5AZEL

Fab fragment of calcium-dependent antigen binding antibody, 6rl#9
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
206
Chain Sequence
SVLTQPPSVSGAPGQRVTISCTGDVHWYQLLPGAAPKLLISHNTHRPSGVPDRFSGSKSGASASLAITGLQAEDEADYYCQSHDSSLSAVVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6RL#9 FAB LIGHT CHAIN
publication title Calcium-dependent antigen binding as a novel modality for antibody recycling by endosomal antigen dissociation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 206
sequence length 215
ec nomenclature
pdb deposition date 2015-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5azeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5azeL01
1NKOA 3U36A 3TIDB 3QWQB 5C6TL 3MRHA 1JNHA 5D7LE 4DWHA 3RDTC 1X4XA 4K71C 2COQA 1ZLWH 4NGHL 3ZE1E 5ALBH 5HD8C 1IQWH 2V7NA 2EYRA 3U2SB 4D0CB 4JFOB 3L5WA 2H8PB 5FYKH 3HCVB 7CGTA 3ULVD 1T1WA 3BH8A 1XR9A 3DVGB 4QRRA 1KENL 3M07A 4YHMH 1WBYB 5GRVL 5GS0L 1C12A 3ZYOA 1BBDH 3RJQB 2ID5A 2NCMA 1LEKB 2NW2B 3E3QC 3FOMB 5F9WC 1CGUA 4LOUC 5EO0A 4MD4A 5C0IA 3BSZL 1KJ3H 1IAMA 2OTPA 4X99B 3NA9L 1TJGH 2VQ1A 5LGHH 4B41A 1FVCB 2EDXA 3CZFB 1LO4L 1B6UA 1OTTD 3QQ9C 1NC4B 1CLCA 3QUYD 1LD9B 1U9KA 3QDGB 4PGJA 4KK8D 5F88B 3RPIA 1ORSB 3O3DA 3TH2T 5TF1L 4XXDA 4O02L 1QSFB 3WHXB 1MVFA 5DS8B 4LLUB 1HSBA 1A7RH 3SBWC 3QEUA 4YHOH 3JUZA 1GXEA 1OW0A 5D1QC 4K3HA 5C0AB 4FQ1H 4FQCH 4TTGA 1A47A 3CC5B 5B4MD 3F58H 1WSST 5ILTL 3IJHA 2H8PA 1U2CA 3HCVA 1PD6A 2NPLX 2NY6B 2QQKL 4IJ3B 1QRKA 3FL7A 3AB0B 4GRLC 1H5BB 1GC1C 4PY7A 4FG6D 1G9EA 3RX8A 2HFEB 5DA0B 2NW2A 2R2CA 4NJ9L 5KSBB 1U91B 4WEBL 1RUPH 1YY9D 4FFVD 2V2WB 3FOMA 3DMMA 2LAGB 2VDQH 4U6XB 5ENWB 4QYOB 4YX2H 5CKAA 3PL6D 2P8PB 1CFNB 1A21A 2QBWA 4ODTL 4X99A 1JNLL 4NCC2 5DD3L 5ADOH 2FEDD 4LDEB 4WI4A 3SQOL 3CZFA 3V9FA 3TCLB 4JAMA 3LQAH 1BD2D 4DAGH 2DQTH 5JR1L 1DBJH 1AGDA 4NN7C 4U6VL 4YDLB 3T65B 1NEZA 1ORSA 3X3GL 3QIWB 2D31B 1SEQH 2P7TA 3L3HA 5HY9B 1UCTA 1F6AB 1JV5B 5DS8A 1ZS8A 5L2JA 4LCYB 5E6IA 5CEXB 2ERJB 5C0AA 1FIGH 2D7TH 5CJOH 2A1WL 4MMZC 2VQTA 1MPAH 3H0TB 1C5BL 4OCRL 3I50L 2G75B 4B7IA 3GI8H 4ZDHA 2XY2A 3WHE0 1ULVA 2JCCE 3RWJB 4RNRB 3QUKA 5EA0H 1G7PB 3ULUC 3HR5A 1YQVH 5KSBA 2D4FA 1U91A 1TNNA 2VN4A 4MNGB 3MLRL 1F2XK 1W2KT 4QXWA 2UYLA 5C08B 4KRLB 3HNVH 4S1QL 5EU4A 2IGFL 3WIFB 2P8PA 2JJVA 1CFNA 4HKJB 2EDHA 1LK3L 3U0PB 1NCAL 1QQDA 1AGEB 2ZUVA 3FQXB 1IGYB 3MYJA 4MQXC 3GJEA 2NXYD 3QDJD 3UROR 2J88H 1OHQA 1VFUA 1S7WB 4G9FD 5DC0A 1NCWL 3BT2H 4GAFB 3T65A 5L9DL 1A6WH 1IAIH 4JM2F 4JCLA 5HPMB 5IFHL 2D31A 4KWUA 5HY9A 3PGFL 2BNQD 1F6AA 3VDBA 5I1KH 5C0BD 3QXVA 1CFQA 3MRBB 4EEEA 3GMPB 1BF2A 5CEXA 1N5YL 1A1OA 5HHMD 4K3GA 5ACZA 4G9DB 4NWUL 1Y6NR 2X1QA 5GSVB 1ZVYA 2A2QT 3ECBA 5JHLL 3CU7A 1A5FH 4GUPA 1NFIA 1X5KA 4N8CL 4Y1AE 1JF6A 2OXGA 4EOWL 3ULSB 3P9LB 5HYJB 1EJOL 1IGIL 4GT7A 5T3XE 5IMMB 3STZB 1MHCB 1MHPL 2O5XH 4OLVH 2HFTA 3IKCA 3S4SB 3PHQA 2EE2A 4ZMAT 3RWCA 4D9RD 2YUXA 3GRWH 1HQ4A 4PREB 2E7MA 4MNGA 4XPHH 5TQ2L 4IIQA 1F58L 2W07A 5LQBL 2JJWA 3T0BA 2W0LA 5C0DA 3IAGC 3MLUH 1MRFL 5IQ9B 5J0BA 3MRGB 2V6HA 3ZHKA 1V7MH 3HFMH 4H1LB 4R4NC 1AGEA 4X4XA 5LAXA 5EZJA 2IBGA 1IC4H 3T8XB 3L3DA 3KPSD 1EO8L 4LLAA 4K7PY 3SCMC 4NM4H 5IGXL 1J05B 2ZUQB 3MRNB 4ZAKD 5HPMA 3HZMA 1MQKH 4IMKA 4H8WH 3VXUE 1G1YA 5DT1L 3G6JE 4U1JA 4OCYL 3GMPA 2DWEB 4WV1C 1OAQL 4HUWA 4GLRH 4RMUA 3GSNL 3VXTB 4JFFE 3IFNH 4YDKL 1TZHB 2NY1D 3ULSA 1M1SA 1QA9A 5ICXA 3UTTD 2XRAH 4CRPA 4QHMB 2R4RL 3DUHA 1F11A 2G5RA 2EIDA 2YPLE 4OCWH 3STZA 4R7DB 1HKLH 2GIYA 4HLJA 4PP1C 2Q6WA 3S4SA 4I0PB 2VABB 3FQNB 4WO4C 3LEYL 4UT9L 3VW3L 1AXTH 4IRJC 1NUDA 3SN6N 2GJZA 3WBDA 3C5JA 1NGXB 5HDOA 4ZYKB 1D5IL 4Y4FB 4RAVB 2VISA 2VAAB 4R8WL 4MNHA 2BVYA 3MV7E 3T8XA 4TNWF 1JMXA 4XPBH 2P5EB 2HKFL 5ID0A 2R69L 1S7UA 3TPUB 4OFKA 3P77A 2DKUA 4LPYA 1QLFB 1LGVA 4LCUB 4DVRH 5DLMH 4TUOA 2CUIA 5FUOH 5C09A 3SDCD 1EHAA 3GSQB 4C57C 1D6VH 1DEDA 3NH7H 3TT1H 5SWSD 2ESVE 4BZ1L 3OAUL 2DWEA 1DQJB 1J18A 5C0FB 5EC1A 1FAIH 5I8EA 1T1ZA 1U58A 2EDYA 1Z3GH 4YHKH 1F4WH 1TFHA 1TZHA 2OSLA 5I71B 2X40A 3O41A 1INDL 2XT1B 5IJVA 3BP4B 3Q0HA 2X7LB 4YEEA 1M7DB 4I0PA 5FAAA 3RHWF 3HG1D 4LKXA 5ESVB 4AMKL 3CVHH 3ULUE 1KLUB 1BWMA 4Y2DB 3FAXA 1UWXH 1S9WA 5AEAA 4KXZI 5F1OB 1DBMH 2R2HB 4Y5YA 2J6EA 3VD4A 4JN1H 5DEFA 1RJLB 1ZE3C 2OTUA 1NGXA 2NY2B 3LPGA 1I1CA 5HHQA 1U8JA 4L1HA 4NKIH 2XZCH 2WBJC 1JPTH 2G60L 1OL0A 2WP3O 3BQUA 4TUJB 5ANMB 5GGSA 1JYVA 1A6TB 1QSEB 3HI5L 5E5RB 1QFWM 3RX7A 5SV4A 3D2UB 2FGWH 1QLFA 4WWKD 2J6EL 5DR5L 4PJ9B 4ETQB 3ZT7A 4NQVA 3VFSB 3GSQA 5FO7A 4R2GC 1T04A 4OLUH 4HD9A 3QAZC 3QFDB 4OV6F 4PJAF 3S35X 1DQJA 4GRWE 1GRWA 3QSKB 4NM8H 2YUZA 3ZL4L 2EXWD 5C0FA 5MI0B 5I1DB 5IKCB 1P4BL 3CUPB 1U8KA 3CX5J 3WNNA 1F97A 4RMQA 2OR8A 4P9MH 4MJ6B 4P5MA 1FCGA 3GSXB 3QUMB 1AY1H 4G42B 4CNIA 5FECA 4UMGA 4PRDB 3TVMB 3UTPD 1WWCA 5DK0B 5ESVA 2EIBA 4LPWA 4NO2A 4P2QE 4KHXH 4Z7WB 1FORH 4DFHA 4Y2DA 4OF7A 1PX3A 2YPLA 2W92A 4X7TB 5EC2B 2MFNA 3B3IA 1CGWA 5TDOB 3M17B 1MREH 2BSRB 1IEBB 3K4DA 5FOJA 2I5YH 4WTZG 4E41A 4HFUH 1XGYH 3NOIA 1K2DB 2AEQL 4OF3A 4C83B 1K9TA 3TESA 3ESVF 4XPAL 1I1YB 3RRQA 4TUJA 3ROOB 5DRZB 1A6TA 1QSEA 4RAUB 2PF6A 3A67H 4FZEL 1G9ML 4PJEE 3D2UA 3O6FB 2OTWB 2OXHA 4P4KD 4PJ9A 3MBXH 2M26A 1F3RB 5J11C 1RK1A 2VSCA 5CEZL 4PLJD 1P84K 5FXCH 1IAOB 3DECA 5FEBA 5K9KB 4PJDE 2X09A 4KJQD 3L9RA 4HHAB 5I1DA 5E2JA 3CUPA 3RVTD 2HLFD 5EH1A 1MUJB 4HIEB 3AS1A 3RBSA 2VDRH 1OP3H 3KLDA 2DLGA 4JY6A 2PW1B 4MJ6A 4F7TB 4IS6B 1E27B 1UYWL 4G42A 2VJXA 4OFPA 2CKBA 3RZWA 1HH9A 3MLSH 2F53E 3TVMA 4HWNA 1RUQL 3WS6A 1E4XI 3JWDL 4WUUE 2VZ1A 5E2UL 4GS7B 4Z7WA 5EO9B 4Q6YA 5D1ZB 4GG8A 4JO4H 1K4DA 2WINA 4X7TA 3HMWH 1R24A 4ZPVB 4G6AD 5DK2B 1JHKL 4X98B 1J1PL 1L0XA 2YA0A 5A3ID 5D93B 2BSRA 4IOIB 1IEBA 2IADA 4M1CD 3QUML 5IFJB 4M62H 4OGXH 1Z2KA 3O2DA 3VRIB 2MHAA 5DD6B 4HFWA 1I1YA 5IB3A 5AZ2L 4UNVA 5DRZA 2AK4A 2F5AH 3HNTH 3TGXA 3CDYA 3O6FA 4KUZH 3RUGA 2VXQL 4AENB 3A6CH 3EDJA 1XGRB 3B9KC 1IAOA 4PFEA 3MGTB 1D6EB 3STLB 3IVKA 4U2YA 3T3MF 1AFVH 1JTTA 3L7EA 3VH8G 1NMAL 3Q1SL 4GKNB 4Q6IA 2ZUWA 1CYGA 1MIML 4Y4HC 2PW1A 5JA9A 3LOWA 4F7TA 1FPTL 2BNRD 1E27A 2DM7A 4HPOH 3NCMA 4R26L 1QRNE 2EDOA 1K3ZA 4CMMA 1HWGB 4G80B 3INUL 1FFPA 4Z7OF 4BM7A 1LNUB 2DWDB 2B1HL 4NHCL 5LJYH 4Z77A 4UQ2B 4HS6B 1I9JH 5E2WH 5T1LA 3PP3K 1OARH 4YZFE 3VRJB 1IC7L 1D5BB 1RHHB 4ZPVA 1D9KD 3F5WB 4HJ0D 1RIUH 2YC1A 3HE6C 5DK2A 5D1XD 4U1SB 3DX9B 4XP6L 4ACPA 2ZUSA 5BVPL 1ZGLM 1DN0A 4OFYD 1XIWD 5E8PA 3QEQD 2GUOB 3VRIA 4CN4A 4OTXL 5JLZB 3H9SD 5K59E 2P5WE 1BOGB 5DD6A 3NAAL 1OAXL 1N6VA 4L4TB 1T4KB 1SY6L 5I1GH 2B4CC 4WNQB 1CLOL 3SEPA 3AMLA 4AENA 5ETUB 3VXQB 1XGRA 5HDLA 1NLBL 5FUCC 3FFCE 3MGTA 1AGCB 4I3SL 3DUUA 4XGZB 3V8CA 5KVDH 1Q0YH 3HI6L 1RUAH 2ZOLA 1I1AC 3EYQD 5JHDD 3ARFA 3L5XL 1R3HB 2HT4C 3TJEH 1OPGH 4OZFB 1DBKH 2DI8A 3HNSL 3NCCB 4G80A 2W9EL 4JPIB 1PLGH 2HT3D 1CG9B 4HS6A 1HWHB 5MP6H 2W0KA 3VRJA 4YHYC 1AD9A 4L3CB 1D5BA 1ONQB 3FONB 5GGVY 1AHWA 3P30L 2KUTA 5F7WC 3FQUB 3V4PH 4X80L 3TEUA 4NUJB 3DX9A 5EIVA 2ZSVB 3SDAA 3MXWH 3S37L 4GFTB 5FGCE 1YMHA 3HUJA 4LNRA 3UDWA 5KOVC 3F65A 3KXFE 3ZKMD 3C5SA 3VFOB 3GFUA 1NFDF 4P2OC 4WNQA 3MRRB 1UZ8A 3MA9L 4E5XB 4P3CH 1ZGLP 2IH1A 4QRPD 1V3JA 5SWZE 5KBNC 3VXQA 3R0MA 3V4UL 3NIDE 3OX8B 4GMSH 3LH2L 4QXGL 1J0IA 4XGZA 4HIXL 2GK0B 5H94B 4HWZA 3WKML 2AJ3B 3FT4B 4QWWC 2QADD 3O4LE 4P2RE 5IVXF 4K9EC 5JTWA 2AABH 4NQUA 4KI5F 2RQ8A 1R3HA 1YA5A 5DVMA 1X5HA 1JGEB 5TPWL 1G9NH 4P59L 4OZFA 2HVKA 4LCCB 1OGAE 1S9KC 3OJMB 4ELMB 5CCKL 4JPIA 2JB6B 1LE5B 1MELA 4UTBL 1CG9A 4WHTB 2V7HB 5LWYH 3UTSA 2F54A 1XEDA 2B5IB 1YN7B 4NDMB 1ONQA 1OTUD 1QBLL 5IHBA 4NN5B 1S9VB 2R9HD 3RTQB 2PYED 3PWLA 3KPNB 4LSVL 4EI5A 5GS0C 1U8PA 1YN6B 5HDBF 4HX1A 5JA8B 3W9EB 2VDML 1VESA 1L7TL 4FQPA 5F6HJ 5C0GA 1VDGA 3VFOA 5TE6H 1TVHB 3ARXA 3MRRA 4E5XA 1TTUA 4TUKH 3V6ZA 1I1RA 2BRQA 3K46A 2J2ZA 4WCYH 2H26B 2NY0B 5A2FA 4UILL 4OFVA 4J1UA 4KRNA 1TVDA 4PRPD 2WLYA 2MCPL 5F1SA 5H94A 4X5XB 1IGMH 3FT4A 1T7YA 3OAYH 4HS8H 2AKRB 3L3JA 2YPVL 2X4NA 1HXMB 3F7VB 3KDMB 4FABL 4I4WB 4RMRA 3KG5A 2VLKA 3LQZA 2FLBT 2BC4A 3EYFB 1FSKC 3EOAB 3ZO0A 3I6KB 5ADPH 3LHPL 2JB6A 2XFXB 4MJIB 2BHYA 3EOYG 3RGVD 3RKDD 1JHTB 4WHTA 4I18B 2XTJE 3LIZL 1YEJH 1N8ZB 1C08B 2VWEC 3TA3B 4XZUB 4D8PA 4OZIB 3BZDA 1Z5LA 4G8GE 5EU6E 5EUOB 1PZ5B 2V5RA 3C9NA 3SDDD 4R97B 2AEPL 4ODSH 4FQHB 4YXLH 5ITBH 4K94H 4L3ED 3NIFE 1G0YR 3WFHA 1WJ3A 3JVGA 3GGWB 3W2DL 4HGWB 1N7ML 3TZVA 1YZZA 2JK5A 1TVHA 1PEZA 1N3NA 1OTSC 2M8XA 3QIBA 4OIIH 2GFBB 1NLDH 4JHZA 4LP4A 2OI9C 4J3OC 4RFNC 2H26A 3CXDH 4JKPH 4GMTH 4G6JH 1J87A 5A1AA 5K93A 1H3UA 1RFDL 1CU4H 1AE6L 2YMXH 2CLZB 2A6IB 3I02A 4UIKL 1T03H 3HS0B 2Y07L 1XCQA 2X1WL 5AUMB 3FO1B 4X5XA 3KR3H 4YDJB 4CVXA 2XKUA 5SWZA 2BXZA 4KJPC 3DMMC 3MXVL 2AKRA 2XQYK 1FG2B 4CVUA 5L7XL 3T2QA 3U7AA 2OL3H 1IGJA 3LPFA 3RNKB 4YQXH 3UZEA 1CD1B 2NNAA 5HXMA 1S5HA 3GUTB 3OXSA 4L4VA 5BO1L 2XFXA 4JDTL 1JHTA 4G6ML 4KPHL 2V5YA 1JNJA 3PGDA 1HOCB 4OFDA 4YE4H 1UVQA 3TA3A 4KROB 1B4JH 4Y8DC 3WFBH 1I3UA 1DP0A 4XC1L 4OZIA 1F13A 3IFPA 1N59A 4NQTA 3UYPA 5BRZD 4FFZH 5EN2B 2NQCA 4KY1H 5EUOA 1PZ5A 4XWGL 4KTEH 2R56L 3IF1A 3TNNB 1KJVB 2H6PB 3CK0H 4FQHA 3G08A 4Y5VB 5IIEA 4E0RA 5F3BB 5DJ2A 2BVEA 3GGWA 4LKCA 3QP3A 2DYPD 3N50A 4HGWA 4C56A 1IEAA 1MFEH 1MHHB 2XKSA 4NO5A 3FRUB 4IJ3C 2NY6C 4O9HL 2YSSB 1YMME 1MAKA 3AB0C 1RUMH 4HMDA 1H5BC 2KZ1B 2QKIA 2CLZA 3MRCB 1BPVA 5AUMA 4PJIB 4YDJA 2LVEA 2V5SA 3S34H 5I15L 1TZIB 4PJ7E 3KJ6H 3OZ9H 1NDGA 1Q9OB 4HJGB 3ULVE 3KPLB 3Q6GL 5C0JA 4LPCA 1T5WB 3B5GA 3VG0L 4X9IA 2VDPH 1C16A 1MAMH 2C3HA 2BVQB 5DRXA 5B39G 1PAMA 2JB5H 4QXTA 4XMLH 5I66A 1W72A 5HI5D 1MCOL 1HOCA 5CP3A 1SM3H 1CD8A 2BY0A 4HIHA 5D9SA 4Z7VB 1UWXK 3DTXA 1JPSH 4YDLC 3MV9A 2NTSP 1DUYB 3QIWC 3MTRA 4GAGL 4Q9BA 4ZO7A 8FABB 3TNNA 4KGLA 3UYRL 4GJTB 2Z4QB 3P73B 4ZTOL 4Y5VA 1MF2L 2ERJC 1HYSD 5HGGS 4PJGB 4X9FA 3GMMB 4XRCB 1MVUB 1CS6A 3DURA 2C3GA 3B8SA 5IROA 5FA3A 1LK2B 4NNXB 1P84J 2VXSH 4YAQA 5ALBL 3ARQA 1IQWL 5TDPA 5B21A 2AJZA 2XI9A 2EDLA 3Q5YA 4JREC 1WGOA 2PW2A 5FYKL 1G7IB 2EH7H 3ARED 3I3BA 1KIRB 1ACYH 4XBEH 4YHML 1FVDA 4IIQC 4PRNA 5IBLD 1BBDL 4HJGA 3LRSA 3KPLA 4HF5H 3RI5K 4V1DE 2GKIA 3FZUC 1F02I 1AP2B 5LGJA 1YPZB 4OCXH 1HCFX 1RJCA 1U8OA 2FJGA 2BVQA 1DVFD 4YBLB 4JFDE 3CFCH 1KJ3L 3AAZA 4NKDB 1I4FB 4TNWK 5DEGB 1TJGL 2ARWA 1TLKA 4Z7VA 3MJ6A 5LGHL 4V2BA 1LDSA 3OB0H 2VH5H 2KDGA 4WI5A 2HG5A 4IMKC 1I1FB 1MJUL 1EO5A 5L6YH 1DUZA 2I9LB 2E27H 3V95A 1CXEA 1HNFA 1XZ0A 3MUJA 2Z4QA 3P73A 2NZIA 3QHFH 2XYCA 2G5BB 4MVBD 1CICA 3C60B 2VL5B 5CD5D 2P8LA 4YHOL 2KKQA 3GMNB 1K4CA 4KKAC 4FQ1L 4FQCL 3KWWB 4ONHA 1LDPH 3F58L 4HEPG 3RHWK 1A4KB 2WW8A 4X4MA 5E5MA 2BVUA 1JZ8A 1OP3K 3NGBB 3BPLB 1YPZA 3NVQA 2CMRH 4E42B 4O58H 3ZHDA 4OJFL 2BOCB 2VDQL 4YX2L 4OBRA 1ZHBA 4LIQE 1I4FA 4JFQA 4M43H 5DEGA 2A77L 1YC7A 4RGND 1MFBH 3QNZB 4AQOA 5IEHB 1NGZB 5ADOL 3EYSH 2DQUH 2Q1EA 5D2NB 3QDGE 1GVIA 2UUDK 3LQAL 3MZGB 2WUBH 4FS0A 2ARJQ 5EU7E 4DAGL 2DQTL 4PJCA 3L3IB 5CGYD 5EUKB 1DBJL 3QHZH 2B2XH 4YBHA 35C8H 1CGXA 3BN9D 1QSFE 4U1HA 1G7HB 1SEQL 5AG9A 1R0AH 3MOAH 4MA7H 2FX7H 4Z7QE 3KLHD 3C60A 1VACB 2FEEL 1A6ZB 1V7NH 3LPWA 3M45A 1SYVB 2VOTA 1U0QA 1CT8A 4KK6C 1MPAL 4OUOA 3MLYH 3QUYA 5T33H 2V9TA 4I0PC 4KXZH 5IVZA 1RZKL 4ZG1A 5HHME 1MIEH 1LHZA 4QHUB 3OJDA 4QKXB 2FH6A 2EE6A 5GGTA 5JORB 2O5YL 5EA0L 1G6RA 3NA4A 1CDYA 4KUCF 4Y5YC 1YQVL 4NQDD 5T3ZL 2Y5TB 1U8HB 4PRHB 2N7AA 2R23B 4Y4FC 4E42A 3QCUH 3B2VL 4DK6A 1B4RA 4YO0A 3DIFB 3T77B 2YK1H 3QXAA 3ZKND 3HNVL 3BQUC 1OAYL 1E28B 2AXHA 5DUPH 4F9PA 1UM4L 3HR6A 2DQHH 2NY5C 1NGZA 1HXYA 4DKEH 2HTKD 4CMHB 3MLVH 4JGMA 3EHBD 1YEDB 3G6AA 5HI4D 3BPOB 3NIGE 3C6LB 2J88L 2AJVH 3L3IA 1YEIH 4BQCA 3X13B 5C07B 2HLAB 4P5KA 4CDGC 4IDJH 4Y4KB 3LKQA 5TJWK 2X4QA 1A6WL 1IAIL 4NC2B 1G7HA 1N6QH 1UXWB 3BKJH 4HKBB 1DANU 4JO2H 4HZAA 1A3QA 3EW3B 5I71C 1TQBB 3JZ7A 5I1LA 5IR1A 3WXWH 3FTGB 1TPXB 1SYVA 4LMQE 2JIXD 3BZEB 5KVEL 1C1EH 1BD2A 3B43A 3O9WD 2C9AA 1A5FL 1VEOA 1AO7D 3C5ZD 2VXUL 4MDJA 1R3KA 4JM2B 2H3NB 1MRDL 4Y2DC 1A4JB 3OG6B 4BKLB 4OLVL 2AGJH 2XZZA 2G2RA 2H32H 3GRWL 5CIPA 5J1TC 4IOFD 1BVZA 1H3PL 4WW2A 2NY2C 4XPHL 2FCBA 3TBTA 2R23A 1S8DA 4HUKB 4U31A 1I9EA 1XF3B 4ORZC 4BELD 3T77A 3ZE2E 1D5MB 3MLUL 1EZVY 3VI4E 5JXAH 2IF7A 4BZ2H 3K0WA 3Q5OA 1SJHB 4M03A 1E28A 4I5BB 2C4XA 2R29H 5HHOB 1V7ML 3HFML 1ZHKA 4IRSD 4QTHB 1YEDA 5EOTB 1IC4L 2RB8A 3WNPA 4CU7A 3C6LA 4PJ9C 4X6DB 1DDHA 1DE4B 2NZ9D 4BFGA 1F8TH 1NBQA 3JWDC 4YGVA 2ZUTA 3EYUH 3D0LA 4NM4L 1NJ9A 2BVOA 2ZSWB 2OR9H 1GC1H 1MQKL 3PUCA 4WEMB 5MI0C 4H8WL 1ZT4B 4HKBA 1BVKA 4NOBA 4JR9H 3CVHB 4OB5L 1CQKA 2C3VA 3QDJA 3BZEA 2H2PD 5K9QG 3J7HA 3TVMC 3IFNL 5SWSE 4PRHD 4LSUH 2YOCA 4G9FA 4RFEA 3GMOA 2XRAL 4YHIB 2H3NA 2BX5A 1D5ZA 4OCWL 3VG9B 2XWTA 1HKLL 2BNQA 2CR6A 5FM4A 5C0BA 4JQXA 1UJ3A 2XQBH 1ZT7B 4HG4K 5HDQH 2PR4H 4ODWB 1AXTL 1D5MA 4I2XA 2OK0H 3HG1E 4KRPD 5IEKB 3BD5A 1SJHA 4I5BA 4X8JB 5HHOA 2BZDA 4LGSB 4TVSa 1A8JH 4N9GB 2RCSH 3PDOB 1WAAE 3O6FC 3GSWB 3DBXA 1UENA 4XPBL 4X6DA 1MHEB 1MOEA 1INQB 2DTSA 1P6FA 4HH9A 2YS4A 3SKNB 5SWQB 1UM5H 5C2UB 1ERNA 5IBUG 5DRWB 5DJDB 2R8SH 1CVSC 5FUOL 2ZUUA 4Z76B 1D6VL 5GGSY 3NH7L 3TT1L 4OAWA 3I6LE 4Q6IC 3V5KB 1QPPA 3WUZA 1J86A 4DVBB 1X5ZA 1IGCH 3KPSA 5HVGB 5IK3B 3U4AA 4JFHD 2NXZB 4WI7A 4YHKL 1Z3GL 2GJ6B 1F4WL 1PQZA 3FB8A 3N1PC 4GS7C 2R0ZH 2VNCA 1GJIA 1JGVL 4ZAKA 4PJ8D 3OAYK 4JHAH 2AV7A 1SQ2N 4JY4A 3RIFF 1CDUA 4HWBH 3C6SB 3BGAA 1QO3B 2XN9B 4OIBA 1ZTXH 3CVHL 5D93C 4LRIA 1QACA 1Y6MR 4N1HB 4ODWA 4GBXD 4ZUSA 1W0VB 2QQNH 1DBML 5DQ9A 4LL9A 4JN1L 5FO8A 3IDMB 1LO3H 3UTTA 5DJYA 2YN3A 5I75B 3PWNB 1RU9H 3MRKA 4NKIL 5KSVA 2XZCL 4N9GA 2P5EE 4QRQB 3PDOA 4A6YH 4BA8A 1UJTA 5T1KB 1MHEA 4HJJH 4NNYB 3FFDB 3MJ9A 5BXFB 1URLA 3V6FB 3VFPB 5DRWA 5DJDA 2WP3T 4HUNB 1R5VB 3T2OA 4RWHA 4L8SA 4OLUL 4PV9A 4GKSB 3V5KA 5IB2B 5KJRH 5KS9F 2F8XC 4NM8L 4DVBA 3DXAD 4G6KH 4WTZA 1S7QB 5MENB 1WFOA 4N68A 3OKOA 2EE3A 4P9ML 1S7RA 4JVUA 1UCBH 5CMAB 1AY1L 1QG3A 4Z5RA 3KPTA 4CBPA 4QHNB 3V6OC 3DHJA 1OSZA 1CWVA 3C6SA 1AHWC 1VHPA 1QO3A 4PJAB 1TJHH 1FORL 1XMWA 2YUWA 2ED9A 4X6BA 3SDAC 5CEZE 3N9GH 3CMGA 4MQ7B 4A2LA 3UDWC 3FOLB 4MS8C 4EDXB 1MREL 4UIMB 2D2OA 1RI8A 4NRZA 3VH8B 3PWNA 2I5YL 1T7WA 2VLJD 3SPVA 1IAKA 4PY8J 2VB5A 3R8BB 4QRQA 2XA3A 4EI6A 1TVBB 1XGYL 4JG1L 4DCQB 4QNPE 4XNQB 1TZGH 1VFMA 3TT3H 5FB8B 3ARRA 1P53A 4M1GH 3A67L 3I85A 5DDHB 1NDMB 1CF8H 4HWEH 3PQYD 3BX7C 3VFPA 2NXZD 3MBXL 1WAAA 1CFVH 2HJLB 2VLRD 4X6EA 3RWDA 1R5VA 1MY5A 5IB2A 4UT6H 3RL1A 4LAQH 5H2BA 3V0AC 1S7QA 5MENA 2CDFB 5IQ7H 3JXAA 1LEGB 1CIDA 4CGTA 5DJCB 4FXKA 3TO4B 5I19H 1NC2A 4KTYA 3JUYA 3ARZA 4PJHF 2BNRE 4EI5C 4BH7A 1MLBB 1ZA3B 1MQ8A 2EYSB 3I9GH 4MSWB 1JK8B 4JO4L 3HMWL 3PWPD 2FO4B 4MQ7A 3FRPG 3MRFA 4UIMA 4EDWH 3OXRB 3VH8A 4OZGE 3WJLA 4LF3B 4OGXL 4XHJC 5C8JB 1TVBA 2APFA 4DCQA 1FYTB 1XR8B 1HINH 4WFHD 4ENED 1FYHB 3U46B 2C3WA 4QF1B 3REVB 5K9OB 2H9GB 3QR2A 4QLRA 3H9SE 2P43B 3P0GB 3HNTL 2PXYD 1AXIB 3UTZB 2CKNA 3A6CL 1AR1D 1SEBA 2UZIL 3HI1B 1J0HA 4L5FH 3H42L 5BS0D 5D7JB 1A7QH 1MCEA 1AFVL 4MAYD 3LB6D 1CDGA 3MLWL 1JGDA 5FHBH 2QR0A 4NZDA 3S8WA 4Z6AT 2VXTL 3SJVB 4LCCC 2CLRB 3NFNA 2DICA 4LCWD 1A6UH 4HKZB 2O5ZL 5JMOC 1CGVA 3TJHC 4WDIB 3ZYJA 4TQEH 2BOBA 1WVZA 2X4UA 5H8DA 2NX5B 1W0YT 4TNVF 4NN5C 5C6WH 3RTQC 3UAJC 2VR9A 1HQRB 2ICES 3AROA 1I9JL 2D0GA 5E2WL 1OWRM 2C4FU 2Y7QB 1MLBA 4TSCL 1IM9B 1G0DA 3QXWA 2EYSA 2E9JA 1N5AB 3FQWA 1MCNA 1VADA 1GOFA 1VEPA 3MJGX 2WK2A 2BSSB 5JOFA 1JWUA 1T83A 4NKOB 4G7VH 2JJTA 5C8JA 4MJ4A 1A7OL 3DUSB 3LRHA 1U8MB 1XR8A 3OB0K 4LGRB 2NY0C 2H9GA 3V7AG 4ZODA 3D18A 3VXMD 4DKAA 2HMIC 2AAVA 4ZUVB 1YEKH 3LS4H 5FGSA 3U6RB 4QRPE 2VZSA 4EUPH 2CO7B 4F2MA 5BW7A 3TYGH 1FG9C 3NPSC 1Q0YL 4WJ5B 1RUAL 3SJVA 2CLRA 3TFKC 1ADQH 4EUPG 1H0DB 3MBEB 4G5ZH 1MCCA 3VGAC 4I18C 1X5YA 4K7PX 3TA3C 2CK0H 1PLGL 1HQRA 3V6OE 4XTRD 3HC0A 2CJUH 2Y7QA 4GQPH 4HPYH 5MP6L 4R97C 3ZSTA 3ARGD 2XACC 2KZWA 4G8IB 3V4PL 3UPCA 3W11C 3K8MA 5CBAB 2WANA 4R9HA 2H1PL 4M6MH 3MXWL 1T6VN 4NFBA 3CXHK 1U8MA 1CFSA 5GGVH 2JF1A 1MJJB 3C8HA 1MAJA 2JTDA 1Q9WA 3WNOA 1JF1A 1NBZA 1AH1A 4OZGA 5J3HD 1D9KA 2W59A 4ZUVA 5KTEH 1I7RB 4NC0B 5AWNH 4AY0A 4GMSL 2X10A 4OFYA 1XIWA 3QEQA 3H9SA 2EDBA 1AXSB 5IW6B 3GBNL 2X6MA 4EVNB 4PP2A 2RR3A 1NFDB 5F1NA 3NFSH 2YR3A 1WBXB 1CCZA 5F96H 2ZWLT 2AABL 3D48R 12E8L 5EDXA 4HUXB 3WNKA 2OR7A 4KROC 2DS4A 5DO2D 3ALPA 2DTML 4C54A 4DFIA 3ARYA 1JCKA 5CSZB 5D7SH 2F8VA 3EFFA 1KGCD 5BVJA 2X4RB 1HEZA 4PLKC 3FB6B 3MNWA 4G8IA 2J7LA 5IVXB 5JHDA 4Y5VC 3BEWB 2D7NA 2HYMA 3O6LH 4YJZL 2PUQT 5CBAA 5GRJH 1HHHB 3AY4A 1NKRA 4LSQL 1V5JA 4HBQA 3QIUB 5IROC 3S3JA 3QDAA 1U3JA 4UB0H 3T0WA 5TE6L 4XBPB 2HH0H 1I7UB 3B5TA 1JPFB 4O5LH 3P9MA 4TUKL 4H20H 4WCYL 5B3JF 1BX2B 2VQUA 2ICEA 3SKMB 3L3KB 1FDLH 3SKJH 3BI9X 4HDIA 4U7KA 2WAHA 1KYOK 3BGMB 4QRPA 1ZAGA 4IHOB 4ELME 4F33B 3QDMD 1XF5A 3G5VB 5CP7A 3VDAA 1Y18B 5ADPL 4FTVB 3TV3L 4HG4J 1GZPB 1OWWA 1YEJL 1AQDB 2R1XA 3H6JA 3BZFB 1X5XA 4LVOB 3SOBL 3TP4A 4BFEA 3BP6A 2W38A 5E1AA 2DIJA 4OIAA 4ODSL 4OT1H 1CD9B 3BGFB 3VFTA 3QFJD 4YXLL 5ITBL 5BRZE 5ELIA 3F7QA 5GZNC 4QTIL 1DCLA 1LO5B 5IJKA 3EO0B 5JW5A 2PCPA 3T2NL 5EPMB 3LEXB 5B39B 1JPFA 4YNYB 4OIIL 3TYFB 1NLDL 1RZIB 5DWUH 3CXDL 1XFPA 4JKPL 4K7FB 4G6JL 3Q3GB 5GRYA 2PYEA 5D5ME 3SKMA 1KIUA 4O2CB 1CU4L 4TN9A 4AEIH 3L3KA 2YMXL 2A6JA 1T03L 3UPRA 4MAUH 3L3GB 1MJ8L 3KR3L 4J8RB 5LGKA 1KJ2H 3MJ7A 4KKBD 1WC7B 1YY8A 4WW1B 2X4PB 1WZKA 2A9MH 3C08H 4M6OH 4YBLC 3QUZD 1A3LH 2DI7A 3BGMA 4IHOA 4X5WA 5E2TH 3G5VA 4MJIE 3IDYB 2J1KA 1BQLH 2Y6SC 3S98A 5BZDA 4FTVA 4PRPA 5GPRA 1JF5A 2X44D 3VGFA 5F7FA 3QIUD 2ARJB 4YE4L 4IRZH 5A16A 1RZKC 1B4JL 3WFBL 4N8VG 3OSKA 4UDUA 5ESQA 3W0WD 4FFZL 4UOW1 4KY1L 5D7IE 5JO5B 4ZFOA 5HYEA 4KTEL 5CZXD 3CK0L 4ZQKB 2Z0BA 3C60C 1HH6B 4RBPH 1LO5A 3EO0A 5GS2H 3KPQA 5HYFA 5I18H 4OD2B 2P8MA 2BVPA 3LEXA 3QUYC 5C0CB 4OUUA 3TYFA 1EEYA 5C6TH 2AP2A 3EKCA 2EXYD 2F5BH 2Z31D 5H37H 3QNXB 3Q3GA 5DHXB 2EDNA 4NGHH 3D39B 1C8PA 1IZKA 2EECA 2ATPB 5MHSE 2IALA 3SDDA 5H37G 3L3GA 3NGBC 3BPLC 3S34L 3TIEA 4J8RA 4L3EA 3KJ6L 1HHIA 3VFNB 3QCTH 3OZ9L 5H35B 5GS0H 3PGCB 2IG2H 4XVSH 4LASH 4XVJH 2VDPL 4F9PC 4PTTB 1JZ6A 2NYYC 2QHLA 1P2CB 4NC1E 3SY0B 4FG6C 2JB5L 3MA7B 5AD0A 1WQVT 1SM3L 1MI5D 4KVNH 3W39B 2ARJA 3TH4T 1K8IB 3CH1A 4K8RH 1JPSL 3NA9H 3BIKB 5FYKE 1CDIA 4NOFA 2E6PA 2Z93A 3B6SB 1G7MB 2DM3A 4ZQKA 1LVEA 3LRGA 2D7PA 3FO9B 4P46B 4FQXB 4N8PA 3BVNB 5D7LD 5MERB 4JFEB 2LV4A 2FZ3A 3MV11 5BOPA 2UZYB 1AGBB 4PJBB 5C0CA 4WWID 1IGTA 3ARUA 2BNUA 4PGCB 2VLMD 1YEEH 25C8H 5KSBF 1F90H 1GCFA 5BRZA 4Z7UE 2FWOB 4PJIE 5DMGD 4KC3B 3N1MC 2ATPA 2UZXB 4Y19B 2EH7L 3KVQA 5DRNA 1FLRL 1ACYL 2QQKH 2EDDA 1MCIA 3VFNA 4L9DA 1IVLA 5F7KC 3EYVB 2E9WA 5D5MA 3RWEB 1S9YA 4HF5L 1RD6A 3D25B 2CIIA 4H8WC 5E8EB 3NN8A 1KEMH 4P3DB 5ID1B 4N0CD 4OCXL 4CMHC 3SY0A 3LV3B 5D72H 4X4YB 3CFCL 3V8OA 3BPOC 1CR9H 4PB9L 2VDOH 8CGTA 1U93B 2H2SD 3C6LC 3O11B 4R0LB 2E7LA 3SKOA 2Y72A 4LEOB 5E8NB 3BRFA 1K8IA 3D85B 3CH8A 3T4YB 4Y4KC 3F7YB 2VH5L 3AMKA 3E6FA 5DD3H 3HC3H 3WDJA 4Z0XB 5L6YL 2E27L 1MLCB 4U33A 4JANB 4PJGE 4GW1A 3PE9A 3LEVL 4JY5H 3ZDXF 3OKLA 4OGAC 2IANB 1S7SA 2VDKH 4M93B 5TQ0H 3BVNA 5MERA 1TPXC 1J9CT 2NXYC 4JFEA 3QHFL 3WFDH 3LCYA 4NZJA 3RGHA 5D7IA 4U3XA 4PJBA 3MR9B 1PGRB 1FE8H 4LLWB 3WFCH 5GSRB 1LDPL 4U0QB 1P5VA 4HAGA 2DM4A 1ZEAH 1MCWM 3FT3B 1M71A 1C5BH 4X7EC 3I50H 4RWYH 3EYVA 3UBXA 4HCRA 3RWEA 5DSCB 3MREA 1L0QA 2FBJH 3D25A 5DJ8A 5E8EA 4D0DA 4K3JH 4P3DA 2CMRL 2P24A 1NEZG 4O58L 1U95B 3ZT5A 5CSBA 3OKKB 4X4YA 3QH3B 4NQDE 3AREA 1U3HB 1WIUA 1UB5B 3MUGA 4M43L 4P2YA 5E8OA 4LEOA 1ODAA 2Q86B 3RVXD 3CIQA 5E8NA 1RZ7H 1MFBL 5I2IA 4NQCB 4HCRL 4U1MA 4WU5A 3EYSL 1FZMB 2DQUL 1NCAH 4GG6B 5DHVA 2DQDL 4NRXA 1FN4B 5KSAB 4JANA 3CCHA 3QHZL 2B2XL 5FA4A 2IANA 4RZCB 4PRID 2BCKA 3GSUB 3A6BL 4GKZB 1U41A 4LNVA 3RIAF 1JRHL 1R0AL 3MOAL 4MA7L 2OJEB 4LPUA 5IFHH 4RQQB 2FX7L 3F62A 2H32B 1EFXB 2ORBH 3MR9A 3P4NB 4QCIA 4TYUA 5DZNA 5E9DD 3BH9A 5I76B 1J8HB 4PRBB 1ZT1B 1V7NL 2GSGB 2VXVL 3ILQD 5BQ7B 3VD7A 4ZAKC 3VG9C 3E0GA 5T33L 4NWUH 3EO1A 1BAFH 1ND0A 5JHLH 2JCCF 3FT3A 4N0UA 1MIEL 4N8CH 4LRIC 1EJOH 1S78C 5ESAB 4AT6B 5D1QB 2RGSA 2YD1A 1AO7E 4Z7UA 4ZD3H 1X6LA 5GGUB 1OOAA 1U8QA 1G6VK 5I9QB 1NGWA 3QCUL 2ITCB 1T0NB 4H0GA 3VXRB 2YK1L 1HZHH 3GMQB 4YR6B 2DI9A 5J6GB 4LEXL 1MRFH 1T66D 3GK8H 3WEXA 1JWMB 5D2NE 3WLBB 3ZHLA 4P23A 2DQHL 5I1AA 3BJ91 3L1OH 2PTTB 3MLVL 2FJFB 1HSAA 5KVFH 4LQ1A 4GG6A 5E94B 5ALCH 4OBSA 2EEDA 2AJVL 5F9JA 1FN4A 1YEIL 1EO8H 3O8XB 4L8SC 4N1CA 1R6VA 4KZDH 1NUFA 5B22A 1T0MA 2I9TA 4HKXB 3B9VA 2R1WB 3GSUA 1N6QL 1OF2B 2OJEA 4XAWL 1MSPA 3RDTD 5DT1H 3TBWB 5DHYA 2BFVH 1ZT1A 2GSGA 3WXWL 4OCYH 5HD8D 5BQ7A 4Y1AD 3PWUB 3DI3B 3WMSA 1C1EL 1A22B 3IB4A 1ES0B 5F21B 5IM7B 5T3XD 3SGDI 4HT1H 4DZBB 4JKKA 1SBBA 1E6OH 3RWIB 2LVCA 5I74C 4YDKH 5IV2A 1QR4A 5CEYB 2IBBA 5ESAA 2AGJL 4PRHE 5DVOA 5GGUA 5C0RL 5IBUB 4P49A 5HSFA 4RX4D 5FYLH 3THML 3TO2B 5GIRA 2X70A 43CAA 5I75C 4LOUD 1W0WB 4YUEL 4BQ9A 4UT9H 3VW3H 4PGBA 2DL2A 5JXAL 1KT2A 2BVTA 4JFPA 2EC9U 4MX7B 4BZ2L 5J6GA 4PGZA 4AG4H 4UTAH 1JWMA 3W5MA 3VFWB 1OAKH 1UEMA 1X9QA 3QJHA 2PTTA 4TTDC 1GGCH 4MDIB 5GRUH 3VXNB 5C07E 4NQDA 2LU7A 5JW3H 1F8TL 4ZSOB 1JPGB 3VXUD 2R69H 3WD5H 1QFPA 5J13B 1GC1L 2R1WA 3KPOA 4I13B 3CFEB 2X42A 4NQEB 3H7BA 3CFDB 3MOBH 4JR9L 3DGGA 5C3LD 2QV2A 2VIRB 4BZ1H 5ITFA 3LN5B 2H41A 4U1KB 2A83B 5IM7A 4LSUL 3GSVA 1FGVL 1QLRA 4Y5XA 3S36H 4DZBA 4LCIH 3RWIA 1IKNC 1QHPA 4TNVK 4GRLD 3DO7A 1INDH 1KFAL 4XBGA 1ZHNB 1BIIB 3IETA 5L8LB 5ICYA 2XQBL 1ZVHA 3LY6A 4AIOA 5HDQL 2BDNH 4YFLF 2PR4L 1IBGL 4LLVB 2DQEH 1FNGA 2OK0L 2IJ0C 4B53A 4A2MA 3GKWH 3O9WA 4YXHH 2DRUA 2EKSA 3C5ZA 4I1NB 3O0RH 1B0RA 5ISZD 4JKLA 3BKMH 3MV7D 4CW1B 2ILLA 1OLLA 3O4OB 3E8UL 3EGSB 2RCSL 5EZOH 3ALWA 4OI9A 2AXFA 2HFGH 5EZLB 2G60H 4N5UA 3K81A 3OKNB 4HQQL 3MNVB 4HUVA 3MNZA 4FHBD 5C86A 1UM5L 1WBZA 2YD5A 1WLHA 4LVEA 2DD8H 3HI5H 1XGUB 4WEUD 4JHBA 1FZKA 3CFEA 2ESVD 2I27N 4KKLC 5DR5H 2J6EH 2R0WL 2GW5A 2BMKB 4RGOL 4IRSA 3SCMB 3TO4C 1IGCL 4U1KA 4MJ5B 3ZL4H 1P7QD 4ZUWB 2ENSA 3PV7A 2W91A 4IM8A 1JGUH 2NY5H 3DXAE 1IAII 1ZGLA 3VXOB 1ZHNA 2X4SB 3ULUD 1OAZL 2W65B 5JIHA 2GQHA 3QXDA 3S7GA 3VFVB 4BFBD 3ARVA 3FT2B 3CDGB 5FV2A 2P4AB 2JJTC 1JI1A 2QQNL 5TGBA 1LO3L 3RUGF 5L2KB 4CW1A 4LBEA 4S0SD 3FKUS 5FV1L 4JRYB 4BJLA 4N1EA 2ICWB 5IUSA 4MQXD 4NQED 5EZLA 3P0YH 4KDWA 5CBEA 3OKNA 4HJJL 4Z7NF 3NZ8A 5GHWL 4WI6A 2EDJA 3OKMB 3ETBF 4M1CC 2K7PA 2PO6B 1E4WH 3BUTA 3T4AB 5BW7C 4NZRL 4S1DD 4PBXA 4YFEA 3PHOB 3VGDA 3VWKD 1PKQB 3PQYE 3GMRB 4UNUA 2CR3A 1A2YA 4BYHA 1F3DH 3OKEB 5KJRL 5F3HB 1Q8MA 2GJ6E 1OVZA 4MCYA 4G6KL 4YBQD 5JPNB 1F3JB 2Z9TA 5GGRA 4PJFA 3DVNB 5M95B 3HE7D 1UCBL 2BY3A 5HHVH 2XN9E 4P2QD 3NACL 4R90L 2X4SA 2W65A 1KNOB 4HS3B 4P5TD 3WE6B 1OM3L 5KS9B 2GT9A 3TBSB 4GOSA 1VSCA 3MQIA 3QI9D 3N9GL 2CRZA 2CUMA 1E4JA 3C87A 3IYLW 2NY3B 3L3OA 1J1PH 2WQ8A 4JRYA 4R4ND 4PJ8A 3O3EB 2CKBH 1C7SA 5I73C 5GGQL 2YA1A 3RY5A 3DROA 3HPLB 4LFHD 4M1GL 3HB3D 4FQQB 2XIDA 5CWSB 1XIWC 4HWEL 2PO6A 2FGZA 2P44B 4WFHE 2WBJB 1FL5A 4RBPK 5BOZG 2UWEA 4YIQB 2VXQH 3F6IA 3ARDD 5SX4I 3MRLB 3VWJD 1KIQB 3MBEC 4DGIL 3OKEA 4UT6L 3K4AA 3IU3A 5DJAA 1T7VA 2KQMA 4LAQL 3O2DH 1LE9A 5BS0E 1F3JA 1VGKB 3CPLB 5F1IB 3BUYB 2F8OA 4J3WA 1FL6B 4DUXA 2F53D 4X6FB 4R2GB 2Q76B 1KSRA 5I19L 1MIMH 3QEHB 1EXUA 4PJAE 4PP1D 4BUHA 5DI8A 2E7CA 5F7NC 5GRVK 3WE6A 1NPUA 2B20A 1WFUA 3RPKA 2ADGA 3HUJF 2F58L 3LMJL 4WO4D 3D69B 4X5LA 4NHCH 2B1HH 2FRGP 4IRJD 3I9GL 4J4PA 3G9VA 4PR5B 2EIZB 4EDWL 5FOBB 1JYNA 3MCLH 4MA1B 3ES6B 4PV8A 4GRMA 4EUPB 3O3EA 2YD8A 3KYOB 4OTXH 4HZLB 1KPUA 4PJHB 5C7XL 4JDVB 4RCAA 3RWGA 3NAAH 1SJVA 3HPLA 4QRUA 5CUSH 4UQ3B 5GRZA 3RVVC 1MCQA 4KH2A 4F7MB 1FL3B 4L5FL 4YIQA 1HKFA 3VXME 2VLJA 3MRLA 1A7QL 1NMBL 3D87B 3HPJB 1KIQA 3T0DA 5ERWA 3QG6A 3ZT6A 2DQGH 3MFFA 5FHBL 5B38A 2Y9RT 1VGKA 1ZANL 2ICWJ 3K8KA 5J11B 1YNTB 3HI6H 1FL6A 3T0EB 1QRND 5C9KA 3PQYA 3QUXB 2JJSA 4TQEL 4V2CB 4NJAL 4P57A 2VLRA 1BBJB 5HHNB 3LKRB 3AXLA 2YN5A 3IT8D 4KI5C 5IHLB 1FNEB 1P7HL 1LQSR 4CVZA 2EO1A 2E9BA 3GNMH 3RZCA 4UUJB 4BSVB 5FOBA 5FYJU 2P5WD 5IJKC 1BVLB 1FYTE 3MGOA 3ES6A 1OSPH 2YKLH 4OI8A 3H9HB 3WIHA 1OTUC 5HVWA 1BZQK 1H15A 4F57H 3WO3B 1A1NB 1DLHA 4OQ1A 4LHQB 3PWPA 5IVOA 2QSTA 1YEKL 4F7MA 3VD9A 2GTZA 3D0VB 3ILPB 3LS4L 3QQ4B 4QGYA 3RNQA 5LBSH 3U9UA 1X7QB 2J4WL 3O6KH 2F74A 4U6YA 2ZUYA 3DHMA 3HPJA 2ZNXA 3GIZH 2X9WA 2J5LB 1XH3B 4HMEA 3TYGL 1RULH 3X17A 2AV1B 3LKNB 3SDXB 1UB6B 3GSOA 2HRPH 3B9KB 2EICA 1YNTA 1ADQL 3T0EA 1SVCP 4LPVA 4G5ZL 2PXYA 1WICA 2NX5E 3L95B 5DEZA 3I84A 1SYSB 4Z95H 3QPXL 4OSUL 1QD0A 3T3ME 3PABA 2B7DT 1MNUH 2CK0L 4QOKB 5TPWH 1NBYB 2XXCB 4LVOC 1VGEL 2CPCA 2OJZH 4OM1H 4MAYA 4UTBH 5AZEL 1BHGA 4HPYL 4JB9L 5J8OA 2VC2H 1FNEA 2DQJH 4AEHH 3BGFC 5F7EL 3DRTB 5D70L 4LCWA 1QBLH 4POYA 1BF8A 3GB7B 2FR4A 1FJ1A 1KGCE 1OD9A 5CINH 3KXFD 2OMBA 4TSAL 4Z7OE 4LSVH 2DBJA 4G8FB 1UWGH 3H9HA 5GGVL 4WFED 4OZFH 2VDMH 1RAMA 4EBQH 5CGTA 5E00B 2BSTB 1OP9A 4M7LH 3CSYB 4HH8A 1F4AA 4RDQF 5FF6A 5KTEL 3ILPA 5AWNL 1QEWA 2IPUK 2X41A 1X7QA 4JFXB 2NY4C 1KJMB 4OLYL 4FFWD 1XH3A 2GHWB 3O4LD 3IXAB 3SDXA 1UB6A 1MCFA 4JRXB 3OAZH 2DMCA 3IDYC 2R4SL 2YPVH 5F96L 3VXMA 3D3VB 4YPGB 1OGAD 3L95A 2ADJB 4OZIF 1UM6L 1CGSH 4W4OA 3MRPB 5DD1H 5EUOF 1JN6A 2FYYB 2FIKA 4ZTPH 5FCSH 4LSRL 4BSJA 3QDME 1I3RA 4G8EB 5D7SL 2Z8SA 4PLNC 5EWIH 2DF3A 3VGBA 1DLFL 3KPRB 1T2QL 1JI2A 3O6LL 5GRJL 1I8IB 3BOVA 1T22B 4O4YH 4G8FA 3P11L 2UV3A 3VFGH 1YNLL 5F7HA 5D7KE 1KLGA 2AEPH 1KJ2B 2V2TA 2N4IA 3RY6A 3FB7A 3PWJA 1AGFB 1AIFA 2HH0L 3HMXA 3EDDA 4NO0B 3CSYA 4NQSB 3FHQA 4O5LL 1A6AB 1MFNA 2IFGA 1QBMH 1PDKA 1A9BA 4S11A 1KTLB 4JFXA 5C71A 4N8VB 3HTLX 3SKJL 1FDLL 1KCLA 1LP9B 3DVFA 5MEPB 1RZGB 1NFDE 1RFDH 3LDBC 4KHTH 3I2CH 4UIKH 2DLEA 3FQTA 5INCB 5DQJA 4JDZA 2W0FA 3HMXL 4Y4HD 3NCBB 3TN0A 5DMJB 5CKGA 3MRPA 1XF4B 2FYYA 4WIQA 4PJ5B 1T1XB 4EN3B 3MV8D 1I3GH 1YDPB 4RSVA 1LMKA 5EOQL 5BO1H 2Z92A 5DZOA 4JDTH 1RURH 4LLYA 4G8EA 3KPMA 5IVXE 4MNQB 4G8GD 3HE6D 3VA2C 4J12A 4FQXC 1I8IA 3JV6B 4XC1H 5KAQF 1T22A 5HI5C 3D5OF 3OV6A 3RIAK 3NIFF 4FRWA 4OT1L 2R56H 5JZ7C 1K5NB 4S1RH 4RDQG 4O2FA 4TULL 1AJ7H 1VCAA 3U36B 1NFKA 1JNHB 1EGJA 5IFAL 4JFZL 1HYSC 3K2MC 5CJBA 1LO2H 1M7IA 3NFPA 4PUBH 3JSSA 1LP9A 2V7NB 5FK9A 2EYRB 5MEQB 2ED8A 4QHLA 3RFZC 3L5WB 2NLJA 1T1WB 3BH8B 5INCA 1XR9B 3CX5K 1KJ2L 4FQ2H 4ZNEE 1I1AD 1HIML 3T0VA 5CLWA 2F19H 2A9ML 3C08L 3PP4L 4M6OL 4Z7VF 4G3YL 1C12B 1A3LL 2JELH 5DMKB 4FN0A 4GH7B 2HT4D 5E2TL 4R0LC 2VZTA 3MRQA 1XF4A 4X8XA 3VMNA 1YDPA 5EO0B 4MD4B 5C0IB 4TVPH 3DOSA 4L9LA 5GISL 4CKVX 4MNQA 5E99H 4IRZL 1MCOH 3SE8H 1CE6A 1HI6A 4U49A 1H8SA 3JV6A 3KYMB 1WFTA 4GAGH 2VR5A 3OR7A 1BM3L 1K5NA 4Z9KB 3BFOA 4X7DC 2Y1VA 4NFDA 1JMZA 3RPIB 3O3DB 4P2OD 4JEGB 4XP9L 5DVLA 4PB0L 3VXSD 1TDQA 4XXDB 1W72H 5IWLA 4Z8FH 4U1IA 2F5BL 1HSBB 1RUKH 1U8LA 3QEUB 1YPZF 2CGRH 1HYRC 4MXVF 4XT1C 5MEQA 2VLME 3IJHB 3QJFA 2X2YA 3QFJA 5CD5C 2OI9B 4PJ5D 3ULVF 4RFNB 3QCTL 4QWWD 5DF0A 2A74A 1Z6JT 2WWKO 3ARBB 1FC1A 5DMKA 4PY7B 2IG2L 3AS3A 3V0VA 1U3HC 4XVSL 4LASL 1D5XA 4XVJL 2VR4A 4JQIH 2ADFL 1YYML 1HILA 3QYCA 4P23C 3V7MA 5CD3A 4PJCF 4XPTH 3DMMB 1FV1A 5GS1A 4MWFA 4LP5A 3SE9H 1P69B 3UX9B 4KVNL 5KAQG 5KSAC 4K8RL 4U1LA 4XPFH 5A2IH 1AI1L 5GS0D 3KYMA 5A2LH 2C1OA 4JAMB 1QSVA 5KOMC 1MJUH 2FX9H 4RGNC 3KYAA 3O81A 3SGDH 4Y16A 1AGDB 5HHXH 3S35H 1NEZB 5CFHA 3CAFA 2APVA 2CDEA 5BZWA 5CJQH 1EPFA 2P7TB 3L3HB 3SGKA 4D9QE 2V9QA 1WIPA 4QRRD 3D39E 3W0WA 1YEEL 25C8L 3BN9C 5EB9A 4O51A 1ZS8B 1F90L 2DAVA 1MCSA 4JRWA 4X6CE 4M9OA 5E6IB 5L2JB 4H26B 1RHFA 7FABH 2Q8BL 3O3BA 3WV0A 5J1SC 2DQFA 4FFYL 2CDGA 3SGEI 4FMFA 4XNUH 3AM8A 3OHXA 4V1DD 5I9QC 3MRIB 4ZDHB 1KN2H 3ARBA 3GHEH 4PD4K 3QUKB 5L88H 3HR5B 1KEML 2Z31A 3MGAA 4JFDD 4DEPB 3NCFB 1JPST 3BRGC 4UDTA 4ZNEA 2OP4H 5D72L 2UYLB 5J12C 1CR9L 4MQSB 4ODHH 4OJFH 3TPKA 2VDOL 5I8OL 2HJKA 5EU4B 1FO0B 1IGFH 2A77H 2X5PA 3O8XC 3OR6A 1QQDB 3MYJB 2VKXA 3HC3L 3ZKNC 1FZJA 5J89A 2MPAH 3GJEB 3E2HB 2EYTB 4JY5L 3UYOD 2HTKC 5INDA 2VDKL 4MZ3A 1CLYH 5TQ0L 3BW9B 4NBZB 3VFUB 4P2CG 3WYRA 1EX0A 3WFDL 3U1SH 5C6PB 1MI5A 5M94B 2EDFA 2JKXA 1KF9B 4PRIE 1FE8L 3WFCL 5IMOA 1CFQB 4Y19E 4H26A 1A1OB 4WW2F 4S2SB 5ACZB 5E9DE 1INEH 3V52H 3QPQC 1ZEAL 4WUKH 3ECBB 2E5EA 5IF0B 3UEZA 1OGTB 4GUPB 2E9IA 4ODVL 1NFIB 5IHZB 1RZKH 4RWYL 5F89A 5D7LA 3MRIA 5JW4M 6FABL 3O9WC 2O5YH 2Y5EA 2EZ0C 2FBJL 4JREB 3IKCB 5DJ6A 3PHQB 3C5ZC 4K3JL 3RWCB 3Q6FA 5T3ZH 1XGPA 1HQ4B 1QFUH 3RWHA 3PHSA 4KV5F 3ARPA 2VDLL 4IIQB 2CUHA 5JW4R 3WSQH 4MD0B 3B2VH 2NR6C 4F7EB 4OF5A 5C0DB 1EHNA 2WWMD 3MRDA 4JPKL 4UZGA 4FNLH 1NC4D 1OAYH 3QDGD 1RZ7L 1FO0A 1L4IA 1M4KA 1UM4H 1L6ZA 2WIIA 4X4XB 5EZJB 5LAXB 5J13C 1G6RH 2W60A 3MACH 3X11A 5C2BH 3L3DB 1QSFD 2EYTA 1KG0A 5E4IA 3P9WB 4IRSC 3GJFB 4Z78A 3BW9A 4Z7QF 5C0AD 3VFUA 3IRPX 1ZXQA 3HZMB 2VO5A 1A6VH 4KJWC 2ORBL 2NY6D 1FO0L 1CGTA 4U1JB 3ZKSD 2YD6A 3MCKB 3BPNB 4S2SA 4HUWB 1BAFL 5FM5M 5KVEH 3C8KB 4CJ0A 3GEWB 4H5SB 5IF0A 1OGTA 5IHZA 2VXUH 5F9AC 1R5WA 1QA9B 5ICXB 4MA8L 1F11B 4X6CA 1OD7A 4ZD3L 1MRDH 2Q6WB 1JZ3A 3KYNA 1SHMA 4XP1H 1H3PH 1MH5B 4X6DF 2K7QA 2A6DA 3O4OC 1HZHL 3E3QE 4MD0A 2FNBA 2A6KB 4F7EA 2JCCB 1SVZA 2GJZB 4NQCE 1O0VA 3GK8L 3MCG1 3C5JB 3L1OL 15C8L 3JTSA 3TLRA 5KVFL 2VISB 3QIWD 1RJZA 4MNHB 5ALCL 4HGKC 3G5YA 2HTLD 2Q3AA 1NCTA 3HRZA 4LGPB 2PYFA 5CIPH 1HHGB 5ID0B 1S7UB 2XPGB 4KZDL 3GJFA 3P77B 3CSBA 1GYAA 1WT5A 1J8HE 2FHFA 3GIVA 2I24N 5E4EB 3KNBA 4TUOB 1TIUA 5C09B 4P48A 2BFVL 1EEZA 3IDNA 4YC2B 2DMBA 2BK8A 4OB5H 3MCKA 3CX2A 1RJYA 4APQB 5EC1B 5I8EB 1T1ZB 2DLTA 3C8KA 3HN3A 4HT1L 4H5SA 1E6OL 1U58B 3LVEA 2OSLB 4OLXH 4U3CA 2YZ8A 3O41B 4XC3H 5IJVB 2IC2A 1TETL 1GOHA 3AVEA 5C08D 1JGLH 3QCVH 3V2AR 3CDFA 5FYLL 3VXRE 1Z0NA 4LKXB 1MH5A 4KU1A 1FP5A 1S9WB 2A6KA 4M5ZH 3F12B 2JCCA 3MRJA 4Y5YB 3ARWA 4AG4L 4UTAL 5DEFB 3RVWD 2OTUB 2VRAA 1OAKL 2K9UA 5DURB 1GGCL 2JE8A 5SX4H 2E8ZA 2PO6C 4NKQB 5HHQB 1U8JB 5GRUL 3T08A 4L8DA 5ISZE 3VE0A 3BQUB 5JW3L 1JYWA 1M6OA 1HHGA 5DJZA 4PJXE 5GGSB 4PRAA 3WD5L 2XPGA 2QHRH 1UXSA 4OLZL 3OKDA 5GJSL 2X1XR 1F45A 4QRTA 4JPWH 1J1OH 1R3IL 3RY4A 4P4RB 3MOBL 4NQVB 4MMXC 5HYJD 1NCUA 5FO7B 1T04B 4EJ1C 5F7YC 1EVTC 4APQA 5HI3C 3FB5A 2FB4H 4NKMA 3S36L 1U8KB 4LCIL 4NQXA 3T1FA 4NUGH 5JXEA 4NCC1 3VCLA 3ZTNL 1CE1L 3G6JB 1JJUA 1T20B 3ZE0F 2WSKA 4P5MB 1JGVH 1JRHI 4J4PC 3QZWA 4M6AA 1XGTA 1YECH 1BZ9B 4CNIB 5FECB 4F37K 4L8BB 2NY3C 5KVGH 4NO2B 2PNDA 2BDNL 4Y1AA 2DQEL 4LVNB 3BP7A 3LKOB 3GKWL 1NGPH 4YXHL 1HK6A 2BHUA 2OM5A 2YPLB 3F12A 3O0RL 3B3IB 4G7YH 3BKML 1WAAF 4KMTH 4LU5L 5EZOL 2HFGL 4ZSOE 4E41B 3OWEA 2LU3A 3OMZA 4WY7H 4RX4A 4OZHE 3TC9A 1QUNA 3U7WH 4WHYG 4NQEE 2DD8L 1UQSB 2DM2A 3G04B 3GMLB 2IH3A 3I6LD 5E6ZA 4P4RA 1RK1B 5I17A 1QLEH 4MZ2A 4KK6D 2JJSC 3L9RB 4I0PD 4JZJB 3VXUA 3MJ9H 1JGUL 2NY5L 3G6JA 5CGMA 1T20A 3HLAB 2WV3A 3F6LA 4JY6B 1B9ZA 4Z0BH 2CKBB 1BZ9A 1HH9B 1U36A 4J3VA 4MB5A 3RZCC 5GGRY 4HWUA 2ZCHH 4L8BA 4JFFA 4Y4FD 2A73A 4MA1C 4OV5A 5FO9A 4BFIA 2P47B 3LKOA 1PY4A 3K2UH 4GG8B 1K4DB 2WINB 1R24B 2P5ED 3EO9H 3V5HA 2IADB 2CXKA 5A43C 5BJTA 3P0YL 4JG1H 4N90D 3DGCR 2CXGA 4F9LC 2MHAB 2GSIA 3WCYA 4HFWB 5IB3B 4N5EC 1T80A 2WUCL 1E4WL 1NSNL 2AK4B 2MWCA 1UQSA 4QY8A 2DIBA 3G04A 3JV5A 3RUGB 4ENEC 3GMLA 4ZXBB 4HXBH 3MV7A 3T0EC 4NZTH 2LABA 3WN5B 4PJXA 1IFHH 2PXYC 4NHUB 5C1MB 1O5DT 3IVKB 3QUXC 1PEWA 3Q2CA 3N1FC 3T04D 4Y88A 2FX8H 3L7EB 4JZJA 1S7TA 4XX1G 3AFLA 5KSUA 1RQ5A 3HLAA 3M8OL 4Q6IB 4Y2DD 5HHVL 2FH8A 2ESVA 3O45A 4OCSL 5K9QI 1FVEB 4CMMB 5DVKA 5CEZD 2NY2D 4BSWA 1FFPB 2FBOJ 1T2XA 4Z77B 3QXUA 5T1LB 3FCTB 1P7QA 5L2KE 4HV8A 2YC1B 2FHBA 1QSED 2GCYA 1DN2A 3RVUC 1VFAA 1DN0B 3D2UD 1S7XB 5E8PB 2CKBL 4PJ9D 3EIFA 1DEEB 1GGIL 1JIBA 4FP8H 1OP5H 4YDVA 1TTGA 4NO3A 1IL1B 2J5LC 4JFYB 4ZXBA 3WS3B 5J9PA 1KEGH 2UZIH 4AJ0A 3FMGH 4HGMA 4OZHA 2Q3ZA 4OCLC 3H42H 1IAIM 3U30C 2CLVA 3WN5A 3DX8A 4NHUA 3HRPA 3E1F1 3U48A 3DUUB 3O2DL 1KCKA 4HWBA 4W4OC 1ZLWK 3TVMD 1F3DJ 3MLWH 1PG7X 1EBAA 4FQJH 2ZOLB 2VXTH 4PIRF 1WF5A 3ARFB 4XMPL 2O5ZH 4PD4J 2WBWB 5KS9E 4PJDB 3VWKA 1FVEA 1QKZH 4M00A 4J3XA 4YHNB 4X0KA 2Z35B 2P46B 1BGXL 3D9AH 1MCLA 2OLDA 3FCTA 4TSCH 3BMVA 1DJSA 4YFDB 1AD9B 4OZGF 2EC9T 1AHWB 1OCWH 1PSKH 3RY6C 3HE7A 4ZS6C 3MCLL 3QQ3B 1K6QH 3BO8A 4WUUB 4R4FL 3JWOH 3S5LA 3BMWA 4P2QA 5GXBB 3O6FD 1S7XA 3QEGL 3SDAB 4P5TA 1A7OH 1DEEA 3V0WH 1YMHB 3HUJB 4LNRB 4I48A 5D2LE 4AQ1B 2EEAA 1YEHH 1L9NA 5CUSL 4U1GB 3C5SB 1ETZA 3QI9A 5JQ6H 1IL1A 1P7KA 1UZ8B 2PETA 4JFYA 2IH1B 3WS3A 3MV01 3WLWC 1P4LA 3T09A 2AJYH 5J3HC 4JHWH 2ED7A 3TN0C 2PTVA 2DQGL 4HWZB 4PJEA 3FO0H 3BEVA 4W81A 1ORQA 2AJUH 5JDJA 1RVFH 3QRFM 4OGYH 1J11A 5D1ZD 3EBAA 4PJDA 3ARDA 2YD2A 2HVKB 1IZJA 3VWJA 4YHNA 1SBSH 4WV1A 2Z35A 2IQAA 3GSRA 4XCEA 1MJ7H 2YD3A 1CXIA 5DMYA 3UTSB 2F54B 1B0WA 4XCCL 3GNML 5DO2C 2F53A 3QQ3A 3LZFL 3K1DA 3PWLB 1OSPL 4WUUA 1MCPH 4EI5B 4Q74A 1U8PB 2YKLL 1YNKL 4HX1B 2H1PH 5FIEA 5EOCH 4F57L 1NMCC 1Y0LA 5C0GB 3LS5H 3DSFH 2ADIA 5FM8A 3U4EA 5HYIA 4WFEE 2HJFA 3V6ZB 3DV4A 5LBSL 3H2WA 3O6KL 4DQOH 1OY3B 3GIZL 4J1UB 1E0OB 1RULL 2FL5A 5E8DH 3GBNH 2HRPL 4EN3C 2GY7B 3L3JB 2X4NB 4GAYA 4GXVL 2GTWB 3FFCB 3GHBH 5F8QC 3ME0A 12E8H 4Z95L 2B0SL 1BJ1H 4M61B 3AS0A 4UBDC 4J2XA 2VLKB 1MNUL 3LQZB 2BC4B 2ICWI 2O61A 1MCHA 3UC0H 2DTMH 2OJZL 4OM1L 3MOQA 4UU9A 3N06B 3VFMA 2VC2L 4DZ8B 2CH8A 1FNHA 2DQJL 5E5UB 4AEHL 4MS8D 1VFOA 2N56A 1QRNA 4D8PB 4L4TD 1Z5LB 5CINL 3MUHL 1UWGL 3O2VL 3FN0H 3C9NB 5IWLC 4LSQH 4EBQL 3WFHB 4M7LL 3A0OA 5T1DH 3TZVB 2JK5B 1N3NB 3QIBB 1ZHLA 4NZUL 2AXGB 2R2EA 4U0RB 1PG7W 1XGQA 2P5WA 5FGCB 4K8RC 1KACB 5FKPA 1XCTB 5IB5A 3EDEA 1RZ8A 3I02B 1RIHH 4ONGH 1XCQB 3T1WA 3R06A 3WJJA 4CVXB 5SWZB 4CN6A 3EZ8A 4RFOL 2GTWA 4QOKE 5JOPE 3FFCA 4YHPA 1IGJB 1CGSL 3O6ML 4M61A 5DD1L 1I7TA 3NPSB 2NNAB 1BQHA 2IPKB 4XI5D 1CDJA 3MLXH 1S5HB 3OXSB 2OZ4A 4ZTPL 1CXKA 4L4VB 2C26A 1QR1A 3TV3H 3VGGA 4P2RB 4ELKA 3VGAB 4NFCA 5EWIL 3MV8E 4DZ8A 3PGDB 1GGBH 1P1ZB 3KGRA 1UVQB 4Y16C 2FATH 5SV3A 3H9YA 5TH2A 3IFPB 1N59B 3SOBH 4O4YL 2E3VA 4G6FB 5EU5B 2YRPA 3VFGL 1DBBH 3IF1B 4ORGB 3MRMA 2D9CA 3G08B 2RHEA 1S7VB 3SGEH 4CVWA 5IIEB 5HYQB 4E0RB 4QTIH 5DJ2B 1OW0C 4LKCB 4C56B 1IEAB 4AEEA 1FBIH 3T2NH 4NO5B 2YXFA 3QISA 2AXGA 1QBML 3X3FH 3VFRA 1REIA 3MZTA 2YWZA 1EUTA 3KXFA 3ARBC 1XCTA 1TCRB 2FECL 4JRXE 3MSPA 3W9DA 4KHTL 2QKIB 2QQLL 3I2CL 3UTOA 2Z31C 5FUCE 1MJ8H 4Q58C 1ZA6A 5DJXB 1IQDB 1AKJA 3NBNA 1NDGB 4NYLB 3TJHD 5C0JB 1WV7T 2HN7B 2RFXA 2IPKA 1EDQA 1C16B 4OD3L 2X05A 2LFGA 1I3GL 3RTQD 3UAJD 5DRXB 3WUWA 1RURL 4QXTB 3O4LA 4P2RA 5EO1A 2J8HA 5I66B 1W72B 4NT6A 1U92A 4HIHB 1P1ZA 5D9SB 5TE7L 2DJ4A 3E6HA 3DTXB 4OLWL 1K8DB 2DBLH 3MV9B 1OGAA 3KS0H 2EDEA 2HFFA 2V9RA 3AC0A 1CXHA 5E0QA 5EU5A 3BXNA 2O26U 1BFVH 4ORGA 2XTJB 2NY0D 4S1RL 3NABH 4ZO8A 1S7VA 4Z18A 4YWGH 5E6IC 5HYQA 1AJ7L 1H3WM 1IM3B 4OLEA 1G7JA 4C4KO 1A7NH 3WL9A 1IC1A 4CJ1A 2APTA 5EU6B 5D5MF 3EJYD 3DURB 3TBYA 4M5YH 5FA3B 2MTPA 1LO2L 1FHGA 3VXSE 4YAQB 4PUBL 4WFGD 5TDPB 1TCRA 5DZLA 2AJZB 1JBJA 1HHKA 1PYWB 2IAMB 2PW2B 5E2VL 2Z91A 2XOTA 4B50A 2UY7A 4FQ2L 4DEPC 5EFIB 1WTGT 1FVDB 5DJXA 1HCVA 2F19L 2X4TA 1KN4H 1IQDA 3TFKD 4OQTA 4PRNB 4MJID 3EZJB 2JELL 4FXLA 3LRSB 5DD5H 4NYLA 4PJ5E 5HJ3A 2HN7A 3R1GH 5C9JB 3TA3D 1ZVSA 5LGJB 1N2RA 3DX6A 2J8UE 1U8OB 1IC5H 2FJGB 4LLDA 5KZCB 4TVPL 2ITDA 1NGYB 3AAZB 2ZCKL 3E2HC 5E99L 5KG9A 4N0CC 3SE8L 4DOHB 5D7IF 4PJBF 5IBTL 3W11D 3S88L 1K8DA 4WI2A 4Y4HA 1HHJA 5HVHB 4G43B 5EZIH 2HG5B 1DUZB 2D7QA 3P4OA 3HZKA 3MV8A 1XZ0B 1IM3A 5C0EB 4G8GA 1W72L 5EU6A 4Z8FL 3HE6A 2X89A 2V2XA 1RUKL 5MHSD 1CICB 3KLAA 2P8LB 4KK5D 1K4CB 1C5DB 1FFNB 2CGRL 4GW5A 3K1KC 1MWAB 4QRRE 4ONHB 1PYWA 2IAMA 4NN6B 1GZQA 1UH4A 1JWSA 4QT5A 1FLRH 5EFIA 4LHUA 4C59B 5LXGH 3EJJX 5E5MB 4JQIL 3PV6A 3W81A 3B4NA 5C9JA 2DJSA 4KROD 4XPTL 4Y2OA 4XNZC 4PJ7B 2WWKT 3M1BB 2D7OA 1RV6X 3UJTH 3SE9L 3EJZD 4PB9H 1NGYA 5FYKD 4POZC 1N26A 1ZHBB 2BY1A 4JFQB 3WIIL 4XPFL 3B2UC 4JVWA 5JDSB 5IMLA 4G43A 1EH9A 2VWEE 1WT5C 4XB7A 4N0FA 4CAGA 5E7BA 4F15C 1UEYA 2FX9L 4PJCB 5HHXL 4ZUUB 3S35L 2C1PB 4UINL 3LEVH 3BPNC 3LKSB 4U1HB 2FJHA 5C0EA 5CJQL 4MXQC 4JO3H 4Z7UF 3P4MA 2APWA 4S10A 3FN9A 3AGVA 1C5DA 7FABL 1Q94A 1LWRA 1FFNA 4I3RH 4ZO6A 1CT8B 1MWAA 3QUYB 1KV3A 5IVZB 4ONFH 4XNUL 1I8KA 4HC1A 4XWOD 3OJDB 3ILQC 4KKNA 1CLZH 1KN2L 4L29A 1U3ZA 1ZK9A 1NAMA 1YMMA 1JTOA 3GHEL 1G6RB 1IT9L 1PBYA 2BSED 5L88L 4GG6F 4AIZA 2D7MA 4R96A 2OP4L 4OZ4A 4ODHL 4PJ7A 4YO0B 2HP4A 3M1BA 5IMKA 3QXAB 1F4YL 1QNZH 4HXAH 1KB5A 2DDQL 3MPCA 1IGFL 1M05A 4J3TA 1OB1A 1BJ8A 2MQ3A 4R4BB 5JDSA 1HXYB 4WU7A 4HCRH 3G6AB 3ZDYF 2J8UA 2MPAL 5MEOA 5F7UA 5E4EC 1A7PH 3IAPA 2DQDH 3K80A 5AYQA 1DL7H 5LG1A 3UBXG 2NTFA 2BJMH 1CLYL 4ZUUA 5GZND 2AK1L 2C1PA 4YC2C 4P5KB 3LKQB 2X4QB 2X9YA 3LKSA 3U1SL 3A6BH 3PL6B 4APQC 4LARH 1OP5K 3ULVL 1JRHH 2RAMA 3RWFA 1KC5H 1A3RL 5C0AE 5JXEC 4PYHA 3VGHA 5I1LB 1RPQA 1U2HA 5IR1B 2F9BT 1YUHA 2VXVH 1INEL 4XVUC 3V52L 1A1MB 5DHVH 4WUKL 4X9HA 1BD2B 4KKCC 2QSCH 2DLFH 4HW6A 4MDJB 1H9VA 1R3KB 3P40A 5KSBE 3BYTA 4Q9QH 5K9JL 2G2RB 2GY5A 1XF2B 5CIPB 1QFUL 2Y6SD 4WW2B 1KTKE 3TBTB 2ZP0T 2YEZA 3NTCH 4ZPTB 1S8DB 3WSQL 4LDLB 2E7BA 4FNLL 4DGYH 3PP3H 1CIUA 4LEXH 4KK9C 4Q9RH 4V1DA 3VMPA 3I75A 4R4BA 1CDHA 5GGTL 1HDMA 1ZHKB 4D3CL 1G6RL 3K74B 2IWGA 3MACL 4YEFA 5C2BL 3HAEA 4JFDA 4KVCL 4ZOBA 1DDHB 2X4OA 1Q9LB 2EDKA 5T3ZD 4M7JH 3C60D 4PG2A 2XWJA 4YGVB 4JN2A 2YBRA 1K3IA 3D0LB 1NJ9B 1QFWH 2BVOB 2SEBA 1PG7L 3PL6A 4FMKA 1A6VL 4XAWH 1IJ9A 4WGVB 3FAWA 3UXFA 1BVKB 3N1QC 4MLIA 4LSDA 4NSKA 3ZDXE 2C3VB 2P1YA 3C2AH 2NXYB 3QDJB 1A1MA 3TIDA 3S37X 4G9FB 4RFEB 3GMOB 4M7ZC 3EUUA 4FZ8H 4LVNC 1D5ZB 1FIEA 3AUVA 3U2SA 2XWTB 4D0CA 4DTGL 4JFOA 4MCZB 4HBCH 2BNQB 3DVGA 4MNGE 1BFOB 1XF2A 1QPXA 1YJDH 4YK4C 5EULV 5C0BB 5C0RH 2NYYD 1UJ3B 4XP1L 4XAKE 3THMH 1WBYA 5C08E 2PN5A 5HHMB 3R8QA 4ZPTA 4MYWB 1LEKA 4F58H 3N85H 4YUEH 4I2XB 3BYYA 4J3SA 3O3UN 1UC6A 5FHAH 3ZMRA 1IMHC 2AJSH 3B9AA 1BP3B 3DBXB 1Q9LA 4ERSH 1M7XA 1FVCA 1GAFH 1D7FA 4HH9B 2I60H 2KQNA 5FYLE 3PG2A 3ZYZA 1TJIH 1NC4A 1LD9A 3QA3B 3QDGA 5JPMB 4JZJC 5F88A 1U8NB 4NPYB 4OAWB 5CAYB 4K7PH 4QXUH 3IFLH 1QSFA 3KPSB 3WHXA 4LLUA 5HYJE 1BWWA 1FGVH 1I9IH 1PQZB 4LIQL 4OLXL 3WS6C 3FB8B 4O00A 4XC3L 1NL0L 1KPRB 1FNSL 3CC5A 3P0VL 4ZAKB 1KFAH 1PVHA 4MCZA 1JGLL 3QCVL 2AV7B 4JY4B 3T0AA 1BFOA 3WFZA 2V17L 1KCVH 4KMLB 5DUMH 4LVHB 1H5BA 1IBGH 2HFEA 2VTFA 4M5ZL 4ZUSB 3PNWB 3C6LD 5DQ9B 5FO8B 2NY1B 1LO0H 2V2WA 3SGJA 3UTTB 5DJYB 1DQDL 1EV2E 2ZJSL 5C07D 1P9MA 3IJYB 4Y4KD 3ESUF 4U6XA 5ENWA 3MRKB 5KSVB 4QYOA 5DFVD 3RKPA 3E8UH 4ZNCD 1KUMA 5IVNA 5I30L 4ZXBC 3QNYB 4RRPG 3DO3A 5JIKA 5AG8A 4HQQH 2AS5M 1GPOH 1UA6H 5F9OL 4OGAD 3X14B 3MROB 3WN5C 2MJWA 2QHRL 4PJFF 3TCLA 3UO1H 3GSNB 3ZDZF 4JPWL 5C09E 1J1OL 3QA3A 5JPMA 2R0WH 1U8NA 3VI3E 4JM2D 4L8SB 4NPYA 3QIWA 4RGOH 4OF6A 3OGOE 4PV9B 2Q8AH 3H7LA 4S1DC 3VRLF 2FB4L 3VWKC 1JV5A 1A9EB 4NUGL 4LCYA 3MODL 2AEIT 3OKOB 3ZKXC 1KPRA 1S7RB 3QT2A 4YBQC 5TE4H 1NCNA 4U05A 4Z5RB 1YECL 3H0TA 1T7ZA 1OAZH 2D0HA 4ZS7H 1OSZB 2G75A 3SDCB 4PTUB 5KVGL 5HHOD 3HE7C 5I74B 5SWSB 5IT2L 3RWJA 4RNRA 1G7PA 1NGPL 3BP5B 4X6BB 2DKSA 3PNWA 3QO0B 4P5TC 4G7YL 2GITB 2UWEF 4KMTL 3Q5TA 3IJYA 4NRZB 2HT2C 1I3VA 3QI9C 5C08A 3SPVB 1NUNB 5KVMC 1IAKB 4EI6B 4Y7MA 4WY7L 3WIFA 4X9GA 1WITA 3QNYA 3HG1B 4HKJA 5GQBA 3U7WL 3U0PA 1PX4A 5GHWH 3X14A 3FQXA 1IGYA 2VLLB 3MROA 1FGNL 4N90E 4YPJA 3GSNA 5I0ZA 4AH2B 2KBGA 5BV7C 2BRRH 5DA4A 4NZRH 4ZOAA 5JW4N 2ZCLH 1S7WA 4X6EB 3RWDB 3HB3C 2NMSA 1V3MA 3CMOL 1QLEL 3ARFC 4JKMA 4RISH 5D71H 3RL1B 5H2BB 2GI7A 1O7VA 3ARDC 4AYFA 1A9EA 3MRBA 3MJ9L 3VWJC 5E24E 1S5IL 1L7IH 1JTPA 4YHZH 1S78D 4G9DA 4FXKB 5GSVA 4WWKB 1JNNH 1UACL 4Z0BL 4D9LH 1NC2B 1AC6A 3NACH 1GH7A 1AR2A 4JM4H 4R90H 2VE6B 1MCBA 3SDCA 2ZCHL 3P9LA 5HYJA 4PTUA 5SWSA 5IMMA 3ZKQD 1MFDH 1OM3H 1MHCA 2XQYG 4BH7B 4GO6B 1I8LA 1JP5A 2HAZA 3BP5A 1X5JA 3K2UL 3QO0A 4P0DA 3EO9L 4PREA 4OKDA 2GITA 3MRFB 4YDIH 4PGEB 4E41E 4U1GC 5IG7B 3RI5F 5JQHC 4NBXB 2DMKA 5IQ9A 3BKYL 3KHOA 2IBZX 2ZKHH 1E6JH 3MRGA 5ANME 3U0TB 1CL7I 1QSEE 3HG1A 3RAJH 5GGQH 4H1LA 5CZVH 4JPVH 3TBVB 2VLLA 3REWB 3RL2B 5M7QA 3UJJH 4AH2A 1SEBB 4HXBL 1T7XA 2GJ6D 2A9NL 5D6CB 3TCXA 4NZTL 1U6AH 4KJYB 1IFHL 1J05A 3MRNA 4DGIH 5F6IC 4GSDH 2FX8L 4K07A 5GRXG 1JGDB 1Z0MA 4EXKA 2QR0B 2XN9D 5KN5B 3NFNB 5DC4B 1TENA 3VXTA 1JHLL 4WI9A 4WWKA 4P4KB 1CXFA 2XNAB 2VE6A 1JYXA 2BOBB 4Q97A 2X4UB 4Z7WE 4M9PA 4QHMA 4HK0B 4R7DA 3MO1B 2F58H 2FD6H 4DUWA 3LMJH 5FFLA 3ET9F 5T1KD 3FQWB 2VABA 1VADB 1NAKL 4K3EH 3UPAA 3FQNA 4PGEA 1WZ1H 4TTDD 5IG7A 5JOFB 1JWUB 1BEYH 3WO4B 5CILL 3U0TA 5GS3A 1TXKA 2LE9A 5C7XH 4FP8L 2AK4E 1WFNA 4ZYKA 4Y4FA 4RAVA 5I1IH 2VAAA 3RUGE 2LQRA 3HC4L 3TBVA 1UKSA 4XMKH 3REWA 3RL2A 3D18B 3WHE1 4R3SB 1KEGL 2P5EA 3NZHH 4NWTL 5MEND 4M48H 3FMGL 3WJJC 3TPUA 5J1AB 5D6CA 4Z7NE 4KJYA 1NMBH 3UJIL 5JIPA 4LCUA 1NC2D 4F2MB 1BECA 2WM0A 3DYPA 4FQJL 1ZANH 5KN5A 4K23H 2GJJA 3EFDL 1ZSDB 2OS7A 3GI9H 2VN7A 5DK3A 4LDOB 4P4KA 2PTUA 2AI0H 4NJAH 1QKZL 2XNAA 4I3GA 4HK0A 3BP4A 3D9AL 3MO1A 2X7LA 1AQKH 3HC0B 1M7DA 4NP4H 4N0YL 3L5IA 2XZQL 3CLFH 1OCWL 1PSKL 1KLUA 1K6QL 1B0GB 3JVGC 3JWOL 1N0XH 2BNRB 3TZVC 2R2HA 5B38G 3QIBC 1RJLA 4U0RC 3LN4B 3V0WL 1CFSB 1YEHL 3SDXF 5JQ6L 1Q9WB 1JF1B 1NBZB 1PJ9A 4BZYA 4OZGB 2LAAA 2YXMA 4PG9B 4KKLD 4R3SA 3RU8H 1D9KB 5I73B 3BZ4B 5C0NC 5ANMA 5E7FA 5J1AA 3UMTA 3QO1B 5D1XB 3G6DH 3IDJB 2AJYL 2J4WH 3HA0A 4JHWL 3WFEH 1XIWB 3QEQB 5I8CB 3TO4D 2YRLA 3H9SB 4ETQA 3T3PF 3BDXA 3OF6D 5C3TA 4PP2B 3WIHH 3FO0L 3VFSA 3DETC 4UOW0 2GK2A 5F1NB 1ZSDA 3QFDA 4FFWC 2AJUL 1RVFL 2XG5A 4OGYL 1FLTX 5IKCA 3QPXH 4OSUH 1SBSL 3GSXA 4B0MM 1N4XL 3QUMA 1MJ7L 1VGEH 1FNAA 4PRDA 5AZEH 3IU4L 1FYTD 3EFFB 4JB9H 4J6RL 4YFLI 5BVJB 3QWOB 5GJTH