5AZEL

Fab fragment of calcium-dependent antigen binding antibody, 6rl#9
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
206
Chain Sequence
SVLTQPPSVSGAPGQRVTISCTGDVHWYQLLPGAAPKLLISHNTHRPSGVPDRFSGSKSGASASLAITGLQAEDEADYYCQSHDSSLSAVVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6RL#9 FAB LIGHT CHAIN
publication title Calcium-dependent antigen binding as a novel modality for antibody recycling by endosomal antigen dissociation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 206
sequence length 215
ec nomenclature
pdb deposition date 2015-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5azeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5azeL01
2BDNH 4MQSB 4Z7VE 2H3NB 3OB0K 4QT5A 4KH2A 1A6ZB 1FPTH 3W0WA 4PJ7B 2ZWLT 2FX9H 3ZKQD 2ITCB 2VIRB 5C08E 3V4VL 5BVJB 2FIKB 3VFTA 4JCMA 5JQ6H 3RIFF 1FDLL 3QG6A 3HR5B 3RWDB 1JHLL 2MNUA 4N8VA 5KSVB 3BEWA 4P2RB 2DQCH 1J1OH 1FL3B 5E2WH 3MTRA 1I9IL 3OHXB 3GBLA 1D5MA 2EKSB 5CIPA 4UUJA 3UZVB 4ODHH 4S1RH 2J6EL 3ULVC 2XQBL 2Z92B 4GMSL 4HWEL 4JO4L 1N8ZA 1KIRB 4L3CA 3GB7B 1NLDL 2DQGL 1DBML 1KCRL 1FZMB 4PJAA 4L8DB 3FRPA 5B38G 3FB6B 4ZUVB 3QT2A 4NSKA 1A47A 1GZPB 4ONFH 4R8WL 3OAYK 5HI3D 2R9HD 1MJ8L 1DBJH 1YEHH 3T4AA 2GI7A 1IEBA 4DZ8B 3GM8A 3LRHA 2IH1B 3ARDB 1GZQA 3GZKA 2R0ZH 3EJZD 2R0LH 2CLZB 4HH8A 4EJ1C 1KV3A 1J0IA 5MEOA 3V5KA 1DQML 5D2NA 2APFA 5E1AB 3DROA 3TNNB 1FSKC 1NUGA 3HI6L 4PGBA 4POYA 5B39A 3QPXH 3L3KB 4U1HA 4EKXA 5EZJA 4L4JA 1FYTE 1I9RL 4CVZB 3LKOA 1DE4B 1T1YB 3KPRA 4KK9C 4A6YB 5C8JA 1J05A 4Y1AD 5FYKE 4F9PA 2YD4A 3VXTA 3L3DA 3TYGH 3DRTB 1B0RB 4K2UH 4O5LH 3KPSD 2M26A 4LPTA 4XNUH 3BIAX 3O2WL 3F65A 3QUYB 5JHLH 3SDDD 1QO3A 4WW1A 2BXZA 3WFDL 2OJEA 3KYKH 3IDGB 1ZXQA 2VDNH 2AABL 3A0OA 3I50L 4HCRA 4RAUA 1AQKH 3GMNA 1WBYB 2B0SH 3WFCL 2CKBL 2DOCA 3WN5C 2D31B 1I8LA 2AJVL 2D0GA 2VR9A 4HFUH 3AU1B 4WTZG 4R7DB 1KUMA 4C4KT 2I9LB 4M9PA 1F3DH 1SEBA 3BZ4A 3BKJH 2VQ1A 1RQ5A 5E99H 3DJ9A 5DD3H 5ITBH 2X42A 3ARBA 4NM8H 1XGPB 5HYJA 3I6LD 3ARFA 2CO6B 5HDBE 4JM2C 3H7BA 1CGWA 1D6EB 3LN5A 1DFBL 5DJ2B 1PG7H 5T3XL 3MR9B 3QSKB 4X6DB 3IDYC 4G6KH 4QXGH 4YZFE 3KPPA 1HSAA 1FC1A 1J11A 3FFCB 5HHXL 1ZA6A 1UC6A 5F89B 2BRQA 4MA7H 2AERT 3GMQA 1BJ1J 3QFDB 3ARPA 3JZ7A 4H25B 4LCUB 2DQEL 4G43B 4WEMB 2OJZL 3AREA 3N0PB 4AEFA 3QO0B 2PTVA 3QUZD 2X5PA 3T0ED 4MJ5B 1I8MA 1BLNA 5FEBA 5J1SC 1QRKA 1AJ7H 3HUJF 4JDZA 4MCYB 3CFJA 4WFFE 4HPYL 4H0GA 1A2YA 3FFDA 2BNQE 2D03L 1X5LA 4JFFA 4LU5H 2VLMD 4JRXD 3VXMD 3D18A 4X8XA 2APVA 4TNWK 2BERA 2FGWL 1Q72L 5IVZB 5CLWA 5C0AA 3LPFA 1NEZG 1WSST 5EU6B 5F7EL 1U93B 5HHVL 3ZLQC 2O5YH 2NX5D 1LVEA 3OF6A 2J8UF 1MREL 4PJCF 5IP4A 5J13C 2VERN 3N1MC 4F9LA 4JREB 5JW5A 4U6XA 1CICB 2OSLB 4K71C 4OB5L 3TCXA 3VDBA 3IDJA 3BW9A 3SJVD 1WZMA 2QL1A 4OJFH 1INDL 3MA9H 4N9OB 1A0QL 1XCQB 4YGVA 3VMPA 3H9SA 5DLMH 4N8VG 4CJ0A 5I6XB 4XWGH 1VACA 2DI8A 5E8EA 3LIZL 1JNJA 5FOBB 4FTVA 1U8MB 2GSIB 1IM9B 1J0YA 3CH8A 1CDJA 3QCVL 2BMKA 3KJ6H 2E9IA 2H26B 1FH5L 2AGJL 3EGSB 4LLVB 5J8OA 4NRZB 3ES6B 2PXYB 2OZ4A 1UZ6E 2LVCA 4RMTA 5IG7B 4K3DL 5FKPA 1BFVL 3QDJE 3OB0H 1ZTXL 1R3HA 1M71B 4PB0L 4LSUL 3BD5A 3O6KH 4JO1H 3VWKB 3FRPG 3QFJA 2ENSA 1A3LH 4S10A 3QNXB 4HLZG 5I75C 5J9PA 3OKKB 5I73B 1AO7D 2BFVH 4Y7MA 2A6JA 1HWGB 3Q5YA 2QHRH 2FZ3A 2DLEA 2YEZB 5C0RH 1H3UA 1OAKH 2RR3A 5HD8C 4DKEL 3EDKA 1MWAL 12E8H 3G04B 3I3DA 1GC1H 4OFYA 4RX4D 1JPTL 1NAMB 1L7TH 4OAWB 4HPOH 3HKFA 3RTQD 2YOCA 1JIBA 5SWSA 4LF3A 3RZWA 3TJEL 5JNYB 5B39G 1JN6A 3TA3B 4LCCA 4R2GC 5TE4L 1LO4L 3UZEA 3PWLA 1GHFH 4TNWF 3BPCA 3CLFH 3ULUD 2P24A 3TWCH 2B2XH 4Y5XA 4JFQA 2EO9A 5AWNL 1D5XB 2E9WA 1T66C 3MLTB 4WGVB 3OAYH 4GRWF 1NCNA 1OB1A 4ODUB 4PJEA 3VXRB 1F4XH 2JIXA 1UB5B 3K80A 3L9RA 4TNVF 5I66A 2D7OA 1W8OA 3CFDA 4NGHH 4NNXB 5EO9A 3BH9A 1Z6JT 3U0PB 2C1PA 3F7RA 1KJ3H 1QP1A 1YMMB 3KLAA 5CKAA 3MV8B 1J1XL 5T33L 4P46D 1P4IH 3GEWB 43CAA 5GRZA 5C0NC 2F54A 1S7XB 4MD4A 3CIQA 3EYOB 1YQVL 4M00A 3WXVL 4KPHH 4FQ2L 1FYHB 3P0YL 4HIEB 5JPMB 5IQ7L 1W8NA 1UACH 3RBGA 4PP2B 5IMOA 4PY8J 4Q9RL 1D7FA 2NXZD 1P2CB 3MRHA 3V4UL 2R2HB 2G60H 3KS0H 2V5SA 2DI7A 4JY6A 1NDMA 2I27N 2F5AH 4HMCA 4WU5B 1C5CL 4M5ZH 1LP9F 3UBXA 3CH1A 5IJKA 4JLRB 5HI3C 2C3VB 2R9HC 3QEUA 4RBPK 3ULUF 2HFFB 4M6ML 3T0XA 3P0VL 3MLRH 2HVKA 5FGCE 1QFWM 3ZYOA 3MYZA 5H35A 2ZCLH 3JUYA 3T77A 5LAXA 4Q6IB 1O7VA 2ILLA 2YD6A 1KXQE 3JBG7 4YHKL 1L0YA 2ZPKH 5DFWH 3MLVH 3ABZA 1H3VA 1S9XA 2P5EE 1IGIH 1LHZA 3MRIB 5F7WC 3GI8L 4X9GA 4JPVH 4YHLL 4HBQA 3CXDL 4HIIB 4BH7B 1KBGL 4IS6B 5DURD 5JPNA 3HTLX 5DD6B 1Y18B 1T83A 5D2LF 3A6CL 3O3AB 4PB9L 2D4FA 4X8JA 2X9WA 1A7RH 3F7YB 1ACYL 3TYFA 2DLFL 3TJHD 1P4BL 4TPRH 1YA5A 5IHBA 1U2CA 2XTJE 1WV7T 3U4BH 3D25A 3CVHB 1JMXA 4X4XB 4KI5C 4NKIH 3FQUB 2J1KA 1G0YR 5I1DB 2DLIA 1BZ7A 5BMFL 5JOFB 4NZRH 1EPFA 3C6LD 1EJ6A 1BFOA 4AEEA 3OKYA 1HYRC 2UWEE 4L9DA 1KPUB 1T89C 2AEPH 5INCB 3PWUA 3RNKB 5C08D 1PGRB 4MD0B 4NQDB 1OAYH 35C8L 3RVUC 1KEMH 2VQUA 1D3CA 1KJ2B 3WE6A 2X4UB 5ISZB 3WLBB 1LK2B 4QHLA 3T08A 1MLBA 4F37K 3ROOA 1BX2A 4LK4A 2G5BA 2CH8A 3S7GA 1YEGL 4FG6D 5CKGA 4ACPA 2ZCKL 4WU7B 4ZUTB 4XP4L 3WSQH 1UADC 4IOIA 2X4QA 2K7PA 4X0KA 4IDJH 5KS9E 2C3XA 5CP7A 2X89A 3SKOB 5CEZH 4KUZH 2MKWA 2NLJB 2OL3A 4H88L 2QQLH 1FSKB 1SQ2N 5HSFA 1NMAL 3S9DB 5DD5L 4HQQH 4G5ZL 1KB5B 3MBED 4KKNA 3S97C 3NTCH 1NBVL 3UPAA 3CC5A 1OP5H 4KQ4L 4WHYG 1HHJA 2IQAB 2MQ0A 4PJGF 1Q38A 4QRPE 3DO7B 1K6QL 3PGCB 1YNTB 5D7IF 2V9QA 1YYML 3BO8B 4HXBL 3HPLA 3VFSA 5EIIB 4Z7QF 4PJFB 1BVKA 4JJ5B 4Z7VF 4MA1C 3FHQA 2A74A 3GBNH 4IMLA 2EXWC 2XWJB 3T8XA 1IGJA 4G7VL 5EZIH 2YWZA 1R5WB 1G7MB 2AQ1A 4AEIL 1IJ9A 5HHOA 3UPRA 3EAKA 5DRZA 4NT6A 1JPGA 2ZP0T 3U79A 3O6ML 2XG5A 1C08B 1JI2A 5L7XH 1FYTD 4PJHA 5L2KD 2FB4H 5E94A 4GRLC 1YJDH 3WN5B 3NIDE 3IDXL 4PGEA 2HKFH 1AE6H 3ILPA 2XWBA 4XVJL 2P8MA 2HFGH 4M6OH 1I4FB 1CGYA 4D0CB 4URTB 2DLHA 3B5GA 3D9AL 2CDGB 5ICYA 3AB0B 2NY6D 3Q0HA 3JTSA 4Y0GA 4I3GA 4JM2B 5EBWB 5M95B 1B4JH 3BFOA 1X4ZA 2NY3D 1JK8B 3IDYB 2EECA 5HJ3A 1W0WA 1S7TB 1VGKB 4MQXC 4UV4H 5HVHC 4PP1C 1RUAL 5FK9A 4UOW1 3DX7B 1AXSA 2Z4QB 3LCYA 4N8CH 1PYWB 4PRHE 1NCCH 2DQIL 4HHAA 5FUCC 5FGBA 1MIML 1AD0A 2AQ3A 3SDCD 1PQZA 4HKJB 5CEXB 3I6KA 4QWWC 2DQHH 3CSPA 4JKPL 4W6YB 1F97A 4OLWH 2CK2A 1CLCA 4GG6B 1JFQL 1YY9D 5CUSH 2Y4SA 1X44A 4MAYA 1N0XL 1HQ4A 2F19H 2I5YH 3UBXG 2EDRA 3O2DH 3VXSA 1JZ2A 1BQHA 2FECI 1P7KA 3CSBA 1U92B 3CZFB 4JQXA 3BN9C 1VKXA 1LO2H 3QG7H 3TO2A 4JRYB 2FATL 5E2UL 4U05A 4NO0D 2E6QA 1CG9A 4OCLC 5J13B 5F88B 1HWHB 4P23C 4R90L 5J7CC 5D70L 4K71B 1ES0A 3NACH 4M43H 4ZUWA 2W07A 3HE7C 3X12A 1NSNH 3DMMD 3P73A 2R4SH 2FBOJ 1C5BH 1QLRB 2A6DB 2HN7A 4WFFD 5F9OH 1I3RA 1CDUA 4KVCH 4HAFA 4N0CD 2BNQD 4KK8D 2C4FT 2JELL 1KIUA 1K4DA 2R69H 2NNAA 4ODTL 4RBPH 4XCCL 1MJJA 3ARTA 5CMAB 1NLBH 5HYQB 5D7JD 5E8OA 1WIPA 2ED9A 3A6OA 5FCUL 1A14H 4G6AD 3JXAA 3ESVF 4O9HH 1NJ9B 1QLFA 1LQSR 1R5IA 2DM3A 2H32B 4LSSH 2EYTA 3UP1A 1U8JB 3BPNC 3VFWA 4P46C 2M8XA 2H6PA 1MFNA 3H3KA 4MDIB 3MV7B 1D9KA 2FYYB 4Q97A 2HT2D 5FOJA 2WUBH 4LNRA 4RFOL 1EXUB 2VLRE 5I75B 5ID1B 4I0CC 5TGBA 5EOTA 1ZE3C 5E2TH 2OTUA 4PJDB 4YZFF 1FLRL 1K3IA 1Y0LB 2FD6L 4P2OD 5J3HD 2VITA 3RQ3A 1PZUB 5FHBH 4PD4J 2EEAA 1CE1L 1LMKA 5K9QI 5DR5L 4G8GE 4LPVA 1TJHL 4WI6A 4EI6B 4Y16C 4S1DD 2IANE 1H15A 2CKBB 4JN2A 1AGEA 4NC2B 1A1NB 4Z5RA 2VB5A 4ISVA 5I2IB 1CLYL 1ZWIB 1MCNA 5MERB 4ERSL 1WWBX 1ZS8B 5I1JH 1FAIL 4R2GB 5ALBH 3U4EA 5I1CL 1XIWC 4TSCH 3CFBA 1HE7A 3VI3E 1NDGA 1B0GB 3IDMB 1KELL 2QSCH 4C4KO 2AJSH 1RV6X 3AFLA 4F7MA 1YPZE 4WGWB 3U9PH 4K23L 4L5FH 4J8RB 3MCLL 2PYEA 1X5AA 3IXTB 2VLLA 3C5ZA 3BGFB 4YWGL 3MLWH 3SBWC 4PJ5B 4WWKA 1IC1A 4FFWD 5EU7C 4U6HA 3Q5OA 2VZVA 3TJHC 1EO7A 1T22A 1Q9OA 3GK8H 2XXMB 1V3LA 3DTXB 1OPGL 3MOQA 5F8RC 4PJXE 4AENB 1FIGL 4FZEH 5ESQA 4K7FA 5EC2A 1F42A 1U3ZA 4RNRB 1UZ6F 1T04B 5FYKH 4MDJA 4YNYB 1OGAE 1E4JA 2AK4A 3MV01 4JAMB 4X5WA 1UWXH 1F6AA 1ND0A 3HZMA 1HKFA 5AZEL 4OFIA 4IOSD 4KJWC 3FQWA 3PQYE 1P4LB 4NUJB 1FGNH 4JG0L 3GSWB 5C3LD 1S3KL 4KTEL 3STBA 4JG1L 1ACZA 3FZUC 2XN9E 2VDLH 3MJ7A 1MEXH 4ENEC 1SY6L 1CTOA 5EWIL 3D3VE 4F7PB 3W81A 4HKBB 1GGYA 4DW2L 2EE3A 3RP1A 1TVHA 3X3FL 4JFPA 3O6LL 5I1IL 4Z95L 1IAKA 4Y2DD 1NANH 2JCCE 1MFBL 1GVIA 4UT6H 4Z77A 4NC1C 4F58L 4QRUB 3C08H 1CIDA 1BQHG 1LDPL 3WIFB 3KPSB 5LGJA 3VFUA 4LDEB 5DTFB 3RY4A 4X6EB 4OCYH 5IIEB 3UTSB 3N1QC 1YEDA 3SE3A 1PY9A 3L95B 4JR9H 3VXOA 4HF5L 1R6VA 1RFDH 2EDJA 3E2HC 2P5ED 1MWAB 4RFEA 4GAYA 1KCUH 4HK3J 1IEHA 5CILL 1QACA 3F62A 1RJZA 1EMTH 5CJXC 1XF4A 5ESVB 1II4E 4JPIB 1KJMB 1NBZA 2R1YB 5IB3A 2QHLA 1EO8H 1EBPA 1XR8B 2J8UB 4PJBA 4Y5VC 2VJXA 2NY6C 1X6LA 3N50A 4PJIA 3MRJA 4LASH 5J11C 3EYSH 2VSCA 4ONGH 3DX6B 1FGVL 1YMHA 1F2QA 4XHQA 5BV7C 3V7AG 4DK3A 5GISH 3MV9D 2W91A 2CDFB 1CU4L 4P9ML 3E6HB 3P4MA 1UH3A 1WFOA 1TTUA 4UNUA 3TF7C 1OW0A 2GYSA 1JRHH 2ZKHH 3O3BA 4I0PA 3GJFA 4MA1B 3GMLA 3EO1B 4FQXC 1UQSB 4JDTH 3NVQA 5IKCA 2VKXA 1BQLH 3ROLA 1NUDA 2QQNH 3RUGA 3VXMB 1A3RH 2KL6A 1DQJB 1NAMH 1IGMH 3UZQA 1EFQA 1T6VN 2Y72A 5HDLA 1F00I 5BW7C 5KANI 1KCSH 1SMAA 2DBLH 5D71L 3UTOA 3TBVB 4Q9QH 3QXAB 3UTTA 2NX5B 3ET9F 4WCYH 3U9UB 5I9QC 3LEVH 4GRLB 4BFIA 2XI9A 3M17A 5KSBA 5F3HB 4LLUB 3H9ZA 4QRPD 4OD3L 4UAOB 4PV8A 4ZDHA 2A77H 3D48R 1QEWA 1N5YH 3LVEA 4XBGB 3QDGD 2UWEF 3F58H 3MYJA 5SWZB 4PRBA 4XVSH 5MENA 2A6IB 4N0CC 4KK8C 5EORH 3TPUB 1WICA 4OQ1A 3A67H 3SPVB 5J1AA 2HJFA 3VRJB 3MNVB 4BYHA 5I1AA 5HVHB 3BQUC 4Q0XH 2GT9B 5TPWL 4QY8B 3EZJB 1GGTA 5EC1B 4GRWB 1JYNA 3HN3A 3DVIA 5JHDE 5C3TA 5D96C 4WI8A 5IM7A 3ARUA 3G5YB 4HUUA 3EOBA 3S35X 4OZHE 4NRYB 2F53E 3G6DH 3NMEA 4IMKC 3WS3A 5KTEL 3QCUL 1Q9LB 5CHNA 2HT2C 2BVYA 1U58A 4APQD 4WHTB 3W9EB 1U8KA 1JI1A 3QJHB 4POZC 3HC4L 3BN3B 3O6FA 4I2XE 2VLJD 5ADPH 4Y4HD 1AO7B 4F7CB 1VA9A 4JPKH 3O8XA 4P2OC 5J3HC 2V17L 2X05A 3MZTA 3WFEH 1LD9B 5DGRA 1F4YL 4JFDE 4NKOA 4LIQE 1E4XH 4MZ3A 5I30H 4MX7B 5BS0E 1ETZB 1NGYB 1A1OA 3SGKA 2ADGA 4WUKL 3ARWA 4FXGA 3B6SB 1QZ1A 3AROA 4P23B 2P7TB 3RTQB 4PRHD 3T09A 3QUMH 2DM7A 1MFAL 3HE7B 3BI9X 4S1SH 1J7VR 3VG9C 2EC8A 3Q2CA 2HTKD 1YN6A 3U83A 4FFZH 4MZ2A 3P4OA 4M4RA 1FL5A 5F1OB 4X4YB 4MA8H 5LWYH 5D1QC 4OLYH 5KOVC 2NY2D 3MRLA 3OQ3B 3E0GA 3B5HA 4I18A 3MJ8A 4TUJB 2BRRL 5JA8B 3NIDF 4JHAL 2BNUA 1P7QA 4XI5D 1NAKL 4KMTH 4U1JB 3QXVA 3WFHB 5CZVL 1IQWH 1JWMB 4FFWC 1GYAA 3BPNB 4P46B 3WHXA 2FECL 2CRZA 4C58B 1SM3H 5B21A 5C0DA 4RAVB 2FEDC 2Z35B 5F8QC 3RVVD 1HHKB 3IDNA 5TDNB 3ZKND 4GKNA 5TDPB 3Q48A 4GQ9H 3VGBA 1CXKA 3N85L 4V1DA 5HYIA 4JGJA 5DQJA 4LHUA 1CFVL 5H37G 5HI4D 4ZODA 3OKLB 4Y16B 1ZGLB 3L3IA 4OD2B 2R23B 4Z7WA 3QQ9D 3X13A 3VH8G 1CCZA 3VFNA 4LSTH 5GGTH 5D9SB 3UAJC 4NN5C 4NP4H 1V7NH 1RAMA 2Y1VA 1I9JL 5JDJA 2EDYA 1FVEA 2BY3A 1E6OH 2IF7A 4ORGB 3S96A 3GBMH 1XIWB 4RIRB 1FN4B 3IKCA 1TJGL 1AD9B 3DX9A 4PJAE 5H94A 4PPTA 4JY4B 3WV0A 1JGVH 1HH9A 2VLRD 5EOQL 5D5MA 3WXWH 2BVQA 3GSQB 4HFWB 3LQMA 1DCLA 2WANA 2BY0A 2VL5A 4M1GH 2YD3A 4PGCA 2GUOB 5I8OH 4UNVA 5IFAL 3QXTA 4LP5A 3G9AB 5DURB 2A0LC 1NCTA 1JNHA 1V8HA 2ZOKA 3FRUA 3KPNB 2AXGA 4G8GD 3ZYZA 4YFLI 5TF1L 3GMPB 3QWOA 3FN9A 4AH2B 4N5EC 3ELAT 1SYSA 1MH5A 3TT3L 5LKNA 2DN7A 4KRPD 1KFAH 4HGWA 4Z18A 5D2NE 1NGXB 1YC7A 3O9WD 2JJVA 4XNYL 3ULSA 1AGDB 3C6SB 2FL5A 3C60C 4X9HA 5DD1H 2ZJSH 4OT1H 2XZCH 3EFFA 4DCQA 3SDAA 4DUVA 3MOBH 3X3GL 3KWWA 4PGZA 3D85D 4Z7VB 5DWUL 3V0VA 2WIIA 2JB5L 1OTSD 2N7AA 3UDWC 5C08B 2PW1A 3SKNB 4Y8DC 4GS7C 5DT1L 3KDMA 4Z78B 3GSNL 2XFXA 2GJZA 3QZWB 2ATPB 3VCLB 3BE1L 3V4VH 1T0NB 1HILA 2W60B 1UJTA 1E4KA 1LO0L 5BRZB 2PCPA 1FDLH 1JHLH 1S7SA 1A6AA 3RRQA 4BK4A 3IAQA 4ZTOL 3WUZA 3CUPA 1I9IH 3AY4C 2NZ9C 3NN8B 4TRPL 2J6EH 2XQBH 3QIWA 1CGUA 2LFGA 2AVGA 4LNVA 4HWEH 5DMKA 1ZA3A 2DQTL 2ZSWB 4GKZA 1OWRM 2OS7A 4JO4H 4NKMA 5L8JB 4JFZL 1FZOB 4J2XA 1OGAD 1NLDH 5I8CA 3EYVA 3D1MC 1DBMH 1LNUB 4L3EA 5A1AA 1KCRH 4XB7A 5HYJE 1G6RB 4UINL 4NQEB 5T5NG 1ORQA 3TT1L 3VI3F 5FECB 4UT9H 3PQYD 1C12B 1MJ8H 2VDPH 1YPZF 1QD0A 2XN9D 5E5MB 3RI5F 3FCTB 4ODXA 1I7UA 1WAAA 3D2UD 3D3VD 3E2HB 2X4RA 4K7PL 5I0ZA 3RZCC 1S8DA 3WEXA 4ZD3L 2CDEA 3B3IA 5HYEA 3DARA 2F15A 5L2KB 2HH0L 3HE6D 1XGYL 4QXTA 2DQJL 3HI6H 2KKQA 2Q86B 4PJ9C 4L3AA 5FM5M 4IIQC 4ZFOB 1GPOL 1MCHA 2CRYA 4HWBL 4PJXF 1INQA 4Y5VB 4WIQA 5AZ2L 2NY6B 4QKXB 5C0AE 3WD5L 4KDTA 4CVXA 3I84A 3U7AA 1ZSDB 1RJLA 1XEDA 5IMLA 1YQ2A 1AI1H 3G6JA 3M8OL 2F8VA 5F1IA 1G7QB 2KPNA 5J11B 2QQKL 3O2WH 4LRIC 1KPVA 5I1HL 2VLKB 2BOCB 5C86A 4JFYB 4Q74A 2IG2H 1BEYL 5B4MC 4G8IA 5BV7B 3MRPA 2WP3O 1RZGB 3GGWB 3H9SE 3WFDH 5A2LH 1A1MB 5IMKB 3SDCB 3BRDA 1MFDH 4YE4L 1NGWA 1QBBA 5F96L 3DVNA 1U3HD 2AABH 4LHUG 4PRAB 2E3VA 4FTVE 3KNBA 2AEQL 2AS5M 1KOAA 2VC2H 4YAQB 3DYMA 3WFCH 1HOCB 5DJDB 5JLZA 2AJVH 5E4IA 1JTTA 4ETQB 4QRRB 1NMBL 2EIZB 4U1LA 1J10A 3MO1B 5IF0A 2JCCF 4ORZC 1HEZA 3FN0L 2OK0L 2E9JA 1AGBB 4P9HC 2YN3A 1TCMA 3RKDD 4JVUA 5DC9B 5DYOA 3BKMH 4NO0B 5I9QB 3QFJE 1A9BA 1DFBH 4NOBA 2C4FU 5T3XH 3HLAA 3M45A 1I85A 1HDMA 1VADB 5I1GL 5JDSB 1O0VA 1LE9A 4I3RL 2DQEH 4JEGB 3CK0L 4JKKA 4U6YA 2OJZH 2ADJA 5GGQL 4P2QA 1YDPB 2HTKC 1EH9A 1JNLL 3V5DA 4M8QB 3H9HA 1I1RA 2VZTA 3ZT7A 1F3JB 4HPYH 2A6KB 1ZVHA 5SWSE 3BQUB 5SX4H 1AH1A 3BP5B 4BSWB 3AXLB 4WI3A 1P1ZA 4XI5C 3FB8A 2VUOA 5D96B 1KJVB 1DEEB 1KACB 1UXSB 2FGWH 1SMOA 1Q72H 4JO3L 1U36A 5E6IA 1XGQA 1ZT4B 5F7EH 1T1WB 5HHVH 4RAHA 5HHPB 1PX4A 4Y19B 4PJEE 2YD2A 1MREH 4QOKB 2GY5A 3JTTB 5IVXA 2ZUTA 5I0DA 4NQXB 1HHGA 3ZKNC 2YD7A 4OB5H 4P2OB 1U9KA 4G9FA 3WNPA 1SJXA 2C4XA 3UJIL 4X6CA 5E5UB 2R2EB 4XXDA 1INDH 1A0QH 3VGFA 1U8HA 1F58L 5HI4C 3MLPA 4I77L 2X4OB 5DGQA 1CDHA 4P5TA 2F54E 3OKMA 4MB4A 3NPZB 1KTLA 3LIZH 4BH8A 3QCVH 1CLZL 4GW4A 4YHNA 3FQXA 3MGTA 1FH5H 2AGJH 3IJYB 1W2KT 5KBNC 4J1UA 2F53D 1VPOL 3AS3A 4JZNA 5L6YL 4PJ8A 3IDUA 4KAQL 3FT2B 2V7HB 1KLGA 3EYUH 4H1LH 2VZSA 4UIMB 1RK1B 2B4CL 3LH2H 3RWCA 4LGRB 4PB0H 4HUXA 3TBWA 4LSUH 3FQRA 2HLAB 3D0LB 2FBJL 2CLVA 4NUGL 2D4DA 5DO2D 1IC7L 1I7TA 3FL7A 5DK3A 4U1IB 4OKVA 4XBEL 2WQ8A 4ETYA 1AIFA 4XBPA 4EDXA 1IKFL 5BS0D 1FNGB 3MXWH 1P53A 3ZMRA 4P4KA 4J4PC 5DUPL 5E5RB 4KRPC 1CE6B 4ZPTB 4YHYC 1O7SA 2ICEB 3FKUS 1RJYB 4DKEH 5FYLL 3S3PA 1HYSD 2DDQL 1MWAH 1JF1A 4TQEL 2G5RA 4KKCD 1JPTH 2OTWB 1K2DA 4HUVA 1U8QB 1EUUA 2I24N 1A21A 1NGZA 4TUKL 1KCVL 3TJEH 4NZJA 5BO1H 3ARGA 3B8YA 4X6FA 3PHOB 1D5IL 1LO4H 2JJSC 5TE4H 3IU3A 3DRQA 5CBAA 5CJOL 1I8IB 5MHSE 3DHMA 1TCRB 3IF1B 1MCJA 5LBSL 1K5NA 4E5XA 1EEUA 5KJRL 1XZ0A 2HG5A 4JGMA 4R4BA 4NN5B 5IB4B 4L8CB 5T1DH 3VXUA 4JDVB 2VOTA 3SKJH 5ITFB 2RFXB 3RX8A 1FFPA 2GCYA 3W0WD 1S7QA 1DUZB 4XWOD 1UYWH 2B8OT 2WZPD 1G7PB 1J1XH 2DBJA 1QTYT 2Q1EA 5T33H 4XVTH 3REVB 2OQJB 4DGVL 3GUTB 4BZYA 4AIZB 3OSKA 1YQVH 3U2SA 3WXVH 4FQ2H 2L4OA 3JV4A 1OSZA 4JKMA 1JHKL 1J0JA 4CMMA 4X4MA 2SEBB 4H8WL 1Y6NR 4P5MA 5F1NA 2NW3B 3V4UH 5F70A 3P11L 2BVOA 3QXUA 3T04D 1CFQB 3PNWB 1C5CH 3CFKA 3VFMB 4AIOA 3HHRB 1H0DA 1XF3A 4K3GA 4WW2F 5TQ0L 5I76A 4M6MH 3P0VH 2JJTA 2PO6C 4OZ4B 5C07B 3MRFB 4IHOA 1QBLL 4HKZB 1NKOA 1QSFA 1I1AC 4U2YA 3GJEB 1N26A 3GIVA 4OIIL 4I4WB 4NO2B 4GS7B 3TBSA 4G9DB 1EEYA 4U3CA 5DVKA 5D7LE 3VJ6A 1ORSA 2QKIA 3EOAB 2FWOA 5A3IC 1CDYA 3GI8H 4MXWH 1BBJB 3V0AC 1KBGH 4NOFA 5HHOE 3WFZA 1EAJA 2NZIA 1PLGL 2R29L 3S4SB 4PB9H 2AV1B 2W0PA 2B4CC 5JW3L 2DKMA 3AAZB 4ZTPH 1IAOA 2QR0A 5I17A 1F11A 5CP3H 2DLFH 2IBGA 1P4BH 3IJHA 3KPRD 3TIEA 1TENA 3QHFL 4TSBL 2MSPA 4YXLL 4XMPL 4ZUSB 4NKQB 3WJLA 3F12A 4M7JL 5BMFH 2GQHA 2HRPH 5DI8A 1I1YA 1XGRB 4X6BA 2MPAL 5TE6L 4DOHB 3MV9B 1I1FB 1DQLL 1RSFA 3RFZC 3OJ2C 4DVBA 4PJAF 3NFPB 1U3HC 1A22B 4U1SA 1CLOL 2OR7A 35C8H 3OMZA 3IETA 1OQOA 4FXKA 4MGXA 4P4RA 3LKPB 2E8ZA 2EDFA 2UYLA 3I02A 1VEOA 3ZHKA 1QR1A 3VW3L 4Y4KC 1ZHLA 2ZSVA 3FTGB 4G3YH 4GBXA 4M1DL 3MRNA 3WUWA 5IV2B 2ADFL 4C83B 2NY0C 5C6WH 1RUKL 2IALA 2PR4L 1YEGH 3LKSB 3PDDA 2GJ6A 4MQ7A 4XP4H 4JZJC 1AGCB 5CBEB 2GTZA 2AKRB 3RZCB 4HMDA 1F02I 4CDHA 5FKAB 3NCCB 4H88H 3GDBA 1NMAH 4QHUA 1MCKA 5DD5H 1G7IA 4G5ZH 1GGIL 4PJ9B 3ARBD 1K4CA 4IIQB 5HYJD 3ARFD 4HS3A 2QADC 1NBVH 5JZ7D 3HI1A 4F7TA 3MLZL 5GSRB 4KQ4H 4EUPB 2DMCA 2FEEL 1DLHA 1MHEA 3VFPA 3QDGB 1WBXB 1K6QH 1AXTL 4ODWB 4JQVC 1YYMH 4HXBH 1YC8A 2XA8H 5F1KC 2HMIC 5GZND 4DUXA 1Z5LA 4JB9L 4XNXL 3ARED 4JFOA 4Y4FA 5C9KA 5CINL 3HPJB 8FABB 2RBLA 4H8WC 4HGKC 3O0RL 4AEIH 3QUXA 3IXAA 2NXYC 3EYQD 4LOUD 1FO0L 3P9LB 4XT1C 4BSJA 5EO1A 3GRWL 4NCC2 3OJDA 2CPCA 4ZPVA 2VSDA 4YIQA 4JFFD 5GGRB 3O6MH 4QHMA 1SBSL 3O2DA 1QFHA 1G1CA 1HHIA 4HJ0D 4X7SL 1X7QA 3R06A 2VLJB 3QEQE 3IDXH 5C0AD 5HHME 4WRLA 1LEGA 3RHWK 4XVJH 5I19L 3V0WL 5FV2A 3BP6B 5HPMB 1JGDA 5DEFA 4D0DB 3LD8C 4IRZH 3D9AH 4U0RC 3OF6D 2H3NA 3GSNB 1AHWA 4FFYL 2PTTB 4LCIL 1A6ZA 2ARJB 3VD3A 3K4ZA 2VIRA 5BVJA 2FIKA 4OQTA 1FZJA 2FLBT 2X09A 3F7PC 5FYJD 1YNKL 4XB8A 5I16B 4PRHB 3V7AE 3HR5A 3NABL 3SCMA 3VD5A 3H9SD 4MNQA 5KSVA 1CTNA 2V2XA 3GSVA 5IEHA 1U3YA 3OHXA 1BFTA 3EYFA 2DQIH 1U8IB 1MIEH 5BQ7B 4NZTL 2EKSA 4FTVD 2L7UA 1MIMH 4XH2B 3BAEL 1IL1B 4WEUD 3VRLE 4JKPH 2NY2B 2XKNB 2Z92A 3L3OB 4EN3A 3WIHL 1KCKA 5D7IA 3AM8A 3UEZA 4UDUB 1N0XH 1KIRA 2P44B 2VISB 3BGMB 3P0GB 3GB7A 4C54A 2V5MA 3N9GL 1WEJL 3IDIB 1FZMA 3NCYP 4L8DA 1ZK9A 3QFJD 4MJIB 4F8QA 3U36B 1T2QL 2YBRA 3ZSSA 4IOFD 1GZPA 5AYUH 3QIUA 1HYSC 2DYPA 2W65B 4KKCC 4XMLL 1HZHL 5ELIA 4DZ8A 3WDJA 3FB7B 4R90H 2PYEE 3NA9L 4MA3B 4FXLA 5D70H 1MHCB 5EZOH 1S9YA 1U8LB 1ZVSA 3T65B 5CGTA 4OFYD 1S7WB 2FX7L 3W9DB 4QCIB 5C0FB 3TNNA 5SWSD 2JELH 4Z0BH 2X1QA 4ODTH 2E5EA 3L3KA 2V9RA 3CDCA 2A83B 4CVZA 4NNYA 1DP0A 3S37L 1DE4A 1T1YA 4OF7A 4KC3B 3TZVC 3VE0B 2KDGA 1T1XB 2VWEE 4XWOC 4HEME 4BFGA 1B0RA 2JIXD 5DF0A 4ZAKC 1MVFA 3LPGA 2AK4E 4JY5L 2B39A 4Q9CA 3QUYA 1MCWW 3MMEB 4XP9L 1E27B 2R39A 3NZ8B 4RFOH 5EBLB 3BZDA 2F8XC 2KUTA 3I9GL 5FXCH 5HGDB 5HGBB 4KJQD 4OD1L 2E7BA 4Z0XB 5IB1A 1FLRH 2JJUA 1AP2B 2FD6H 4FZ8L 4MNHB 3PHQB 3RBSA 1C7SA 1IGFL 1L4IA 1RUPL 3IDGA 1G7JB 2IBBA 2MOVA 3GSRA 2F54D 4LBEA 4OI9A 3WUWG 1CE1H 5EG6C 4KRPB 3W11D 5DR5H 3HG1B 4YHYB 1G9NL 1C1EL 3HS0B 2ICWI 5DSCB 3O9WB 4G6ML 1JYVA 3QXWA 1MVUB 2W9EL 4O58H 1CLYH 2I9LA 4ERSH 4F7EB 1FAIH 2DD8L 4HDIB 5I1CH 1NL0L 3R8QA 1J88A 1XGPA 4H26B 4WO4A 1RULH 1MI5B 5DJ2A 3FT3B 4M7KH 2I9TB 2P8PB 4X6DA 1KELH 5FUOH 2O5ZL 4XPAH 2X7LB 1JTOA 1V7ML 3FFCA 4K23H 1RHFA 4PJEF 1PKQE 1MCWM 4H25A 4CDGC 4AQOA 3MCLH 4NBXB 1YEIH 4KU1A 3ZYJA 4YWGH 4L29B 3GSXA 5C0BA 4MCYA 3MRKA 3SOBL 4O2CB 3NOIA 4OF0A 4XNQA 1OPGH 5HHNB 4QRTB 2XIDA 4KKLD 5E8PB 1FIGH 4ZXBA 5IVZA 4PJBE 1OGAB 3RDTA 3BJ91 1U93A 4D0BB 4NFBA 2EZ0D 1OHQA 3BHBB 4PIRF 4OLUL 3I3EA 1EFXB 3QNZA 2ESVE 3UC0L 1CICA 3CXHJ 2XNAB 3NCJL 4HWZA 1J9CT 2PO6B 5CD5D 5K9OB 3ZE2E 1I75A 1T0PB 4JG0H 2WAHA 1S3KH 1I1AB 1BIIB 4JG1H 1ZLVK 1FVDB 1SY6H 1CD1A 5B22A 5EWIH 2ZCHL 1U8MA 2GSIA 3VA6A 5ILTL 1RHHB 3BXNB 4DW2H 3HNTL 5TFSL 2JCCB 5ADOL 4AG4H 3X3FH 3W39B 3ES6A 3O6LH 1MNUH 3RUGE 2PXYA 4BM7A 5I1IH 5L2JA 4Z95H 2V5TA 2HTLD 4IM8A 4PRNB 3SE9L 3ARFC 2X89D 3RGHA 4ODSL 1UGNA 5IG7A 4NJAL 4YHZL 3E1F1 3GO1L 3VFOB 4X7EC 1W0VA 4F58H 1BFSA 1M71A 5C9JB 3S8WA 3UTTE 1LDPH 4PGDB 5T1KB 4HXAL 3TO4A 4M6AA 5EUKB 3GMOB 3AREC 1FFOA 4LL9A 4NKDA 2V2WB 5KSBE 5F7UA 2V6HA 3BP7B 1MQ8A 2YEZA 5E70A 1ERNA 4LOUC 4HF5H 3WHE0 1G9NC 5D6CB 4N8PA 3QNYB 3IS1X 5MENE 2YZ8A 3G04A 1U3HB 3PV6A 3U7WL 5LCVL 3AMLA 3KYOB 1C16B 5CILH 1NAMA 4HJ0C 5HHOD 5ABDE 4JN1L 3N1PC 1G0DA 1SJHB 4R3SA 4Y4KB 3QDJA 3TA3A 2CSPA 4UQ3B 1H3PH 2NY0B 3PE9A 4ZOBA 4GW1B 1A6UH 4ELME 3VFVB 4K3JH 2BHUA 2R0WH 4Q9BA 4JZJB 4F9LC 3MLTA 5I71C 1BOGB 4B5EA 4ODUA 3OJMB 3VXRA 1BBDL 5HGAB 1UB5A 3MRRA 2R2BB 3E6FB 5ID0A 5B38B 4LVHC 3U46A 4NNXA 3MRQA 1HIML 4MJ6B 4BUHA 1VHPA 5GS1A 5HI5D 1HNGA 2QADB 1OY3B 5EB9A 1UWGL 1L6ZA 3JV6B 3MV8A 4O2EA 2CUIA 2OXGA 1X5ZA 1Z9OA 3NFSL 1CU4H 2FJFA 4P9MH 4CU7A 2DTML 1DDHB 2DQFB 3EYOA 1TZGL 4MMXC 1Z0NA 1GXEA 3NCBB 4F15C 4HIEA 5EFIB 3H2WA 5JPMA 4NNPH 2RGSA 3TIDB 4YBQD 2VXVH 2NXYB 4G80A 3ARZA 5GGSB 3QAZB 1MUJB 3MUGB 4IOFC 4WI9A 4MAYD 2CD0A 1BVLB 5D71H 4PTTA 1G7LA 2NTSP 5FGRA 2AI0H 5DEGA 5DQDL 2DIAA 4G6FD 4JLRA 2NYYD 3VXSD 2J8OA 2HFFA 4OI7A 4OGXL 2ZUUA 5T3ZE 2K9UA 1K8DB 4M62L 2Z93B 2DM4A 3THMH 4G8FA 2D7QA 3DHJA 3RWJB 1R3LB 4Q6IA 1CFSB 3M1BB 3IRZA 5CGYD 1DSFH 2W0KA 3LD8B 4W6XB 3I75B 4U0RB 1U8OA 4M6NL 4EVNA 4FQJL 3P30L 5E95B 4N68A 3QUMA 4X9FA 3V7MA 2YN5A 2GHWB 2YPKB 4LCCC 3GI9H 4BH7A 4HIIA 2OBGA 4ZYKA 5DRNA 5DK2A 3O3AA 3OG6B 5TPWH 2XRAL 3LQZB 5KSUB 3Q6FB 1U0QA 3CAFA 4V1DE 3BH8B 1AKJA 1H3XA 1KC5L 3I6GA 1WGOA 5E2VL 5IROC 1BZ9B 4G6JH 1JWSB 3IFNL 4Z7WE 4OGZA 5KTEH 4I2XB 3QEQD 3QCUH 5HHMD 4MB5A 3FQUA 4YHIA 1BREA 3L3JB 3O41B 5I1DA 3RWEB 4M8VA 1U8PB 3WNOA 5JOFA 3HC4H 3EO9L 2EO1A 2EYRB 3UMTA 1FNEA 3J7HA 4P3WA 1DBAL 2CRMA 3ARYA 1D9KD 2CR3A 5INCA 4NQDA 4QRQB 1HI6A 5D5ME 4F3FB 2X4SB 3PGDB 3KPLB 3G08B 2X4UA 3DUSB 4XHJC 5ISZA 4WUKH 1CT8B 5BZWB 3CFIC 5DK0B 3B8SA 2Z91B 1CXFA 1UEYA 1KULA 3X11A 4LHJB 4JPWL 1RK0B 1JV5B 4AZ8A 3UTQB 4OGAD 1TTGA 4LPWA 5GGTA 3GHEL 3PHSA 2E7LC 2NLJA 4XCEB 4KJPD 4U49A 3DYPA 2VH5L 4HUKB 1KB5A 5ETUA 3DNKA 2UWEA 1MAKA 3N1GC 2IPKB 1UB6B 4MWFB 3VMNA 4DFIA 5MP6L 5IJVA 2BRRH 1QLEH 5GSVB 4JHAH 2ZOLB 1NAKH 4QT5B 3ARRA 1YNTA 3F5WA 2D7TL 3PGCA 3W0WB 4ALAL 1ZLVH 3D0VA 1IFHL 3VA2C 5CZVH 4PJFA 4ZAKB 1BJ1H 1T7XA 3TN0C 4CJ1A 2PYED 4KWUA 2CRIA 1T83C 4MMZC 4N8VB 4P59L 4DTGH 4OBSA 3BEWB 3C5ZD 1R5WA 1G7MA 3QRFM 3B9KC 2DLGA 4WWKD 3C8HA 1FO0B 2NPLX 2AEWA 5KS9A 5DMGC 5CD3A 1O5DT 5CIPB 4UUJB 5BXFB 1KEGH 3N85H 4G7YH 4OFDA 3VFGL 4BZ1L 3OKEB 4MCZB 1C08A 1CFVH 3ZKMC 5I18H 3IFOA 2VDRL 5HPOA 5GS0L 1FZKB 2P48B 1WZ1L 4QHKJ 1ZEAL 5HHQB 2BC4B 2R4RL 3VRLF 4PLKD 4ZO7A 4HD9A 1DEDA 4QRPA 1I9JH 4PJAB 5EOCL 4UTAL 4KK5D 4HUWB 4D0CA 2BY2A 2AK4D 4BK5A 4NSKB 5CAYB 4GG8A 5M94B 1TJGH 3MJ6A 3MUZ1 4OCWL 4JM2A 5EBWA 2RCSL 4Q58C 5D72L 2BVTA 1N2RA 4EUPH 5EOQH 3T4AB 1JK8A 4J3VA 5C0GB 1S7TA 5F1SA 2P47B 5IFAH 4UU9A 4TTGA 4K55A 1UEMA 5MEOB 3DX7A 1P6AB 2HTLC 3V5KB 6FABL 5DMIL 4O4YH 1WAAE 3C5JB 3OPZL 5K93A 1J0ZA 4X5LA 5F9JB 5TF1H 1HINL 1OAZH 4PLNC 4HKJA 2J6EA 2Q7NA 5CEXA 4PGBB 3TT3H 1WZKA 5EZJB 4QYOA 1OD7A 4YK4C 3KPRB 1Z9SA 4XNYH 2Q20A 3LSOB 4WNQA 1VEPA 4DKDC 4GUPA 4HS6A 1X5GA 1OD9A 4HZLA 4M3KB 1G7HB 2XTLA 3T2QA 5JMOC 3VXTB 3L3DB 2AJZB 1MJUL 1HXMB 3RWHB 3X3GH 2X1WL 2VUYA 1MF2L 4D9QE 4GXUM 1FLTX 3OR6A 2JB5H 1BQUA 4EXKA 5FDYA 3DBXB 3G6JE 1ONQA 3IJSB 1YEKL 2RHEA 1EV2E 5F88A 3GSNH 1IEAB 3CVIH 5FM4A 3RJDA 1OTTD 3SGEH 2OJEB 3BE1H 4H5SA 4QO1A 1NH6A 1P69B 4PR5B 4HLJA 1LO0H 5GJTL 4M7ZC 4FABL 2A6DA 1Z3GL 4CMHC 1DQQA 4NHUB 4RAUB 4U1GC 3RY6A 4P48A 4ZTOH 5JUEH 1CIUA 5DD0L 4RISL 5IEKA 4ZSOB 1RZIB 5IK3B 4DGYL 3NCFB 5GJSL 1SEBB 2JB6A 3BZ4B 4TRPH 5T1MA 1ZOXA 4A6YL 2CUMA 2WUCL 4XP5L 3I85A 5HI5C 3TESA 2CKNA 2DQTH 3ARFB 2DICA 5IFJA 1MLCB 3BUTA 3Q1SL 2H32A 4JFZH 4XMKL 5IB5B 1U8JA 1ZLSL 3O4LB 2MTPA 2ESVD 4MDIA 3MV7A 1RMFL 3V6OC 2FYYA 4B53A 1QA9B 4UINH 2YMXL 3GHBL 1EXUA 3GMQB 2APWA 3RL2B 3TT1H 5ID1A 2YXFA 1YECL 3G5VB 3AREB 5DMJB 4LPXA 4PJDA 2NY1C 4YBQC 1I8MB 3HC3L 1GOHA 4P2QE 3LPWA 4I0PD 4K8RL 3CZJA 3VGDA 1IE5A 2CKBA 4YR6A 3QJFB 4JFFB 1A1NA 4NWTL 4ZD3H 5GS3A 3D18B 2OMNA 2NY4D 1XGYH 5MERA 2DQJH 2GAZB 3LB6C 1MAML 1ZS8A 3H3PH 5C0AB 3QEHB 5JA9A 1HK6A 1MCCA 3UTTD 4DKFL 1GPOH 4HWBH 3S6CA 3SEPA 1A4KB 2NY7L 3O3DB 5AZ2H 4I3SL 4PJBF 5K59E 3IDMA 5JW5B 5I71B 5GZOD 2CR6A 4U6XB 4PJIF 5E8DL 3M8OH 1QNZL 4GLRI 4PREA 2HVJB 2FRGP 3BW9B 2QQKH 4LVHB 4J8RA 5JW4M 5IVXE 2IPUK 4KKAD 5I1HH 1IC4L 2R1WA 4G9FE 5MEND 3PL6C 1EJOL 5IHZB 2J8HA 1BEYH 2IANA 2YD5A 4ZO9A 4X6CE 2Z8SA 1VACB 4PJ5A 7FABL 3KHQA 3RAJH 3ZE2F 5HDQL 4FTVB 4KMQA 2BMKB 4FFVD 4YE4H 5JXEC 5F96H 1JPSL 1VDGA 3DTXA 4N1CA 3DV4B 4F15B 4QRSA 4IRJC 2AEQH 2PYFA 3KR3L 5CJQL 1DLFL 4AENA 4GJTB 4TVPE 4PD4K 4EXPX 5FKPB 4EDWL 3D85A 1E4WL 1R3HB 3RUGF 4E41E 3QR2A 4RNRA 1NMBH 1T04A 2ZG3A 1D9KC 3NH7L 1A6WL 3HNSL 5IOPA 3GNML 3H7LA 4YNYA 3C5SB 3F6IA 3FN0H 5J9PB 5E08H 2OK0H 4JAMA 5EO0A 3O6FD 3UYOD 3E3QC 2A6JB 3O8XD 4ONHA 3HZKA 4C56B 4KJYA 2FZ3B 5GGVY 4L8BB 3WS6C 1S7RB 4NUJA 5KSBF 1HHHA 5I1GH 1PG7X 4I3RH 1KENL 5DQ9A 3CK0H 2VR4A 5GGQH 3V5HA 2GK0A 1JNLH 4R7NA 3SE8L 3AVEA 4UBDD 5SWSB 4KJPC 4LF3B 3V4PL 1GAFL 1JN6B 4LCCB 2E8YA 4H1LA 3BPCB 1N5AB 2Y7QA 1M7XA 2ZUWA 3CPLB 4JFQB 3RL1B 4QRUA 2NR6C 1RY7B 3WIFA 2JIXB 1A7PH 4PY7A 3L9RB 1DTUA 4ELMF 5T3ZD 5I66B 5EO9B 4E42B 3OTTA 5DTFA 1P7QD 2VL4A 3VXUE 3C5ZC 5FF6A 3UTSA 4PLJC 3QQ4B 4N90E 4DGIL 1A6VL 4X99B 1T89A 1MWAA 3D5OF 3FO1A 4MD4B 3ZT5A 5T5NF 3IFLH 1F58H 3T3ME 3KYNA 1T21A 3HMXL 2XKUA 4PLKC 5D4QA 2WK2A 4JPIA 4V1DD 1S7UA 3HA0A 2BNRB 1CLZH 4LHUD 3MRHB 2OLDA 4TULL 1GRWA 4JY6B 1NDMB 3UPCA 1VPOH 2B1HL 2BCKB 5L6YH 2IAMC 4KAQH 3UBXB 1JF6A 3QRGL 1TVBA 3B2UD 2H8PA 2NQCA 1MCPH 1RIHL 1T5XA 2G9HA 2O93L 2FBJH 5LAXB 4JVPA 1IC7H 3PDOA 3SDXE 1QSFE 1AFVH 2XZAL 1VFAA 1IKFH 1XGTA 3E6HA 4L4TA 2D3VA 3QUKB 5DUPH 5HVGB 3TFKC 4OSUL 3TN0B 5DJCB 3FQNA 4MJ4A 1UQSA 2DWDA 5FYLH 2DDQH 4KTDL 4X8JB 4TQEH 1Q9KB 2YD8A 2Y5EA 2KZWA 3B9KB 1DQJA 3TYFB 1H3TA 1CGVA 5CEZE 2WW8A 1KCVH 2AJ3A 1BIHA 1JZ3A 5KVMC 1NGPL 4RGMC 3J8F7 3D25B 4OCMC 1CFNA 1D5IH 5DC4B 4OGYL 4QNPE 3PG2A 3U9UA 4NYLA 3SDAD 3D39B 1BZ7B 3MCG1 1RZ8A 4KY1L 5LBSH 4Z7WF 1BFOB 2EDWA 5KJRH 1OTTC 4J3TA 1ZKAA 5D1ZA 2GJJA 1RZJL 2R56L 1FNSL 1PG7W 4PRPA 4JANA 4KKBD 1RZKC 4OF8A 4NQTA 5EUOE 4F33B 4Z76B 4O51A 3JV5A 5SWZA 3PIQA 2A6IA 2X70A 3WE6B 4QHLB 2A9NL 3SPVA 3ROOB 1BX2B 2NTFA 5D5MF 4MSWB 4CW1A 4LMQE 2G5BB 5TH2A 4DGVH 3U1SL 4QHKI 1OQXA 3V9FA 4QY8A 3BVNA 5EC1A 3SY0B 5CJ5A 3DXAB 4IOIB 3DETC 4X0KB 3TGXA 5CP7B 1H3GA 2HT3C 4HZAA 5CP3A 2CGRL 2OL3B 3G5YA 4N0FB 4H8WH 5DHYA 4NO5A 1F4WH 2YD1A 1QFUH 1T6WA 3QIWD 1Q9LA 4DN3H 3K2UL 1JGLL 1J8HA 3P11H 3VGAC 2V5YA 3EUUA 4XPGL 4YK4B 5E03A 3TBYA 1IM3B 5TQ0H 4BQ9A 3MRCA 4L3ED 3HPLB 5F9AC 1EA9C 4V2CB 5HY9B 1LD9A 2YRLA 1QBLH 5DA0B 1XCTB 1OW0C 1SEQL 2H1PL 2FJGB 4I0PC 5CZXD 4OCRL 5I8KH 4MX7A 1CGXA 4NJ9L 4IMLB 4WFEE 1NGYA 1KJ2L 4OIIH 2J88L 5T1LA 3T8XB 3P77A 1IGJB 5HVWA 5EIVA 1BOYA 3B6SA 4P23A 3DPBA 5JHDA 2P7TA 2CQVA 3UPRB 2XT1B 4CVWA 3HE7A 5I1LB 4OZHA 3VXPB 2CK0L 2BHZA 3QH3B 4YXKL 4M7ZB 4Y5YC 4POUB 2FO4A 5JOPE 2C5DC 1HH6A 4U1GB 4OUUA 4PJHB 3ZSTA 5GHWL 5JW3H 5E94B 3NZHH 1KTDA 2B5IC 1G9MH 5KAQG 3LMJL 1IGYB 5JR1H 4AT6B 2XWBB 3LN4A 2CIKA 4UTBL 1UM4L 4KZDL 5J56B 1S7VB 1TQCC 3QHFH 1XT5A 3OX8B 4JFDA 4D9QD 5DRXA 3JTSB 1KCLA 4YXLH 1D6VL 5TQ2H 4FQLL 4XVUD 1UWEL 4U3HA 4U1JA 2PF6A 3X14A 4M7JH 3WFHA 5HGHB 1JWMA 2MPAH 5TE6H 2HLFC 2IJ0C 1DQLH 2VXTH 2Y5TB 4FFVC 1W0WB 4B41A 1FORH 3SDYL 4MS8C 1UT9A 4M7LT 1ZT7B 2DLTA 2Z35A 3RPIB 3QPQC 3MA7A 5C6TH 1HHKA 2Z31C 5TDNA 4NM4H 5EU4A 2NY1B 2YXMA 1U3JA 5TDPA 4MNQE 1QUNA 4GAGH 1PQZB 4S1RL 4P2RE 4M1DH 3HZVB 2ADFH 4GMTL 1WAAF 1ZANL 3GMRA 1N59A 1RUKH 2PR4H 3T0WA 3MZGB 4Y16A 1ZGLA 2DM2A 4OD2A 1A02N 1B0WA 4X5XB 1KF9B 1HQ4B 3PWVB 2Z8RA 3RU8L 5D9SA 3ZT6A 3VXSB 2FO1A 4YDVA 1RZJC 3MNZA 2LAGB 3MLYL 4NQVA 2WINA 1RI8A 1VKXB 4ZQKB 1XIWA 3TO2B 1DVFC 4JO2L 3I3BA 3MLZH 1CG9B 1DBJL 2WBWB 32C2A 1AGFB 1XGUB 4J3SA 4XP6L 3GSQA 4HFWA 4AYFA 1AXTH 1QVOA 3E8UH 5F72S 1ES0B 4ZUWB 3LZFL 1M7IA 3G6JF 2R0LL 3P73B 2GUOA 4JB9H 4XNXH 3LKNA 4P2QD 2HN7B 3KPNA 3H3BC 1I3RB 2BVPA 5CINH 3PL6B 3F7VA 3PV7A 3SBWA 3O0RH 3QIBC 4UI2A 4BQBA 1K4DB 2NNAB 4LKXB 1FO0H 5DA4A 3OXSB 4RMQA 3GRWH 4LKCB 3GFUA 1NGXA 1PEZA 2ITDB 3HC0B 4RDQG 3EKCA 1AGDA 3C6SA 2ICWB 1FV1A 5HHMB 1SBSH 4IRJB 5FO7A 1QLFB 4X7SH 4UV7H 1ADQL 1XF1A 3HB3D 3MJ9L 5J1TC 1R5IB 4LSDA 2EYTB 1DL7L 2XICA 5E6ID 2Q8BL 4X9BA 4Y8AA 1S5IL 1URLA 5I19H 1D9KB 3V0WH 3VWJC 3RVWC 1AQDA 1N6QL 1QBML 4JQIL 4FFYH 5TGBB 4X9IA 4X80L 4LCIH 3VI4E 3KJ4C 3QZWA 1J0KA 2ATPA 2OTUB 4HWUA 2HWZL 2VITB 4G9FD 3KYKL 4OM1L 3VCLA 1BJMA 2W60A 5BRZA 1H8SA 1PD6A 3NABH 1BECA 4YC2C 2BOBA 3ZDXE 5IQ9B 2OP4L 3SKMA 4JN2B 4P5TD 3JUZA 3IB4A 1WFUA 4E0RB 1IAII 4RMUA 3PDGA 4NZTH 5ALCL 3BAEH 1QRNB 2Y25A 5ANMB 2E7MA 3U4EB 4PJ8D 3WIHH 5MEQB 2WWMC 1OT2A 1UA6H 4RSVA 1CVSC 5BJTB 3ESUF 4GH7B 3MLUL 4G6KL 1WEJH 3VXQA 2VXSL 3RVTC 2BK8A 4F7MB 1I3UA 4NQEA 1RU9H 1T2QH 1QR4A 4GRMA 4IBLT 5K59F 4X6DE 2LU4A 4KK6D 1DQDL 4NPYB 4L4VA 5IW3A 3FFCE 2VLLB 3C5ZB 4XMLH 1HZHH 4CUCA 4WFHE 5E0QA 5E5MA 5DJYB 3FCTA 2EDLA 3FAXA 4P4KD 3NA9H 5IVXF 1QFWI 4RGND 1T22B 1DANT 1YYLL 4Y89A 1TMCB 3WL9A 4X6CF 1KXTB 2FX7H 4JRWA 4YHPA 5C0BE 1A6TB 3T0BA 5LGHL 1DBBL 1MY5A 5ESQB 4XPFL 4K7FB 3ARGD 5EC2B 1PZ5A 4KUCD 2DQDL 3AB0C 2VYRE 1BVZA 4HX1A 2O5YL 4LARL 2Y36L 4W70A 3S37H 3DSNA 5C0EB 2AK4B 2IAMB 2YUZA 4X5WB 3OR7A 5BZDB 1F6AB 2WLYA 3ZDYE 4Z7UA 2Z8WC 3S36L 1IMHC 3VXUD 1IBGL 3FQWB 1P5VA 4JY5H 3CMGA 2FHCA 2VLKA 2BOCA 4N90D 1XF2B 3CDGA 4JFEB 4JFYA 5FA4A 5C2UB 3U0TA 4HJJL 3LKQB 5SX5H 3GGWA 3FO9A 4FZ8H 4NRXA 1A1MA 5F7DA 1RUPH 1IGFH 1WITA 4KXZI 5EBMA 5KZCB 3QDMA 1OGTB 1B6DA 5JXAL 2F74A 2FHBA 1IAKB 1ZVYA 5LXGL 1ZLWK 1G9NH 1C1EH 4FQXA 4YAQA 3NBNA 1K8IA 1HOCA 2VZ1A 4G6MH 1A7QL 3STZB 5DJDA 5INDA 4WI7A 2W9EH 4U33A 4BUGA 4G42A 1MPAL 4ETQA 4QRRA 4DVRH 2Q87A 4GQPH 2WBJC 2AV7A 4RGMB 2DD8H 4X83A 5LGJB 4K9EH 1NL0H 3FMGL 1D5BA 1DBKL 4KUCF 3VFUB 5DUBB 3HR6A 4U7SA 2UVFA 3LKRA 2NW2A 1GIGL 3QA3A 4HIJA 3OAZK 6CGTA 1YEDB 1BD2A 1QBAA 1A3QA 5JW4R 1Q94A 1OP5K 1QSFD 2UY7A 1I3VA 1V7MH 5JDSA 4BSVA 4RFEB 4OZFH 1FQ9C 1SY6A 2MQCA 3EJYD 1KNOB 1NCBL 3MREA 3WIIL 1XF4B 1FFNB 3F6LA 15C8L 5J89A 3TC9A 1F3JA 1NBZB 3AS0A 3H8NA 4ZS6C 4B7LA 5FYKU 3T3MF 3JWDL 2A6KA 5CEZD 4MYWB 3BQUA 5CFHA 4X7FC 2A1WH 3BP5A 3AXLA 4KDTC 4PJIB 1OWWA 2ADIA 3MGOB 4XVUC 5D1XC 1U41A 1KJVA 1DEEA 2HFTA 3MRJB 3ORJA 2YC1A 2Z0BA 4IMKA 1ZT4A 3KYMA 1T1WA 2P8LB 4JFHE 4I1NB 1YMHB 2BP3A 5HHPA 4Y19A 3IFPB 4XAWL 3VXRE 3VGAB 4QOKA 4OLUH 2V2TB 4Z7NE 1LO5B 1JPFA 3QZWG 4KQ3L 1KT2A 4DUWA 1RUQL 2P5WA 4YBHA 3NCJH 4HIHB 2BSSB 1WWWX 2R2EA 3MV8E 3SDXF 1FC2D 4I0PB 3Q3GB 1CD9B 3GJFB 2X4OA 4YBLC 3SN6N 5FAAA 2UV3A 1FVCA 3O11B 3DYOA 2A9ML 3ROLB 3RUGB 4D3CH 2C7UA 4GBXD 2ZCHH 4KGLA 5ILTH 4FNLL 3HNTH 5TFSH 2WQRA 4CADA 3OAUL 4TVPH 5ADOH 3HMWL 2GJ6D 1RVFH 3IJYA 2F5AL 1E6JL 4O2FA 3MRDA 4HIXH 3SE9H 4Y5YB 4AMKL 4OLZL 4NJAH 4YHZH 3GO1H 1GCFA 1G0XA 5DJ8A 4PGJA 1NFKA 5IHUL 5CJBA 2B5IB 5D1QA 4BFIB 3M17B 1ZHKA 2XWTB 1WF5A 4QNPF 3WNLA 4LSQL 2HLAA 5AG8A 5HGGS 4HXAH 4PV8B 3BGFC 5D7SL 1QEWB 3SQBA 1TQCB 2ZPKL 3V6BR 5FO9A 3C8KB 3FAWA 3RY5A 3ZDZE 5MENB 1FNGA 2UY6A 3RVXD 1TTFA 4WFED 2AJUL 1NQBA 5H2BA 3PWPA 1G1YA 4LLYA 4D9RE 1JMZA 4G8EA 4AL8H 5EUOF 3H0TA 2XZQL 5I1AB 1JZ6A 4Y4FD 2VDOL 1FIEA 3U7WH 5LCVH 2XG4A 1KLUA 1FRGL 3QUXD 2OTWA 2Z31B 5DZOA 5JOPD 5IM7B 4JN1H 4HUUB 3MFFB 2W9DL 3U0WL 3WS3B 1EEZB 2AXFB 4N1HB 4X7DC 1U58B 1U8NA 5DJ0B 1XMWA 1U8KB 3TH4T 1I8IA 4BJLA 5JQHC 4KMLB 3T0VA 1TCRA 5JORB 1YEEL 5SV4A 3ULVE 3EO0B 4OLXL 1BBDH 2H2PD 2YSSA 3EJZC 4DJMA 2AEPL 3QULB 2AJXL 2C3HA 5ITFA 2RFXA 1HIMH 4NKOB 4ZS7L 3T3PE 1DVFB 5ENWA 1EGJL 2WWKO 3W5MA 2F5BH 2GW5A 3T1FA 1UWGH 4NQDE 2DI9A 5LJYH 2Q3AA 4FXGB 3JWDC 3NFSH 3SCMD 3GUTA 2DTMH 3PGFL 4AIZA 4FQQB 1TZGH 3BSZL 4MNQD 5C09A 3WLWD 5ISZE 4PJ8C 2R1XA 3QEGL 3RGVA 4IDJL 4JKLA 1JVKA 2C1OA 4UMGA 2RIKA 3P4OB 2QQLL 1FL5B 3QIBB 2J7LA 4HMEA 2DQUL 4EN3D 3KXFB 3KPQA 4NZUH 2EIDA 3UJJH 4FS0A 3NTCL 3SDDC 3PNWA 3EDFA 3VFMA 3C60A 4S0TD 4F57L 1P7QB 4OGXH 5C07A 5EZLB 4M62H 1KB9J 3WHXB 4RGNC 1FHGA 3GJEA 4YX2H 1CL7I 1NC2A 3KPOA 1MCLA 3GBNL 3QIUD 9CGTA 1A9EB 2DYPD 3DV6B 1IQDA 4I4WA 4YDLC 3VWJB 4PJFE 4M6NH 1ZLWH 4Z8FL 1T3FB 2MCG1 3STLA 3P30H 3DURA 4BZ2L 3KJ4B 3EOAA 3VRIB 5D6DC 3ARGC 5C0JA 3GMMB 1T20A 5FDWA 5DQJB 5F7NC 4LHUB 4YC2B 3ULUL 3MRBA 3TLRA 5L7XL 2XRAH 3L3IB 3AAZA 5FA3A 3S88L 3LEXB 1YJDL 3HNVL 3X13B 1N7ML 3MGAA 3VFNB 1AE6L 1KC5H 3AY4A 1JZ5A 3OAZH 5E2VH 5SWQA 3CGTA 1V5JA 1FVEB 3IFNH 5E6YA 2WBKA 2GSGA 4ZUSA 1CS6A 3QUZC 3T0EC 5H94B 3PWJA 1B4JL 3EO9H 2D0HA 1OL0A 2BVQB 1GOFA 1MHPL 1U95A 5E9DA 5D7LA 2VL5B 3QUYD 4UV4L 5C0CB 1UWXK 2NY5L 1X5JA 1T0MA 2O5XL 3NFPA 4PGCB 2VXQL 1RZFL 1N6VA 4HC1L 4N1EA 5L9DL 4N8CL 4DEPC 4YFDB 2ZOKB 3RWGB 2AXGB 1AC0A 3QWOB 4UOW0 1KPRA 2IBZX 2MKLC 3FTGA 2LU3A 3L3HA 4XTRD 5F44A 4HEPG 4JPWH 5I15L 2EC9T 4MJ2A 1CI5A 1VESA 1AGCA 1YEFL 3ULSB 2D9QB 3RZCA 1SVZA 4U1NB 2YKLL 3GHEH 3EFFB 5FKAA 5FYKD 4GG6E 4UAOC 2JJTC 4L8SC 5CEYB 1IAIL 2VO5A 1PW3A 2VH5H 1IVLA 5EDXA 1EVTC 3QG7L 3V0VB 2WIIB 3CSYA 4MAUL 4IIQA 4J6RL 4MD5A 4WO4D 1A5FL 5MP6H 2PW1B 1REIA 4EUPA 1CF8L 3KDMB 4ODWA 4JRYE 4ALAH 4LVEA 2D7TH 3A6BL 4TTDD 2IPTL 1IFHH 3FFCD 1P7HL 5KVDL 4F37F 2R4SL 2PCPB 3GKWH 4NQSB 4LRIA 3INUL 3VI4F 4BKLB 1A6AB 4P59H 3NIGE 3HRPA 4R96A 8FABA 5EIQA 3CUPB 4YXHL 5C0BD 4N5UA 3ZDXF 2G75B 4M9OA 1JHTA 1H9VA 1QFWL 5DDHB 3VFGH 4BZ1H 3QIWB 2GTWA 5GGRA 5DMKB 1ZA3B 5C7XL 5GS0H 1BWWA 4M48H 4LPCA 1WZ1H 4ZXBD 1ZEAH 4LSSL 2IGFH 1BHGA 2R4RH 1GH7A 3EYVB 3RDTD 2OTPA 1M1SA 4L3EB 3GSUB 5EOCH 5GRVK 3BP6A 2WUBL 2WBJB 3JSSA 1Q0YL 3GSNA 1YNLL 3RTQC 2ARJA 3MV7E 1D5ZA 4OCWH 4OZIB 1CICD 4WHCA 2RCSH 2CIIA 5D72H 1KG0B 2I60L 3CDYA 5FHBL 1TJIL 4OQTH 1I7UB 4YUEL 4X6DF 3SE4A 1ZHBA 4PJDE 3ULUC 1JZ4A 1I3GL 1YJDC 4ELKB 6FABH 5DMIH 2DF3A 3OPZH 5L8KB 3RNQA 3B3IB 5AAMA 5GGUA 4XH2A 3W2DL 4YJZL 1HINH 4UDTB 4BFEA 1IL1A 5LQBL 3QEQA 2PXYD 3L3OA 3VMOA 4PRIB 3T0AA 1A6PA 4UDUA 2FLRT 2VISA 1T7ZA 3VGGA 1WCBB 1I8KB 2QSCL 3IDIA 5D1XB 5IMLB 3RVXC 1MELA 2NY5C 3G6JB 4TOYL 1G6RL 3OKOA 4MJIA 3K7UA 5HDBF 3TO4D 1BP3B 2B7DT 3U36A 1T2XA 5T3XE 2I25N 5IBUB 3UTPE 3ZDYF 2W65A 4Y4FC 2DKUA 5IR1A 1YEKH 4LSRL 3MFGB 5CSZB 4YHML 1P9MC 2VQTA 4G8IB 2NXZC 4OCSH 4MHHG 3TV3L 1MHCA 1Z9MA 1U8LA 2V5RA 1H8NA 5GJTH 4PJ5E 1EAPA 3L1OL 4FABH 3G6AB 3W9DA 1Z3GH 3V2AR 4JZOA 3KNBB 4YBLB 4YEEA 5C0FA 4FZEL 3IS0X 5DD0H 2XQYK 4RISH 3UTZA 3QDJD 2IQ9L 3TA3D 4FQ1L 4EIZC 1LE5B 4GXVH 3S34L 4U1LB 2PETA 5FYKL 3U7YH 2A83A 4HWBA 4XPBL 4ZFOL 5IF0B 5GJSH 1HEZB 4A6YH 3VE0A 1AHWC 4XP5H 3O2VH 2FR4A 3DGCR 2QJDA 5D93C 5DYOB 4AIXA 3O3EA 3VXRD 3Q1SH 4EBQL 4XMKH 2EE9A 2F58L 3QI9A 2WP3T 4J3OC 1ZLSH 5ECJE 3JWOL 3BMVA 1HDMB 2DS4A 3SCMC 4JHBA 1RMFH 3BEVB 2VN4A 1QQDA 2W38A 2YMXH 3GHBH 1LE9B 1E28B 2IFFL 3I2CL 1YECH 4OV5A 2ADJB 3MV8D 5BV7L 1U6AL 2VE6B 2X6MA 1AP2A 4MNHA 3PHQA 1KN2L 2EDTA 3HC3H 4XPHH 5IGXL 3H9HB 1ZT1B 4OLVL 4J4PA 2FJHA 3BPLC 5I8EA 3HG1A 3HS0A 4K8RH 4UIKL 3C6LC 1OTUD 1MVUA 4NWTH 4Q2ZA 3FB8B 4HUMB 3CFEA 2BSTA 4LQFL 5E6IB 3QQNA 3DGGB 3V8CA 1EHNA 5DVOA 2JJSA 3QIUC 1OP9A 4DKFH 1PKOA 2NY7H 4EUPG 4I3SH 1MI5A 2P8PA 2OR9L 2YWYA 5IVXB 1AXIB 3BJLA 1HHGB 2HJLB 4KI5E 5E8DH 2XOTA 3TCLA 4FG6C 2BVEA 5JO5B 3UTSE 3MRGA 4MXVE 4X6CB 1UJ3C 4Z7NF 4D9RD 1IC4H 1EMTL 1QOKA 3CDFA 1EJOH 4P5TB 5A2FA 7FABH 1EK3A 5FO8A 5HDQH 2Z9TA 3QDAA 4BH8B 3MBEC 4OI8A 4GW4B 3OG4B 5K9QG 3P40A 2VZ3A 3FQXB 4J1UB 4JZNB 4NN6B 4PJ8B 4QRTA 4Y1AB 5DUML 3KR3H 5CJQH 1KLGB 1AKJD 1DLFH 1BF2A 1NBYB 1NCAL 4YDIL 5E8PA 4A2MA 2O61A 3KPTA 4RZCB 4EDWH 4LASL 1E4WH 4W4NA 2P45B 1VFBB 4WI5A 3ULVD 4D0BA 3U4AA 3NH7H 1A6WH 1DANU 2VNCA 3HNSH 2CLVB 3GNMH 2YUVA 3SDDB 2W0FB 1PKQA 3ETBF 4AK1A 1G84A 1I7TB 1ZAGA 3HUJB 4OKVB 1NC4A 5GISL 4XBPB 1I9EA 3S5LB 3MODL 1TITA 4XZUA 5DRWB 5K9OA 4NQDD 4P4KB 2ZUVA 3IVKA 2ZKHL 4RGNB 4PG9B 3ALPA 1I1AA 3P2TA 3ZDZF 4BQCA 1F8TL 1KENH 4L4TE 1DZBA 2G2RA 4YDLB 1JF1B 5ISZD 2QQNL 1FVDA 4M4PA 1B4RA 4X7TA 3BKCL 3SE8H 3C9NA 1RHHA 4HUVB 1NGZB 3MCKB 3V4PH 1GAFH 2B20A 4PJCB 4R0LC 4U1KA 3ARGB 3VXME 2DBLL 1NGQL 2XTJD 3SQOL 3IU3B 4WO4C 4QGTA 3VH8A 4WCYL 5CBAB 3VFOA 4N0YL 3ZTJH 2NY3C 3JWOC 1K5NB 4LVOC 1CXIA 3BWUC 2ESVA 2NX5E 5FM5O 4R4BB 4PGDA 3D69A 5T1KA 1R3JA 1S78D 1QSEA 5EUKA 3LQAL 4ODBD 3QISA 1PX3A 2V2WA 3WNNA 5L88H 3ULVF 4LRNL 4RQQA 3O4OC 3QUZB 3MBXL 4PYGA 3T0EB 3BP7A 1ZMYA 3SDCC 4LEOB 1MY7A 4PRPE 5CJ8A 1YY8B 5F7YC 3T3PF 3QNYA 4DGIH 3N06B 5SWZE 4NO3A 1YY9C 2X4NA 2FDBP 5TDOA 1YN7A 1CL7L 3U2SB 1CZ8H 3CXHK 1UKTA 3JV4B 4JRXB 1C16A 3EDDA 4DN4L 4DEPB 3VXNB 3HMXH 5KSAA 4CMMB 4XCNA 3FO2B 4Y4KA 4P5MB 4K3EL 4GRWE 5F1NB 4GW1A 3LHPL 3NGBC 2HFEB 4TULH 5FUCE 1QHOA 3VFVA 2B1HH 1M05B 2J4WL 3CFKB 1XF3B 1BOGA 3LEYL 3QRGH 4GW5A 5AUMB 5HGAA 1J8HE 3DMMC 4L8SB 3SJVB 4IHOB 1RIHH 1VB9A 2VABA 1QSFB 4GT7A 3OXRB 4UILL 3K74B 5KW9L 3PWNB 2X4PB 4JM2D 3UJTH 3TBSB 2XZAH 5B8CA 3VJ6B 3OZ9H 1ORSB 5D7JC 4JQVA 2FWOB 5GS2D 1MQKH 2GFBB 3QUML 1DDHA 2VZOA 1RPQA 4G6AC 4PJFF 3RIAK 5EFIA 4KTDH 4ELMA 1N64L 1IAOB 3P4LA 1VENA 5LWYL 4U0QB 2QR0B 5I17B 1F11B 5DVLA 5GGSA 5KS9F 4XNZB 1R5VA 1MUJA 1NGPH 2QBWA 3IJHB 2NMSA 4P49A 3SO5A 3DUUB 4OGYH 2YD9A 1P84J 5E7BA 1X6NA 1CFTB 3HFML 4KY1H 1NPUA 4LLMB 4DZBA 3RWJA 1R3LA 4JRYD 3R1GL 5F21B 4LFHG 1RZJH 4S1DC 1SM3L 4DVBB 1FNSH 3I75A 4U1SB 3P4NB 3IETB 2YUXA 4HH9B 3WO3B 3RIFK 4P4RB 1KIQA 2AXJA 3ZO0A 3NAAL 3ZYIA 5J57B 1QR1B 1Q1JL 4JM2F 2A73A 3CD4A 2YPKA 1UXWB 2A9NH 3IU4L 1ZHLB 2ZSVB 1LP9B 1NFIA 1RIVL 1PSKL 3U1SH 2IALB 2IMMA 1EERB 2GJ6B 1OOAA 3LQZA 2ZNXA 2CLRB 1W72L 2IH3A 3Q6FA 5KSUA 2VAAB 2GTZB 1WC7B 3BH8A 4RA3A 4W4OC 2CGRH 1EHAA 1JWSA 1Q9WA 1CK0L 3LQAC 5ICXA 1E6OL 3QO1B 1UG9A 5KANG 3CVHH 2PUQT 1G7IB 3K2UH 3ULVH 1FNLA 5TE7L 3O41A 4ZMAT 4I0KA 3RWEA 2Q7YA 4U6TA 1OP3K 3DECA 5LVEA 4XPGH 4F7TB 1R0AH 2EYRA 3VFPB 5E4EC 5F6HI 2JE8A 1B2WL 5D2LB 3MV7D 4PBWD 5GRUH 2Q76B 3TBTA 2VR5A 1EDQA 2OI9C 2J12B 5I8OL 1Z5LB 4QRQA 2H9GB 1SEQH 4F3FA 4NQCA 3FB5B 2X4SA 4FQIL 2FH6A 4RWYL 4NJ9H 2I07A 3SGJA 4Y4FB 3G08A 1KJ2H 1PBYA 2J88H 3MUHL 3FONA 5DK0A 3IXAB 3K0WA 2NXZB 2Z91A 3S3JA 3NIGF 5HD8D 3QWRA 2CK0H 4ZPVB 4D8PB 4YIQB 3CNKA 1TLKA 4YXKH 4OCNC 1HSBB 4S0SD 4QHMB 5EU7E 2ZJSL 4OT1L 3BP4A 1HHIB 43C9A 1GGBH 4XCEA 1MCSA 2X44D 1A7BA 1ZV5A 3R06B 1XH3A 4FQCL 4QTIL 3RWIB 3LMJH 2KQMA 4D9LL 2ORBL 1LEGB 4R2GD 2AP2A 4KTYA 1KB5H 5F97E 4UTBH 1UM4H 5AG9A 4Z7QE 1JGDB 4KZDH 1UB6A 2WLZA 4MWFA 4M7LL 3TZVA 2YRZA 4LLWB 2WM0A 5GSVA 5T3XD 3WJJA 1AHWB 2ZOLA 1D6VH 1T66D 2MMXA 4FQLH 4QXUH 5D93B 3UTPD 2YPLA 1UWEH 5H8DA 3QBTB 2JLLA 2K1MA 4ZAKA 2P4AB 1FZJB 3VDCA 1QFPA 1JTPA 1Q0XL 3SCMB 4Y2DC 3SDYH 1NUNB 4MNQB 1OM3L 2V2XB 2IAND 3GSVB 3DLQR 5BRZE 4PJ5D 5IEHB 1FO0A 3EYFB 3B83A 3GRWA 4UNTA 4PJDF 2L7JA 5C0ND 5BXFA 4OTXL 1XF5A 4NDMA 1JUFB 3OKEA 4MCZA 4PJGB 3EW3B 4GMTH 4EN3B 1MRDL 3BPLB 1ZANH 3FQTB 4OF6A 4CAGA 5D7IB 4RGOH 1FZKA 5J0BA 5GRWA 5HHQA 2BC4A 4JKWA 1NCDL 3C6LB 5HYSA 3RU8H 1F90L 3BKYL 1I7RB 3MLYH 4HUWA 4XGZA 3VDAA 2YBRB 4NC1E 4UT9L 1M6OA 4JO2H 4P9HL 3QIUB 2DYPB 3BRFA 3H42L 3MLXL 2VDPL 4NQEE 5FUZL 1HXYB 1ZHNB 3L7FB 4XP6H 3ZE1E 5C0GA 1C5DA 5GS2H 4L4VE 1S9YB 2WSKA 3LZFH 3MROB 1ZVSB 3BUYA 2XTJC 3MV11 5JTWA 5GIRB 1UJ3B 5GQBA 3C5JA 4N0UA 5F9JA 1B88A 2OR8A 4GKSB 4P3DA 3UO1L 5F3BA 4YH6A 3WIHA 3MBEB 4GMSH 3HAEB 5L2KE 1S78C 1ODAA 4NNYB 2IPUG 4KDWA 4HV8A 3LSOA 2DQGH 1G7HA 1ADQH 2AJZA 1AR2A 1HXMA 3MJ9H 1AI1L 5EU3A 3RWHA 4U6VL 3ECBA 1DL7H 3IAGC 4YLQT 1PY4A 3MC0A 2Q8BH 2YUWA 1S5IH 4KI5D 4U1MB 5DEZA 1KIPA 4Z7UE 4R8WH 1G9EA 3DBXA 3IJSA 2EC9U 3B5TA 1N6QH 3DVFA 1QBMH 2IG2L 3UTSD 4JQIH 4X7CC 4U7MA 4GO6B 4LPYA 4X80H 1IEAA 5IB1B 2VLKE 3O45B 2HWZH 1FBIL 4OM1H 1MFDL 5IW6B 3DX8A 4PR5A 4DFHA 3GSRB 4LBEB 5A2IH 4GLRH 4XNMB 2EDHA 2W1NA 3JWNC 1DQMH 4NHUA 3RVUD 4F2MB 2OP4H 1FYTB 2VC2L 1X5XA 4LLAA 1BJ8A 3QDME 4ZSOA 1RZIA 4HWNA 5IK3A 5ALCH 4ODVL 1I9RH 4R0LB 1JJUA 2RQ8A 3KPMA 1Z9LA 3KYAA 4DQOL 4QRRE 1H3WM 4WO4B 1EX0A 2Y6SD 1MLCA 2DMKA 3BKML 3U6RA 4RMRA 5IB5A 1MCEA 4HG4J 2H32H 3MLUH 4JJHA 4R26L 2NY3B 3O4LA 2DIBA 4WV1A 2VXSH 4LVOB 3NIFE 3TVMA 5KAQF 1QA9A 2AK1L 4L1HA 3RL2A 4YPGB 4ZFFA 3G5VA 1BD2E 1DQDH 1WWAX 1JCKA 4I5BB 4WEBL 4KI5F 2Q8AL 2HKHL 3O4OB 1J86A 4L4TD 1GGCL 4MXVF 3GSXB 3SGDH 5C0BB 3REWA 3MRKB 3BWAB 3I50H 3VFRB 4APQC 1YYLH 5FCSH 4B7IA 2EXWD 1FNAA 2CKBH 3QJFA 4XNQB 1N3NB 4Y4HC 1SJEA 3PP4L 5LGHH 1J8KA 1HQRA 4RRPA 5ESAB 1OP3H 1DBBH 4PUBL 4YDKL 4ZXBB 1K3ZA 2GAZA 1CWVA 4XPFH 1JPST 1MFCL 4FHBD 3QEHA 3RDTB 2DQDH 1V3KA 4PBVC 5K9JL 4LARH 3NGBB 2OMBA 2UZYB 2Y36H 1A4KA 3O3DA 2OXHA 3OGCB 4MB3A 5ICZA 4GRLD 3QNZB 4TNVK 4WJ5A 2QSTA 3DVGB 1AY1L 5C0IA 4Y19E 3S36H 5HHXH 1NFDA 2HVJA 5D1ZD 3RKPA 1IBGH 3DMMB 4HWZB 4QOKE 4OZFA 5A40E 4PRPD 1G6VK 3RY6C 1JYWA 2NCMA 2P5WE 5SWZD 5IHZA 2BNQB 4HJJH 5MEPB 1CD1B 4XP1L 2NY2C 5D7JB 4MQXD 2VDQL 4PP1D 2D03H 1SJVA 3CSGA 5JXAH 1MRCL 1WT5C 2JJWA 3DV4A 5L2JB 5LXGH 1YUHB 3EYUL 1BWMA 5JIPA 3BDYL 1A7QH 1F2XK 1W0VB 3LH2L 5HYSG 5KN5B 1MHHA 1MPAH 4QWWD 5EOCJ 5E2JA 2FX8L 1J8HD 5E8NA 3RA7L 3TO4B 3C5SA 4X98A 3FMGH 1DBKH 3OL2A 4RDQF 3RVVC 1FFOB 4NKDB 1FJ1B 2X1OA 5J6GA 5DHXB 4OF5A 1GIGH 3MXWL 1ED3A 4C56A 2H41A 4L8BA 5AAWA 1S7RA 3BN9D 3S35L 4U4BA 1IGTB 5EPMA 5T1LD 1KLFA 1U91A 3PV6B 3QQ9C 3PWPE 1NCBH 4P23D 5JHDD 3G5XA 3WIIH 15C8H 4R3SB 3HE7D 5BO1L 3QDJB 4E41A 3JWDH 4P57A 1RIUL 5F9WC 1N5AA 4K3DH 3CPLA 1BFVH 2ICWJ 4XAKE 4OV6F 3RL1A 1ZTXH 3HCVB 1TVDA 1WBZB 2BY1A 4TYUA 5T1DL 5IROA 3QP3A 3MRRB 2BX5A 5ID0B 3P9MB 4Y2OA 3SKJL 3U46B 5FYJU 1S9WB 3MRQB 4NCC1 1ZGLM 4E42A 4JFDD 5DVMA 4ZFGL 2RAMA 3K1KC 3PF2A 5GS1B 4XAWH 4CN4A 1UYWL 1IAIM 3QQ4A 4KQ3H 4O2EB 3PXHA 4KHTL 4XVTL 5E4EB 1RUQH 2W0LA 5C71A 4U2ZA 2FJFB 4X99A 5I74C 5DJXA 3KGRA 3O9WC 3L7EB 2OI9B 3WMSA 3CCHB 4GAJL 3KAAA 2A9MH 5C09E 3PJSB 2BNRA 4G80B 4FNLH 4YDJB 1OTSC 1UH2A 3OAUH 3BIBX 3HMWH 4YEFA 4Y16D 2BCKA 1E6JH 2HYMA 4ONOA 4OZHF 5AWNH 4PTTB 1G7LB 5DEGB 4AMKH 3OJVC 4K94L 4OLZH 2E7LA 2LU7A 1OSPL 2Q6WB 1JWUA 3RWFA 3T4YA 2XKSA 5IHUH 5ERWB 1BM3L 1JGUL 4G8FB 4LHQB 4LSQH 1XIWD 1R3KA 5D7SH 3BMWA 4AQ1B 3UXFA 3KVQA 5C07E 3MLSL 1MJ7L 1U8OB 4EVNB 3HRZA 5LGKA 1KN4L 5IW1B 3QUMB 3QUKA 4MXWL 2AJUH 3WKML 5M7QA 3P0YH 2XY2A 3TN0A 5DJCA 3DIFA 4ZYKB 4Y2DB 2XZQH 5IQ7H 5DRNB 5DK2B 2EYSB 2VDOH 1Q9KA 4ZTPL 5JIIA 5DJZA 3B9KA 1FRGH 4RRPG 4CRPA 4Q9RH 1AKJB 3I6GB 2LQRA 3BDXA 1LGVA 3DSFL 2ZUQC 4ZUUB 4EI5A 2YZ1A 5DMYA 2W9DH 3U0WH 5DJ6B 5FGCB 1T80A 4MLSA 4YHIB 5A16B 2VZUA 2IC2A 3D39A 3T2NL 2HRPL 2BSRA 1YEEH 3SDXA 3LRSA 4OLXH 1FL6A 1FNEB 4FMKA 2WMPA 1QHPA 1SYVB 1CFBA 4P5KA 2P5EB 4OZFG 2AJXH 2YA2A 4YHKH 2AQ2A 2YR3A 1HI6B 4ZS7H 2VMFA 4DOHE 5E9DE 3MV9E 4F33A 1EGJH 4Z76A 3MOAL