2VERA

Structural model for the complex between the dr adhesins and carcinoembryonic antigen (cea)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
143
structure length
143
Chain Sequence
EECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGYWAKDNKQGFTPSGTTGTTKLTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFIMBRIAL ADHESIN AFA-III
publication title Binding of Dr Adhesins of Escherichia Coli to Carcinoembryonic Antigen Triggers Receptor Dissociation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 24
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2verA00
2JKLA 2JKJA 1USQA 2IXQB 2BCMA 1UT1A 2VERA 1UT2A 2W5PA 1RXLA 1USZA 2JKNA
chains in the Genus database with same CATH superfamily
1B4RA 3EJSA 1FFNA 4ZSOA 4QRRA 1XF5A 2K8QA 2CQVA 4JG1H 3C09B 4Z7UE 4ABUA 5IIEA 1KTLB 1EANA 4NAJA 1WQVT 3TBWB 4XO8A 3KL0A 4Y4FC 5IB2B 3EGDA 4AQZA 3BP4A 3LZRA 4KI1A 4PGZA 4K8RD 5L9DL 1CIUA 2FECI 2YPVA 4DF9A 5A3ID 5IWLA 1UQSB 4NYLA 3IFOB 1CZ8L 4KO7A 4OD1L 1AS8A 2GBUA 1A0QL 3PWJB 4D0BA 1GYAA 4ZFOA 2YHGA 1AH1A 2QQKH 2BIIA 4Y9EA 1JUFB 2WAHA 3SD5A 2FEJA 3CMGA 2DOCA 2FHCA 2Q0ZX 2P52A 3ESMA 2E5EA 4BRVA 3LB6C 3QUYB 4M61A 4BQ9A 2C9XA 1X5XA 1ZLSL 2FX9H 4RQQB 4JHAH 2WJ7A 4F57H 3S8FB 4IGBC 1YA5A 3FNKA 3BAIA 2A6DA 1ZHLA 5I18H 5CNHA 3CU1A 4C58B 4M8VA 1HHHA 3OKLB 3ZIYA 4IU3A 1PLAA 4PSPA 1CFBA 4OKDA 1NAMB 1QO3A 3PCYA 5F8RC 3JVGA 4M1CD 5E4IA 2EYSB 3E2HB 3KH4A 2WWOA 4FTVE 2ZWLT 4ZMNA 4MS8D 4FG2A 3TV3H 5FCUL 1CS6A 2LQRA 2VN6A 4WI8A 3K6SB 1PLGL 3BAEH 1P7KB 4J1UA 2NX5E 4Q4IA 1FNSH 5DHDA 1IKFL 5CIPA 4KBPA 1CGWA 1Z5HA 3MFGB 4MSWA 4DKFH 3SCMD 1E5CA 3POCA 3QORA 3SGJC 5C8JB 3PWUA 1TOXA 1Z1WA 1JPEA 2PTVA 4LE8A 5BO1H 2HTKD 1UM4L 3VFPB 1OCRB 3D25A 3KVQA 5GS2H 4QOKE 4EKXA 2DTML 2JI3A 2LOEA 1NEPA 3FF8A 1LYQA 3HE6D 3HZMB 1XMWA 4ZS6C 3GSQB 1WHPA 4MKMA 4DN4H 4DZBB 3MJ9H 5MHSD 4I2XB 3EH2A 3D69B 4JDTH 2ZCZA 4NWUL 1B90A 4P5KA 1CD1B 2ED8A 5GS2D 2FL5B 4PEEA 5CEYA 4NI3A 1KCSL 2VNCA 2BMKB 4FNLH 3U0WL 4HW6A 1TKWA 2ATPA 4P4KC 1SMOA 3IMRA 3AB0C 3L4ZA 5HVGB 1XD0A 2EDWA 4LCWB 4LL1A 5AB2A 3VFWB 3IU4L 4E41E 1SRDA 1BREA 4KJQC 3GSRA 2J5WA 4W6WB 1IM9D 1UKQA 1Q1JL 3GB7B 5LBGA 1AIFA 1LK2B 4JHBA 4RRPG 2UYLB 3WNKA 1LM8V 3L2LA 1JRHI 3INUH 4P3DB 5G2NA 1NDMA 4XP9L 1I1AC 4O00A 5ESQB 2B4CL 4YHZL 3BMWA 3BFQG 1C8QA 4AUYA 1FYTD 4MYWB 4XNUH 2VDPB 5BS0B 1QUNB 4ZO9A 1RH8A 3FB8B 1SHMA 1N2RB 1YEDB 1QPXA 2ZG2A 3QUKB 4XP5H 3DPDA 2EZ0C 2EDJA 1KWGA 4RIRA 2YZ1A 3JV6B 2E7CA 5DK2A 2QPEB 3D6GA 3D18A 4WNQB 2J8OA 1JVLA 2B5IC 4HGWA 3VWJA 2DLFL 1WK0A 4XPFL 3SDCB 3BVTA 2YOCA 2XN9E 5EZOL 4CA4A 4F8PA 3GI8L 5KN5A 1PQZB 5FW6A 3O8XC 1SY6H 2G60H 5FECA 4J27A 1LE5A 1Q9WA 2X4SA 2XTJE 5T5NG 1JPST 3VI4F 4QHUB 4L8CB 1RAMA 3A67L 4PGDB 4OLZH 4DTGH 1W8EA 1XSJA 3HG5A 4X8XA 2LTQB 2H2SD 1HL4A 4PRPD 4ZUWA 5BZXA 5FK9A 2H32B 5T33H 3X2QB 1I7TA 1LO3H 2NY5C 3WMSA 2W0PA 4ANXA 5SWZD 5JIDA 1M2VB 4H4NA 5I71B 3Q1SL 5IBUB 3CVHA 4TSCL 2W38A 1PY9A 3W11D 1IKNA 5B39A 5T3XH 2AEIT 3QJHB 5C0AD 2HFTA 4AGOA 3AWFA 5D71H 43C9A 3ZZQA 5TGBB 3ZJAA 2E7HA 2Y06H 1HI6A 1WZAA 4RBPH 1JFQH 1L9SA 2VR9A 5GSVA 1AQKL 1NGZB 3DC0A 1HYSD 4G71B 4WWID 4YWGL 3V9CA 1DDHA 3N1GC 2VDQH 4OVUA 1CURA 3L3DB 3KBPA 3NTCL 2CNZA 1CFQB 3NABH 2DIJA 3MLWH 1ORSA 4IKJA 1GYVA 4WI6A 2ZOOA 4MYPA 1VF5C 4K7PY 3WLWD 1BZQK 1KPRA 4CGUB 2XIIA 3TH4T 5FYJD 1KB5L 1QSEB 3EJQA 3AG4B 3FXIC 4O51B 4FQ1L 4B9GA 2OK0H 3HLAB 4M43H 2OP4H 4U3CA 3QUMA 3BCFA 4NQDE 3U48A 2X0VA 4WW1B 4U6YA 3TTSA 4FABL 3T2NL 3N1PC 5CBEB 3O0LA 3H9SA 3NGBC 1XSIA 1F00I 3F00A 4GIAA 2NNAB 2HJFB 2DQMA 3HZKA 3ATFA 4UYQA 1DBAL 3VB8A 3H6JA 2AEQH 5DD5L 4LNRB 4MNGE 1S7RB 1T7XA 4BFKA 5A2AA 2BFGA 1MRFL 1B2WH 2X4PA 4X0NA 1HILB 2RIKA 4F7PA 2ARJA 2Z1PA 3VE0A 4DCQA 4O2EB 3WCYA 3U36A 3NJFA 3MNMA 4XMWA 4G11A 1C5CL 2MKWA 4ZTPL 4JB9H 1J0IA 4TQHA 3E38A 4NUGH 3IJYB 5HYIA 5CD3A 5JXED 3T0EA 1FC2D 2DYPB 2I60L 3GS0A 2OI9B 4AMKL 3AROA 3KJ4C 5HHOA 3S3CB 4JO3L 3DX8B 1NPJA 2ADFL 3OXSB 2ZJSL 2VW4A 1G7LA 3U9PH 2E6QA 2W80C 1PCXA 2AP2A 4FCAA 4NQQA 4GAYB 2I9TB 4MNQD 4PP2A 3CNKA 1AXSB 1KELH 4S1DD 2J8HA 1K3ZA 3P2DA 1HWHB 3LQZB 4EXKA 2BZCA 3LS5H 4MJIA 1BZ9A 3RBSA 5CN1A 3C6LD 2FZ3B 5J3HD 2FO1A 1IQWL 3GFUA 5T1LB 2Z7ZA 2ENJA 1K8DA 1X7QA 4QRQA 5I19H 5I73C 2AQ1A 1A6AA 3QAQA 4H13C 2OX5A 4DGUA 4AQ8A 5EU6E 2B14A 3Q0HA 2M2DA 2AFNA 1XL4A 4XAWL 1BFSA 3VXME 4MMZC 5IB4B 5SX4I 5EORL 1BW8A 3V0DA 1UFGA 5C0CD 2BVUA 2J1WA 4N2HA 4YDNA 2MFNA 4X6DA 1HE8A 3MRNA 2DWXA 4KRPD 1M71A 1OGAB 1V10A 2R69L 3OMZA 4HC1L 4N2DA 3RL1B 4KJPC 5HI5D 4HWUA 3HCVA 3HI5H 4XXCA 3GSNL 4LEBA 4V1DB 3GSWA 1IEAB 4LCIL 1BLNB 3AQDA 1JK8B 1YN6B 2R56H 5IB1B 2Y6SD 2X28A 2EC9T 1BBDL 3P0YH 4YC2C 3K5RA 4PRIB 1NCCH 3VFSB 4GKLA 4WV1B 5JPNB 5MEQA 1G7JA 1BX2A 1AFVH 3TX4A 4WWKA 1BFOA 4ONOA 3P30H 2BCKB 4BSVA 1F90H 1CLYL 5E9AA 1FZJB 4LP4A 1WAAF 2E27L 3GRWH 1DR9A 4Y5VC 5EN2A 4POYA 2X9ZA 4EBQL 5I30H 3F7VA 1DVQA 3I02A 3ECUA 4EXPX 2ETWA 3C08L 2NY1B 4JDVA 1RIUL 2PO6A 4PIBA 1W72B 2Y1VA 4O02L 4OLYH 4L4VB 3S6CA 3WEXB 3BQUD 5BNXD 3T3MB 2X4RB 2DYRB 1TTBA 4O4YL 1YEJH 2P5WB 4OJDH 2FJGB 4PV9B 5DJAB 1WIOA 4WLCA 1PNCA 5FLUA 1SN2A 2CDFA 3QUYD 4CNIB 4WW2F 1NAMH 3HLKA 3MRIA 3KW8A 4HUWB 1MRCH 4JQIL 3LMJH 4PG2C 3WKNA 1JP5A 2IAMA 3EGXA 3HNSL 2PR4L 1M9WA 4KAQL 1ZT1B 2QR0B 5DF0A 4A66A 1GR7A 3MRFB 5FW7A 2JJUA 1UWXK 1W0VB 3S3JA 3EADA 1T1XB 1ZVSA 4DGYL 1BQHA 1JV2B 2ADIA 2NNFA 4L5FL 4ZPVA 4PCKA 2IMMA 4P9HH 1E3FA 3CU7A 3ZXAC 2NCMA 1G9NH 3NP4A 2FLRT 4P57B 4HMEA 1YY9C 2G75A 2WXMA 5EOTA 4FXGA 4PYHA 3EOAB 3PRZA 4WIQA 3VJ6B 3M07A 15C8H 4F2EA 3FB7A 1DANT 5JLZA 3ARUA 3ROOB 1VADA 3QHFH 2K4AA 5HVWA 4TPRL 3ULVD 1UH2A 4BUHA 1OAKH 1NCWL 4OFYA 3CN2A 1AGDA 1IQDB 1KPVA 4IMLA 4FFVD 2IQ9L 5D7HA 2HUHA 2Z8WC 5EPMB 4D9QD 1CFSA 1JNJA 5KJRH 3ISRA 3QYCA 4WU7B 5C3LD 4RGMB 1D5IL 3APMA 2Z92B 3RZCB 3WKYA 4L1HA 1UCBH 3IDYB 4GO6B 2WSKA 2R0KH 1DQDH 2VJ0A 1RY7B 3QHTC 4IIZA 1F4XH 5F88A 2DIEA 1JGEB 4K3JL 2X40A 4N0UA 1CB4A 3CIQA 5KSAB 2FAUA 1LK3H 1S9WA 2OJZL 3KPPB 2DQHL 3H8NA 2WP3O 2Q7AA 3MOAH 1I9IH 4XP4L 4C83A 1DCLA 1DLHA 2O4EA 4PCTA 1E5BA 4G8GE 3U1PA 3BKYH 2WPGA 1UB5A 1F4WH 4J3VA 3CBKB 2E75C 4U1MA 3B3IA 4YVNA 3AVEA 3MV9E 2CIKA 1A7QL 1G9ML 1HNGA 2FE0A 3PWVB 3SCMA 4WK4B 1AQDA 4ZO8A 2ED9A 4HXAL 5T1JA 3IS1X 1TMCB 1DSFH 4YSEA 4GRLB 1OGPA 1QMUA 4AEEA 2HUEA 5B4MC 5BS0D 3S96A 2B9AA 3BUYA 1D5MA 4QJ4B 1KG0B 3GKWL 3HC4L 2GEEA 1GAFH 3HE6A 5CEZH 3E3QE 3DIDA 5LCVA 4WF7A 5LAXB 4PUBH 3GTTA 3LPPA 2PYFB 4P5SA 3IFNL 1E6OL 1R5IA 5F72S 3OKDA 1JGLH 1P7QA 2V4LA 4G6JL 4HT1L 3SDXB 3V10A 1JYXA 2FX8L 3KW7A 3SDCD 3MYJB 4HJJH 5KVFH 3LXAA 4HWEL 5CEZD 1HDMA 1TCRA 3OKNA 2VDNB 2CGRH 4YPGB 4Y9FA 4IBZA 3MJ9A 3WDIA 1YC8A 1HOCB 1HSAA 3TYGL 3WO4B 3T1WA 3FUIA 1UA6L 1IM9A 3A4EA 3F3HA 3IXAA 4M5TA 3KYNB 4MJ5B 4QEGA 4OZIE 4PJ5E 5FM5O 2VLRE 4PJFE 1MHPL 1RZJH 5ITFB 2EVHA 4G5AA 4U1IA 3P73A 2A9NL 3K6DA 1BQLL 4HDIB 3TH2T 1MFEL 3HZVB 3K80A 5FKPA 1MW3A 3FCSB 4DKEH 4MDIA 4BRJA 4IEFB 3CVIL 1GJUA 2FO4B 1E5AA 3P4NB 1ZA3B 5AZ2L 4R7XA 1NUFA 1EAQA 4N8VB 3C6SA 5SX4H 3CZNA 2X70A 1TFHA 3LEYH 4KI5D 3AXLB 1MY5A 2MIZA 4Z0BL 3RHWF 1GS6X 1VERA 1A1OB 1S7UB 4N8VG 1T5KA 3BEVA 1D5ZA 3LRMA 2RR3A 4QYOB 1OD7A 1NPNA 5ETUB 3LHAA 1FO0A 5HYQA 3GZPA 2CHXA 2R29L 2VDRL 4QNPE 5L8JB 5DJYB 4OH2A 1AD0A 1YEKL 3FHQA 5KANG 1GTNA 4C56E 4FQQA 2WQXA 2R0LL 4Q6IB 3L5WA 2NY2C 1PG7W 3L7FA 2PUQT 1QSED 2WBJA 3LRSA 3MLVH 3QIWC 4P2AA 1LEKA 2WIIB 3TPUB 5KAQG 2IDCA 1VAHA 2VDOB 1H0DB 1KC5L 1N8ZA 3A6OA 5E2JA 5SWZA 5TQ2L 1HU8A 2GK0B 2VC2B 3WHE0 1KTDB 3PUUA 2DMGA 5BRZB 1EHXA 1WGVA 1X5KA 3FTGB 3KPLA 4A2FA 1RPUA 4XTRC 3VRIB 3ECVA 5T1DL 2OTWB 5JHLA 1J0HA 2F53E 2OCJA 3MRQB 2XN0A 3F01A 3GINA 4J6RH 4S2SA 4XVOA 3UO8B 3MX0A 1U8OA 2F8IA 1EHLL 5DUJA 2BK8A 4XVJH 4AYBA 1IU1A 2XPYA 3LRKA 5KW9L 4PGBB 4UDTB 5GGSY 4PTTB 4I18C 1RZGA 5C0DA 3MZGB 3KPOB 3KPRB 3AITA 3NN8B 5B1JC 2R8SH 1S7XA 2Y9RT 3WKML 2NYZA 3Q01A 4GP5B 3WTXA 3DX3A 2LVEA 1J9SA 2DYPD 2J4WL 4GKSB 4GXVL 5D1ZA 1I8MB 2F61A 2ZUXA 1OQOA 3R4RA 2W07B 2ZX6A 4KO9A 5JW4Q 3RY4A 1FYTE 3NQIA 5C08B 4HWZB 5D2NE 3KLHD 1TVBB 4CVWA 3ZKNC 1N4XH 1ITCA 1YQVH 1ZWIA 2P8PB 3J07A 4FKHA 4GG6F 2VM9A 4HQQH 3MODH 5FWQA 5IB5A 3JWDC 1IM3B 1KN4H 3T65A 4JQXC 2NQDA 4XGZB 2HRPH 1JBJA 2IPKB 4E36A 2QQQA 2DQFA 5T1LD 3D85B 3DV6B 4HISA 4AV5A 5AB1A 5KANI 5ENWA 2C3VA 1WPCA 2F8XC 1I7RB 1MPAL 2B0SH 2BNUB 1ZLEA 2AW2A 5T3ZH 3C8KB 3QNYA 1JFHA 1OM9A 5DRXB 3C2AL 1A4JA 1UENA 2BX5A 5A6LA 2NXYC 3EYVB 4Z7OF 5D7SL 5FGCE 2F1EA 1GH7A 3BGAA 2NZIA 1OGAD 3OSKA 3PWPB 2A9CA 5DGQA 2YMXH 4X6CA 2CLVA 3C6EA 1J8SA 4V1DD 1TEGA 5T3ZD 1V3MA 3FMGL 3IEAA 4XMKL 4GMTL 4UT6L 3IDMB 1CR9H 4H8PA 2A1WH 4H88L 4Q52A 2Y2WA 3QZWG 4DP4X 4MNQA 3WNOA 5LGHH 1OGTA 4PRID 5CWSB 3KHQA 2IQAA 1FSKB 4FXTA 3CHQA 3U0PB 3UTPD 4PV1C 1XCTB 1W72H 3FT4A 1SJHB 2PWEA 1NCDH 1D6VL 1UD4A 2DBJA 1KXHA 4RNRA 1U41A 3C6LA 5JHAA 2AJSH 2DF3A 3MLUH 3MR9A 3GMNA 3OGCB 4MQ7A 3S3BB 1S5IL 3PFQA 4LGRB 1W16A 4KK9D 4UILL 5T3XE 1NWOA 2B7DT 3OJMB 3M1BA 3PXLA 2R4RL 3QJSB 1KYOJ 1ZPUA 4NT6A 4PJXE 1NDGA 2EDYA 3B56A 2YGOA 5KG9A 2C1PB 5GS0L 1HAWA 3AS1A 2NY1D 3V5KB 3AQYA 4TVPL 4N2EA 3OWRA 2A0LD 4TSAH 1KGCD 4L4TE 3E9TA 5EU5A 3RWCB 4E42A 2W81C 4L4VD 1KIPA 2MEJB 2FX7L 5D1QE 4I9XA 1A7NL 5TK4A 5C0CA 4FKKA 3IYLW 5E2TL 3DX0A 1X7TA 1SBBA 2J5LC 4LSSL 2P5WD 2DQUH 1KBPA 3KYMB 1AYOA 1ZTMA 4B3EA 5C0JA 1B0IA 1KFGA 4KXCA 1ZGLB 5F6IB 4OCYL 4NO0B 1A6UL 2DTSA 1MKFA 2A6IB 1C08A 4PIRF 3FL7A 1T4WA 2X42A 4XCYA 5AZEL 4MB1A 3ASOB 5GIRB 4URKA 5AOIA 1TCMA 1U92A 1GL4B 4MFHA 3KMDA 1FLRH 1KCVL 2QQLL 1C8PA 1WBXA 4BZ2H 5HHQB 1UWFA 3EYFB 3BUBA 3HC3L 3HUJA 5DZNA 1IGJA 4IRSB 4NXKA 5F70A 3RGVA 4IRJC 2QVMA 3RP1A 2X6MA 1XBRA 5E8DH 4XCNB 1KTLA 4MJHA 4X4ME 4PJCE 3TBWA 2V5TA 4XCFH 3L6FB 5HHME 1MCBA 1OOAA 1UA7A 3QC5X 4HSCX 3TT3L 4X0KB 5FM5M 1UQSA 3VA2C 3ZQWA 3IFOA 5DU7A 4CBPA 3IN0A 4KK5D 2XZQH 2VXTH 5C0BA 1G7HA 5GRYA 2W60B 3QG7L 1GW0A 1KLGB 2WB1A 4WWPA 1UVQB 3PWJA 2E8YA 4KNTA 1YEEL 2LVCA 3ZE0F 3MRGB 5K69A 1JUFA 3O81A 1TJGL 1CQKA 4UF7C 3RDTB 3U79A 3ZRCC 5CGYC 3QUYA 4BYHA 1EK3A 3VX1A 4IRZL 4EIBA 2GY7B 3SGDH 1FE8H 2QLVB 4ETQB 3RZCD 3SO3B 1LE9A 1N0LA 3VD7A 4A7UA 4AIEA 1YCSA 1Y1UA 4WEUD 1YAIA 3OKLA 3EFOB 1IGFH 2IG2L 4M7ZB 4Y5XA 5AVYB 3UTZB 3WNLA 5KSAD 3RVUD 1N7ML 3S8GB 1G9EA 3CZSA 2EYSA 5FYLH 2I5YH 4MAUH 5I1AB 1YPZE 3MGTB 5C7XH 5KYUB 5CINL 1MWAB 4YE4L 4JFEA 4AK2A 1IC5L 4XPBL 2YAFA 2EDTA 2AQPA 3K6SA 4I0PA 5FHAH 1P7KA 4C55A 2NXZB 5ES4B 4ZAKC 3VNYA 4NM8L 4O2FB 4M56A 3RWEA 4P49A 3VI3B 3QZOA 5G5DA 4EDWL 5C8JA 5CZXD 2UZIH 1MAML 2BRRL 3BT2H 5HI4C 1UT9A 5HYSG 1AGBB 4GRLD 5FYLD 4N1HB 3VFPA 4CMHB 2B1HL 2J73A 4ANVA 2EVGA 2JKTM 2XBTA 3TFKC 1TT6A 3HZMA 3NT0A 5TQ0L 2HSIA 4UOZA 2B9BA 3BPNB 2VDNH 1SOQA 3BH8B 4Q0XH 1ZIBA 5I9QC 4JFVA 3TJHD 1CK0L 3MXWH 4I2XA 3VW3L 1DP0A 1I8IA 3D69A 4FG4A 4B50A 3TZVB 3NA4A 4NZTH 1SBSH 2EC8A 3CFBB 1BXAA 3QFGA 3WN5C 3N1FC 3RPIB 2BMKA 3BT0A 4LSPL 5DLML 3MLTB 3WLBB 3PAZA 3II2A 4LCWA 3VFWA 1NGQL 3A4DA 4WEEA 3TBBA 2ED7A 1JF1B 3DRQA 5EO1B 4W1TA 4HCRH 2A77H 5EEUA 1ID2A 4NCDA 3GB7A 3V0AC 5JW3H 1LK2A 1SDAB 1MFCH 3T6QC 2UYLA 5D55A 1IO4C 4QXTB 2H2PD 2Y22A 5I1IH 3WNIA 2A74C 1MNUL 1UYWH 1DBBL 2AI0H 5D8JL 4YNYB 1VGKB 1BXUA 1RU9H 1IUZA 5ESQA 3RAJL 1HNYA 2KBGA 3A47A 2DZEA 4NKQB 2I7OA 4HJ0D 3GMLA 3REVB 2BH0A 5BS0A 4OGXL 2ZUVA 4Q9CA 2ZQKA 3V0VB 3FB8A 1QACA 1R33A 1N2RA 1YEDA 3MRJB 1VRSA 3MV8E 3QUKA 3T5WA 4WNJA 1YMMB 1CD0A 1R4XA 1P5UB 1IE5A 4IBQA 4KKNA 4WNQA 4ZUVB 5C1MB 3PF2A 5DJCB 4DGIL 1I82A 1ERNA 2Y7QB 3SDCA 1HK6A 4GQRA 5HJ3B 3WIHA 1PQZA 2HP4A 4FP8L 5A7BA 1XD1A 3OX8B 3QIUA 1OO2A 1OIOA 2VC2H 2VQUA 1MDTA 5D70L 1NA8A 1GJIA 3UBGA 4QHUA 4PGDA 1PAMA 5E00B 2L0DA 4NHCL 1OCWH 4PLJD 3B1TA 5TTRA 1WYJA 1G0YR 1JZFA 4K94C 2WLJA 3T6VA 2J6EH 4HUVB 5G4MA 4F7EB 2H32A 3LTVA 4PJAB 1I8LA 3BJLA 5FYJU 1INEL 3VG9B 4D9QE 4X5RA 3PUCA 4J3TA 4WU5B 1DLFL 3W0WB 5BRZD 1RIVL 3MUZ1 2O5YH 4LFHG 5EZPA 5ALBH 3S35L 5EFIB 3CFMA 4UZUA 4KTGA 4XPAL 3RUGE 2CCWA 4H40A 2ZXBA 4BFEA 1G1CA 4X9GA 3WE1A 4WY7L 2VXUH 3AY4A 1G87A 1OARL 4NERA 1NGZA 2GCYB 4DOHE 1WAEA 1QSZA 1FRGH 3OL2A 4QHLB 4FQCH 1FGVH 2MOGA 3JTTB 2VMDA 4XNMA 1J9CT 4H8UA 5F0LB 1NIBA 1KJ2B 1R5VB 4AC2A 1CFQA 4KC3B 4KKLC 5LLIC 2NZ1A 4EUPB 4R6UA 2VUYA 2JF1A 1U2HA 4Z7VA 4H0LC 4AWJC 1FFRA 3EH4B 4OY9A 5C08D 4X6DF 4YEFA 4XWOC 3ZKXC 3P4LA 5CAYB 3C2SA 3MLZH 3K1KC 3A22A 4O51A 4HOMA 3OBAA 4NO3B 3HLAA 7FABH 1W6LA 3NZSA 2X3CA 1GHFH 3EDFA 1T7WA 4CC4C 5CBEA 3TV8A 4KKZA 3AXHA 2VAAA 4AL8C 1MCRA 1KBVA 1EJFA 4GNKB 3K2KA 4MDJB 2NNAA 2HJFA 3D85D 3GMRB 1Y1DA 4WGWB 4JO4H 4TULH 1CLZL 4AXWB 4JG0L 3ZTDC 4LPCA 2XC8A 5CEZE 3EH5B 5D93C 4LNRA 1S7RA 1KCUH 3GHEL 4FYSA 2Q87A 1B6UA 3SE3C 3CLFL 1T83C 1HILA 4GSDL 1HAUA 2WVUA 4FNUA 2YXFA 1UT2A 3JWNC 1E65A 4O2EA 2X2HA 4PCYA 3LQAC 4Y9GA 4EIZC 3UYPB 1KCRH 1ZPLA 4BQCA 2AXWA 3Q6FB 5CMAB 3PWPD 3T2PA 2JLLA 1PZDA 4UQIM 3QNZB 2EKJA 3ZGHA 1J10A 4LLVA 4OZGB 4Z3HA 1J5CA 1TENA 3OXSA 4P07A 1KENL 2XBZA 3QI9B 1TU2B 2BHUA 4NN6C 4OCXH 2I9TA 3LEXB 1SLVA 4L8BB 3ME0B 2XDHA 3KBFA 2CBMA 4I4WB 2FGWH 3N0AA 5TK2A 1W0YT 4KI5E 3LQZA 2KS0A 2YEVB 4GAGL 4Z3TA 4MCZB 4FA7B 2XJKA 4JY6B 5FWRA 1A7RH 2FZ3A 4OW6A 4OI8A 2A9AA 5AVVB 3KL5A 3HAEH 4MD5B 1YN7B 4YGVA 5TF0A 4P06A 4TSBH 5F7NC 4Z3FA 4QHNB 5JMOC 5IB4A 4N0FB 5CD5D 1QSEE 2XA8H 2CDGB 1PZ2A 1RPKA 3ILPB 3LD8B 3N3EA 3CIAA 4FQ2L 3A23A 3RL1A 3O3UN 1UC6A 3TEYA 1I53A 4A37A 5DURB 4LEXH 4JY5L 2PW2B 4V1DA 1IEAA 1YEFL 4NO0D 2WZPD 4PGCA 3UJIL 1BLNA 3FU9A 3BP7A 3QJUB 4RDQF 4FFYL 1JK8A 1YN6A 2WLNA 2YPKA 1CDBA 4ZT1A 4YHOH 3BAXA 5I1GH 3THML 4G1EB 4HIXL 4RWHA 3HMXL 2AC0A 3VFSA 3EHBD 3AREB 4WV1A 3EJYD 2H6PB 2VJ8A 4ZNEA 1TETH 1RMFH 5C92A 1IC7H 3CFKB 3CXHK 5EOCH 2XPZA 2N4IA 5DRWB 1KUMA 4IRSD 2APBA 4YE0A 1CDIA 4JM0A 1FZJA 3VVWA 2WYTA 3G5YB 4AKOA 4R83A 2MPAH 3LJ3A 2KLRA 3ESPA 4J3OF 5DHVH 3U30C 1W72A 4J4PC 4L4VA 2WCSA 1YEIL 2PR9A 3ZTNH 4O2CB 1JAEA 2Z8VC 2G0KA 2QVFB 5TFSL 4OZHE 2GHZA 4ODXB 4YSAA 3OKKB 3BLKA 1O7DC 3P4OB 5KYWB 5GJSL 2P5WA 1SEQH 2FJGA 4QAWA 2LU3A 3PL6C 4PV9A 5DJAA 2N7AA 3QDAA 1QPKA 3IVKA 3LRHA 5KSVB 2DQEH 2O26U 5L0QC 4CNIA 3VTAA 4X7CC 4D8OA 1QBBA 4JO2L 5IEHA 4GSUA 4TQEH 1ZLWK 4Z3EA 2PCYA 4DKDC 1MWAH 2R2CA 3CFNA 4PD4K 1QABA 2QZ5A 1WFMA 3T8XB 3PY9A 3L48A 1XF3A 3X14A 1UD3A 1ZT1A 3DLQR 4G80B 1QLEL 2QR0A 1O6TA 3MRFA 3VXRB 1P6AB 1PX4A 3B8SA 3QJXA 1OGAE 1W0VA 1AO7B 1T1XA 1FVDB 3CSYB 1JV2A 3CHOA 4UBDC 5F97E 3QJTB 1WIUA 3U9UB 3B5GA 2EDLA 5T3ZE 2NXZD 2UXVA 4FNPA 2HFGH 4P57A 3FULA 4IOFD 3J2PA 4MRCA 5ADPL 5K9QG 3AU0A 1Z0NA 1RZ8A 3V52H 3EOAA 1U8JA 2IH8A 1DYZA 1BP3B 3VJ6A 4OCWH 4PRIE 3ROOA 5D1QC 2GITB 2J57A 4NZUL 4BWTA 1M9SA 1T2QH 4XMLH 4KOBA 1MF2L 3LVTA 4BQ8A 2ZOTA 4ODUB 2X2UA 5GGTA 5EPMA 1U4EA 5LJYH 4Y19E 2D7MA 1KF9B 2HLAB 4JFHE 3ZE2F 1QD0A 3GUFA 1NUNB 4WU7A 4BINA 2NY5L 2Z92A 4N0YL 4X7TB 3TZVD 5D7IA 2AABL 2C9QA 4DPAX 3N5AA 3HG3A 4U1JB 1CL7I 4FYQA 4ZD3L 5EZLB 3SDYH 5EF1A 3VACA 4XZUB 1JK9B 3SKUD 3F65A 1JGEA 3VMOA 1NOAA 4X9HA 1EJ6A 3T3ME 5INDB 5E51A 1YEGL 4W9IC 4ELKA 2K7QA 4PJ7A 4DP0X 1VGEH 2R4SH 4FQLL 3NG5A 4MHHG 1EPFA 1NM4A 3MBEA 5JIIA 2Y24A 4WCYL 4CMMB 3QSKB 3A3YB 1HZHH 2FLBT 4F8OA 2HH0L 1RZKL 4NBXB 2DWTA 1A3RH 3PWVA 3TF4A 2J2ZB 1L7IL 1Y6MR 4Z7WB 1GIGH 2R9HC 3M8OL 4GRLA 1YYLH 2VDLH 4TUOB 4Y9BA 2BP3A 3V0JA 1VB9A 2J7LA 5LAXA 1YMMD 2F74B 2PYFA 4UM9B 5L7XL 4TF4A 2CBOA 4F24A 1KY7A 4D94A 3M7FB 4NX0A 3SDXA 4W81A 3JV5A 3MYJA 5CJBA 5KBNC 2E7LC 5J1AB 4WDIB 5K9QI 4PJ9B 2MNUA 3NJMA 3QXAB 2AXFB 4OQTL 4WK0B 4YPGA 3CQPA 2ZWNA 3C60C 2YIHA 1CZ8H 1SF3A 5HGHB 1BG9A 1HOCA 5HDQL 4NZJA 4OD1H 5A16B 4FFWC 1GZHA 3KYNA 4XVUD 5DMGC 2YD2A 1BVNP 2FBOJ 3WHE1 2ED6A 5ABDE 1QSFE 3BZ4B 2XI9A 4YBLC 2EXTA 4HDIA 5FA3B 3HZVA 3W0WD 1OZTG 3FCSA 2BNRE 2J8UE 1KBWA 3OGOE 3UIZA 3W82A 1HJBC 2FO4A 4HCRA 5IROC 1DVZA 4EUPH 1Y18B 1AAJA 2W65B 3FW6A 4N8VA 4FL4C 4N5EC 4P23C 1CICC 2E4TA 4RA0C 1KGYE 1IARB 4X7EC 1A1OA 3HI1B 4EDXB 1S7UA 1X4ZA 5FYKD 1TJIL 1X5YA 2PP8A 4AEFA 5K9KB 5FCUH 3PAVA 4QYOA 1IAIH 2Z91A 4LASL 1PLGH 4DUXA 3I50L 5ETUA 1IKFH 2EEDA 5I1DB 2OMUB 5DJYA 2B3RA 5DR5L 2WYHA 3SQRA 3KBHE 3ZHFA 1MCOL 1NMAL 5FYLE 5C9JB 4GO8A 4Q6IA 4G7RB 3VG0L 3MKKA 4OBSA 1PKQB 2WIIA 3TPUA 3MCLL 4X6CF 3NZHL 3PS6A 1S7SA 1H0DA 3EYUL 3GK8H 1KZYA 3CFDA 2GK0A 1KTDA 5BRZA 2WNWA 3FTGA 4IIQC 3VRIA 4I77H 2BZ7A 2OTWA 4NWUH 3QHZL 1KEML 3MRQA 4RMBA 2ADYA 4G70B 3V2AR 3HVNA 1LWJA 2D3VA 1F11B 4OLVL 4D7BA 2AEPH 4HMDA 3VXSB 4KDTC 1KCSH 4LCYB 4YAQB 3U0WH 3O2WL 4Z76B 1FZKB 4HWNA 2D9QB 1NLBL 4PGBA 4HG4J 3PAUA 2K3TA 4PTTA 2YK1L 5AG8A 4DK3A 2X5PA 4MQXD 3S0PA 3IU4H 3KPOA 2OMNA 3KPRA 3QPXL 1TTRA 4L8DB 3NN8A 3ASWA 3P3UA 4MAYB 2Z31C 4GKSA 2HKHL 2QL1A 2ZF9A 4HP5A 1XX9C 1LO2H 3ASNB 1I8MA 1WC7B 2W07A 4XP9H 2X88A 3L4UA 2B4CH 3H3PH 4HWZA 5CILL 3QI9D 2B3IA 3EDKA 5DO2D 2IDQA 3LX9A 1S4IA 2P8PA 3MXVL 4EN3C 5JUEH 4N9OB 1T0MB 4K3EL 4LU5L 5LXGL 5DQDH 1J86A 1IM3A 2OR8A 4N2GA 4X99A 1BMZA 4Y2DB 1KFAH 3QDHA 2FJSA 3IS0X 4XGZA 4XOAA 5C09E 4BUGA 2JCCB 5KS9B 1OHZA 2IPKA 1UKSA 4K5PA 5F21B 3D85A 3DV6A 4XPFH 1WE5A 1D9KB 5EZOH 1H5BC 2YZ8A 4K4KA 4E68A 1BPLB 1I7RA 3MGOB 3WJLC 4Q97A 2BNUA 3FSVA 4ERSL 1EJOH 3C8KA 3EXJA 3TN0D 4M3JA 5DRXA 3BO8B 3B2PA 1R24B 3K46A 3A67H 1Q9KB 4NKMB 3H7LA 3VYPA 3G08B 3EYVA 3VGBA 1AY1L 1SOSA 3HB3C 1OSEA 2Z4QB 1GZPB 3ZDYE 1U36A 3PWPA 1HKLL 3BAYA 5DURD 4NJ9L 4B27A 3NEEA 3ZYOA 3V7AG 3FQWB 1L9OA 5J6HB 4FZEL 3Q1SH 1LO4L 3LPOA 1N67A 3QEHB 5EF3A 4TSCH 1TG8A 1J8HB 4CADB 3IDMA 2DD8H 1G4MA 4L37B 1RFDH 2XN1A 3Q1EA 4HSQA 2JJTA 5CWSA 4MXQD 3ARED 3U0PA 4RGNE 1UT1A 2OSLA 1XCTA 1TUPA 3ZE1F 2WGNB 1SJHA 4R2GB 1AQKH 4Y16B 1P0SE 4YWGH 2IV9A 3HE7C 3IK2A 3OGCA 4C4BA 1DQJB 4PJ8C 3H53A 5AW6B 3NTCH 5ADOH 1HYRC 3C5ZB 2C1PA 1E67A 2DN7A 3U1QA 5JHBA 5D2LB 3V6OA 3KH3A 5F6HI 1CXIA 2NY6C 1CL7L 3RWCA 1OTSC 3LKNB 5C08E 2OJEB 4YBHA 3A21A 5EZJB 4OLUL 4YDMA 1EDQA 1ML0A 5L4MA 1KB5H 4ZUUB 1GSMA 5B3JF 3KYMA 2NTSP 1JI1A 5BUAA 1NGYB 4FQ1H 1TNNA 4CSSA 2EYRB 3CLEL 4OGYH 4ELMB 3K6FA 2CNYA 4LVEA 2W9DL 4OD2B 4JGUA 4NO0A 3IJHB 4OGAC 5AKVA 4OLXL 2WZPA 3RPBA 1IZKA 3T2NH 3PP3H 2A6IA 4FABH 5J11C 5FV2A 2JQMA 4ODWB 2N3JA 5GIRA 1DQTA 3ULVF 4KDWA 4GUQA 2CIIB 1DBAH 3UZVB 3K3QA 5HHQA 3MOQA 1MCJA 2FB4H 2EKSB 2AJ3A 5DD5H 3VSUA 2VJXA 5KBDA 5D1XC 4Z6AT 4JFDB 2W8CA 1MRFH 4NKIL 4K5LA 4MMXB 4UAHA 1E4XL 4AE0A 2ICEB 4IRSA 1IZJA 2Z9TA 2H1XA 3DOSB 1AO7D 5DJ6B 4XCNA 3ARWA 4XRCB 2Z1KA 1C5CH 3L6FA 4X4KA 1BGXL 2WWKO 4U2ZA 3SBWC 1E27B 4DPBX 1IMHC 4QRPA 4AM0Q 5ID1B 1OT2A 3P1VA 5K9JH 4X0KA 3HBPA 2I60H 3BUQA 4XBEL 4AMKH 2B77A 1MXGA 4JO3H 5MEOB 4HH8A 3FBQA 3X3FL 3SE8L 2ADFH 3O2DL 1C9SA 2W60A 2ZJSH 3FKUS 3DETC 4FXKB 1KLGA 1NIDA 3U2IA 1UVQA 4HD5A 4MA3B 4B9JA 4XI5D 3MRGA 1PSKH 3WTTA 3L54A 1CUOA 4OUUA 3RDTA 1JGIA 3T8MA 5JW4N 3QCTL 4J6IA 2QZQA 4WK2B 4DP6X 4TTDD 1A4BA 1BFVL 4PJHB 4U1HB 4UU9A 1RJLB 2JJSC 1NQBA 5D7KD 4YXKL 3PQYE 3STZB 4WW2C 5F8QC 5LG6A 1ZVHA 2Z7UA 2APSA 1KBKA 3EFOA 4XAWH 3RI5K 1T89A 3UTZA 3BUDA 2OW7A 4N9GA 5T5NF 5I1AA 4FLQA 3MGTA 4XB3A 4YEEA 1JSYA 2P9RA 4EZJA 1MWAA 1IGTB 2JKLA 2R69H 4HC1H 4CGTA 2O5NA 3DOHA 5HYSA 1JG9A 1BQSA 4XHJC 1Z9MA 1WT5A 4LCIH 4M6ML 1QSVA 3ZW3A 4NEHB 5AW2B 3LDBC 5I17A 1AHWB 4P5TA 1QEWA 1AGBA 3M88A 3MUGB 2O6PA 4L1TA 4Z77A 2YD6A 2EAEA 1A9BA 3OAUL 1NOLA 3BH8A 1FWXA 4UM9D 3EO1B 3T9WA 1M05B 3BKMH 4NRXA 1CLYH 4KMLB 3RIKA 3JZYA 2B2XL 4ZFGL 5TD4A 4KXAA 5JYLA 2EDDA 2E27H 3M86A 4EBQH 3CFBA 5BUGA 2CR3A 4PJ9D 1HT6A 3FUKA 3RPIA 3GMQB 4LSVL 5AVZB 4Z3IA 3LNHA 3C08H 1E4HA 4KHTL 3MLTA 3WLBA 4O02H 1RK0B 1I9EA 5E1HB 1A5FH 1UM5L 4LSRL 4KGJA 25C8L 1P7HL 5F93C 1MCPH 1QBML 4QXTA 4YK4B 4LDCA 2R7EB 3A6CL 4Z7VF 4YNYA 1VGKA 4XNXL 3UTTB 4WSJA 5I75C 4JQIH 5L6YL 5HYJB 1VACB 2MCG1 3Q6GL 1OCOB 1E6JH 2FQEA 3REVA 5M94B 2FT8A 2X89D 4RH4A 4HKJB 1QUPA 3V0VA 2IDSA 2CLZB 3HNSH 3VXTB 2PR4H 2WM0A 2XFGB 3ARDA 4JFQA 3WIFB 1YMMA 4NJAL 3BUTA 4KAQH 4QRTB 5I15H 4NC0B 3MOBL 5B1KA 2YSSB 1P5UA 4PS8A 2OYLA 4XOCA 3DVFA 1O7SA 5FAAA 3V79C 3JWDL 4XO4A 5DJCA 3UBXB 2CRYA 1J1XL 4YDKL 2Y7QA 4DGYH 4NUJB 3NZUA 4WSGA 1MFDL 3BJ91 3OX8A 3VI3E 3UYRH 1ADQA 2AQNA 3FK3A 2Z8RA 4TNFA 4Y2LA 3VRJB 2FUQA 1G6RB 5SV3A 1CGXA 3V0GA 4NXSA 5D5ME 5E00A 5BRPA 3TEUA 3VGAB 4Y9CA 1F18A 4F2MB 4TPRH 4N2CA 1NCWH 4F7EA 3CZEA 2D8KA 3O9WA 1NKGA 5CZRA 5JXAL 5FGSA 2XWDA 3TBCA 3L9EA 1F86A 4WU5A 1DBJH 3DSNB 3W0WA 5EOCJ 1RULL 5I74C 1FVCA 4N22A 2OL3B 3GMOB 3AS0A 5IHHA 2IWEA 5B8CC 4YIQB 4F8NA 2XXMB 3WS6A 4KZEL 3VXSD 4KKAC 4JX0A 4OLEA 4UTAA 3QRGL 5DSCB 2J56A 1AOHA 1VA9A 4K3JH 1PEWA 3QJZA 4FKEA 1Z9OA 3FOMB 1MH5B 2VQ4A 2F8OA 3U7YH 4QHLA 2WLYA 3JTTA 1F1GA 4XP4H 4W9JC 4ZW6A 1K8IB 1WG3A 1KJ2A 1R5VA 5F9OL 1NFKA 4RESB 3UYOD 3HFML 5F7LB 4LLDA 2V8LA 4DQAA 1G9MH 3ABKB 4LPVA 5GJTH 4P2OB 2X2JA 4M5ZL 2PXYB 1PZAA 4HXAH 1S78C 2WQAA 4N25A 5F96L 4NUQA 5HSFA 4PJGB 2ZOKB 3WHXB 4NO3A 2PPEA 4OI9A 5JPMB 2RQEA 3GKWH 3HC4H 5D6DA 1J5OH 4PWEA 4KZCA 4Y2DD 3ZBMA 4BCYA 2JV6A 3VGEA 4KTEL 2G4GA 1NPUA 2YUWA 5EIIB 4F9LC 3QE5A 1DUYB 4MDJA 3IFNH 1E6OH 2V2TB 3GMRA 5F3BB 2Z0UA 3ZY7A 4G6JH 4ALAC 2EIBA 4AXWA 2AZUA 4QMEA 2FX8H 1D9KD 3ZQXA 2JELL 3QA3B 4Q9BA 3FCTB 4XOEA 4HWEH 5EBLB 3RU8L 4S0HA 4PJBB 3G6JE 3TYGH 4N2BA 3UYPA 4PP1C 1UA6H 3KVPA 4PJAE 1ZA6B 2K3HA 2VZ1A 1A25A 3Q6FA 2L4OA 3MRCA 5CMAA 1RUPL 1ODAA 1T21A 4L18A 1NMCB 1MHPH 1SDYA 4HIJB 5H4ZA 3ZRSA 2A9NH 1Z0MA 1BQLH 4OZGA 1CE1L 1J8HD 3DX2A 2WO4A 3SODB 5F9JB 3QI9A 1TU2A 5MENB 3IAGC 3CVIH 2X3AA 3GLZA 3ME0A 4L8BA 3TONA 5AZ2H 3GEFA 4ZW8A 2X1PA 1QI5A 4AGMA 2X1WL 3K6NA 4R2GD 4QXWA 4MCZA 3Q9PA 4JY6A 4ZFQA 1P4IH 1RK1B 2C1OB 1ZD6A 3KG5A 4FEIA 4FQPA 3QS3A 3SYPA 4MD5A 1YN7A 3OM3B 3R0NA 1NCBL 3L45A 3C5ZD 1FG2B 4NQCB 2PPDA 4QHNA 2R29H 2VDRH 3WEMA 1JE6A 1YEKH 2YAQA 4N0FA 1PIGA 2FBJL 1UZ8A 2R0LH 2A7BA 2CDGA 3AADB 1T22B 1BPVA 1TO5A 1QBAA 4LAQH 4P2QD 1PPIA 4Z78A 3R19A 2CHNA 2WBXA 2MRYA 4PHZA 5FM8A 2VCOA 2PW2A 4P46B 3QAZB 4FXLA 2FEDD 2QDWA 1E9OB 4AENB 3C8DA 1CVRA 3O4LE 1XGYL 5D4JA 3RVWC 1RSYA 2BNQB 4UB0L 5T1DH 3DGCR 4G1EA 5IWLC 2HMIC 3VH8B 4POZD 3AREA 2XCMC 3EYQC 4L1DA 1OF0A 2G2PA 2BHYA 2H6PA 4JFDD 2AERT 3GSOB 3CFKA 5DD3L 2HT2D 3D0LA 5DRWA 2JIXB 3S4SG 3TA3A 1TO4A 1MQ8A 3G5YA 3IFLL 1EFXD 1XF4B 1Z32X 1EZVX 5K39B 5D7IF 1IC0A 3FTZA 2QGCA 3MV11 1FBIL 3CN3A 5GHWL 4BFOA 1HN1A 3V9EA 1LWHA 2YQBA 1A3ZA 3ZUCA 4ORZC 2VZSA 1LHZA 4HUMB 2J4WH 3ZTJG 4GXVH 4OU3A 4PBXA 4PJ7F 5HDBF 4LAJH 4YSDA 3ESVF 2Z93B 4UM8B 5DT1L 5JW4M 4ODXA 3OKKA 3UZEC 1FG9C 3P4OA 1MI5B 4X5QA 2NSQA 3BEWB 2GEQA 1U3NA 1RZFL 2WO2B 3JVGC 1OLZA 1Y6KR 5A2CA 1XV8A 4DW2L 4DHLA 4AYEC 1RJZB 2VZOA 5LBSA 5KVGL 1F02I 2UX6A 1U3HA 1KCKA 4XC3L 4I13B 3ZE2E 2B1OA 3T8XA 1BXVA 3QORC 1NKOA 1MPAH 4QTHB 2WLIB 4G80A 1XO8A 4I5BA 2CK0L 4OI7A 4BE5A 3UGXA 5M7QA 5BUPA 3C2AH 3CK0L 3VXRA 5IJVB 4HKZB 3RFZA 2H1PL 3REWB 2VR4A 1AO7A 2ODIA 1FVDA 3EYOB 1XSOA 5D7SH 1R17A 2AF2A 2QVTA 5C0NC 1CDGA 1J9RA 1TLKA 3P40A 3FPXA 4AEIL 3IPBA 4WKZB 3KJ6L 3WS3B 4ICXA 2VLKE 3QR0A 3EJZC 3P9LB 5JHDB 4XMKH 4LMQI 4GMTH 4UT6H 4A55A 4K9EC 1H8OA 1OTTD 2DI9A 2V5YA 2X38A 4H88H 2WUBL 4WFED 4KROC 4DP9X 1U95A 1QFUL 2YARA 4AQEA 3BN9D 4RZKA 4PLNC 4ODUA 3W5MA 2I85A 4K71C 4WTQA 3OAYH 5IB3B 5K59E 4R90H 5CHNA 1DQQB 3KLAA 4Y4KB 3RWIB 2WBKA 2P5EB 1D6VH 4K94L 2YAEA 4CDHA 4N8CL 3U83A 1ZHBB 1S5IH 4UILH 3Q2VA 2EUWA 3L5XL 1U8LB 3ZHNA 2R4RH 3SIKA 2EDXA 4A2DA 1E28B 2MH4A 4U3XA 5EZLA 2ADGB 1JK9A 4XZUA 1S5HB 4HYTB 4MBOA 2UZYB 4KKBC 5E5RB 4X83A 5INDA 1OP4A 3KCPB 2FX7H 2YAPA 3LS4L 4PWGA 2CH8A 2FQGA 2C7UB 4KJWC 4JLRA 5E2TH 5F71A 4LSSH 1NZRA 4LRNL 2NY7H 2BW5A 5H37H 3GXMA 3VWJC 4OCYH 1A6UH 1ANUA 3UTTD 3VCLB 4K3HA 2J2ZA 4LIQH 4X5WB 1G7MB 2WYZA 4Z7WA 5AZEH 5J57B 2A9ML 5HYJD 3W37A 2YPLB 4X7DC 4XR8C 2GJ6E 1KCVH 4TUOA 2UVFA 1SDDB 4F27A 3HC3H 2F74A 4JBSA 1G6RH 4UM9A 3KPQB 5KVDH 2QADC 4GP8B 3O6FA 2RCSH 2QV4A 2L7UA 4FG6C 2X3BA 3A6BL 4LOEA 4I1PA 1MVYA 4PJEB 5J1AA 1A1MB 4PJ9A 2WXNA 4NNPH 1P1VA 3T6WA 1P84J 3TIDB 4AL8L 3QXAA 1IKNC 2AXFA 3X1EA 3S36L 3WFHB 3TT3H 1XT5A 3ILDA 2AKRB 1JXGA 3FSZA 3IKCB 1IRAY 1UWYA 2TSBA 5HGHA 5F1KC 3BZDA 5A16A 3MJWA 3QG7H 1ZDQA 2P44B 1ECYA 1UZ6E 3ORJA 4KK6D 3RNKB 1KEGL 1TJGH 3LQAL 3BZ4A 3N91A 1U8PB 2EE6A 2ZKXA 4NN7C 3SDAB 4PGEB 3CDCA 2DL2A 1H3TA 4B9PA 4AITA 2VXQL 2Q2EB 2FT6A 3P3YA 2X2YA 7PCYA 4G8AC 4APQA 5KEZA 5CZKA 3CZKA 3AY2A 4E5XG 1FNGB 3SE9L 2CALA 3F05A 2BIMA 3B2VH 4WHTB 3RVTD 5I0XA 1Y18A 3AB0B 1T1WB 2W65A 3QEQB 4LCUB 4Y2NA 4XMUA 2A83B 4R4ND 5D7LB 5GGRY 2RAMA 4Q56A 3JXAA 5HD8D 3OAZH 2BP8B 2CPUA 4MQSB 4PJIB 3KLQA 3RWFB 3HI1A 3LXUX 4EDXA 2OMTB 3TP4A 2H26A 5K9KA 1D5BB 1IC5H 4XPBH 1WICA 4M1DL 1I1AB 5I1DA 1T0NA 1FDLL 2OMUA 3F8UB 3WIIL 5T5FH 4P2OD 2PXYD 4XX1E 3ZR6A 4EDWH 1HNFA 1MAMH 2BRRH 1PKQA 1T4KB 2OMXB 1X5LA 4G9FE 4X8JB 3EUDA 5T1MB 2B1HH 5CJ8A 2F5BL 1AR1C 4W9HC 3WTSA 5TQ0H 1HINH 4JPSA 1NUDA 1SLWA 3KR3L 2F54B 1TJHL 3U4BL 5IHBA 1GZQA 1IBBA 5FO8B 1XEDA 3TCXA 1CK0H 3VW3H 2QSVA 1F4AA 3ALPA 2CO2A 2DPKA 1J5IA 4F37F 3RTLA 3NJNA 1F11A 3RX9A 2GC4C 3VXSA 4F7CB 2ZKHL 2QPSA 4LCYA 4YAQA 4Z76A 3OHMB 4JRXA 3EBHA 1D5RA 2CXGA 2BRQA 2EQDA 5L2KB 1NGQH 2ZOWA 4XC1L 4DERA 1ET7A 4HULB 2WVTA 3ARBA 2N0MA 3WNPA 4L8DA 4O9HL 3BPOC 4MAYA 1L9QA 2OZ4L 1FJ1B 3CX5K 3CPLB 1MNUH 3V6FB 1DBBH 5D8JH 5HPOA 3RGBA 1I75A 4YSRA 1WC7A 4AQ8C 3RAJH 3CFTA 2G2NA 2Q8AL 4OF5A 3TPKA 3L1OL 5MEND 2WNKA 2WKGA 2XG5B 4LVOB 4WENB 4EOWL 1T0MA 4F7MB 4OGXH 2HTLD 2XVLA 5EOQH 2CGZA 2XHNA 3IAPA 1BZ8A 4K7FB 4KXZI 2G30A 4U6VL 1S2EA 4UOQA 1R34A 4RAHA 5KS9A 2JCCA 5BQ7B 4K3DL 2Z65C 5E6RB 2BOLA 3EXLA 3H9ZA 5CLYA 4XXCC 1V3JA 2YWYA 3TBTB 1N19A 5FM4A 4DGIH 1D9KA 5CLZA 4GBXB 4A2LA 3ZHKA 3U25A 4EE2A 3MGOA 4NQCD 2FO8A 3ATEA 2OXGB 3BO8A 3U6XS 1R24A 5CLXA 4NKMA 1Q9KA 5LB1A 4XMTA 2EILB 3G08A 4KQ3L 2ADJB 2VYRE 3D12B 4NHCH 2ITDB 3TYFB 5EH1A 3VDAA 4CW1B 1GZPA 4L5FE 4WWKC 4YQXH 3IGKA 2IIJA 3C5XA 1MREH 4HIHB 1FQ9C 1NEUA 1INEH 2VH5L 3DVGB 5DC4B 1ADWA 4RLDA 4WFHE 4P46D 4M4PA 3FQWA 5B3JE 1DLFH 2EECA 1X44A 2HG0A 3QEHA 3RL2A 4WI5A 4CADA 1ITBB 5IMKB 4K3GA 4L37A 2PYEB 1ZK5A 2PO6C 3S35H 1PZ5B 1AIZA 2FH6A 4N8PA 4CSTA 5E2WL 3NAAH 4R0LB 1UASA 4Y16A 4GFXA 1TTAA 2HG5B 2JIXD 3DX4A 4GLRH 9PCYA 1I8AA 1DQJA 1JYNA 2VO8A 3SPVB 1F2XK 2D3LA 4V33A 3T0XA 2Q6WB 1N59B 4DP2X 1SVZA 3C5ZA 1ZIAA 2GSMB 5F7WC 5D2LA 5DQ9B 4Z8FL 5IF0B 1MHHA 3NOIA 3LKNA 4Q9QH 2OJEA 5EZJA 3JTBA 3NJVA 2IAMC 4NB7A 5IQ7L 4WUKL 3B83A 4N2MA 1J18A 4ZUUA 1MI5D 1JIBA 2UWEB 1E3ZA 1NGYA 1QHOA 1Z5YD 1CFMA 2FTAA 4ELMA 3W38A 1DBML 1QWNA 3BKCL 5TDNB 1RZQA 3IJHA 3KPSA 1YUKB 1INQB 3MV7B 3HN8A 4PJDB 3FFDA 3G04B 4ODWA 2WKLA 3VSQA 3KXFE 4GW4B 1BVKB 4BUQA 1JHTB 5A3IC 1X5FA 1CLZH 4JG0H 3UZVA 4IDLA 4FXGC 3CDGB 5AOLA 2EKSA 5I6XC 1UWGH 4HJEA 4JFDA 1OKEA 3I9PA 1WFUA 3CLFH 2ICEA 4X5XB 3V0WL 4QXGL 3SY6A 3DOSA 1FNFA 4IOSA 5DJ6A 5IKCB 4X98A 4PPTA 1PJWA 2X4UB 4XRCA 3BD4A 4X6FB 1IAOB 2FEEL 4BJLA 5GS1B 1WZ1L 2QKSA 4R9HA 5ID1A 3R06B 3EW3B 3MRMB 1VHPA 4XNYH 1EBPA 4HXBL 2O5ZL 1QQDB 4NPKA 3WENA 1J48A 4TLKA 4YC2B 1TQTA 5JHDD 5MEOA 4J3OC 3G3LA 3DTDA 4UT7L 1DN0B 3A4AA 2G3NA 4FXKA 1KENH 1CFNB 3H54A 3LN4B 3CHXA 3D4GA 4ZOBA 4MA3A 1CMOA 4LLAA 3WNMA 2X6UA 3MFFA 5DK0B 5SWSE 1RUML 1UGNA 5F6HJ 4QI3A 4BCZA 4GAGH 2P5ED 5TPWH 1NH6A 1XAUA 3FN3A 4L48A 4W9EC 2H3XC 4U1HA 4PJHA 3WI9A 5DS2A 1K3IA 1Z9LA 4RX4D 4ZOAA 4ZX3A 1RJLA 1A3LL 2MQCA 5MEPB 1B9ZA 4LRIA 3ZMNA 2BO0A 4HS3B 3SCMC 1AD9B 3WG7B 1RL1A 3STZA 2FT7A 2V7NB 1DQKA 3D3VB 2HTKC 2L8AA 1P6FA 1QTYT 1K4CB 4TRPL 4L3FA 4RMTA 2CHWA 4P2QE 2G3XA 4YN3A 1IGTA 1QW8A 2AJYL 3FFCD 4FQ2H 5E8PB 3TL5A 4XX5A 1TTCA 3LB6D 4UI2A 5KSUB 1JHKL 4HD9A 1AZCA 2DMBA 4FC3E 2O93L 4PBVC 4YJZL 1YEFH 1I3RB 4QF1A 3UJIH 4XVSH 3NSXA 5FO9B 4FFYH 4Z7QE 3HHMA 3LN9A 4KJYA 1WS7A 2YPLD 3FF7A 1AGCB 4JPKL 4HIXH 4HFUL 32C2B 2JXMB 3VDBA 3P9WB 4FFZA 5AB9A 2F68X 2EDKA 3BGMA 3EFFB 3MUGA 2OPCA 2VWEC 3RG1C 3VFGL 1NBVL 2CZNA 2I9LB 2R1XB 4KVNL 3BIAX 3EO1A 1M05A 2DKMA 4JREC 4F5CA 4J3XA 4JFFB 5CN2A 2Q3XA 1NCIA 2ZXAA 1CGSL 1TSHA 1CQYA 3SPCA 1FAIH 1T66C 4AJWA 3GMQA 5E6UB 3VGGA 1GGCH 2IGFL 4JL1A 1HL9A 2XG4B 2FBRA 2P8MA 1CFVH 3AQXA 1AGFB 1ZJAA 3GIVB 1YEIH 3UH8A 4GXUN 2EDRA 4J23A 4NZDA 4UQ3B 3NJHA 1WV7T 4RFNC 3RI5F 7PAZA 4PU2A 4HZ1A 5GJSH 4LP5A 1R3LB 3DSFL 5EUOF 4JAMB 3U4KA 2V2WA 2BOCB 3WELA 2F18A 2R7EA 1IGYA 3KPTA 1JTOA 3UTTA 4JO2H 1JVKA 2ZXQA 3II1A 5KJ4A 3T3PE 5HYJA 1VACA 1TVDA 3QXTA 2WO3B 1OAYL 2Y0SA 2BWDA 1IL1A 1OAUL 1N64L 1YQ2A 2GUYA 4HKJA 4K55A 3IDNB 5E70A 1NCTA 3QEQD 2Z7WA 1AOZA 3N06B 3VXTA 2CLZA 5D7LD 3DROB 3WIFA 3AGVA 2AHIA 4XCCL 4QRTA 2WBJC 1GPOL 2H2SC 2ZAGA 2YSSA 4ZW3A 1QLEH 5IFAL 4Z7UB 5AL0A 5TF1H 4FTDA 5BZZA 1A2YB 8PAZA 4AKPA 4NUJA 5B21A 4YL9A 1PYWB 5GRJL 5LAPA 1I1AD 1IGIL 3DUHA 5ADPH 2YD7A 1G6RA 2FIKB 3WKPA 4UQDA 4P3WA 1MJUL 4Y5YC 3FN9A 3Q44A 2CR6A 4GUOA 3ZZSA 5BZWB 4G7QB 4NZUH 4F2MA 1HYSC 1MF2H 1L3NA 4MASA 2EE2A 2F19L 2MOVA 5IQNA 3GHBH 4XAKD 1GS7A 4Y8DC 1UJ3A 3DSNA 4KV5F 2UXTA 5CU5A 5IR1B 2WZ5A 1SXCA 2OL3A 2GY5A 2H7WA 4F20A 1EXGA 3O8XD 5CSZB 2NY5H 4N0YH 4YIQA 3PJLA 3QWRA 4UTBH 5D1ZC 3HHSB 1ET8A 3WNNA 1K85A 3MZTA 3WLWC 1ILSA 1BMGA 4AC4A 5DSCA 5IM7B 1MH5A 4HALA 1YEGH 2NNXA 4LHUB 2AV7B 4FTVB 5FOBB 4LEOB 4FQLH 1K8IA 4Q74A 1SZNA 1WITA 2CKBL 2DJ4A 4KMQA 5EBWB 1H3XA 2NX5B 1IBFA 1QFWI 4WCYH 2VRAA 4TVPE 4ESKA 1NM9A 2HH0H 1VENA 3PXJA 5AG9A 4M1GL 4KX9A 4P2OA 5DTFB 1QOKA 3MN8A 1L6ZA 2XLLA 1L7IH 4HUCA 3KAAA 4QOKB 2CJTA 3M8OH 4WSKA 3WHXA 3GBNL 3V4PB 2VKWA 4I48A 3OJ2C 3FHEA 1IBHA 5JPMA 5IHLB 4A7TA 5AVUB 3B8YA 3LXBA 4Z7NF 1FFTB 2QV2A 3DNKA 5I16B 1U91B 4BKTC 5EIIA 5I6OA 5LBVA 3KNBB 5T5FA 1DUYA 5L7XH 1R3IL 2ATAA 3J7HA 3RILA 4GBXD 3QA3A 4AGLA 3MUJA 1ETJA 2K45A 4F8LA 4IW4C 2R1YB 3FCTA 4N1EA 3AS3A 4OQTH 1JWMB 2Q1EA 5EBLA 5JIMA 5ABZA 2UZXA 3HBZA 2CCVA 4E41B 1Q1PA 2P49B 5HDQH 2VR8A 4E9QA 2E7MA 5MERB 4G8IB 5HPMB 1ZA6A 3FT0A 5E6IB 4APXB 3C6LC 1QBLL 4HIJA 4P4RB 1SJEB 2YRZA 4IKNA 3A4FA 4WHYG 4UT9L 6FABL 3OXRA 3UXFA 1Q72H 2ZIDA 5EIVA 4HGKC 1MAJA 4AV0A 6PCYA 4ZMOA 1G4RA 3R8BB 1I1CA 1P2CB 3B2XA 5HGBB 5TDPB 5F9JA 2PYED 4GPVA 5MENA 5CM1A 3QUGA 5KTEL 3GS7A 4G7VL 2Q7YB 3B2UC 1A8JH 3RE0A 3QG6B 3NA9H 4OZFB 5BV7C 1RK1A 2C1OA 5DVNA 1NFDE 5C7ZA 5HI5C 5JA9A 5AUMB 2Z3FA 2XN9B 4KUCD 3TA4D 3SGEI 1TJIH 3ABZA 1B9KA 4XXDB 1A22B 2DI7A 2Y1YA 3BQVA 2CE6A 4HCGA 2V8MA 2XTJB 1FG2A 4LASH 4NQCA 4OR1A 3I50H 5E23A 2Y6SC 1T04B 2VR5A 4JKPL 1NC4B 4Z7AA 3G5VB 1L0QA 2X0UA 3H0TB 2PWDA 1MCOH 3VA6A 2CK2A 4PJGE 1T22A 2F58L 3VG0H 3W2DL 1QPPA 1JHLL 4OTXL 5B7FA 4AQOA 3MCLH 3S3SA 4BZ1A 4XB8A 3NZHH 1WWWX 1YVLA 3RGVC 3CN0A 3C09C 1KT2B 4P46A 1GS8A 1AQMA 3EYUH 1I85A 2YXMA 3MV7D 4DP7X 1E9OA 4YSCA 4AENA 4AVHA 5DQJB 1G5AA 3MREB 2BZDA 2OS7A 1DJSA 3QFDB 5TE4L 3ZKMD 2ILLA 2BNQA 4BK5A 4X4XB 1JS4A 1AS6A 1A4KB 1WZLA 3S5ZA 2X44D 1DJYA 1KEMH 2HX8A 4KQ4L 3SKOB 3VH8A 4N1CA 1TR7A 1YY8B 3UC0H 5SX5H 3L4VA 4KZDH 3OZ9L 4OLVH 4CJ0A 2JTDA 5B3NA 1A4CA 1QWUA 2VMJA 3O11B 3O2WH 3ALWA 3MCG1 3GSOA 3LXCA 4GEIA 2NXYB 1NLBH 4PJBE 4WUUA 3FQ2A 2JIXA 4NKOB 4MNHB 2WXIA 2ICES 5K33A 5C07E 3TTYA 2LV4A 4BBWA 3PDDA 1XF4A 4KJPD 4R4FL 4X6BB 5DDHB 5K39A 5I1KL 1OSZB 3GBMH 3EOTL 4L2LA 3QUYC 4R8WL 2FR4B 2DBLL 2DLEA 3N43B 4TVUA 1AZZC 4QRUB 5CS7A 4N28A 1J12A 4OJFL 5I82A 1A9EB 1MJJB 2HKHH 3DTXA 4IK7A 4LKCB 1EXUB 1KGWA 2Z93A 4RWYH 2FJHB 4UM8A 5BOZG 5HTSA 5CILH 4UQBA 2PABA 3EH3B 1MI5A 5A6IA 4Y5XC 3MXVH 5BPPA 3BEWA 2W9EL 4W6YB 4LU5H 4LLMA 2HVBA 4R26L 5LXGH 3E2HC 2BERA 3FTUA 4YHKL 1OAQL 2LR4A 1COBA 2WXQA 1RJZA 1EZVY 3CC5A 3OMNB 4I0PC 4P05A 1QLRB 1T20B 3FUDA 4FLOA 2CRZA 1INDL 5B38B 1HCVA 4MNGB 4HWBA 1YDPB 3V4VL 4ERSH 3D3VD 4QTHA 1BBJA 3JV0A 2WLIA 4Q89A 5DMJB 3ULVC 5B38G 1QRNB 1UXSB 5IJVA 2HT4D 5HHNA 4FFVC 3L9YA 4HKZA 3REWA 2G5BB 5DYOB 1TF4A 1QR1A 1ZS8B 3EYOA 2E56A 5IK3B 2P42B 1M3IA 3WUWB 3QJQB 1KZQA 2J3SA 4WFGD 1I1FB 5ECGA 1MCCA 3FTWA 3F62A 3QUZB 2J1XA 1OT1A 4FZEH 3B9EA 1LO4H 3P9LA 5JHDA 3L2MA 3VFNB 5IQ9B 1K72A 1KYUA 4OCRL 4JMXA 3RWDB 1UGKA 3LV3B 2ZYHA 5IB3A 1MEXL 1Z7JA 3HPJB 4IS6B 4NC1E 2EDMA 4ONHB 1Q9LB 4Y4KA 4BE6A 3RWIA 4OCMC 5J9PB 4WEBH 1X9RA 4C54A 3LZOA 4JRYE 1SUJA 1ZHBA 1AZVA 4RX4A 4JFFD 5GRWA 2ZCHL 5AKRA 1I9JL 1U8LA 4S11A 5EU6B 3T77A 3DMMA 2DICA 4GXUM 4R96A 3E7JA 4JFYB 1S5HA 1XFPA 4BSWB 2FSDA 3VXMB 1GOHA 2CD0A 1QLFB 2UZYA 1UM6L 3QQ4B 3KCPA 1ND0B 3DA0A 1BAFL 3G6DL 4OLUH 1S7QA 5DHMC 1R3KB 4NENB 3FO9B 2WKOA 4JZJA 4ZMLA 4XNQB 4A6YA 2KPNA 1SN0A 4N90E 3JBG7 4QGYA 3FONB 2CLRB 3CLEH 3NH7L 5EEZA 3BWSA 2W9DH 4EI6A 1BWMA 1M2OA 4OLXH 3D33A 3SDCC 1QFWL 4H1LB 4ZMWA 3VCLA 2DQJL 2YUVA 4HLZH 4JHZA 4N68A 4U1LA 1G7MA 1JYVA 4AIOA 4JK0D 3V0FA 2YPLA 1ZHNB 3QIUC 1XEUA 2N1KA 1IJNA 3IE4A 1H15B 4YFDB 5JZ7D 3QWOB 2LTQC 4PVMA 1E4XH 3GIZL 3U2SB 5HJBA 1I8LC 4NWTL 2W0KA 2GJJA 3CDFA 1E50A 2OV0A 1ET5A 2DWEB 4PJEA 4TUJB 4Y1AE 5I71C 1A1MA 3MROB 1BGXH 3R7RA 3SE4A 2AVGA 2VDML 2VT0A 1YNKL 3WFHA 3DIVA 3MRBB 1MUJB 4ALAL 2AKRA 4XBEH 1MFVA 3IKCA 3NIGF 4ZQKB 5B4MD 1EGJA 5FKAA 4X7SL 3X1FA 3SE8H 3O2DH 4P99A 3BVXA 5DS1A 3K74B 4NIKB 2XBDA 4AUUA 1PIFA 3ROLB 2FRGP 4LO9A 2P5EE 3PU7A 5IJKA 3IMVA 3F7YB 1H19A 3QCTH 3SDAA 4PGEA 1RZ7H 1DUZB 1R19A 1CIDA 1BQKA 1BFVH 2NW2B 3SGEH 4DZ8B 2EEBA 2TRYA 1HXKA 2Q9OA 4GRMB 2BIHA 3U6RB 2DLIA 4WHTA 1LMKA 3QEQA 1KJ3L 1T1WA 5I6NA 4LCUA 5DJXB 2A83A 5D7LA 5E8OB 2JCCF 4WJKB 4Q9RL 1WUZA 2BP8A 2IC2A 5E9DB 4LHUD 4PJIA 1MRDL 4DVRL 1SHWA 3FFCE 1PJ9A 4KITB 4TNVK 3T09A 5F1NB 2NX5D 3I85A 4K15A 3IJSB 5CCKL 2CA3A 4NBZB 3GRBA 3GSVA 1YSOA 4H8HA 2CJSA 1WEJL 3QO1B 4D0DB 3DUSB 4HS6B 4YHLL 4LCCA 5CR1A 2OMXA 5C6TL 1T4KA 3CXFA 4QOKD 5DHEA 1RP8A 5T1MA 4MD4B 3U7WL 2IDFA 35C8L 5IMMB 3BRGC 3DOIA 5GZNA 5J6SA 1PY4A 2O5XH 3OAUH 2F54A 1N10A 1MHEB 5LGJB 4N4YB 5FO8A 3MRLB 1WP6A 2ZKYA 4NUPA 3CV5A 5KUKA 4ZFGH 2K7PA 3M17A 2B2XH 2OMVA 5DYFA 3S5YA 3MLYH 2ZWKA 3PE9A 4U49A 3S5LB 2OI9C 3MNWB 2ENYA 4JN2A 4A2HA 4H8WC 3GJFK 4F7CA 5FW8A 1SXSA 4LSVH 5HY9B 3CMOH 3BN3B 4KHTH 5DZ9A 4LSQL 3PWLB 2F7RA 2YPVL 4JM2B 1JGUL 2X2IA 5E4EB 2VW6A 3LCYA 3S35X 1QI3A 4E41D 3LHPH 5L2KA 1E2ZA 4DUVA 4BK4A 4Q6KA 6CGTA 4G8GB 4W9DC 4LSRH 5E6ID 3W39B 4EMZA 4UTBA 4JHWH 4EEEA 4ZFOL 1QBMH 1TEYA 1LP9B 1NAKL 3TWYA 3V4UH 1FJ1A 4UIMA 3CPLA 2Y07H 3A6CH 5G55A 3V6FA 4OZFH 3V5HA 1OPOA 1CYWA 3QBTB 3D07A 4XPGL 5EZIL 3VFTB 2Y6TE 2IBZY 5K1NA 1SXAA 2D73A 1VFAB 2VKXA 3Q6GH 2NSMA 1PX3A 1RUKH 2XG5A 3CVCA 1J88A 2GQHA 4XP1L 2WXLA 4ELMF 4K7FA 3NMEA 4X42A 4HEMA 3EZJB 5EO9B 3MNVB 1CDUA 3UOAB 4A63A 1OGSA 3MOBH 3NIDE 5IT2L 2BIPA 2EABA 3JWDH 4LXFA 2QPDB 5D9SB 2XN9D 3PJNA 3TBTA 3EJRA 2SODB 4GBXA 4GKNB 2JKRM 4JDZB 3F5WA 3FTXA 5EBMA 1BQHG 1LO0L 2XTJD 2ZXCA 1MFDH 2X4OB 3ZKXB 1NC4D 4V11A 2OXGA 5I5JA 2X4TB 3ZKND 4WV1C 4EI0A 2JKSA 4GRWH 2ADJA 2CUAA 3TYFA 2ITDA 2KZWA 4RDQG 4XO3A 4CW1A 3WL9B 4XN1A 4OZIB 4PJ5B 4ZMTA 2XX0A 2VLRB 4PJFB 4K5MA 4YLCA 4GI8A 5AAWA 2EUXA 2F1BA 2OQJB 5JNYA 2RALA 5JXAH 4KK9C 3FYEB 3P54A 3NJIA 4PFEA 4HHAB 4DKTA 2ZP0T 4YDZA 5CLTA 1RULH 1SMDA 1XCXA 4Y88A 1A6ZB 5IMKA 4J3WA 4UQAA 2PYEA 1QFPA 1PZ5A 3NIFE 4NI6A 3IGAB 4KZEH 3VX0A 3FUEA 3LKQB 1N18A 2WIMA 1IJ9A 3BWAB 3BP5B 5CJXA 1UWEL 1MDAA 4K9EL 4R0LA 1C5BL 1EEZA 1QG3A 3O3EB 3QRGH 2NXYD 3OV6A 2HG5A 4OB5L 3QDJB 2KKQA 1CGTA 4YSUA 4PRNA 3SPVA 3OF6D 4NSKB 4XVTH 1PD0A 1CGYA 2Q6WA 3T2OA 1N59A 2AV1B 4O5LL 5F9OH 2Q3AA 3CWGA 4G8FB 3UJJL 3S3DB 2KZKA 2XKSA 4Z0XB 2ZYIA 2F08A 5DQ9A 4I85A 5IF0A 2E76C 4C56B 4GYBA 3ULUL 4NN6B 3RHWK 4M5ZH 4N26A 3IDXH 5CSBA 5E1QA 1N12A 2DEYX 1AHMA 5F96H 5E9NA 5C0FB 5DUBB 1AKJB 2UWEA 4AQAB 3UTQB 3CSBA 3NJXA 3BESR 4JW3A 3VFUB 2W59A 4DP8X 4ZTOL 1GOFA 2A6JB 5TDNA 3TF7C 2HVJA 3D39A 1UZGA 1INQA 3MV7A 1XH3B 4PJDA 1ZTXL 4HF5L 2ITEA 3H2PA 3G04A 3UGUA 1IX2A 4ILDA 2F53B 4GW4A 3FYIB 3BW9A 1KIRB 1JHTA 3ZT6A 4K23H 4NNXB 1EIBA 5I8OH 3OLGA 4NOFA 2JELH 2YEZA 3CDGA 4KK5C 3BSHA 5DD1L 2XXGA 1BZOA 2BHFA 2LU7A 4YXLL 3RU8H 1QRND 4X5XA 5E5MB 5IKCA 1OD9A 1KXQE 2FATL 2X4UA 3O3BA 4X6FA 1IAOA 3KD4A 4N86A 1RSFA 4WI2A 5GS1A 2XQYG 1OP9A 2EE0A 3QDMB 3MRMA 3R06A 3NCXA 5IP4A 4RGMC 2X4NB 3QUZD 1QQDA 3IDYC 2FQDA 4HBCH 4MS6A 3HJEA 2F15A 3I6KA 1CE1H 4OFQA 4YLBA 4FDWA 5D2NB 3CVHL 1BF8A 3OHXB 3LN4A 2ZICA 3L4YA 5FUZL 4MX7A 3GXFA 3RVUC 5DK0A 1OQXA 3DWTA 1RUAL 2N0KA 3LAFA 3O6KH 4UANA 4ZNCD 3WFCL 1E5YA 2XIBA 4JVWA 3MBEC 1HL8A 1WCQA 4HAKA 1CWVA 4A38A 1QTPA 2JE8A 1FH5L 4UNIA 5EU6D 5GRUL 4LPTA 2OFQA 1AD9A 1Q90A 1NCBH 2ZAIA 3L81A 5CZXC 3JYCA 3VXMD 3FSOA 4GRLC 3FQXB 4H1LH 1K4CA 2Y1AA 1AXTL 2P24B 4B0MM 3FTYA 3L3OA 2FBJH 3SDDA 5FGCB 4BH8B 2VUOA 2AK4B 3KEHA 3RIAF 4B60A 2NSXA 5E8PA 4UWQB 1TQUA 5D7EA 5CGYD 5KSUA 5L0QB 3WSQL 5G4NA 2E0PA 3JUYA 5J6GB 2B20A 1A14L 2C9RA 2D7TL 3NFPB 3QUML 4MA1B 4OCSL 1I3RA 2QSCL 2DL9A 5FO9A 5EUOE 1XGYH 2K6ZA 3V6BR 4UB0H 1AGCA 4JE0A 4M6NL 32C2A 2JXMA 3GXPA 1JZJA 4IBLT 3L1GA 5F0MB 1SFDA 4JO5A 1YLBB 4QRFA 1F1DA 3SKMB 3EFFA 1PX8A 3QB7C 3WO4C 5KZCB 2I9LA 2R1XA 1GZHC 5KSBE 3HRPA 4XOBA 3D09A 4RFEB 3GYRA 2PWGA 5D6CB 3ZN6A 5EU3B 3UAEA 2H3NB 2H2PC 1D6EB 3T0AA 2UXFA 4GAAA 1K6QL 4PJXB 4HPOL 2VTFA 4PWKA 2NY0B 3MA9L 5GHWH 2ZG1A 2R59A 4Y1SA 2E6JA 4L4TB 1FFPB 3ZL1A 4IU2B 4G3YH 2XG4A 2VDQB 5D1QB 1AGFA 3ILQC 5D4IA 4Z1PA 1QNZL 1WBYB 4RMVA 3AT0A 3S98A 4UQ3A 3TFKD 2BSSB 2XYBA 3OB8A 2ERJC 1KYDA 4A7GA 4HUKB 5GRZA 3UPRB 1KTCA 5GZOD 1WJ3A 5I0YA 4PS7A 4KO5A 2BOCA 1F3RB 4NRZB 2Z64C 1WTLA 2R0ZL 2Z35B 3IMUA 4RMWA 1EMTL 5I23A 4N0CC 1CLVA 4QY8B 5KVGH 4A7VA 3FJTA 2WQWA 4WHCA 1WGOA 5HHVL 1TEFA 43CAB 3D3VE 4NHUB 1PZCA 2ZP9A 4M6OH 1OP3H 1NGXB 2YXWA 3DROA 4YH6A 2LAGB 4PLOB 3BWZA 1QVOA 5GRXG 4Z7UA 4UOJA 5E9DD 3CK0H 2K8MA 3QJFB 2VUKA 1P7BA 1A2YA 2OTUB 2H1PH 4UAOB 2EEXA 5F89B 3GBEA 3HR5B 4WVRA 5HHMB 2YMTA 1PYWA 4M7KL 5ANMB 1Z9SB 3ZZLA 4AEIH 2NUPB 5KVMC 3U4EA 3KJ6H 5KBLA 1YUHB 2FIKA 1BIHA 3KM1A 3TO4B 5BZWA 1KSRA 2EDQA 2WUBH 4LVNC 1NSNL 2NUTB 3R1GH 4MCNA 1QFUH 3IE9A 4AH2B 1ICTA 1U3ZA 2BXYA 3NPZB 2X0WA 2Y3AA 3PDOA 4GT0A 2YJQA 4Z5RB 1UH4A 2DQCL 3ARTA 4K94H 5IR1A 3L13A 1NBYB 4Z7NE 2AJUL 2HRGA 3K6OA 5CSZA 1HEHC 3L5XH 3BZEB 4GP4B 3HHSA 4BCXA 2CXKA 3C60B 5EF0A 2VDKB 2R15A 4GG8B 5IM7A 4JM2D 2R2BA 1PZ3A 3NSFA 4PMEA 1UOKA 4LHUA 3LS4H 3D2TA 4FTVA 4LEOA 3TO2B 2CO6B 2IALA 4G8GD 2V9TA 2LFEA 4MRBA 3VQMA 4LOVA 3PABB 5EBWA 5ID0B 2NX5A 4HS8L 4LRNH 1H8LA 2M1KA 3U1SL 4DIXA 1TJMA 3SE6A 4AEHH 3O6MH 2J6WA 1NKRA 2GIXA 3T4AB 4FLRA 1KTBA 2ID5A 5DTFA 1U6AL 3O41B 2A9MH 4QOKA 2DLHA 1AZNA 3OC8A 5BVPL 3V4PA 1ZVYA 4P2RE 2C5DC 4GUCA 1CD9B 3NRPA 4AYFB 3WUZA 1W80A 5JQ6L 4Y2OB 1MCNA 3GT6A 1A64A 4L9LB 1U91A 3R4DA 1JYWA 4YSOA 3H3KA 1EDHA 3BVWA 2ROXA 4UIKL 1N0XL 2XV3A 2Y2TA 3BWUF 1BM3L 4N2IA 4AL8H 2R1YA 1FL6B 3BQUB 3GI9L 4X8CA 5DZOA 4BFNA 2GIMA 3HRZC 2WXFA 3S36H 4GMSL 4YL4A 3NJKA 2CHDA 4HJIA 3EO0A 4E41A 5FC9A 5BXFB 1YEWA 4ZUTB 3LIZA 3VI4B 3MJ6A 5MERA 1ZLVK 4G8IA 4PJ5D 5E6IA 5HPMA 5DWUL 2VLRD 4APXA 4ZS7L 3K1DA 1SXBA 4Y4HA 1UH3A 1KEGH 2DDQL 3JWNH 1ZANL 4K7PH 3HNTL 3LQAH 1CD8A 1IBGL 1B0RA 4RRPM 4QTIH 1Q4NX 4MCMA 1PD6A 1A6TA 5TDPA 5HGBA 3VUAA 3V6OC 3QZMA 4N0RA 4PB0L 3ARFA 1OZUA 1EA9C 3KM2A 3APCA 3SE9H 3CSFA 3QUXB 5KTEH 3MV8B 2Q7YA 3MQIA 1ZVNA 3DIFB 4OZFA 1M7UA 3F84A 2FSEA 3I3EA 5F7AA 3QDJD 1EERB 3B9VA 3QC6X 4L9DA 5AUMA 3HR6A 5GISH 2XN9A 5F6IC 1UACH 4LBEB 2CAKA 4EI5C 4HAGA 4JHAL 4XXDA 4FMVA 5DD6B 3MMEB 4U1KB 3ML8A 4M1DH 1LEGB 2OW6A 2AMUA 1FDLH 1NC4A 4C56D 3G5VA 2VO5A 4GS7B 2QSQA 3H0TA 4WHDA 1T2XA 3FUNA 5KYNA 1AKJD 5LKNA 4IRSC 3W5NA 4FYRA 3ARQA 5I2IB 4PQXA 5GGSB 1KT2A 3CSGA 1MLBB 5ISZE 3KR3H 5LCVL 3BAEL 3IRPX 1B0GA 3PGFL 1TJHH 3HG1E 5DQJA 1QKZL 4KDVA 5F1OB 5K9OB 3QFDA 5A2FA 1Y7VA 5GS3A 1H5BB 1ZHKB 2F53D 2RFXB 4KKCD 1A4KA 4X4XA 5ALCL 4JE4B 2WTRB 4U1NB 3ZDZE 2OMZB 3SKOA 5LGKA 5EU7C 1XGQB 3RUGB 5BO1L 1A7BA 1YY8A 4L8SA 2VLJD 3HG2A 1NEZB 1IVLA 3V6ZA 3O11A 4DOHB 1GCFA 3TC9A 1IE4A 3ULSB 3SZKC 4AOFA 4NKOA 4MNHA 4HLEA 1URIA 4BFJA 3MJ9L 4X6BA 5DDHA 3RDTC 3OF6A 3EAKA 1OSZA 4BH7B 1NCAL 2FR4A 4PRAB 1U8MB 4O9HH 1TTUA 5ESVB 3IBOA 3QDMD 5C0IB 2W94A 1A9EA 1E4JA 4FNLL 3FUFA 4NCC1 3SO3C 2ZWZA 4RSYA 4Z3GA 1EXUA 1E4WH 5HGAB 3GMMB 1ZLUK 2FJHA 2Q8AH 2WKOF 3F04A 4TQIA 3ISWA 3L1OH 3MGAA 1T89C 4M7ZC 1XB3A 2IH3B 4LK4A 4ODVL 4WGVB 3IXTA 4EOWH 4NQDA 1PKOA 1C7TA 3H2QA 3P11L 3QEUB 4U6VH 4G5ZL 1TPXB 3H4FA 4PJ8B 1UD2A 4K3DH 2EVFA 3T4YB 1KIUA 1QLRA 4NN5B 1T20A 2NXZC 4J7RA 4JZNB 3AFLA 4S0TD 4NNYB 2VL5B 3TBSB 1WT5C 2XN2A 5B38A 2NY6B 3C9NB 3LZFL 4MNGA 2VLMD 1HHJB 4OV6F 4XNUL 1YDPA 4J4PD 4LSTL 5DMYA 1ZV5A 2CDEB 4P5TC 1RKRA 1FO0L 2DY2A 3BSZH 1UXSA 4J3BA 1X5HA 4G6ML 4QRSA 2G5BA 5DYOA 1S8DB 1ZS8A 4KQ3H 5A2IH 3MRDB 4PJEF 4YDIL 5IK3A 2AK4D 4KTYA 1X5AA 3WUWA 4NP9A 4KKRA 5HI3C 2IBBA 1I1FA 3OSVA 2VH5H 1HSBA 3SQOL 3QUZA 2PW1B 2JTYA 4HHGA 4ZUSB 1DSYA 4CC0A 4FA6A 1FIEA 4GRWE 5IQ9A 3VFNA 4F3FB 4HJGB 3PG2A 5IBUG 2YGQA 4OLZL 5AVWB 5JHLL 3UTSE 2HT3D 3LV3A 3N41B 3OTTA 4W9FC 2V5MA 3KE0A 4ZO7A 1L7TH 3HPJA 4HJ1A 4FJZA 4IS6A 2WLLB 1KIQB 4JJHA 1FUNA 5KZCD 5A40E 2QFPA 5J9PA 1F3DH 1RZKC 5T3XD 4YR6B 5H94A 4R7DA 1XXFC 2QFRA 5EU6A 1GYWA 3FPYA 2GPZA 2NY0D 2Y2YA 4JFYA 2H1LM 5D71L 4BSWA 3P3RA 4L4TD 2QJDA 3C75A 3VXMA 3ZTJH 1QLFA 1FAKT 1K2DB 3IJEB 5D1QD 3QQ4A 4PJIF 4N85A 1Q0YH 2E74C 4OQ1A 5IQ7H 5BVJB 4UNTA 4WUKH 3FO9A 1U30A 2C3XA 3ARDC 4U1SB 3BFOA 4XNQA 3AWEA 3NIGE 5FYJL 6PAZA 1J8KA 1P5UC 2IADA 1F3JB 1SQ2N 3S88L 3FONA 1G1OA 4ZMZA 2CLRA 4OVVA 1DBMH 3VYNA 3QDGB 4HKXB 4CU6A 1CXKA 2AEOA 3NCMA 3ATDA 4KRMB 4EZLA 3KS0H 3X3GL 1FGNL 2ZT9C 1CGUA 2VE6A 2IDTA 1ZHNA 1XAKA 4WW2B 4UV7L 3KPMB 1L9NA 1GMEA 2IH1A 4QHMB 1H15A 3KGSA 4TNWK 5E94B 1QRNE 4OIIL 4KGLA 1R6VA 4M43L 2OP4L 3IPFA 3QWOA 1DSWA 1HEZA 1NCHA 4I88A 3U2SA 3V0WH 4QXGH 1P9MA 5HYEA 3O9WC 1SLXA 3HOGA 3ZTCC 1MAKA 2DWEA 2EXWC 4TUJA 1QI4A 5HHMD 4ETYA 5LN8A 5JDSA 4NQEB 1WZ1H 3L08A 4AMWA 2FECL