DB 2VISA 4NJAH 4CMHC 5TF1L 3EYSL 1ZHLB 2AV1A 4DUVA 3I50L 1DBAL 1KJ2A 3SKOA 4KKAD 1E27A 5ANME 4IS6A 1P4BH 2O26U 2Z8WC 4WW2C 5EU5B 4P57A 1N0XH 5ESAB 3F7VA 5EOCL 1A64A 3PWPB 5IVXB 4MA3A 5GGQL 3QDMB 4HJGB 4NC1C 3WIHA 4XCNA 1BX2A 1JUFB 2GUOB 3RX8A 3VWJC 5CZVL 2P46B 3TEUA 3Q1SH 4BZ2L 1NC4A 4O9HL 4DFIA 2J6EL 3UP1A 5HDQH 3MQIA 2M1KA 5TQ0H 2WBJB 4G8EA 4WFGD 3LV3B 5H37G 1I1AC 2CXGA 1M05A 1KC5H 3UTQB 1ZS8B 1RVFL 3QIUB 3VGEA 1ORSA 1IQDA 3O4OC 3LRGA 2D7TH 1ETZA 5FYLH 1JNNL 2BJMH 1MCNA 1BIIA 3TZVC 1G7JB 4TNVF 1ZLWH 4NNXB 4CL7A 5EIIB 3LS5L 2O61B 5GZOC 5I30H 2ATPB 5GGRY 2E8ZA 4HXAL 5C6TH 4I1NB 4OZHA 3OAYK 4OLWL 2HN7A 3T2PA 3ARGC 2C3WA 2ZPKL 4XHJD 1WAAF 1QLEH 1R0AH 5IB2B 2A1WL 1RHHB 2CRMA 3QEUA 4XBGA 4NPYA 4P5KB 4S1SL 3RI5K 4WTWA 1RFDH 5I75C 3PIQA 4ETYA 3VWKB 2Y36H 2BVYA 1EFQA 1YNTA 1QA9A 1OAQH 2B1HH 2ZG3A 5DRZB 4TNWK 4LIQL 4W4OA 1DQDH 1LP9E 5KJRL 4R7DA 4L3EA 1TDQA 2EC9U 4NCDA 1RZFH 4XB8A 4PJDB 3RQ3A 1D9KC 4HK0A 2Q3ZA 5EBLB 1NCWL 1OW0C 3DVFA 1E4XH 4YH6A 4MDJB 4F8QA 4FG6C 4ZSOB 4KZEH 4X4YB 1IKFL 4GKOA 1OQXA 2R0WH 4KJQC 5MENB 1E6OL 4HBCL 5I15H 3GMQA 3PGCB 4JHAL 2W9LA 1ZGLM 3ELAT 2FJFA 3VXME 3D1MC 3O3BA 2X4PA 3MA9L 4H1LB 4JRYA 5DQJA 4OLZH 4ZO9A 4UQ2A 2HFGL 1JNLH 5C8JB 5B4MD 1U8OA 3BT2L 1W72H 5CEZE 1QFWM 3QEQD 1BIHA 1HSBA 2UZYB 1YYML 5F8RC 4EN3C 1FZOB 3OAZK 2RAMA 5F3HA 2KZ1B 1EO8L 2EIEA 4PV8B 4OGAD 3MV8E 3RWDB 4ODXB 3Q48A 2OL3H 3QO0A 3G5YA 4HWEH 4O58H 1YEFH 2IADB 1R5WA 4HXBH 5L88L 4J1UB 3HE6B 4QRRB 2VL4A 1NLBH 1ZMYA 1I7TA 4RISL 4F7EA 3B3IB 2XV6B 5DJZA 1WITA 1DQTA 2ZWLT 4NP4H 2HYMA 5GGRA 3QXWA 4IBLT 5LWYL 1LO0H 3JWDH 1G6RA 3AREC 3V4VH 5HGHB 3P11L 4O2CB 4BFIB 3GB7B 3GUTA 4QCIB 3NCBB 4E5XA 1QEWA 4RWYH 1IC1A 3D2UB 1BZ7A 2WQRA 2IPKB 4HIJA 1CE6B 1YMHA 3FKUS 1QPXA 4PREB 4LNRB 2I26N 4LCIL 2Y5TB 3PV6A 4ZOEA 1YUHB 2F53B 3FHQA 4C4KO 3MFFB 3PQYD 4GAYB 1OAXH 4GUPB 3O3EA 2Q86B 5CBAA 1C5BL 3LN4A 4TSCH 3HAEG 4AIOA 4GXUN 4KI5F 4NQXA 5JR1H 3MRRA 9CGTA 5DQDH 2VE6A 5IB4B 4OZFB 4NQEE 1A3QA 1LO5A 4Z95H 5T1LA 4O4YH 3UROR 4C56A 5KS9A 5E70A 3JWOL 3VG0L 2F15A 1K2DA 3G08A 4ZD3H 2VLRE 4X8JA 3B9KD 1BOYA 4XPGL 1I1YA 2AJYH 4NRYB 4HGMA 4NN6C 1U0QA 4E41B 3N1MC 4PJ9B 4Y1AD 1DP0A 4Y7MA 4MQXC 4ZFOL 3L3GA 2APBA 4NQSA 1VFMA 3NPSC 5KANG 3MPCA 3HNSH 1DR9A 3FN0L 4X7FC 2BCKA 1ZVSB 3JBG7 3BKCH 3CH8A 5DJXA 5I71B 2F8XC 1QQDA 2ERJC 5IGXL 1YNKL 5ALBH 5I1HL 1W0VA 2XZQH 4DZ8B 1CD1B 1MFDL 1Z3GL 5GS0L 4EVNB 4JZNA 4UILH 3CLFL 4DGIL 2JJSC 1F13A 1PG7W 3OJDB 4X4XB 4HIXH 1IAOA 1KJ3H 3UYRL 4PD4K 4U1HA 3T09A 1VEOA 5FEBA 2DQGL 3L9RA 3V79C 4FNLL 4P2OD 4FFVC 3BP4B 4XCEA 5A3IC 1X5GA 5L8KB 2A0LD 1EHLL 2Q8BH 4PYHA 2FSEA 1TITA 4N9OB 4WHTA 2VLMD 3SO3C 2BNUA 2G2RB 1J1XH 3PWPE 2P42B 1UT9A 1T1XA 2LQRA 5IVXE 5LGJA 4OFKA 3IDIB 5KSUB 3GMMA 4IEFB 3U7WH 1TQBC 2M2DA 4XMPL 2VH5H 4PJCB 3ULVH 1XF3B 3KR3H 3LS4L 1Q0XL 2LTQC 5DD5L 5CEYB 4N90D 3V6ZB 1CD9B 2MPAH 5HYJA 5FDWA 3MYZA 2R2HA 5JPMA 1S7UB 3NABH 1ZSDA 4JFDE 4J2XA 3FRUB 4A6YB 1UJ3B 3LKOA 3P9LA 4PPTA 3EYQC 5K9JL 3AFLA 1CXEA 4L9LB 3K7UA 5AEAA 4I3RL 1A3LL 1K4CB 2XWJA 3L5XL 5F70A 5E2UH 1H8OA 2DBLL 1U3ZA 1GHFL 2A6KB 2C3XA 5HHQA 1BD2B 3DX8A 5JW4N 1CK0L 3QULB 4NKDB 4HKBB 3VRJB 1J0IA 5C3LD 4FA8A 3DXAD 1MQKL 1KELL 4GMTL 3MRBB 2F74B 2Z8RA 4EJ1C 5AD0A 5JOPE 5KW9L 4PG9B 3GSQA 1A6ZA 5A2FA 3QUML 1HQRB 1SJEB 2FECI 2NR6C 1RUQH 4GG6B 4DZBA 2H32B 5TDOB 4N9GA 2NY2C 1MELA 1MF2L 4ESKA 3IJHA 2BXZA 3OWEA 4M62H 5IUSA 4FQHA 1JK8B 2OLDA 5HI4C 3S35L 3RVXD 4FQ2H 1V3LA 3B2UD 3QPXL 2NTFA 4EDXA 2BDNH 3S37L 1OGAA 5E94A 4HMEA 3C60B 2GYSA 3QHZL 4OZ4A 5DI8A 4ODTL 2EDJA 3FO9B 2YRPA 4KV5F 4G5ZH 4PJDE 2R8SH 5GS1B 4FQIH 4NUJA 4OCNC 5E8NB 5ADOL 1K8DA 1S9KC 4M7LH 3EZJB 2J4WH 4M8QB 1C16A 3TNNB 4ZSOE 1ZVHA 4PJAB 2AI0L 4K9EH 1F3JB 1YEIH 5ENWA 2Z9TA 4RMWA 3ETBF 4K23H 4WW2F 4YR6B 5MENE 5MHSD 3GI9H 3RZCD 4JQXA 3OG4B 3W2DL 4M7KL 4CN4A 1R3IH 3EOYG 4PGEB 1QBLL 3NFSH 2LFGA 1ZWIB 4IHOA 4ZQKA 2AABL 2VZ1A 1JGLL 1NCCH 1EJOL 1BJ1J 4Y2DA 4JDZB 4XNXH 2D9CA 2XI9A 4JZJB 4LLQB 5KAQG 1KT2A 2QL1A 4FABH 2CLRA 3RY6A 1HNGA 5DK2B 4AT6A 3TP4A 4TNVK 3RL2A 5JUEH 4WV1C 4ZO7A 2DYPB 4QWWD 5GJTL 3BSZL 3WLWD 3MFGB 2ZUUA 5HYSG 1MWAA 2QEJA 2YUWA 5C0FA 4QRRE 5SX5H 4Z7QF 4GSDH 2P5EA 4J4PC 4N8PA 3MLSH 3KJ6H 3V7AE 1YMMD 3VFUB 4OZGF 2QQKH 3DVIA 2YPKB 3QG7H 5E5MB 1MLCB 5DMYA 5EBGA 4YGAB 5L6YH 2C9AA 1MI5B 3QA3B 4R4NC 2A6IB 2DIJA 2Y1VA 4P23C 5E5UB 2QHRH 3IFPB 3VFNA 2O5XH 3RGHA 1WIOA 5DEFB 5J7CC 3FB7B 3GGWB 3KXFD 4PLJC 2ENYA 4PJXF 2X4SA 5E8EA 3VDBA 4K8RL 3UBXG 4CVXA 4JFHD 1WAAA 2BOBA 5KVFL 4LCWD 2B1AH 4JPWH 5DFVD 5FYJD 2NMSA 3RTQD 5I16B 3OAUL 4ODUA 1CFSB 2F53E 3C5SA 1A6TA 5DJ2A 1AD9A 3AAZA 5FIEA 3GSWA 5JA9A 4EBQL 3FQNA 2NY3C 3FQXA 2I5YH 3VFPA 5ID0A 2YPLA 1KB5B 3STLA 3O41A 2VXUL 1MY7A 1N4XH 1BFVH 4NNYB 2C1PA 2R2BB 3QWQB 4J3SA 5DUBA 4L8CA 2X4RB 3DJ9A 3K0WA 1S9YB 1JFQH 3BD4A 3JWNC 5GQBA 3HRPA 1PLGL 4QRTB 1DQQB 3I6LD 3CIQA 1GGIH 3IAQA 4YHNB 4CVWA 2I9LB 4E41E 3GHBL 4MJ5B 1PQZB 3G6AB 4F37K 1XH3B 5FECB 4HUUA 1KJ2H 3MLVH 3EDFA 1ZHBA 5FYLD 1G1CA 2XXCB 1T03H 1I7UA 4JKPH 1QBAA 4XC1H 3MNVB 3CFIC 3VXTB 1LHZA 3JTSB 4ODBD 4HZAA 3U1SH 1S7RA 3PNWA 4Z7UF 4ELMB 5IB5A 1BM3H 3JV0A 2IANB 3KLDA 5CIPB 1YJDL 4AEFA 2KPNA 4KMLB 3SDCC 3PWJA 1GZQA 4UT7L 4YHOL 1FVEB 1ERNA 5C0DB 2VDML 4KUCF 1WWCA 1CIUA 2GJ6E 4ZAKC 3ZSSA 4Y4HC 3MUHL 2BY3A 4LMQI 5D7JC 5MP6L 5A2IH 4P3DA 1F5WA 4G9FB 5GSVB 4KHXL 1QVOA 3SOBH 4HS3B 5EWIL 4PJIF 2FHBA 4Q0XH 5EU6A 3TVMB 3P77A 3BZEB 3H9HB 1M7DA 4PJCE 2FL5A 1BQHG 1ND0B 3P9MA 3WUZA 3MRHA 3IGAB 5I8CA 1XF1A 1F00I 2Q76A 1OAUL 4QHLA 3U0WH 1IFHL 3BQUC 5HI5D 4UTAL 5L2KB 1VGEH 1Q94A 5LAXA 3T0XA 3GIVB 5DVLA 4YDKH 1RHFA 4PY8I 4YHMH 4U0QB 2DTMH 4QHUA 3K81A 5GGVL 1J0ZA 1AJ7H 1ES0B 1BD2E 1J0KA 1KLFA 2FH8A 4G7VL 1BFOA 5EBWA 1H3TA 5E8PA 3QUXA 5B38B 1U8HB 4LLAA 4U3CA 5CJBA 1JPGA 4M6ML 4S1RH 4PJ5B 3MGAA 1KTRL 3HR5B 3NTCL 1JZ8A 3BDBA 5JW3L 1QSEE 2VLKD 1OM3L 3BWUC 2ZOKA 4OCXL 1RZIB 4YUEH 1JGUH 5IJKC 4P46C 4QXGL 3CFCH 3QIWA 2YUXA 1SHMA 2HLFD 2V5RA 4HC1A 1P4IL 3D39E 4F57L 3QFJB 3FT2A 3JXAA 5HHOD 1P1ZB 2FX9L 3SCMA 2QSCL 1Y0LA 5E9DB 4DVBB 4QTHB 5C0GB 2ESVD 2JB6B 2JJWA 2E7CA 2YUVA 3U0PB 2NY5L 2HKFL 1WBXB 5BQ7B 2GY5A 4KRPB 1F6LL 3OHXB 1MEXH 4K3DH 4QXTA 4TUKH 4BQ6A 3UTSD 1JWUA 4NO3A 3UJJL 1KLGA 1YYLL 4YWGH 1G1YA 2AJUL 3WIFB 1SMAA 4NKMB 3MTRA 4HFWB 4LPVA 3NAAH 4FQXB 4QRUA 5C0EA 2CRIA 2YA2A 1AGCB 5HYSA 5T5FL 3ARFB 5EUKB 4B5EA 3QDGB 1ONQB 2D0GA 3T8XA 2CLZB 4HDIA 1IEBB 1RUPH 2ARJQ 4X9BA 3U9PH 1EVUA 4J6RL 1WC7B 3QIUC 5T3XH 4CRPA 3VG9B 1CGVA 3OAZH 1PY4A 4LF3A 4IRSD 3BVNB 3H42H 2JJTA 2MHAB 4RAHA 3SGKA 1G6RH 1X3DA 2J88H 3L3OA 4F9LA 4M3KB 3JSSA 2GSIA 3S5LB 1MJJA 4FMKA 1N6QH 3UBXA 3OSKA 3FB6B 3NFNA 2OJZH 1ORQA 5FUOH 1HI6B 5E7BA 2VQ1A 2XWBA 5TJWK 1FV1B 3QH3B 1JGDB 4LPYA 3HUJB 3OF6D 1D5ZA 3CVHB 5EZJA 4YHPB 3D0LB 4NO2B 4PJ7B 4CVUA 4LSTL 2BNRD 4HJ0D 1AO7E 3GSNL 4OGXL 3V0AC 2DLFH 1C5CH 3BH8B 2B7DT 2PNDA 4NO0B 4NUGH 2WWMD 3VWKC 4X9FA 2VC2L 2VDQL 4JM2F 1A7QL 5DJ6A 3TFKC 3SJVA 4K55A 1DLHA 3KPMB 5J11B 4PRHE 4NC0B 1AGEB 4N0UA 4AZ8A 4GRWB 4MA1B 3RIAK 4MB5A 4PRPA 4ETQB 4O02L 1EXUA 3MJ7A 4LLYA 4P2RB 5EN2A 3V5HA 3BKML 4LLVB 1JHKL 4KY1L 5I1AB 4JFFA 2IG2H 1AC0A 5IR1B 4M8VA 1AGDA 3U30B 1OWRM 1Z6JT 3MYJB 3ZL4L 4UDUB 5I6XB 1T80A 2MOVA 1P2CB 3Q6FB 1V7NL 2AGJH 3U48A 2J8UF 3C5ZB 3MREB 3DPBA 3UDWC 4XVTH 1Y6NR 4X80H 3HRZA 4LNVA 5FO8B 5HYQA 1K6QL 2DQUL 1KEGH 5LBSL 3BI9X 3TBSB 2BP3A 1OD9A 1MCWW 3JTTA 3W9EB 3LEYH 5KOVC 1F42A 1F97A 2IBZX 4OKVB 3T04D 1Q9LB 4RFEA 5C0ND 4DKEL 5BS0E 1DQJA 3ULVD 3H9SB 4PV9A 1AXTL 3O81A 5C9JB 5H37H 12E8H 4FZ8L 4OCSL 3IRPX 4JZOA 4MVBC 5DMKA 2ED9A 4JLRA 2ZKHH 3LOWA 4WW2A 4XNUH 1FL6B 1ZA6A 4LIQE 1FHGA 4F58L 4HT1L 3QPQC 1XGRA 3NCMA 3VWJA 1I9IL 1NMAH 4X6EA 1S9WA 4NHUA 3HE6C 5CP7A 4ELME 1OTTC 4U6XA 1TMCB 5E99L 2IANE 4TN9A 4W68A 1FLRH 1I1AA 2VZTA 4BQ8A 3ARUA 4NT6B 3KAAA 3MOQA 2LAAA 4I5BA 3ZKXB 5C08D 2VIRA 5IVZA 3R1GL 5B39B 5EUOB 5I8OL 1X6NA 2B0SL 3I9GL 1CQKA 4JFED 1GIGH 2EH8L 3S35X 3QI9B 2JB5L 2FB4L 4OZGA 4E9LA 1Q8MA 3QSKB 4LSPL 3ARGA 2Z35A 1A5FH 5ADPH 1KTDB 4L3CA 2DQEH 1KF9B 2N56A 4XRCA 3OGCB 4PJHF 3VXUB 1VFAB 3QP3A 4NQVA 1NJ9A 4OFIA 4AENB 2AJXL 4MB4A 1G7PB 1H15B 2W9DH 4UIMA 2XZAH 4ALAH 4PJXA 4O2FA 5D96B 2FYYB 4AEEA 1IMHC 1JYXA 2XRAH 5I76B 3RWIB 5L2KE 5EO0B 1NCDH 5F1SA 5IW6B 2BC4A 1RK1A 1RV6X 5D1QC 3E6HA 5I8EA 3DX6A 2EH7H 3IFOB 4HMCA 1QFOA 1N2RA 1ITCA 1NKRA 3I3EA 4HFUH 4LMQE 1NEZB 2APWA 3AY4C 1OW0A 4HLJA 1ZT7A 1YPZF 4DTGH 1MPAL 4PJ9C 2XNAB 1QSZA 1CF8H 2LV4A 4K3JL 3T0ED 1J8HB 2Q8AH 1X4YA 3WHE0 3BO8A 4APQB 2X1OA 4H0HB 3QQ3A 4U3XA 1TNNA 3GSUB 5I71C 3QNZB 4F3FA 2EDEA 1HH6B 2P24A 3C5JB 1GH7A 5DSCB 3C2AL 3G6JB 1CVSC 2FIKA 2NY1B 1F2QA 1HDMA 3EYFA 1SVCP 1RZGA 4Q97A 4IRJB 4NM4L 5T3ZD 5JZ7D 4UU9B 4CW1B 2F54D 1RQ5A 2ORBL 1OT1A 4UT6L 2IQAA 4DVRL 5E9DE 2VDLH 2BHYA 4WWKD 4EN3A 3AU1B 4YX2L 4BSVB 1OVZA 3VRIB 1Z5LB 2FJGB 4Z7UA 3V4UH 3FQUB 5SWSD 2EICA 5I73B 5IT2L 2IF7A 4Z6AT 3UCRA 5DJAB 2NY6C 4LU5L 3RRQA 1K8IA 3INUL 3PHOA 1QFPA 3HCVB 5DZNA 3QIBA 2XTJB 4DAGH 2NX5E 1MWAH 3KPQA 3QDGE 3Q2CA 3O2WL 2A73A 2W60B 3RIFF 5D5MB 1FAIH 2DQDL 3AREA 5AZEH 1OP3H 3KLHC 1IGJA 4DN4H 5INDB 5AYQA 3ZT7A 1UJ3C 1MCQA 1KLUB 1WBZB 4MD4B 4HWZA 1MHPH 3KS0H 4PJIA 1U92A 4BM7A 3L5WA 1HHHA 1EO7A 5D2NE 1I7ZB 5DR5L 2R0LH 3VW3H 1AHWA 3LEVH 3GO1L 1FRGL 5IF0A 1A7RH 4NKQB 3CGTA 3RY5A 2XT1B 5TH2B 4EDWH 2A6DB 5HVHB 3V9FA 4DGVL 3U36B 1AY1H 1XIWD 3HUJE 3G5VA 5GIRA 2WBWB 2EDQA 4LRNH 1CLYL 1MNUH 5IWLA 3BISA 4PJ7E 2HLAA 2IALB 3EKCA 4HCRH 4LEOA 1A3RH 1MHHB 3LN5A 1G9MH 4XB7A 1FORL 3RDTB 3UTTB 3OXSA 1HCVA 5MEOB 5DC0A 4I2XA 4Z7WB 4FFWD 3MLRL 1KCKA 2W38A 2J12B 4JO3L 4K94C 4Z7VF 4BSWB 4QGTA 4WUUB 4JJHA 4GRWE 3ARBB 1KYOK 1R3JA 3THML 3PXHA 1Q72H 1NC4D 5ISZE 4WFHE 5LGHL 3RGVD 1X5JA 2E9WA 2HJKA 2X6MA 3P73A 5HGGS 2BNQA 3DIFB 5C0BD 4P5MB 2DLTA 3W39A 3GBMH 4I3SH 2G5BA 5CD3A 1G7MA 2D31B 2GFBB 1I3RA 3MNWB 3VH8B 1IGYB 1DCLA 3S98A 5CJQH 2HKHL 2AJ3B 3H3PL 3MRFA 2P7TA 4NFDA 1TZGH 3VXPA 4QY8B 1BWMA 4UI2A 8FABB 3VXSA 4H26A 1R3HB 1GOHA 3KLAB 4Q9BA 3TT1H 5J1AB 5EOTA 4NGHH 2YD8A 3FFCD 4H20L 1XF5B 3D69B 1UH4A 3AM8C 2F9BT 1UJTA 3DUSA 4JZJC 4W6YB 4OQTL 4HQQH 5LG1A 2PTUA 1E4JA 2CKBH 1A9EA 3SPVB 4GKZB 1FYTA 1AXSB 3T0VA 5J9PB 2VDOL 2EDBA 1ZLVK 4OBSA 2ZCLH 1FP5A 2GKIA 3QFDA 1FQ9C 1UCTA 3ZDZF 4BZ1H 4JCLA 3X3GL 2EYRB 3QHFL 5DFTA 5FCUH 3D3VA 3L3HA 4L3ED 3FFDB 2P49B 1RJLB 2H6PA 3F7QA 1KPRB 5DDHA 2P5WA 3GI8L 1A1NB 4IIQB 4GAGL 3N0PB 4IDJL 4I3GA 4OV6F 2Z92A 4XBPB 5D1XC 3G5ZB 1C7TA 2FR4B 1S7SA 3I85A 2AEPL 2XY1A 1A4KB 2FX7L 4LCCB 3V6FA 1NUDA 5SWZD 1QRKA 4XI5C 1IAIL 1T1YB 4I9WD 4PY7B 3O45A 2H9GB 2E7HA 4MA7L 5D7KD 1P7QA 2NY4B 4Z7NF 4OB5H 5KVGL 4JRYD 4LHUG 3QUMA 3BPCB 2R69L 1U95A 4JM2A 1HILA 4PRDB 2K9UA 5DRWB 2GTWA 1CDBA 1NGPL 3OR6B 1UWGH 3BIBX 1OGTA 5DT1L 1W0WA 2X41A 2PW1A 5MEPB 1ZLSH 3RWHA 3UPCA 1KULA 2EE9A 1J1OH 3EYOB 1UM4L 3BKJL 5GS2H 3G04A 1GC1L 3A6CH 4MXWH 1F90H 4HHAA 2X4TB 3CCHA 1OCWH 1FLTX 2IFFL 1RIHH 3HI6L 4ZTPH 4HC1H 3ARXA 2AEIT 4HUWA 5K93A 4U1GB 3QDJB 5ANMA 2VXSL 2XOTA 2J8UA 2VLLA 1TIUA 4WIQA 4G43B 1LEGB 4L4TB 1J8HE 5DD1H 2AQ1A 5T3XD 1AGBB 4Z77A 2JCCE 4WEUD 4XCFH 3TJHC 1B88A 3WNPA 5DVKA 2Y6SD 1U2HA 1F4XH 4QXUL 5EU4A 3FQWB 4OGZA 1JWSB 4OD1H 1RJYA 3O6FA 5F9WB 1MUJB 2C4XA 2G75B 3QUZB 3C2SA 1MRCL 1LDPH 1EO5A 1G0DA 4XHQA 5IEHB 5L8JB 3RJQB 3PP3K 3QWOB 1VA9A 4ZFGH 3GFUA 1BVKA 4M7LT 3BKYH 4Q2ZB 4ODVH 3HZYB 5IOPA 3EYUL 4ZUTA 4F7PA 3GKWL 5GRUL 4K3EL 3EDDA 1DBML 2NXZB 3MLZH 4HX1A 3WNLA 1BOGB 4QOKA 5T1LD 2X9YA 2YN5A 3L7EA 3DV6A 2IPUK 3TVMC 4CADB 3U9UB 5EZIH 2P8PB 2H1PH 3MSPA 4LFHG 1ITBB 3CXHK 2XTJE 3OPZL 3VXQA 1DBJH 1RUAL 3B5GA 4KKCC 1BBDL 5EU3A 4P23A 2OP4H 3MACH 4DGYL 3BAEH 2YSSB 4OD2A 5EPMB 4KDWA 1EZVX 2DMKA 5AYUL 3RUGB 3MMEA 3I75B 3RWCB 4Z8FL 3O2VL 4LL9A 4PJHA 1C1EL 4Y4FB 4EIGB 5GRXG 3WHXB 1ZTXH 2QTEA 2Y07L 3QXAB 2H2SD 4MNGA 4QRQA 4B50A 1ZANH 1T0PB 3EZ8A 3DECA 3WFCL 2ZSVB 2EO9A 1BEYH 4O5LL 3U0TB 4LLWB 5BMFH 2CDGB 5EH1A 4JY4B 3V5DA 3WJJC 3KPPB 3VXMA 2YC1A 5HYIA 3JV6B 2PO6A 1UB6B 1MVFA 3MLPA 3UTTE 1UM6H 3VD5A 1YPZA 1INEL 3PUCA 5E6IA 4GBXA 1NBYB 4Z7WE 5CINL 5FUCE 3FO2A 4NYLA 3S97C 1EAPB 4URTB 1P7HL 1I8KB 1WJ3A 3W0WE 3EYSH 2B4CC 4PGDB 5ACZA 3UYOD 2YPVL 3H3BC 4MJIE 1DBAH 4HS8H 2VR5A 4PRID 4YDIL 3O6KL 3VFWB 5IK3B 5EOCH 3MV8A 4HK3N 3T4AA 3RVUD 2BK8A 3EGSB 5GGQH 4LLDB 1UACL 4HPOL 2AK4D 2QADB 43C9B 5CILL 1A7NH 1BZ9A 3TNMB 4JRXA 4XH2A 5CZVH 4FQXC 3HLAA 4JQIL 4BZ2H 4O9HH 4H1LG 4O00A 3WE6B 2J6EH 2ZCHL 2PETA 4NFCA 4NM8L 3GMLB 3VD9A 2GSGB 3EAKA 2D4FA 3VFMA 1OWWA 4PJCF 1BF8A 4RIRB 1RVFH 1JWMA 3RIFK 2R56L 2GJZB 4OJFL 4RMVA 1KCVL 1WGOA 2HFEA 1MFNA 5D7JA 3LEXB 4Y16B 4QRPB 1JNNH 3TT3L 3JVGC 5D2NC 4KJWD 3U6RB 2MSPA 1FJ1A 4ZPTB 3W9DA 4ZODA 1CICB 3O3DB 5H94A 3GJFB 4P59L 2AQ3A 1T6WA 4GMSL 4HXAH 3CFKB 2Z31D 4JPIA 4LLMA 4OAWA 3SE4C 4YNYB 2DQHH 5F3BA 1UXSA 4LQFL 1TZIB 3L3JA 2ZPKH 4MXVE 2Q7YA 5ICXA 2OYPA 4F33A 4RAUB 2A1WH 1OGAD 1U36A 4KMQA 3KYAA 1TCMA 1XCTB 4S1SH 4NQEA 4U6HB 3WFBL 4IOIB 3BQUA 5BXFA 3DO7A 5H2BB 2YD4A 1RZ7L 4OCWL 4C83B 5DJYA 4LQ1A 2R2EA 1S9XB 2BSSB 3FONB 2VQUA 2VLRA 3MRPA 5J11C 3WFHA 4GG6F 2DLIA 4MZ2A 1R3LB 4RAVA 4G9DB 5EOQL 4FQLL 2RCSH 3HC4L 1GYAA 1IBGH 5C0AD 3VFOA 5JW4R 1NCWH 1ZLUK 1JNHB 4U31A 3GK8L 1QHPA 3U30C 5CP3A 1X5HA 4YHKH 3VCLA 2E6PA 4L8DA 3HA0A 2BVPB 2Y25A 3MROB 3MRMA 3UX9B 4OZFG 3TA3A 3O4LB 3C5ZC 1E6OH 3T1WA 4HBCH 4Z7VA 2EXWC 4JHAH 4YDVB 1YQ2A 4P46A 5DJ0A 4PJAF 4JKMA 3E0GA 1QG3A 3O11A 1KPVB 3MA9H 1K4DA 3A6BL 3MCKB 3PGDB 4DKAA 3BOVA 1FFOA 4ISVB 1ED3B 1ZHLA 5ICZB 2N7AA 4GW1B 2HFGH 3OX8B 3EDEA 3ZYIA 3BT2H 3QDJE 3L3IA 5FYKL 5GGUB 2P5ED 5GPRA 1LK2B 5EU5A 4JDVB 5ESAA 4L4TE 1HEZA 3VFGL 5IVXA 3QDMA 1EO8H 4XNYL 3FTGB 2XZCH 1JUFA 5IG7B 4HIHB 3U4EA 5L88H 3MNZB 5FA4B 3DHMA 3LVEA 2WBJA 1YY8B 1P9MC 4RISH 5I1KL 3LV3A 1IGTB 3UTQA 3ZTJH 1ZS8A 2BZDA 5L9DH 2MFNA 3QIUA 2X5PA 3SGJA 3ZKXC 4EEEA 5LWYH 4RGNE 4L1HA 3KDMB 3L3DA 5CJOL 3P11H 4YZFE 3Q6GL 1G7JA 1RMFL 1XGPB 4NNXA 5EIIA 2O61A 5IKCB 2PYEB 4WFEE 1RK0B 2ATPA 1MQ8A 25C8H 4JFXB 3SDDC 5DQ9A 2L7UA 3QI9C 2D7NA 5HHPB 2ZUQB 1IAII 4KXZI 3VRLE 1FH5H 4G8FB 2DB8A 2BJML 3T65B 2FZ3B 1N6VA 3NIGE 5IB2A 1RHHA 1RIUL 1IZJA 5IBUB 4M1CC 1MJ7L 3X14B 2M8XA 2NXYD 4P5KA 4QHKJ 5I30L 3DV4B 3OKNB 5C6TL 5BRZB 1KGCD 2XY2A 4ZPVB 4HPYL 3UAJD 3IDNB 1U42A 2DKUA 4HF5L 4X98B 5D96C 5IMMA 5DRZA 3VXOB 3JWOH 3VG0H 4MQ7B 5T1KB 4HK3J 2C3VB 4H8WL 5LXGL 3RUGE 4RMUA 4XPGH 3ROLB 4CNIB 4KUZL 5EBLA 1NFKA 2Y36L 5J12B 43CAB 4MDJA 4X7TB 1DQDL 4ZSOA 4LSVL 1QYGL 4N0FA 5FKPB 3RKPA 1BHGA 4X4YA 4KPHH 4ZS6D 1F6AB 1K3ZA 3H8NA 3QEQB 5MENA 3SDAC 1XR9B 5F7DA 4JGUA 4C55A 4M6NL 3PGCA 5ECJE 1YNKH 1HYSD 1LWRA 1U3HC 2XKSA 3LAFA 4L8BB 1MFDH 3CAFA 1L6XA 3QZWB 2NY1C 5GS0H 3FO0H 4KZEL 2VNCA 4DGIH 1U8JA 3CLFH 4S2SB 3MOBL 4IRJC 1JGVH 3UYRH 3OG6B 5C8JA 1A6AB 4BJLA 5EU6D 5I15L 1JYWA 4H5SB 2K3TA 2I07B 4FNLH 3K2UH 5T1DL 4XVSL 1FZOA 5DD6A 1TCRB 5GSRB 4OLZL 4PV8A 1OF2B 1I4FB 3RWDA 4ODXA 2Z91B 3EW3B 2VDPL 2IADA 5IMKB 4JN1L 4UIKH 3HE6A 4QRRA 3T1FB 1FFNB 3GJEB 4XMPH 4YK4C 3TBVB 3B3IA 5AUMB 2XTJC 3LS4H 1Q0XH 5DD5H 1Z0NA 3B9VA 5C2UB 3PQYB 4R90L 4LVHC 4X6DB 2DI7A 2V7NB 4PP1C 2OL3L 5HGHA 1LEIB 3QUXD 1YY9D 1WF5A 4O2CA 3JUZA 4Y19B 4ENEC 3GB7A 4YXLH 4QCIA 2K7QA 5HD8D 4I3RH 1A3LH 4PGZA 2GAZB 3L5XH 4N1HB 32C2B 4W4NA 3NPZB 2VAAB 3DVGA 4XMKL 2IPKA 4DW2L 3RVWC 5ABDE 1CE6A 2DBLH 5DVOA 2R2CA 1ZHKB 2YN3A 3NIFF 4PREA 4LNRA 1VHPA 3V6BR 2Y5TA 3BRFA 5GS2D 3V4VL 2F53A 1CK0H 3B9KB 5D1ZB 3HB3C 4R4BB 4MX7B 3EUUA 3MFFA 4GAYA 3QIWD 4GUPA 5HVHC 2Q86A 1MQKH 1KELH 4GMTH 5D71H 5JIHA 3SCMD 3QUMH 3ZE0F 5IB4A 4OZFA 1FGVL 3LB6C 3V5KB 5E4EB 4DWHA 4M6OH 2BRRL 1GL4B 5A16B 1MF2H 3RDTC 4L8SB 5BCAA 4JFYA 1UWXK 3OKLA 2RQ8A 1CU4L 1R24B 4OSUL 3S35H 3QQ4B 3QPXH 5FUCC 4NRYA 3VD7A 3AY4A 3QAZB 4E41A 3QHZH 5DQDL 4PJ9A 2OMNA 3WD5L 2PR4H 2HRLA 3DMMB 5ADOH 1PAMA 3UMTA 1HXMB 1MCJA 1GPOL 1ZVSA 4P2OB 4ZD3L 5LJYH 3BN9D 5M95B 4R4FL 3WV0A 3ISWA 1MCBA 5J56B 2AI0H 4CGTA 2A38A 3F8UB 4DZ8A 1EHNA 1CD1A 4HMDA 2O5YL 5A1AA 3W2DH 4M7KH 1CXKA 1CLCA 4PR5B 5C0CD 4POUB 1QBLH 3OJDA 4X4XA 1UVQB 1S7VB 3SE8H 1U58A 3BE1L 2AABH 1TJIL 3KHOA 1JGLH 1J18A 3DROB 4WFGE 3ZYOA 1Y6MR 4G42B 3BP4A 4P49A 1QSVA 1V3JA 3VD3A 3WNOA 2G2RA 4OF5A 3ARZA 2OR8A 3T77B 2E7LC 3F5WB 4LPWA 2A77L 1UZ6E 3IDIA 4OFYA 3HPLB 5GJTH 5KSUA 3VI3F 3GKZA 5E8OB 3PWNB 4PJCA 4OLYH 1CD0A 3SJVD 5DS8B 1XF3A 1NC2D 2YRLA 5CEYA 1CFNB 1CGSH 3V6ZA 3TBYB 2CLVB 4PRPD 1F45A 1GOFA 3TO4B 3DXAB 1S7UA 4ZXBD 5SV4A 1VGKB 1TJHL 4A6YA 1FL5B 4JFFD 3HUJF 4IIQC 4C4KT 1RURL 1X7QB 4L9LA 3ESUF 2VH5L 4PJ7F 1CDYA 1K4CA 4NZJA 3N1GC 4KMTH 4PRNB 1IE5A 3ZLQC 4LCCC 1EEZB 5BZWB 1X9QA 3ME0A 4K8RH 2A6KA 4QKXB 5ITBH 3GMOB 1BD2A 4PLKC 3F12B 4NKDA 5EZOL 4HKBA 2BVQB 1H5BB 3VRJA 1ADQA 1KFAH 5B21A 4YXKH 2NY4C 3MRBA 2F74A 1GVIA 1IC7L 3BEWB 4PG9A 2DN7A 3O6LH 1T22B 3C8DA 2EDLA 3QCVL 2UY6A 3ZHKA 4EBQH 2BMKB 5DYOB 1HQRA 4Y5XB 1SJEA 1XR8B 2VXUH 2FDBP 1A1MB 4GG6A 3KWWB 2H32A 4MAYB 5TDOA 4XP6L 3BH9B 4XNQA 4BA8A 4U49A 3RZCB 2X2YA 3CFBB 1T21A 1Q9KB 2Y4SA 1PLGH 2GK0B 4B53A 3C60A 3FT4B 1GZPB 3FO9A 2HVKB 5GS1A 3D9AL 5B38G 4U1GC 4U1KB 4HWBA 5E8NA 5K9OB 1TVHB 1H9VA 3EO9L 3MA7B 3TNNA 3RBGA 4PJAA 1JE6A 3V0VB 3I6KA 3F6IA 1F3JA 3QEQE 4JANB 1MCFA 4YR6A 3KPRA 4NQDB 4G5ZL 1I1FB 5HHXH 4FQIL 4OCRL 4OLUL 2IGFL 3QRGL 1BGXH 3CX5J 4Q9CA 4PGEA 3B8SA 1YJDH 2Z93B 4R7NB 4Q9QL 2CUHA 2J4WL 5F9WC 1ZWIA 2R0ZL 3GSRB 4EI6B 1ZGLB 1A21A 1OTUC 3QUZC 4UT7H 2WP3O 3T3MF 1NDGB 1CI5A 1KB9J 4R0LB 1BQLH 1YMMB 3AM8A 4JDZA 5ERWB 4LLQA 1BVZA 5C09E 1JV5B 5MP6H 1RZJL 2IAMA 3X3FH 4YEFA 1BJMA 4JAMB 4QT5B 3F6LA 5EUOF 4FXGB 2Z0BA 5A2JH 4JCMA 1NCCL 1NLDH 3KXFB 2DYPA 4U0RB 5EWIH 3S4SB 4U1MB 4LCWB 3DETC 2KZWA 1ZXQA 4WFFD 8CGTA 5IFJB 4P3CH 4MA8L 3RTQB 1L7TH 1HE7A 3VFUA 1G7HA 2YPKA 4G80B 5E5MA 1CVRA 4LPXA 5EU7E 2BY2A 5HJ3B 3GNML 1VFUA 2PTVA 5JUEL 1MI5A 3QA3A 4XPFH 5K9QI 4TUOB 1L0YA 2A6IA 4LCYB 2CDEA 1IFHH 3IFPA 1M6OB 1GXEA 5DEFA 4GSDL 3FB7A 3GGWA 1QPPA 4KQ3H 3S5LG 1D7FA 3P3YA 4MS8C 3P4NB 3BZDA 4MLIA 5GGVH 1T1WB 5L6YL 5I16A 2F8OA 4AH2B 4X83A 3T0DA 2QHRL 1NUGA 4U1SB 1T7YA 2O5XL 4M6MH 3K1KC 5C07B 4Y1AE 3B83A 1A2YB 3MUZ1 3L7FB 1KB5A 2UZIL 5CP3H 2VN7A 1OM3H 3PL6D 4NNYA 1FIGL 4LCUB 2R2BA 4YHLH 4OCXH 2V2XB 5AG8A 2X4RA 4MD5B 1S9YA 4X9IA 1CR9L 4I0PB 4F9PC 4QRTA 3MV01 4F7CB 1DQQA 1P4IH 4F57H 1E4XI 2Z8VC 1TNMA 1QNZL 3G6JF 4U7KA 1MCKA 4YHNA 4X4ME 5HI3D 2QSCH 4OIIL 3AXLA 2I9LA 5GS3A 4EZMA 4MJ5A 2R1XB 3QIBD 4KUCD 1PQZA 2NY5H 3G6AA 1XH3A 3FN3A 3S96B 4NOBA 4OF0A 3UYPA 1FFPB 3DBXB 1JPFB 3CMGA 5F1IB 3O3AB 4L5FH 1GGIL 3ES6B 3FQRB 3UJJH 3MRKB 3MNVA 4XTRC 3VXTA 2AJUH 3JTSA 2VLME 4TOYH 2FEEL 2QADC 3ECBB 4MD0A 5C70A 1DQMH 5DA0B 2IANA 5CIPA 1KG0B 3JUYA 5JXEA 5T5FH 1NCNA 4ZUWA 4BH7B 3D25B 1MCOL 1KJ2L 3MLVL 4OD3L 1SM3H 1FVEA 3FAXA 5C0DA 1T03L 2N1KA 4NN5C 4N90E 2ICWI 3WIHL 3D85A 3IDGB 1DVFC 5D5MF 3WKNA 1A6WL 2NYYD 4G9FA 2IC2A 2D9QB 4P4KD 4TRPH 4HUVA 2FD6L 1CICC 4HS3A 1NGZB 4ONHB 3BX7C 3TVMA 4UZGA 3DUHA 3LKNB 3BZEA 2VZVA 2GT9B 1WWWX 3H9HA 3IYLW 2DKSA 2X4NB 5D8JH 5JHDD 1ND0A 2XPGB 3FO1B 3F58L 2K1MA 3IGAA 3SGDH 5B39G 4OGXH 3SQOL 1BP3B 1W72B 1A4JB 3RHWF 3BUTA 5L2KA 2VLKB 4YC2C 2VXQL 5JOFB 4GXVH 4R2GD 3K80A 2VDQH 1A7QH 2BNQD 3L5JA 1TTGA 1MOEA 3MO1B 2ICWB 2DM2A 5BV7L 3BW9B 5JDSB 4R3SA 3BHBB 4HKXB 1ES0A 3RNKA 1QO3B 5GS0D 4KVNL 3HC0B 4Z7WF 1JHKH 4KY1H 3MBED 4E0RB 5B38A 1LEKB 5HHOB 1U8HA 3BP5B 4PJ5A 4QHMB 2ESVB 4YBQD 3T2OA 1KJMA 3HR5A 3VXSD 1F4YH 4KKAC 5CWSB 4Y4KB 3WJJA 4X4ZA 4AIXA 1HCFX 1D5BA 3U79A 1GGYA 1RZIA 2CJUL 1KJVB 2A9NL 2C4FT 1ZOXA 1IM3B 3VFTB 1RJZB 5MHSE 3SE9L 3QFJA 5J57B 2OR9L 5F96L 2ZNWA 3E6FB 1XF2B 2FCBA 1FYTD 1P1ZA 3EJYD 3FT3B 1NEZG 4DVBA 5E9DA 3QDAA 4QTHA 3TH3T 1AXTH 3DHJA 3TPUB 3U0PA 3QISA 1BJ1H 4FZ8H 3PDGA 5BQ7A 5I17B 3D3VD 5BVJB 3OHXA 2V5MA 4WWID 3BRGC 4F58H 3MZGB 1Y18B 4KC3B 5F1KC 2P5WD 4BKLB 4M5ZH 2IBBA 3R06B 4X9HA 3S36X 3WIFA 4NKMA 5FGBA 1QSFA 1I9IH 4YBLB 4HFWA 4L9DA 4FQXA 3E8UH 1AGCA 2YHGA 1E4WH 3ARFA 1MCLA 4B41A 3QDGA 4GLRH 5E99H 2CLZA 2COQA 4Q6IB 1MEXL 1P6AB 1DEEB 1QLFA 5DURD 1WC7A 4XHJC 3R1GH 3BVNA 1CLZH 1P7QD 1YMME 4S1QL 2MHAA 5I8OH 3QUYA 2B0SH 3I9GH 5D6DC 1KBGH 1CTOA 1WFTA 4JM2D 2EH8H 2DWEB 3S5LA 2NR6D 1EERB 2CQVA 1RUPL 2XWTB 1BQHB 3FB6A 3SE4A 2JB5H 1HI6A 5FM8A 3KXFE 3O4OB 4LSPH 5JLZB 2WWKO 1FV1A 3QH3A 3BYYA 2YD6A 2RR3A 1JGDA 1AQKH 3O8XD 4JFHE 5FYKE 3TZVB 1G6RL 3HUJA 2GK2A 3MV7A 3CVHA 5A43C 3D0LA 5J6HB 2J88L 5FYJE 1HH9B 4W6XB 4NO2A 4PJ7A 1NCBH 1N6QL 2JLLA 2AJXH 2LVEA 3BH8A 5FUOL 4NO0A 1JHTB 2UWEB 1UKSA 2IMMA 2KH2B 3CXDL 5GZND 3LDBC 5D7IE 3KPMA 3MJ6A 2ADJB 3IDJB 3I02B 1AGEA 1J8KA 1KSRA 1OAZL 4HS6B 4ETQA 4P2RA 4IMLB 5I75B 4A2MA 3BMVA 5I1AA 4LLVA 1BBJB 2OTUB 4NUGL 1J10A 4J3VA 3B6SB 5IR1A 3I6LE 5J12C 4K3JH 3O6FD 4P9HC 5E56A 2EE2A 3QCTL 5B4MC 3MYJA 4UDUA 1S7QB 4L1DA 1P2CA 4PB9L 2X4UB 1IKNA 3C6LB 3Q6FA 2NQCA 1UWXH 4OIAA 3C5ZA 1JZ7A 3MREA 4BQ9A 5F7FA 1FN4B 4QGYA 3DYMA 4XPAL 2CIKB 1D9KB 4OI7A 1E6JL 2XQYG 3TBSA 3C2AH 3QXUA 3OZ9H 4OGAC 4M43H 3W9EA 5F9DC 3EDJA 5FYLE 7CGTA 1U6AL 1YNLL 4GQ9H 2K7PA 2DJSA 4OKVA 1Q9LA 4PBVC 5EC2B 4NM4H 3BPOC 3H9SA 4FZEL 4QOKD 3PG2A 1NUNB 4XVTL 3CK0H 1CCZA 4UT6H 4XP9L 4KWUA 4DVRH 3OB0K 1FG2B 1T1ZB 3VXRB 1FL6A 5C08B 4KGLA 3LEYL 1YEHH 4YX2H 4FFZH 4KJPD 2D2OA 4Z76B 2VLJA 4YZFF 4KK8D 3TBTB 3VH8G 3IXTB 4LU5H 2MQ0A 1G6VK 1ZHNB 3X13B 1M1SA 4WU7B 12E8L 3INUH 1U8KA 3V0WL 2ZJSL 3VFRB 4K8RD 3PV7A 4X99B 1CZ8H 5C0RH 3VRLF 5KSAD 2A83A 4WNQB 4NT6A 1S78D 5EU7C 3O2WH 1FSKB 1WIPA 3K8KA 5F7EL 3VGDA 2O5ZL 5B39A 5EUOA 3PJSB 1ZLWK 1OP5K 1MCHA 3K1DA 5CCKH 4GKNB 1T89A 2I60L 4GXUM 1OB1B 1UCBL 5FO9B 3CC5B 1I8LC 2AKRB 2XYCA 5DR5H 3PE9A 3QI9A 1JNJA 5E0QA 1KIRB 4TSBL 4G3YL 3GO1H 1CQYA 2PO6D 2ITCB 3B9KC 4MDIA 5CGYD 1KTDA 4M5YH 3RUGF 4YFLI 1NBVH 3C9NB 5E6ID 3RA7H 4GBXD 3OGCA 4U6YB 3VXUA 1MRDL 1VFAA 4ODHL 4PUBL 4DGVH 3T0EB 1GRWA 4XXDB 1CLYH 2H8PA 4AENA 1H15A 4ZMAT 5I1CL 2FYYA 2MCPH 4HH9B 1T0NB 5E4EC 1FORH 1H3PL 3BZFB 5I76A 5ADPL 5EO0A 2H32H 1HSAB 4L8SC 5IW6A 1NUFA 3TV3L 3MLRH 4PJ8D 3IFOA 2P4AB 3DSNA 4HWUA 4JO3H 1NMBL 5D2LB 1NEZA 2J2ZA 3QAZC 4O2EB 3THMH 4JRXD 4UV4L 4BK4A 2XNAA 2A9MH 4U2ZA 2F54B 2ZCKL 4PJFE 1J8HA 5HHOE 4ZNCD 2E27L 4OZIB 1UZ8B 1PX3A 1ZK9A 4APQA 2ESVE 4TQEH 4WWKB 1BLNB 4P2OC 3E3QE 3GSUA 4YHYB 3QNZA 5HDBE 4NN6B 1HH6A 1T3FA 3C5JA 5IFHH 5DSCA 1YEKL 4O51B 4K7FB 4DTGL 5I1IL 3G6JA 3UTSE 3ZKMD 3M1BB 2HKHH 3NPSB 3H3PH 3T3PE 3MRJB 2FEEI 3KPOB 4IRJA 3STBA 2OI9C 5DJ8B 4CW1A 2KBGA 4NQCD 2ERJB 4ZO8A 2BVUA 3G5XB 3R4DA 3LKRB 1U8IB 5GGTL 2X89A 2VABB 5E95B 5HDLA 2YKLL 4H20H 3KPLB 5FXCH 3AU1A 5MEQB 4BSVA 3EO0B 4HBQA 3VRIA 2FJGA 1QBML 3O3UN 5ILTL 4DOHE 4OQTH 3TN0A 1X5FA 3L95B 1T83C 4NRZB 5D70H 5DJAA 4YJZL 1CG9B 2VN4A 4FTVD 5DZLA 3U46B 3HCVA 4LRIC 5C86A 4M3JA 1GGBL 4KKLD 1IQWH 4WW1A 3LZFH 1T20B 5FDYA 3QHFH 1KCLA 4KZDL 1NSNH 3V4UL 2JK5B 2GITB 3DI2B 3SO3B 2W60A 5D5MA 1Y6KR 3B5HA 4KDTC 1XIWB 1NFDB 5INDA 1YC7A 4JN2B 1KLUA 1WBZA 4P2QD 4MD4A 1SYSB 4D0CB 1PKQB 1IC5H 1EEQA 3TO2B 2BNRE 2LTQB 2FX7H 4RZCB 1E27B 1I7ZA 3REVB 4DAGL 5TE4H 1R5VA 4ZS7H 3KPSE 4PGJA 2ZG1A 4PGCB 3TA3D 1FAIL 4TYUA 4YE4L 1P84J 3RVXC 3B2UC 2V6HA 4CUCA 5CKGA 3UTPD 1T2QL 3WXVL 5TH2A 4P46D 4MA7H 2A6DA 1H5BC 4JHWL 4KKBD 4D9LL 4XZUB 3U36A 5ESVB 2R0LL 1S8DB 2R69H 3RGVB 2IALA 4Y5XC 3ARDD 5C0BB 1MHHA 4WENB 5HHMD 1NGPH 4JJ5A 1KB5H 3RDTA 1HKLL 2UWEE