2VERA

Structural model for the complex between the dr adhesins and carcinoembryonic antigen (cea)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
143
structure length
143
Chain Sequence
EECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGYWAKDNKQGFTPSGTTGTTKLTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords AFIMBRIAL ADHESIN AFA-III
publication title Binding of Dr Adhesins of Escherichia Coli to Carcinoembryonic Antigen Triggers Receptor Dissociation.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2verA00
2BCMA 2JKNA 2VERA 1UT2A 2JKJA 2W5PA 1RXLA 1USZA 2JKLA 1UT1A 1USQA 2IXQB
chains in the Genus database with same CATH superfamily
4PV8A 3QIBB 4RRPG 1DVFA 1UB6B 3C5XA 3IDYB 1VFBB 4KDTC 4ODWA 2OMXB 4Z7VB 5LGJB 1MELA 3LH2L 4HKZA 1G7LB 3VXMD 3JTSB 4UQ9A 4H1LB 3PQYD 1K85A 5DRNA 3LKQA 5E9DB 3GIZH 1MFCL 4RWHA 3D4CA 5JHMA 2WWOA 2XWJA 3L8QA 3HNTL 3MBXH 4F8TA 4B3VA 5F7NC 2UY6A 7FABL 4NIKB 4PGDB 3IMBA 5KVEL 1KNOB 1N64H 4RDBA 4TRPH 5AYUH 2P3YA 3LRHA 3QEQB 1OP5K 1DBAH 1LMIA 3MXWL 5E2JA 5I76A 3QXDB 4YN3A 2GAZA 5CWSA 1L9MA 2FT6A 2XICA 3LN4B 5CD5D 2QPSA 4M1GL 5I8KL 4S1RL 1IFGA 4J2XA 4JN1L 1IT9L 4Z23A 4N6RA 1BPVA 2VQ1B 1PKOA 1WISA 3L1OL 5B8CA 1JI1A 1GPOL 1HSBA 4OLYL 5F0PB 4AIZB 5I18H 5E8EB 3DI3B 3GHPA 3MDJA 5C0CE 3T0AA 3ZY7A 5LGHH 4YHIA 5DUML 1IGJB 3OB0H 5HSFA 4ZMZA 1AAJA 1GGIH 1SYVA 1NGZB 3QNXB 4XP6H 1N18A 4L3ED 2CDEA 2XBZA 1F18A 4Q7DA 1LVEA 1O7DC 5JQHC 4RMVA 2YPLB 4KMLB 3T0WA 1QUNA 4BFOA 1MFDH 1EX0A 1G1YA 1N59B 1J05B 4GFXA 1YEEL 2H1PL 5DSCA 4FQIL 5EF1A 4YDKL 2QTVA 4N2OA 4X2UA 2VZVA 2WXJA 1E8XA 3S36X 1BQ5A 4GW5A 4N86A 4OCYH 1CE1L 2XWDA 4HISA 4YL9A 1HXKA 2EC8A 2JJTA 1SDAB 5C2BH 2PPFA 1MJUH 3ARXA 2ZIDA 1LE5B 1WZLA 4RDQF 4XH2B 4Y5YB 4QF1A 2MCAA 2NW3B 1ZHNB 1YEGH 3AY4C 3P3TA 4DFIA 4HAKA 1IM3A 3T1FB 2CA4A 4AUJA 4U1JA 3QC6X 4XHJD 2BH0A 5BV7B 4XHJC 1Y18A 2NY0B 2BNUB 3DJ9A 4O9HH 1IAOA 4IIQA 5KANI 1HINH 4GUOA 4L8BA 3WYRA 2VDMB 2AZAA 3BKYH 5J1SC 1G6RA 2JFCA 3HE7A 4MMXA 1F8TL 4HCRL 3W0WD 5T1KA 5IFHH 1A25A 2DKMA 3VI4E 1S7VA 3BXNA 3AT8A 3P3YA 1H3WM 2GG1A 4HKJA 1DHKA 4YSRA 3PGDB 4IGBA 4G83A 5C2UB 4Z78A 3QWNA 1JNLH 1RUAL 2ZYSA 2IF7A 1J5OL 2OMTA 3ALXA 1Q0EA 1E6OH 4GAYB 3IFNH 4QHMB 3L3IA 4RZCA 4JDZA 4I18B 3NJKA 5T5NF 1YMHB 4KNUA 5HYJB 3Q13A 3UYPB 1ORQB 5ISZA 5DRXB 4ONHA 1HDMB 2ZTBA 5I73C 5L8LB 1VZGA 3KW8A 4JM2A 4HWNA 1FAIH 2Y6TE 4KMTH 2E75C 4QHUB 4N9GA 3T5WA 4AX3A 4AYFB 1MCCA 2EIKB 5IIEB 1W15A 1IAKB 3WEAA 3HN3A 4Y5XB 2R0KL 2W0PA 3VQ1C 3V0VA 2YJLA 3CXHJ 1KJMA 5EOCH 3P4MA 3DX8A 3R8QA 3QORB 3RZWA 3ECBA 5C08A 1T0MB 4R8WH 4HLZH 3Q8BA 5E6RB 2XTLA 2ENYA 2PR4H 4N0UE 3I9AA 2OA9A 3D0AA 4HJGA 4R5VA 1F97A 4X5XA 2CCWA 1UOKA 1QVOA 3VXSE 5A2BA 1DVFD 1CL7L 4U6YA 1DVFC 1H3TA 3RL1B 4AG4L 5A1AA 1J1XH 1TR7A 1G0XA 4MAYB 1LDPH 4JJ5B 3DK2A 5HHXL 1WPCA 4G1EB 2GFBB 1DCEA 2HJKB 3BEVB 4JFYB 3QQDA 4H1LG 4RAVA 3OKLB 4V11A 2JJSA 3FQRB 4EDXA 2CCLA 4LL9A 4JFZL 1G7JA 4AZ8A 1UXSB 2LU3A 2IH3A 1SMDA 2X41A 4FXGB 1TO4A 2CK0L 1S7WB 1DE4B 3X1FA 2PTUA 1RU9L 3JWNG 4S1QH 1EHAA 1OAXL 4RMSA 3QHZH 4E9WA 3FQWA 4MQ7B 5DHDA 3HFMH 4OV5A 4HC1L 3OXRB 5FHBH 1WFTA 3QWOB 4Y8DC 4BWTA 2LU7A 4NRYB 2V8LA 4J3XA 1RIHL 3BT0A 5B8CC 2Q76B 3BP7B 2WWKO 1KWGA 1G9HA 3QUGA 2J4WH 1JBJA 5JMOC 4HS8H 5LGYA 1S7RB 2AS5M 5HHVL 3MMEB 1S6NA 5DHEA 4W9JC 5D7JD 4TUOA 5D7JC 3WJMA 1M57B 1JYNA 3HB3D 4JB9L 4N2HA 4WI2A 2HG5B 1BCIA 3HB3C 4OJCA 2X7LB 4YUEL 5F7EL 3EJRA 2VLKB 5DJ8A 1QLEL 2DH3A 4ZUTB 1A3RL 2V9QA 4TTGA 4TSCH 1VADB 1OP9A 3BRFA 1UACH 1AE6H 3PP4L 1Z3RA 1T66D 4NCC1 5FGSA 3KYOA 3TA3A 1OAYH 3ZDYB 5E99H 3W2DL 3PPSA 1DO6A 1EPFA 3S88L 2XVBA 2AK1H 3Q1EA 3R06A 5IK3B 4DZ8B 5CEZD 2BS8A 4JDVB 2CH8A 4K7FB 3BAWA 2B9AA 4OSUL 2JJTC 3WHE0 2N01B 3KLLA 3LS4L 1IMHC 4YHOH 1JPTH 4JQXA 1ZV5A 2G2PA 1W16A 1RPQA 7TAAA 5DD5L 1IM3D 4BSWA 4MNQE 3I50L 4OVVA 2BSSA 3LNEA 5I5RA 1A6VL 5EN2A 3WDIA 1QACA 5CIPH 4XAKE 5B4MD 1DN2A 5C09B 3CVCA 3U7YH 5B4MC 4IIQC 4JFEE 4UM8B 1I3VA 3HE7D 3ZDWA 2RFXB 4TVPL 1JZJA 3HE7C 2DLIA 5B21A 5T1KD 1AZUA 2QADD 3I6LE 3QEGL 4BUHA 5ABAA 2QADC 2NXZD 2VERA 1MI5A 2AABL 4IGBD 2NXZC 1DJYA 2AV7A 3MGAA 4HJSA 4IGBC 4M56A 4X5QA 4X6CA 3QXAB 3NZ8A 4DQOL 4OKDA 3EYUH 2AJXH 2AJYH 5A43C 1H3XA 3L4XA 2F53A 2HP4A 2VDKL 4C83A 4JPSA 5CLTA 5ISZD 3ZPDA 1ODAA 1BQHA 2KLRA 4JM2D 3L7EB 4X0KB 2CALA 4NZDA 4U7KA 2PXYB 4JM2C 4KHTH 3S8GB 3CFJA 1Q9OA 4OZHB 1G87A 1QX1A 1DDTA 5GGUB 1WICA 4G8IA 1NQBA 5HHMD 2LHAA 3K0WA 2AJUH 4G9DA 3PJSB 4DEPB 5C08D 3IS0X 3UJJH 4G42A 5IHHA 4W6WB 3EADA 1P84K 4WENB 3SYQA 1A6TA 3K2IA 4ES8A 2XN0A 2FEEI 4U6XB 1XZ0B 5HGHB 1X5ZA 1HE7A 5I75C 3RJQB 4B5ZA 2XFXB 1I7RB 3NFNB 5FYJU 2G5RA 1MZZA 3QISA 1DVYA 2EEBA 2V5TA 4FNTA 4Z95L 1UZ6E 1FVCA 4Y19B 3L6FB 2K8MA 4JY6B 5IB2B 1Q72H 3QUML 4QXTA 3IFOB 1MFCH 4V2CB 3RWFB 4G6ML 1ZVSB 4PBVC 2JJSC 3U4BH 1NC4A 2BCMA 1XGYH 1IC0A 2VR8A 2ENPA 5D4IA 1GGCL 5FO7A 7FABH 5KVEH 1AI1L 4WIQA 2ZUTA 3MSPA 3SKUD 2WXMA 3JWOL 2V5RA 4DO6A 2H9GA 3BMWA 2ZWKA 2IBZX 1SDYA 4LOFA 3IJYB 5EPMB 1ZGLB 3U1QA 1UATA 4WFFE 2FGWL 1AGDB 4M1GH 1E5AA 2CNYA 3G5VA 3MLRL 4JN1H 1IT9H 1RJYB 3ZTNL 1GPOH 1RUPL 2XQBL 5F3HB 4KBPA 3SGJA 4JUTA 5C6PB 1HFUA 2OR8A 5DUMH 5H2BA 1WWWX 4LDLB 4NDMA 1PX4A 2YZ8A 4WHYG 1A66A 3BVVA 4X6BB 2OULB 3V6BR 3P73B 2N1KA 2V33A 5D55A 3OGOE 3F7PC 2ZKHL 3QYNA 2JIXB 3OR7A 4NAMA 4A7GF 3MLWL 5CSZA 2FEDD 1KB9K 2DV6A 4FZEL 2FEDC 2QR0A 3K2UL 4LLWA 3O3EB 3B6SB 4FQIH 3ZL4H 4YDKH 1WZ1H 3TA3D 4PJEA 5AVZB 2A99A 4FEMA 5AVSB 3U6XS 4GMTL 4U1GB 2BM3A 1CE1H 1S9KC 1A6AA 2MOQA 1CN4A 3BCFA 4YEEA 2VISB 4QNPF 2YD9A 3NDZE 4YK4C 5J57B 2FT7A 4HULB 3AGVA 2N7SA 3T3MF 3H7LA 3V0IA 3K0YA 4LU5L 2J88L 5E7FA 3SYOA 2P44B 2WKLA 1EQWA 5EO9B 1QPXA 3FTVA 2GHZA 1H6FA 1GYVA 4OCLC 4WU7A 4ZSOB 5CLXA 5BV7L 1J0KA 4W4OA 3B9DA 3BP4A 3OMNB 3ARZA 3SZ6A 1T2JA 5EF3A 4B9IA 3ZX1A 4W9ZA 3CN0A 3I9GL 4QUOA 1TXKA 5A6LA 5CJ5A 4Q2ZB 3TF7C 3WNJA 4KNSA 5HYQA 2PCFB 3D0LB 1RZ8B 3UAFA 4K7PL 1YRKA 3SDCA 3HJEA 1RUAH 4HXBL 4UQDA 2ZE0A 3NFPA 2F53D 2UY7A 2HVJA 4P2OC 3H0TA 1DR9A 2BSRB 2X3AA 3KVPA 4P48A 1AQ8A 43C9A 2E8ZA 2WXQA 2CHZA 4OD3H 3D0VB 2I07B 2YD7A 3CHSA 4ZMVA 3EYQD 3ULUD 6PAZA 1FVEB 4Y7OC 3EYQC 3ULUC 4ISVB 3S97C 4KRNA 4I0CC 5I82A 3HUJA 1GYCA 3E8VA 2ZXDA 2WQAA 3ELAT 1CYWA 5JO5B 1L0PA 1XX9C 4JKNA 4TMPA 4K3GA 2CR0A 4LVOC 3U0PA 4WV1B 4WCYL 1JFHA 2D8KA 1W80A 3ILDA 3F7RA 4IK6A 4WUKL 3GLZA 3UO1L 1HHIB 3X1BA 1EZSA 3STZA 2ED7A 2UXGA 1CL7H 4Y1AA 5J5EA 2MTPA 1AXSA 2WQ8A 1E4XH 2BS9A 3MV01 3P30L 4P46B 4RFOH 1H9DA 1BVOA 3ULVE 4P2QA 5HHXH 1HHJA 2K6YA 3QEHB 2KZWA 4V2BA 3H7BB 4JFOA 3LZLA 4NUQA 4OLXL 2G0KA 3RGVC 2OMUB 4AT6A 5DDHA 2YEVB 4ORGB 3N1GC 3OKKA 1F3RB 1U4EA 4KOCA 5DQJA 4JFZH 5L4IA 1J8SA 4EZMA 2X38A 1L5GA 2CK0H 2X40A 3TO4A 1RU9H 2DMKA 4PJCF 4V1DE 1OAXH 1J5DA 4YE4L 3W9DA 2TRHA 4A7QA 2EDTA 3OZKA 3DX7B 1KLGA 3NACH 3OQRA 4Q6KA 5BS0B 4AW4A 4HC1H 5ID1A 4LPYA 4DTGL 3NEEA 3TS8A 2IAMD 3L4CA 4ANVA 1CBJA 5DGRA 1A8ZA 2IAMC 1WRFA 4RH4A 1RIHH 1NSNL 3NSXA 3HBQA 4NWTL 1PZBA 3SGJC 4LLVA 2UZYB 2D4FA 1KIUB 1ZJBA 2IAAC 2BDNH 3KLAA 2C9RA 4PG9A 2APSA 2X6UA 2NY6D 5EORL 3PHOB 3LXCA 2ZJSL 2NY6C 5HHVH 2L7JA 2FWUA 3H4FA 3RX8A 5F9JB 4D8OA 1HHGB 3S5LB 4A7VA 4YR6A 1B4RA 4JB9H 1KY6A 4L37B 3KLSA 4R7NA 3CC5B 3VFNA 4RMBA 2BS71 4YUEH 5F7EH 1GIGL 1QLEH 3OZ9H 2VLLB 4WI6A 1PZAA 2FB4L 2ZQKA 4P3DA 5F72S 1D2PA 4H13C 4KV5E 1UCBL 4ODXB 3TX4A 1URLA 2X4OA 1MPAH 3PP4H 3SE9H 2I69A 4R96B 1YC7A 4JGUA 2J8UE 4QHLA 3WDHA 5JNYA 4NFBA 5IJDC 3S88H 1BVZA 3TNNB 1Q0YH 1GXEA 1UJ3B 3IFPB 4DETA 4PRIB 4F1ZA 5MERB 3B37A 2YD8A 3AU1A 5F7FA 3RWDA 1K2DB 4GIOA 2WLYA 3ELQA 4G6FB 3W3BA 5TDOA 3WIHL 4H0GA 2C9QA 2CO7B 3PAVA 1D5XA 2R4RL 5E1QA 3I50H 1BGXL 4JKLA 1IFHL 1A6VH 3JSSA 3LRGA 2YWYA 2BK8A 4W4OC 1JHTA 2V9UA 1VCAA 2YZ1A 5B38B 1MHCA 4MMZC 5FV2A 4TVPH 1TETH 3HZKB 5L9DL 1G0DA 2Z35B 3AT9A 4ELKB 3CQQA 5I24A 2Z6FA 5DVMA 1FG2A 3QEGH 3VG0L 4UV7L 1WT5A 1OCCB 3L9BA 4X5LA 3SDCD 2JK5A 1JV5B 3MRRA 3O41A 1C7TA 5CKAA 4NO5A 3SDCC 1NDGA 3VH8A 3D05A 2OMNA 3CH8A 3CZKA 3FQXB 4PR5B 4XXDB 2F54A 1Q8MA 2GSGB 1OVZA 3VFPA 3TWCL 3KPNB 2VDKH 5IJVB 4JQIL 4X9FA 4BH8A 1TZGL 3OAYH 5SV4A 1L0XA 1EIBA 1KV3A 3UCQA 1CLOH 2IPKB 1MFUA 4NQEE 3V0GA 1WIOA 3FUKA 4HIJA 1JK9B 2NZIA 2Y1AA 4F37F 4PD4K 2VR3A 1W9XA 4HWEL 1JMXA 3VFRB 4N9OB 1X5IA 5D1XA 4PWFA 2O6PA 3O9WA 4R26L 5JPNA 4PRBB 1GR7A 3T9WA 1F3DH 2YMXL 3NJVA 4WWNA 2ROXA 3VD0A 4Y1AD 4F7EB 4M6AA 3QJQB 1L7TL 1A14L 1IGYB 4DN4L 5ITBL 1R3JB 1U8OB 4L4TE 2ZP0T 3QZMA 2WBJA 3GKWL 3RP1A 4P2QD 5MEOA 1EEZB 2F58L 1ITCA 2R4SL 4UYPA 4Y16A 3RG1C 2C3VB 1QRNA 2X1OA 5CNHA 1S7QB 4H1LH 1IIKA 1N2RA 4G6MH 4JJHA 1NCTA 5T3XE 5IB4B 3GUTA 3KHQA 3KH3A 1DSFH 3CFNA 2OTWB 1GGCH 1AZNA 2YK1L 3TO4D 1A2YB 4ZG1A 1CO1A 3TO4C 4IIZA 3JWOH 3JWNH 2AGJH 2NCMA 3SPJA 4RDQG 1TEGA 2VTFA 4FKHA 4HSQA 4EQ2A 25C8L 3HE6A 4W9GC 3UROR 1G4MA 2QSTA 2ARWA 2FGWH 1ET7A 2ZWYA 4LP4A 1KPVA 1DQJB 3FF8A 4LE8A 3ZTNH 1O5DT 2FX9H 4UTBA 2K3HA 2KBGA 1OP3H 1KPUA 2EKSB 4G5AA 2CO6A 3BD3A 3ILPB 1WAAA 4BGLA 5KVGE 4F33A 1WBXB 4GKSB 1DBBL 1S7SA 1BD2A 3L5HA 4NSKB 3GXNA 3K4DA 1CFQA 3VRJB 3S5LG 4PB9L 2IV8A 2Z8WC 3NIDB 3AREB 2DLEA 4QIRA 2A83A 5C6TL 3ZKMD 2DYSB 3MRMB 1NH6A 3ZKMC 4FZEH 5T5NG 4B9JA 2VM4A 5D71L 1EZUA 3KAAA 3E3QC 3ABZA 3VXUB 2FSEB 1PVHA 3KXFA 3LKRB 1EO7A 1D3CA 3BIBX 3Q6FA 4YDIH 4D9RD 4GMTH 4LVEA 4QTHB 3ETSA 1VENA 4KKCC 4JRXB 1ASOA 4O2CB 3HRZB 3ARVA 1DBKL 2BO0A 3PGCB 3POCA 4MNHA 1F13A 4UNIA 4LU5H 3OAYK 2J88H 3ISWA 3N43F 4XO5A 5DRWB 3TBWA 4A63A 5HGAA 3T4YA 5DZJA 4W9LC 3UERA 4Y89A 1FDLL 2H5UA 3RVXD 2FBJL 1HQRA 2XTJE 5C86A 5H8DA 1N9PA 5BV7H 2GI7A 3SYCA 3UGEA 4XRCA 3WUWB 1DN0A 5FA4A 5B38G 2ICEB 4BKLA 2XYBA 4ZS7L 2CUAA 3I9GH 4KKNA 1F6AA 4NQSA 1NPNA 1WT5C 4PJIE 1H6TA 3BMVA 1CLCA 4PLNC 2YO3A 4K7PH 4KDVA 5BRPA 4DCQB 2BNQD 2F54D 3APNA 3FN9A 3K2KA 3S96A 1AYOA 3TPKA 5F7DA 1MG3C 2FJFA 4OD1H 4JFSA 3WNKA 2CLZB 1XB6A 3TVMA 5D7LA 4QRPA 1V7NL 4I1RA 5FYKD 2D9CA 4MCZB 2VERN 5BMFH 2Z4QA 4MB5A 2LFEA 4YXHL 3RLSA 4K71C 1PQZB 3KE0A 5D96C 4AV4A 1J5CA 1A9EA 1TMQA 4NQDA 4M00A 2D3LA 1BOGA 3RVVD 5TF1L 4R6UA 2YJQA 5D6CA 3RVVC 3D5OF 2VKXA 2P28B 3QJXA 3GSUA 3AVEA 2WO3B 5DJDB 1I7ZA 4L9LA 1E9OA 4QLRA 5D1XD 2EVJA 4RMRA 4B9KC 3N5AA 3O9WD 5L2KB 5D1XC 1BEXA 3O9WC 1E40A 1ZIAA 4ENED 5EU6E 4F58L 5JPNC 3L9RB 3CDFA 4ENEC 4ELMB 1AQDA 2QQNH 4CAGA 4CU6A 3I75B 3QIUB 2RCSL 1Q90A 3CLWA 1R3HB 1F58L 2WBJD 1HJBC 5DEZA 1RK1B 4DK5A 4CDHA 2WBJC 2XUWA 5EU7E 3E1F1 3N50A 1DTUA 1XB8A 4K7PY 4Y16D 2EIDA 1QRND 4Y16C 1UXMA 5FUZH 5JLZB 4H40A 2ZUQC 3QUYB 3ZDXE 1JVOA 3S3JA 2FD6H 5AW8B 2NY2B 3RTLA 1SN0A 3BVUA 4J6RH 5HHOB 4HSAC 4G9FB 4N8CL 4NO2A 4OFDA 3CHOA 3K5RA 3QI9B 3PG2A 4YE4H 3PWVB 2OJEB 2XJLA 4WK0B 2BCKB 3HE6D 1H8LA 3SDDA 1JHLL 3HE6C 4DTGH 4M62L 1O6SA 2YUXA 3UPAA 2JKNA 1TZIB 3TV8A 4Q6IB 4HUWA 1CZ8L 3WL9A 3GXUB 1OAKH 2ZKMX 1NSNH 1U92B 2E9IA 3NH7L 6FABL 1IQDB 4NZJA 1MCOL 1YZZA 3KD4A 3LXBA 5C0AA 4M3JA 3CV5A 1M6UA 1F11A 1KG0B 3ZL2A 1S9VB 1G7PA 3JWDL 3LKPB 1BD2D 3FU6A 3VX0A 1CFMA 3MRBB 5DHYB 5JUEH 3KPRD 4UMGA 5KBNC 3SGEH 5JDJA 3QNYB 2QJDA 2XJKA 4TV3A 4PIBA 3JV6A 5AD0A 2YGOA 2DQUL 5MENB 2EEDA 4J39A 1GIGH 3C6EA 3GJFB 4YHLL 3FU5A 4FJZA 2FL5A 1V8HA 3IDXL 5INDB 4EKXA 3KXFD 1QBLL 1UCBH 4X5PA 1ILUA 1CXLA 3PWLA 4OJDH 5F7YC 1NEUA 1YPZA 1DZBA 1Z5YD 3U4KA 5E95B 1GA2A 2DM4A 1SJHA 3DUSB 5E8OB 3MJ9L 5BV7C 4QRRE 4EO5A 1VEPA 4OZGA 1X9QA 5JHLL 3D4GA 4OCMC 4I8DA 5I15L 2B14A 1PG7L 1W72B 2XACC 4CW1A 3T0EA 3WIHH 3L5XH 3T6WA 5ICZA 4AEIL 2FO8A 1XZWA 1OB1B 2R4RH 4PJBE 1BGXH 1CL7I 4FXKB 4GYBA 1QZNA 5AVUB 3EH1A 3RWEA 1E4XI 3H8NA 3NIFF 2XDHA 9PCYA 4L18A 2H6UA 2X9YA 4FQLH 4FHKA 4OF7A 3U2JA 3WUWG 2V3FA 1SN5A 3WY4A 4ES9A 2TRYA 2F2HA 3VXME 2YD1A 3KH4A 3ABMB 3P3RA 2GIYA 3VG0H 1MWAB 4APXA 3T0DA 5D9SB 3IGFA 3GMRA 3SGKC 4YHKL 2H26B 3EZJB 4G6AD 2V2TA 1KJVB 5F9WB 1KTLB 3VW3L 2LLLA 4G6AC 3TH4T 2VMFA 1BVKA 3TVMD 5D7LD 4BE5A 1AMXA 4QRPD 3TVMC 3CFCL 4XGZA 5DJXB 5G5DA 1HTYA 3LNIA 3KYNB 2J2ZB 1TZGH 2R29H 4I48A 4BFIB 4BFEA 3IE4A 4LEOA 4YSUA 4NQDD 2DL9A 1JI2A 2VQUA 1AO7A 3NA9H 4X5WA 3SPCA 2R0ZH 3EBIA 3MLXL 5BQ7A 3K6SA 2IADA 3G6JF 4M1DL 4L9LC 1E2ZA 4JANB 2F1AA 5DJCA 4HWEH 3PUUA 1ROCA 4NYLA 4L3EE 4R26H 4RRPA 1O7DE 3SDXA 1A7OL 1TPXC 3UBXI 2YMXH 2PCYA 4QYOB 3WJLC 4BIKA 1L7TH 5ERWA 3B2VL 1AZRA 4DN4H 1F90L 2WQUA 3P3UA 4G3YL 1I1YA 3TN0B 3GKWH 9CGTA 1A1NA 2Z8SA 1BQLL 2BERA 3LZQA 1ZT7B 2R4SH 3MBWB 3Q2NA 1FUNA 1BJMA 1JXKA 3RJOA 4N0YH 1XEUA 1TEYA 3FTUA 4XHQA 3BH8A 2ZNXA 1Q9LB 3Q5YA 4LSQH 3EYVB 1P84J 5JHAA 3UC0L 4XNZB 3HIZA 2P52A 5CMAB 3NYKA 4HUUA 2AXHA 2DQMA 4O2FB 1TSHA 3KJ4B 2VDQB 4X7SL 1ACYL 2VLJA 3MR9A 3OAZH 3ZJAA 4DP5X 3S37X 4IS6A 2FH8A 3B5GA 3IBOA 3ME0A 2Z1PA 3SDDD 5C0JA 5L4JA 2XPGA 3CFEB 2EUWA 3SDDC 1FJ1B 1NL0H 3EUDA 3AQDA 5SWZA 5D2NB 3NG5A 1HJCA 4XBPA 4UV4L 3RWHA 3U6RA 2XRAH 3GO1L 3VWKA 4JGMA 4OUOA 5LB1A 4U1NB 1YUHA 5KYUA 2OMVA 3W0WE 3GSRA 2CR6A 4NQCB 1BFVH 1NBYA 3D39A 4LP8A 2CHNA 2X70A 4JG1L 4M7JL 3PAYA 4APQA 1G7HA 1ND0B 4CKVX 3J07A 2I9TA 2ADIB 5ECGA 3NRQA 4X0NA 2LT9A 2VITA 1C9SA 1KTDA 4G72B 1DEEB 4ZFZA 5HDQL 2H7WA 4J1UB 2FAUA 1G0YR 5D71H 1MW2A 5FFLA 4WZ9A 3RFZA 4K2UL 1U91A 4JCWA 2ICWB 3VXPB 5FUOL 1BJ1H 1G7MA 4ZDHA 3L4WA 3CG8A 1KYFA 2ZSWA 3EJTA 4KKAD 3MOBL 3LIZL 4KKAC 1DBKH 2QPDB 4FYRA 3T0ED 3U25A 4CMMB 4FQJL 1BLNB 1GYWA 3BQUA 3BT2L 4X98A 3T0EC 3US1A 4F2FA 1OSEA 2B3IA 4XPHL 3IGAB 3PP3H 3L3OA 1SOKA 4ZFOB 3C60D 2LVCA 3AQZA 3C60C 5F97E 2FBJH 2C9VA 4UYQA 5B7FA 4HU2A 4F27A 4W9DC 2QLVB 4XCFL 1NMCB 5I0ZA 3BKML 3QAZC 1WIUA 4ZS7H 2PTVA 1ZVNA 1Z9OA 4HP5A 4PJXE 4XPFH 1AGCA 3NCFB 4PMEA 3BGMB 1GTFA 3LY6A 2VXQA 1DBML 2F74B 3MUY1 2APTA 2NX5A 5GRJL 1SFDA 2JQAA 4NKMB 1V7NH 1H3PL 4HPHA 3VFWB 4CMHB 3VYPA 1JVLA 3NBNA 1X9RA 1XR9A 5IP4A 4RWYH 4FTVA 4XMVA 5AUMA 4EN3A 3KL3A 1M3JA 4C55A 2D73A 2Y72A 3C9NA 2A6IA 4LT7A 3PPEA 3EAKA 4MSWB 4CVUA 1QYGL 4UBDD 5KYXA 3UAAA 1RULH 3ROOB 5TDNB 4LRNL 3OAZK 4UBDC 1MUJA 3SBPA 2IGTA 4GKZB 4WW2F 4EJ1C 2VMJA 1XF2B 3AACA 1HCVA 2XZQL 1IZJA 2RMNA 3QIBA 3VD9A 1SEQL 1UB6A 1VFBA 2ALWA 2RCSH 2OMXA 5IFJB 5D4JA 4H20H 5DVNA 5H94B 1RUKH 3C5SA 3DV4B 2KDYA 4H1LA 4IHBA 4DEWA 2RAMA 3GSXA 1SZNA 2FIRT 2ZNWA 4HLEA 2J5WA 1IGIL 3MTRA 5IFAH 1R3IH 1SQMA 4IRZH 3SB3A 2B5IC 3GZQA 4PGDA 3TEWA 1KNOA 5E6IB 2FWOB 1X9LA 1GJIA 1ULVA 4ZXBA 1L6PA 3QXDA 2BY0A 4LL1A 4XP5H 3BPCB 1QFUH 1W8EA 2VLJD 4YDJB 3VX1A 2YRZA 1ROWA 2H8PA 3QK0A 1MY7A 3CJJA 2W95A 3VGGA 2D03L 2JI2A 2NUPB 3N43B 1JHLH 2VQ1A 2F1BA 3P2BA 3A6BH 1NCDH 2NOYA 4UT7H 4AIZA 1CZ8H 4R97C 2XVGA 4HGWA 3VWKD 2WSPA 4NKOA 5E94B 4N1HB 3VWKC 2BSBA 3WE1A 3NH7H 6FABH 5BZWB 2E47A 3IRCA 1MCOH 2PTTA 3D39D 1NGZA 1L7IH 5L7XL 5GSRB 1JUFB 2DYRB 3JWDH 5CR8A 4APQD 3KPQB 2UUDH 1O75A 4APQC 2NNXA 1TNNA 2R69H 1HYRC 3PP3K 4W1TA 3UBGA 1AHKA 4KV5F 5K5YA 3BW9A 4LLUA 3TEZA 1N59A 1J05A 2J7LA 2VR6A 2CPCA 4JY4A 2QSCH 4TLKA 2AQQA 3ZUCA 3E6HA 2ZX7A 1CU4H 3IDXH 4FQHB 3RGHA 3HLAB 3CZJA 3PWJB 4K0OA 2YAPA 4CC0A 3RFZC 5LAXB 4OUUB 1XCTB 3BAXA 5IHZA 1I1AB 4CGUB 5J8OA 4Z9KB 1M6OB 2VRAA 5HHME 2P4AB 3DWTA 4UIKL 2MOVA 5C08E 1KN4L 4M7ZC 3VGBA 1LE5A 3MRIB 4TKWA 2NW3A 1ZHNA 2XWTA 3BQUD 5I15H 3T1FA 3BQUC 1QP1A 2WGNB 4AEIH 1HEZB 2ZXAA 3ZBMA 3L3OC 2BNUA 3MCLL 4MB4A 2X2HA 2ZXGA 3DECA 5GGVL 5AALA 4MFHA 3S6CA 3E38A 2XWBB 5BJTA 2W65A 1QPKA 4G1MB 4HUMB 2FJHB 4IEFB 2F7RA 3FK3A 2Q7NA 2GBTA 4H8WL 3WE6B 2ENJA 2O72A 4MJ5B 5JA8B 2C9AA 5GS0L 3SE4A 4DERA 4N26A 4QHMA 3P11L 1DFXA 4J3UA 3JVFC 4NN5B 4EMZA 4QGTA 4TULL 1YMHA 4GXUM 3VW3H 3UYPA 5DMGD 4RGMB 4I3GA 3X3GL 1JGIA 5DMGC 1PZ5A 3QIWB 3CCHB 4ORZC 3RPIB 5A6IA 4AYFA 4B0MB 2IBGA 1JD9A 2PPEA 1WE5A 5JW5B 1XF4B 1FZJB 1RP9A 2ORBL 2P5WB 3MN8A 4WGWB 5JXAL 3E9UA 2XIIA 4U0RB 3IDIB 4JR9L 4X99B 5EO0B 3HJ0A 3VRLE 1TCRB 2A9ML 4M1DH 1ZA6B 3ESNA 4UDUB 4IMLB 1AGEA 2MTAA 1U3HB 3EZ8A 5CZXD 2WCGA 1PZ2A 3FUFA 5CZXC 3SGEI 2DDQH 3WY2A 4OD2B 1KV7A 3BHBB 3WTSA 3QIBD 1SHMA 1RXLA 2H1XA 2XV0A 4ZODA 3UC2A 3QIBC 3RL1A 3IDYC 1RFDH 4OBRA 3SPGA 4CKQA 4Y2NA 5I17A 1BZDA 4NXSA 1F90H 3SKJH 1JZ5A 3B56A 3WNOA 1TFHA 3IKKA 4G3YH 3Q2VA 4PREB 5CLZA 3BEVA 1BQLH 1KGXA 2HJKA 4JFYA 5E9DD 1BF2A 1JDDA 3OKLA 2NNRA 1RZQA 5HVWA 3NQKA 3ESPA 2A0LD 1BZ8A 1X5YA 2A0LC 3CC1A 1WC7A 3ECQA 4FXGA 3PXHA 1COBA 3JWNC 1S7WA 3KPOB 3MACH 4FYSA 4ZXBD 3UC0H 1WFOA 1NMAL 5EEWA 4ZXBC 4B60A 4MQ7A 4H0HB 5I1KL 3MRQB 1DFBL 5HJGA 3EKCA 4AC2A 3SKMB 4GP5B 2KLSA 3KCPA 2Q9OA 4KK8D 4ACTA 4JFEB 3BAKA 2A1WL 4KK8C 1T5WA 3FS9A 2W0FA 1FF5A 1UWXK 3DGGB 5D6DC 5FHAL 5IB1B 1NLDL 3WEXB 2Q76A 3BP7A 3MBEB 3QQ3A 2CE6A 4GSUA 4PI0A 4PJ9A 3GO1H 1CK0L 3NIFB 4LASL 3EDKA 4M6OL 5FW7A 3I9IA 5CP7A 2QV2A 1S7RA 3SBWA 3ZIMA 2AEPH 1I8MB 1NGXB 3A21A 1JF1B 4E0RB 2XHNA 4RISH 4AIXA 4M7JH 2X4RB 2Q8AL 4YEFA 2YPLD 3VXTB 1E67A 2HG5A 2R2CA 3VTTA 2X7LA 5B1KA 4YS4A 3WTYA 1A7PL 2F53E 4FQCH 4ZUTA 3T2QA 1FV1A 4HIEB 1VADA 5KSAA 1U42A 3FQTB 5HDQH 5BQDA 1YQVH 1SHXA 2JKIS 1A7QH 2H41A 1X5MA 4ZTOL 1T6BX 1CPUA 4K2UH 4P2CG 3WI9A 4K7FA 2V7NA 3GKZA 3P2DA 4WY7H 1KPRA 3AQYA 1FZMB 2BP5M 4NCC2 4MDJB 4UNVA 1NOAA 4Z1PA 1MLBB 1T0PB 3DHMA 3UTQA 4BQBA 2R23A 3MOBH 4L0PB 3G6JB 4YPGB 2YRPA 1NEZA 4GEIA 4Y9CA 2GQHA 4A38A 3B7SA 4C4KO 4XPHH 2JLLA 3VFTB 3VXNA 2WUCH 4PS4L 5DZPA 1ZS2A 4A6YA 2K4AA 3WENA 1XCQB 1YNTF 3ARBA 4G6KL 4TM9A 3RFRA 3U9UB 3CZNA 4HGKC 1T1YB 3U30B 4OZ4B 1KIPA 4FNLH 5E2VL 5K39A 1R34A 1RMFL 2FE0A 1P4LA 4HEPG 2X4NB 4Z0BL 1Z0MA 5TTRA 3BKMH 1NCNA 2R0LH 3QXAA 4BEIA 3SE4C 3X17A 3PWPB 3ZO0A 4HQQH 5IR1A 5HYJD 3WNPA 1E4KA 2DQEL 3AMLA 2IH8A 4JG5A 3LV3B 3HW7A 5IUCA 2F7OA 3UOAB 1IUZA 5I6NA 3L7EA 4U31A 4I4WB 3MCYA 4FFYH 3U46B 2PXYA 3O2DL 4BK5A 1H3PH 4B3EA 3CFQA 1CVSC 4PRDB 5E8DL 4I3SH 3B1UA 3HG4A 3OAUL 1N4XL 4ZPVB 4WI0A 3ZTEA 4Y5XC 3T08A 1EGJA 3M07A 3PJSA 3QORD 3BWZA 3FSAA 2DLFL 3QORC 4C59B 3BKJL 5GS2H 4YOKA 3QUXB 2OR9L 3WKYA 1TQVA 5DQ9B 4U6XA 1MJ7L 1J1PH 1HT6A 5HGHA 1A7NL 2YGNA 3OKOA 2PABA 4LHUB 1I7RA 1KUMA 3NFNA 2BP0B 4KMQA 5FEBA 3T65B 5IUSA 1LK3L 1T1ZB 2YXWA 4MLSA 5DD6A 2BZDA 4LAQH 1XFPA 1I8UA 1MHHA 4MA7L 1XIWB 1ZA3A 3AFLA 2JKXA 2OP4L 2Y5QA 1ZVSA 4AGOA 3MFFB 4XO8A 1M53A 1F0LA 3ZO9A 3BYYA 3NN8B 5TH2A 5CCGE 3WKML 2W92A 4FXGC 2EDLA 4JPWL 2YPKB 3STLB 2CG9X 2Y2TA 4PYHA 2MNJB 4HPYL 1MXDA 4TTDD 3FAWA 1IBGL 5IB3A 3IJYA 1Q38A 2ZXCA 4TTDC 5F6HI 1KXQE 3O3DB 1S8DB 1UUSA 1WAEA 4LNRB 4DKEL 2KI6A 4X83A 1T22B 4YHZH 1RJYA 4PHZA 4JRYA 4PJ9D 2ZCHL 4PJ9C 1G6VK 2XN9A 1EJOL 2XIDA 4PVNA 3SYPA 3LN9A 4PJ6A 2V7HB 4JPQA 3BWSA 4M93C 2GI0A 4L3AA 2R51A 5LNEA 1HL9A 5DFWH 4DO5A 2ZP9A 3QPQD 4HFWB 1NIEA 5I1JL 3QPQC 3QRGL 4HMCA 3EBAA 5C0NC 3BGFB 2CMRL 3APDA 2OMYB 4QOKB 4XXCA 2DD8L 1E5CA 4AVKA 1EANA 3ISYA 5I8CB 1QI4A 5TE7L 1HZHH 3C87A 3WXVL 1HESA 1MVUA 4F15C 4MD0B 3GJFH 2RACA 3DSFH 1KBPA 5CLWA 3QJOA 3MGTA 3OZLA 1YNLL 3CTTA 3Q01A 5LWYH 5MI0B 3ZGHA 1CDHA 2QQKH 1D7BA 3B7TA 3HC0A 2ZUUA 1NCJA 1KN4H 4KXAA 1FAKT 2DBLL 2VJ0A 4O02L 4WW2B 3P9LA 1OO2A 1W72H 3L3HA 4GAGL 3ARBD 5EO9A 4JO1L 4UILL 3S7GA 3TESA 3ARBC 3MCLH 4Y1AE 4G7YL 4RX4A 2C3WA 4G6JL 4M4RB 4PAZA 5IJCC 3ZE2F 1RZJH 4P2QE 1Z9PA 3U1SL 2CKNA 3P4OB 1G9ML 1S7XB 1UD5A 1HXMB 4UQCA 2VLRE 4H8WH 1RZ8A 3L1GA 4YHML 1ADWA 3IU4H 4XPAH 3JTTB 5GS0H 2UXVA 4OM1L 5A2LH 1MWAH 3AXLB 4DO4A 3P11H 4K3DH 1K8DB 4BQ8A 1SXBA 4U1IB 4TULH 1E4KC 1NPUA 4CVZB 3H54A 3D0VA 2E74C 2YWZA 2PXYD 2TAAA 1BZ7B 3SQOL 2PXYC 5A2FA 1QD0A 3II3A 4ZUSA 2CIIB 4ISVA 3MV9B 3AWEA 1R3LB 2ORBH 1ZMYA 1OT1A 5EU3B 3FQUA 2QZ5A 5JXAH 3GK8L 1VA9A 4DEPC 4OF0A 3N04A 3V5DB 2P80A 4Y4HA 4JR9H 3FB6B 5EUOA 4PG2A 3V4PL 1WVZA 1BXUA 5L4FA 1HHIA 2R7EB 1G5AA 4M1CD 2D7QA 4M1CC 3ZMNA 1INQB 4LHUG 3DUUA 4AVIA 4F3FB 1TO5A 1CDCA 5F9DC 4KGLA 2I5YH 3CIAA 1NJ9A 4Y19D 4DGVL 2FEJA 3QEHA 4AGNA 3H7BA 1JFQH 1RCYA 4IRZA 4CBZA 1U8CA 5I16B 2V0AA 4FFTA 1WD8A 2BY2A 2OMUA 4WGVB 2ALAA 5I8EB 1MF2L 4ORGA 4NIYE 4D9RE 4JKPH 4D94A 3DETD 2RJMA 3EO9H 3RUGE 5SWSA 3DETC 4RA3A 1CLYH 3VFUB 4JW3A 3QYMA 3L1EA 5I1GL 4OU3A 1NMAH 4G80A 1YEKL 5DR5H 1YEDA 3DX7A 4J5VA 1KELH 2OXGA 1R3KB 4OFQA 1NKGA 5BS0A 3U2SB 1I1RA 2VDQH 3HNVL 3LPPA 3D3VB 3GDBA 3IPFA 4ADGA 3VFOB 1AOZA 4Q8BA 1XSKA 1UH2A 2ZOUA 1NLDH 2XN9D 4M4PA 1UD3A 1P4IL 3MRCB 2BSTA 4GRWB 1N70A 5DJAB 4M6OH 4QKTA 2A77L 5L2JB 2OQJA 1HS6A 2YUZA 5AW4B 4JL1A 3KJ6L 4A7SA 2A74A 2XXFA 4KAQL 1I8AA 5F89A 2W9DH 3FUEA 5K1VA 1KB5B 2Q8AH 3M6DA 4G59C 3CC5A 4LGSB 2BNQE 2F54E 1ZTXH 1RJLB 2VLLA 5DK0B 3X3FL 1PJ9A 2IOIA 5GSVA 5MEQA 4ODXA 3U7WH 3UADA 4N2KA 2EH8H 5FYKE 4I13B 1ZLDA 1L4IA 2H2SD 3LIUA 2NNFA 4U1GC 3G6DH 2EIZA 2H2SC 3O6KL 2G2RB 2Y7OA 3IFPA 3L2LA 4PRIA 1E28B 5EZLB 1IGTB 3FCUB 4Z0XB 4M6ML 5TGBA 4KZEL 1TYJA 5A2JH 1KTBA 1B6UA 2LLNA 3H42L 5IM7A 5INCB 3SDAB 2CO7A 5D1XE 5HGDB 2JKTM 2DWDA 2J55A 2ROYA 2C4FT 1XH1A 1FGVL 3IU3A 3RB5A 2WKGA 1U3JA 1ZSHA 5I9QB 5C0BA 5F6IB 2XY2A 3O3AA 1HXYA 3HZKA 3ZRCC 3MUHL 4KU1A 5TFSH 2ADGB 1QRNE 3L1FA 1FL3A 5DI8B 2A9AA 1CDYA 1TTBA 3FCTB 5KBMA 3GJEB 4NLHA 3QCUH 4FERA 4FE9A 4C4KT 2O5YL 1KTJA 3UEZA 1R47A 3U1PA 2GSGA 5IJVA 1OXYA 2TSBA 5J1AA 5J6GB 3HMXL 4D9QD 1JPST 2VAAB 4EZLA 4AE1A 4GW4A 4PLOB 2F8IA 4B7LA 3O2DH 5C97A 3GRWL 1Z9SA 5F21B 1EBPA 2G30A 1FNGB 5E8DH 5FA3A 3OAUH 1N4XH 1OD9A 3IDGA 1QEXA 4HOWA 3UZQA 1JK9A 2P80D 4Y4HD 4BZ2A 4H4NA 4OF6A 5HYIA 5DRZB 2DLFH 2JKLA 4L23A 4Y4HC 4ZMLA 4CJ1A 3BKJH 3ARDA 3BZEB 3WKPA 4PG2C 2OR9H 3O11B 4PCYA 1BD2E 5DMIL 4KKBD 1QBAA 4L1LA 3KPRE 4LCUB 1ED3B 4F7EA 1QLFB 5I1AB 1IGYA 4KQ0A 1R3JA 2CUMA 3B9AA 1U6AH 4XBEL 4HOZA 1S3RA 2OPCA 4OAWB 3KBEA 3P9MB 4IJ3B 1ASQA 4OZFB 4F7PB 4XVSL 2C3VA 2F61A 1A6WL 3ENEA 1CWVA 1D5BA 2UXTA 4U6VL 1Z7JA 3DIFB 4FQ2L 3BVXA 4HD5A 5SWSD 4ONFL 2YUVA 4OVUA 3SQBB 4ZO8A 2VXVH 3I85A 1LYQA 1J9SA 4JFFB 1A2YA 3WKMH 1U21A 5IGXL 4JPWH 2YXFA 1NGQH 3F7YA 3FUHA 4HX1B 4G8GB 5BS0D 4HUVA 2ZF8A 4HPYH 4HKBA 2R1XA 3EDJA 1RURL 5T1DL 3ZHNA 4LMQI 4DKEH 4X7TB 1UXWB 2YXMA 5DJ0B 2KKQA 2J6EL 4FG2A 2ZCZA 3C5ZA 1JSYA 4OFKA 1YNTB 1DQJA 5EB9A 5MEPB 3MRHB 4FHBD 2Z93B 3GSQA 1FLRH 3QFDB 1EJOH 3D30A 2EKSA 3GZKA 1BMGA 3ILPA 1VKXB 3G9AB 5FWRA 4GKSA 4IKKA 2A74C 5IROA 3SHSA 3KL0A 4ZX6A 2D31B 1QFPA 4ZT1A 3VRJA 4DKDC 4F37K 3BQVA 5FKAB 4WNJA 1FNLA 5I1JH 3QRGH 1I9EA 2XX0A 3DROB 1WYJA 1YSOA 4XN2A 2CMRH 4LCCA 1QUPA 1U33A 4JM2F 5AAMA 5L6YL 5KBKA 2LAGB 4ILDA 1GMEA 5LDSA 3GXPA 4QRPE 5TE7H 5JQ6L 1UENA 3VXUA 3LKRA 4UUJB 1JWSB 4J12A 3WXVH 2XYCA 2W94A 2J1XA 3F7KA 3FFCE 3PS6A 4HPOL 2CDGB 5EDSA 3LKSA 3C8HA 4QTHA 4NQDE 4PP1D 1UJ3C 3OKNB 4PRID 1FVDB 4JRXA 1TTAA 4PP1C 5IMMB 1RZPA 3TPUB 5AG8A 5JQIB 3ATEA 1UHVA 4O2CA 2PP8A 3HRZA 1BIIA 4G6FD 1N19A 1QR1A 2R1WB 3PGCA 2EDBA 2VDNL 1SPDA 4OT1L 4RFEB 5EC1B 5GRVL 1ETB1 2B1HL 3IDNB 3HTLX 2D0GA 4ZW3A 4BFNA 1J7VR 4F2MA 1UYWL 4UILH 4M9OA 2QVTA 4QJ5B 1KT2B 5C0BD 1IBYA 4EI5B 4XT1C 3KDMB 3ULVL 3A5VA 3QT2A 4KK6D 2HX9A 2N4IA 3IS1X 2PCPA 2CRZA 1MZYA 4KK6C 4PW3A 1YNKL 3GXFA 3VQ2C 1X6LA 3GSVB 3MPCA 1WS7A 4PGEB 2JSFA 4M8QB 1IGCL 4KJYA 5F7BA 4DCQA 4I77L 4ECNA 4OM1H 2R2BB 1IEBB 4FFYA 2CNZA 2IDQA 4UAOC 2WLIA 2CLZA 3NESA 2HFFA 2AF2A 1EXUB 3E2HB 1CR9L 3B9KA 1TYEB 4JO3H 5BZDB 1TQUA 5CGBA 4UT6L 2P5EB 1SM3L 4FL4B 5IMOB 3O8XB 4L29B 3UCRA 3PU7A 3QZOA 1JS4A 1PQZA 4AV0A 4TNGA 1U8KB 2X12A 3QGVA 3VRLF 4IHOA 5HHQA 1E8WA 3QG6B 3NGBB 1WQVT 4MCNA 4QHKI 1KJ2B 2VO5A 5AOKA 3P9WB 2R2EB 4Z76B 4AOFA 5L2KA 3MYJA 4XMKL 1ZT4B 4A2MA 5BZXA 3L9RA 3KWTA 1K3ZA 5BXFB 3RIAK 4ELMA 4KRLB 4N0CD 1W0WB 3I75A 2NNAA 3QIUA 4N0CC 4NKQB 3GBNH 5I6XB 1MFAL 3O2WL 1JGDB 4TSBH 3BE1H 2DQHL 2H0PA 2IPTH 1R0AL 1Y0LA 1MCBA 2CBOA 3FHQA 3MU3A 4DGVH 4HHAB 5DZNA 2OMZB 5ES4B 4OZFG 3A4FA 4KHXH 3BZDA 4PWJA 2WVVB 1HL8A 3MKGA 5C0FA 2BNRB 1YUKB 3QUYA 3UJIL 4JHZA 4BFKA 2VB5A 3CZLA 1J9TA 1PSKH 3ZGIA 3B5TA 1MF2H 2Q87A 4JGJA 3KBHE 4HV8B 3FQYA 1HIML 4O51B 5HHOA 1MDTA 2NY1D 1E4WH 4OZGE 3LZRA 2NY1C 2H0FA 5I1GH 1KACB 3QI9A 4YHNB 1YEKH 1QSVA 3KM1A 3T0EE 2GC7C 4KNQA 4FQ1L 2UZPA 5DS8A 3W39B 3C5ZD 3SE3C 4Q6IA 1HH6B 4JZOA 3C5ZC 3FRPA 4R4FL 4U3SB 4XVUD 5IF0B 3VXMB 4M43L 1U92A 3QO0B 4WJG3 3ZE2B 3PQYB 1P4IH 2BY1A 3INUH 5C7XH 5DGQA 1R19A 2APBA 1WCBA 2F8OA 3FO0L 1D7FA 4X6CF 3ABLB 1IM9B 5IBUB 2A77H 3LKPA 4JFHD 5IROD 3KJ6H 4M7KH 3MRBA 5DHYA 5IROC 3TBVB 3VXOA 4KAQH 1TZ8A 1FLTX 2GEQA 3ARED 5GGRB 1EVUA 2DIAA 1SF3A 3AREC 3DOHA 1VFOA 4FOMA 1KB5L 2V8MA 5D7IE 5AAMC 5HI3D 3ZR6A 3BN3B 2CK2A 3X3FH 1EDHA 5HI3C 1XAKA 3HOGA 5INDA 3ULUF 3VXUD 3PIQA 3L3DB 3HZYA 5KJRL 5TE6L 2YEZB 2B4CC 2ZX8A 2VDOB 1EEYA 1JGLH 2L7UA 4NQVA 5DLLA 5TQ0H 3UFIA 4XCEB 5C70A 4G8EA 4JRXD 3SQRA 5E8OA 3UPRB 3MNWB 1F4WH 2KPWA 4UQAA 2BIPA 3HRZC 4M6MH 3SJVB 1A4CA 4EPSA 2DIBA 1NBZB 4HYTB 2WQXA 5CD3B 2EUXA 5ACMA 1P0SE 3H42H 3Q8AA 2BMKB 3GHBH 3QJFA 3QNZB 4U1SB 3O6LL 1U8NB 5E00B 4YJZL 5F3BB 5E8PB 5E1AA 1OB1A 2X4PB 3E6FB 3EJZD 4IKJA 3SDXE 4AM0A 1WFIA 3EJZC 4ANWA 1BQRA 4RLDA 5F88A 3EFFA 3V6OA 1U8IB 2J1YA 4KX9A 4TLTA 1ADQH 2ICEC 4LPUA 5L0QB 2YSSB 3MRJA 4C56B 1INDH 2FECL 3EYOA 3B3IA 3QXUA 2YFOA 4KOBA 4KX8A 2JQZA 4RGOL 5T3XL 4OCRL 1BQUA 1SY6H 1UM5H 2O5YH 4KVCH 2F68X 3S2AA 4DKTA 4DSYA 3QNFA 5ABZA 2ZXQA 5EIIA 3IMVA 3TU6A 3WNMA 2AEWA 3UL4A 2FDBP 2AK4A 1WF5A 2Z0BA 1VGEL 5I1DB 3Q7JA 4F7TB 1BEYL 4HHWA 3B9KD 2VLJE 4P9HL 5DJXA 1MCFA 3TP4A 2NLJB 1WZMA 2GTWA 3B9KC 3HMXH 1TJIL 3QP3A 4BFIA 4JM0A 4KUCD 4JZNB 2QVFB 3GRWH 4AQZA 3QRLA 5HDBE 5GS2D 3ZT6A 4PJFE 2EVHA 3EO1A 1HAWA 2NXYD 4NZ8A 4WI9A 1EAPA 1FA4A 3DVNA 3MRGA 3NJGA 1L3WA 3IXAB 5BUPA 4JANA 4RMTA 5BOPA 6PCYA 5KVGL 1W6LA 5L2KD 4JK0D 3D39E 3HHRB 3O0RH 3V4VB 1NCAL 5EOTB 1A9BB 5CR1A 1THAA 1E27B 3QIUD 1CG9B 1RJZB 3QIUC 4CU7A 1M4KA 2DMCA 5CUSH 1U8QB 1NCUA 3A4EA 4PJEF 3TH3T 4XBEH 3D12B 3KMDA 3DUHA 3DV6B 4UNTA 4UT9H 1ZT7A 3MBWA 1GZPB 4PCTA 3D87B 3EYSH 1A6WH 3QUYD 4Q4IA 3K71B 1S9WB 2EDYA 3EYVA 3QUYC 4U6VH 1NGYA 2NY2D 1CI5A 3L3JA 2BZCA 3PV6B 3ZE0F 1C12B 2NY2C 4ONFH 4PP2B 1E6JH 2ICWI 3CFBB 5HHOD 3FQNB 1NUNB 4AGQA 1MFNA 3TO2A 1SNRA 3QI9D 2B2XL 3K5SA 4MJ2A 4MRBA 3OHXB 3QI9C 4PV8B 4XWGL 3NT0A 1DVFB 2CHWA 3CFEA 4ODWB 4PRNA 2GJZA 2JB5L 5D2NA 4HKZB 4Q6IC 2J6EH 1KZYA 1OLZA 4W9KC 5DRNB 4KZDH 2XWJB 4BZ1H 4NQCA 5IBUG 1SDDB 2UY6B 2BVTA 3U79A 2K9FB 3ARSA 2ZX6A 4XCNA 1OSZA 4PJHB 2ADIA 4U7SA 1AD0B 2HN7A 4FYTA 5I76B 3M17B 1DEEA 5L6YH 4J1UA 4QO1B 4XX5A 1YEHH 3KGUA 1ZY9A 2X1PA 5JQ6H 1HSBB 3PAZA 3BYTA 3HUJF 1PIGA 1QBML 4WWPA 4GUQA 1SVBA 1Y7VA 4YHIB 3IB4A 2V5YA 3EDEA 2JI3A 3K74B 2QFRA 2E5EA 3COOA 3GXTA 4KTEL 1TJGL 2CDEB 3GB7A 3C12A 1BF8A 4OT1H 1CBVL 1HL5A 2VSCA 3ZDZF 1QUNB 3SE6A 3IGAA 2B1HH 1WFMA 4KI5D 2GCYA 1OM3L 1QFWM 1RZJC 4P59L 4KI5C 5DSCB 3BUBA 4Z7VE 4LCIH 3B83A 3GQFA 4QRTA 2DBJA 4ZO6A 3A6OA 1MY5A 4HK0B 1PZ3A 4XP9L 4ZMPA 3SODB 3JUZA 5E9DE 2XXGA 35C8H 2APVA 3AJ7A 5GHWH 3VUAA 2IALA 2Z34A 3TBTB 1ETJA 1N12A 4I77H 4W6XB 2EEXA 3JWNE 4QF1B 3NEXA 4RA0C 5F9WC 1ACXA 3HS0A 2F74A 4LPTA 2I25N 1OARL 2CBMA 4DJMA 3CSYB 3IN0A 1HVXA 3S3BB 4U1JB 2BOBB 4NKMA 1Z5LB 1KFGA 2G3NA 1CR9H 5JORB 1Y18B 1ACZA 3VFWA 4L1HA 4IIQB 4UT6H 4DHLA 1SM3H 3L9YA 4IU2B 4BWUA 4OV6F 4MMXB 3LX9A 4B9PA 1NAML 3BXNB 1MCHA 4HKJB 1RHHA 4H8QA 4PJ8B 4MSWA 1JOIA 2AXJA 2X44D 3ROOA 2YQ3A 1Z3GL 2OMTB 1B2WL 4YHYB 2ZG3A 2AI0H 3WO4C 4GINA 1BG9A 2YPVL 5LBSL 1E2VA 4EDWL 4XNMA 3L3IB 1XF2A 4JDZB 2AITA 2YPLE 3E8UH 3WFBL 4HMDA 3T8VA 5ISZB 1JYWA 4XVOA 4ONHB 3WD5L 3TOPA 3DX9A 5CILH 5IFJA 5IEKA 3O2WH 3BZ5A 5FIEA 3TN0D 1M1XB 4WQOA 2DQHH 2H0JA 3HPJB 3TN0C 3GMLA 2B77A 1AHMA 3NABL 2BSEA 1IKNA 3BP5A 3DX0A 3VD2A 5DUPL 4J3BA 2NYZA 1OCZB 3V0VB 4JPIA 1ETZB 3P4MB 4HUXA 4GI6A 3CAFA 5C08B 1RI8A 5E6IA 4XNZC 2W38A 4HJGB 1O6TA 4BGDA 3KJ4C 2WVSA 1GW6A 4YDJA 1OZTG 3WAJA 4JFDA 1V27A 1MRCL 3LQZB 2VN3A 5ILTL 4C4BA 2OSYA 5B3SB 1I31A 2FATL 2NY7L 3I2CH 3KM2A 4FQ1H 4KQ3L 5D8JL 3EOTH 1GYUA 1S9XB 4OFVA 4W9CC 5D2NC 3SKOA 1ZHBB 4PH8A 1RUMH 4UTAA 4PJAA 4M43H 5E94A 3QQDB 4DP1X 1K9TA 2BVUA 4RAVB 5BZWA 3EDFA 4NQCD 5GRWA 3FO0H 4EDXB 4P49A 3CWGA 3EIFA 4E9RA 1XGTB 2DTSA 4TUUA 1G7JB 4AZ8B 2IH3B 1DQQB 1N8ZA 2FHFA 4UM9A 3EH2A 3Q43A 4YSSA 4W70A 5GGSA 4OV5B 4GMSH 2HT4D 1KB5H 2HAZA 2WIIA 5HYJE 2HT4C 1QEWA 1OAUL 2W07A 3OMAB 4FQHA 4QTFA 4LVNB 3PWJA 1XHHA 3D4ZA 4A7TA 4ZMNA 4G43B 5LAXA 1RV6X 1XCTA 2V2XA 2WXNA 4XZUA 1ZOXA 1M6OA 3CIQA 3L81A 3WKQA 3DIDA 3V5KA 2AJ3B 2XIBA 4JX0A 4TUOB 5AZ2L 3CX2A 3MO1B 3WJMB 1F86A 3CMGA 3FN0H 2DM3A 2QDVA 1HEZA 3ZMEA 1CQKA 4E41B 2K4WA 3K46A 3EJYD 1C8QA 3EJYC 1I9JL 1PLCA 2XWBA 2FH6A 5LVEA 5GXBB 3TA3B 5FM8A 5JIMA 3OPUA 2F7IA 1PG7W 3NCBB 1NMCC 3FU7A 4IEFA 4QKXB 1OT4A 5TK2A 1RJCA 3QVAA 3A4DA 3MOAL 3VMOA 3N0PB 4RGOH 5E9AA 1R1CA 3OLIA 2OYLA 1E7VA 4LL4A 3MJWA 3JBG7 4BSWB 5D7HA 4DK3A 3FFOA 2I26N 1DBJL 2BSSB 3QIWA 4Q52A 3CCHA 4DOHB 2Z7YA 5KVDH 4K07A 4P9HH 3CGTA 3CN4A 4X6EB 2D7OA 5EN2B 3FUMA 3PL6A 1TJIH 4CMHC 1AR1B 3K91A 1HE8A 5JW5A 1XF4A 1FZJA 1D5MA 2P5WA 4TQHA 1RHFA 2LAAA 2C9UA 4GXFA 5HYSA 2GUOA 3TM6A 1WAAF 4L0YA 3BGAA 4FQXA 4J6IA 1MI5B 4X99A 1QSFA 2V5SA 4M5ZL 2AV7B 4MWFB 4UNUA 5FYLD 3QSKB 4UDUA 4X6CB 3NPZB 4IMLA 4AYSA 1RY7B 3NZ8B 5IW6B 1MREL 2ESVB 5JMRA 4ETYA 5DD3H 4OD2A 2F53B 1NCAH 1WAPA 4LVHB 4C83B 1MW3A 1QBBA 1NFAA 1FZKB 1N26A 2BP8A 2EIMB 3IMUA 3Q2CA 4LLDB 7PAZA 2B59B 2CRIA 1TFPA 2GW5A 1BQHB 2AAAA 3LEXA 3MNVB 3QUMA 4G8AC 4N3TA 4OGAC 4ATTA 2C3XA 1R5VA 3GSWB 4NM8H 4ZFFA 3KR3L 1Q9OB 2BSED 4PREA 2KH2B 4ODSL 5B3NA 4G8IB 1V5JA 3ZDYE 2FO4A 5AWNL 1UD8A 3PHSA 5LNGA 4ZMAT 1IJ9A 3AG2B 2DICA 4G42B 4UQ3A 5E6ID 1HH9A 3VCLA 3F2LA 2XNAA 5E6IC 4KKRA 1A6TB 4P57A 4YSEA 4JFDD 1IRAY 3SKMA 4XWGH 3ILQD 2VJ8A 2JB5H 3DGGA 4N87A 4PWGA 5IB1A 5C09E 3WEXA 2WBKA 5CJOL 4ZMTA 3ZSSA 3MBEA 5CU5A 1BAWA 2DKUA 3RY5A 2X2YA 4B9CA 2CDFA 3FT2B 1AANA 1I8MA 1J1OH 1NGXA 3F83A 2GK0B 1NC4B 1MCPL 3Q48A 1J9QA 4P5RA 2X4RA 3FT1A 4R7XA 2O6CA 1WK0A 2BIQA 3F04A 2Y7NA 3R0NA 4H25A 4PBWD 2EDHA 4UM9D 1ZLUK 5T33L 4OGZA 4RIRA 1AR2A 4KVPA 1GGYA 2H9GB 2VGLM 3VXRA 2ZKYA 3FRUA 3GEWB 3IRZA 2GTZB 2HH0L 2AJVH 3FQTA 1ZLWH 2DM7A 3IDJA 3MTXA 4RGNB 3X1GA 2RA1A 4CL7A 1BHGA 1CD8A 2FZ3A 4U1KA 3REVA 4OZHE 4F8QA 1JF5A 1I1AC 1LO5B 4MZ2A 1AQMA 3H3PL 4N2CA 2HJFB 5ESQB 4YPJA 1FZMA 2CJ3A 1SBSH 2NY6B 3CZUB 4MDJA 2KLTA 1MLBA 4KTEH 5AW3B 3G6JA 1TJGH 4YPGA 3TV3L 1QMUA 4KXDA 5J3HD 5E23A 1UT9A 1ZWIA 5J3HC 1CBVH 1QKZL 3VFMA 4U1HA 3VFTA 4HS6A 1F6FB 2M26A 3SCMA 1XCQA 3U9UA 3UJTL 1OM3H 2KZ1B 2QR0B 4P59H 3QDMA 2XA8H 1LGVA 3ARTA 3WLBA 4URTB 5C3LD 4PJEB 3Q1SL 3AADB 3BVNA 2X4NA 2K6ZA 4Y19E 2FIKA 2QBWA 4XP9H 2YMOA 4TQEH 1HSAB 4YSQA 1LHZA 3EF7A 3TNMB 4FFZH 2HVBA 1A6AB 3LS5L 2QKSA 5J6HB 5CEZL 1R24A 4WRLA 1PX3A 4FLSA 2HKFL 1UGNA 3ZE0B 4NN5C 1MCWM 5EEYA 4GG6B 3P40A 5DXWA 5E2TL 4RGMC 1CGSL 1OARH 3D08A 3QIWD 3CSPA 4DP7X 4ZX4A 2VL5A 3QIWC 3D34A 3PL6D 4XNYL 1XO8A 3PL6C 4WU7B 4ERSH 2X1XR 4B9ZA 3GRBA 2P5WD 1DDHB 1P6WA 2VZSA 3BP4B 3VGFA 4LIQH 4ZPVA 3WELA 4F2EA 5DA0B 3ZW3A 4NXKA 3Q2WA 2P47B 3OSVA 2YD4A 4POZD 4U0RC 4FQXD 1G6RL 1NAMH 2XN9E 3BRDA 1QSFD 4P23B 4POZC 4FQXC 2MCMA 4DUWA 4XXWC 5HYQB 1Y6KR 5EZJA 3EDDA 2BLFA 5IW1A 5DQ9A 3SDCB 1GGBL 3NFPB 2UY7B 3LVEA 1KXHA 3GFUA 1GZQA 2VR7A 3H0TB 4KK9D 4LHUA 5LBSH 4AW7A 1LXMA 2YSTA 4EDWH 4Z7IA 4KK9C 5GS1A 1BW8A 2BP0A 5GJTH 3T65A 4UT9A 2KL6A 3RDJA 1BQHG 1T1ZA 2WXKA 3BCDA 3H3KA 3UBFA 4FD0A 3WD5H 3I6KA 4E9TA 4XWOD 1YPZF 1IGFL 2FX8L 2HRGA 1ZAGA 4XWOC 1XIWA 3CDGB 3BKCL 5DUPH 1SVZA 4CBPA 3ZXAC 4XN8A 3HUJB 4OZGF 1Y1UA 4R0LB 1C5BH 4L4VA 3TZVB 3KLQA 1YEFL 2YPKA 5ANMB 3U0PB 2V9TA 5AOZA 2FLBT 3CUPA 3X13A 3FBQA 1HZKA 1OTSD 3STZB 1JV2B 2HVKA 4Z7WF 1OTSC 1MRCH 1S8DA 3EJJX 4LNRA 2AQ2A 4LZKA 5ILTH 2YS4A 3ZDZB 4BYHA 5FO9B 2NY7H 2MCPL 3P77B 3GXDA 4KQ3H 1AXSB 1L9SA 3MBED 4BE6A 3JVGA 3BZ4A 4GQRA 4ZSOE 3MBEC 2OX5A 1HHJB 4IRJB 4A2EA 3MHZA 4JFOB 4UDTB 3B2UD 3S34L 5IHUH 4DVRL 2V7HA 3B2UC 3F65A 3ISRA 4JVPA 4NPJA 3MV8A 2DL2A 3SBRA 4AT6B 2GTQA 1GS6X 1BV8A 1P1VA 3OKKB 1OZUA 1MJ8L 5DVPA 4I0KA 1Q1PA 5J9PB 2NR6C 1XMWA 4HFWA 1L5GB 4LAJH 1HZLA 4H7VA 3W9DB 1T7YA 4QOKA 3FT4B 1F4XL 1ETA1 1KLGB 1S7TA 5I8CA 2J44A 4UU9B 3KLDA 1NINA 4UMSA 3BDYL 4AQAA 1P53A 2F5AH 2EINB 1J87A 3RU8L 5GISL 1T03L 3CN1A 1AZVA 2WC7A 3FU8A 1IBBA 3V0AC 4NP4L 3KLAB 4F9LA 5J11B 4RVBA 1VB9A 2EDFA 1XF5A 3GT6A 1A5FH 4KTDL 3UZVA 3FB7A 5EUOE 5LXGH 1CTNA 5AZ2H 3SDXF 1EHKB 2D7NA 4M48L 1EK3A 3N0AA 3SCMD 1EZVY 1KBBA 3SCMC 3ARPA 4P3DB 3FAXA 4KY1L 2HFGL 4M4RA 5IHLB 3U30C 3F05A 2X4OB 4KJPD 4KJPC 1V3LA 4BRVA 1IZKA 5JNYB 1S7XA 3K6NA 4BA8A 2XN2A 4TUKH 4N0RA 4YBHA 1LEIB 1ECYA 4NHUA 3MOAH 4IU3A 4X4ME 1I82A 3HVNA 3JTTA 3NIGB 3VE0B 1RL1A 3AU1B 4B97A 3Q44A 1XR8A 4Z7OF 2M83A 5KSBA 5TDOB 1SHWA 4AMKH 4ZRGA 1P7KB 5F9OL 5TJWK 1HC1A 1D5XB 4RRPM 1DBJH 3HS8A 3OTTA 5BS0E 4RBPH 3HG1B 2CIIA 2VMDA 3IKCB 5JHDB 2IFGA 3PY9A 4LCWA 3MV9A 5FS5A 5EU3A 5TPWL 4L1DA 4TXVB 1FG2B 2WXPA 3V5DA 1JWUB 3WOVA 3O2VL 1WHOA 3O4OB 5I23A 2FVNA 3MRRB 4A2LA 4NQQA 3CDYA 4NO5B 1NDGB 3BI9X 3VH8B 3VI3B 1FGNL 4KITB 1MREH 2IGFL 4LHUD 4PS8A 3VFPB 1JRHL 1INQA 3CN2A 4H26A 4F3FA 3H85A 2VUKA 4LEBA 1FE8H 2APXA 2LVEA 5ANHA 1XIWD 1I8LA 3KR3H 2XG5A 1NIFA 1XIWC 2J1KA 4ODSH 4Z7NF 3SKNA 3ULUL 4KJWD 3ZRSA 4DP9X 2I85A 1LEKB 4HIJB 3QWQB 4KJWC 2EDWA 4OI8A 2QT6A 1X7QA 4XPTH 1E5BA 3FO2B 1IAIH 1YECL 2UXFA 3D9AH 4PRIE 3VFUA 4OCNC 4AJVA 4YXKL 2GJ6B 1ZTMA 5IVXA 5SX5H 5AW1B 3JV4B 4AMXA 2R59A 4AQ1A 3D2TA 4OCWH 3G08B 3VFOA 4A68A 1MCDA 1MHEA 4P0DA 4FNUA 5ICXB 2WBJB 1LJMA 3JVGC 3EJCA 4DP4X 5CJOH 4GQZA 2WAQA 4I0PB 1ZSDB 3MRCA 3EJUA 3I74A 2GKIA 3MV8D 2ZUQB 1LQSR 1N0XH 4RNRB 3U4EB 3NZUA 1N2RB 2WZ6A 2H3NA 3GBDA 3LPFA 5DR5L 5HJDA 4DPRA 1QO3B 3GUTB 4S10A 2NTSP 2GY5A 3DHJA 5FFGA 2AKRA 5AB0A 4HVBA 4AENB 1GCFA 4QOKD 4DIXA 1A65A 2CIKA 4PJDB 4LKCA 1RJLA 3PJNA 2D7TH 5JIDA 2HH0H 2WNKA 4NRXB 2O26U 1UUNA 1P7HL 1KPVB 4D8PA 3ATBA 3UPCA 2BP3A 3MREB 2GJRA 4WKZB 4Y2LA 2NSXA 3Q3GA 3IAPA 2G2RA 3IJ9A 4GXVL 1UZGA 1X7SA 4F9LC 2Q8BL 5PCYA 3OB8A 2P48B 5I74B 1KXVC 3BH9A 3E80A 3A23A 5C71A 3V5HA 3MLVH 4UZSA 3RYMA 3TV3H 5HGDA 4R7LA 1SLVA 3PNRB 4XR8C 2I24N 4ZZKA 4JPKH 1FH5H 1T20A 4WW2C 2VDLL 5I66A 1D5RA 1QKZH 4XC1H 3UMNA 1K6QH 1MRDL 3HI1A 3UJTH 3OR6B 4EIUA 4GBXB 1CDIA 1PTZA 2XKUA 3BVWA 4KXCA 3KXFB 1FPTH 2X2UA 5LCVH 3HA0A 3MXVH 4N2FA 1MCJA 2R8SL 4OZIA 2VCOA 3T6XA 1DZ0A 3FCTA 4P04A 2G4GA 3LS5H 1WWBX 2V2WA 5CEZH 4JDEA 3EXLA 5KTEL 1A64A 3FTGA 2HKFH 3L5JA 3OLDA 4KO9A 4EZKA 5CGYD 4MNHB 3OV6A 5E2TH 5CGYC 2VJXA 2F18A 1KIRB 2LV4A 4FDWA 1CGSH 5J6GA 3TBWB 4AQ8A 3IT8D 2DQTH 5KS9A 4HZAA 1HQRB 3KYAA 4LCWD 1FNGA 3MV9D 3QJSB 2CA3A 2NDFA 2DQIL 4XRCB 4JAMA 3VSTA 3DHUA 4X5RA 4AEEA 4BKLB 1E4JA 5KSVA 1T1XA 1F6AB 4NQSB 5IBTL 1G6RH 2NQCA 1V7ML 5DRZA 3BZEA 5JA9A 1XD0A 5HTSA 4XPBH 2VN6A 3LKOB 1Q4NX 4JFHE 5HHPA 1CDGA 3VH8G 3VYOA 4HALA 5F7DB 3NIDE 1CF8L 4PV1C 1K8IA 5B22A 3HNSH 2DPKA 1IJNA 3TJEH 4G71B 1FP5A 1QLFA 4L9DA 1OTTD 2X6MA 5D7LB 1QFWL 4P07A 1OTTC 4J8QA 4N22A 2Z4QB 3IMSA 4KVNL 4OZFA 1I8LC 3VXUE 2G0LA 2X0UA 1A9EB 1G9NC 1GC1C 2L7EA 3NJLA 4NQDB 3DIFA 4Z7QB 5IVNA 1OK8A 5AW6B 4ZK8A 2ED8A 4ZW5A 3GSUB 5F0JB 3SQBA 1TEFA 4JRXE 1E9OB 4AITA 3DJRA 1XCWA 3J27A 4HX1A 5BW7C 4G8GA 1QI3A 4LOEA 4UZGA 4JBSA 4TNVK 5HJ3A 4LMQE 1TPXB 3VM7A 3W11C 3DPDA 3D3VD 1AGFB 1R6VA 1UXWA 3REWA 1DQIA 2MCPH 2P8LB 1XQ4A 4F2ME 2VQ4A 4HJTA 5MEPA 3MRHA 1EVTC 2WXOA 4ZS6D 1BAFL 2Z93A 3GIZL 5D2LB 3PFUA 1QNZH 1URZA 4ZS6C 3S34H 4CJ0A 1VKXA 3HKZA 2JV6A 2OZNA 4DKFH 1GMIA 4WEUD 4UI2A 1DBAL 1MJ8H 1UD6A 1ZT1A 2FTAA 4PPTA 3KLKA 3KDPB 5ALCH 2ZAGA 3GRGA 5EWIL 5BO0D 5FKAA 3S48A 4BBWA 3DROA 3RKDC 2DEXX 1OL0A 1F4XH 3PDGA 3KS0J 1IAMA 2FQEA 5E8NA 2V3EA 3BDYH 1FNAA 1ZV9A 1BLIA 5C9KA 1FORH 3EOAA 3RU8H 3WL9B 4NNYB 2CDGA 5GISH 1T03H 4PVLA 1PG7X 1PS3A 5LGHL 5GRXG 4NP4H 1X9UA 3UTSB 1KXTB 5IMMA 3KPSB 2YAEA 4MAZA 2CXGA 5C0AB 1JD7A 2EO9A 1GVIA 1NIBA 2P7TA 3MUGA 3L9EA 3OGCA 4HIPA 2XQ0A 4NEHB 4WNSA 4KTDH 2X4UB 3NCWA 4RFEA 1DJGA 1RUQL 5EC1A 5L2KE 3HN5A 4M48H 1WFUA 1MFDL 4B41A 4ELME 3TASA 2R15A 1JPSH 2FL5B 4BKSC 3APCA 4FYQA 3FJTA 4KY1H 4WNQA 3LEYH 4QPEA 5F6IC 5I9QC 3PWLB 4NFDA 2LTQC 4JVWA 4JKMA 1LD9A 1F41A 1YPZB 5L8KB 4MZ3A 3R19A 4NERA 3GSVA 4PGEA 1SJHB 3QJUB 4M8QA 3RVTD 1HL4A 1E0OB 3H53A 1MFMA 3RVTC 1YEGL 4TQPA 3S3DB 2VRQA 4M7LL 1WSST 4CGTA 5HHOE 1IEBA 1PIFA 4G9FE 5ICZB 1E2WA 4J3VA 5F9OH 4D0CA 1TVDA 2OTPA 3FUIA 5F1NB 1WJ3A 1EXUA 3FTSA 1CJYA 2KS0A 2EKJA 2FSDA 4O9HL 1PLGL 4AQ8C 5BZDA 5K9QG 1XTMA 1XMEB 2P5EA 4Z7WB 1KENH 2WANA 3O8XA 4I5BB 3ASNB 4KC3B 5EH1A 1JAEA 5IFHL 5BPPA 2QL1A 3VGAB 3QG6A 2ZCKL 1KJ2A 4APXB 4MJIA 5DMKA 2C1PB 4XE5B 2NY5C 2R2EA 3DVGA 3STBA 2WMPB 4Z76A 3GMRB 3JYBA 2IV9A 1SXNA 2O5XL 2EVFA 2V2TB 1CFNA 1FGNH 1JZDC 3ZKND 4Y2DA 2IGFH 3ZKNC 3LOWA 2BXZA 3BSZA 1JRHH 5MENE 4XMLL 5DD1L 5DHMC 3HR6A 4XGZB 4K5PA 5G5DB 1ZEAL 3ZDYF 4AE0A 4BCYA 3L3GB 3LDBC 4IMKA 4I48B 4IJ3C 2XLLA 4HHAA 4LEOB 2WLJA 5FYKL 1NCBH 4ZMWA 3TBCA 2P8MB 2CKBA 1AO7B 4Z3JA 3ZYIA 4H5SB 4Y9EA 5EOCL 3ULUH 5E5LA 4AK1A 3QE5A 5E4EC 2PR4L 3QYCA 3KWUA 2YA2A 5I8OH 4HV8A 2PWDA 5CM1A 3RILA 3P2TA 1NEPA 4O51A 1MHPH 3QR0A 5DJCB 2AJSH 4PRPA 4HWUA 4YXKH 4NYLB 4G8GD 4YHNA 2BW4A 5D4HA 4NI6A 4LCVA 5A3ID 4KTGA 4XOBA 3W39A 2PW2B 3DURA 5A3IC 4KI5E 1HH6A 4U3SA 3NUKA 3GZPA 1J8KA 1U93A 2H1LM 3QO0A 3QXVA 4JHUA 3M45A 5BZZA 4BQ6A 1IM9A 2DJ4A 2F19H 4WGKA 5K33A 3UAJA 4KNTA 5BVJB 3TYGL 3TBVA 3LNHA 2J1WA 1JPGB 5GGRA 5CEYA 4OLZH 3QHZL 2ZUVA 5FFOA 2WUBH 3HFML 4Z7OB 4P5KB 1WIPA 4GSRA 3MR9B 1XGUA 2WLZA 4IS6B 5AOLA 3ME0B 2DH2A 5J1TC 3QFJA 5HBBA 1R46A 5SWZB 3FO9A 3RWHB 2YEZA 3M88A 3U6RB 1TQWA 2J4WL 2N0MA 4XCEA 2A6DB 1M3IA 3VWKB 3AUWB 4KJQD 1T0OA 4UTBL 4KJQC 1OV8A 3MNWA 4GXVH 5AAPA 5KG9A 2OMVB 4DP8X 2Q8BH 3SJVA 1NBYB 1RZFH 1NBZA 3P54A 2X70B 4APQB 1M7IB 1G7HB 1NUGA 2GJJA 3GF8A 2IWFA 2I9TB 5HDLA 5E00A 4BHUI 2LOEA 3F7VB 5E8PA 4DK6A 2VITB 4TSCL 2VDLH 4YVNA 4U33A 1Z1WA 3ARGB 4BH7A 1UACL 3BVTA 4ZFZB 3PRZA 2HWZH 1UASA 3FCGA 4EI5C 1LILA 2BXYA 1DVTA 4KDWA 1U91B 2ZP8A 5I1IL 3NJFA 2R8SH 1G7MB 4F20A 4Z7NB 4F57H 4GH7B 4YHOL 1JPTL 5HGBB 1IAII 1P4UA 5LG1A 2VC2B 5DWUL 4P4KB 2IBZY 4X98B 3BQUB 1L9QA 5KYNA 4F7TA 4BSJA 3H6AA 1KOAA 1DUZB 2ZD0A 3E2HC 3US9A 2P5ED 3NCJL 3O8XD 3OJVC 3O8XC 4JZNA 1OQXA 5D2NE 4DGYL 2DQIH 3N6YA 4KRMB 4W81A 5JW4N 3F3HA 5JOEA 5IQ9B 2Z1KA 4HWZB 2E3VA 4K5MA 2HRHA 3B43A 3S4SB 4MJID 4OF5A 5IBTH 3RWCB 3WTXA 1V7MH 3UDWC 2E76C 4JCLA 4NQCE 4RAHA 4EIZC 3T09A 4TSAL 3V4VA 1M2VA 5EOTA 4Y2DD 1A9BA 2OSLA 5ID0B 1ZTXE 3L5WA 4ONGH 2OXHA 4Y2DC 5LAPA 3VGHA 1BX2A 1CF8H 1U3ZA 2NX5B 5I6XC 1MFEL 1PD1A 1U8QA 1J86A 4KHTL 4WTZG 3IVKA 1QFWH 4J3OD 3IF1B 4KRPB 1AZBA 1ZGLM 3DV6A 4J3OC 4IMKC 3GNML 4DKAA 3RI5K 4NUJA 1GZPA 5CJQL 4KVNH 1OT2A 1XR9B 4GNKB 3ZOAA 4TYUA 2N3JA 3B9VA 5AVRB 3OPZL 4M8VA 3WEMA 5DMYA 4FTVB 3KWXA 5AUMB 3UJJL 4PGCB 4EN3B 1C12A 4XZ4A 4HZ1A 4PP2A 3C9NB 3CFBA 2ZWLT 3FQNA 1S9YB 2BOLA 1SXSA 3LZOA 5DZOA 3GSNA 3QH3B 3BSHA 4OLWH 2Z4TA 3OHXA 2R83A 4RMQA 4PTTB 1U3NA 4GS7C 5D1QB 2WKOA 4HWBH 1AYRA 3L5IA 2YA0A 3AU0A 5TE4L 2ICES 3JZYA 2DN7A 4JQVA 5DJ2A 2YUWA 2ZSVB 1YAZA 3C5SB 3INOA 3BWAA 1Q72L 4XOCA 3K6OA 1BAFH 4MJ4A 1FYHB 1I1FA 3ARYA 3GSXB 4W9FC 1IM9D 3UAJD 3U4BL 3N2JA 3DVFA 1XGYL 3UAJC 1SDDA 1MOEA 5CAYB 3IMWA 3ZE1F 3GIVA 4PJHA 4ZXBB 3NSJA 1AD0A 4FI8A 3ZHKA 5EWIH 3BWUC 1RQ5A 3M17A 2Y36H 3NCXA 1NFDF 1MJJB 1AZCA 1LO3L 2H8PB 4QO1A 3QFJD 4JY5H 5CD5C 3QG7H 4GG8A 4NBZB 4CSPA 3GWJA 4K94H 2UWEA 1IQWL 2E4TA 4HGWB 2IVFC 1X4YA 4NKOB 4BSVB 5JZ7D 1PY9A 5EUOF 5I1CH 2EDJA 1A8JH 1MCRA 3X11A 5JZ7C 3WS6A 3SJVD 1WFNA 2PTTB 1NBQA 2IWEA 1YJDH 3ALWA 3TT1L 4XMPH 4UCFA 5FYLE 4IBQA 3BX7C 1RUQH 4OM0H 5C9JA 4MD5A 2HPTA 5CGTA 3BW9B 4LLUB 5IWLC 3EXJA 4XNQA 1JGUL 1U95A 3ZL4L 4JY4B 5LCVA 1WZ1L 3VFSB 2XBDA 3E6HB 8PAZA 4CC4A 1S2EA 1UWYA 4C56D 3SBQA 5FOBA 5L0QC 4HK0A 4ZO7A 4RSYA 4MMYB 3K72B 5IHZB 3K81A 1HK6A 5HI4D 4KFMA 2QV4A 4J7RA 3TBTA 4ZMOA 2Q86A 5B1JA 3RB7A 3FT3A 1NKRA 4HF5L 3ZQ9A 5CGMA 1LTXA 4LPWA 2XWTB 1JNNH 4M7LH 4GLRH 1ZRUA 2BFVL 2YAHA 3CSYA 1MEXH 3FHEA 1BQKA 2BOBA 2D4DA 2RGSA 1Z5LA 3F00A 5JORA 1P6AB 3DXAB 1PLGH 3GZOA 4WEBL 4ZUWA 4OLVL 1H9VA 1OF0A 4IU2A 4OTXL 4WI8A 3QJHA 3QO1A 2HT3D 5BJTB 2W65B 2EQDA 1SOSA 1QA9B 5CZKA 2HT3C 4X6DB 5IJBC 2UVEA 4JE0A 1U30A 4YL4A 2X4TA 4PJ8A 4WTWA 1PYWB 4YAQB 3S4SG 2ZCKH 3I02B 5DUBA 1T89A 1XH0A 2JTDA 2LFGA 3D09A 3KCWA 2O5XH 2Q2LA 4ZQKA 4MQTB 4RAUB 4OD3L 4RFNB 3LPWA 4XMLH 1PZ5B 3QZWA 4N90E 5DD1H 4OI7A 4YE0A 3I6SA 1M1XA 2YQGA 3FONB 1ZEAH 3CE1A 3HPJA 2IMMA 4P5SA 3IGUA 2VLMD 3L4ZA 5FYKH 4WFGD 1G4RA 1ETZA 5CS7A 2OSXA 2VZUA 4ABQA 1QPPA 1ANUA 3F6JA 4NKDB 5FCUH 1JGVH 1OQOA 1AGEB 2BVOB 1ZS8A 2XTSA 3BPOB 2WOBA 3TT3L 3OHXC 3FH7A 3LQZA 3CHRA 1HEJC 4RFOL 1E4XL 5EEXA 1S9XA 1ZHKA 5I17B 3HC4L 1ZHBA 2QPEB 1HN1A 4EBQH 4YX2L 4WI3A 5DJZB 1PFCA 2WCSA 3S98A 5JIQA 1C8PA 4G82A 1DLFL 3BZFA 2YFNA 1UWEL 3NP3A 3BD5A 2HPOA 1XGTA 2O6EA 3U36A 2R9HD 1DQQA 3TYGH 1LWHA 1WC7B 3F58H 2R9HC 5I0XA 2XPZA 3RY6A 2L04A 4OQTH 4GT0A 1VESA 2IDSA 3NACL 5AZEH 5CP3A 3B8YA 4QY8A 3KCPB 1I7TB 1E3ZA 2GY7B 2H3KA 1T5WB 2W0FB 3MRDB 1H3VA 1FH2A 4FJYA 3OKMA 4G43A 2JVUA 3QQ3B 4PJ9B 3V52L 4AUYA 3VB8A 2NQ3A 2BDNL 2P5WE 3OX8A 2GITB 2MRYA 5CP7B 1DJXA 1KC5L 4UTBH 4HJ1A 4M93B 1K5NA 1LEGB 4MYWB 5DFVD 1QSFE 2AJ3A 3ROLB 2DF3A 1T04B 4PU2A 5DD0H 3MO1A 3T6VA 5DFVC 3HBPA 3KGRA 5A6MA 3UP1A 4U6TA 2HUEA 1TCMA 3CPUA 3JZ7A 1OE3A 3CNKA 2W0KA 1FV1B 1UA3A 2A6JB 3OZ9L 4LBAA 1JRHI 1MSPA 4MBRA 4PY8J 4U1LA 4YZFE 2CM6A 3WHE1 4DUXA 5KSAB 2AEQL 4HFUL 3EH3B 1MPAL 3SE9L 4F15B 4GO9A 1T66C 2IGLA 2CO4A 4HBCL 1Q0YL 1KYOJ 5I1IH 2EYSA 2V7NB 3FB5A 4JRWA 1KPRB 5FYJH 1D5ZB 5B1JC 3QJRB 4LO9A 3UTQB 3HG0A 1FFRA 2OK0H 2R23B 3GPEA 5A16B 2IC2A 5DWUH 1UEMA 1FFNB 3LPGA 1NEZB 3IRPX 1OIOA 1L0YA 1CURA 4NZUH 1UD4A 3F7QA 3VXNB 4X6EA 3DARA 5C0CA 1ZVHA 3QPXH 3ARBB 3VDBA 2Q20A 3C2AL 3NCJH 1IE5A 1GS8A 3QZLA 2CBTA 2WIMA 1KIPB 1TETL