2VERA

Structural model for the complex between the dr adhesins and carcinoembryonic antigen (cea)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
143
structure length
143
Chain Sequence
b'EECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGYWAKDNKQGFTPSGTTGTTKLTVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFIMBRIAL ADHESIN AFA-III
publication title Binding of Dr Adhesins of Escherichia Coli to Carcinoembryonic Antigen Triggers Receptor Dissociation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 24
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2verA00
1USQA 1RXLA 2JKLA 2W5PA 2JKNA 2BCMA 2IXQB 2VERA 2JKJA 1UT2A 1USZA 1UT1A
chains in the Genus database with same CATH superfamily
1JF6A 4K94C 4YDNA 5FO9A 5HHQA 5HD8C 2OTUB 1JV2A 2BRRH 1LE5A 1S9YA 5T3XD 3QUMB 1QLEH 1HC1A 4XNXH 5B4MD 4PFEA 1SDAB 3V4VL 1ZOXA 4HDIB 1KCRL 1CFQB 1E3FA 3D85D 4W6XB 4L05A 3S3DB 1HQ4B 4KV5F 1JF5A 3CFKB 2YPLA 1SHXA 1A7NH 3KYOA 4JQXC 3RZCA 2BDNH 1AG0A 3M7OA 4I5BA 3VSQA 3MJ8B 3CFNA 3IM1A 1JTOA 4LDLB 4JFQA 3OZ9H 4LVHC 4YC2C 2X4NA 3MGOA 4GKZA 1P5VA 2LR4A 1K5NB 3MCKB 2VW4A 5B1BB 3FKUS 3BPOB 3ARDD 1BAFL 3LZOA 4P4RA 3RDTB 4FYRA 4M7KL 2OTWA 4RGOH 1FYTA 1MZZA 3BAYA 5EORH 3CBKB 4DQOL 2J71A 4KVPA 3P11H 1B88A 1M53A 2VSKB 4NCDA 5F44A 4HX1B 3BGMA 4A2EA 4G42B 5DD0H 1C5BH 4I48A 1ND0A 4KMTL 1N7MH 5E6UB 3UEZA 4QTIL 3QDGD 3TV3H 3LS4L 1U4FA 2K45A 32C2B 3T0AA 4MCZA 2XWJB 4NZFA 4U1GB 2X3AA 3BQUB 3D09A 3DOSA 2HWZL 3N44F 2VDOB 1P7KA 5GSRB 4A7UA 4LFHG 1CG9B 3GGWB 3S36H 4D9QD 1S9VA 2R29L 4MNHA 2HT3C 2QADD 4BFEA 4UINL 3RTQA 1T0MB 2X2UA 3QEQE 5D2NC 4BH8B 3VE0B 4DERA 2ZUQC 4K3DH 4UZUA 1NUGA 3FCTA 4KY1L 4OCNC 4NRZB 2XHNA 4Y89A 4L3AA 3RKDD 2CMRH 4ADIA 1V7NL 1DVSA 4R0LB 1VRSA 2V5TA 1BMZA 1MHHB 3IT8D 4X9FA 1H9DA 4HXAH 4WF7A 2XIBA 2YLKA 1CMOA 2O61B 1GGUA 4N20A 4CBZA 4JQXA 4JX0A 3STLB 2V5YA 2ZPKH 1A02N 2Z1PA 3U9PL 4PWGA 4Z76A 1Z7JA 3HG2A 1FRGL 1KGUA 2PWGA 4XAWL 1JI1A 3U4BH 4X7CC 2Q2EB 5IJKC 1TTCA 4BDVB 2DKMA 4LGPB 4TQ8A 3HG1B 5ESQB 1TVDA 5EU6E 1J86A 1TKWA 4C83A 3QG6A 1QA9B 1Z0MA 3PREA 1OV8A 4H1LH 1T22A 4HHAA 4M03A 1CGSL 3B2PA 1HI6A 1RHHB 2OXGB 2YAFA 5GRUL 3V6FB 4BKSC 4X7FC 2A9AA 1D6EA 4FMKA 4NO5A 1I3UA 4X6DA 3CQPA 5F0LB 1VZHA 1SJXA 2X2JA 4TNVF 1EGJH 1N2RA 5A40E 2J2ZA 2VQ1B 2WV3A 4AT6A 3IJYB 1WF5A 1IE5A 2YGNA 3BSZH 1GGBL 1NGPH 1MXDA 5ESVA 3FU7A 1JTPA 2W91A 1UFUA 4UTBH 3TBWB 5D2NA 1VZGA 3PDOA 3IAPA 4JO3L 3BSZA 5AW1B 4A7GF 5DJXB 1BXXA 2VQUA 3M17B 3QO1A 2EDTA 4Y1AB 1IAIM 4IIZA 4CW1A 1G7QB 2AQSA 4HFUL 4HQQH 4IMLA 1HIML 3W0WA 2I69A 3CN2A 3L45A 4FQLL 1SZNA 3S4SB 4XPHL 3CXHJ 3OKEA 1E2WA 3BW9B 1SLUA 1JF1B 2R2EA 4XMZA 1WG3A 5EOQH 2AF2A 3AW5A 3NRQA 5INDA 4M00A 2ADJA 1JGLL 1KJMB 2OJ1A 3CBJB 3BKJL 2Q86A 4KJYA 4OZ4B 2FL5A 3SOTA 4JB9H 5JYLA 5IJKA 2O5ZL 3VXMD 1NGWB 5CN3A 4XPGH 1OVZA 1E9OA 1IM9A 4PJXF 4WW2C 2Z64C 5E8NB 4ZFOL 4GUOA 2Z93A 4PLJD 4Y2DD 1UKSA 2A6DA 2EVGA 1YQVH 4Z7UF 3QPXH 5D71H 2RHEA 3IXTA 2D2CC 1VAHA 2O1AA 1GAFH 2JH2A 1ZLVK 3SN6N 1QSFB 3BYYA 5LCVH 4HUVA 1I8KA 3G6AB 4Q74A 5HVGB 1NCBL 4X7DC 4WJ5A 4NDMA 2R4SL 5EZOL 3WSQH 3U4EB 1G9HA 2Q5BA 3U0WL 5GGVL 2Z7YA 2YGQA 1XMEB 4O2CB 4WTZA 2EC9U 5J11B 5ISZB 2C26A 2NW2B 2O30A 1IFHH 4JFOB 4IOSD 1T89C 2OMXA 4G6AD 4EXPX 3FQ4A 2OMZA 2VDQB 3MRMA 1WV7T 2CAKA 3QR1A 4WUUD 4NQEA 4UT7H 3IDNA 3KYMA 1FSKB 1MEXH 4IRJD 5F93C 2YQ2A 5JHLH 2JKNA 4K3JH 3TIDB 2ERJC 3DTXA 1E6JH 5DURD 2Y6SD 4OJAA 2X4QB 4QRPD 3ETSA 5ENWB 3C5XA 4ZS6C 1MI5A 2FATH 2NCEA 4R96B 1TG8A 5DA0B 2PP9A 5TH2B 1EV2E 3MGAA 3SKJL 1QUPA 1ZCRA 3E3QE 2Y2TA 4FFWD 3PE9A 5EO1B 5D2LF 4JKKA 1G7LA 1VFUA 4GSDL 5FWRA 3D2UD 4WW2A 1AZBA 3RJQB 4RBPK 5J1AB 3ORJA 2ED8A 4QUOA 4TUUA 3T5WA 4E5XB 3UXFA 4OCRL 1L9RA 1OY3B 1D5XB 1QACA 1RZGB 2WQ8A 3Q2VA 1F11B 3WXVH 4AXWB 5CU9A 1DVFD 2ENYA 4FNUA 5CMAA 2P47B 1SOSA 1XCTB 2J88L 4X7TB 4LOUC 3MRKA 4OJEH 4PJXB 2HVBA 1FN4B 3T0DA 1QPXA 5DC9B 3RGVD 5F96H 4L1TA 2K9UA 1PDKB 4XBPA 4P05A 3W2DL 4L3FA 4AEFA 5JNYA 4K55A 4N3UA 4ZK8A 3IGAA 4U6YB 2XZZA 1TEFA 4ZS7H 4O00A 1KN4H 2XXCB 5F9DC 25C8H 1AO7E 3QJHB 1T89A 4KKLC 4HGWA 5E5MB 1ITBB 1NBCA 1OAUL 2O5YH 3HZMA 3QJXA 4MZRA 3SGDI 3LXAA 4TTDD 3T0BA 4YGVB 1NZRA 2BVOB 4XHQA 4DZ8A 1FZOB 2VDRH 5A6IA 3VTAA 5E5UB 4BE5A 5T5NG 3T8XA 1OCWL 1MW0A 3N1GC 5DRNB 2EADA 3H42L 5AYUH 3HPJA 3MRDB 4B41A 2ENPA 3BO8B 4KMQA 3S35X 3V5KA 2OXHB 3KS0J 3QDJE 2CM6A 2Q76B 4X6CE 4LGSB 3OWEA 3ZZ1A 1IEHA 3EBHA 1N0XL 3BJ91 1G9EA 4MZIA 2H2SC 1MCDA 2Y9RT 3PAZA 4WEBL 4RH4A 3LQZA 1JD9A 1I8LC 3AACA 1AH1A 2G3XA 1C16A 1EAPB 1JWSB 2J44A 4EDWH 3G6JF 2H3NB 1D9KC 3BUDA 5IM7A 3RWFA 4H0LC 2QL1A 4PMFA 3GMOB 3IRPX 5DFTA 1E50A 2YPLD 5CIPB 3E6FA 3RZCD 2OCFD 3LOWA 3OJVC 5DLMH 2NUTA 3TBSB 1I4FA 3GMRB 3ZKMC 5AW2B 1VSCA 3LH9A 4YN3A 2AJYL 1TZGL 1JV5A 4B9GA 5K1NA 3L3HB 4MBRA 5KTEL 2Z3FA 4Q0XH 1SF3A 4NFDA 2DB8A 2V2WB 4C4KT 1HAWA 7PCYA 4UF7C 1KIUB 3DYMA 3HEIB 4I3RH 3FN0H 4NC1E 3E38A 4O2FA 3IDUA 4X0KB 3GXPA 1FYTD 4NQVB 4I1NB 3INUL 1G9MC 4G7YL 2P5WD 5E8EB 4DGIL 4N8CH 5FPIA 2Q0ZX 1D5BB 1YEIH 4KQ0A 3EGXA 4K7FA 3W1ZA 5MERA 1JWMA 3MV8B 2XPGA 2J5LB 4YEFA 5A2CA 4IHOA 3WE6B 4L8CB 2Y1VA 1NAML 3X3GL 3IMWA 3Q9PA 5A2AA 1A2YA 2XTJE 1QRNA 2FGZA 4OFYA 1T66D 4M8QB 5F72S 5FUZL 3SYQA 3DVIA 4TSCH 1N68A 1WWBX 4G5ZH 5DD6B 3DX9A 1X5LA 1SOQA 1OALA 1EEUA 2ICWB 2JFCA 3RTQD 1CFSA 1PKQB 4G7RB 3K81A 2WYTA 2X09A 1X7SA 4X5XB 4B9PA 2VAAB 5I6OA 2QT6A 5LN8A 1I8LA 5ANMB 1BD2E 2NUPA 1ZLWK 1F00I 1F3DH 2NX5B 3H3PL 4LF3A 1RJLA 2WCGA 4QRAA 5LHDA 1XF2B 3BGFB 3ZZQA 3HRPA 5JIIA 4GO9A 3D9AH 2VR9A 5DHMC 1AQDB 5I1KH 4L5FE 1MRCH 2WXKA 1NBQA 1E27A 2J1ZA 4AIEA 1LP9A 2OMWB 5C0BB 1MCWM 5C07B 5INCA 3G6JB 2GBTA 3KXFA 5DGRA 1WZ1H 4ONHA 5IHUH 3D18B 1KB5H 1SJVA 3AXLB 4LCUA 5CJQH 1CLYH 1UCBH 2W65B 3ABMB 3PGCB 4LKCB 3H9ZA 3IKCA 5BJTA 5A3IC 3BRFA 1GY2A 3C09B 1O7SA 1YZZA 3LKOB 2EIZA 2X70A 5FECB 4E9YA 2LT9A 4FFYL 4XI5C 3IFOA 3MTXA 4NC2B 3ZDXE 3MOAL 4H2AA 4JO1H 2Z8WC 1NC2A 2L7JA 1AGCB 2K4WA 2VLRA 1FORH 2VXVH 4U2ZA 3JV5A 5T3XE 4F37K 2X6AA 1OGAA 1GW0A 2YD9A 5BV7L 3IEAA 1TZIB 2CXGA 2ATPA 2HT3D 4X4MA 3O0RH 3CFBB 4H0GA 5EOCH 2WZPA 4LEBA 1PD6A 5GRWA 4UOZA 1FE8L 1O6TA 3GT6A 4PREB 4YO0B 4R90H 5F9OL 5IMOA 3VVVA 5KG9A 1NL0L 2V2XA 3ARGB 4PGCA 5E1AA 3BD3A 5CEYA 3HZKB 4WKZB 3TFBA 4EPSA 4PP1C 1OSYA 3T0EC 1LHZA 2BNUA 4FI7A 2EXYC 3BLKA 4CSZA 2HKHH 3QA3A 5FW8A 5J1TC 4R5XA 4P9HH 1IBGL 3NJKA 3SO3B 1WZKA 2E47A 2N7AA 3WEAA 4Q9RL 2V4LA 5HP5A 3RB5A 1WAPA 4GRLB 4DKFH 5CBAB 5CR8A 1M4KA 1CE6A 1YEWA 2H2PC 2YRZA 4GI6A 5TK4A 2PWDA 3HVDA 3GLDA 5I1LA 1U8JB 3HFMH 3DX8B 4J3OF 3QDGE 5C0GB 2NTSP 1NFAA 2APSA 3VRIA 4J23A 3SPIA 2UVFA 5BVPH 1IM9D 1SYSB 4PB0H 3VI3E 2R0LH 4TN9A 3S8GB 2C3VA 3MBWB 3MJ9H 4NEHB 4J6RH 4ODXA 4M6NH 3ARYA 2WSDA 4WU5B 5E8PB 3P0VH 1WBYB 4FI8A 3W3BA 3K3QA 1A9EA 5FCUH 3SCMC 1Z5YD 2VN4A 2ADIA 3KEHA 5ICYB 2Y07L 2CBPA 1B4TA 4OZGF 5BUAA 2ZG2A 1UYWH 3HJ0A 4AQ8C 5F1SA 3TBYA 1WIOA 4Y1TA 5D7EA 3QHZH 2CIIA 5EIVA 3BI9X 4ZODA 5CJOL 3MXVH 5GJTL 1I3GH 5EWIH 1B6DA 1E9PA 2ZP9A 1ET7A 3BN9D 4BCZA 3S88H 4PJAA 3HR6A 5AOKA 3V0WL 1F4WH 5DZJA 3T0EA 4JEGB 1TQUA 2BIIA 3G6DL 4JFPA 1KV7A 2VABB 3L3KB 4E5XG 2PCYA 4WWOA 2JJVA 2W5PA 1DBMH 3PP3K 2ED7A 3TYGH 4ZOAA 2ZCHH 1UZ8B 2W88A 4WFED 4CU7A 5L88L 1MI5D 2YN3A 4NHUA 4ZX3A 1IGIH 1LEKB 3GK8H 1XR8A 2I24N 4WEEA 2YAPA 5KJ7E 5LQBL 2IPUG 3WTWA 2DWYA 1SQMA 4ZW8A 1EUTA 1KNOB 5CF3A 4A37A 1UUSA 3FT9A 2AMGA 4L3EA 3GMPA 3V4PA 3KVDD 3A4DA 5I8OH 5SWZB 4BZ1H 3ET9F 3OAYK 4FOMA 2AJVL 4JKPH 1CF8H 3UTZB 4QCIA 3GS0A 3WJMB 4I1RA 4L9DA 3SCMA 4YHZL 4CMHB 1AACA 2G2NA 1F4YH 2F19L 5FYJL 3SDYL 3BAEH 1RIUH 4Z9KB 1GCYA 4JO4H 3RNKB 3T2LA 5KS9E 4FXLA 1I8MA 2AEPH 4KJPC 2WLKA 1CDHA 5F3HA 4AQ8A 1ZY9A 1UOWA 1U3HB 4UDTB 1ZLEA 4RRPG 5MENB 4G70B 4ESKA 1J88A 3K6OA 1UZ6F 3PWNB 2L8AA 4OZGB 4WU7A 1XL4A 2QFRA 3NCCB 3AMLA 4PJHF 4PJIF 3WIIH 4RZCA 1CL7I 5C1MB 4PR5B 4CRPA 1M1XA 3VXME 4DP9X 5HDRA 5JPNC 4WGVB 3TJEH 5HGAB 2L4OA 5E2UL 1D5MB 4OQ1A 3HTLX 3KL0A 5L8KB 2VLKB 4J4PD 3STZB 1KCSL 3FSWA 4XNZC 2X7LB 3QZOA 4J3XA 4GIAA 1AR2A 3QUML 3DHJA 1IAIH 4Z7QF 3B2UC 3I74A 4NT6B 4WJKB 2LFEA 1OF2A 3O41A 1CFTB 2XXFA 3FNKA 3G08A 4FLRA 4H5SA 1BEXA 2AXJA 3A6BH 1ED3A 5C0EB 2FECL 1HOCB 3OG4B 2EEXA 4PUBH 5IVZB 2AJSH 3DX2A 4LOUD 4K23L 1I7ZA 5SX4I 4WUUE 2F53A 2V9UA 4JL1A 4WI2A 3RWHA 2YLHA 1GH7A 5K9JL 1MWAA 2B2XL 1UA6L 2R15A 2BMKB 1U8NB 3CFIC 2OR9H 4JZNA 5E9DD 1A7BA 4PJEB 4XCFH 1D7DA 1XB8A 1ILSA 1XH3B 3ATBA 3MV9A 1UB6B 3MODL 4MMZB 1TMQA 2E7MA 3KPLB 3OZKA 4G7VH 4K3HA 4B5EA 3BP4B 4NSKB 3CSYB 2DQMA 1QWHA 1IQWH 4JREB 2L04A 4NHCH 3NK4A 1DQJA 1KYOJ 3QP3A 1TJHH 4L4JA 4U1SA 2VDOL 1XR9A 1J12A 3HUJE 1RH8A 3QDMA 4I88A 2BNRB 4PJFA 4MB4A 4OFYD 1QRND 1OP5K 2F7OA 4TPRL 5JPNA 3FB6A 2H6UA 1UFGA 4DJMA 1N64L 3QHFH 2DPKA 3I9GL 3BVNA 1HNGA 5IESL 4PJIB 5KOMC 2OAAA 4FZEL 2FX7H 3WNOA 3MVSA 1UM4L 1TJMA 2R0WH 4TSAH 5EBWA 4P48A 1RHFA 2OX5B 3DPBA 3HCVA 3L8QA 2OMBA 5FA3A 5IBTH 1A4KB 3W5MA 3Q8CA 3ALXA 4U1IA 1PYWB 4BWUA 3VA2C 3QDHA 2IFGA 1P4IH 1I9IL 2XV3A 1YDPA 3D39B 3QUKA 4FE9A 4FYSA 5DCCA 5GZOC 4HJEA 1D7FA 1NPNA 3POHA 2NR6D 1JNHA 5D9SA 3NGBC 5E8DL 3ZKMD 3EJJX 2E86A 3N85H 4LPXA 4LRIC 2EZ0C 1B2YA 1F8TL 3DUSB 3KXFD 3V4VA 1AOHA 4TVUA 1JVLA 4FLSA 1G7PA 3EJSA 5I1HL 2Y3AA 2OK0L 5HHOD 1HCVA 3DX1A 4NO3A 3WEOA 3F12B 1E8YA 5A43C 3ECBA 4A2MA 4WK4B 3QULB 1UEYA 4JM0A 4OQTL 5IJVA 3LH8A 4M62L 5AB1A 4ZXBC 2C7UB 2WB1A 5D4QA 1BFVH 5BRQA 5EIIB 5FK9B 1A6VL 5B7FA 4KMTH 3VA6A 4JN1L 1PKOA 4OZFH 3D07A 4JFFB 2EEFA 3LS4H 3UPAA 1OGAD 5IBTL 3ARWA 2K3TA 1EVUA 3I9AA 2GSGB 4NKIH 4Q2ZA 1BZ9B 5BZXA 2WZPD 2A74B 1YNTF 2MMXA 2YPLE 5DD5L 3UC2A 4A7VA 4AJWA 4KK6D 1VADA 3ARZA 2P5EB 1IC1A 4MXWL 2FZ3A 1B0IA 1GOHA 3CSBA 3AGWA 5KSVB 4NBXB 4WO4B 3TT1L 1VESA 4Q8BA 2R29A 4MCNA 4JFYB 4PTTB 4E9RA 4XNMA 4KY1H 4LSDA 4PRNB 1QI5A 2X4SA 5GHWH 5GZOA 2AAVA 2X10A 2ZOLB 3MLWL 1A7RL 2P5WE 3S37H 4EUPH 5IQ7L 3FO2A 3MACL 1XGTA 1QWNA 2CZNA 4LRIA 3TA3B 2XLLA 3D1MC 3JV6A 4ZW6A 3V8OA 3L6FA 1BP3B 1JHLH 2EDMA 4JHWL 2HRPH 2D0HA 2VJ0A 3Q44A 4ZT1A 3K0WA 5E4EC 3JVFC 1WAAA 2H26B 4TUKL 3ZHNA 4NYLA 1FI8C 3FAXA 5A3ID 3MLVH 2OMYB 3B7YA 4LLAA 4XI5D 4ZXBA 1FL6A 3TO4D 3JV0A 3VQ1C 4GW1B 1NWPA 3FT3B 1XSJA 4KVNH 4ODUB 3GS7A 2EEDA 2J8UA 5EN2B 1S5HA 2JKTM 1T0NB 3V10A 3D4YA 2VDQL 5JQ6H 3QNZB 5K5YA 3DPDA 4Z6AT 2FBRA 3T1FA 3QSKB 3WFHB 2CGRL 1GGBH 4EI5C 2L7UA 2F1AA 2P8LB 2M8XA 3SGJC 5T1KB 4K71C 2QDWA 3UYPA 1ZGLP 4HUKB 3CDYA 4PJBF 3LY6A 1FHGA 3T0ED 4WFHD 3HNVH 2EXYD 3KPOA 3R19A 5E7FA 4RAVA 1EDQA 5E24E 1VCAA 4QHLA 4DVBB 4Q6IC 1OB1B 5BUGA 1L9SA 5KJRL 2X4PA 4HFUH 1T2JA 4KZEL 1V3MA 4XVSL 1HIMH 3NCMA 2NSXA 4FQLH 4J3OG 3C08H 1PEZA 2GJZA 1YMHB 2H2PD 4XPHH 1LNUB 2PETA 3IDMB 1AJ7H 3N42B 4U1KB 1DQMH 3C6SB 4FL4C 4GAYB 1E65A 1MLBB 4UIKL 2ZF9A 1UT2A 4X6DE 3SPHA 4ZMOA 4QAMB 3G9VA 2Q10A 3EO0A 4HJGB 2YD5A 3ZE1E 2Q9OA 5KYYA 5DD3H 3H9YA 4L3ED 3KPRB 1T04B 4R7DB 1TO4A 4NAJA 4D8PB 4B3EA 3KZ8A 1JWUA 3Q13A 2NQ3A 2PWFA 4G9DA 3SCMD 4JPQA 4QHKJ 2R0ZH 4LDOB 5IQNA 2ZWNA 4ZFOA 5B39A 2CO6A 2FX9L 3IS1X 3GSXA 4C4BA 3QW9A 1AXTL 3P02A 4HC1L 4BZYA 1B4JL 4FQPA 3N06B 1DQLH 1OW0C 1F6LL 3N3EA 4JCMA 4MD5B 2DM3A 2BP5M 5DTFB 5E6IC 1CFBA 2WTRB 4A2GA 5EFIB 5CZKA 3ZL4L 4AMKH 2I9LA 2R4SH 1PIFA 5EZOH 3D87B 3ZE0E 2G30A 1FGVL 3U0WH 2W60A 3MRHA 1U8HB 2AZUA 5HHXL 1IEBB 2OR8A 3APNA 1UHVA 5GGQH 5C0IB 1I3RB 4BH7A 3SGJA 4F7PA 3KW7A 4PRBA 5FUOL 3HLKA 4LARL 3S3SA 3QUZB 5KSAB 1L0PA 3KDMB 4F8QA 1MFEL 3FRUB 4Q6IA 1KXQA 3L7EB 5HPMA 4JLRA 2AXHA 5GS0L 2R27A 1OSZA 3B5HA 4NIYE 2AV1B 1JZHA 2I7OA 4MD4B 1RJZA 4PJBB 1VENA 2IALA 2ICWJ 4AW7A 3OJMB 3C8KA 3IJSA 4XNQB 3P2TA 3K6DA 1OAXH 1BVNT 2YUVA 2CJUL 3CSPA 3DI3B 1T7XA 3U36B 5HHQB 3VFTA 5HYQA 2Z8SA 3TPUA 1QPKA 4M3JA 3U7WL 3X1BA 3WUWA 2IWEA 2CKNA 4LSUH 4TL4A 5FDYA 3AXIA 1NCNA 2KL6A 4P4KC 4E9QA 3JTSB 1E2ZA 4N2BA 3EH4B 4F9PC 4OIFA 4HG4J 1IM3B 2WVVB 3FUMA 5D1XD 3T0WA 2JJTC 2F61A 4GKLA 3B37A 3PWPD 3VX1A 3P9LA 4P49A 2TRHA 2F53D 3HB3C 1KLFA 4FABL 2DM4A 3UAFA 1Z3GL 2VDPL 5KYXA 4KJPD 5HY9B 2C9QA 4FNPA 1OW0A 1BVOA 3MRGB 4MNQB 4NNPH 3SKUD 1OTTD 3BPNB 5E6IA 2I32A 3RA7L 3MV9D 2OMNA 3FUKA 2NNCA 3U7AA 3W2DH 4JFEB 5LGJB 3W9DA 3P0YH 4F80A 1M7DA 4WFEE 2DQUL 2W0FA 3RGBA 1MI5E 1OTSC 3CFCH 4LEEA 4OI7A 2AHIA 4HKBB 2EYTB 5JIHA 1SUHA 4F57H 1ADQH 2R2CA 2JCCF 1BQ5A 3GSVB 1RIHH 4KUZH 3BESR 2BXZA 2RGSA 3GSRA 4Y5VC 5L2JA 2FJUB 3UZVB 4M6AA 5A6MA 4NN7C 2ORBH 2F7IA 1NFKA 2IANA 2JI3A 3SO5A 1HWHB 4IRSD 2R1XB 4FJZA 2ZXBA 1JK9A 1RZ8A 4C56A 4JK0D 3CDCA 1E28B 1SXAA 4JE0A 3QIUA 1TUPA 1BIIB 1BAWA 3B2UD 4F7EB 3FOMB 3WD5L 4HGKC 4KTEH 5HYEA 5B1AB 1W0WB 4Y4HB 4D0BA 1QO3A 1OEZW 1L0QA 4ELME 2APWA 4KKNA 3H0TB 3WY4A 4P4KA 3ZKXC 2JIXA 4F9PA 2DDQH 1PZAA 2ENJA 4OV6F 3DURA 3QQDA 4PLKC 5FC9A 2JJTA 3A4AA 3M1CA 5EIIG 5IB3B 3AREC 2O5NA 2DM7A 2IAMA 1FC2D 2R56L 2XBDA 1IAKB 3EFDL 1F1DA 3IRZA 2WMPA 4Y4FB 4FLQA 1LK2A 1U95B 3BKCL 2VLMD 1GZQA 2FLBT 1MCOH 3MBEB 4DGIH 1T7YA 4N2IA 4E9WA 1LL1A 3ARXA 3BDBA 1GVIA 4XXCC 3V52L 3TWCH 1A14H 1U42A 2XYBA 4HZAA 4Y5VA 3OQ3B 3UFIA 1M05B 2NOYA 4AL8H 3RTLA 4XWGH 5FUZH 4G8AC 2VLJA 5IVXA 1KYUA 2EDDA 1T5WA 2QGBA 3KHOA 1NAMA 1XDTT 2JCCB 4ORGB 1QLFB 4N0RA 3DROB 1EAQA 2A83B 2IO5A 4M61B 3WU1A 3EO9H 1FHNA 3ZX1A 2WTOA 4ABVA 5BV7C 4S1RL 4PTUA 1CLZH 2B59A 4LLUB 2QVKA 4N2HA 3FCSB 4IOIA 5CJ5A 3HPLB 5DJ2B 1H8SA 2GAZB 2AI0H 2L7EA 4YDJA 2QHRH 2BY2A 2WZ5A 5E9DE 4M7ZC 1OWWA 4Y16D 1IV8A 4YHNB 3MRJB 3RQ3A 1I8IB 2EZ0D 5EZJA 3U9UB 4ZX4A 3AREA 5D5MF 1R5IA 5GGRY 5EEUA 1VB9A 1ORSA 2V0AA 4XN1A 4UDUB 3BPCA 1ZT1B 4G6FB 2Y22A 4L4VD 5FKAB 1DUYB 1S7TA 2F8VA 3DX3A 2WQXA 2HFEA 1MKFA 2AQ2A 2YBGA 4P9ML 4Y5YC 1QTSA 4F27A 5HBBA 1JXFA 5AQ0A 1MLCB 2NY6C 3IDXH 2C9RA 1VFAB 2DBLH 3LDBB 5ECJE 3FQNB 4ZXBD 3AQZA 2DJ4A 2LE9A 3I9IA 3M7FB 3HC4L 4HLEA 3PXLA 4APXA 4WRLA 1AS7A 4XXCA 4FFYH 1IGCL 5I8KL 2VMFA 2BCMA 2YKLL 1ZEAL 2YAHA 1EZUA 3GXFA 4YNYA 4IKJA 2VQ4A 3S3CB 1FO0H 4JMNA 4FFYA 1U30A 1V55B 2X1OA 3RWCB 3DBXB 5H35B 5T5FL 1AR1D 1E5BA 4M6OL 2BSCA 1SXBA 4N5EC 4NOFA 1KXTB 4RRPM 2WC7A 3R4DA 1DHKA 2ZYRA 4OFQA 4A7SA 1FE8H 1S4IA 4QI3A 5I1AA 4UQEA 1XV8A 1A1OA 4PRHA 2WNXA 4MDJA 4JQIH 4TUJA 5F9OH 2A6JB 4YDVB 2X6BA 1T1XA 3FZUD 4LDEB 5KBPA 1PZDA 1M1SA 5HHOE 3B7TA 2CCVA 4JKMA 1AFVH 4FXKB 4OAWB 1ZGLM 1QSEB 1I8UA 2DYPB 3WJLA 3NTCL 2PYEB 4L8SB 2I07B 3KWWA 3UIYA 1JFQH 4P2QA 3BE1L 4LSVH 1XGQA 2BFVH 4OZIE 2FK9A 1NGZB 4YDIL 4H8WL 2C9SA 4BFKA 5DQDH 1EDYA 5FYJU 1CGUA 3F8UB 2XG4A 3VMNA 1KTLA 2BIOA 3ZT7A 3OR7B 4PBXA 4OU3A 4UQ9A 1H0DB 4Y5YA 4X4YB 1BOYA 1OGAE 4JDTL 4WGKA 4P3CL 4JCWA 3ABKB 2A9NH 4HIHA 4X4ME 5D5MB 4B60A 1UWGL 1KZYA 3X12A 3MNWB 4AITA 1J7VR 3AFLA 4L48A 4AIZA 4L0PB 4Z7NE 2R1WA 5EUOA 3HI6L 4EXKA 3MNVA 3ZYIA 3DIFB 1YLBB 2ISDA 3DWTA 4ETQB 5F2FA 4OY9A 1J10A 4HWEL 2JLPA 3Q48A 3S6CA 1E90A 1AAJA 1CYWA 3GZQA 1CL7L 4LAQH 4LO9A 4U6HA 1SF5A 3UJTH 3LRMA 3TWYA 1YN7A 2B08A 4IJ3B 1EXGA 4LRNL 4ENED 4YBLB 3RRQA 3HN8A 3GJFH 4DAGL 1NSNH 3UYRH 4ISVA 1UD3A 3IS0X 4XMWA 1KJ2H 2H32A 3REWA 2XZQH 4ZUSB 1UUNA 1H15B 3V0WH 3WLBA 2WXHA 2CK0L 3DV6A 2GUYA 3GJFA 3HZVA 4B3VA 2V3DA 3G6DH 4R3SB 4W4OC 1BM3L 2QPSA 4L9LB 3VXRB 2AXFA 4ONFL 4PJ8B 1PLGL 1K2DB 4IRZL 1C08B 3PL6B 1U21A 5D93B 1E4KC 4S0SD 4FQIH 1IILE 2MEJB 2VIRB 5L88H 1AMYA 5TDPA 4R83A 3HZ3A 3QORB 1RFDH 3KVPA 3Q0HA 4MS8D 1FL5B 3P4NA 1LEIB 3ESPA 4X6BB 3VTTA 4N2CA 1OM9A 2CH8A 4HZLA 4XR8C 5DU7A 2KYIA 4DN3H 2I9TB 1DTUA 3UTQA 4YSCA 2VZSA 4GMSL 1DJHA 4S2SB 3W39B 2PW1B 3A4FA 4HKZB 2WW8A 4DFHA 1GGIL 4GP8B 4XMKH 3F7LA 3UC0L 1G1CA 5BVJB 4FI6A 4KFZC 2CXKA 3P4LA 4Z77B 4KXCA 3UMTA 1TJGL 1P1VA 4YHZH 3T0EE 4WFHE 2IDQA 2F19H 2E4FA 5FYJH 5EF2A 1H6FA 3L1OL 5E6ID 1N12A 2AGJL 2GITA 1JCKA 4G8GD 2A9DA 3K1KC 3OWRA 3RDTC 1IGML 3GXIA 5HHME 4F3FA 2WGNB 2H0JA 3NPSB 4RIRA 3E9TA 2JE8A 2APTA 2G9HA 5F7NC 3W9EB 1P6AB 3OGOE 1MIMH 3T3MF 4LOVA 3IB4A 1BFOA 3HR5A 4OLXH 3MRQB 3NIDB 4HWZA 5F89B 2W95A 2EKJA 2FGWH 2IAND 3IN2A 4JFSA 1HJCA 1EPFA 2EJ1A 4U1GC 3FO9A 3QJZA 4L3EE 5AVSB 3T9WA 3BQUC 4B0MM 4C56D 2HJFA 3CTTA 4D7PA 2GC7C 4YFDB 4DGUA 1E4KA 1EO8L 4HS8H 1BZ7B 1ID2A 1GYVA 3QIUD 3GWJA 3P30H 2VXQH 4MKMA 1ACCA 4G9FB 1KENL 3LEXA 1TETL 2OL3B 1NFDE 2EE6A 1FVCB 1KBGH 3BT2L 4A7QA 3NQKA 3KBEA 3PJSB 2NY2C 2OTUA 4P4KD 3HHMA 3OLDA 3QUMA 4ZSOB 2JIXD 5E1QA 5AB2A 4R0LC 2Y7SA 4HDIA 1CFQA 4MAYB 1QHPA 1CGTA 2HFGL 3NCBB 2HKFL 1HQ4A 1JK8B 2DRUA 3CFKA 2IAMD 5DO2D 4K8RH 1ZXKA 3C5ZB 3S2CA 3HB3D 3O6LH 3MJ8A 2ZT9C 1ACYH 2YQGA 3BP5B 3ETBF 4K23H 4J5VA 4CMMB 4NAMA 5FHBH 1G9NH 5TE7L 1KF9B 1K5NA 3MCKA 2KUTA 3LX9A 5K9JH 3TF7C 5IK3B 1KCVL 2F08A 4ZW7A 4LSRH 1UA6H 1DBKL 3RDTA 2V5RA 4PJDA 1RQ5A 4U7KA 1EHNA 2WWMC 3VRLE 2C3WA 1OTSD 3EGDB 2WM0A 5G5DB 5SV4A 3VXNB 4G82A 3IDGB 3QXAB 4PLOB 4DKAA 2YFOA 3ULVL 1ZDSA 2G5RA 3V0DA 3NQIA 4HX1A 5E6RB 4BYHA 4C54A 4NUQA 4G42A 1UD8A 4N25A 1XMWA 1KPRB 4PCSA 1MWOA 2JWYA 3H6AA 32C2A 3VXOB 2XWJA 4Z8FL 1BDYA 1FWXA 1RSYA 2VN7A 1JGVH 3BQUA 4OLYH 4XP6L 1CQKA 4TLSA 5GSRA 2CRYA 3OPZL 1CG9A 5D1XE 3DDFA 3GGWA 3QUYB 4WQOA 2DYSB 5LBVA 5JDJA 3T3MB 1NMCB 3PWPE 5IESH 5I71B 3CPUA 3HKZA 4NO0B 2ZOWA 1I1RA 1T0MA 3QCVH 4BH8A 2F53E 3VE0A 1AQ8A 4HWUA 2XETA 1X6NA 4NQUA 1ASOA 3MSPA 3VFNA 4QRTB 4TM9A 4KVCH 3EBGA 4NRZA 1S7VA 1QR1B 3MV9E 4R0LA 1S7SB 4UNUA 5E4OA 1K5WA 2NY4B 1MHHA 5LNGA 1I9IH 4PLKD 1BFTA 4DUVA 1XBDA 1YC8A 3ARED 4LFHD 2O61A 5E8DH 2E7CA 1TZHB 3STLA 1UVQB 4U0RC 4OLVL 3HS8A 2VXTL 4BK4A 3TXAA 5FYKL 1NOFA 2CDFB 3ZZSA 1A0QL 4H8VA 3UBHA 4OLZL 4BDVA 3HG1A 1NGQH 1MHEB 3DGDA 1Q72L 3ML9A 4A2FA 3CDFA 3K0YA 4QYAA 2FSEB 4RFEB 4N0UB 3EXLA 4FJYA 4C8XA 1RHHA 2OXGA 4CGTA 3V6FA 3TESA 5HYJB 1E4WH 1KCUH 4PY8J 4L4TA 4OQTA 3THMH 3NDZE 3HZYB 5TF0A 2H3KA 1CYXA 1CC3A 4KKBC 4PJ9C 1BJMA 4UIMB 3DXAE 2WLYA 4AYFB 2OLDA 2VQ1A 4JHAL 4OF6A 3IJYA 4UT9H 5J11C 3JZYA 2I5YL 5DD5H 5AD0B 4PRHD 2Y7LA 3TBWA 5I1CH 1XF1A 4NGHL 1M42A 2J4WL 4AGMA 3BPLC 5DJXA 4AGPA 1W8OA 2P80A 4RX4A 3X1NA 2LABA 2FD6H 2I60L 3NPZB 3AUVA 4Y1AA 3VXSB 1G7QA 3GTNA 2GPZA 3ATFA 3PU7A 1N4XH 4OJYA 1Q90A 3IPEA 4P2QD 4PRIB 3S4SA 5CEZH 5DS8B 1ZT4B 4FAAB 3BW9A 1A7RH 1JF1A 3DMMB 3GHPA 4AYEC 1K72A 4DOHB 3WFDL 4PBVC 1KJMA 4UCFA 1DBBH 4OCYL 4OFVA 3GPSA 1BEYL 2C9PA 4W9HC 1X5XA 4DEPB 1ET8A 5LGHH 3MI6A 2IQAB 4JHWH 1NGWA 1X9RA 5TE6L 1EWHA 1T3FB 4AEHL 4TUKH 1NH6A 3QCUL 5E8NA 3V0HA 1LO4L 2ZNXA 3V0EA 4GQ9H 3UTSD 3FH8A 5CHNA 3BH8B 3K8KA 1CXFA 1G6RB 2JB5L 4LP8A 3EHBD 1QSFA 5JR1H 3LNEA 1QOKA 1PX3A 5IB2B 1UD6A 4CNIB 1CDUA 1EQWA 3G6AA 4PJ9A 2AITA 4XVUC 1A25A 1O75A 1IZKA 5FV1L 5A2FA 3I9PA 4O2CA 5C86A 2VDQH 1OHQA 1S46A 3BGAA 2NW2A 5ISZA 5D1QB 4JFXB 5DZLA 2C4XA 4JFOA 2JXMB 3FMGH 1PY9A 1S3KH 3HIZA 4N6QA 4PPTA 3FQXB 1OE3A 4L4VE 1WAAE 3TURA 1V7ML 5K1JA 2BOCB 1QASA 4QXWA 1M9WA 1M7IB 4WO0A 1MNUH 1BQRA 4TRPL 3TIDA 1NICA 2F7RA 4KI5F 1X5YA 4TSBH 4Z3EA 3FRPB 1IT9L 2X4QA 1FIGL 3II3A 5ENWA 1YNKL 5HI4C 5LJYH 5GS0C 1FG2B 2E4TA 4R96A 1OZTG 2O93L 5TH2A 3D3VD 1TEGA 4AQ1B 4JKNA 5EO1A 5CLWA 1RLWA 3ULUL 5AAWC 2QZ5A 1K9TA 4N2FA 5AVYB 5J1AA 1WGVA 4UQ2B 2WLLB 4OCLC 3D2TA 4E5XA 1K4DB 3WN6A 1D5XA 3S35L 1RZGA 1KXHA 2EKSB 1F11A 3ISYA 3V55A 4AXWA 3WEXA 1RULL 1WWCA 2QKIB 2A0LD 1ZVNA 1X4XA 1I7TA 4QD2E 4EAEA 3OVUB 4GAJL 1I85C 1XCTA 5AW5B 4X7TA 4PJXA 2W8CA 1AXTH 3DHUA 3FC8A 3O2VH 4N2EA 5GS2D 3UBFA 4PYGA 1B4JH 3SDXF 1FN4A 1Q0XH 3BZEB 1PDKA 3BSGA 5FYJD 4ZFZB 2G0KA 3VX0A 1XGZA 3ZL4H 4U6YA 4ZFFB 4HC1A 3SGDH 4KQ4L 1E2VA 5FFOA 4R7VA 5HHXH 1TFHA 3QJHA 1C12B 5BOJA 3CC5B 1MUJB 4U7MA 1PZBA 3FQ1A 3H1ZA 5FUOH 1QI4A 4X5LA 3VWKB 5KBLA 3C6LD 4YGVA 1IJ9A 3P0GB 2BVOA 4GS7B 1FZOA 3WIFB 4AC4A 4FQ2L 4XOCA 1IC5L 2VL5B 2VXSH 5DRNA 3V7AE 4ALAH 3RX5A 3MRDA 4MJ5B 3IMTA 1V10A 2BOBB 3BO8A 2ZZUT 2OXHA 2Q76A 3MV11 2D9QB 3G5YB 5IW6B 4F58L 1CBJA 1U3NA 3HG5A 3EYSH 3KPSB 4I4WB 4NQDB 1P69B 1Z9PA 3TGXA 3PPEA 5DT1H 2AABL 4PJGE 4YDZA 1EAPA 1JWSA 1NGYB 2NXZB 1PD1A 2H3NA 5CIPH 5I1GL 3VGGA 2GSMB 3BGFC 3SPCA 5AAWA 2EUVA 4MRBA 3U6XA 1FLRH 1KT2B 3GMOA 2VZ1A 3EH2A 3VNZA 4ZQTA 5CIPA 1JL8A 2AEOA 2IDUA 2XDHA 1AZUA 3TBSA 4AH2A 2DTMH 3GMRA 2WVTA 3GMLB 4BGDA 2JCWA 4HCIA 2PCPB 3EBIA 1LK3H 1I85A 1KIRB 1RZJL 1WAEA 2V2WA 3EG9A 5H4YA 1GL4B 3CXDL 4XMPL 1BQLH 2VM4A 2ICEB 4X0KA 3RDTD 1O6SB 3QWRA 4XXWC 3MX0A 4NQVA 2VUOA 4WI9A 3TBTB 4EOWL 4KKCC 7CGTA 1ZPUA 3C09C 3CXHK 2J55A 1D5BA 1HKLL 4YUEL 2JJWA 1MREH 3SE9H 2YA0A 3UABA 2AC0A 4YDKH 3CSFA 4LASL 1HS6A 4AWJC 3BFQG 3L2NA 4G7SB 3VU2A 3MV8A 3SDXB 4Z7AA 4HOMA 5I74B 5IREA 4GUQA 3DOHA 4MAUH 2AEQL 3ZTNL 3WE6A 4L8CA 3QQXA 35C8L 5CEXB 3T2QA 4M8QA 1WDAA 3SGEI 1SJHB 2J1WA 1AOZA 5DD6A 5EO0B 2HLFD 2ARJB 4PRPE 4QOKD 1NANI 5E2VH 1CR9H 3L4ZA 2ICWA 3F7KA 1PKQA 4Y7OC 1B9ZA 4TULL 1WT5A 4WHDA 3ARGC 2VAAA 3WNIA 3X11B 2WQAA 3ZJAA 4Z0BH 1DR9A 3J8F7 5ANMA 2RCSH 4LGRB 2NX5A 4TVPL 5B38B 4U4BA 1XF2A 2OMTB 5I6MA 4G8GE 4KJWC 1F2XK 3PAUA 3LTVA 4MWFB 5GGTH 2EH8L 3SO3C 2KZ1B 1AQDA 2ZSVB 3ROOB 1CD1B 2XWDA 2J1YA 3DJ9A 5JOFB 2ZXWB 3WL9B 5AWNL 4WV1B 3NA4A 3VFGL 2OMWA 5C0BA 3CX5J 5C07A 1BQHB 1KPVB 2DQJL 2D7OA 3G6JA 2DI9A 4FEIA 4HOXA 5E0FA 2XZAL 3D0VB 1U8KB 4GB9A 4NCC1 5C09B 3STBA 2ESVB 1YMMA 3D18A 3TF4A 3AXLA 3HG1D 1YPZE 5FEBA 4XXWA 3BSHA 2W65A 2WWMD 4C56E 3PGCA 4LKCA 3LS5L 3GUTB 4ZMTA 3IE9A 5I76B 1QYGL 1P7QB 2EACA 2MJWA 3LKOA 3MV7A 2V9QA 2IPTL 1MN4A 1EJOL 2G5BA 2WVSA 3KGTA 5C0FB 5FECA 1CBVL 1OT1A 3B7RL 1KOAA 1E8XA 4TLUA 1QATA 1X9UA 4ZNCD 2RFXB 3GMQB 3S5YA 2W92A 1XF4B 3K46A 3LEYH 4EI6B 1AGCA 1UACL 2E27H 1E42A 4MDIA 2EE2A 3ABLB 3CMGA 3DRTB 5LXGL 2GTZB 1OD7A 3UROR 1JVOA 1P4BL 1TZIA 4W6WB 4IBQA 3KG5A 3U6XS 3CFBA 3C2SA 2YGOA 3RVXC 3ILEA 4KHTL 3AY2A 1ETZB 3V5HB 4EE2A 4PREA 4YO0A 2AV7A 3ARGA 5T1JA 2P80D 4RX4D 3HZKA 1NLBH 4S1RH 4WKZA 4PV8B 3VMOA 5AEAA 2VWEC 2DQCH 2HJLA 3RURA 1XB3A 3B34A 3LH2H 3NOIA 12E8L 3RVWC 2YAOA 4J12A 3RIAF 4MJIE 4F7TB 3SYCA 3O11B 4BFRA 7FABH 5CBAA 5CEZD 1XQ4A 4XVTL 4AYGA 1RCYA 1BBJB 3QC6X 3HC3L 1U8JA 1XF5B 4GSRA 1LWJA 5C0GA 5I0XA 3GXNA 4AK2A 1SYSA 4NQXA 4H8WC 5L4MA 1OSPH 4P9MH 4FQXB 3BVXA 5J0BA 4N0CD 4KXAA 4WU5A 5E8PA 5D7SH 1WBYA 4E9SA 5E00B 2FBOJ 2CIKB 1QFUL 3HC4H 1A1MB 3NFPB 4WDIB 3QUGA 4I9WD 4CMHC 5DSCB 5C3LD 5D96C 3EADA 5ICYA 3TYFB 4N85A 2YKLH 2G3MA 5IB1B 4I13B 2COQA 3BMVA 1VERA 2EXTA 4Q7DA 2X1XR 1AQKL 2TRYA 2ZUXA 1JBJA 3GMNB 3VMPA 3V6ZB 5F1IB 3VG9B 1KFAL 1G4MA 3SE8L 4QHUB 5HGBB 1D5IH 2YFNA 1ZV5A 4BQCA 1EJFA 4KZDL 2R2HB 4S11A 2A7BA 2ZCKH 1S78C 4I1PA 4Z7WE 3MA9L 3KHQA 2N56A 3MUGB 2UVEA 1TCMA 4I0PB 5F3FA 4QAWA 2PTVA 3NTCH 1UZ8A 2IWGA 4TOYH 4U1JA 5EBLB 3ESVF 5FR3A 1QBAA 2ALAA 4RAUB 5IG7B 1LEKA 2ZOUA 3MUY1 4PJ7F 3NZ8A 2DQDL 3E8UH 1GCFA 2NY0B 2WQSA 4NM8H 4UQ3B 2BNQB 4XC3L 2CUHA 4EIBA 2P43B 1V05A 2ILLA 2XBTA 1PAMA 4J3OH 2YK1H 4JDTH 2FWOB 2X6UA 4OT1H 3S34H 4BQ8A 5SWZA 3PWLB 4FN0A 4JDVB 1UWGH 3UTZA 3BYTA 3PG2A 4LL9A 2E56A 3RB7A 3ROLB 1XHHA 2B4CL 1MSPA 1KB9K 1UA3A 3HI6H 2RBLA 2X41A 3RNKA 1CDYA 1HNYA 4JO2H 3EYVB 2VE6B 4Q14A 4XP5H 5J5EA 3LN4B 1U3HA 4UDTA 4HWEH 5HVHB 5DHYB 2BHUA 3MXWL 4MMZC 4CUCA 4Z7OB 5C9JA 1CL7H 5J4MA 1RZ7H 3A47A 3PWNA 4JREC 4OZGA 2XN0A 3B2XA 1CPUA 4LCIL 3UZQB 4ZNEE 3H9SB 2DMCA 3M1BB 4RMRA 3CVHH 4PR5A 5EZIL 1B2WH 1MFCH 4AJYV 5HGAA 1OCOB 1JDDA 4ZFGH 2NLJB 1D5MA 1VPOH 1MCRA 2A4EA 5HDWA 4KOBA 2NYZA 3UTSE 5HI4D 5GS0D 2KERA 3STZA 5ABZA 2ZX8A 2BP8B 2X7LA 2CHZA 3BXNB 5CS7A 1P0SE 3MNMA 2JELH 2PF6A 1H3XA 4IRZA 4H20L 5DC0A 2RA1A 1DFXA 3RPKA 4NT6A 1RY7B 5DHVB 3P2DA 4G80B 4PWFA 1CFTA 2F5BL 3DDGA 4K3EH 4LEXL 3SPGA 3U0PB 2FYVA 5KVFL 5H2BB 3IETB 5LLIC 4I2XB 2R9HC 4GMSH 4GXFA 4DPAX 5C0EA 1CLVA 1HOCA 2UUDH 2YO3A 4PJ7B 5FDWB 1BAGA 4Z3JA 5IVZA 3IPFA 5B1JC 3WIHL 2A9CA 2BWQA 1EVTC 1OP4A 3E0GA 1AZVA 4PWEA 3FFCB 1GIGH 4LSTL 5K69A 3QWRD 3IBOA 2BMKA 3NZHL 3GJFK 1U8NA 4PJEA 3OMZA 5C6WH 1XH3A 4IW4C 1IGMH 1UB6A 4MMZA 2CPUA 3KPLA 3TOPA 3OKDB 3BP4A 4NSKA 1IARB 3LIZH 1YYML 3CSYA 3CDZB 3BIBX 4H7VA 3V4LA 1SN0A 3DRQB 3NRPA 3D3VE 2BNRA 1UM6L 3LIZA 4PW4A 3JVGA 1KTJA 2VGLM 4FDWA 4XO9A 3S2AA 1KC5L 4FQHB 1AKJB 5BUPA 3GRGA 3NSCA 4NZDA 3ULVC 4JG0L 3RY6C 1IGYB 4ZUWB 3QS3A 3FTVA 4PRAB 3L48A 4GRWF 4AVIA 8CGTA 1LQSR 5IGXL 2QSCL 1BQHG 4PJIA 3VFMB 3P3SA 2VERA 5DWUH 5GZNC 2ZNWA 4F7KA 1I53A 1R3IL 5B8CB 2A73B 5IBLD 1Q9LB 1MRDH 2OX5A 1NMAH 1OAQL 3RAJL 5I66B 4WO4C 2NX5D 1A4KA 4W9ZA 2YR3A 5BMFL 3BKYH 4RGNB 1MQKL 4XPFH 2X42A 3EAKA 1ZSDB 2CR6A 4J39A 2X87A 5FYJE 3D39A 3IDIB 4YH6A 4ZW5A 2PO6B 3WS3B 5ITFB 4JJHA 4XMVA 4HJJL 5B1JA 5C0BD 5C07D 4E41B 4OKVB 3L5HA 3O3DB 3IFLL 3DUSA 1RPKA 5DK2B 2IQ9L 4UQAA 1JVKA 4NZRL 3UCRA 1AP2B 4RFNC 3ZQXA 4MNGA 2MRYA 3P3RA 2UZIH 1MCPL 3F12A 2AJZA 3QULA 1CUOA 2BIMA 3VXTB 3B2DC 5DJZB 1OCRB 1PPIA 4KQ3H 5JORB 1LYQA 2C7UA 1JZEA 2WAHA 4HKXB 1OARH 2NNAB 4KXBA 4LPUA 5FK9A 1ROWA 4BFIB 1RD6A 4AE0A 3WLWC 4JN2B 5EV7A 3RY6A 4KK8D 4UILL 5C6TL 4XP6H 2GSGA 3AJ7A 5HHPB 1BZ9A 3MRRB 2F54B 3ZTEA 1CXIA 2UYLB 3HMWL 2P5EA 2TAAA 2RIKA 1YNLL 3ARGD 5EEYA 4NLAA 4S1SL 1PEWA 1SMOA 1IC7H 1I1AD 4QHPA 4WO4A 2BK8A 2X4UB 1M3IA 2XWXA 5T3ZL 3TEUA 1WCBB 2FHBA 4JFYA 3M1OA 3IJ8A 4KJWD 4PTTA 4DO4A 4GRWB 4PRNA 1A7PH 1OTUC 3QYMA 3F6LA 5GGRB 2ZOLA 4GRLD 5K1VA 1UJ3C 3V0GA 1F97A 3GBLA 4WWKB 3TA3A 2E9WA 2ID5A 3MHZA 2RD0A 3Q6FB 4YSRA 3O6KH 2DIAA 3T3PF 4OLVH 3CU7A 2ZCLH 2IAAC 3FN9A 3DO3A 5CGBA 1DCEA 4CADB 3TNMB 2H26A 1QBMH 1DZ0A 1DQDL 3QUXD 1G6RL 1O5PA 2OMYA 1E67A 5IEHB 3LXCA 4QOKE 3ATEA 3Q8BA 1N5AB 4R2GB 1QSZA 1KJ3L 1BJ8A 3HI1B 3WGVB 4UV4L 4GW1A 4RFOL 3LQMA 5I8EB 3FT3A 1YG9A 3SGKC 3RX9A 3KL5A 1J0KA 1RK0B 4ODUA 3V0VB 4LHQB 4LVHB 5EN2A 4YC2B 4Z76B 1VF5C 2JV6A 1T0NA 1M7XA 3DC0A 1KGXA 1X3DA 1M6OB 3RVXD 2HMIC 3QNZA 4P3DB 2AMUA 1ZS8B 2EDJA 3WFHA 4QWWC 2JKWA 5ABDE 2P8LA 3AROA 3U1SH 2V37A 4OM1L 43CAB 3QUZC 4X4KA 3RILA 5KSAC 4AZ8B 4U3CA 4KV5E 4DVBA 1OB1A 4L0ZA 3RVWD 2Z7WA 2IH9A 1PQZB 4FA6A 4ZYKB 2ZXAA 1JZDC 3BX7C 5DJDB 1YMHA 1LNUA 3CH1A 3IDMA 4JY5L 4ZMAT 3JWDL 4IM8A 1L0XA 4U1KA 3IJ9A 3WFDH 2QBWA 4O9HL 3C6SA 4GAYA 5BZZA 1MLBA 1C1EH 4OCYH 2LTQB 1BX2B 2OW6A 1NKOA 3ESOA 4HJGA 1CI3M 2HXAA 1EAOA 2WXPA 4K0OA 4NI3A 1IU1A 5TE6H 3KPRA 5DR5H 1T04A 2XA8L 5SWZD 4R7DA 4D8PA 3QZWG 2GT9B 2Z9TA 4HF5L 3NEOA 4O4YH 4IMLB 3T3PB 3K72B 3IRCA 4J3OD 4WK2B 3DVNB 3ULUC 3AQXA 4FG6D 4LCWB 3SGKA 2Q8AH 1WO2A 5IHBA 2E75C 4AV0A 3OZLA 1U3HD 4MD5A 3BPNC 5DTFA 3IFNL 2WTRA 4A66A 1TTAA 5CJXC 5MEND 1FFNB 1YN6B 2GY5A 2HFTA 3E2HB 1WSST 1IEBA 1TTRA 1WC7B 4AYMC 5CEZE 1I3RA 4HMCA 4JJOA 1S9KC 1L9TA 2VH5L 2JTDA 1WCQA 3GSQB 3QUZA 4XHJD 5JYMA 3W37A 5KSAA 2NNFA 2H8PA 5F7AA 3KDMA 3FRUA 2KKQA 2WXQA 1NBYB 4AG4H 5I73B 1YJDL 5AAPA 2AV1A 3X17A 1VGKB 4MD4A 2VLKD 2LOEA 3SPJA 4NKOB 1CDJA 2P8MB 2Z92B 3ZTCC 2IH3B 1WFJA 1F02I 3TVMB 4XNQA 4DP5X 4ANUA 1YNKH 1IRAY 3FQRA 4XP1H 3U36A 1SY6H 4A1RA 4B9CA 1JZ7A 4JRXB 3HE7B 4NS0A 4AX3A 4Y4HC 3SDDB 2NT0A 2Q1EA 4YWGH 1A6WL 3IFPB 3CSTA 2EDXA 2Z4QB 1N10A 2CO4A 3JTSA 4X7EC 1IM3A 2WVVA 1ETA1 5GJSL 2MWCA 4NERA 5F0MB 3NACH 2H0FA 5FOJA 2Q8BL 2SODB 4BFBD 2WLZA 2CBOA 4UQDA 2CE6A 2IC2A 4TNVK 5IOPB 4ODTH 3LMJL 4Y4FC 3CN3A 3MRGA 4MNQA 1IKOP 1DSYA 1K8IB 1UXLA 1JDAA 4MQXC 3QE5A 4E9XA 4NWUL 5BXFB 1G0XA 5J3HD 5CJXA 1A47A 4JFEA 2WBKA 5DRZB 3FL7A 5LGJA 5IJDC 1R0AL 1CXLA 1RZJC 4CSPA 1MH5B 3MBEC 1IUZA 1FH5H 1D6VH 1S2EA 1YEGL 3LNHA 4M8VA 4P59L 2EYTA 1NEZB 3TN0D 1D7BA 3WS6C 3V95A 4XZUB 1AGFB 1SFHA 3FUIA 3GSVA 2W9EH 4ZO8A 1JPTH 3ARFC 2ZKMX 3OGCB 5IMLA 3UZVA 1PY0A 1T6BX 3MRKB 5A7BA 2W80C 3TTSA 4BRJA 1IC5H 3PIQB 4HIJA 4HK0B 2R1XA 3VYPA 1JZ6A 1FNEB 4EBQH 5GS3A 3UJJH 4GIOA 1E28A 5TQ0L 3UYOD 5JNYB 1T1YB 1BIIA 1UKTA 1ZHBB 4F7EA 3FOMA 4K7PY 4KOCA 5FM8A 1CT8B 4PJXE 1Y07A 1O5DT 4G6MH 5K33A 1W0WA 4Y4HA 2X40A 2YD6A 2BJMH 4ZD3L 3TH3T 4Z7UE 2R9HD 3D39D 3K6NA 3H0TA 3QIBB 3JSSA 2IPUK 1H3UA 1ZHLA 2ZUYA 3AC0A 4AGQA 5J56B 5DUMH 5ID0B 3SDCD 3RWIA 1JFHA 1P6FA 3CHOA 1CJYA 1L9QA 3OKNB 5IB3A 5C97A 3LQAL 3PXHA 5L9DL 1IAKA 2BINA 3NABL 5FGSA 5ABAA 4Y4FA 4LP5A 3QISA 3L4VA 1Q0EA 1U95A 4KO9A 3VJ6B 2CJTA 2WINB 4V2CB 1LP9F 2WCPA 5IM7B 4NN5C 2FSDA 4BFGA 3LDBC 2A9ML 3MBEA 3L95B 2QV4A 3SY6A 3LZNA 5J1SC 1JPGB 2IH1B 1KDJA 3E6FB 3H6JA 3OLIA 3MRIB 4BXVA 2SEBB 3F7VB 2FO1A 5KEZA 4FXTA 4YLBA 4JFFD 3VFOB 2AEQH 4P2OB 2W9LA 1JV5B 5TJWK 1IE4A 1Z1WA 35C8H 5SX5H 5I8CB 4U49A 4YHOL 1ICTA 3D12B 4UM8B 4OGYL 1TFPA 3QIWB 2CGZA 5IFAL 2MOQA 2XN9B 3MZGB 5HGDB 4NJ9H 2JCCA 2P5ED 1OXYA 1QLFA 3OQRA 4ORGA 3DROA 4M61A 2A83A 2P26A 4PM1A 4APQC 1XGRB 5ERWB 5T1DL 5D2LE 3SOBH 4MCMA 3B9VA 4KKPA 5LUMA 4LLUA 1XH0A 3FCSA 3EGXB 3HPLA 1TTGA 2GAZA 3PWJB 3BCFA 3T1WA 4TVPH 3IMBA 2BY1A 4IHOB 4FXKC 2AJXL 4UNIA 3IXAB 1JIBA 4MA7H 1LMIA 3RI5F 2ZSWB 3NESA 3MRJA 4L8SC 2EH8H 1IAMA 3TA3D 3EOTH 1FNLA 1I8IA 2QLVB 3U9UA 1IGJB 3FPYA 2A6IB 2OP4L 1MF2L 3D52A 1RMFH 5AKVA 1ZTXH 2VYRE 1TQTA 2HVKB 3GLZA 3QXTA 3SZKC 4UDUA 1T0OA 1U6AL 2DQJH 1TZAA 3IDJB 1X4ZA 3BDYH 1BBDH 5FKAA 4W6YB 2I25N 5DGQA 5IQMA 3IJ7A 4N24A 1U8PB 3PAYA 1M56B 2PW2B 2ZWSA 4UAHA 1MLCA 3A6CL 1D9KB 1RJLB 1JXKA 1VFAA 4N9GB 3FQNA 1EJOH 1DANT 1CBVH 3SZ6A 3LNDA 4HU2A 3WI9A 5B3JF 1DZBA 2XICA 4HCGA 4HWBL 3ZVVA 1OGTB 5FCSH 2CG9X 1PNDA 2WGXA 1UACH 5DUPL 3RWCA 3DBXA 5H35A 4YSTA 4XODA 5AZUA 5L2KB 3X1FA 1R9FA 1XWVA 1KXTA 4IJ3C 1ET5A 4APQA 5BW7C 5T1KD 3UO1L 3G6JE 4YBLC 4CVXB 3KYKL 3ZYZA 3PHOB 2A6JA 4YDVA 2EDNA 4TMPA 3EDKA 5B7MA 4PEEA 1OF0A 3GI8H 5B3SB 4FA8A 4FXKA 4OAWA 3IGLA 5KUKA 1CVSC 1QSEA 2DYPA 4L9LC 1NC2B 3L4UA 4PJ8C 2PYEA 4L8SA 1KEGL 2I07A 3PL6C 4YK4C 5D93C 3ZE2F 1TPXB 1NGZA 3EJTA 3U46B 5I1IL 1BGXL 5BQ7B 2DH3A 3QORC 4LZKA 2WSPA 4NUGH 3ZUNC 5I0WA 3GI9L 3OR7A 1G0DA 3O4OC 3KPRD 5CEYB 3VWJB 4X4YA 1CB4A 4HJ1A 2BIPA 4Z0XB 4HU8A 4DK5A 5D5MA 3ZMEA 1LWRA 1AYRA 3QA3B 3T2NL 1PZUB 2DY2A 3L08A 1AGBB 3MNWA 4FFZL 4F2ME 4GFXA 3O6MH 4Y9CA 4OTXH 1EHLH 1B0RA 1DSFH 2DTSA 5TGBB 5EU7C 3I75B 3EJPA 3Q6GH 4JPIB 3ZR5A 3ABZA 2EO7A 2B4CC 4BRVA 5LDUA 5L6YL 3OXSB 4QWWD 3NPSC 3RL2B 4WTZG 2NY1C 1JPSH 1M2OA 2WO4A 2D7TH 4G11A 5CD5C 5I1JH 5JZ7C 1UCTA 3QUZD 4GINA 1TVBB 2F8IA 3D4CA 1LQBC 4LSQL 5B21A 1H15A 4P99A 4ZUSA 4UOW0 1FPTL 1N9PA 5EA0H 4R3SA 3OB0H 5D70L 5GSVB 4L9LA 3VXRA 4PJ8A 3SYPA 1C08A 4XBEH 3PL6A 4B96A 3VXUB 3WMPA 5BS0D 2VIRA 1TQSA 2CIIB 4JHUA 2FEJA 4OW6A 3F65A 4R6UA 1KGIA 2XKSA 2QR0B 3QORA 3CFQA 1VLXA 3DYOA 3LKPB 3SD5A 3VYNA 1FL5A 1LEIA 3MLTB 5DJ8B 4X6BA 4GKOA 2I9TA 2YEQA 2X0VA 3ZE2B 4S2SA 3W39A 1IM3D 2PW1A 3ZSTA 4G6KL 4HKZA 4F93B 5F70A 1X5AA 1NEZG 4MSWB 5CFHA 4PMEA 5BVJA 2F1BA 3C5ZC 1R75A 3RWDA 5CN1A 2E74C 4Z77A 3ZYOA 4X9IA 1XT5A 4XCNB 2WBJB 2B4CH 5GS1B 4MNQD 5ILTL 1MAKA 1NAKH 2J1KA 1IGFL 1TTFA 3GKWL 4MXVF 2E7HA 3U2JA 1A22B 3CHXA 1OAZH 3LHPH 2X12A 2FT6A 3CFEB 3N9GL 4RMUA 5JPMB 1USZA 2YZ1A 1UT9A 2EIEA 5AG8A 2W07B 4AUJA 3MZTA 2X6VA 4DW2H 1F4XH 5F89A 4NZTL 2FHCA 1BJ1J 1JI2A 1UG9A 3OD3A 5D4IA 5SWZE 2OL3H 1UC6A 3I3EA 3PDGA 1MCEA 1NMCC 2O5XH 2BP0B 3CU1A 4JFDB 2J6WA 4G9FA 5HJBA 1BZDA 4D9LL 4KKRA 1FVCA 3OLGA 3PJSA 1TLMA 5TE4L 4N87A 4ZSOA 5A2IH 4RZCB 1J1XL 2NY4C 3V0IA 3APMA 5MENE 4MAYA 4DPCX 3WTVA 5KWYC 1C8PA 3DVFA 1A64A 4PGDB 1JK8A 4OZGE 1R19A 2BVUA 3C5ZA 3N04A 2FHFA 5CINH 3OHMB 2CLVA 3BP5A 4J3BA 2ZKWA 4PS4H 2HLAB 4Y4FD 5D7IF 4K7PX 4CMMA 4ELDA 1NCOA 3CLEL 1IC4L 3K2IA 1X5JA 3L3GB 5IK3A 3WIHA 1T5XB 2J73A 1PX8A 1ZV9A 2DD8H 4YFEA 4ZTPL 5A6LA 1TQCB 3WKNA 3L81A 2CJ3A 2VLKE 3MBED 4XMLH 5G5DA 3SY0B 3VXNA 1L7TH 3LCYA 3IDGA 4YX2H 5IY5B 4AYDC 1DDHA 4OLWL 1C7TA 2WNKA 3MLYL 2QGDA 5DXWA 4N22A 3AG3B 4PCKA 1LO3L 3B7SA 3CZLA 3FTXA 4FJ6A 4IKKA 1KPRA 1UM6H 2X44D 2FEDD 3VXOA 3SDAB 4LLQB 3TCTA 5D7LD 2P8PA 4OCWL 2ZUVA 2VDLB 4JZNB 2ZUSA 3UEQA 3OC8A 2XVGA 4NO0A 2C1PB 1LVEA 2UUDK 3VFUB 4YXHH 1OAQH 4M7JL 3RAJH 2CRIA 5F0PB 4ETYA 1JNNL 1TNNA 2EO9A 2JKRM 5BMFH 2OSLB 2WP3O 1G7HB 3BMWA 2XWZA 3MLSL 1QR1A 5C6PB 1S7SA 2Y7OA 3HMXH 3ARQA 3PP4L 5BOPA 5JPNB 1U58B 3ELAT 4TVPD 5D1ZB 3DX7B 1J5HA 3DMMC 3P9MB 2DI8A 2CQVA 1TZHA 4BKTC 1UVQA 2C1OB 5PCYA 4G6FD 5GRZA 1E30A 1N0LB 1JCVA 4XNZB 4DEPC 4NZRH 1Z3RA 2CDFA 1F6FB 1MAML 1KYFA 4UQCA 3PGFL 5EZPA 2C4FU 1MCPH 1MHEA 4HMEA 1RURL 4PJHE 4PJIE 4ZI8A 3IK2A 1JNJA 5FM5O 2FSEA 2CLZB 5D7IB 4RFEA 2IDCA 4N9OB 1N70A 2GVYA 1HZLA 4N0UA 2E6QA 3CVIL 1JNHB 5HYJA 3MAWA 2JLLA 4DKTA 1MRFH 4LL4A 3HZYA 1E4JA 1FA4A 1IO4C 3V4VB 2F8OA 4NZUH 4UIMA 1G7PB 1C5CL 4K2UL 4AYFA 2K6YA 1WFUA 3AGVA 2F1EA 2GJ6A 3IU4L 3MKKA 4Y19E 5LAPA 5C6TH 4Z7QE 1LTXA 5D1QC 4D2NA 3FT2B 3R1GL 1N6QH 5AD0A 1JDCA 2J8UF 4KU1A 3O2DL 1YNLH 1CU4H 3QNYB 5F7WC 2NZ9D 1WGOA 2GTQA 3IMUA 5C7XH 2GK2A 1BPLB 4NN6B 3ZRSA 5C2BL 1GOGA 2ZUTA 1I7UB 5T3ZH 4X7SL 1QSED 2DYPD 5GRJL 3VXSA 4H0IA 2PYED 4PRIA 3RJDA 1MG3C 3AQDA 4ABUA 5DS8A 1ZT4A 3H7BB 5ETUB 1EAJA 3DMMA 1U41A 3BD5A 5AOIA 4RGMB 4KPHL 4OD1L 1EZVY 3FHQA 1YEHL 3NSFA 3TIEB 1N19A 4A2HA 5I1DA 3QZMA 1A7OH 4AQ1C 5FGBC 2IQAA 4JFFE 2C3HA 5AAMC 3JWDC 1AIFB 2IGLA 1T3FA 1IC0A 1MELA 4LVOB 1ORQB 1CTOA 2X4OA 4FZ8H 1CTNA 1UKQA 3JWOH 4QRSB 3L2LA 4FP8H 1SMAA 4YDLB 2QKIC 4HD9A 3NK3A 3BH8A 1G6RA 3VD4A 4UV4H 2FT8A 2WHVA 4PWIA 5IB2A 2I85A 4CNIA 4NWTH 4JY4B 1TYJA 1ID5I 2YKKA 2C9AA 4YL9A 5CGTA 2F2HA 4UQIM 1INDL 4JFTA 1E3XA 4L23A 3KCWA 1IKFL 2JKXA 3WN5C 2ZXDA 2E9GA 5CO1A 2DEXX 5D1QA 1BOGB 2JXMA 1YEKL 4HSAC 1H3VA 4GAGH 2APVA 3D4GA 3B6SB 3FQXA 3VWKC 5JXEC 2Z7UA 5BO1L 4GS7C 4JPKH 3L9EA 3VXRD 5GXBB 2VR3A 2BOCA 4PJ8D 2K0RA 2DLGA 2PN5A 1HINL 2HT2D 5LAXB 4CN1A 3FRPA 3ZHLA 4BK8A 3QORD 1KYDA 3UPCA 1FG2A 2UXTA 2XN2A 3CX2A 1TENA 1YJDC 4O9HH 4AQ1A 5CUSH 5FGBA 1MDAA 5J7CC 1F4HA 3NJMA 1B0WA 4I3SH 5AAMA 1GSKA 3BWZA 4KI5C 3DV4B 5DQ9B 4G6JL 4R26L 2AFNA 1BYNA 5TQ2H 4UQ2A 2WLLA 4P2RB 1K4DA 5EF1A 1GZHC 2E7DA 1PS3A 1M57B 2UV3A 4LOEA 4KDWA 2FO8A 4GQRA 3D08A 1XH2A 2QKIA 5HDQL 4ELKB 2R4RL 3CUPB 1BWWA 1GR7A 1HILA 2CHDA 4EMZA 4NC0B 4TKWA 4LMQI 5DMIL 5FUCC 2ICEC 3BZEA 4WCYH 3Q8EA 4ZFZA 5E4EB 1AO7B 2EDQA 5E51A 4ZFFA 3L5XL 4JFZH 4AENB 5I30L 5CD5D 2ATAA 3H2WA 1C12A 3TTYA 3NG5A 3CC5A 1Z9OA 1MUJA 5D6CB 5JZ7D 3GHBL 4K9EL 4AQOA 3VWKA 5JXEA 2VH5H 3QNXB 2OQJB 3QPQC 3WIFA 3KPRE 2E76C 3QDJB 5ADOL 2VL5A 4FC3E 2A4CA 4JKLA 4AMWA 1YYCA 4MJ5A 2N7SA 2BOBA 2FUQA 1R3HB 2K3HA 4HPYH 3MR9B 3G5YA 3L9YA 4G9FD 3EDFA 5IW6A 4FRWA 4I4WA 3HNTL 4Z95H 3MRHB 1JN6B 3GSNB 4AZUA 1EJ6A 4KXDA 4LSPH 4EI5B 4HT1H 4PG9B 1NGYA 4K71B 3MO1B 3MCLH 2XXMB 5CCHE 1G84A 1A6WH 1QAWA 5HI5C 1BG1A 4MAYD 1Q4NX 2KT6A 3O9WB 4GXVH 2W1NA 1KT2A 3L1EA 3GMMB 4DZBB 1GZHA 1RZFL 1TQVA 3C5ZD 5IR1B 5GJSH 1S9WB 4WV1C 3CFMA 3NAAH 3GMLA 3GDBA 5CCGE 4LAJH 3ZDXF 2PCPA 2O6CA 5GISH 4MYWB 1EUUA 2KHAA 4FD0A 1KIRA 5IOKA 5EMYA 2WUBH 3IDYB 4M8RA 2ICEA 1O6SA 1YECL 1TOXA 3LQAC 3TBTA 3CXFA 2G60L 3ZRCC 4OGXH 2XT1B 4A55A 3J7HA 3GQFA 1WBZB 4PJBE 5BS0E 4XP4L 9CGTA 1NIEA 3EDEA 2GBAA 2WYHA 4DGVL 3O6FB 2P49B 4FYQA 2E5EA 3SGEH 4OF5A 3SDXA 4FTDA 3MFGB 5IBUB 2I26N 4YDMA 2QDVA 2J12B 1NANH 3W56A 2CA3A 5CEXA 3KYAA 1GGCL 4K5LA 5GQBA 3ZBMA 5BRZB 1SJHA 2P42B 5AVWB 4XP9H 3QRLA 3RFRA 4CJ1A 1JZ8A 5EO0A 3QUYD 2ARJA 4XN5A 1CCZA 3VGEA 3O2WH 5CZVH 4NO0D 4PGZA 3OAUH 5JOEA 3ARBB 5TQ0H 1BD2B 3DHMA 1WA0X 4RSYA 1HT6A 3MN8A 3X11A 5IVXF 2LV4A 1P2CB 5B38A 4CILA 4IKIA 2OMTA 4Y2NA 5BO0D 5I1EL 2CHWA 4MWFA 3GSRB 3ROOA 2ZSVA 3F58L 1CD1A 1GS7A 2HH0H 5JOFA 3WL9A 2J8OA 4IBTA 4WV1A 5H94B 1Z2KA 2QQKL 3M86A 1PG7X 1BQHA 1KPVA 1CICD 3LQAH 3KNBB 1ZT7B 2YPVH 3D0VA 5C09A 1U8KA 1D2OA 2APBA 2WQWA 2ESVA 3NABH 3P77B 4XX1G 4LE8A 3SE3C 3DK0A 2CR3A 1AIZA 2FYYB 4CC4C 1WK0A 3GUTA 3N43B 1J05B 4U1MB 1DBJL 5I76A 3ZDXB 1OHZA 5C0FA 2XU9A 3A3YB 4JO8A 2A9MH 4OIIH 2QPUA 2P44B 5HYJD 5E08H 1VA9A 2RFXA 3FCBA 3GMQA 3NJXA 4JJ5B 1XF4A 4EI6A 2B1HH 3V6OE 3RPIA 3HI5L 5CBEB 3DRTA 3SPVB 3SQBB 5ESAB 3VD5A 1KN2H 2GTZA 3MRLB 1J1OL 4QMEA 1SVCP 3ZQWA 2RB8A 1GZQB 1ZK5A 3ULSB 2YQ3A 2QGEA 1CGVA 1X9QA 1A3RH 2CO3A 1ETZA 2B1OA 3V5HA 3SKOB 5EIQA 1AE6H 3ARDB 3I02B 2CNZA 1FL3B 4KHXL 2FH8A 2PP7A 3MLUL 4PV8A 2PWEA 1L7IH 3VXSD 2DYRB 3VQMA 4PRID 3PWUB 1SEQL 1LO0L 3WEMA 4I0PC 4CDGC 2DJUA 2ICES 1JJUA 3EO1B 4UTAH 1IIIA 3ZK0A 5T3ZD 2NY7L 4F7TA 4AJVA 3O11A 3UG3A 3ABGA 2CWRA 4YHKL 3LZLA 3B2VL 1XZ0B 1MF2H 1PZ5B 4MQTB 1EMTH 1BBJA 1XF5A 3QJQB 2NY0C 4RA0C 2XIIA 1U6AH 1I1YB 4NPKA 1J0JA 3ZYJA 2X53A 1AHKA 3SE3A 2BSRB 4WFGD 3FB7A 2B59B 3HVNA 4P2AA 4CC4A 4FQXA 5C08B 4JCLA 4XC1H 2WXFA 1LWHA 1W0VA 1INQB 1TYEB 4LLMB 4RSVA 4PJ5D 1HE7A 5D7LE 1H3GA 3A6CH 3ECQA 3VG0L 2HT4C 4BFNA 1AKPA 3FJTA 5SX5K 1YEEL 2O6FA 4UOW1 5E00A 4IKNA 5FW6A 2CIKA 3BKML 1A1MA 2H1PL 3NFPA 2VT0A 4WDIA 5DSCA 5EZJB 1EZVX 3VDCA 3TYFA 5E4AA 1HU8A 3I50H 2G3NA 5IB1A 4KTGA 3VFWB 2X9ZA 1AZNA 2Q7AA 5AVZB 2Y5EA 2GG1A 5F1IA 1FJ1B 3V6ZA 3I6SA 5EUOF 4HWBA 1XGUB 3G5WA 4OJCA 4TVPE 5D1QD 1QR4A 3WFEH 4QHUA 5HGBA 5HDBF 1A7QH 2R2HA 2DLEA 3II2A 1G0YR 2Z31C 3LNIA 4J3UA 1RVFL 1CWVA 4APXB 1ZTXE 3V4UL 1Q9WB 1ZAGA 2WJ7A 3KJ6L 4YPGB 4HXBH 3MUGA 3UX9B 1BPVA 4QR7A 3O0LA 4I0PA 1GJWA 3D0LB 2NSQA 3LIUA 4IS6B 4O2EB 4WUKL 5KVDL 4CKVX 4GG6A 1ODAA 4P04A 1KEGH 4PJCA 3VM7A 5EBLA 2M26A 3LZFH 1QZ1A 4DQAA 5MEOB 2OA9A 1D7CA 3QAQA 1F1AA 4AGLA 2J8HA 2DQHL 2HZHA 4E9TA 5I1IH 4WSKA 3GZOA 3ZW3A 5I1AB 4UQ3A 2BNQA 4HUWB 5BV7B 1N59B 1VEOA 3GI9H 1OD9A 5DC2A 1I7RB 3FUDA 2ROXA 2VRQA 1T20B 2EDLA 2FWOA 3IAQA 3RNQB 2VM3A 1CZ8H 3FU9A 4EIGB 3PWLA 1IMHC 2DAVA 4JDVA 2WNGA 1RUAH 1W72B 1V3JA 3BIKB 4H88L 3ROLA 4AM0Q 2XQBH 4IDJL 1V54B 5FHAL 4U1HB 4FNLL 4G8FB 2KLSA 3M45A 3O8XB 5JOPD 1WFNA 1S3RA 3EYVA 2VE6A 4WLCA 5JW5B 1Z9SB 1B4RA 4FFZA 3LN4A 1C5DA 2K1MA 4GW5B 4GY4A 1KTLB 3QR0A 5T1LA 3V0JA 2HB0A 5FYLL 5DHYA 2QKSA 3WKPA 1MW3A 4ICWA 1XF3B 1RUPH 2NY6B 4HKJB 1IKNC 5CGYC 5JA8B 4OF0A 3VWKD 5AZ2H 1JRHL 3UZQA 4N8VB 3EFFB 3H9SA 1KY7A 3AG1B 3DBSA 3M1BA 3MLRL 3MJWA 4XB7A 3UAAA 4CDHA 4Y2DB 2KI6A 1CF1A 2R1WB 1ZIAA 2NLJA 3KPMB 5D5ME 2GJPA 1RU9H 5HDBB 5I16B 1BQSA 3L4CA 3HN3A 1WP6A 3TT3L 4QIRA 3GTTA 2GSIB 3KPSD 4MRCA 5DHVH 5EUKB 2BP8A 4NQDD 3VGBA 2ADGB 3BXNA 4B7IA 4AVKA 5B8CC 2YMXH 3LNGA 2G2PA 5F7EH 1P84K 2FX8L 4V1DD 3NJLA 2NXZD 5AKRA 4G80A 5DHVA 1GHFH 1W16A 3NA9L 4KI5D 3RWJB 3X2QB 1DN2A 5JA9A 3U0PA 1S5IH 4RGNC 2Y1YA 4JHZA 5H2BA 3IETA 3WUWG 5K9OB 3BIAX 4I2XA 3MREB 3REWB 3DO7B 5TFSL 3SYOA 3WKMH 4NCC2 3HA0A 5FV2A 3ES6B 2PO6C 3K8MA 4PJ7A 1QFWI 3LRHA 5F6IB 5FDWA 2VR6A 2IF7A 3UTTB 5G4MA 1JYVA 1G87A 1F3JB 4W9EC 2QQLL 4U6VH 1Q1PA 4YQXL 1P53A 1OP5H 4IRJB 3FFCA 4PCYA 1ZLDA 5C0RH 2HTKC 4XMTA 1ERNA 5DURB 3KR3H 5DMGC 3VXRE 3LXBA 1FQ9C 3FU5A 4QXVA 1BHGA 3NJNA 4LHUB 3V9CA 1HYSC 4GG8B 2EXSA 3OKDA 3OB8A 4MA3B 3CDZA 3OB0K 2D3LA 1JAEA 1IKNA 3TNNB 3OKYA 4G8EB 4HA1A 4JGMA 1WEJL 2ZX9A 3DRQA 3T4YB 4URKA 3AWEA 3QPQD 4PJDF 3BLPX 4OM0H 1HHGB 3D50A 1OT4A 2VDLL 1LDPH 4FQHA 4XVJH 2B77A 4MA1B 3OKMB 4F5CA 1IGYA 3DVGB 4KGLA 4ZUWA 1LE9A 4TLTA 3WHXB 1TCRA 4PRAA 4RETB 4NKMB 3SE4A 3VFMA 4OBRA 3FB5B 4AKQA 3HLAB 4HK3J 4J28A 2XYCA 2MOVA 5F7HA 2MCPL 4ZMXA 5B8CA 3F83A 1A4AA 2A73A 1Q9LA 5A16B 3RUGF 4FFVC 2XZCL 4KX9A 3KPNA 5L7XL 2NY3C 5IMMB 5EU7E 5I66A 2YC1B 3P40A 2ROYA 4NJAL 4U31A 4XMUA 3RX7A 3UPRB 5I19H 5HI5D 1Y6MR 5TE4H 1OOAA 4Z5RB 1ZSDA 4M1GL 2YD1A 1VEMA 1IBHA 3ARSA 3HR5B 3S96B 3IDIA 4NZJA 4HPOL 2YAEA 2PO6A 4XGZB 3WS3A 4BHUI 5ITFA 3GO1L 3ERXA 1XFPA 4WWKC 3MROB 3GBNL 1RUKL 4E41A 4OKVA 3O3DA 3OX8B 5FM5M 4R97B 5DK2A 5C09D 2R7EB 1U93B 1U4EA 2ESVD 1JP5A 2VMEA 3FFOA 4ZRGA 1AP2A 5MP6H 3WTSA 3EIFA 2MQGA 3B5TA 1IC4H 1MHPL 3ATAA 1Q9OB 2IOOA 1KCKA 4KY2A 1P7QD 3T6ZA 2YGVA 4ZTPH 5MI0B 3CDGB 4JFUA 3VXTA 1HEZA 4JBSA 5DJZA 3FYEB 2ZUUA 1NC4D 1YYLH 2VNCA 4N1EA 2WLNA 2OJZH 2IG2H 4G9FE 4R2GC 2N01B 5DZAA 5JORA 1WICA 4HOWA 3G5VB 4HKXA 1WFTA 2NNAA 2BHZA 3GRWL 3SD2A 3V5DB 3BZFB 3VCLB 1EJ8A 1MJ8L 4QY8B 4BFIA 1Y6KR 4NP4L 5AVTB 4ZSOE 5SV3A 4JN2A 4GSQA 1QLEB 3TS8A 2KLTA 4QJ5B 2FECI 1GJUA 1THCA 4P0DA 3ARTA 4M5ZH 2VITB 5HHPA 3LB6C 3MRRA 2F54A 3CIQA 3FT0A 4OCWH 5JIPA 2UYLA 1BQKA 2ED9A 2ITFA 4PJDB 4W4NA 8FABB 4MHHI 1QHOA 1CDIA 4GRWH 4JRYB 2X4UA 4KZCA 4UBDC 1WCBA 3VD1A 1NCCL 3L17A 5F6HJ 5GGRA 4P57B 4P3WA 1DVQA 1J18A 4MXQC 3VFVB 3RUGB 4ANWA 4WWKA 1OAKH 5CILH 3I6KB 4G83A 3Q6FA 3TCLB 4MASA 4K94H 4QXGH 5AL0A 5HHVL 2LTQC 1SBSH 1V27A 2B20A 3VNYA 4CADA 3U79A 3TNMA 1MAMH 1J8SA 4FQXD 1W80A 2OM5A 4DTGL 2X1QA 2PPEA 3QQ9D 2MPAH 1P4LB 2VR7A 3VFNB 4F33B 3ZE0F 2NY2B 1RZQA 1W0YT 4OIBA 5IEHA 1RURH 1S7VB 2Q87A 1CLCA 1N5AA 3HI1A 4BKLB 2CBQA 5I8EA 2RQ8A 4ZTOH 2W9DL 3M07A 2DMGA 2WJ5A 2LVCA 1EZSA 3CZJA 4Q9QL 1RK0A 5C7ZA 3VGAB 4RNRB 3V0VA 4ODVH 2MQ3A 4TQIA 4LCYB 4EN3C 1MY5A 3CCHB 1EANA 3L3OB 3ZSSA 1M6OA 4P3DA 3MBXH 5DVPA 3E2HC 3I2CH 1ZS8A 5IT2H 2LQRA 2ZG3A 2MCG1 2X4RB 4OCXL 1WTGT 4AEIL 2D03L 4H40A 3FW6A 3HKFA 3R1GH 4OSUH 3GLAA 2V5SA 3O2DH 43CAA 1MCCA 4JPVL 1JNLH 2BZ7A 4OZHE 4KDTC 3D34A 4AZ8A 1KCWA 1N3NB 1ZS2A 2XG5A 4L4TB 4A39A 4X7SH 3LKNB 3O2DA 1PQZA 4ZYKA 5I73C 4JL2A 3WFBL 3S3PA 1MFAH 4Q6KA 5DJDA 5KSBF 2GEEA 2HVJB 4K5OA 5J6HB 4KPHH 3TVMC 2BX5A 3ZKNC 1RAMA 2NY0D 1YEHH 4JO5A 5DUBA 1BX2A 1R17A 1F18A 2BNQD 4XNUL 3HE7C 4YGAB 3SDDC 3ASWA 4MB1A 1HL5A 1SM3L 2O72A 1AY1L 1YAIA 1FAKT 2W59A 1HSBB 2XWCA 4JG1L 2GT9A 3OHXC 1NLDH 2VXUL 3QZNA 1A4BA 2XPYA 3K72A 3QT2A 5ELIA 3DVNA 3EDDA 1BZ8A 3ARVA 1CLOL 1Q0YL 4LCWA 1IBFA 4U0RB 3OV6A 2OS7A 43C9B 3QG7L 1TQBB 4R8WH 3ZE0B 3VXSE 4F1ZA 2F5AL 3BEWB 4F91B 2IBZX 2JSFA 2CGYA 1GC1L 4JZJB 4OI9A 3G7TA 1FFNA 2PR4L 1YN6A 1VACB 4Y9FA 1QBLL 1INDH 5T3ZE 4NM4H 3B9DA 1WC7A 2YD4A 4I7ZC 1SOXA 2IIJA 3BEVB 1ANUA 1NJ9B 3H9SD 4L1BA 3D48R 1H3TA 3GSQA 4ELMF 2VTFA 4KDTA 5CHNB 4JKWA 3KLLA 4WFGE 1FDLL 4ONGL 4W68A 2DICA 1OLLA 1NBYA 3TC9A 1J5OH 2UY6B 4K9EC 3R0MA 3GSNL 1HHJB 4PJ9B 3WDHA 1VGKA 4PJ5E 1B0GB 1UWEL 4NKOA 6TAAA 2Z92A 2P8MA 6CGTA 2IH3A 3RIKA 3DGCR 1Z5HA 1QKZL 1TXKA 3TVMA 3MMEB 5DMJB 4Z7VF 4DNLA 4EQ3A 1E4XL 4GKNB 5DZNA 5LG6A 2L0DA 3KBFA 3HE7A 1CDCA 4JRXA 3LZQA 3SDDA 3S3JA 1I9RH 1AI1L 2QMKA 3IFPA 4LHUG 5DZOA 5KSBB 2Z4QA 3BPLB 3QIBC 4MDRA