2VERA

Structural model for the complex between the dr adhesins and carcinoembryonic antigen (cea)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
143
structure length
143
Chain Sequence
b'EECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGYWAKDNKQGFTPSGTTGTTKLTVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFIMBRIAL ADHESIN AFA-III
molecule tags Cell adhesion
source organism Escherichia coli
publication title Binding of Dr Adhesins of Escherichia Coli to Carcinoembryonic Antigen Triggers Receptor Dissociation.
pubmed doi rcsb
total genus 24
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2verA00
1USQA 2IXQB 2JKLA 1UT2A 1USZA 2BCMA 2W5PA 2JKNA 1UT1A 2VERA 2JKJA 1RXLA
chains in the Genus database with same CATH superfamily
3II2A 4P49A 3NIGB 4NI3A 5F9OH 1HJCA 4Q0XL 5GGUA 4ZX3A 4A6YH 3SDXA 2W0KA 4XNXH 1S9YB 1XIWC 1F00I 4YNYB 12E8H 1KGUA 1P7KA 1TETH 1YECL 3OKOA 4M43H 2YC1A 5EBMA 3U9PL 3CZEA 3INUL 5I0YA 1WYJA 2DMGA 3DIFB 3FHEA 4NUJB 3U4AA 1G43A 7TAAA 5I73C 3V0IA 5L0QB 4I3SL 4YH6A 5FO9B 5IESH 2CDEA 3OMIB 1BBDL 3BFQG 4Q14A 4FMFA 2H1XA 5DD5L 3EYVA 3RVXD 3N40F 4AL8H 2CRIA 3LIZL 4NRXA 1MW1A 4NRXB 4Z3GA 4GUPB 2FSDA 1L6XA 1WIPA 3H7LA 2OXGB 4ZT1A 5C0EA 5DI8B 5DUBA 1ODUA 1HINL 5SWQB 4OFKA 1EPFA 1U8OA 3CSPA 1WUNT 3K8MA 4XZ4A 4DP8X 5SWSB 3D9AH 3VRLE 1MFNA 4WEBL 5A1AA 2YZ8A 4R9HA 4YXHH 1UGKA 3SGKA 1KB5B 4M7LL 4CBZA 1KCRL 2DRUA 3D39D 1WFUA 1Q0EA 4YDLB 4J3BA 2PF6A 2Q1EA 4AG4H 4KK9D 1L4IA 1U8KA 1GSKA 3DUHA 4HJUA 4NXSA 4P99A 4XVTL 5E94B 5HHXL 2D9CA 4F7CA 3A6CH 4YFLI 1K5NB 5I23A 2YBRB 4J2XA 3O4OB 4OBRA 3WGVB 1H15B 2NX5E 1YLBB 2OJ1A 2OM5A 4Y2OB 5J1SC 4OFYA 4P4KC 1PG7H 1M71B 3BPCA 4N6RB 4OFQA 2CMRH 5AD0A 1G1KA 1U2YA 4KO9A 2B1HH 3HE6D 4IOSA 4RDBA 1A1NB 1TMQA 4I5BA 2AVFA 5E4AA 5HHOE 5IJVA 1E4WH 4MDIB 2IVFC 1U8MB 1AGBA 2JH2A 4JM2A 3IDNB 3JV5A 4KAQL 1EQWA 4JPWL 3EG9A 1NBZB 2X2IA 3I6GA 3ZJAA 5ADOH 2VZOA 2ZKYA 3EJCA 2XQYG 1AS6A 4FYQA 4RX4D 2Q3XA 1S9VA 1N5AA 3HBQA 4G9DA 5JDJA 2NY4B 2QVFB 3VFTA 2YPLA 4M02A 4WV1C 2Z8SA 3FCUB 4RBPK 5DHYB 3LKNA 4NFDA 3PRZA 2AEWA 2ATKA 3IRCA 5ESQB 4MS8D 1RD6A 3HE7B 4JGMA 5I75C 2X89A 3RB7A 3FUKA 4EIUA 1AXSA 2VN4A 2FL5B 1ZLEA 1ZANL 5FGBA 5L8JB 4OIBA 4GI6A 4QTFA 1PZBA 4KO7A 3TCLB 2D4FA 4CW1A 4MQXD 4ANXA 1KGWA 4O2FB 3KVQA 1S7SA 2NR6C 2X5PA 4ALAL 5D2NA 4JY4B 1KB5H 4NOFA 1AP2B 1ND0B 4UDTB 3NIDE 5C2BL 1EAPB 5EIVA 1G6RB 2ZCLH 2ZCKH 2EAEA 5D7JA 1FL6A 3ESPA 3ZDYB 1P4LA 3TYGL 1NCNA 1H9DA 1BQHG 1RUPH 3FT4A 2OYKA 4BFJA 4YHPA 3U0PA 3I3DA 1S7UA 1XR9B 3D0LB 3VGGA 2WWKT 4E36A 4R4BB 2BJML 1K9TA 1RULH 3CLEL 2NSMA 4NJ9H 5DFVD 5A40E 1RURL 3DMMA 4GO8A 3V4PB 1CLCA 1E3FA 1HL5A 3CBRA 3GK8H 4FX5A 2H3NA 4PGJA 3WG7B 1QYGH 2N7AA 3EYUH 1T6BX 1YEFH 1QAWA 1WIUA 5CKGA 4Z7UB 3N1MC 1L6PA 5JORB 1OGAB 4PV8B 3DSFL 2BOCB 5KUMA 5ITBH 2RFXA 4H2AA 4NZRH 5GJSH 1NBCA 5GZND 1AC0A 1BBJA 2WWMC 1I8AA 2D2CC 4YEFA 1OD9A 9PCYA 1IFHL 4FI8A 1QFPA 5J6GB 5B1AB 4DCQA 3NBNA 3KPLB 1WLHA 1OSZA 4JO1L 1XMEB 2Y1AA 4MBRA 4P04A 1PKQA 3CZGA 3OAZK 4DEUA 4FJYA 2FZ3B 2JQZA 6PCYA 2B1HL 1IBHA 1TQBB 3DIVA 4N8VB 3BGMA 3VG0L 1CU4L 2AV1A 1BFSA 1VEPA 3RWEA 1CTOA 4D7BA 3MRNB 1HE7A 2ZTBA 5CJXA 3P3UA 1BG9A 5E2VH 1CL7I 4PJ8C 1D7DA 2CHZA 4LAJH 3ULSB 4JK0D 1E4XH 5HYQB 5KVFH 2JB5L 3GLAA 2ESVB 4H8PA 2YGPA 3ECWA 3L3OA 4WY7L 4MAYB 2UZXA 1Z3GH 1UJTA 2D0GA 4LLYA 4WEMB 4DN4L 1F4XL 2ENPA 2ZUXA 3K71A 5C0NC 2J71A 1KLUA 1YJDC 4XMWA 3BUIA 1CL7L 4PG9B 3S35X 1IIIA 4J3UA 1OAXL 1AACA 4IBQA 3S0PA 3W9EB 2WXIA 3ZBMA 2L0DA 1HZLA 4OD2A 5C8JA 4XAWL 2VDKB 1EZVX 4FFZH 4V1DD 4LIQH 4GQ9L 2ARJA 5FUOL 1UD6A 2X44D 3ARGC 2F5AL 3NH7L 4PJDA 5E00A 5HJGA 4C56D 3TONA 1AYRA 3R7QA 4KHTH 1U93A 1RUQH 3Q3GB 2YA2A 4MXQD 5J3HC 2P5WE 1XCXA 2D03L 4R2GD 3IJSB 2UWEB 4IHBA 3QHTC 2VKWA 1BEXA 5ICXA 4MA8L 5ISZE 3CCHB 3PHSA 1TZIB 4NDMB 2GJ6E 4TQ8A 1OTSC 4V1DE 3QUZB 3J8F7 5T1LA 4TNFA 1CGTA 1AR1B 4WK2B 1Q72L 4UOZA 1RMFL 1RERA 4AGNA 2XKNB 4D9LH 3WKYA 2NXYD 1D5ZB 2QPSA 3KDMA 1XF5A 3O3BB 1DBML 4HUUB 5G55A 3ULAB 3RWFA 3I02A 1ZT4B 1A4CA 3R4RA 4NO0A 4OGQC 1JNLH 2Z7WA 5F3BB 3UMNA 5J5EA 5L2JB 5LDSA 4PB0L 3UTSB 5IV2A 5E2TL 1RCYA 1VCAA 3BPLC 3D4GA 4OFPA 2OMVB 2Y7QB 4TVUA 5BUGA 1AHMA 1UM6L 2IH3A 3N5AA 4PLJD 3VXOA 4CSZA 3LQAC 4O58L 5INCA 2VSCA 3BEWA 5F1SA 2YGQA 2RACA 4PTUA 3CD4A 3P9WB 1ET8A 2H3KA 1N3NA 2VN3A 1FNGB 2XZCL 4KTYA 4JFFE 2QADB 2XFXA 3E7JA 2G4EA 3PHOB 1MCWM 4NQSA 3VRIB 3VWJC 4PGZA 1C5DB 2CRMA 2IALB 3B7SA 1FYTA 4IRJA 4KTDH 4QR7A 3CVCA 4HPYH 4EI5D 1GGUA 4JKWA 1ZT1A 3ETTA 4MD4A 4K23H 1CICB 3QC6X 3NTCH 3ARBA 4DP7X 1OXYA 2ENQA 1AR1C 1BIHA 4IDJH 5C7ZA 4R4NC 1XGPA 1ZVSB 4Q56A 1EXUB 1MIEL 1N67A 3PDOA 3CX5K 1EBPA 4J1UA 1GGIL 3ZDXE 1MSPA 3HC3H 5DUJA 4DGUA 4G6FB 1DLFL 4YIQB 2NXYB 1GZQA 1S3KL 4LLQB 3B5GA 3V0VA 4YSUA 5HYJE 2KZBA 3BLKA 3ZR5A 2HPOA 3MLUH 3QDMB 3QQ3B 4JJOA 1A7QH 4AJWA 3U4KA 3KHOA 3ML9A 4O51B 5EN2B 4UNVA 1R3HB 3QYCA 4M6ML 4WHCA 4WUKL 2Z4QB 4QD2E 2APSA 3I75A 3KNBB 3MV9D 3QPQD 1OM3L 1G9EA 4RMSA 4WZ9A 1ZVSA 4P07A 1E6JL 3GQFA 4LSPH 1U8NA 2PP9A 1TSHA 1I8KB 4AQ1B 4P9ML 3HN8A 3KH4A 5A2IH 4W9GC 1EFQA 3IXTA 4YBQC 2DF3A 5DJXA 1ZS8B 5FW6A 5J6HB 3E6HB 3AXLB 1KJ3H 1RIUL 1S7RB 3QQXA 2D7NA 5J13C 2Y7NA 1LO3L 4QXUH 4W70A 3TN0B 4H0LC 1M4KA 3FRPA 4NWUL 3IF1B 2QZ5A 4IMLB 5E4OA 3KWUA 3ARDD 4M5YL 1KFAH 4PJ8B 3RWEB 4CN1A 1J5CA 3EG9B 1MLCB 1M1SA 4R8WL 1VFOA 4HT1L 2YPLB 2GTWB 2KQNA 4XVUC 5DXWA 5HVGB 4B7LA 1E43A 3DX0A 3HZVB 4NXKA 4MJ2A 1ZHLA 3OGCA 4ZFOL 4H20L 2EDRA 3KPLA 5IQNA 3CQPA 1KJ3L 4YO0B 5D7JD 1R0AH 3NN8A 5B1KA 4HIIA 4JE0A 1AZUA 4R4FL 1AKJB 1LD9B 2O5YH 4J8QA 3A67H 4R4FH 1MWOA 1BAFL 3PYCA 3GMLA 5IK3B 1RHHB 1UQSA 2DMCA 3S37X 2OX5B 3LKQB 3TBCA 4ZUWA 1DVTA 2V2WA 1AGEA 4H8UA 4XCYB 2BVPA 4UQ3B 4FNUA 1N8ZB 2APXA 3IM1A 4I0KA 3GMNB 1IC5L 1NC4B 3MV11 2CNZA 3EBHA 1ZEAH 4D9RE 1WGVA 2GKIA 5ECJE 4UOW1 2P8PA 2XT1B 3VWJA 2HWZL 1WTLA 4PV9A 1QPPA 1J5OL 2FR4B 3GDCA 1HH9B 2O6EA 3ZTNL 2Z7UA 4XWGL 2P8LA 3H9HB 3CV5A 4X4YA 1HEZB 3KH3A 3MRFA 3HC3L 3IKCB 4BV1A 4C54A 1CCZA 4UQBA 2IAMA 1K8IB 1FIGL 4WHTA 3N1FC 4P9HH 2FO4B 1CTMA 4LO9A 5IOPB 4ELMA 4MAUL 1SHWA 3B2DC 2VLLA 3AY4C 1H5BA 3L3HB 4PVBA 3C8KA 4K7PY 2LABA 1TYEB 3NCCB 4E9LA 1OAZL 4MXVE 4J2QA 4MJIA 4K5OA 1JZ7A 2NY4D 1KFGA 3WS6C 4M6MH 1IV8A 3EF4A 3NA9H 1WHOA 4XTRC 3V4VB 4QRFA 4AH2A 4W9FC 3HIZA 3CTTA 4Z18A 4OY9A 1A7OH 4YVUA 3NCFB 4JAMA 4UM9A 5E8NB 3NIFE 1D5XB 1MAMH 3LJ3A 4WSGA 5FDYA 1BWMA 4FULA 3TBWA 4WSKA 4HEPG 3VH8A 4Q74A 1S9YA 3NEXA 3MACH 3QNXB 4UU9A 2DEXX 4NNYB 4F7TA 5ITBL 2V0AA 3EBAA 4DEWA 1GJIA 1PDKB 2ZAIA 4XB7A 3ZLQC 5FYKH 5JZ7D 2NXZB 2H3XC 4BQBA 3QJQB 1HZHH 2C3XA 4BCZA 4BFRA 3UTTA 1MVUA 3SDAB 1J9QA 3T2OA 2NY4C 4NP9A 1WZMA 2TSAA 5H37H 3MROA 3QWRD 4RWHA 3UROR 1J48A 4W1TA 2PTVA 2ZKMX 3WHE1 3QUXB 4JY5H 2XN1A 3CDYA 3LIZA 4PJCF 4X7FC 1BHGA 2VQTA 1H8LA 2A7BA 3PL6D 4W68A 3E3QC 1AZRA 5F9WB 3TPUB 1J8HD 3BWUF 4PJGE 2KS0A 4TM9A 3UAJA 4HFUH 3S34L 2FDBP 3FW6A 1R3JB 1SZNA 1CR9H 3M46A 4ADJA 4LDLB 2G5UA 3N9GL 5E99L 5KS9F 4HC1H 4TNGA 1CXEA 4G9FE 1FVEA 3IDJB 1CLYL 3B2VH 4POUB 5C0BE 2QKIB 1P84K 5EU5A 2C9RA 4P2RD 1E8ZA 3L3JA 3KM2A 5L8LB 3AB0B 5F7UA 3HHSA 5I6NA 5L4JA 3QYNA 5GISH 3HNTH 2HFGL 4NN6C 4RQQA 3FXIC 3S98A 2K0RA 2Q3ZA 4V2BA 2YQBA 5AYUL 2ITCA 1CGVA 2O1AA 3QDAA 1HKLH 3MBEA 4QOKD 5DI8A 1PD6A 3T0ED 2H9GB 4AUJA 1IGCH 4I3GA 1R34A 4KJQD 2YAPA 5HDQH 3VWKD 5L0QC 4EO5A 4GI8A 1NEZB 4KAQH 4DKDC 3LXUX 2R8SH 5CEZD 1X9LA 4ZYKB 2YC1B 4GAGL 1RZ7L 5T1DH 3ZT6A 1TQVA 2AERT 3FULA 4PLKC 1DBKH 4UNTA 3QZNA 3SYCA 3TJHC 1JV5A 3OC8A 4EBQL 3U1QA 2IDCA 4NUJA 4W9LC 4Q9CA 2NUPA 2CKNA 5E4IA 5E2UL 5JW3L 2Y7OA 4KWUA 4RZCB 1KGJA 4PB0H 3HZYB 1TG8A 2JKTM 3W82A 2R23A 2C7UA 3MODL 4QOKE 3T0EE 3T0XA 4DJMA 1KPUA 3LKSB 4S1DC 3UC0H 2UY7A 5DHDA 4U1IA 3TC9A 1AANA 3FSOA 1LK2A 1MFAH 3HMWH 3VAEA 5IHHA 4FQQB 2HX9A 4P23C 1SN5A 5AKRA 5FM5O 2M83A 4FQQA 2JKXA 5LNDA 3SDXF 3VX0A 6FABL 4HBQA 5HHME 2OK0H 2DBLL 4JEGB 3QXAB 2KDYA 4OFVA 1A5FH 3CPLB 3RWCA 2KPWA 1SYVA 5IHWA 2OZ4L 4XO4A 2E9GA 4XGZB 3WFBL 1BFOA 1NLDL 4M4RB 3SB3A 4IDJL 1K5NA 3MCLH 4FXGC 1IM3A 2XWTA 4M6OL 3RHWF 2DI9A 4OLXH 1SVCP 3F64A 1QFHA 2BJMH 3CLEH 3DBXB 2LAGB 2XWBA 3MREA 5F1NB 4TLSA 1LYQA 3NJHA 4G6AD 1KCUH 4L8SC 2VN6A 4HIJB 4NKDA 3QUHA 1HC1A 1KIQA 1OHQA 5E6IB 3VXSA 2NY3B 2WQSA 1CFNB 3A6OA 5IOPA 1UTDA 5JW5A 3P4OA 5CMAA 1EH9A 3AM8A 3ZDXF 1FJ1A 3P3SA 1AZBA 3DJRA 2OXHB 4QTHA 1TEFA 3TV3L 4GUQA 2NOYA 3D33A 2FWOA 4OGYH 2NX5D 3ROOA 4U1KB 1UGNA 2YUVA 3UG4A 3U9UA 3FUIA 3ZE2B 4X6CF 2NLJA 4X0KB 5FW8A 3B2MA 5KSBE 2DLEA 3FU9A 3TL5A 3E8UL 5JLZA 2Q2LA 1DSFL 3H9HA 5F9DC 2Z31B 1DSFH 2LR4A 3LIUA 3QQ9D 3IMWA 1F45A 4PJIA 3CFMA 5DQJB 4PD4J 2V2TA 5BJTB 4NRYB 3SDXE 4KX8A 4JG9A 1MFBH 1FGVL 2IH1A 5MI0C 2YLHA 3OJDB 4AEFA 5BW7A 1T6VN 1E50A 1KENH 5DC4B 5C08A 1WVZA 3HKZA 2MPVA 3GM8A 1JE6A 4UQ3A 2CO3A 3MLUL 3Q5TA 1JDCA 4X6BB 2F9BT 4LASH 1LWHA 3V0WH 1ETJA 1NFIB 3RVTD 1ORSA 2JELH 1IC1A 3DX4A 5CIPH 1GIGL 4FFYA 3VXNA 5FYLE 3CLFH 3ZMRA 2FEEI 5AWNH 4LSSH 3FUFA 2EDMA 4IU3A 1CYXA 3ZHNA 3DPBA 4BQ9A 2C9SA 4PJFB 1YNTB 3P69A 5A16A 1GJWA 3T0WA 1WO2A 5EZIL 4XX5A 2HP4A 1TVHA 3AG2B 1BD2B 3L7EB 4FG6D 4PD4K 4GRWH 4LP4A 5E2WL 3FRPB 1HEJC 3M7FB 4M7JL 5BRZE 1Z9LA 1NCUA 1AD0B 2GJJA 3MRQB 3GF8A 3RDJA 3QVAA 2YWYA 4OCXL 4ENEC 3I02B 4TSCL 1KACB 2RAMA 2X28A 4N1EA 1ZLUK 4Z0XB 3HLAB 4PWIA 4MXQC 5AZ2L 2VDOB 3QXDB 2E74C 1T2QL 2FHCA 1L7IL 2OL3A 5D4JA 3MRHA 4Z7VB 5D8JL 3BPNB 3OXSB 3UP6A 1CB4A 3QW9A 3MJGX 4YSSA 4N5ED 5JIDA 3BZEA 1URLA 3CHXA 4XPTL 3T3ME 4Z77A 2BP5M 4UDUA 3TO2A 2G9HB 5DJ0A 3A5VA 1ITBB 3S97C 1GAFL 3MUGA 1NICA 5MEQB 3B3BA 4YDKL 1QATA 1DN0B 3L3HA 3BAWA 1IRAY 5DMGD 1H5BB 4JPVH 4FQHB 3AREB 4XXDB 3BUPA 4DUXA 4P2OB 3D0VA 2DWEB 4WKZA 5E9DD 3Q8CA 1B0RA 3WFBH 5ITFA 2BMKB 4ATWA 3BRFA 3CLWA 5D8JH 3P73A 2VDNB 5D1QE 3ELAT 1A5FL 32C2B 2R0KL 3JUYA 3LYRA 4IBSA 4F1ZA 3TJEL 1T1WB 3WJJA 3H6AA 5FGCB 3T1FA 4PJHE 3TJEH 2JLPA 5JIIA 5CINL 4JBSA 4DQOL 5FLVA 2HVKB 2DL9A 3HMWL 4HS3A 5K9KB 4TNWK 4I7ZC 1AJ7L 1X5GA 3FO0L 4M56A 3PUUA 3Q6GH 4GRWB 1R3LA 5BZXA 4QNPE 3FT3A 3GPEA 2BVPB 3HNSL 4KROD 2OSXA 5DWPA 3DO7B 3RUGB 2AJVH 1AGFB 3WFDL 4HJ0D 3FO9B 2EUVA 2YD6A 4I3SH 4HJGB 4PP1C 2PXYA 4JPIA 1B9KA 4HCRL 1D6EB 2B9AA 1JAEA 4Q2ZA 5GZOD 2VLKB 2C3GA 3BSZA 4IIZA 4KDTA 1HHJA 3SY0B 3W0WB 2CO1A 1E5UI 1OAXH 3BUTA 2FVNA 1CL7H 1SGKA 4UYPA 5EUKA 2ZWKA 5GGTA 2J5LC 1JJUA 4C56E 1R9FA 1CFTB 3GMPB 4WU5B 3GRWH 5HDOA 4B5EA 1BYPA 3FPYA 2BCKA 2BM3A 4Y2LA 4CSSA 4PRDA 1P2CA 3IAGC 3Q01A 5JXEC 3RWFB 5BVPH 2BNQB 3ABGA 2EILB 2VZVA 2WSKA 2Z1KA 3B6SA 5KVGE 4YL4A 4PJ9A 2HLFD 3QISA 1XZWA 4BYHA 1M6UA 2ZCZA 5DRXA 2Z1PA 5EN3A 4M7ZB 1XH1A 2VR9A 2X42A 7PCYA 3LZLA 4CU7A 4HS6B 1BZ8A 3VTAA 3OHXB 1DJSA 2M8XA 2ZSVB 3II1A 4WWNA 5HHPB 4P4KA 4BA8A 5AW2B 1I8KA 1QBAA 4P2AA 2VT0A 2XWJA 1PZCA 1AD9B 3V5KB 2QADD 2BC4B 4HFUL 2EDQA 1EO8H 3MRCA 4NUGH 4APQC 5IFJB 4LLQA 5GPRA 4DGYH 4OD3L 2R69L 2HTLC 4N2HA 1R24B 2X3CA 2ZJSH 4FQHA 5CCKH 4S1SL 4QGYA 1KENL 4U49A 3ULVD 1U8LA 1JVLA 2KYIA 2OJZL 3N50A 3LNIA 2NXZD 2VWEC 4FKEA 3ZQXA 3TF7C 4B27A 1ND0A 3KPRA 2BY1A 3R0NA 3HRZC 1CF8H 2A3TA 3SDCC 1SFDA 2CO7B 4YAQA 4NZ8A 4A7GA 1JF5A 3VI3F 2PO6B 3B2VL 4Y9EA 5BOPA 1TSRA 3HG1D 1J18A 3ECUA 4PJAE 4X6CE 3L5WA 4W9ZA 1UUNA 3G08A 4P2QB 5D1QC 1F4AA 3PL6B 4XBEL 5IMMB 1DZBA 4JVPA 2RGSA 2JSFA 1J5HA 5FYKD 1T04A 1AQMA 1TMCB 3C6LC 4LU5L 4ODXB 3ZTNH 2X40A 3U0TA 3MLPA 2W60B 1RUKL 4HUVB 1FYTB 4IRJB 4Y9CA 2A4CA 2H7WA 2K7PA 3NABH 1UJ3C 3CFKA 2XRAH 4QRSB 5CEXB 3BGFC 1KGYE 3X13A 5J1TC 4QWWC 2CLVA 4OF5A 3GSVA 2Z8VC 5FGCE 4H13C 1XDTT 4HJJH 4OJFH 3WLBB 1E5AA 1T7WA 4LHUA 4ZO8A 3NCYS 3IAQA 5ESVB 2EC8A 5CEZL 4LOEA 2FJUB 3KAAA 3IJYB 2LVEA 5AD0B 3HG3A 4PRHB 4J3SA 4P9HL 3ZT5A 1QEWB 1JXGA 1Y1UA 2XKNA 3U36B 4YWGH 5I1JL 5JNYA 1AE6H 5KG9A 1C7TA 3O81A 2IDQA 3PREA 4OUOA 1A3QA 4RLDA 1NWOA 5EU7C 2ZNXA 4P2YA 5JHDD 4ZG1A 1JGIA 4HA1A 3FBKA 1NUFA 5T8IA 3AADB 5FFLA 4GKNA 5ACZB 4HDIB 4GBXD 3MRLA 1XSIA 3QUYB 4QIRA 5D4IA 4ERSL 2C4FU 1NKRA 2WYTA 2P80D 2XTJB 3GIVA 4WCYL 5A2AA 5D7JB 1B4TA 4E9TA 2Z91B 4U1JB 1R46A 4TQIA 3U48A 2Y5EA 4PSPA 3WNOA 5JLZB 3CIAA 2GC7C 4NQTA 1XR9A 2X4SA 3D0LA 4ALAC 3CN4A 1UEMA 1XD0A 1FWXA 5I1GL 1WZLA 5CEZH 5C97A 3UADA 1E4JA 4UMGA 2HT3C 2XWZA 2E6JA 4JZJB 1TQBC 4O2FA 2ZUVA 1NCTA 1BZQK 4LPWA 3JTSA 3QDME 2EVGA 3S3DB 3CBJB 3GSXB 3MGOA 4G71B 3V10A 4MMYB 4HIXH 3P40A 3O41B 1YYCA 2ADYA 2YPKB 5CM1A 3IK2A 4JFOB 4YDLC 3MRIA 4N22A 2O30A 3L3OB 2BP0A 2PCYA 2UXVA 1MFMA 3QDJD 4OU3A 1RUAL 4LCWD 5I5IA 1KBWA 1QI5A 2EO9A 1B4JH 4PJBB 3FQUB 4DESA 1KLUB 4RFOH 1A65A 5D7SL 2YK1H 4P5KA 4N2IA 4X6CA 3UO8B 5KS9E 1EHLH 3BGMB 1P53A 4HIEA 4CVZB 1QSZA 2NY3D 2SODB 5TD4A 4DOHE 5DK0B 4PY7A 3Q8FA 4YGVB 1FF5A 5HYJA 4HUWB 4Y89A 3QEHB 4PPTA 1DBKL 3FO9A 4KK8C 3DUSB 2CRZA 2NX5B 5A7EA 4PJCE 4AXWA 2P5EA 4PJAB 2J4WL 1T3FB 3F7QA 4IMKC 1M1XA 4B9YA 1KJ2H 3BIKB 4F33B 1WFMA 2AVGA 1P4BL 4E42B 3MV7D 3NA9L 1MJ8H 3FU5A 4HXAH 4PVLA 3MZTA 5MERA 1OSZB 5JXED 2R23B 3VQ2C 1OLLA 2G2NA 3DOSA 2AZUA 3T3PE 2CM5A 1PS3A 2BWDA 2V2TB 5ABZA 5EEUA 1VJSA 1YC7A 4FFVC 2RD0A 4HKXB 7CGTA 3PPSA 4UM8A 3D34A 5T5FL 4WTQA 4ZOAA 3UAAA 1R3IH 4OLZL 4PWEA 1HTYA 1SEBB 1B0RB 3SPIA 1CG9B 3D0VB 3FN0L 4JGNA 4BK4A 5EPMB 4YXLH 4KUZL 4EKXA 3RNQA 4K23L 5KZCD 3R1GH 2ZP8A 3GDBA 1KGXA 1Q9OB 4G8IA 1JUFB 4HUKB 4WI2A 2WXQA 4U3CA 1E4KC 3CFJA 1R47A 5D5ME 1MCLA 3H9SD 3HHSB 2GTQA 2YARA 3NSDA 4L4TD 5JW4M 4AC4A 2IV9A 1YNKL 4L3FA 1FFPA 2Q9OA 1BD2D 5HPOA 2A6DB 4AI7A 5CBEA 4JCWA 3SDYL 3ARQA 1OAZH 4PYGA 5A43C 3VFPB 1CFSA 4YUEH 5E6IA 3VXSB 1I9RL 1OE1A 2XQ0A 4M61A 4OZHE 3VXRA 4ELKB 4RGNC 1MCPH 4PP2A 1B4LA 2XIBA 4F8LA 4F2FA 4L4VE 5I5RA 2KMWA 2AJVL 2E8ZA 1EJOH 4NQEB 5EEYA 4KH2A 4MXWL 1FO0H 5F6HJ 5HHQB 2BX5A 4KQ3H 3D30A 4PWFA 3L13A 4DPCX 3B9DA 4E9SA 4B9CA 1ADQH 3BVNA 3V7AG 4J8RA 4JZNB 2K6YA 5DHVH 2Q7YA 4LEXH 2APFA 1EXHA 5B39B 1AJ7H 1TCRA 3TNNB 1TXKA 3WHXB 3O6FA 3MJ8B 2HJKA 1T4KB 4KMLB 4NZTH 1YYML 1A7OL 2F7IA 1OP3H 2WZAA 5HPMB 4ZUUB 2XG5A 2A1WL 1KLGA 1I1AC 1RJZA 3FQ4A 1ACYH 2B7DT 1BQHA 4KX9A 3APMA 4TXVB 4OTXH 4YC2B 3DPDA 1MUJB 5E03A 3P2BA 1J0HA 1QFOA 2B1AL 3LH8A 1VGKA 4Y5YA 3LDBC 1LJMA 1OTUD 2XZZA 4L9DA 5IVXB 3SBWC 4P4RB 1T21A 4Y4HD 4J3WA 1ZLSL 4AEHL 1QRKA 4ETQA 4NENA 2JJTC 5K1NA 3GSNL 1WRFA 2Y25A 5DVOA 2OFQA 4ENED 4F7CB 3L3GB 1MWAB 2ZCHL 1JNLL 1OOWA 3F7KA 4NC0B 5KJ7E 4WVRA 1X4XA 3IFOA 1TFPA 3BKCL 1MHCA 1MCQA 1O7VA 4PJCA 1H15A 1NEUA 4M1GH 4DVBB 1THCA 2WO3B 1OCOB 4PJEA 2IOOA 4PV1C 3NACH 2B2XL 5B1CA 3TBVB 4CNIA 1JTPA 3NZ8B 1XIWB 3PWUB 4LK4A 25C8L 2ZWYA 1DDHB 1KXTA 5I1AB 3LS5L 4Y16D 4UANA 4NQCE 3JVGC 3WSQL 4OCXH 3TWCL 1YRKA 1F4HA 2AANA 2RBLA 5I1DA 1KDIA 1Y6NR 5KVEH 1USQA 2VM3A 4R7DA 4J12A 4OAWB 3KHQA 1CIDA 1I9JL 2Q2EB 4F58L 1K3IA 1BWWA 3LZRA 5CGBA 3W0WD 4HH8A 3SGEH 3VXUB 3EAKA 3MYZA 4KY2A 3TPUA 2CO4A 5B3JF 1XIWA 3MRPB 1K6QH 4Q89A 4EDWH 4UV7H 4HKZB 1T0OA 3QUMA 3BUYB 4AUUA 3AJ7A 5JW4N 2P24B 1IQDB 1NDGB 2J20A 3NABL 4TQPA 2W0PA 5DLLA 1ZA3B 3U2SA 5FIEA 3LRGA 1EFXD 5AVTB 5IB3B 3F7LA 3BN3B 3VFMA 3OR6A 2WCSA 4M03A 5EV7A 1WZ1H 4YSAA 1YO4A 3SDCD 1OOAA 1M7DA 3LNGA 2VZTA 3BQVA 3K72B 4PLKD 4QO1B 4XCNA 2JIXB 1CXKA 2AV7A 4YLQT 4BKSC 4RIRA 2VLJB 4U7KA 5I8EA 1K85A 4RIRB 2IPUK 3QH3A 1MCOH 2QGCA 4KZEH 4Z7WB 5F1IB 3VWJD 3GK8L 1Z7JA 2YRBA 2QVKA 3NCYP 1FL5A 2W1NA 3ZL2A 1SFHA 3QDGB 5FF6A 2JQAA 4OT1L 2QVMA 3VRLF 2WYHA 2RQEA 4GMTH 1A9EB 4HJTA 1TVDA 3ABZA 2PPFA 3MBWB 5DURD 3BZ4B 4OV5B 2VRQA 1PZSA 4F9LA 2ZYIA 3L3IB 1N6QH 4A63A 1GGCH 4ORGA 2FX9L 3HG1B 4YXKH 1W0WA 4OLYH 2AF2A 4FTVD 5EZLA 1NCBH 1QO3A 5KANG 2QJDA 4XC3L 1JF1A 2J44A 2P1YA 2P43B 2UUDH 3NUKA 4X5PA 4ELMF 2EDJA 1SDDB 3FSZA 4A67A 3QFJA 5D1XE 4IOFC 4FCHA 3MNDA 2KT6A 3HHMA 4JZJA 5I24A 3MGTB 3WFEH 1RJCA 1MW0A 3A0OA 5E1AA 3N41B 4LVNB 2VUKA 3WV0A 5I1LA 3UGUA 4BXVA 5KSAC 1Q9LA 2JCCE 1JK8A 1TQSA 1JRHL 3U83A 5IVXF 4JM4L 1PU0A 2ZSWB 4QF1A 3L1OH 5FYLD 1QBBA 2NTSP 4Y4KC 2HZHA 2ZD0A 4AGOA 4HCRA 4DZBB 2VCOA 1F4XH 3GXUB 4YJZL 1MVFA 5DDHB 2ZCLL 5D93B 3VWJB 5H4YA 1CFQB 1NBVL 2WLMA 3ZYJA 1M56B 1J1PH 4KVPA 4MKTA 4YZFF 1XO8A 2VH5H 3KYNA 5LBVA 3D85A 3R8BB 1E2VA 2L8AA 1K6QL 4UNUA 3C12A 1IB5A 2FT7A 3WN6A 3VWKA 1JGUH 1E9PA 5GGVY 3VQ1C 3LKQA 5DURB 4YPGA 5D72L 3SO3B 3SY6A 3LEYL 1BJMA 3VYPA 4FNLH 1O9VA 2Y07H 4HUWA 2YN5A 1ZLVK 2IDTA 1DQML 1BXXA 2E47A 4X99B 1B9ZA 5LGKA 5BQ7A 3WJLC 5EF3A 1A1OB 2YWZA 1UHVA 3NJMA 3TH4T 2LVCA 4A68A 3RNKA 1G7QB 5FHBL 2ADFL 3LAFA 2EKSB 3PP3K 1XH3A 2Z65C 3U46A 3DI3B 4M93C 1PZAA 2F68X 5IFHL 2Q7YB 4X98A 4U1SA 1KC5H 4G70B 4DPAX 2DQDL 5JA8B 3KR3H 3KPQA 4MJIE 5EBLA 3KGTA 3ETBF 5KW9H 3EJZC 1LQBC 2WKOA 1N64L 4EQ3A 3P9LB 2C4XA 1MFAL 3BHBA 3FB8A 2BHZA 4LHJB 5EBWA 1X5ZA 3B83A 2R69A 1J8HA 4Z7QB 5HJBA 2K70A 3VFPA 4AV5A 4PREB 1QSFA 1FZOB 3UEQA 5JPMA 4KPHH 3HPJB 1F18A 3PP4H 5KYUB 2D7TH 3SE8H 5IT2H 4OI8A 1OVZA 3GSWB 3JYBA 1BG1A 3M1BB 4D0DB 3C2AL 3PHQA 5ID1A 3GSOB 4FXLA 4GKLA 1NLDH 3ZU8A 1W8EA 4B0MB 2VSKB 5L8KB 2D3NA 5HBBA 5DVPA 1G7PA 4W9JC 1KXHA 5LG1A 4XODA 5ETUB 2BS71 4PVNA 4HUCA 5CINH 1CGUA 5F71A 4MZIA 4BFEA 4PLOB 5ANMB 1E67A 2FB4H 3QO0A 4TUOB 1JXDA 4WEBH 4AE1A 1E8WA 1WT5C 3LRHA 4TYUA 2ZWLT 4LIQE 3C9NB 1JMXA 2ARWA 1R6VA 1IAIH 1MQ8A 4H5SB 1E4XL 3U6XA 2UX6A 1THAA 4L29B 4JO4H 1EIBA 3EF7A 1XF3A 3ZDWA 2CKBA 3PHQB 3MKKA 4ZTEA 1EVUA 1YEHL 3GSWA 1IEAA 1TFHA 4MD4B 4WTXA 5G4NA 3WGUB 4G43B 5AW3B 4RESB 3JWOL 4MCZA 4NN5B 4N4YB 3T4AC 2DLGA 5MERB 1O75A 4Q97A 1E4HA 5AYTA 2VC2L 3OLEA 3LEVH 4UILL 3UTSE 3UYPB 1WC7B 4RAUA 3U1SL 4EEEA 1CBJA 4EVNB 5KAQG 3RVVD 1N3NB 3BXNB 1T0PB 1F1AA 1X3DA 3LHPH 5DC9B 3OLIA 5B4MC 4R90L 3KWWB 4DKFH 2GJ6A 4W6WB 1NBQA 1T1ZB 3QS2A 4KK6D 4KKBC 4WHYG 4MS8C 1PY0A 3VYNA 3UJIL 1I31A 1CLOL 3QEUA 1CF1A 2NY0B 4FJZA 2ED8A 4BUGA 4P5SA 4YS4A 4PWJA 3E9UA 1WDAA 1KTCA 3SJVE 3F6IA 2KUTA 4DCQB 4QHUB 4XC3H 3EH5B 3IXTB 4KDWA 3QUKB 3FCBA 4YR6A 5E8PB 4ODXA 4MD0B 3WNKA 2EVJA 2VDMH 2BOBB 4MMXA 1ZY9A 2WZ5A 1MI5A 4YDVA 1EJFA 2FCBA 3T8VA 1BM3L 5D7JC 2KH2B 4Z3EA 4M6NH 2HFFB 1F3JA 2NY0C 4IRSD 2APTA 1PTZA 4XCFH 4Q6YA 2GT9A 1KB5L 1OARL 5BZWB 4E41D 3IPBA 4XOAA 1E9QB 3G6JE 3RI5F 4CMMB 2LLNA 1HK6A 3DC0A 1MW2A 1OSEA 1OF0A 1G7PB 5T33L 1JZ4A 2AQSA 1G7JA 1A21A 1P4LB 2Z91A 4U1JA 1QLFA 4N90E 3H0TA 4Y1AD 3MOBL 1FZMA 5GGRY 1F6AB 3VGAC 2Z31C 2XY2A 4FG2A 2BY2A 1IKFH 4LCCB 4K71C 2OSLA 4R3SB 2QQLL 4PM1A 2YSSA 3MUZ1 2FLBT 2WXOA 3V6ZB 4ZFGH 4Z8FH 4RGOL 5C86A 2OK0L 1T0MB 1CI3M 1KF9B 1OCCB 4PJFE 1UWGH 3A47A 3KPNB 4G3YL 1G9MC 3CU1A 3V9CA 4OZIB 1MPAH 2BINA 4QRRD 2AEQH 1QFWI 1HQRA 5DS8A 1BPVA 1FRGH 3BGFB 3O9WB 1AG6A 2H6UA 4J23A 4LT7A 3F00A 3NT0A 3OAYH 2A6IA 3QJFB 2UZXB 3VVWA 3MAWA 5F7FA 3HE7A 5C0DA 4N28A 4IJ3B 3TO4C 4WF7A 4UT6L 1P69B 3N3EA 1ZHNA 3BVVA 4HWZA 4BSVA 3P1VA 15C8L 3K4AA 5TE6L 4FA8A 4Y2DA 4Q9QH 1XIWD 4UT7H 4JG1L 2D3LA 2A9AA 5EUOB 4XXWC 4EQ2A 3LRLA 1CZ8L 2GBTA 3O3AA 4YPGB 5I74C 4ZW7A 3CUPB 3GB7B 2P5WB 3INUH 3S5ZA 3DV6B 2X4UB 1NCWL 5AALA 2XBTA 5KVGH 5BXFB 4RDQF 5IJKC 2I85A 3BH9A 3IMBA 4A66A 4CC1A 3BN9C 4ZXBD 4E9WA 2MFNA 4WNJA 1DUZB 3APCA 2Z35B 1JWSB 4EZLA 4Z76B 4Y2OA 4DAGL 4QXWA 5GISL 2EDBA 3RX5A 1I1CA 1CE6B 1A4KA 5D7LA 3W1ZA 4C47A 1HIML 1UH3A 3AU1B 2R2BB 4XMLL 1GW6A 4Y5XC 3QP3A 4ZUVB 3ZYOA 1JPSL 1KZQA 4ODTH 3KYKL 4ODSH 2APVA 3C5ZC 1CK0L 1FO0B 3RFZC 3QAZC 2FH6A 3LZFL 4Z7UA 1I9EA 2LQRA 5FYJE 1MCPL 1J9RA 1JPGA 5A2BA 2QV2A 5FEBA 2F7RA 2Z64C 1KB9J 2UY6B 5BO1L 2PETA 4KOBA 2B1AH 3TXAA 1G7MB 2YKLL 4LKCA 1FCGA 2FECL 1HYSD 3FRPG 4O2EB 3SO5A 5A6MA 4Y5VA 1LTXA 2NUTB 4FD0A 3QG7L 1FGNL 1OGAE 3KPPB 4GIAA 4OM1H 3W81A 2VLJD 3QDHA 4FXKC 4NO2A 1QQDA 2WBJC 5JZ7C 3D5OF 2ZSVA 1IBDA 2DQGL 2K78A 1MCKA 1G0YR 3T2LA 1PGRB 1YYMH 3OXSA 3V6FB 3HI6L 3IWVA 4FQXB 5FCUH 3G5VA 6TAAA 4I88A 2FEJA 4I85A 1YC8A 4GKSA 4I87A 2QHLA 4LU5H 5IBTH 3WNLA 3FQYA 3BQUD 3B5TA 2DQIL 3LB6C 4F1SA 4G5ZL 5EBWB 3KJ4C 2M1KA 1XGQB 4JG5A 3WFCL 5EF2A 2AK4D 5D7IE 5JHLL 1D5RA 5JOFB 5T5FH 5KZCB 1TLMA 4MB1A 2N7SA 4N3UA 4MQSB 3X3GH 3P02A 5IB2B 5IEKB 3ZE2F 3GZQA 4W9DC 5CEYB 2OAAA 1G0DA 4KXZI 4P2QE 5KYXB 4NO5B 3UBHA 2F1AA 5LWYL 1UWXH 3OKKB 1VFUA 3PXLA 1JI1A 4XVJL 4AW4A 3MU3A 4XBGA 3DPBB 3U7WH 4F5CE 3PPEA 1EX0A 3ZSSA 4U0RB 4FGMA 3MV9A 4TNWF 4FXTA 3HR5B 1Q0XL 3MLSH 5ENWB 1OB0A 3QUMH 4KNUA 5AG8A 1AIZA 1UOLA 3M8OL 4J4PA 2X1WL 2AK4E 1UUSA 1JBJA 1F97A 4J27A 1E5BA 5TF1L 3W9DB 1V8HA 4FL4C 1QEXA 5I1HL 1CBVL 1MQKH 4NKMB 5D5MA 5TE7H 2W9DH 1NCHA 2OULB 2VL4A 2F58H 5K93A 4B7IA 4ZK8A 5TGBB 43C9B 1NEZG 4YBLC 5EU4A 2UWEE 1JSYA 2JNZA 1T1WA 1YYLH 1W15A 1CURA 4JRXE 4MYPA 1QASA 2GIXA 5I9QC 3MV9E 4UV4H 3D05A 5D7HA 3WUWB 3CN3A 3OKMB 3T77B 2X4TB 3TA3C 3KEHA 3KD4A 2BVTA 4PRPA 4A2LA 5EZOL 2B3RA 3GIZH 3QJXA 4L4VD 5EBGA 5DJDB 4ZJ9A 4UT7L 3HUJF 3L95A 4F7PA 4FA7B 2ZX5A 1RIUH 3MTRA 1F4WL 5HDRA 4JKLA 1QRND 3QNYB 4W9IC 2ZIDA 1YMHA 2WBKA 5GIRB 2OTUB 1PLGL 5I1DB 3ZL4L 3EBIA 1PYWA 4J3XA 4HCRH 2V17L 1BIIB 3DYMA 3V5HA 3B7UX 4L4TE 3FO2A 2WTOA 1BMWA 2ADGA 1PLBA 3F8UB 5BW7C 3IBEA 4ORGB 4QKTA 1JTOA 4YHZL 2IGTA 3Q1SH 5D7SH 5I28A 1TUPA 1PW3A 2FL5A 1QKZH 4GXVH 3F5WA 4HKXA 3TT3L 2AQ2A 5F7DA 4HIJA 2P49B 1VSCA 1CI5A 4G6FD 2CBTA 4NBYB 4RMQA 3VXSE 3CSGA 4OZHB 5CFAA 4WI0A 4HUXA 2PCPA 4G9FD 4KQ0A 3I84A 3MBXH 1Z32X 3SDDD 2WQAA 3B9KA 5DHVA 1NAMH 3S8FB 1GMIA 1X4YA 3P11L 5DQ9B 5E8DL 2DMBA 5HHVL 2JJVA 4KH9A 4F9PA 2FQDA 2JB5H 4OJDH 1VAHA 1LP9B 3RPKA 4E41A 3IDMB 2CJUH 3G3LA 4PB9H 2XG4A 2BPBA 4JRFA 1TQWA 1TCMA 3K72A 4QO1A 3IDIA 4XX1G 1FG9C 5DVNA 3MV9B 1WPCA 3LKSA 3MR9A 2J6EL 1RULL 3FYIB 4GO6B 2LT9A 4MA3B 5T33H 4F57L 2OMYA 3OKNA 3G9AB 4LCWE 2VN5A 4N6RA 4X2UA 4Y1AA 3S3BB 2H0FA 3TYGH 1UWEL 2ZJSL 1N68A 2H8PA 4JUSA 4O02H 2HTKC 5MEND 3GLZA 4DT2A 3SE9L 4DGYL 4M61B 2DI8A 1GC1H 3WXWL 1M2VA 1CYWA 2XN0A 3PWNB 3TN0D 4DN3L 5I8KH 5IB3A 3MFFA 2V33A 1PEWA 5LBGA 1OTUC 3BO8A 3FDWA 5IHZA 2Y23A 1EUUA 1BF8A 3QEQA 1S8DA 1IO4C 3OZKA 3WL9A 3DRQB 1BZEA 3MTXA 1QMUA 2PYED 1H3UA 2N01B 4AZ8A 1JZJA 1VEMA 2WLZA 3MV8D 2OL3L 3VD1A 1HXYB 2IQ9H 5IGXL 1MIEH 3I6KB 3N0PB 4KTEL 2P26A 3EOTH 4G59C 4BUQA 1N6UA 5JPNB 3PABB 4TL4A 5E2WH 5AEAA 5FC9A 1BEYL 2I60L 4NI6A 4Z95L 1ZGLB 4EE2A 5E1QA 1CU4H 1FVDA 1SDDA 4G6AC 4D9LL 2NY2D 1PAMA 2YD4A 3WKML 3QZOA 5I30L 3P4OB 4P46C 5TH2B 1L9RA 4S1SH 1HHKB 4PLJC 3RX7A 3ZE1F 2XWEA 1WS7A 3BYTA 5DJCB 3WL9B 4HDIA 2G75A 5ABAA 2C7FA 1EEUA 2NDFA 2ZKWA 1T2XA 4A1RA 4CRPA 1KEMH 3ECBA 2Y5TB 4FTVB 4AK2A 4YDJB 1GGBH 1BQLL 2QSCH 5F89B 3BZFA 3P2DA 1CYGA 2I24N 2LFEA 1BZ7A 3QRGL 5IFAL 1CE6A 4Y16C 3KPOA 2WV3A 5D7LB 4XNQB 3D4YA 1PG7L 3KLHD 3U36A 4FZEL 5E8EA 3TBSB 3GGWA 2YAMA 1LEKA 2JKWA 4NPYB 3F7RA 2EXWD 1F02I 1P1VA 2XICA 1EXGA 4OZFA 2XVBA 3US9A 4A6YB 1LO5B 1E2ZA 2ZUSA 4PJGA 3BT0A 3FUMA 4JFZH 4RSVA 4XN1A 2JE8A 1JWMA 4XVTH 5HHXH 1LE5A 4OI9A 1KBGH 1ONQB 1TO5A 1Q94A 4IRSB 1A02N 4LRNH 2ICCA 2C9AA 3O4LD 5AVYB 1HILA 4LEOB 3PS6A 2MSPA 4PJAF 1RSYA 1HCZA 3MUHL 5A7BA 1OALA 2R4RH 4PJBA 3MRMA 1NIAA 4JN1L 3OHMB 1A6WL 2DM4A 2Y0SA 5JHLA 4QLRA 3QGVA 2HX8A 4ZD3H 4XNQA 1VHPA 5D2LB 1Y1DA 3T6QC 2VXQA 4LLMB 4I9XA 3GD1C 3L3KB 4HWBL 1SEQL 5I8OH 4ADIA 4GAJH 3VFSB 4BQ8A 3W11C 3NAAL 1RK1A 3UZVA 1GR7A 1UD4A 2QLVB 3N1QC 3HFFA 4QRPA 1J0IA 1U21A 2CALA 2WMPB 5LB1A 2CJ3A 4DK6A 4KOCA 5KSAA 4LHUG 2YPKA 3HUJA 4LPTA 3IFLL 3O9WD 1IT9H 3WIHH 1URIA 3LZNA 3V6OA 1JGVH 1J0KA 4AV0A 3V0HA 1Q9OA 4D2NA 4TUJA 5FHBH 2FIRT 3IXAA 2P8LB 3TOPA 3PABA 3FMGH 1ZJBA 4EZKA 5EU6A 1UVQA 1BREA 2X4TA 2B5IC 2PTTB 1YNLH 1WWCA 1G7LB 4KRNA 3EGXB 4WUUE 2JTYA 4GAJL 2X4OB 4WGVB 3VXMB 1JPGB 4PGCB 2XWRA 2KDGA 3T65A 2AXHA 4YDKH 3KLQA 1LDPH 2NZ9D 5F9JA 2RH0A 1A7NH 3V79C 2HB0A 1V7MH 5K1JA 3AROA 3FUEA 4C59B 2DQFB 1OF2B 4EBQH 1SHSA 4NENB 4A2GA 1GIGH 2GC4C 3FQ1A 3DK0A 3HI5H 3KBHE 3HE7D 3FU7A 3GKWL 4N2GA 4PJXA 1NBVH 5D2NC 3DOSB 5AVXB 3TO4D 3T6WA 3KM1A 3ZTCC 1SUJA 5JYLA 2MNWA 1F4YH 3KDPB 2I60H 3N85L 4Z95H 4ZDHB 1F90H 2Z8WC 1MZZA 5E9DE 5FXCH 3NFNA 2OMTB 4NZRL 5GJSL 1UT1A 2UUDK 4Y19D 4A2MA 5AG9A 2DLHA 5I6XC 4HUVA 3ECVA 4Q4EA 3N1PC 1S7QB 4ZOCA 2PMZA 5GGSB 3V0EA 3V4LA 4PJ8A 4NC1C 4K5NA 4KK5C 1DSYA 1M2OA 4PRIA 4ANVA 1XF4B 2OI9C 3O11B 2QSCL 3O9WA 3HFMH 3S36H 4MD5A 4MGXA 3T0VA 3DRTB 4WW1A 3LN5A 1QVOA 3QI9C 5M7QA 1WC7A 1QACA 2NRDA 5TQ2H 2NW3B 3OM3B 3VGAB 5EC2A 1SJMA 4E2OA 3E8VA 2F08A 2WYZA 3C6SB 3O2DA 1P5VB 5CBEB 3F05A 1NPUA 3NJGA 4ZTOL 2C1OB 1HSAB 3ESMA 1ECYA 4HLZG 3WNNA 1JZDC 1XL4A 1KBGL 3DX7B 2CGYA 1RK0A 4P0DA 5JPMC 3V6ZA 3ET9F 4L29A 3FFDA 3AITA 5GIRA 2WTRA 3SKUD 3GJFA 5DJZA 1S5IL 5J6SA 3IFNL 4XNYH 2VQ1A 1A9VA 4JQIH 1BFVH 4LNRB 3HI1B 3L6FB 4BZYA 3T5WA 1N5YL 5JIQA 1JZIA 5HI3D 1EEYB 5GS1A 3M17A 4J1UB 2VRAA 5BRQA 1OAKL 5E24E 1A3RL 2F6AA 1J0ZA 2W9EH 1GZQB 4JY6B 5AWNL 4M7LH 3CSYA 2EECA 2PP7A 1CXFA 3MNWB 4PW4A 1A9BB 4MDJA 3TASA 4H25A 2JFCA 1MCWW 4WWKA 1PEZA 4JPWH 4ZUWB 5FUCC 2VR4A 1HYRC 4UAHA 1S7WB 3HUJE 3DARA 1HSBA 5IQOA 5CJ5A 4HALA 5TDPB 1SJVA 5CLWA 4ALAH 2FO8A 3MOQA 5D96B 4GBXC 2WVTA 4AKPA 1MHEA 4LRIC 4F2ME 4G6JH 2UVEA 1A6VL 5DO2D 2EXSA 3TF4A 2W91A 3GBEA 3L4VA 2J7LA 1ET5A 4ESKA 4TUUA 5ICZA 4LCUA 3GXFA 4N3TA 4U2YA 4DNLA 4XN9A 1G9MH 3A24A 4L1DA 4NCDA 4OGXH 4F3FB 1J88A 1YJDH 3LS5H 4KKRA 1INDL 1IGTA 2W60A 5KBPA 3EO1A 4M8UA 2ATPA 2BVEA 3V0JA 2E7DA 1ACCA 1IGCL 1KYUA 2D0FA 3D18A 4JFEA 2MTAA 4XC1H 4KK5D 4QJ4B 1R3LB 4OZIF 4EUPH 2J6EA 1JZ3A 4Q9RL 2BSSA 2VQ4A 1OT1A 2MCPH 5GGVL 3K80A 3RPIA 4X6BA 3MRIB 4HBCL 3V0DA 2PO6A 5I6XB 3MHZA 4GP5B 2GFBB 2A6IB 4N2OA 1C12A 2Q86B 3PL6A 3HE6B 1HNFA 2EYTA 1TZIA 1IU1A 3TESA 2FJFA 1NAKH 1XWVA 4PGBA 4Z7QF 1AFVL 5E70A 3ZW3A 5FGBC 1K5WA 2PCXA 3QUML 2ERJB 4R0LC 2DLIA 4QTIL 4FCAA 2H3NB 4QRPD 5BMFL 5A3ID 3ZZSA 1F1GA 3WOVA 4JKMA 3NFSL 4H1LB 4LPVA 4GAGH 1VFBB 1HDMB 4HFWB 2UY6A 4OD1L 3JWNH 3P9MA 4H8QA 4WKZB 5I15H 4F7KA 3BP4B 5GGTH 3H2PA 3ZKMC 2EICA 1ADQL 3QJZA 2E7CA 3S96A 1NGZB 1XV8A 4LSVL 5F72S 3GI9L 2HT2D 4NRZA 4J7RA 3S3CB 5CJ8A 5DZJA 4ZMTA 1TTCA 2EO7A 5GS0L 4KKAD 4UZUA 3BSZH 4ZUVA 3BZEB 2R2BA 4MD0A 1MFDL 1KELL 2WJ5A 5EWIH 1QFWH 4OKVB 2CLRB 2IF7A 3BHBB 3MUJA 5TF1H 1BVKA 2J1WA 3RVVC 4BH8A 4PCKA 3PWVB 1NOAA 4WI5A 3SDYH 3UZVB 2XWXA 3MACL 5CGMA 4PMEA 2FSEB 3C5SA 3VRIA 4X7SL 4FYRA 4KRMB 5C0CE 3RKDD 1AZCA 1O7DC 3S34H 1BYNA 4MA7L 1EHKB 1KCSL 1OTTD 1SBBA 2ESVA 1HWWA 3LY6A 4WAFA 1HEHC 1YG9A 4NM8H 5DQDL 4PJ7B 4JQVC 3O0RH 3IE4A 4KKLD 2BIOA 2VLKA 3MV8B 3QA3B 1QFUL 4Q2ZB 3SOTA 1JV2B 1T1XA 4FQXD 4LCUB 1WWAX 1JK9A 2VLRD 4JQXA 2ITDA 3D07A 2QSVA 5I1IL 3HAEA 1HCVA 1BZ9A 1O7DE 1JFHA 3NCJL 4LRIA 2HSIA 3V4PH 4FOMA 1T04B 4X9GA 1OTSD 4A39A 1TPXC 4FFZA 4PJIF 3V4UH 1T03H 2FGWH 1D5ZA 2AAVA 1BOYA 3US1A 2EVHA 3NZHH 3HS0B 3TEXA 4PV8A 2JVUA 3FTZA 4HC1L 5C0CA 4Y4KB 1E6OL 3O6FC 4F2MB 4QYAA 4HV8B 2ZWZA 3IJHA 2VXQH 1J0JA 2KPNA 2FLRT 3GSNA 2FQEA 2XV2A 5E6SB 1AO7D 2GSIA 3ARBD 1P4BH 5D70L 5EU6B 5A2LH 5DS1A 2LU3A 4XCEA 1ZA6A 3V4VL 4A2EA 4JKKA 2YOAA 4G82A 1LGVA 2IAMC 5ESAA 4WK0B 1IBGH 4FXKA 4WJKB 4X83A 1ROCA 3MUGB 1WP6A 2VDPL 4AX3A 5CN3A 1R75A 3ASNB 4URKA 2DMKA 1BAFH 3V6BR 2R1XB 1CFNA 2O5YL 1Y18A 3O6KL 3MFGB 4D9QD 4Z7WF 5E8DH 5FO7A 3Q6FB 4Y8DC 5DYOB 2XIIA 1S7VB 2UZYB 1MEXH 3ARDA 4M9PA 4P2OC 2ENJA 4B0MM 1RZ8B 4AYEC 1QP1A 2W0FA 1A6AB 3QWOB 2NY6D 2XZAH 3OC5A 2WKOF 4AVIA 3P4LA 4HIHA 1SYSA 4WW1B 5D2LA 1MHCB 1QNIA 2AITA 4ZMAT 5JOPE 2A74A 1OEZW 2O5NA 4QHUA 5EMYA 1H3PL 4ELDA 1GCFA 2VLME 1OAUL 3NFSH 4UINH 3ETSA 4YNYA 1ZMYA 3PQYB 2VXTL 1UJ3A 1RZIA 1GY2A 3HCVA 3CHOA 2XYCA 3HZ3A 3UZEC 1SOQA 2EO1A 1KPRB 1SYVB 5HJDA 1NC4D 3RNKB 5ABDE 1F4WH 3D2TA 2QR0B 4JO2L 4GBXA 3CX2A 4ZUTA 3NSJA 1HH6A 3RBGA 5BV7B 4G9DB 1U8PA 4KY1H 4KO5A 4RMWA 4UWQB 2I07B 4JFQA 1FNLA 4XNAA 4P46A 1U95A 2VMCA 3RJOA 2FWSA 2ICWB 4Z7NE 4NPKA 2R1WA 1KG0B 1YVLA 2C1PA 2HJKB 5I26A 4MCYB 5DRZB 1I7UA 1NGYB 1JXJA 1JGDB 3AZUA 2XPGB 5CKAA 3VG9C 4YHLL 4HU8A 4HKZA 4C4KO 3GEWB 5IIEB 3PGCB 4NPYA 2GIYA 4WI0B 5FX3A 5LKNA 1XSKA 2IXQB 2ROXA 1ILUA 1U91A 1X5IA 2P24A 3NZHL 1Q1PA 4BFNA 3ULUE 4GAFB 5DC0A 1FYTD 2E9IA 1NOLA 2MHAA 4IRJD 1ZDSA 4NSKA 4WY7H 3VI3A 4ZFOA 1X7TA 1LP9F 4E9RA 4R7DB 1U8KB 1YDPB 5E1IA 4MJIB 3G5XA 1J1OH 4XNUL 4L9LA 2ADGB 2GK0A 4YSTA 1JL8A 4JM2C 1MIMH 3S2CA 3QG6B 5IJBC 3MRBB 3NRFA 1T7XA 4QCIB 3I6KA 1GMEA 4C4UA 3CZUB 2MQ0A 2O61B 2KLTA 5FA3B 1FLTX 3NZ8A 3PWUA 3WU1A 2ZUQC 3TO2B 4G8GB 2EDDA 2KZWA 5FHAL 3BD3A 1ASOA 4HZ1A 3D87B 3FUDA 1FJ1B 3DX2A 2X6VA 1YDPA 1CVSC 1YEHH 1TTRA 3AGWA 4LCWA 2V6HA 3OAWA 4ZZFA 5ANME 1D7CA 5E6IC 4GIOA 1BQKA 3QZWG 2CHDA 4C4KT 3ZXAC 3PY9A 1KTDA 3FSWA 1GZPA 3BP6B 3CGTA 1OSPH 3HI6H 4L05A 4PIRF 2NT1A 3IMRA 3GMOB 2V5YA 5CCKL 4WFGE 3ASWA 2P42B 2YQGA 1X5XA 3T4YB 2SEBA 5AENA 2H8PB 5DMIL 4OD3H 3LNEA 3V5DB 3DVGA 5E2JA 2AQTA 3CXFA 1EEZA 3ESVF 4N2FA 3ZE1B 3CPLA 1LE5B 5DQ9A 1WAAF 4LCIH 2HFEA 1G1CA 4PRBA 4X99A 1K72A 3NRQA 4PRBB 5I0VA 3DBSA 3JZ7A 3R0MA 2JI3A 4WRLA 1D2PA 2GTWA 2C4FT 4YX2L 1IAIM 1OCRB 1TJHH 1UA3A 2N56A 1ORSB 4P2RB 2VLJA 4MA8H 5I8EB 4N20A 5DA0B 2JIXA 1YEDA 2XN9A 4ONFH 5D7LD 2ED9A 3WFZA 4P9HC 3GEFA 3QDJB 3BIAX 5H4ZA 3G6AA 3ZUCA 1U4FA 4KNSA 2LAAA 3QI9D 2A9NH 1S7RA 4UM9B 1ZTXH 1ZLVH 4QYOB 3V8CA 1EA9C 1I8LC 4OR1A 1BJ1J 3BAKA 2B20A 3OZ9L 4MBOA 1KIUA 1BSIA 5E1GA 1YUHA 3FTSA 1RU9H 3O4LB 2I27N 2OQJB 1MJJB 2R29A 1D9KA 1ES0B 1IJ9A 2PYEE 2PYFA 4IGBB 3DVFA 2QLYA 3AAZB 2WINA 3LPPA 1YEWA 1N7MH 2FNBA 1DEDA 2MPAH 2QGEA 2W59A 3VFWA 5HSFA 1O9WA 4HK0B 5FYLH 4YZFE 5EU5B 5JXEA 3HMXA 3C2AH 3IN2A 2DL2A 2N0MA 2HKAA 5B21A 4YC2C 3C60B 4XXCC 1KB3A 2X4SB 3K6FA 5A2JH 5E7BA 5FM5M 4UT6H 5IMOA 4FQXC 4IIQB 4O4YH 3JXAA 2R0ZH 4B50A 1QFWL 2K9FB 2XN9E 4FQ2L 4WHYH 5ICUA 3L7FA 2W81C 5IVXE 1RL1A 4ICXA 1IEHA 3X14B 3GLDA 4HEME 4LXFA 5T3ZH 2VDQL 4JHBA 5EBMB 2YS4A 4RAVB 4JFHE 4OV5A 4GMSL 4PJBF 5JR1L 5HTSA 5T3ZD 1ZOXA 2C9QA 1INEL 2GI7A 4OCRL 1MFCH 1QSEB 4L5FE 4WNQB 4WTZG 2P5EB 2EIDA 4PJAA 1I8IA 4UTBA 3U2JA 3C5ZD 2H0EA 4DPBX 3IDGB 1NIFA 3BESR 1OAKH 3L3GA 5AW4B 5DHEA 3AWGA 2Q76B 4YEEA 3MRKA 1N26A 3L5XH 3SQBB 5FO8A 1HX0A 2ZP9A 3CQQA 3QAQA 5F96L 2HT2C 1FFQA 1F56A 1O5PA 5FFGA 2WVSA 1QA9B 2WN3A 5DC2A 1Q0YH 2W8CA 4FQ2H 2XJLA 2BRRL 1BQHB 3MLZH 4IHOA 4JDTH 3DX9A 2QQNH 4IGBD 3SHSA 1PKOA 1G87A 2AEOA 4X5RA 5GGRB 1AGCB 3VXSD 1GTNA 3ULUL 4LNVA 5C0IB 2MCPL 2BP0B 2CA4A 3ZN6A 5BO0D 5D1ZI 4XMVA 3CFTA 4XAKD 1BVOA 4MVBC 5JIMA 1XXDC 1M42A 3A22A 3TIDB 4JZNA 4KKPA 4X6FB 3RY6A 5IHBA 2EDFA 5HGHB 1IM3D 4DGVL 4JAMB 4LP8A 3G08B 3AW5A 1SBSL 4KDVA 4N0FA 4YN3A 1H3GA 5DMIH 4J6IA 5T1LB 2D8KA 3OMAB 3W5MA 1NFDF 4A6YL 2J3SA 4JDVB 4ABVA 4HCIA 3OSKA 4M1CD 2OMUA 3NCXA 4LVHB 2YQ2A 3WO4B 2ESVD 4WFFE 3BOVA 2KHAA 4MQ7A 3CZNA 3E0GA 2F5BH 4ONGL 4EDXA 4S1QL 3I6LD 2W80C 3QUXD 4CUCA 3S7GA 1EXUA 2YR3A 5ALCH 4L3AA 2WIIA 4G7YH 1WBXB 5CIPB 3RGBA 3NFPA 4AQAB 2AKRB 3FB6B 1BGXH 4TVPL 1SJHA 4BSWA 3ME0A 3ES6B 3QCTH 2HPTA 4KITB 4AQ1C 4M3KB 4C58B 3GMLB 3JWNC 5IK3A 4MMXB 1QD0A 4JO5A 2QTVA 4A55A 3EXJA 4MX7B 3WS3B 4NKOA 2DKUA 4QRRA 2AFNA 5AB0A 2PABA 2DIEA 3D39A 5C0FA 1W0YT 4LBAA 2EIZA 2Y72A 3B3IB 4KNQA 2N1TE 1T66D 2ICWA 3DI2B 3HLKA 2IH3B 1A6ZA 1J8RA 1IAII 3PP3H 1JNNL 4HK3N 4L5FL 5IB1A 3FCGA 1GGBL 2BP8B 3ML8A 3QC5X 4GFTB 1MH5A 4PTUB 1OO2A 4PJHA 4AKOA 3FFOA 1VFMA 2GK2A 3DMMD 1LO0H 5FYJL 4XPBL 2AW2A 4ILDA 4QXGL 4YXHL 3TBTB 3TT3H 1KIPA 5DD1L 5ILTL 5MP6L 2PO6C 3MVSA 3LD8C 2GQHA 1SPDA 4LLUA 4JB9L 2X7LA 4K9EC 1DUYA 1N2RB 3HJ0A 1O6SB 5GJTL 2KBGA 4XT1C 1HWHB 2H47C 4ZMNA 1R5IB 1Y0LB 2V7HB 1GS7A 1HHIA 1REIA 3UTSD 1A6AA 5J12B 1J1OL 2K45A 5IESL 4NRZB 3SE6A 3UDWC 3NPSC 1E40A 1SM3H 2MQCA 3LEXA 3OXRB 4IBLT 5DMKA 3T1FB 4TSBH 5BRPA 3TZVD 4JY6A 3BVWA 3V4PA 2E5EA 3X1NA 3IGUA 1X4ZA 1UKSA 3NZSA 2J43A 4Y7OC 3GSQA 1CGSH 1XTLA 4E9QA 3ORJA 5DHMC 1HQ4A 2NNRA 5EO0A 3LXCA 3SYAA 1HXMA 4DW2L 2GT9B 2E75C 2EE0A 1AI1L 2HAZA 2VAAA 1C1EL 4K8RL 3EUDA 3AABA 1EAPA 4MXWH 5B38A 3ULUH 2C3HA 5HP5A 3RAJL 4WWKC 1RHFA 2DWXA 3GSNB 1C08A 4OLVH 2GFBA 4LLYB 4LQFH 3MODH 3MRDB 1A4KB 2GJZA 4KVNH 4LSUL 5H8DA 3E80A 2VR7A 4AW7A 4ONFL 4KRLB 3I9GL 2FJFB 3H3PH 4B6ZA 3E2HC 4LLVB 5DD0H 3UG5A 4IOSD 4X9FA 2IC2A 3ZUNC 1DQJA 1WF5A 5C9JA 3AXIA 3A4AA 3DK2A 4Z7UE 2ICWJ 3Q8BA 4P3DA 4XPHH 3GC3A 1VRSA 4W9HC 3GB7A 2ZG3A 3BPOC 4N6QA 2DI7A 2VO8A 1RIVL 4ZMOA 5TDOA 4X80L 3CFQA 1RU9L 1AQKL 2UV3A 2JWYA 2DQTH 3S48A 4NKQB 3QZLA 4XH2B 1CXHA 2IOIA 4X4KA 4GG6A 1V55B 3KJ4B 3MKGA 3UTSA 5IV2B 2P8MB 1XH3B 4KTEH 5J6GA 3SY0A 3HZMA 1QW9A 3UZEA 3EHBC 5CD5D 3RZWA 3D0AA 4JFPB 3LMJH 3QRGH 1A1NA 4I5BB 1W0VA 3P54A 3WN5B 1DQQA 2DEYX 4BKTC 3TN0A 1DQJB 1IC0A 1BQUA 5C9JB 5J12C 5ALBL 5CLYA 4BH8B 2YD1A 5I1EH 4QRRE 4Y9GA 3M8OH 3PAZA 3SZKC 5LXVA 4LSTL 3VTMA 2YD0A 3O6ML 1OK8A 4YX2H 4ZMYA 1URZA 3B5HA 1YEEL 4RFEB 1TYRA 1XF5B 3O3BA 1DZ0A 1QBLH 2MPAL 5EO1A 1EWHA 3FN9A 1CN4A 1MCJA 3CZFA 3WE6A 5ICXB 4EDXB 1T89A 5DDHA 7FABH 5FGSA 3I74A 3L54A 3O2VL 5JDSA 2R29L 2ODHA 1UCBH 3O2WL 2BERA 1OZUA 3FBQA 4I48A 5ALBH 5ETUA 4EOWH 1NC2A 3QUZC 4ZO6A 4P3CH 5BZZA 5F0PB 4AOFA 4AK1A 3HEIB 5DUBB 1YEIH 3EYQD 4F92B 3P0VL 2IDFA 4G7RB 2WWMD 4BWUA 4MVBD 2EDHA 5AOJA 2YGNA 4Z7VF 3P4MB 4OZ4B 3VXPA 1RUML 2F53E 2X0WA 4K73A 5JPMB 4FYTA 1V3KA 2HVBA 2ICES 2J5WA 3OB8A 3VO0A 4S10A 3GSOA 3KLKA 3ARBB 2R9HC 3OL2A 4APQA 1CFBA 4HKBB 2VJ0A 3LH9A 2ID5A 4R7LA 5F7KC 3A3YB 3GXTA 5IW1B 2ZNWA 4UAOB 3QI9B 5GRUL 3E2HB 1NGWB 1DQQB 2JQMA 4JMXA 1F3RB 5CILL 3SPGA 4GT7A 3UABA 1YA5A 2DIAA 3LZFH 5GS2D 3APDA 2ZYSA 1RUMH 2GCYB 3SBRA 4ZX4A 3ARED 2FGWL 4U1GC 5JIHA 4OIAA 4BGDA 5BQ7B 1NAML 2R7EA 5TDNA 4PTTB 2QPUA 3SJVA 3NJJA 5JHDA 2NY2C 2NY6B 5SWZE 2UVFA 3FL7A 4HWEH 1NCJA 2IWFA 4MNGA 1MCIA 4NGHL 4QUOA 2AZAA 2F53A 4K3EH 3C60D 4OIIL 5HGGS 5FK9A 2YBRA 4M3JA 2WOYA 3IN0A 2FBJL 3AT8A 5AW9B 4MNQA 2AAAA 5DUPH 3H2WA 4UQEA 4HULB 3BVUA 1HL4A 3ME0B 4HK3J 1OAYL 1HESA 3MNWA 2VERA 1SF3A 4IDLA 4ZXBC 3CSYB 5IQ9A 3FONB 1KB5A 3DX1A 2EC9T 4RAVA 1Z9SB 4QMEA 4P5TC 43CAB 4H0GA 3QORB 4DKEH 2NY1C 4GAYA 4PY8J 4DKEL 1J0YA 1WJ3A 4K2UL 4BHUI 5IVNA 4Z7UF 2HH0L 1GKOA 4U1LB 3G6DL 4PU2A 4LNRA 3C5ZA 4O02A 2R0LL 2W5PA 3HTLX 5C3TA 2WIIB 3R18A 2P9RA 3EYVB 4XNBA 1DVFD 1DJIA 3B8SA 2WVUA 5JHAA 4NPJA 3SGDI 1AD9A 3RGVC 2YGVA 3G6JB 3QPKA 1ZSHA 2KKQA 2O5XH 2FBJH 1FSKB 2BNRE 1HN1A 3DHPA 3BKML 3CSTA 3QFJB 3P4NA 5CD3B 4HSAC 2V5SA 1MEXL 5CMAB 3KLSA 2WXKA 3MLVL 1OIOA 4KI5E 3RTQA 4JY4A 1F42A 2BDNL 5DSCB 4N2NA 4K3DH 1WTGT 3BAXA 3F65A 1ANUA 4EN3B 5AL8A 2K3TA 1MWAA 4EOWL 3C09C 1IM3B 2XWTB 4X50A 5DVLA 1S5HA 2XV3A 3SDXB 5MEPB 2F1EA 2YQ3A 4KI5C 5ANHA 3CU7A 5A16B 4Y1AB 3ARXA 2JJWA 4XN4A 3PQYE 3QDGA 4TVPH 1U8MA 1K2DB 3HAEG 3OKEA 1IM9A 1PCXA 2GY5A 2OMNA 2P46B 3W5NA 1EDYA 2XFGB 5LXGL 2WLKA 3HC0B 3STZA 2WXFA 3HB3C 1EEZB 3U30C 3F7VA 1YMME 3KYMB 2EEAA 2G5BA 2JJTA 2AJSH 2Z93A 4JN2B 5C6PB 2ZXQA 1UA7A 2NNAB 5L88L 4WNQA 4HYTB 3O3DA 2Z0UA 5EFIB 4JRYE 4JRWA 4A2DA 4OZGA 5IKCB 3EJUA 5H94A 3L48A 4ZXBA 4ODUA 4FHKA 4AIOA 1UCBL 2OTWA 3LRKA 1JNHA 1U3JA 4Q6IA 5I1IH 4TOYH 2I9TB 3CIQA 4PAZA 3G5YB 4IKLA 3VSVA 4DERA 1AHWB 2NDGA 5BRZB 4B9PA 4G8GA 3L08A 4N68A 2IH1B 2WSPA 5TH2A 2YRLA 4OCWH 5IB5A 3VD0A 1JK8B 4XNZC 1XB3A 1SJXA 3NA4A 2GHWB 4S1RL 5B3NA 4NO0D 4IKNA 2FATL 5DEGA 5F7NC 4XHJD 1E3XA 2YUXA 1JPTL 3ALXA 2X9WA 2H6PB 3W3BA 4PJHF 3BP5B 2BHFA 4PRHD 5EZLB 4LGRB 4P57A 4HOXA 5MENE 4QRTA 4RFOL 4HIQA 3CPUA 4I2XA 2FIKB 2YAOA 4NAMA 3DETD 3OKMA 3H6JA 1RK1B 4KV5E 5JW5B 3RYMA 3NJKA 2G3MA 4XP6L 2AK4A 5CHNA 3MBWA 2OMXA 3VE0B 3HN3A 5DS2A 3RU8L 1AD0A 3MRQA 2Z93B 4U6VH 4F24A 3QQ4B 3CVDA 4M6AA 1JGVL 4HAKA 3VXRD 5DHYA 3NDYE 1MVUB 3ABLB 3ZMEA 1P1ZB 2IANE 4K94C 1LHZA 1PIGA 4YHMH 4UQAA 1EZUA 3G9VA 4PJ7E 3QDJA 3EBGA 1MHHB 5CCGE 1WGOA 4NP4L 4HH9A 2MNJB 1AFVH 3HB3B 3NN8B 1TZGH 2JI2A 2VL5B 2Q0ZX 4OW6A 3LKPA 5GS3A 2OZNA 1NAKL 1F5WA 4KVNL 3MA7B 4LSUH 3TZVB 2OS7A 4KJQC 3ROLA 2SEBB 1TU2A 4M7KL 4BEIA 1HXKA 1MFDH 3OKEB 1KLGB 1RJZB 4OZFB 5DK0A 4A6YA 4KMTH 5DRNB 2ZOUA 2WLIB 5D93C 3TV8A 2NNFA 4N0RA 3T2NL 5IF0A 2AJUH 4OZHA 1KY6A 4M5SA 5F2FA 3NCBB 3JTTA 4KQ4H 3U7YL 3VXRE 4AIXA 4XBMA 1MPAL 2ZX9A 4JHVA 3IGKA 2X12A 3M88A 1I8LA 4LCWB 4NS0A 4X80H 3KXFE 5D7KD 1QRNE 2CHNA 4W9KC 3VG9B 3P30H 1T7YA 4QY8B 4LVNC 3TX4A 1GYCA 4FYSA 2A73A 2QT6A 3VXUD 1BXAA 3PDGA 2QV4A 2XN9D 2A74C 1ZLWH 1LEGA 5TE4H 4DN4H 4KFZC 3A4EA 5CJBA 3B9EA 4J4PD 35C8L 5L7XL 4FQLH 3A4FA 2AQRA 4FHJA 4WFED 3ARPA 4L4JA 3QRFM 2A6DA 4BFBD 4FNTA 3O4LE 2WB1A 1UEYA 1NMCC 3UBGA 2EIEA 2WN2A 5KYNA 2QTEA 1Y18B 5J1AA 1W72B 2OTUA 3AAZA 1MVYA 1RZGA 2BSTA 2H0PA 4JRYB 1FRGL 3MO1B 2H6PA 3PNRB 4LL4A 1JUFA 3QIUB 5GJTH 4OF3A 2IH8A 2DWDA 2P47B 4DQOH 3L3JB 4O02B 2L7QA 1A64A 1F6FB 5LCVH 3GINA 2VC2H 4J6RH 3W2DH 3IMTA 4PJCB 5J0BA 4P5TB 3VU2A 3H1ZA 4HKJB 4QYOA 5I66A 3BH4A 4Y8AA 5CP7B 1DO5A 1MCEA 3QZWA 1ZSDA 4E0RA 5TK4A 4W9CC 4GMSH 2L04A 4F9PC 1JS4A 4PUBL 3KYOB 1U91B 1GHFH 4WWID 4GYBA 5T3ZL 1QBML 2WZPA 3UTZA 5JW4R 1IC7H 1CJYA 3UJIH 4U1NA 2X9YA 2X4PA 2YEZB 1M05B 2OJZH 3OLDA 3WTWA 4DK5A 1QRNB 1UZGA 3W37A 1I1YB 1I75A 2MWCA 2VITB 3LQMA 2JELL 4CVWA 5HDBB 1J1PL 3V0WL 3EZJB 1T4KA 3BAEL 5TPWH 3HR5A 2JB6A 4NBZB 4OIFA 1SVZA 3HVNA 5C09A 5I2IA 2D0HA 1HHGB 3PU7A 3PUCA 5HGAA 4U33A 3WKMH 3L9BA 3AXLA 1UOVA 3L81A 4Z78A 1YY9D 1XGQA 3BKJH 4HG4J 2OYPA 3C09B 1U30A 1IGMH 4HD5A 1BEYH 1OP5K 3RIFF 5C0BD 3MNZB 4WFGD 1OM9A 4JDTL 4ZTPH 1JV5B 4H2CA 2FRGP 2F15A 1FH2A 2CJUL 1FHNA 1JD9A 1U6AH 1HQRB 3DJ9A 2V8LA 2H1PL 4I4WA 2Z4QA 5CZRA 5FO2A 1R3HA 2VLKD 2OZ4H 1NMBH 2BVYA 4D94A 8PAZA 5T3XL 2F8VA 4NC1E 1AIFA 4XCCH 2YA1A 1NBYA 2ZP0T 3P77A 2EZ0D 2X88A 1GYVA 2ETWA 4D0BA 5LHDA 3IE9A 2EADA 4EXPX 5CEZE 4FXKB 1VKXA 3P3TA 1F6AA 5F7BA 3ZKSD 4DEPB 4LGSB 5JIKA 5GRYA 3UXFA 4Y4HB 4X9YA 4N9GB 4URTB 5MENB 3T2NH 1HDMA 1IM9D 1ZK9A 4S1QH 4GEIA 3UP1A 3WFDH 5BV7C 3US0A 3KXFB 3N44F 3C5XA 4NSKB 3IGLA 5GGQL 3L4XA 1ZKAA 4MTMA 2I7OA 3GIVB 2YMOA 1AQDA 4TQEL 3OHXA 3DHMA 1I3GL 1ZLUH 4U3SA 3BFWA 5GZOA 3WE6B 1XGZA 4PHZA 3PDOB 3RKPA 1ZHKA 4NHCL 2G0KA 4OM0H 3WJJC 3HE6A 4JFVA 1I9IH 4NHUB 2C9XA 2H2PD 5AW0B 2ITFA 4JFPA 2MKLC 3VQLA 5K9JH 1OAUH 3HC4L 2HVJA 4HX1A 4JHAH 4RAHA 3ZRFC 1GRWA 1NUNB 2PPCA 1V27A 1G6RH 3DNKA 3FFCE 3I6SA 3VGBA 2CKBH 2WZ6A 3NSYA 3ZKND 4HETA 4CVXB 3C75A 2Q6WB 1QI4A 4JFFB 4NQDA 5BXFA 1LE9B 4NKIL 5J06A 4NN7B 3IRZA 3CXHJ 1UB5B 1JGEB 2BLFA 4GG6B 1GSMA 2XU9A 1A6ZB 5IB1B 3BP7B 4L8BA 4TVSa 1DVFA 1ETA1 4Y4FB 5F8RC 4OLYL 1PKQB 3QIBA 5DJAA 4GKOA 4OCSL 1OY3B 4JGUA 4MRCA 4U4IA 1ZHNB 4JDZB 2YOCA 4UQ2B 2A6JA 4Y9BA 4Z6AT 2DQHL 4FDWA 3MMEA 4OKVA 1A9BA 1WS8A 4XN8A 5C3LD 3PJLA 3FMGL 2PWGA 5IJCC 5E9NA 1TQCC 3SKNA 1T66C 1Q4NX 3B2UC 3FU6A 3MLTB 3RL2A 1BQRA 1GW0A 1WFNA 2BOCA 1IQWH 3S3SA 4NYLB 5C0AB 5CSGA 5C71A 4JZOB 2DQUL 3ABKB 5DYOA 1NL0L 3FKUS 1PX4A 3GI8L 2J55A 2PWDA 3S35H 2QQKH 4GFXA 4LSRH 2ZOKB 1JI2A 3L4CA 3X3GL 4TOYL 4Y5VB 1C5BL 1G7JB 3S5LB 5DJ6B 4HHAA 2Y9RT 4C83B 4ZSOE 2GAZA 2BHUA 1XB6A 1YEKL 2QELA 4X4YB 1NCBL 1O6TA 2Q20A 4LAQH 1G94A 4OD2B 1IGML 1VPOL 3NJFA 5D96C 2GHZA 4Z9KB 1JFQH 1VFBA 4PJ5E 2G0LA 4LASL 3RL2B 2R8SL 3QNZA 2ARJB 1AP2A 3U2IA 3MA9H 1CGYA 1GC1L 2F54E 1HHIB 2BNQA 4QHMA 5FV1L 5J7CC 3O8XC 5C6TH 2BVQB 4MNHA 1NLBL 2HLAA 1ZT1B 3EFOB 3GBDA 3CZFB 5KTEH 5B22A 3LKRB 2UZIH 3BIBX 4K0OA 3WKPA 3RBSA 2OW6A 1DL7H 3GXPA 3E38A 4RGMB 3QAZB 1RZFH 1XVSA 4G7VH 1QVOB 5GRJH 4PQXA 3SCMA 1O0VA 2IQ9L 2A6JB 2FEDD 1D6VL 2XTJE 3HC2A 3P9LA 5IGXH 1ZTXL 4TSAH 1RZQA 5HD8D 5BRZD 3EJJX 3RA7L 1GS8A 3MOAL 3TLRA 3SGJC 3UDWA 1LQSR 3MLVH 1GOFA 1MQKL 4IHOB 1N59A 2GJPA 1JVOA 2CCWA 3VFOB 1S7QA 4CN6A 2ED6A 4FNPA 3RUGA 4XNDA 2V3EA 4LPUA 2Z8RA 4JFEE 1ZT4A 4JKNA 4XH2A 4FFWD 4HEMA 4L3ED 2JV6A 4RVBA 4D8OA 4DGWC 3UBFA 4OLWL 2J4WH 1B2YA 3GS0A 2J8UB 2Y2YA 3EH4B 3T6VA 3FU7B 2CBPA 1K4DA 4TRPH 3ISYA 2AKRA 3FB6A 4RAUB 4EVNA 4D0CB 2FK9A 4AQAA 5A6LA 4R7NB 5CN2A 5DK2B 2NYYC 1N0XH 2EXYC 1ZSDB 2A0LD 3FTXA 5TE6H 3X12A 1G7LA 1MG3C 1YNTF 1I3RA 1CK0H 3HRZA 4R3SA 4YFEA 2PP8A 5AAMC 2CBMA 3VXPB 1I1FA 4JFED 4WWKB 3V4UL 1T03L 1NKGA 2DWEA 5HHVH 5HVWA 5L88H 3BKYH 4JG0H 2ZOLA 1L5GA 4WCYH 1RZPA 3OB0K 2YUWA 1K3ZA 4DAGH 1QNZL 3IYLW 32C2A 3QIUA 4LARL 1KLFA 3SGJA 3X1EA 4DGIH 4CMHC 1CDJA 2VTFA 3S6CA 3NK3A 5MI0B 3U9UB 4I18B 2VRKA 1IGIH 4Q52A 4YSRA 4N0UB 5K59F 2NYYD 5CLZA 1QLEH 1TYJA 1GKEA 2W9LA 2ZYRA 3KCPB 4FP8L 5EC1A 3OX8A 1INDH 1XF1A 3KG5A 1QUNB 1Z6JT 4L2LA 5HGBB 5CZXD 1LDSA 2WKGA 5EORH 3SE3A 2O6PA 3QFGA 1RK0B 2Y3AA 3IU4H 3DX7A 2XCMC 3Q8EA 1R5VB 4JDEA 2EDWA 4K55A 2DM3A 4GRWF 3BH8A 4YK4B 4UTAL 2X2UA 4XO5A 3OWEA 2QBWA 5LCVA 4RFNC 3VFTB 4GW4B 2B4CC 2A9BA 3DVIA 4NIKB 3OQ3B 4I0CC 1CT8B 3CHSA 2DYPA 3LN5B 1WH0A 3WUZA 1YEDB 1V7NL 1B4JL 2HLEB 2XN9B 3GJEA 1FL3B 5HD8C 1KBPA 3U0WL 3QIWA 5D4QA 2L4OA 4AQ8C 5DTFA 4UTBH 3FSVA 2NZIA 5IJVB 1H9VA 2N4IA 4WWKD 1BVNP 1KPVA 1DQTA 4A38A 1SDYA 4TULH 4UT9H 2CA3A 4KV5F 1R3IL 4X6DE 3TNMA 4QPEA 4CU8A 3EUUA 4AENA 1JWMB 4QTIH 5BMFH 2J8UF 4JFFA 4EN3D 4PN6A 3PF2A 3QEGL 3UPAA 3SOBL 1ZLSH 3QHZH 1ZAGA 3QWQB 2QHRH 3ECBB 4JO8A 4N24A 5CJQL 5D71H 4UB0H 4U3SB 5AAMA 3W57A 2UZPA 4HXAL 5DJ2A 2R69H 4PJDF 3QZWB 4MQXC 3EOAA 5HVHC 2DD8L 4BE6A 3U7WL 2DWYA 5FECB 4N2LA 1FC1A 1NEZA 4RMVA 1P4IL 1FVDB 3EOYG 1TKWA 1S3KH 1J9CT 5CP3A 4E41E 5E1AB 4OSUH 1U8IB 2GB2A 3IB4A 3O6MH 1WCBB 2NY0D 3IS0X 4GO9A 1T4WA 1QZNA 3FHQA 3HFML 4J3OF 4LBEB 1AVAA 3A21A 4OLZH 4QF1B 2DLTA 5C0JB 3GUFA 5FO9A 1TZAA 4YHYC 4ICWA 2HJFA 2IPKB 2R59A 5C07B 5BV7L 2WXJA 4LSPL 2HRGA 2DYPD 3JV4A 4M7LT 1XGUB 1UURA 4TVPE 5F7AA 3SKJH 4WHDA 3UBXG 1W16A 5D1QD 3ARFD 3BGAA 3GTVA 1PSKL 5JQIB 2ORBL 1F4YL 3L5HA 1T0NB 5BRZA 3S5LG 4LPXA 4PI0A 5DD3L 3KPSD 4LKXB 1S7SB 1A9EA 4HQQH 2VMEA 1L9PA 2AJXL 2WMPA 1O6SA 3FYEB 2VNCA 4LF3B 1RUKH 5IF0B 3MFFB 3SGEI 3VXTA 5BO1H 2WLJA 1OKEA 1KB9K 5GXBB 1TIUA 2HG0A 1VERA 2ZXGA 1XSJA 4X7SH 4GW1B 2X87A 5CN1A 1RXLA 3GM0A 2NNAA 5DFTA 4Z3FA 3U46B 4I3RH 3K81A 3MROB 3ZDYE 3LZPA 4HH9B 2R15A 2XPZA 4IU3B 2JXMB 4OLVL 4ZW5A 2CSPA 1JPSH 4ODTL 3SQBA 4AJVA 2WTPA 2D7QA 4GLRI 5ISZD 2D31A