5AZEL

Fab fragment of calcium-dependent antigen binding antibody, 6rl#9
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
206
Chain Sequence
SVLTQPPSVSGAPGQRVTISCTGDVHWYQLLPGAAPKLLISHNTHRPSGVPDRFSGSKSGASASLAITGLQAEDEADYYCQSHDSSLSAVVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 6RL#9 FAB LIGHT CHAIN
publication title Calcium-dependent antigen binding as a novel modality for antibody recycling by endosomal antigen dissociation
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 206
sequence length 215
ec nomenclature
pdb deposition date 2015-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5azeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5azeL01
4Q2ZA 5CSZA 1NUDA 1OP5K 3T65B 4AMKL 1KT2B 1T7YA 1X5IA 5INCA 1OTTC 2H2SD 2YD6A 4J8RA 4BJLA 4ODHH 5L88L 1R3LA 5HI3D 5I8EB 1BVLA 1EEZA 3JTTB 4OD3L 1YEKH 4JQIL 4MSWA 3VXUD 3WFEH 4R7NB 5I19L 4L4VE 3NIFF 1HH9B 5FO7B 1D5ZB 5IM7A 3UDWA 5EH1A 4C59B 3R4DA 4F57H 4JREC 3ZKNC 3QUMH 4FTVD 4P2CG 4JFFA 1KB9K 4KJYB 3GJFK 1I1FA 3MZTA 4G5ZH 3QUKA 3T0DA 5EU5A 4HWEL 1KB9J 3GI8L 4LU5L 1FSKC 2PYED 1X7QA 1XF2B 2ZOKA 2XFXB 3D3VE 1MHCA 3QDGA 3VI4F 4NN5C 1NSNL 4PV8B 1J1OL 4WW2C 5EFIB 3KPMA 5KG9A 5FV2A 1EZVX 5D72L 2D9QB 4Y4HB 1YMMB 5ECJE 2EEAA 4N9GA 4H25B 2UVEA 4HIEB 5F89A 5JIPA 4JHZA 3SDXB 1TVDA 1J87A 1JTTA 4XRCA 3RVTD 1F3DH 3CUPA 4NQCE 3N50A 3CFJB 1NCTA 5IB3A 4KTDL 4ZPVB 3UC0H 1B0RB 5ELIA 1YEFL 2GJJA 1KPRA 3DV4B 2NX5E 3WO3B 3RKDD 5GGRA 1EZVY 4ZFZA 2V2TB 1CXIA 4HH8A 5E6IA 4Z7UF 3VD9A 2R9HC 2XTJB 2ZUXA 3PIQB 3WFHB 4M7ZB 5DJ6B 3HI1A 5J57B 2P5EB 2VXTH 1NL0L 1HQRB 1R3KA 3WO4B 2RFXB 1ADQL 1NMAH 3VFRB 4UT9L 1PZUB 4LLDA 1U8JA 4L1HA 3WHE0 2C4FT 5J56B 1JGVL 2OK0H 5IFHL 3RPKA 5E9DE 1KIPB 4C55A 5IP4A 4HUMB 1HSBA 1RUPH 4TUKL 4YE4H 2HJFB 4D9LL 1W72A 3K1DA 2X1XR 1DQMH 5FM4A 3NGBC 3G5VB 2EKSA 1UB5B 1CIUA 1U42A 5TE4L 4FFWC 1U8HB 1UADC 5C07D 5E00A 1I75A 1Q9WA 2DQJH 4IOFD 4I0CC 4R4FH 5ABDE 2IFFH 2MKLC 3GB7A 3L7FB 2B0SH 4M5ZH 2DIBA 2WP3O 1J12A 5HD8C 3A6CH 1OM3H 1GGBL 3MRCA 4DGYL 2ZPKL 3IETB 4E5XB 4O02L 3T0EB 3U4EA 4Z8FH 4HCRL 2JKXA 4LOUC 3TT3H 4MXVE 3O2DH 2OL3H 5EPMA 3MGAA 3QCVH 4JE4B 4RA3A 3SOBH 1P9MA 5KVEL 1NBZB 2VNCA 5EC2B 3U48A 2NXZC 3NN8A 1WT5A 3ILPA 5I1CH 2X4NB 4EI5C 1KNOB 5AAWA 1QQDA 4M7JL 4Q6IA 5GHWH 1UT9A 1I3RA 2EXYC 5KBNC 4KKLC 1HI6A 2NZ9D 4CMMA 3NCBB 4HUUA 3GKWL 4PJFF 3ARBB 1AGBA 3C8HA 3KXFE 2I60L 3V2AR 4NOBA 1QFWM 2OTWA 2X44D 4MXQD 1RJYB 2BDNH 1A2YB 4CRPA 3SKOA 3S36X 4MCZB 2EYSB 3QDGE 3IJHA 5EIIA 1IGIL 4GO6B 4ELMF 2F74A 2IPKB 3DMMC 4QHMA 1JWMA 3BW9B 1D5MB 4WFHE 4PRAB 4KDVA 1D5XB 5J1AB 4X99A 5F7EL 3SDAB 3MV8E 3EGSB 3UPCA 3GSOB 4XGZA 1PSKH 3QDMB 3O6LH 1JGLH 3BZ4A 3CFDB 3CXDH 1GGCL 4X5WB 3O2WL 3QFJD 1IEAA 1U3ZA 5I8OL 1PKQE 1AIFA 3F7VA 4OLYH 5D7KE 4HIIA 5JXED 4ZO9A 4JRYD 3PL6A 4HMDA 1QFWH 3FO0H 3IS0X 5CZVL 2DMBA 1I8IA 5D8JH 1TQCB 1J8HE 1LDPH 3SDDA 1RHHA 3AS3A 1RAMA 4GAYA 2DAVA 2PXYC 2WP3T 3B43A 1P4BH 1B4JL 3F8UB 5DMIL 3MLWH 4Z7NE 2JIXD 5SWSA 5IB4B 2C1PA 1CDGA 1BJ1J 2FZ3A 3U6RB 3P4NB 1MREL 1NEUA 1AD0B 3GSRB 4OQTA 1Y18A 3TPUB 2VB5A 5C2BH 3W9DB 3SHSA 1BBJA 3VG0L 4J3WA 3HPLA 1T7WA 4U6VH 4Z7WE 5I1HH 2AK4A 4X80H 4M1CD 3BUYB 3QH3A 3PHOB 4OZHA 2NNAB 2JK5A 2Y06H 2AJ3A 3QEQE 1U41A 5CGYD 4PJXA 3CFKA 1RZJL 3RNKB 1NCAL 3CVHB 3RA7H 5FUZL 1HHGA 3QIWC 2YKLH 3EZ8A 2QQLL 4XPFL 5BW7C 1UXSA 5C0AB 3AXLA 5D5ME 4AEIH 1Q0XH 4FQ1H 5DRWA 1GOGA 3VFUA 2CKBH 1JPTL 1UJ3B 4ODUB 2UY7A 5C0DA 1MEXH 4APQB 4FQCH 4MLIA 1T1YA 1DQLH 2RQ8A 4CU7A 3ZTJH 3L5IA 4XC1H 3MBEB 4I18B 1J86A 3HUJE 4HHAA 1DEEB 3WIFA 1PJ9A 3IT8D 4HXBH 2VLKE 5I73C 3WIIL 2D7MA 1F58L 1X4ZA 2EC9T 1BPVA 4G6KL 1HEZB 1SBSH 1U3HB 4ZD3H 4MQSB 5F7HA 3S4SA 4ZUTB 3FN3A 1H8SA 2IGFL 4LGRB 1FN4A 3TBTA 3O3AA 3GMRA 5TFSL 4P59H 3IFLL 1MWAL 3W2DL 3NA9L 3ZO0A 2C1OB 2LAAA 3CFEA 5C0EA 3BP5B 3H9SD 3O4OC 2G75A 2CIIB 2WZPD 2JJSC 3VFTB 3QIBC 1FL5B 5D1XB 1YEIH 5FGSA 3LH2H 3R0MA 4HPOL 2A1WL 2DLFL 2FX7H 1E6JH 2CKNA 4NN7C 3OR7A 1NFDF 5DQJA 1AGEA 3DX8A 5IBTH 4OCRH 4ODWA 1EHLH 3SGEH 2A6IA 4XVSH 4LQ1A 1GAFH 3O11A 4MQ7B 3BRFA 4HJJH 5GJTH 2ZUTA 3D0LB 5D7IE 5CJBA 1KT2A 5FV1L 1NGZA 2DIJA 3VXNA 4HQQH 1V5JA 4G6JH 3ULUE 3HNTH 2BX5A 4HV8B 1HH9A 1IE5A 1D5ZA 3W9EB 1AQKH 3C5ZD 3WLBA 2NXYB 3R1GH 4KJYA 5SWZE 4W81A 4QOKE 2X09A 4QHUB 4OZHE 2R0LH 3MMEB 4XNMB 4WCYL 1XF2A 2DJUA 2QADD 4K94C 2XFXA 2LV4A 2YEZB 4JRXD 5C1MB 5FM5M 3KPRD 4PV8A 1W0WB 4AZ8A 4H0HB 5EFIA 2MQCA 5F9JA 1FGNL 1OTTD 3EOBB 4QHNB 2VDMH 5CBAA 4Y4HA 1YMMA 4DKFL 3BKJH 5KTEH 1H15B 2F58H 4H25A 4HIEA 4YIQA 1D5IL 4TULL 3F7YB 3CFJA 4JFDD 5C92A 3ZKND 3GJFB 1WSST 3FO9B 5K93A 1B0RA 4LLAA 5KS9E 4KVNH 5FKPB 3JZ7A 2OTPA 3W39B 1X5XA 1NAMA 2CMRH 1Q72H 1T0NB 4JFEB 4M03A 2V2TA 1FJ1B 1J0YA 3QHZL 3PIQA 1X5KA 5DJ6A 4WI6A 3VFPB 2EEBA 1F2QA 5EU4B 1HHKB 1HQRA 1ZT4A 3BPLC 3UTSA 5EIQA 4LLUB 3HNSL 3VFRA 3E3QC 1IBGH 3C8KB 3VXME 2VXSL 4J12A 3ARGC 3HI5L 4DKEH 4UV4H 3TBSB 4ZNCD 5ID0B 4XCCL 4HIHB 3T0AA 1YEJH 5CS7A 4PGBA 4YXLL 1PQZB 2ICEB 3G5VA 1GGUA 1VGEH 3QG6B 1IAKB 3EYFA 4YDKH 3F6LA 5JXAL 4UAOB 1GHFL 3RWJA 4MJ6B 3L7FA 5LG1A 2Q1EA 2R9HD 3SE4C 5LWYL 4MNGB 3VE0A 3OKMB 3F7PC 2ZSWB 5C0CB 2RIKA 3K8LA 3IETA 4E5XA 3T0EA 5GRVL 1G9MH 4M00A 2C3HA 3FFCD 3FFDB 4G8GE 4P9MH 4ZFOL 5HHXL 5L2KE 2DM7A 4C57C 5GSVA 3MOBH 1QR1B 2VH5H 5E6YA 4PJEA 1NBZA 5EC2A 3LEYH 3IDYB 1C5BH 4JZOB 5C0NC 2D03H 4P2RD 5HJ3B 4FFWD 1IMHC 2QSTA 4OLZH 4YNYB 3S3JA 5HHMB 3ISWA 2WM0A 4GKNB 4HH9A 5LAXB 2Q86B 3EFDL 5EA0H 3S35L 3IU4L 4KUCD 4YBQD 4MA8L 5HD8D 3L3GB 4XTRC 2CRZA 1A2YA 1SVCP 4MCZA 5HDQH 4ZQKB 3TWCH 4LOUD 3PV7A 5HGDA 5BMFH 2OJEB 3PV6A 2BVUA 3BW9A 4NQUA 2DQDH 3DARA 1VGKA 3SE8H 1D5XA 3SDAA 2AXHA 5IGXH 3LQZB 4NFCA 3M17B 5DDHB 2GJ6D 2N4IA 3FJTA 4IHOB 3IXTB 4FQJL 4HWBH 3CFDA 5TF0A 3KPLB 3QQ9C 4EI5D 1JRHI 1B6UA 1ZLSL 5GZNC 4DEPC 4FHBD 4TYUA 5AG8A 3O6FC 5IVOA 5D2LF 3TH3T 4DVRH 3GO1H 2CUIA 5FYKD 4LSSH 2Q6WB 1YEHL 4KKLD 5LQBH 1YY9C 3DBXA 1HYRC 5CP7A 5DK3A 3WUZA 1AP2B 2OI9C 2DM2A 5B21A 3OPZH 4EEEA 1H3WM 3FT2B 3U0WH 2ICES 2R0WH 35C8H 4IJ3C 1DQJA 4Q6YA 5DZLA 2NR6C 2H1PH 5IB4A 5C7XH 5E8DH 3INUH 1XGPB 3DMMD 1AD0A 1VPOH 4MX7A 3QI9D 1ZS8B 5LVEA 1FNGA 4GG6A 1LK3H 4GW5B 4FP8H 1T7VA 4NO0D 3TPUA 5HYJD 3ZDYE 4HAFA 2J7LA 5I6XB 1KPVB 3BUYA 3EDJA 2DQUH 4I3SH 5KVFH 4HF5H 2NY4B 5MEQB 4X6BB 4NNPH 3CVHA 3RVWD 5I8KH 1AY1H 1UM6H 3LS5H 3ET9F 4R2GB 4M9PA 1S7TB 3ZL4H 3BN3B 2VXQH 3MXWH 4QRUA 3IDIB 4C58B 1QRNB 1DLFH 1XH3A 5C0AA 2HFEB 3MLUH 1CBVL 5LCVH 1F8TH 4KXZI 2DDQL 3S4SG 4IMKA 1O5DT 3I02B 3L5JA 3G6JF 4ODUA 5BVJA 4WV1C 1UYWL 3NIDE 3T04D 4NO3B 4PJBB 1NCBL 4QRQB 1TFHA 1LD9B 3CDCA 2B4CH 5E08L 3OAZK 1HWHB 1DEEA 3DRQA 3BDBA 5LGHL 5GGVL 1GRWA 5FIEA 4OT1H 3IS1X 4JM2F 5TQ2H 4OTXH 3D39D 1HEZA 2IJ0C 2YN3A 4BFIB 3TYFB 1U3HA 3SBWA 4L29B 1ZLWK 3PNWB 4F7MB 3VMOA 1KJVB 4FTVB 1RU9H 3P11H 3LRSB 3P77B 1CXKA 4ZOEA 2AK1L 2ATKB 5DJCB 1M71A 2C1OA 4QRSB 1HXMB 1HKLH 4NM4H 4MVBC 1I1YB 1NCWL 2IG2L 4ZTOH 4RGMC 2R0ZH 3JV0A 1JYNA 2CIIA 2R56H 1D9KC 5BZWA 4ZFGH 1JYVA 1CIDA 2PO6A 1FBIL 1MFEH 4F2MB 5DRZB 2NW3B 2AXJA 1P1ZA 1CQKA 3LS4L 4HZLB 1VKXB 3N1PC 2PKDA 4NQVB 2ORBH 1T7ZA 4KFZC 4PY8J 1EHXA 4OLUH 5IROA 4I3RL 2IPUG 2VN4A 3QULB 5E4EB 5CJXC 4O2EB 3X14B 4MQ7A 4OD1L 4HS8L 3HG1E 3D0LA 3LZFH 2H32B 4LGPB 2V17H 1JN6B 2CO6B 4RZCB 1S7SB 4GRLC 4KGLA 5AYQA 3NTCL 1AGCB 2D0HA 4BFEA 4JQXC 3HMXL 5D7SL 4NPYA 1NLBL 3PWJB 2EIEA 5HHOE 4M7KL 3RKPA 2I9LB 4HV8A 5E2UH 3QIBD 1MI5D 4OV6F 3TCXA 2A9NH 2APVA 3VI3F 3QQNA 5FYKL 1MCWW 3V8OA 1AXTL 3DHMA 3VJ6B 5FYJH 1N6UA 4TQEH 5E9DB 3SE9L 1F2XK 1CT8B 1JHKH 3AREC 3BZFB 5EBLA 5IBUG 3MLYL 3FQRA 4NRXB 2B2XH 1H3PH 3TC9A 5HHQB 1UM5L 1QP1A 4RISH 1B6DA 4X7SL 1KJ2A 3RL2A 2YEZA 1WEJH 5I0DA 4W4NA 3QEUA 5F7FA 4UMGA 5FUCC 4L8CB 1FNFA 1MH5A 2YA2A 3EOBA 4OI9A 4QHNA 1DN0B 1QSZA 5B4MD 5EZIH 1H15A 1JJUA 3N9GH 5F97E 1J8KA 3UYRL 4YHYB 5CLTA 3G6AB 3NFPA 5HDBF 3H42H 2AV1B 3GJFA 1BLNB 2XA8H 2CK0H 3N1QC 4TUOA 1EGJA 4J2XA 3RQ3A 2D7OA 3W39A 4TNWF 1X5ZA 4KJPC 1MLBB 1XGYL 1QBLL 4V1DE 1QFPA 1FJ1A 1RUKL 4POUB 1MIEL 1CXLA 3QWOB 4XP5H 3NCJL 4P9HC 4LRIC 5IT2H 1MVUB 3VFPA 1KJMB 4W6XB 4ENEC 1KBGH 1L9MA 4RX4D 5F1OB 3C8KA 5KZCB 1I1RA 3CK0H 1OT1A 5F9WC 3TBSA 4Y8DC 3OF6D 1K8DB 3KXFB 2FGZA 4Z76A 5ID0A 3U0TB 4HIHA 3MGOB 3NIGF 3RWEB 4KU1A 2ICEA 1A7QH 1IAKA 4PJ9C 4WI4A 4Q0XL 4Y5YC 2CLZA 5F7MC 5IQ7H 5JW5A 2DI9A 3MV8B 4MJ6A 2P42B 3BEVB 3IDUA 2SEBA 3MSPA 1EH9A 4MNGA 2E9BA 3QFJB 3FN0L 4NT6B 3OKMA 2Z91B 4YX2L 2ZSWA 1CDYA 2VN7A 5C0CA 5F7DB 1QSFE 2VR5A 3MLTB 3BKYH 4M48L 1BGXH 4HW6A 3B9KD 3FFDA 3CSYB 3ARGD 2DTMH 1UWGL 4LLVA 2WW8A 1QR1A 3HE7C 3LSOB 3PQYA 2R2EB 5DFVC 3QRGH 3BPCB 1FC2D 5ITFA 2DQIH 3PXJA 1NQBA 2R1WA 2JIXB 1N3NB 1VEMA 2PTUA 5LGKA 1AKJD 4Y1AD 4OKVB 1T6WA 1EFXA 2YMXL 3QXTA 1QBBA 5FDWA 4X8XA 1LO2H 5KVMC 4YNYA 1CK0H 2AQ1A 3QZWB 5ESVB 3BE1L 4GKNA 5LAXA 4GG8B 4H88L 2PUQT 4NRZB 4HT1H 5EORH 1V7NL 5EU6D 2ZKHH 4OM1H 1F5WA 2JB5L 3HZYA 1MRCH 4OIIH 5I1IH 1TVBB 2FEEI 3V7AE 3GDBA 5CGMA 3G5XB 4NZUL 5KSBF 4HDIA 4JFOB 3LQZA 3BKMH 4M5YH 3BDYL 2WUBH 4IHOA 3V0WL 5IHUL 5MEPB 4TVSa 3KPLA 3O6MH 5D5MB 1ADQA 3A6BH 2MHAA 1BFOB 1MFBL 25C8L 5T1LB 1J9CT 3FRUB 2Q6WA 4YR6B 3SGKC 1W8OA 4YDVB 3E2HC 3A6OA 1I85C 1AP2A 2X6MA 3HUJB 3T0WA 3ULUH 2X1PA 3P0VL 5D6DA 5J11C 3FT2A 2VLKB 2W9EL 4XTRD 3QRFM 4X6DE 3RX5A 1ITCA 1GOHA 2BRRH 3LIZH 4HS3A 3QNYB 4LCYA 1XGPA 5H37G 3EOAA 4XPTL 3QNXA 5JOEA 1DUYB 12E8L 2JELL 2O26U 4CADB 3P30L 1YMHB 5AYUH 4ZS6D 4P5KA 1V7ML 3IDNB 5A2FA 2ADJB 2MJWA 4JY5L 4KKBC 1GL4B 1KPVA 2NLJB 3MJ9A 2E5EA 5JR1H 1TLKA 1G6VK 1LQSR 4GOSA 2B20A 3H9SB 3OAZH 1QFHA 4D0DB 4JZJB 3NAAH 2C3VA 1EO7A 4K94L 4ZFOB 2AJZB 1KCRH 1FCCA 4M61A 5CCKL 4X6BA 1CGWA 1YY9D 4U1LB 1BIIB 1IFHL 1F90L 4XNXH 2GSIB 3GMNB 1AO7E 5TF1L 2V2WA 4HKXB 3ARSA 4RA0C 3F5WB 3AY4C 1FRGH 2AJUL 2HFEA 4TVPD 4HUXB 4I77L 3V79C 2XQBL 4UINH 5BXFB 4AIOA 1NLDH 3SJVA 2VR9A 5DS8B 4OAWB 2VSDA 1LD9A 4YHLL 5D7IB 1JF1B 2GK2A 4NCC1 4B50A 2E27H 4ZDHB 5HI5C 5E5RB 2JB6A 3RY6C 4PJIB 1M7DB 3VXUA 4Q7DA 4XBGA 1M05B 1BD2E 2E8YA 2AQ3A 1SM3H 4MZ2A 4F7MA 4ZOBA 3C5ZB 4ZTPL 3LRSA 3P77A 1QHOA 4YDLB 5C86A 2NMSA 4E41D 4Z95H 2Q3AA 4LSUH 3VCLB 3ZE2E 1G7IA 4QOKB 4QRSA 1CXHA 1HSAA 1I1YA 2PYEA 3MUGB 4Y4KC 4KTEH 4AEHH 2QADB 3IDMB 1WBYB 3L9RB 4DK6A 4X6CA 1BFVH 4PR5A 3O6KL 1VKXA 4HZLA 3GNML 1CGVA 3D18B 1KELL 4XMLL 4NQVA 4WWKC 1RZKC 4R4BB 1OAZH 4PGDA 2P5WD 2XICA 3O3UN 4O2EA 4XPGH 2AEWA 2J8UF 4FQLL 5IMLA 3TNMB 3X14A 2X9YA 1ED3B 4PS4H 1A7PL 4D3CL 4JREB 4PRBB 5KOMC 2B1HH 4OCYL 2FR4B 3RIFK 4JR9H 4HEME 5F71A 4JKPH 4MAYC 2J3SA 3P9LA 4U7MA 4XMPH 1FSKB 4MVBD 2VDNH 5M7QA 3MREA 3C8DA 3X3GH 4JY6B 3QXAA 1D9KD 1GPOH 3AAZA 2I9LA 4NN5B 3MYJB 2DRUA 4WW2B 3I3EA 1U6AH 5FGBA 2ZUYA 3FTGA 1ZSDB 5I1GH 1R5VB 3GKZA 1CT8A 1MAJA 3F7RA 3HNVH 1IT9L 3BZFA 4JO4H 4JY4B 3GHBL 2W92A 4NRXA 3WDJA 3TBYB 1DP0A 1K85A 3BMVA 3MJ6A 1KV3A 5C07A 1RIVH 4NQDD 3MOAL 1IGCH 4WUKL 4L8CA 2VDLH 5AUMB 2LU7A 3BP6A 5E2TL 5HBBA 2YXMA 2IQAA 4LCUB 5EWIL 1MCOL 2XZZA 4RDQG 2VQUA 3MRRA 4W70A 1NAMH 1C5DA 1MWAA 5KJRL 4G8FB 3FFCB 4GAJH 1MJ8L 2DKSA 1MCRA 1M1SA 4G7VH 2G60H 5IR1B 5L2KB 1JCKA 1MCHA 1WWAX 4QHKI 1G6RL 1CGUA 1MLBA 4KZDL 3VH8B 2BVQA 4X4XA 3ARED 5E8NB 2DKUA 2NPLX 1MCWM 3NGBB 1E4WH 4TVPL 1MVUA 3CLEH 4PJDF 4M6OL 2AW2A 1AXIB 5K9JH 2CXGA 1E4XH 1P69B 3F58L 4KJQD 3GHEL 1JHTB 1K8DA 1HDMB 2JJTC 2FJHB 4Y19E 1UM4L 1MAKA 4XNYH 1C7SA 2CUMA 1VADA 4BZ1H 1S9VA 5DMJB 5F1IA 5EUOF 1KGCD 1QBMH 2X4RA 3QP3A 4JG0L 3G08A 4FQHB 5IESH 4KJPD 5CINH 1BOYA 4DN3L 4QTIH 2NXZB 5GS2D 4DGIH 4EI5B 3QFJA 4R8WH 3S97C 4NT6A 4FFZH 2Z91A 3FOMA 5DLML 2AJYL 1XZ0A 2QKIA 2X1OA 2X89D 4JQVA 5F7DA 5JXEA 5B38G 4HWZB 4ENED 1Z5LA 1RJLB 4JRYA 1VB9A 3IFNH 4LMQE 1KJ3H 2NY5H 3DNKA 3V6FA 1S78C 4YAQA 3CLFL 2R2EA 2E7LA 5C08D 3BPCA 2WK2A 4UT6L 2HLFC 5FA4A 4BSVA 2JIXA 1N3NA 4O4YH 3ZSTA 1DANT 5E94B 2EDXA 3DMMB 4OKVA 1YQVH 3L3OB 4PJ9D 5DMYA 1QNZL 1EPFA 4EUPH 3QZWA 4X4YA 5ESVA 4NRYA 4NN6C 4IRJD 5HYJB 3H7BA 4NO0B 4GG8A 2R1XA 4NRZA 5ISZE 1I8LC 4FQQB 1S7XB 4M7LL 5B8CC 3B9DA 4KI1A 3F65A 1MOEA 6FABL 3C9NB 1HHJA 5FK9B 3EJZC 1A64A 3MLXH 4GS7C 2IAMC 1I3GH 3TJEH 1MCEA 4H8WC 4D2NA 5MEOB 1I1AD 1P84K 2YC1B 2BHZA 1QLRA 3G5XA 2Q20A 1P84J 4LIQL 1KCSL 1WJ3A 3HE7D 4JFOA 3OJ2C 5DFVD 1GCFA 2PXYB 1BQLH 5C0JB 5C0FA 2BP3A 2YHGA 4JANB 4F9PA 4M6NH 2VLMD 4GRMB 5F9AC 1F11A 4F7PA 4YDVA 4YEFA 2BZDA 1P2CB 3OZ9L 1IZJA 1JBJA 5IQ9B 4YPJA 4PGEB 2YR3A 4TNVK 3SN6N 4JHAL 4TPRL 1MF2L 1RMFH 1ZGLB 1EERB 3WFDL 4MA3A 5CILL 5ALCL 1N6QL 4N1CA 2GTWB 3PGDB 4U1MB 4F37F 1CU4H 5CJOL 2HKHH 3OKEA 3QIWB 4CADA 1YMHA 3C09B 4Z0BH 3IDNA 4EUPB 1PY9A 4XP6H 1F00I 2UY6A 3MZGB 1ZHNB 3ZE1E 4MQXC 3H9SA 2GIYA 5H37H 4JZJA 2RCSL 3MNZA 1BX2A 5MI0C 4KK5C 4P48A 1MNUL 2Y5TA 4DW2H 4Q74A 3H3BC 4FABL 5DUPH 1ZLUK 1FH5H 2OJZH 4U1LA 2VDRH 3L5WA 1LK2B 2WQ8A 4O2FB 5I73B 3S9DB 4HKXA 3PWLB 3QEHB 4K7PX 1DEDA 2VISB 2JCCA 4PJGE 5J7CC 1WBXA 4EBQL 4JFHD 5BXFA 3O9WB 4U6TA 4KV5E 5C9JA 1CFSB 3DRTA 4OAWA 3T3PE 1JF1A 2EH8H 4XVJH 4RQQB 4Q9CA 1MJUH 4N5EC 4KKBD 2XA3A 3UTZB 1K3IA 4PJIA 3O4OB 4P9HL 5FB8A 4F33B 3CX2A 5HHOB 3QIBB 4UV7L 3O2VH 1MI5B 4NZTH 5DEZA 4IIQC 4I0PC 2X4QB 2JF1A 4MXWH 4N8VB 5GRUH 3C5ZA 4K3EL 1R3HB 4LSQL 4NN7B 5HHPB 4RFEB 2CO7B 1U92B 3VCLA 5I76B 3TBVB 2VDQH 1JI2A 3OHXB 3QIUC 3RY5A 1RZ7H 3S36H 1WBYA 4RMRA 5AAMA 2FCBA 3VRJA 3UCRA 2V6HA 1FO0H 4JRXA 3KPRA 3TFKC 3OKYA 3WFCL 5HI5D 1OWWA 3D18A 3J8F7 2E9JA 3O8XC 2LE9A 2Q7YB 1WFOA 2QQKH 4R4BA 1MHHB 4HK0A 4QGTA 4NJAH 4ORGB 1EDQA 5FYLH 3ZT5A 4CUCA 4KKNA 4BUHA 4JFDA 1ED3A 1CE1H 2D3VA 4PRBA 3BIBX 3BD3A 3BEWB 5EZJA 3LB6D 2ENSA 2NZIA 2I07B 32C2A 3HE6D 1KN4H 2MQ3A 1ZWIA 1C08B 1JRHL 3PWVB 3RBSA 5DHYB 3PDGA 5IHZB 4X4ZA 3K4AA 3MYJA 5HSFA 2YK1H 3BD4A 4PJ7F 4JPIB 5T3XD 1R5VA 2Z8WC 4NZDA 5CP3A 1RIHH 3EYUL 4JY4A 4DVBB 1KJ2H 3G6DL 3J7HA 2G2RA 1NPUA 4YPGB 4XMKH 3TBYA 1L7TH 1KYOK 1WZLA 5DI8B 3K3QA 4D9RE 4DKDC 3P0YH 2ZCKL 1A14L 1KC5H 4OLWL 4M8QB 3WS6C 5I1LB 5TPWL 4ZAKD 1IAII 5AUMA 2OXHA 5DJYB 1R24B 5A3ID 3FONB 3TVMC 2XN9E 1IC4H 1BQSA 3BPLB 3IJYB 1AJ7H 2CDGA 1EGJH 2EKJA 4KI5C 2J4WH 4UTAH 5GS3A 3U7AA 3FFCA 1PG7W 3ARGB 1VFMA 3MFFA 1AR2A 3PWPD 5DD1L 1T66D 5HGAB 3C6SB 3EDDA 3RUGE 3HAEA 3ZYZA 1JNLH 2VXUL 5JW4R 3JTSB 4ETYA 5E56A 2YWZA 2Z92B 5ID1B 4Y1AB 4P2RA 4GQ9H 4LCCC 4WJ5B 1S5IL 1CR9H 1EX0A 4PRHD 3U83A 1MUJA 4ZUWA 5A2KH 3OGCB 3LCYA 4ISVB 3WSQL 1V3MA 5EU6B 2ED7A 4WI8A 1JHTA 3MYZA 4PP2A 1HDMA 3DXAD 2FJHA 2B7DT 3U0PB 2FIRT 2ARJA 2A83B 4LKCB 3B4NA 1QA9B 4OCSH 3PGFL 1UCTA 2HT2C 5I17B 5TH2B 1FV1B 3NIFE 3TV3L 4KDTA 2YPLD 5HY9A 1ORSA 5T1DH 1BZ9A 3S88L 2EH7L 4FQHA 3Q6GL 43C9B 1T1ZA 5GPRA 2GJ6A 3PUCA 1QLEL 1SVZA 1FYTD 3T3MF 3OX8B 4DZ8B 1U2HA 4HXAL 3L3JA 4EI5A 4YQXL 5IMKB 4OF0A 3PJSB 4HLJA 2AEPL 1PG7L 1QSEE 3VGHA 5IVXA 3IFOB 4OGXH 1DQDL 2ICWA 3ARPA 4LVNC 3GI8H 2X1QA 2FL5A 2YD9A 1NCUA 3Q6FA 4WNQB 3MLZH 1CE6B 3RWCB 1RZ8B 1NSNH 1SJEB 1N7MH 2N1KA 1NUGA 3GZKA 2V5TA 3OJDB 1A0QL 4O9HH 3BZEA 4J3VA 4F58H 3QA3B 4Z6AT 5D72H 5E94A 4HG4K 3DMMA 1KSRA 3MRHB 1K4CB 4HUVB 3QI9A 4DN4L 4HG4J 2X4SA 3X11A 4E0RB 1KG0B 5HYJA 3MACL 1L0QA 2VIRB 3P4MB 4FQQA 4AL8H 5I15L 1S7XA 4Z7UE 3MXVH 2PTVA 3ORJA 3O6FB 1SJHB 5FK9A 3JUYA 2QHLA 2VZ1A 2Y23A 3HZKA 3LKSB 1WZMA 1J88A 4JFYA 1G6RB 3LKPA 4LSDA 2OI9B 3P73B 4XC3L 1T0MB 3WCYA 5T3XL 3LAFA 1JZ5A 4QCIA 5C0JA 4IJ3B 1R5IA 2DQCH 2I26N 1RZKL 1G9NH 3KVQA 4G80A 5ANME 5CJ8A 4JANA 5EBMA 5IFAL 4NIKB 1LILA 4H0GA 5E03A 3JWOC 1J1XH 4XPHL 3LKNB 2ESVD 1DLHB 1A4JB 5DFTA 3U7YL 3CXHK 5IQ9A 1QSVA 4BZ2H 4PRID 5E70A 5F7WC 4M1GL 3CXHJ 2AEIT 3D39A 3BGMB 1TVHB 3DGCR 1V3KA 1ZGLA 2IAMD 3N1MC 5DD6B 2Q87A 3PGDA 2NCMA 4U1MA 4WFGD 3L3KA 3MBXL 3UBXG 2YPKB 5E6ZA 1ZHKB 5CEYA 1GGBH 4OM0L 3GGWB 3MJ9H 4OBSA 5BW7A 1A3LH 4J3UA 1AXSB 4Q9RH 3IAGC 3FQNB 1FYHB 1G7HB 1JPGB 2XYCA 2FX8L 1UH2A 3FRPA 4WV1B 2HFTA 4CL7A 4BELD 4XI5C 4LCIL 2NW2A 1FORL 3BD5A 1Z0MA 1OP3K 1RUAL 1XEDA 4O2FA 4BQCA 3HRZB 2IH3B 2GHWB 3AMKA 1VACB 4LSTH 2VISA 1OGAE 3RWIB 1OCWL 4ELME 1T89C 3CH1B 5CWSB 4I9WE 1CFSA 2QR0A 5IEKA 3QJHB 1RK1B 1FFNA 2GTZA 4JM4L 4XH2A 5FCSH 1PLGH 3TCLB 2O5XH 4RQQA 3OAUL 1I7TB 4JDVB 5CIPB 2AJXH 1GIGH 5C0BE 3VWJC 4JVWA 2X4PB 4RGMB 2UWEA 1MRDL 1TDQA 4GKOA 1D9KB 2JJSA 4F33A 3NCFB 4KK5D 4ONGL 1MCKA 5EOCJ 1MI5A 3RP1A 4R3SA 2VLJE 2QQQA 3LPFA 4EXPX 5HHPA 1G1YA 4Y16C 2AI0H 4CU6A 4MA7L 3ULUF 3OHXA 1YEGL 2AXFA 4NM8L 3KPOB 1KXVC 3V6OC 5SX5K 2DQGL 2CH8A 5IV2B 1HE7A 1Z9SA 4MAUH 5DMIH 5K33A 2V5MA 4OIAA 4PB9H 1D5BB 4GRLB 4Z5RB 3N85H 5KW9H 4D0BB 4OCWL 4WTWA 4NO2B 4N5ED 1MREH 2VDPH 4YHOL 1RULL 4OZHF 3HTLX 4P5MA 3UTTD 1MHHA 3BIKB 1NGYA 4PJXF 3MGTB 4JM2C 2OYPA 4GXVL 4KQ3H 4KHXH 4I0PD 3LEVH 5ICYA 3KYKH 4XNZC 3VXTB 2FEEL 3HMWH 2CJUH 2H3NA 2B1AL 1RZGB 5J9PB 1RZJH 2C4XA 1T83C 3QIUD 1IQWH 2VZUA 4Y88A 3GIVB 5B39A 2XQYK 5TGBB 3VFMA 3RDTC 1EO5A 1K6QH 4V2CB 5IHZA 5DUMH 4S0SD 2QQLH 3BQUC 2DI7A 4RX4A 2QQNL 4NSKB 5FA3B 1QO3B 2JJWA 4JPIA 1EMTL 2FB4H 1KLFA 2D7QA 1DVFC 3WS3B 4JPWL 3RHWF 3U82B 1MCPL 2DQFB 2VDKL 3OF6A 4I5BB 3O8XD 4HKZA 3R06B 1OSZA 4NP4L 4DVBA 4WHDA 1JNNH 1J0JA 3OR6A 3V6BR 5DI8A 4K3JH 1JI1A 2PCPB 5DMGC 4DOHE 2QV2A 2EDHA 3HAEG 4R90L 2A6DB 5I1LA 3CFBB 2VERN 1QFWI 3M8OL 3FONA 4PUBH 3MV9D 3DX7A 5BV7C 4NKIL 3MRFB 5EU7C 3KAAA 1U91A 4XBEH 2NY1C 2XZAH 1LGVA 4LFHD 3S37L 1MFDL 3B9KA 4GW1A 4MJID 1ZANH 3EJJX 3U4AA 5L8JB 3ARGA 4MS8C 5F9WB 3DUSB 3QG7H 4OCLC 3RGVC 3W5NA 5HGAA 2AJVH 3TH2T 1NFDE 5C08B 4NDMA 3MROB 5E24E 4JO1L 1CF8H 2DQEH 1P4LB 3Q0HA 5ID1A 2NY7L 1AKJA 3F6IA 4Y1AA 5H2BB 5FDYA 4UOW1 1HNGA 2GK0B 4PJ9B 4Y5YB 4MDIA 1KENL 3MNVB 3AGVA 1I9EA 2XG4A 5D2NC 3Q5TA 2VDOL 1S8DB 4L4TD 4ISVA 5GS0D 1YNLL 3REVB 5EU6A 3SE4A 2G9HB 1VEOA 5ISZB 4XX1E 3TVMD 5HGGS 1FIGL 1K8IB 1H5BB 3FL7A 5F8QC 1DQQB 4KI5D 5TH2A 5I17A 1FV1A 2ZNXA 5MENE 1J10A 2BOCA 1LDSA 2ZCHL 1OTSC 1QEWB 5KVDL 4AYFA 3DROB 3HE7B 1YNTA 4Y2DC 3OX8A 4HFUH 2Q8AH 5IMKA 3PJSA 4LRNH 5EZOL 1YECL 4LASH 3VXSD 1A6WH 1WFNA 2FNBA 2DL9A 5D7LD 1AC0A 4BKLB 4XWGL 5CZXC 2YWYA 2E7CA 3OKDA 3D48R 5C0IB 1LO5B 2HP4A 1F97A 4KMQA 5SX4H 2EE2A 4WNQA 3ARXA 4N0UE 1CE6A 5D1QC 1RZ8A 3GSXB 1SJEA 1CDBA 1UH3A 2MOVA 5C2UB 1N26A 3H3PH 3OJDA 2HT2D 3DGGB 3EO1B 4X9BA 1FGNH 1MCBA 2IANE 4Z0XA 1XCQA 4I0KA 2OR8A 4F80A 4DKFH 1T21B 1F6FB 2ZUSA 4PD4J 4WUUA 5IB2A 3WN5A 5IMMA 2YPVH 3H9YA 5FUOL 3ZHKA 1D5IH 4E0RA 1KG0A 4LAQL 2G5RA 4C56D 4LARH 4QXUL 1UH4A 2P8MA 2VIRA 3P4MA 4XHJC 2EZ0C 5C0RH 4CGTA 4PRNB 3I9GH 4N1EA 4X83A 5I1EH 1SJHA 4OLXH 5DVMA 4K8RH 4NUGL 3VFGL 1DBKH 1MCCA 2MKWA 3O81A 4KRPC 1JHLL 2BFVL 4MDJB 1G6RA 1OHQA 3E2HB 3SGEI 3P73A 2DLEA 5J11B 3HNSH 4MD0A 5E99H 3KPSD 2A73B 2OP4L 2WAHA 3IRZA 3QT2A 1IGJA 2P4AB 2NTSP 1R3IH 4K3DH 3VRLF 5FOBA 1U3YA 3KJ6H 2Z8RA 4I48B 5CEZE 4OZGA 1NCCL 2IALB 3ZDXF 1JP5A 3LKNA 1DLHA 1FFPB 2ZWLT 4R97B 4XAWL 3B9VA 1JGUL 1A4KA 2F54E 1Z9OA 1LP9B 3FRPG 1TJHL 1A7NH 3IAQA 1VERA 1GHFH 1UACL 4NQED 9CGTA 3NVQA 2R0KL 3MFGB 1MIML 3DVNB 43CAB 5A16B 2YPKA 4AG4H 4K23H 1ZHKA 3GMLB 4PJEF 3GGWA 4E41A 3VW3H 3LOWA 2DL2A 3PF2A 1TIUA 2X4UA 3DOSA 1BHGA 1AXSA 1MRFH 1IGYA 4G6ML 5HHXH 2YUZA 5T5FH 1G7HA 2FHFA 1IKNC 4GMSH 4PJHB 3K4ZA 4DUWA 3IVKB 1FFQA 4NWTL 4HC1L 1UA6L 1JPSH 2YUVA 1T1WA 1OAYL 3FT3B 4HPYL 1CD1B 2J1KA 1NKRA 1T5XA 1ZEAH 3G5ZA 1II4E 5GS0L 2PW2B 2IH3A 4PJAA 5CAYB 4OLVH 1JGEB 1X5HA 4H1LH 2P5WA 3IKCB 3LMJL 3RWIA 3S35H 3IU4H 3EFFB 1FG2B 1I8KA 1LO3H 3FB6B 4JB9H 2HJKB 2XPGA 3CH1A 5CWSA 4WENB 4TSCL 1KCVL 1FAIL 3QJHA 1RK1A 4NJ9H 3D9AL 1CFTA 4RAVA 4QEGA 3TCLA 4P3CH 3U1SL 1SHMA 5CIPA 1NDGB 1SY6L 4Y4KB 3D1MC 4PBXA 3VWKD 5ICXA 3WNPA 4NKQB 1D9KA 5F3BA 3HFML 5D2LE 4JAMA 4XI5D 1WICA 4WUUE 2F53D 3OJVC 2K9UA 3SQBA 5C0GB 3X17A 3U7WL 4PGJA 5BVPH 2ADFL 1IC5H 2IQ9L 3IYLW 1CZ8H 4G7YH 4WWKB 2HRLA 3JV4B 4CW1B 4QHKJ 3CPLB 3LN4B 1JZ2A 5T3ZE 1OAKH 5CJXA 3KPOA 5DT1H 4OJFL 4MQTB 3M1BB 5HTSA 4GG6F 5FO8B 4NQDA 3X3FL 4MAYB 1INQA 3FOLB 4Z5RA 4X9HA 5FHBL 4H20L 4NO2A 4JQXA 5B39G 3VWJD 1Z9LA 2HAZA 4KZEL 3BIKA 4QXTB 4UU9B 4OZGE 4UB0L 4APQC 1MCFA 1ND0A 5EN2B 3KYNA 2F8XC 3C5JB 5FXCH 4H1LB 4QXGH 3GSWB 2UUDH 3QO1A 4LKXB 3QJFB 1AI1H 1YEEL 4RFOL 3IFPB 5I16B 4WTZA 4LVOC 5J9PA 4BSVB 3AREA 4ONFH 2WIIA 3TA3C 3GIVA 5I2IB 3U2SB 3G6JE 5IVZB 4LLWB 2LU3A 4OSUL 2HYMA 2N7AA 5FA3A 3KLAB 4LSPL 4K7PL 5CEZL 3OB0K 3ZYOA 3KWWB 4PV9B 2DQFA 2CGRL 3ULVF 1T2QH 3DXAB 3R06A 3FB8B 3W11C 4UBDC 4XZUA 4R6UA 4FNLL 4HGWB 3MUY1 4OZFB 4RAHA 1ZAGA 2J8HA 3PWUB 1PKOA 1YA5A 5JQ6H 3RAJL 2BNRD 5LGHH 3V9FA 2YPLB 5KANI 2PCPA 4H26A 2KPNA 5GISL 3C6LD 4LPXA 2DD8H 2L4OA 3CFBA 1FYTB 4P2QD 4QKXB 4LRIA 3V0VB 2F5AL 4FFYL 3RDTD 4UI2A 1JE6A 1FGVL 3NA4A 2X89A 4JFQB 1QSEB 3BQUD 5FKAA 1NBVH 3HAEH 5J3HC 1NCWH 3JWOL 1DVFD 2EIZA 3DUSA 1HHIA 3FAXA 2DLIA 5C08A 4PGCB 1SYSB 4YHPA 2Y5EA 1C1EL 5JHLH 1RIUL 1G7QB 4ZS7H 4HS6B 1HCFX 3QYCA 3NCYS 3UAJC 5H2BA 4GAGL 3OGOE 2GK0A 3FN9A 4PJ9A 2P48B 3EUUA 4HIXH 5DMGD 5TDPB 5C9KA 3E8UH 4Y5YA 8CGTA 5DJDB 5T33H 5M94B 4IRJA 1S8DA 3BP4B 3REVA 5EU7E 2G9HA 2IPTL 4HJ0C 1W8NA 1K8IA 4Z7UB 2R2HA 1FVEB 1T22A 3QUZD 3UP1A 4JJHA 1U8IB 3NTCH 1I1AA 2EC8A 5FAAA 3VXPB 4MS8D 4JHWH 3G9AB 4U33A 4RRPA 3RGVD 5ICZB 3OKKB 3HE7A 3VG9C 4S1SH 3ZYJA 2W91A 4P2YA 1NUNB 5D71H 1NCDL 5FYKH 1XGQB 5TE6L 3V5KA 3V52H 4IS6A 5ANMB 2FJFB 2BY2A 1U2CA 4FFVC 1WZ1H 5F96L 1OAUH 4WWID 2XV6B 1YJDH 2ESVB 4NN6B 5F3HB 3CNKA 5C8JA 5TQ0H 4BH8B 4F3FB 1LO5A 1UM5H 4ZO8A 4X7SH 2BC4A 4PRIB 5B8CB 3GSXA 1NJ9B 1JGDB 3ECBA 3DGGA 4GS7B 1HCVA 2IAMB 5I30H 8FABB 1YY8A 4L3EE 5KVGL 3ZTNL 5GRZA 3KS0J 5HDBE 3QHTC 1OTSD 1DDHA 3FB7B 5IW6B 5I1JL 1C16B 5DHVA 2YS4A 1E4JA 2ZOLB 3FQUB 3T2QA 3V4PL 4PG9A 4UILH 2D4DA 3U9UA 5C3TA 1DSFL 2BK8A 1FNLA 3U9PL 2QSCL 4HBCH 2PNDA 4PRPE 5GGUB 3MC0A 4O58H 3SGKA 3ARDC 3CGTA 4MDJA 5H94A 3U36A 1I85A 2HRPL 1KIRB 2AVGA 4PJFB 1OAXL 5D1QD 2O5ZH 2DTSA 4PG2C 4EOWL 5I66B 2A73A 4NUJA 3LRHA 3NIGE 3DVFA 1A9BB 1K5NA 1U93B 3I3BA 2AEQL 1OGAB 4I48A 4LCWD 5LBSH 4ELMB 5AD0A 2ZNWA 3O4LE 1FFPA 2IEPA 2XNAB 1TZIB 4XHJD 4QLRA 2EZ0D 3RBGA 4KVCH 4PGZA 1IAIL 5HHNB 5JHDD 1MQKH 2ZSVA 4GMTL 5EC1A 4XXDA 5C0BB 1LP9A 2DLGA 1WCBA 3ZHLA 4G8IB 3MRBA 1IAMA 5MI0B 1MHPL 4HUKB 1HXYB 1MJJB 1YPZE 1NBQA 5FHAL 4Z18A 4KRPD 4XP1L 3DVNA 4DTGL 5HVGB 1NEZA 1CDHA 2H26B 1VFUA 3GMLA 1DE4B 4GKSB 2DBLL 3SKNB 3MV7E 4KRMB 2L7UA 3GM8A 1MFCL 3AY4A 4JFPB 4K3GA 5JLZB 1FDLL 1BM3H 2PW1B 1WWCA 5BZDA 2Y1VA 1N5YL 2AAVA 2DQHL 3V5DA 4ZSOE 4BSWB 4G43A 4NCDA 1JWSB 4PJHA 2CLRB 5DEGB 4ODXA 2BY1A 1XF5B 4AM0B 3FQTB 4WI9A 2N56A 1KLUA 4L9DA 4FS0A 4MB5A 3RY6A 3KPPA 3UTTB 3VFNB 3TJHD 3BXNA 5BV7L 4ZFFB 1FHGA 3IKCA 4R0LA 1UWEH 4XNQA 3VXRE 1IC7H 4IIQB 4I0PB 1V7NH 2P24A 3PDOB 1CLZL 4WDIB 1FG2A 3FB6A 3GSVA 1FE8L 3ME0A 3QISA 3CU7A 4JPKL 1EVTC 1EXUA 3ARBD 1DFBL 4N8CL 5KSBE 3HE6A 4U1HA 1G9MC 2X40A 5F9DC 4GLRI 3UZQA 3QIUB 1A6VL 4L5FH 1WQVT 1ZTXL 5DD5L 1GZPA 2QHRL 1INEH 1NBYB 4EI6B 1EV2E 3C2AL 1C5CL 3EW3B 3BDYH 3BPNC 3I2CL 5ESQA 4P2OC 3WUWG 4QRTB 2FO4B 2RB8A 3GUTB 1KIQB 2IF7A 5IOPB 5FCUL 3UX9B 2FLRT 4XPAH 2AJSL 5IIEB 5JW3H 3GMQA 1S9WB 1LEKB 1Q9KA 3JV4A 3CPLA 1B0WA 3LN4A 3W0WE 4ONOA 4POYA 1XGUB 2UZXB 3GBNL 1FL6B 3ZYIA 1WWBX 2CRIA 4A6YA 4M1DL 3LV3A 4U1SB 5FO8A 5L8LB 3V6ZB 2QSVA 1U8LB 2O5YL 4WTZG 4DOHB 3ESVF 4S2SA 3RTQC 5DQ9B 3JWDH 3BISA 4ZAKA 1ZT7B 4QRPD 1P4IH 5ITBL 3O3EA 3DX6B 3PG2A 5D6CB 1WAAA 3PDDA 12E8H 2JELH 4X7EC 3OB0H 5J1SC 4G3YL 4Y5XB 2WWKT 1A5FL 4D8PA 5EN2A 1XGTB 4MJIB 1VFAA 5F7KC 3PWPA 4LKXA 4LLYA 5DRNB 5KSAC 2L0DA 3OAYK 5J1TC 1NFDB 1U8OB 4LK4A 1N5AB 4PYHA 3LVEA 3MPCA 3U2SA 2YRLA 5H8DA 1IFHH 4A2LA 4RMSA 1A1NB 1SYVB 3EKCA 4HUNB 4LPTA 1SMAA 3NABH 4ODHL 5GRJL 1CFVH 4PRHA 4I4WB 4LLWA 1AHWB 2ADGB 3KLAA 3WFEL 5FO9A 4AJ0A 4L4TB 4CN4A 4XPBL 1T1XA 4PV9A 1HHHB 4KJWD 3DXAA 3TVMB 3QUML 4WVRA 3SDCA 3GEWB 4G5ZL 1J7VR 4APQD 3K2UH 4JN1L 5I71C 2YPLA 4OIBA 3T8XB 3D2UD 4NC0B 1BQHA 3MBED 5IK3B 3QUYC 4YWGH 1URLA 1LMKA 1UZ6F 5J6GA 5F93C 4AT6B 3S3SA 1FYTA 2R4SL 3V0VA 2V5SA 4TNWK 4ZTPH 1Q94B 1ZMYA 1OLLA 4LCCB 5E4EC 4X6CF 1NGXA 1VDGA 4JFQA 5D7LB 2XZCH 2VE6B 2EDQA 4ZO7A 3OXRB 1OARH 1KUMA 3QNZA 4LLQB 1AH1A 1IGFL 1OAQH 4PLKC 1RZFH 1UCBH 2XIDA 3P40A 4FXKB 2JJTA 4N0UB 2OBGA 3W11D 1M6OB 4X9IA 2B4CC 3A0OA 2VOTA 4YXKH 4D0CB 1IL1B 1G7QA 3GNMH 3DI2B 4MD4A 3VGEA 2D0FA 3E0GA 2J8UE 1LNUB 3ALPA 3DX9A 5D1XD 5BS0D 4X98B 5TDPA 3MLRH 5IJKA 1FIEA 3BSZH 2VXTL 3N1FC 4MNQE 2OR7A 1WITA 4C56B 3EYOB 1NFIB 1KB5H 3WKNA 3VGFA 1A7PH 2A6KB 1TITA 4QRRE 4Z7VB 2OK0L 3OKOB 1PYWB 4K2UH 4FA8A 1LE9B 3S34H 1FVEA 5DC4B 5EB9A 4LVNB 1X4YA 1Q38A 1RUPL 4YE4L 5HDOA 5J3HD 2DWDB 1L0YA 4GUPB 1DQML 2ZUUA 1FLRH 3CZJA 4ZXBC 4NKDB 2Y25A 4JDTH 2KBGA 3KPSB 2ADIB 2DQJL 1AGFB 5EO9B 4R4FL 2YN5A 4WW1A 5DK2A 4J4PD 4S1DC 1XGQA 2FYYA 5DJ8B 2B0SL 4M9OA 4M5ZL 4KC3B 5DO2C 5JDSB 2ESVA 3A6CL 2J5LB 2NXYD 3AU1B 1OM3L 4BH8A 4F3FA 4FZEH 3MLSL 1I8LA 4Z8FL 1MJ7L 3TT3L 4PRIA 5B8CA 4HJ0D 3UPRB 3CZFA 3O2DL 2HVKA 1F3DJ 4QWWD 3EO9H 1JGDA 2OL3L 3QFDB 2F54B 3QCVL 4NQEB 4Z78B 2IAMA 1KPUB 3SOBL 3CD4A 1YDPA 4NKMA 3UDWC 3BH8B 4OFVA 5E2TH 1E28B 3DHJA 5I1CL 3FB7A 5I9QC 2WBJA 5K9OB 4LQFH 4GSDH 2ZOLA 2NTFB 5T3ZH 3FQUA 5GHWL 4ETQB 5BQ7B 4ZNEA 4Y0GA 2W0FA 1MJ8H 4UNTA 3OJMB 2HLAA 2Z93B 3S5LB 3FQXB 3MCKB 2VR4A 4TUJB 4WU5B 4FFVD 4PJDE 2BDNL 1ES0B 3H2WA 1BIHA 2Z9TA 2DIAA 2GEEA 2DLHA 4YH6A 3HCVB 4JFED 4PJFA 3ZKSD 4M6OH 5I66A 1BECA 2ATPB 4JVPA 1A9BA 1BJMA 1PSKL 1U93A 3UJJH 3O6LL 1JGLL 1NEZG 4ZUVB 1D6EB 3CCHA 5EUOE 5IHLB 4PJ5E 4W6YB 3H8NA 4ODVL 4OLYL 1VSCA 1O7SA 1FG9C 1RQ5A 2VLRE 2G5BA 3H3KA 1QFWL 5HHNA 3FO0L 1SEBB 3QCUH 4JG0H 4D9QE 4S1RH 2BMKB 1HXYA 2HN7B 1LDPL 1MJJA 5JOPE 2AERT 3CX5J 2F53B 5D2LB 1I1CA 1W0VA 3GK8H 1P4BL 3ARDD 2OM5A 4PTUA 3L7EB 3B9EA 2H6PA 1HH6B 1S7WB 1OY3B 3SKNA 1A6AA 3LPGA 2Y6SC 3ROLB 3BVNB 1JV5B 1N4XL 1LO4H 2C5DC 2H45A 3MNWA 4WFEE 2PTTB 3GBMH 1K2DB 1JWSA 4U6VL 3WL9A 5I1HL 4X80L 5DEGA 5AZ2H 5BRZD 4AM0A 3FQTA 4WHTB 2R29H 2Y06L 5ILTH 1I7UB 1HIML 2V7NB 5DR5H 3VWJB 2DMCA 3RA7L 3VD3A 4O5LH 1KTLA 1G7PA 3UTTA 4YC2C 1XAUA 4ZFFA 3DO7B 4IIQA 5HHMD 4AEIL 1Q0XL 1J0IA 1N0XL 4FQ1L 6FABH 2CD0A 1EEYB 2CKBL 3I85A 4U31A 4Y16B 1HYSC 3DYMA 3IF1A 3PABB 1MEXL 4OZIB 1DQLL 3QIUA 3VD7A 3K8MA 4W4OC 4XC1L 4K9EH 4NWUH 1NBYA 4EI6A 2A0LC 2LVCA 4HXBL 3UO1L 5J6HB 1JPST 2P8PA 5DXWA 4MLSA 5IOPA 1SBSL 5GSRA 4ZD3L 3BDXA 1PFCA 3O8XA 4U3CA 1T04B 1Q9OB 2EYTA 4TN9A 1J0ZA 2R2BB 2DJ4A 4JM2B 2VL5A 5IG7B 1XGUA 2BNRB 1FL6A 4XNZB 5F1NB 4XP4H 3V6ZA 4LSVH 4P2QB 1ZT7A 1YEIL 3MV9A 3RDTB 3F12B 3LH2L 4R4NC 5D6CA 1D6VH 4XAKD 2FX7L 5DJ0B 1A6TB 1JF5A 1G7MA 3BQUB 4IMLB 4P2OD 3OWEA 1XGTA 2YBRB 4MJIA 3HC0B 4FQ2H 5IBTL 4OCRL 3IXAB 1DVFB 1V05A 2YD4A 1R0AL 1EHLL 4XVSL 1GAFL 1NGPL 1ZHBB 5DRNA 3ZT7A 5GJTL 3UTPD 2JCCF 1U8OA 4FABH 3ULUC 3S96B 4MHHG 4HC1A 1SYVA 1BQHG 1XGRB 3O41B 2C7UA 2HFFA 4G6JL 1WBZB 4RAUA 3STZB 2HWZH 1GC1H 2GCYB 4K7FB 3UJTH 2ADGA 1U8MA 4R2GD 3KHOA 3RTQD 3HNTL 5BOPA 4L4TA 2XKNB 4PJIF 1QRND 2C9AA 4XCYA 1HHHA 5DEFB 3TVMA 5BV7B 3VFVA 1DQTA 4YHIB 3RZCA 3R1GL 2BNQE 2NY1B 1DUZB 4GW4B 4XP9H 5C09A 2GKIA 2ID5A 4OI8A 4CVWA 2R0LL 3RGVB 4AQ1B 5IK3A 3BHBB 1VFOA 2HT4C 5KSAD 3MCLH 4KRNA 5GGTH 4AT6A 5DJXB 5F88B 4K3EH 2YRPA 1Q94A 5ETUA 3Q3GA 3VXSA 4PJCA 2VDML 5T1KD 3IDJB 4KK8C 4L4VD 5D1ZC 5D7LA 3BKJL 2VE6A 4R96B 1C12A 1MCIA 1AD9A 2F58L 4LLQA 5D2NB 3WEXB 1EVUA 1ACYH 2P47B 2X41A 5DYOB 4KVNL 4HX1A 3SO3B 1B4RA 4WGWB 3WFCH 1IL1A 1Q72L 2CMRL 2HG5B 4FXGA 4LBEA 4MB4A 5DD0H 5IKCB 4X0KB 3P4OB 3D3VD 1LNUA 3EDKA 4KGJA 3V5HA 1OB1B 1BFTA 1QKZH 4QTHB 2QL1A 5ADOH 2VXVL 3VFOA 3QUYD 4Y2DB 4C56A 3EYOA 2M26A 3SE3C 1I7ZB 1BWWA 1IBGL 2A6KA 1ZT1B 1XR9B 4Z7VA 3HZMB 3RZWA 5I1AA 3NFSH 3OKOA 1PYWA 4DKEL 4UV4L 3GSNA 3A67H 3WFZA 2GSGB 2KZ1B 4NQCD 3P9MB 1YEJL 3Q1SL 2DWDA 4GUPA 4PJ7E 4PLKD 5KSVA 2NX5D 4KPHH 3TIEB 1MVFA 5D1QB 1VGEL 1OWRM 3ZKMC 4KY1H 3KPSA 4YDKL 4AIZB 4N90E 1OP9A 3KYOB 3NPZB 4LCWB 1INDH 5IFJA 4YHNB 1OD7A 3L3HA 1I4FA 2A74B 5IW3A 2FH6A 3LPWA 5CHNA 3EIFA 5JW4Q 5E9DD 1P7QD 3QUMB 1G9ML 5JHDB 3KDMA 4P9ML 1A14H 2YD5A 3MRIB 4JVUA 3QFDA 4ALAH 4NQEA 3MOBL 4UTBH 5HPMB 2VH5L 2PYFA 2JJUA 4G9FE 4CN6A 4KRPB 3RWGB 3LEYL 5DHVH 1C5BL 2AV7A 3B5HA 2IADA 1WC7B 4M93C 2D03L 4ZXBD 5K9OA 4O51B 3RL1B 4OLZL 2NTFA 4ETQA 3MR9B 5F6HJ 5EA0L 4IRZH 4NC2B 4S1DD 5KAQG 3S5LA 5C09E 1U95B 3HPJB 3MCKA 4U4BA 5IMOB 2WQRA 1H0DB 1Z3GL 3B6SA 5DO2D 1OF2B 2IBGA 4KUCF 5HDQL 3TWCL 3HCVA 2AS5M 2DQDL 3SE8L 2ATPA 1MLCB 2LFGA 4HWBL 2D9CA 2LQRA 4ZUVA 1D6EA 4MNHA 3L95B 4JFFE 5KZCD 5DC9B 1S7QB 3KXFD 3X13B 3GO1L 2W9LA 5FYJE 3TV3H 4F37K 4LSSL 3T3ME 3SCMC 1BMGA 5LQBL 2M8XA 5IVXF 1TZHA 3VWKA 3CSBA 3HR6A 3QDGD 1MAMH 3OPZL 2UVFA 4LF3B 1MCJA 3I84A 4HXAH 5GGQH 3U0WL 2R0WL 35C8L 5ACLA 4PJ8C 3KLHC 4WFHD 3KLDA 3L7EA 5C7XL 2H1PL 1S7WA 1PG7H 3MV8D 2WLYA 5E8DL 3INUL 3ROLA 3QDJA 1VPOL 3BVNA 5F72S 2VTFA 2MPAH 3VMNA 1LK3L 3EYVB 4FP8L 4H5SB 4RGNE 5EBGA 3W0WB 4UQ2B 3GSQB 5D7KD 1UWXK 1K2DA 1T89A 2Y9RT 4YK4C 3LEXB 3H6JA 2FEDC 2AABH 1CGSL 4WRLA 5L9DH 3ZHDA 3DV6B 3E6FA 4X7DC 2DQUL 5KVFL 2XKSA 2FX9H 4WHTA 2VRAA 3DTXB 1T2XA 3NCEB 3BN9D 1MCDA 4HF5L 1J8HD 4QRPB 2OL3B 2ITCA 4Z9KB 3VWJA 4NNPL 1U58B 3HR5B 3VRIB 3NFNB 5I8KL 1AY1L 2AXGA 1UM6L 3LS5L 1WCQA 3GMOA 4PRDB 1UXWA 3ZL4L 3DO7A 2VXQL 2FHBA 1EHAA 3MXWL 1L9NA 3QCTL 2J88H 1DLFL 3MLUL 5LCVL 1F8TL 4KWUA 1EEYA 5TDOA 4L9LC 2FO1A 1CFNB 2Y6SD 4OZIA 2XWBB 3T77B 1O0VA 2NY5C 1S5HA 2EDEA 3QEQD 2IH1A 4G6AC 4OT1L 5TQ2L 4OTXL 5CBEA 3FAWA 1ZGLP 3CDGB 1UB6A 3C09C 4BQ9A 3TIDA 5CMAB 1J05B 1TCRA 4WI3A 5DJZA 5DWUL 4JG1H 4QF1A 3P11L 1RU9L 5HYSG 5BJTB 2KH2B 4A6YH 1Q9LB 2R2BA 2DICA 4X7TB 1FZMB 4FMFA 1TQBC 5IG7A 1AQDB 1J1PH 1NUFA 2BNRA 5T1LD 4G42B 3RVXD 4RWHA 2XWTB 1HKLL 3HI6H 4M1GH 3D2UB 4NM4L 5F1NA 3BP7A 1EJOH 4ZTOL 3T4YB 4N0RA 1H8NA 2BVPA 4PLNC 1RFDH 4NO5B 1HYSD 3C6LA 1IAOA 2R56L 4LVOB 2FBJL 2LVEA 3VGGA 4ZFGL 4P2QA 1OTUC 1NKOA 3LY6A 5GRYA 1CLYH 3TA3B 3MBXH 2VLKD 2J2ZA 4GRWE 3H9HB 3RDTA 3F12A 1ZK9A 3C5SA 3L3DB 2A0LD 5GS1C 3RWDB 3VGAC 4OM0H 5DJ0A 4ERSL 1YQ2A 4V2BA 3BQUA 3T09A 2ORBL 4LGSB 5DSCA 4WI2A 3O9WC 1CDUA 3AROA 4OLUL 3HC0A 4U6HB 4AY0A 3ELAT 3LKOB 3IXAA 2E6JA 1DVFA 5MP6H 1QPXA 3WBDA 2FX8H 5K9QI 5ADPH 1ZHBA 2YD7A 2EICA 1XF3B 3LZFL 15C8H 4JO2H 5DRXB 1OW0C 4G6FB 3S96A 2BSED 2BY3A 3PWNA 3O41A 1AE6H 4LHUB 3RWHB 5BS0B 1ZV5A 4KHTH 4K7FA 1IQDB 2AKRB 3TM6A 3QDJE 5E2UL 2H9GB 2UWEF 2A9NL 3QEGH 3EYSL 4R4ND 2C3GA 1CDCA 3TZVB 3F7QA 1EBPA 5E8PA 1DUZA 4TQEL 3QUZA 1N8ZB 3T4AA 1JHKL 5EOTA 3VFWA 2CKBB 3KG5A 2B2XL 1H3PL 3ARTA 3T65A 3RGVA 2YD8A 4RISL 2ZZUT 3BHBA 4ONGH 1NAKH 5LXGH 5I8EA 1WEJL 3JTTA 5SWSE 1QRKA 1I9RH 3ULUD 5CSGA 4R7NA 2RJMA 4JHBA 1QYGH 1N64H 5FO7A 4R26H 4R96A 4I2XB 3N9GL 2D4FA 4AIXA 5D2NA 1YEGH 3WEXA 5DF0A 4NM8H 3MO1B 5F1KC 5SWZD 2AK4E 2BSTB 3H42L 3T1FB 4N0FB 1DBJH 4QOKD 3VDBA 2XA8L 4RMVA 2Y07H 4PJXE 1DL7H 2HG5A 4OCWH 4EVNB 5IKCA 2W1NA 4WTXA 4X0KA 3SBWC 3UMTA 2AGJH 1RULH 4UIKL 1OB1A 4XP5L 3WIHH 1QZ1A 5IT2L 4QTHA 3VG9B 1Z9MA 2HT4D 2Q8BH 3MUJA 4OGYH 1KBGL 3HKFA 2Y72A 1KTDB 1ZT1A 3LKRB 1XR9A 4YFLF 3CK0L 1KOAA 3SDXA 4HKJB 4KK8D 3PGCB 5D1ZD 2GSGA 4N5UA 2OMBA 4ZPVA 1MQ8A 2PO6C 4PJDB 3TT1H 3DV4A 1HILB 1U8KB 3UZVB 3ZE0F 3BI9X 2LTQC 1A7QL 5D1QA 3PP4L 2ZG1A 3WXWL 5DA0B 3DURB 3WFHA 5IQ7L 2P5EA 3MODH 5IROC 4AIZA 4YZFF 1WFUA 2RFXA 1B88A 4XB8A 4DCQB 3KYOA 1A9EB 3VXMD 3GMMB 4XVUC 4YHNA 7FABH 1KIPA 2A74A 3BKYL 3KNBB 4LPWA 3IJSB 1BGXL 4X8JB 5JHDA 3ARFC 2HJFA 3S5LG 2VLRB 2DTML 5CLWA 1UB5A 1PZ5B 3PP3H 1U8HA 2CXKA 4WHCA 3QRGL 3VFSB 4J1UB 3ARDB 2DQIL 3KYMB 1WC7A 2QBWA 4RSVA 4RGOH 2V2XB 4UIMB 1EAPB 4C4KO 4O51A 3RL1A 3ZKMD 1LO2L 3S37H 3QWRD 2OSLB 4ONHB 2W60B 3SDYH 5L2JB 1U95A 3HPJA 5HYFA 3DO3A 5GIRB 2ZKHL 4OM1L 1H0DA 1R3JB 1LE5B 1DTUA 4JO1H 1F4WL 1OF2A 4G8GD 5BRZB 1MRCL 1UQSB 2J12B 5L2KD 1T0PB 4OIIL 3I6GB 5I1IL 4F7CB 4LMQI 5DQDL 1CLOH 3BOVA 2X4NA 1KNOA 5KOVC 2FATH 1NGQL 4DZBB 1ZVSB 1CGTA 1X6NA 4NQSB 1WWWX 1OSPH 3BKML 1MLCA 2WUBL 5E8OB 2PR4H 4OCXH 3O6ML 2JLLA 3L95A 1FIGH 3RU8H 2HFGH 1JFQL 3MUZ1 1SEQH 1WUNT 3BPOC 1NC4D 3ARBA 3A6BL 1S7QA 3JV6B 4YFDB 2GITB 1UWXH 3X13A 1JZ7A 5AWNL 1MCQA 1RJYA 4PB0H 5JDJA 2EYSA 1IKNA 3M07A 3ULUL 2IPKA 2CIKB 4LF3A 5FF6B 2NY3C 1D5MA 1Q0YL 3H0TB 4L3CB 4PRAA 5FGRA 5J1AA 2BRRL 3LIZL 3SQOH 3EGSA 3GSOA 1RK0B 1YMME 2FWOB 3QDMA 4HKBB 3KPNB 2NXZD 2Q76B 4X5WA 3SDXE 1B3JA 3QHFL 4UQ2A 3GSQA 4Q9BA 4ACPA 2OMNA 2EXYD 5DUBB 3HC4H 5JR1L 4DWHA 3GRWL 1E27B 4OD2B 5DURD 2DYPD 2PETA 2VABB 4LLMB 2XTJE 4C4KT 1KCRL 4M43H 4OFKA 5C6TH 4QRPA 3SCMD 5HVFB 2P5EE 3HR5A 3VRIA 3NFNA 3UTSE 4XNXL 4PRDA 3BPNB 3U6RA 4P2OB 3P4NA 2DI8A 1PX4A 1FZOB 2Y4SA 1N59B 3EOYG 4HUWB 1FRGL 3GSRA 5H35B 4PJ8D 2JJVA 4Q97A 3QPQC 1RURH 1FVCB 3S98A 1DCLA 1U3JA 1CG9B 3W9DA 4KH2A 3TLRA 4UINL 4N68A 5INDB 2XWBA 1NLDL 3OV6A 5CD5C 2DN7A 3GI9H 4JLRB 2BFVH 3PHOA 2NNAA 1A8JH 4OZGF 4S10A 2GAZB 2X05A 1EJ6A 2E27L 3VRLE 3RNKA 4NHUB 3LDBB 3ZDXE 1TJIL 1Y0LB 2MCPH 3CDGA 3RTQB 4CDGC 2P45B 2W9DL 1SM3L 5CMAA 2PXYD 1F4YH 4RWYL 4LPVA 2D7NA 5BJTA 3T0EE 1MCLA 1FZMA 1UJ3A 4LSUL 4APQA 1AQDA 4I1NB 4MJ4A 1DBMH 3QPXH 1XCTB 4G42A 2GY7B 2XWTA 3D2UA 3E6HB 4JFZH 4FQIH 4KTEL 3MBEA 4I18A 3T4YA 4AEHL 3MCG1 4YUEH 1UACH 4PJEE 2WLZA 1FNSH 4F7EB 5KSAB 3H9HA 5SX4I 1CDJA 5T1KB 4M6ML 4L4VB 4ZUTA 4G6AD 1NC2B 1G9NC 1MFAH 3QIWD 3LKOA 3NMEA 2RAMA 4XPGL 4PJAF 3WDHA 4PS4L 2HVJB 3GSUB 4NWTH 4XCEB 5IJVB 5D6DC 2B1HL 1L6XA 4JR9L 2QLVB 4P57B 3O45B 3RHWK 1ZHLB 3BP5A 4JKPL 3OSKA 4OF3A 3VFTA 5I71B 3D3VB 4WFFE 4XMPL 4JPVH 1FL5A 5D1XA 5BS0A 5GS0H 2VDNL 5E7FA 1AR1C 3X3GL 3QDME 1IQDA 3QUYB 2AKRA 1GPOL 5I1DB 5JQHC 3X12B 1OTUD 2WUCH 3NCCB 3WXVH 1WIOA 1IRAY 4UOW0 1U6AL 2XZQH 5E8EB 3MA9H 5I1GL 3BMWA 1YUHB 1N8ZA 3O9WD 4NQCB 3U1SH 3HNVL 1ZVYA 4JO4L 2CKBA 3HG1D 4FQXB 1FZJB 3SKUD 4CNIB 2NX5B 4PJ7B 3RWFB 2P1YA 2VSCA 1RIVL 3IDGB 1IGCL 1TTFA 4J4PA 5HHOD 1FFOB 2VDLL 2IQ9H 3EDEA 3W9EA 3CDFA 4I2XA 4GG6E 4JEGB 4L4JA 3T2OA 3B8YA 5JUEL 1A1OB 3ESUF 3D25B 3MO1A 1QLFB 1P7QB 3RNQB 1NAML 2BSTA 5EBWB 3T1FA 4GAJL 5HI3C 2CSPA 4QHUA 3MMEA 4XNMA 5T1MB 4G7VL 1FVDB 1VHPA 5HHVH 4EVNA 1ITBB 1GH7A 2OZ4A 3BKCL 2IPUK 1W0WA 5E2VH 3S8WA 3CLEL 4ZXBB 4BZYA 3UBXI 5C0AE 5HYQB 4UB0H 5C3LD 4U6XB 3GSNH 1A7OH 1KTDA 5K9JL 4PIRF 3LKRA 5BO1H 5DFWH 4HKJA 3DPBA 3F7YA 1LHZA 3PGCA 3LD8C 1PGRB 1M7IB 4Q2ZB 3FO9A 5CSZB 1CD9B 4XNYL 1JF6A 5FKPA 1PW3A 3QBTB 4KQ4H 1T0NA 4JFEA 3GJEB 5F1SA 1R3LB 3ULVE 4V1DD 1BVLB 1EEZB 1E6OH 3DURA 4OSUH 4NGHH 2VKWA 5IESL 5EU4A 4FZ8L 1W0YT 5CINL 1HHKA 4LLUA 4QTIL 2CGRH 3RVTC 4DCQA 2NYYC 2Z8SA 1A9EA 4R8WL 2RGSA 4FFZL 5I9QB 1ETZB 3GMMA 4X4MA 1IC1A 2F19H 1I1FB 2C4FU 5T5NG 1W72H 3QUKB 3HC3H 5EU5B 3STLB 3IKKA 4X8JA 3IFNL 2Z31C 3UXFA 4DGVL 1X7QB 1KJ3L 4B7IA 1PQZA 2ZOKB 3QDGB 1RZJC 3QG6A 1LO0H 2K1MA 2XKUA 1A6PA 4J3XA 3LQMA 3ARDA 3KPMB 3KYMA 5KG9B 3B2UC 1YQVL 2V2XA 4UIMA 1EAPA 4PG2A 3NBNA 4N9GB 2OSLA 4W68A 4ONHA 1CICC 2W60A 1BBDH 3S35X 4OFYD 2MWCA 1PKQB 1H5BC 4XRCB 5L2JA 1YPZF 3CUPB 1QSFD 5IB3B 5JPMB 5GIRA 5J06A 5FYLE 1R3JA 4AH2B 4XVUD 4YHZH 1C1EH 2KQNA 1UQSA 2HKFL 5GGRB 1HN1A 3MLXL 1YEDB 3TJEL 2WINB 4GRWH 4F7CA 1J8HB 4TSBH 3ARFD 2K3TA 4QT5B 4JZOA 3SGJA 1QHPA 3SGDH 5AG9A 1ZVSA 1JYWA 1AFVH 5D96C 5HJ3A 1R3KB 1D7FA 1TZGH 1I9IL 2I5YL 1FQ9C 1S7RB 1BQLL 4LLDB 1U8JB 2OR9H 5A40E 2Q86A 1RHFA 2GITA 4M6NL 4OZ4B 3L3GA 4Z7WB 3FQWB 4OCNC 4ZQKA 2XI9A 2EDBA 5J89A 1VESA 2ZJSH 2OJEA 3QEQB 5FF6A 1WV7T 5E00B 1ACZA 1DBBH 4NOFA 3H0TA 1RMFL 3MRDB 4L3CA 2NZ9C 2V9TA 1JMZA 4BFGA 1RK0A 2EE6A 2FWOA 4HKBA 3M17A 3KPNA 5DDHA 5IHBA 3IXTA 5IVNA 4MXQC 1MHEB 4WEUD 3G5YB 4YC2B 1RSFA 5C0ND 2HKHL 4Z0BL 3U4EB 5SWQB 4HD9A 3PE9A 4XP6L 3C2SA 3RVUC 5DZOA 3VA6A 1E27A 5EPMB 1NFKA 1BAFH 1YYLH 1SQ2N 4LLMA 5E0QA 1BF2A 1NMBH 4DW2L 2XXMB 3ILPB 5A43C 1KTKE 5DUPL 5GRWA 1FH5L 1QQDB 2OJZL 1DBAH 4DJMA 4OQTH 2VDRL 1IGMH 3KJ4C 3RGHA 3UTOA 2NY6C 3ZLQC 4P2OA 4W6WB 2NY3D 3UJIH 3V4PH 1I3RB 4HUWA 1HI6B 1ZS8A 4HUUB 1AGBB 4GW5A 4P23C 1PAMA 2COQA 5DD3H 4R97C 2OTWB 1Q8MA 2YUWA 1A6UH 3QQ9D 1CCZA 5GZND 1YYMH 3GM0A 1CXEA 5CJQL 3MJGX 3SKOB 4HCRA 3GIZH 3O6FD 2HRPH 2ILLA 2WMPA 1Z2KA 3IJHB 1BFSA 5EIIB 2EH8L 4XVJL 2GAZA 1OAXH 1MJUL 1KXQE 5MEQA 1HINH 2VYRE 4EOWH 4Q58C 3KLSA 4Z7QF 4X99B 1Y0LA 1KLGB 3RTQA 2VC2H 1S7TA 2I24N 2AEQH 3BZ4B 4TSAH 3IDIA 3O2VL 4MNGE 4CMHB 1QRNA 1LP9F 4MXWL 1AO7D 5GRUL 4YGAB 4M1CC 2GJZB 5C0CE 2NR6D 1AIFB 3F7VB 4HWBA 1FPTH 5GGVY 3I02A 2E3VA 4NBZB 5MHSE 5FEBA 1WGOA 1XCTA 2ICWI 2VDQL 4NO3A 4PJBA 2A38A 4GMTH 1EEUA 4QRQA 1I8IB 4K8RC 4TRPH 4UDTB 3E1F1 4KRLB 3MLVH 1RZ7L 3S36L 3PQYE 3SDDB 4F7EA 5KSAA 4ODTH 5CD5D 4LP5A 1FO0L 4U0QB 4YDIL 5K59F 3LN9A 2EC9U 4BFIA 3TYFA 4PJHF 3WFBH 4I8DA 2FZ3B 2FBOJ 5T1KA 4L4VA 4L29A 1BD2D 1Q1JH 3PNWA 4HJGB 1KJVA 2QQKL 4FTVA 4X7FC 4NJAL 3HS0B 1N5YH 5FYLL 1KCUH 2ATKA 2DQHH 5SWZB 5DJCA 3HPLB 3GSUA 5IJVA 3V95A 2AK4B 1CE1L 1HXMA 4Q9QH 3QH3B 1V3LA 4L8SC 4OZHB 3EZJB 1ZHLA 1UC6A 2JK5B 2AJ3B 4HMCA 1KN4L 4PJXB 3CFKB 3D87B 2BXZA 4IEFB 4F2MA 5DRZA 3FHQA 2NW3A 1HHGB 3QUYA 4NYLB 1T80A 5C6PB 2HTLC 1UXSB 1T03H 2YK1L 4XCFH 5DRWB 3VFUB 1KFAH 3QULA 1FP5A 5C0DB 3I50H 5D1ZB 1T1YB 3O3DB 4NQCA 1RIHL 5LKNA 1TJGH 2H32A 3QB7C 5KS9B 1FZJA 2QHRH 4XMKL 1L7TL 2ZUQC 1JN6A 4CNIA 2NX5A 4RZCA 4P46C 3UYPA 3WIFB 1ROWA 1S7SA 3RWFA 3NCYP 3KR3H 1AGCA 3P0YL 4WEBL 2RR3A 2BXYA 5JPNB 4G9DB 3PWJA 2A77L 3S4SB 1FFOA 3B3IB 3I6LE 5GZOC 5TDNB 1QBAA 1FN4B 3L1OH 3GMRB 1TNNA 3VXMB 2VJXA 1IC4L 3VJ6A 1AJ7L 1YZZA 1EA9C 5E9DA 2J4WL 1A7RH 3GBNH 3RNQA 4UTAL 5EBWA 1WAAF 5CKGA 3V0AC 3O0RH 5C0EB 5T1MA 5HHQA 5F9OH 1FVDA 2G75B 1KN2H 4MMZC 1JNLL 2YUXA 1GGYA 5CZKA 1LWRA 1DZBA 3I6KB 4WHYG 5D70H 4GRLD 4ZXBA 5HGHB 3MV01 2IWGA 4GQ9L 1DN0A 1CR9L 4NZRH 3T08A 1A47A 1TETL 3MRLB 2WANA 3DX8B 3QR2A 4M62H 3S3PA 2A6IB 2ZG2A 1V8HA 3G6AA 4EIGB 3SJVE 4POZC 5D9SB 4F7TB 2AV1A 2VZ3A 1M7IA 4M4PA 1BLNA 2YD3A 4G8GB 4OCSL 1NGZB 4JRWA 5JIHA 2NY2B 3VXNB 4KDWA 4U49A 3GJEA 5GRJH 2ZCLH 5T1DL 3VXUE 3QWOA 5F7UA 5ERWB 1KF9B 4XNUH 1KJMA 4XCNB 4XPBH 4FTVE 4D94A 2R4RH 4M93B 3WLBB 1ETZA 1NC4B 1VEPA 1X4XA 4IM8A 4OGXL 5ALBH 3KXFA 1UZ6E 4JDZB 3STLA 4JN1H 5D4QA 3U0TA 2PYEE 1WIUA 3MGOA 4Y19D 2A2QT 3RWEA 4YHKH 2XRAH 4ELKB 3MLZL 2X70B 4X6CE 1N7ML 2J6EL 2R4SH 4PLJC 4LSRH 3WKMH 5F9JB 4O9HL 3CMOL 1CN4A 3MV8A 4F58L 5CBAB 2E7BA 3BEVA 3HZVB 2GUOB 1CGXA 4YIQB 5IBUB 1IGFH 1PKQA 4ODSH 3MLTA 3DUHA 4KUZL 4AL8L 1BVKB 3TYGH 2CRYA 2NYYD 2WBKA 5JPMA 5ACMA 2B8OT 3MXVL 4O00A 3CSYA 2VZSA 4AH2A 1NAMB 5DURB 1QVOB 4B0MM 3LHPL 2DYPB 1YEDA 3LSOA 2WINA 1J8HA 3SCMB 2FHCA 2Y36H 2Z31D 4QT5A 2WIMA 1MPAL 4LVEA 5CFHA 3QXDB 1P6AB 3GBLA 2MCG1 1BOGB 1ZT4B 3UTSB 3DVIA 2X4OB 1EUUA 1S7RA 4YFLI 5IF0B 4J7RA 4PJ8B 1UZ8B 1ZLVH 2DQCL 3B2UD 1G9NL 1P6FA 4ZUUB 2FSEB 1X5YA 5HGBB 4YHMH 5E2WH 3MRQB 5ISZD 3B2VH 1A6ZB 2F5BH 4OZ4A 5ACZB 1J1XL 1CICD 1F4XH 4Z7WA 3FQWA 4IDJH 3EOTH 4PGBB 1U36A 1CL7I 1TVBA 4YK4B 5C07E 4BZ2L 3EYFB 3NZHH 3QEQA 1C8PA 1RI8A 4Y7MA 3S7GA 3MRDA 4NFBA 5DVKA 3RWJB 4Y89A 1YNKH 4YBQC 4Y4FC 2DB8A 4LNRB 5MEPA 1TTUA 3VE0B 1CVRA 1MHEA 3G5YA 5D5MA 4YBLC 2OTUB 3MJ9L 3MLSH 1A21A 4MJ5B 1MJ7H 5SWQA 1BFOA 5T1LA 1A3LL 4LPYA 4GT7A 3FRUA 4KDTC 4YR6A 4Q9RL 4UT7H 4L9LB 5GSVB 5B3NA 3HUJA 3P3YA 4PJEB 5EU3B 2VLKA 1A1MB 4W4OA 2ED8A 3T2NH 3QNYA 4CU8A 1NDMB 3HLAB 4HH9B 4LSTL 1DUYA 4XXCC 4JGUA 2KL6A 4RBPH 3WE6B 2ADJA 1YJDC 4LAJH 2NLJA 3THML 4CKVX 5KAQF 3CVHH 1B2WH 4D0DA 1TQBB 1PLGL 5KANG 2D7TH 1I7RB 2O5XL 3PV6B 5HGDB 4ZFOA 2AJZA 3RVUD 1RVFH 2AJXL 1GIGL 3NPSC 1VGKB 3QI9C 1BIIA 1KLGA 2GSIA 3GMNA 5BCAA 3CFCH 3QFJE 3F5WA 4RCAA 3V4UL 1ZKAA 1HZHH 2GJZA 3VGAB 4HUXA 5GS1B 4ODVH 4NC1C 1NGWB 4EN3C 2NY6D 4JRYE 2AI0L 4LEOB 3JXAA 5DS8A 2R23B 3DBXB 3HG1B 4J6RH 5CP7B 4P23D 3RVWC 3H9ZA 4UDTA 5D7IA 3ULVH 5D93C 4ZDHA 5DC0A 4E9LA 1I9JH 4MAUL 2PF6A 4G8EB 1DQJB 2DQTH 1M7DA 4PB9L 3N85L 5KW9L 4S1QL 1M05A 2AQ2A 1KEGL 4LEXH 3RI5F 2VDPL 5A2JH 4MX7B 4OB5L 1N4XH 2ITDB 4HJGA 2W0KA 1FNGB 4GG6B 4RMWA 3HS0A 1X5GA 3IDXL 4KQ3L 3B5TA 4KHXL 3C08L 5SWZA 3LEVL 5E7BA 3KYKL 4HFWB 4QOKA 1TMCB 3HMWL 3MUGA 2CJUL 5EZLB 3IDMA 3L9RA 3RFZC 4ZMAT 1HIMH 3GRWA 4LVHC 1IQWL 4K8RD 1K6QL 1KEML 3FCTB 4M4RA 4NYLA 4QRUB 5DUML 2EDFA 5FECB 1B9ZA 1XH3B 2BJMH 2R15A 5F8RC 1N0XH 3BAEH 5CUSH 2FB4L 3PXHA 5D1ZA 5BVJB 3RPIB 3TNMA 1L7IH 5HVHC 2EE3A 3O3DA 1BEYH 1IM3B 1JNNL 2FR4A 4JJ5B 3HA0A 5KS9A 4CJ0A 3DRQB 1MCNA 3WNKA 3UO1H 4K3JL 4V1DB 2X7LB 4U0RC 3CDYA 4OF8A 4Y4KD 2A9MH 3BGAA 4A2MA 5JPNA 5I1KH 4G9DA 4JY6A 4LNVA 3BZDA 3IGAB 2UZIH 4WY7H 1OOAA 2A6JB 3B3IA 4Y5XC 3ARVA 5TDNA 2FD6H 1EHNA 1CTOA 5E1AB 3FMGH 5TJWK 4PUBL 4WW2A 4NZJA 3VXMA 3WD5L 3CMGA 4EXKA 4KAQH 1ZSDA 3L6FB 3FT4B 5I18L 3CIQA 4XBEL 2Z0BA 2XZAL 5JO5B 2HTLD 3SE3A 1M71B 4WWKD 3H9SE 1ZANL 2CPCA 1OP5H 2OZ4H 3LQAH 4X7CC 3QG7L 2Q3ZA 2AJVL 5BZWB 2O61B 1ULVA 2PO6B 4YLQT 4D9RD 4Y5VC 3JV5A 1CF8L 1AHWC 2DQEL 2GT9B 1P1ZB 2LTQB 5FGCE 4MAYD 4EZMA 3I6KA 3VXOB 4P46D 3NOIA 1CLCA 1FO0B 5HGHA 4AEEA 3OXSB 3QWRA 3MRLA 2JCCE 1IKFH 5GJSH 4EQ2A 2XN9D 4XVTH 3GJFH 4LCUA 1R0AH 3MJ8B 4XHQA 1QSFB 3CVIH 5GZOD 1NGPH 5D9SA 4G8FA 4F7TA 4N0YH 4WHYH 4PPTA 4G8GA 4X9FA 5IR1A 5L2KA 2FGWH 1UGNA 2F9BT 5J13C 3JSSA 1S3KL 3VH8A 5E8NA 4KMTH 5B4MC 2R8SH 3ARFB 4NPYB 4PJIE 3ES6B 4KI5F 1J5OH 1N6VA 3MRGB 4MMXC 3JWDC 4LHQB 5ERWA 1IJ9A 5SV3A 1EEQA 1FFRA 4XCNA 4CJ1A 4HFUL 4WIQA 2Q8AL 4LRNL 1NC4A 3L5XH 4LASL 1A6WL 1QFUH 4JDZA 1H9VA 4PP1C 5EBLB 3FQRB 4PJCF 4AMKH 4ELKA 2X70A 4POZD 1KJ2B 4JRXE 3RL2B 5L88H 3KPRE 2R69L 1G1CA 2E9IA 4DUVA 4OD3H 3H3PL 3QEUB 4JQIH 1MH5B 5I19H 5JMRA 4DFIA 3HMXA 3SO5A 3HZVA 1CWVA 2GUOA 4HWUA 2YPVL 2B39A 4JFDE 4LARL 2M2DA 3NFPB 1QSED 4HWZA 4HWEH 3QZWG 1BVKA 1RJLA 5C0RL 4LU5H 3BPOB 4TUOB 5I1EL 3I9GL 2I9TB 1QVOA 4OLXL 4K8RL 3M45A 2DYPA 1LEGB 4GH7B 4U05A 5HPOA 1DBKL 4Z7VF 3SCMA 1J1OH 4NHCL 1FNAA 3LKQB 3QXDA 2VXVH 4X6DB 1ZOXA