3QZNA

Staphylococcus aureus isda neat domain y166a variant in complex with heme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
b'ATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINANHRYTTHLEFEKAIPTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein A
publication title Iron-Coordinating Tyrosine Is a Key Determinant of NEAT Domain Heme Transfer.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal binding protein
total genus 26
structure length 121
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qznA00
3SZKC 4MYPA 2ITEA 3S48A 3SZ6A 2K78A 2ITFA 2MOQA 5D1XE 3QZNA 4H8PA 2Q7AA 5D1ZI 2O6PA 2E7DA 3VUAA 4FC3E 2Z6FA 3QUGA 3OVUB 3QZOA 3QZPA 3SIKA 4H8QA 2H3KA 3RURA 4WJG3 3QZMA 2O1AA 3RTLA 3VTMA 4YMPA 3QUHA 4NLAA 5D1QE 3QZLA
chains in the Genus database with same CATH superfamily
1YYLH 5FYKD 5BMFH 1I31A 4GH7B 4PUBL 1ND0A 1CDGA 4GY4A 1AO7D 4PRAA 1NC2D 3QZNA 1E4WH 1I53A 4FOMA 5D7KD 5T1KD 4ZW5A 4WO4C 2Y5EA 4DH2A 4WI0B 1HQ4B 3CSGA 3SDAD 5CIPH 1D5XA 3NH7L 4ERSH 1UFUA 1WIUA 3ARED 2YARA 1NKOA 1H6EA 3T6VA 2DTSA 4AITA 2HRLA 4FGMA 3L9BA 4OV5B 1QLRB 3VFNA 3FB5A 4ZOCA 4KVCH 2R0LL 2V7HA 5HGAA 1KV7A 1QSED 3ZHNA 3VD0A 3ARBB 1YYCA 4I3RL 3FDWA 3QHZH 3HBPA 1GSMA 4FX5A 4MDIB 2DMBA 2CUHA 2VDRL 2ESVA 3GSNL 5EC1A 4LLWA 5IVNA 3GSWA 4PQXA 4S10A 1WP6A 4HISA 3IFOA 4YHOH 3CFDA 4ECNA 2VAAA 1X44A 5CLTA 1LNUB 2A4ZA 4K7PL 2VUYA 3UC2A 1FV1A 1JZFA 4NHCH 5ALBL 3GRWA 4JM4H 1WE5A 3JV5A 5DEGA 1SVBA 2OKMA 4KKAD 1IGFL 4FFYA 4ZMPA 4JPSA 4HC1L 2ED8A 1WGVA 4LSRL 3CU1A 4Y1AA 5J3HD 3RYMA 4JMXA 1X5GA 1KNOB 4NWUL 3Q1EA 4PY8I 4IRZH 2DEWX 4BH8B 1JHTB 4OCYL 3RUGA 2PYEE 1QVOB 4N3TA 2HWZH 4C55A 2MH4A 4P4KA 1XMEB 1KENH 1F58H 1RLBA 3EH2A 5JMRA 1BVLB 4WV1C 5CUSL 2HA1A 4GAYA 2P44B 4PLKC 4BQBA 2AJVL 3LEVL 4ZG1A 1ZEAH 3BEWA 1JZGA 3Q0HA 3N9GH 1HZHH 1OAYH 4FNTA 4R7DB 3TJHC 1AI1L 4UDUB 4TL5A 2FGZA 4F7TB 5KYWA 4ZPVB 1S3RA 4HV8B 1OGAB 2R7EB 2H26A 3GK8L 3NK3A 4C57C 2OSXA 3MYJB 2X0VA 2A77L 1KC5H 1ZV5A 3L3HA 1MW3A 2Z35A 3AGWA 5DDHA 4M6AA 3NP4A 2IH9A 4XBGB 3BN3B 3EYSL 4I4WB 1R1CA 1XWVA 2AK1L 3QJQB 1JHKH 5HGGS 2EVJA 4UDTB 4UV7L 3QNFA 2CCLA 4XN2A 1CLOH 2WM0A 3K5SA 1ET7A 2MHAA 4XMXA 1CFSB 1GAFH 4MLIA 1I1AC 4LLUA 4XHJC 4ELKA 5L0QB 3EYVB 2XWCA 2W9DH 3ZDWA 3LSOA 2Y7LA 4LCCA 4OCLC 3T3MB 5HYFA 1YEHL 2BIQA 2FE0A 3HRZC 3HS0B 4PJGE 5FOBA 3ZU8A 4RIRA 4GB9A 1KTDA 1W16A 4HP5A 5D2NB 5IJKA 5EBGA 2EVHA 1FLTX 3QQ9D 4G7VH 3KPPA 1W0YT 4PCSA 2DV6A 1BLNB 3RWEA 5K93A 1JNLL 1YEJH 1OAKH 2X4NA 4JFZH 2ADGA 4LLVA 3V9FA 4AGMA 4TOYH 3RZCA 5I1IL 1FHNA 4ZPTB 3WLWD 2ZYHA 3S88H 1ORQA 3SGDH 1M7IB 1S4IA 5LNEA 1UWYA 3MNWB 2E0PA 2RR3A 4NQDB 3DX4A 3EJSA 1ZRUA 3UZEC 4NJAL 1DCLA 2N1TE 2NOYA 1YMHB 4OJYA 2IH3B 4CVZA 1HU8A 5KJ7E 5KYNA 4NN6C 1RKRA 1MLCA 4BZ2L 2E46A 2I5YL 2F8VA 3K71B 4LU5H 5JORB 2WBJD 2XWTA 1KGCD 1QZNA 4NO2A 2ZAHA 3RWHB 3T4AB 1A4AA 3H2WA 4KHTH 3UROR 1DFXA 4PIRF 4LSQH 1TETL 3MACH 2BS8A 3VVWA 1G9MC 3DX6A 3D2TA 2VLLA 5IV2A 5AOMA 3RX8A 4ZOAA 4QT5A 3PPSA 5C0BE 4JQIH 2PO6D 3M8OL 2FBOJ 4X9GA 3LXUX 2LAAA 1FL3B 5D1QE 4CNIB 3QDMD 1S7VA 1UM6H 2Y7MA 4P5KA 3TGXA 1P4BL 1W72L 4P3DB 5T1JA 1KF9B 2NX5B 4OY9A 5EIIA 1HWHB 3K2UH 5ALCH 4XAKD 4HCGA 4MA3A 1RD6A 2ED6A 4C4KT 5JW4Q 4Y4KD 5IMMA 3L4VA 4K9EL 4J1UB 4NXSA 1JI2A 1O7SA 4AE1A 4CMHC 4BKSC 1T21A 1M6UA 1KG0B 1RULL 2H9GB 4RFEA 3A47A 3AS2A 4OGAD 5DK2A 2HRPH 2PABA 3ZT6A 1I8AA 2XRAL 4YXLH 2FEEI 3R4DA 4G3YL 1EAOA 4J3OD 2I24N 5DVOA 3P3RA 5IWLA 4ZTPL 3ZZLA 2NT1A 4NAQA 5DHMC 2XY1A 3BDXA 4NN5C 2HFTA 1J10A 4PGCA 3FQRA 1UZ6E 4XMKL 4Z7UE 5J6GB 1X5KA 1ACYL 4HSAC 5LDSA 2MCPH 3ARFA 1QWHA 4UQEA 1XCQB 5DJCB 2LQRA 3HZYB 1A4KB 1NLBL 4HJ0D 4EBQL 3CLFL 4AL8L 4X4MA 1X5AA 1CGSL 2EXSA 5DRZA 5HHMD 2AABL 1VACA 3B7YA 2JTYA 4IRSC 4GT7A 1SXCA 1CFBA 1ZA6A 3VXSA 3WLBB 3WY2A 3EGSA 2Q3AA 1LWRA 1CR9L 1OTSC 1TZIB 2WV3A 3MRFA 1F56A 1UXWB 3QXTA 4KC3B 3DO7A 3HAEG 4FKEA 1C8PA 4HIXL 3P9MA 1Z9SB 4YZWA 3VFSA 2SEBA 4H7VA 3ARGD 2A6JA 1IO4C 3D06A 1SOQA 2Y0SA 1GZHC 3LH8A 4UOJA 4YEFA 2VJXA 1H0DB 3VXQB 3SDDA 3UPRB 4DFHA 3SE6A 2AXFA 2PTTA 4MJHA 4GW5B 3G08A 5EBMB 2FZ3A 3S2AA 3ULUE 2DM7A 3F7QA 3GHEL 5G5DA 4BELD 3QJXA 5L6YH 1VFOA 3KJ4C 4YDVA 2IGFL 5C07D 4DAGL 5F3HB 3GRGA 1OP5H 5IQ7H 3Q6FB 4S1DC 1AXTH 4OIAA 5I8CA 4TQIA 2Q7AA 3VDBA 3KEDA 5TE4L 1OGAE 4H40A 1J8KA 3MRPB 1XSIA 2BP0B 4J6IA 2OCFD 1X5IA 4K3EH 1GCYA 5JQHC 5FUOL 4YHYC 3QCUL 3OR7A 3CVIL 1ADWA 3ZTJG 2DH2A 4FFVC 1FO0H 1BBJA 4ZI8A 1FNFA 3U0TA 2BVYA 1L9OA 2AMUA 3QEUB 4M7LT 3WFBH 1CDYA 4U1JA 1KJ3L 3D51A 3LKOA 4FFZA 2QADB 5E4EC 3ZHFA 2GKIA 2HT4C 2YLKA 1K4CB 3K7UA 5H35A 1L7IH 5FF6B 3T3ME 4EAEA 4G8EB 5C0NC 5LAPA 1RUKL 4NCDA 2Y6TE 4OIIL 5D2NE 1UOWA 5BUGA 4GRLB 4PTTA 3GD1C 3OGOE 4RRPG 4KZ0A 2UUDH 4B3EA 4JFXB 1MCKA 1F1AA 2R1YA 3HI1A 4ATWA 1DLFL 3OV6A 3Q5TA 4BXVA 2AEIT 2H1PL 4DK5A 4JFEE 3TCXA 5I5MA 4NQDE 3BZFB 3SHSA 3HIZA 1FIEA 1N5YL 5IVXA 2VKWA 4PS4L 5FB8A 1DVSA 3CFMA 4PV8A 2OI9B 1QSFD 3MODH 2IFGA 4GUOA 4XPGL 4X4YA 7CGTA 1GHFL 5E94B 5AUMA 2Q2EB 4A04A 4Z7NF 3NSCA 3UGXA 4CKVX 5IB3B 2D3VA 7PCYA 3ZR6A 3GHBH 3QFJB 5IB4B 2BOCA 2B5IC 4AJWA 3O8XC 1R24A 5FGRA 4KMTH 2QEJA 5HDOA 1G87A 5AW6B 3Q5YA 4UILL 2QKSA 2YGVA 2D9CA 4H8PA 5E9DA 4PB0L 4PFEA 4LSUL 1Q94B 1TPXB 5CSBA 2EEFA 3ULAB 1N59B 3MRKA 5DJ0B 3CC5A 3DHUA 4Z95H 4XVJL 1KACB 2IWKA 2R56H 1S5IL 3FT3A 2NTSP 2DM4A 3QWOB 2WNGA 3T3PF 1UXSB 1KBVA 2NX5E 1P1ZA 3C2SA 1Q4NX 3SQOH 4NOFA 3V0VA 4ZBJA 2CA4A 3MLVL 2WWNA 2X9XA 4MA7H 3ESUF 2Z93B 5C0CB 1P7KB 1ZJAA 4MMYB 5BVJB 2AKRA 3WEOA 3S48A 1QBLH 4A37A 3K4ZA 2FR4B 4KJWD 1JK8B 1JK9A 1MJJB 4QAMB 3PAVA 1CTMA 1FUNA 4FLSA 5HJDA 2HG5A 3HZMA 4J3XA 2ARJA 4MHHG 1IEHA 2ROYA 4NQSA 1WBYA 4X6EA 5HJGA 1OEZW 2BO0A 3MC0A 3VB9A 3NSYA 2PWEA 4AV4A 1V27A 2OP4H 4PWEA 3WMQA 3BYYA 1PG7X 4PWKA 2Y2TA 3ECVA 3Q06A 1IL1B 1UB6A 5DT1L 1T1XA 1G0DA 3IXTB 4LLYA 4N90E 3EH4B 2VGLM 2Y5TB 4GAFB 4XNMB 3SYPA 3N91A 3NJFA 2UZYB 1OGSA 5LWYH 5EEYA 1DJGA 5A2BA 3WJLA 3B3BA 3ROLB 2DS4A 5DFVD 4Y16A 4NBZB 4C56A 4JHWH 1X7QA 4DEPC 1ZHKA 4YDLC 1LO5B 1H15B 1KJ2H 3D05A 3MRBB 4GPVA 4XB7A 2FX7L 4ESKA 1EGJL 3BFQG 4TSBL 3VYPA 5C0IB 2RACA 3M1BB 1TQCC 4NUJB 1MHPH 3GJFH 3LYRA 1CU4L 5I8EA 3PF2A 4GIPD 3TNNA 1EHKB 2Z64C 4LLQB 4QXVA 4XN8A 4AEHL 5BJTA 2ZWLT 3ARBD 1P69B 5DFAA 1RZPA 4GXVH 5T3XH 1N67A 3BPOC 4M1DH 4O2CB 5DC9B 5KAQF 5CNHA 4O9HL 3LX9A 1LMIA 5I6PA 2BSDA 1ETB1 5B8CB 4PJAF 3C5ZB 3IDMB 2R2HB 1AQKL 3QUZC 1MJUL 1EEZB 1SY6L 1MFVA 5ITBL 4TUOB 3H7BA 4JO5A 4JFVA 4HSCX 5EDXA 5EF1A 5ESQA 1A9EB 4XNBA 3A21A 1RIUH 4PTUB 1UWGL 2CGRL 3WS3A 5KSAB 4MD4A 4B60A 2BDNL 4OQTH 1E3XA 2YAMA 2J1WA 2V8LA 2YSSA 3SPCA 4Z3TA 2HG0A 2MCG1 3GXMA 3D5OF 1GGYA 3QXAB 1E43A 5DMKA 4IBSA 1T1WA 5DRWB 2VMEA 2AZUA 3E7JA 3BSHA 1OOWA 4JFUA 5GXBB 1N64L 5B21A 4HS3A 4GOSA 1Q0XL 4MZ3A 1HHIA 2PXYA 4ELMF 5JR1H 1S7RB 2DIBA 3T09A 1DUZB 1RHHB 2DW5A 5AAWC 3BGMB 2ZTBA 2ZUXA 1O9WA 2D4FA 4RGMC 5HHPA 3GTVA 5D7IA 2UXGA 3NOIA 7TAAA 1GC1H 4I0PA 1CXLA 4CDGC 3QDJA 3UYRH 2XQYA 4RWYH 1DVTA 3MI6A 2FL5B 3MRMA 1RZ7H 5JA8B 1U36A 1MCCA 3TL5A 1SJXA 2DQUL 2H3XC 1IM3B 3VXOA 4P59L 5AAPA 4GJTB 3X1GA 4U1MA 4PP2A 4BHUI 4GG6F 3K2KA 3L3GA 4KKCD 1IM9A 2JNZA 4DIXA 4QRSA 2DQFB 1BYOA 3OL2A 5ANHA 4LEXH 4CAGA 3T65A 3HVDA 5H4ZA 2F8XC 2F2HA 2J1YA 3VGDA 4XP9L 1BXAA 1U92A 2NQ3A 1IBZA 3QFJE 4MMZC 2VZSA 4ZTEA 4D0CB 4QO1B 1TG8A 1AKJA 3JUZA 3N1GC 1NCIA 1OF2B 5F96H 2EYTB 1EV2E 5D8JL 4XNUL 4I2XB 1MVYA 3FJTA 3NK4A 1NIEA 2P3YA 4JZNB 2NCMA 4UT6L 1ZTXH 5KAQG 2VLKD 4CJ1A 4ZX6A 1FAIL 4CSZA 4TTDC 1ZHLB 2O1AA 3DX8A 4KPHH 1J7VR 1IAMA 5MHSE 1AE6L 2E4FA 3OWEA 1GY1A 3TBBA 4DUVA 2P8PA 3BE1H 3FT2B 1SQMA 3EJPA 2VE6A 5DD1H 3V95A 2WNKA 3WTXA 1VPOH 5DVNA 4BSJA 1FVDA 1TTCA 3PL6B 1DBJH 4JRFA 3FU7A 3ZL4H 2WKOF 1N12A 3O3BB 1QEWA 3FN9A 5DJ6A 5C0CE 4K71B 5GISH 4OR1A 1OCZB 4D0DA 3GKWL 4E68A 5JPNB 1BF8A 2R1XA 4TRPH 3JTBA 5D6DC 5HD8C 2V2XB 4AYFB 3DIFB 2WGNB 5I17A 1DBAH 4KNQA 4X5WA 1KWGA 3RJDA 3CK0H 1FNGA 3FO9A 2OS7A 3WNMA 1L9MA 1CPUA 4PYHA 5T5FH 3HE6C 4LHUG 5JOPE 4UIKL 5AW4B 2NX5D 3MOAH 1ET5A 3NFNB 1CTNA 2E27H 4F8LA 2G30A 1A6AA 3GMMB 1E2WA 2A73B 3L5WA 1GTFA 2P47B 3LCYA 2EH7H 3OD3A 3ARDC 3QFDA 5I82A 5TDOA 4M43H 3WUZA 3U6RB 1RZKH 4P2OA 1KWKA 5DO2D 5I1JH 3RURA 1F3JA 1D9KC 3DX9B 4CMMB 3G3LA 2GUYA 3LQAL 4FQ2H 1ROWA 4JNXA 2R0ZL 1XH0A 1Z3GL 1ZHBB 2E9BA 4JM0A 4NO3A 4X8XA 4ZOBA 4F33B 1N9PA 5MEOB 4YHKL 4FXKC 1KXTA 3D2UB 1WFJA 4U6TA 4YE4H 1NFIA 4PRDA 4I9WD 1KIUB 1XIWA 4NX0A 1KIQB 2EXTA 1D5MA 1KLFB 4JKLA 1QA9B 3HZVA 4N90D 3WIFA 5GZOC 3C5SB 4BDVA 1OTTC 4WCYL 3M1OA 5T33L 5AB0A 2JJSA 3N40P 2F9BT 3ULVH 4YDNA 1CG9A 2BRRL 3FF7A 1GVIA 4RAHA 1TNMA 1C5BH 2VN3A 3B2VL 2HMIC 2FT6A 4LHJB 3DGCR 3LD8B 4NZTH 1KIRA 2E8ZA 3I9AA 1UUSA 1MRFH 3QQ3B 1YN6A 4L37B 5EU6B 1DO6A 2JELH 5CFAA 4JPKH 3ZHDA 4AVHA 4OJDH 2RQEA 5C0JB 1ZHNB 3I75A 3HR5A 5KVDE 3FSOA 3BT2H 4PJIA 1S2EA 3DA0A 3KLAB 2CIKB 4Z7NB 4F8NA 5AWNL 2OJZL 4TNWK 4X8JA 2A74B 4HDIB 1UATA 1BHGA 5DHEA 4OFYD 3B6SA 3NJIA 4X80L 1ERNA 5MERA 1TMQA 3TV3L 4GUQA 3T0AA 4IOSD 4PUBH 4KGLA 3BZEA 2DYPB 2CJTA 2Q10A 1SXAA 2YD3A 1JGUH 3TO4C 5C3LD 3O3AA 2VDOB 5BO1L 3NEEA 3WNJA 4I18A 3OQRA 2YD6A 3MBEB 4FABL 1TJIL 2VISB 1UCTA 3I6LE 2ZCKL 2DAVA 4I77H 3T3PB 5KBDA 3TF4A 5K9QG 1JXFA 4QAWA 3QISA 2R0LH 5I6XC 3LEYL 2UY7B 4DNLA 3TBSA 2FIKB 4JX0A 1NMBL 4LARH 2FTAA 4Z7WA 3FNKA 4B6ZA 1OM9A 4I3RH 4HIIB 4BM7A 1W15A 2NLJA 3KPOA 4ADJA 4O5LL 6PAZA 2A3TA 4ZUSA 3GSNH 2QADD 2Z8VC 3O11A 5DJDA 4Z0XB 5C9JA 1AY1H 2QSCH 4POZD 5AZUA 4X98A 3VWKD 4NIYE 2BNRB 5TH2A 3ZDYF 3VH8A 1IGIL 4PI0A 4KUZH 4K7PH 1E5YA 2EXWD 3OKKA 3A6CL 3WBDA 2JK5B 1M7DB 2XWJB 4L1SA 3JWDL 1H3PL 1PIFA 2FJHB 3PGDA 4XP6L 4Z7VA 2DQDL 2WMPB 5FGCB 3UTSA 1R6VA 2IH1B 1A7OL 4H1LA 4LGSB 5F7LB 5KVEE 1NEZB 2H0PA 1EH9A 4HC1H 2FJFA 1UKQA 3L5IA 2XLLA 4ZFZA 2XN9D 4LSRH 2XQBH 4I2XE 5L4JA 1JJUA 3VYOA 2ZIDA 3VXUB 4NWUH 4FQXC 4L29B 2EH8H 3G5XB 4U1GC 2C26A 4JM2D 2DMHA 5T3ZL 3ESMA 1VGKB 3BD5A 3DROA 2D3NA 1IGJA 5DVLA 2ZKWA 3WJLC 1LEKB 1O5PA 1HIML 1A7QH 4GG8A 5CUSH 1CE1H 3QIWA 4TYUA 4Y16C 3CPLA 5B39A 5LCVL 1E4HA 2QPSA 4XWOD 1R5IA 1C16A 1QD0A 3FB7B 2QVMA 3QFJD 1AI1H 1TTRA 2EE9A 1WHOA 3QJUB 3CDZB 1FYTA 2A77H 1NIDA 1BFTA 3UDWA 3T08A 3BSZL 4X9HA 5HHVH 4A6YA 2F5BH 5H2BB 3D4GA 1RURL 4PJAB 2B15A 2AK1H 4AC2A 4UV7H 1RMFL 1AO7A 1JFQL 1NC2A 3DSNA 4X4KA 5DJAB 3ZN6A 4X8GA 5CZXD 5T1KA 3SDCB 5AL8A 5CEZH 2FO8A 2XU9A 3IXAB 4BQ8A 2AQRA 4JW3A 3SDAA 3N41F 2IH8A 2PR9A 4JPVH 2CK2A 1OD7A 1ECYA 3AREA 5FV2A 4PJXA 2QV4A 2WZ0A 5EOQH 1BEYH 5D9SB 1QG3A 2CNYA 2HKFL 2ADFL 4LESA 4M5SA 4PWGA 2H6UA 1ZT7B 5C0CD 4JDTL 2XBZA 4P5SA 3W37A 5CSZB 1QSEA 4N2OA 1JNLH 2F61A 2K3TA 5CHNA 4PRNA 3P4OA 2WW8A 2Y3AA 5I1IH 1J9RA 3CFCL 4GKZB 3R19A 3P30L 5D7JB 1EFXB 3C6EA 1H8NA 4JFOB 3MRCA 1JRHL 3TA3B 4ELMB 5DC0A 1ES0B 4FFWD 1RIHL 5K39B 4NJAH 3UIYA 4B7IA 1Y6KR 3D3VD 1VKXA 5B1JA 4FNQA 4YDKL 4BZ2H 1I75A 1GYVA 2I5YH 4KTEL 5ADPL 5F1NA 4X6CA 1TOXA 3EH1A 1Q90A 4NPYA 4UZGA 4R8WL 4Y2DC 5MI0B 1MHEA 4HCRA 3P0VL 3CHXA 3D0LA 3L2MA 4E42A 5GS2D 2MOQA 4UQ9A 3REVA 1UH2A 1U2CA 2NY4C 5EU6E 3R8BB 3V4VL 4GG6B 5FS5A 1DJXA 1I7RB 4ICXA 1A1OA 1UT9A 1T7XA 1BQHA 5FYJL 1Q9WA 2RCSL 4FEMA 4BZ1H 4YHPB 3A22A 2WCSA 4QCIB 4Z7NE 1FZOB 2P43B 1H3UA 5FIEA 1TF4A 3T2NL 3SGDI 1GOFA 2UYLA 4HZ1A 4ZFOB 3B7TA 2X4OB 1I1FA 3BUBA 4L2YA 4PRPD 3B9AA 3ZYZA 5K9KB 4K9EH 1DEEA 4CADA 1AANA 3K1DA 3RWGB 2GJ6B 4JG1L 1RULH 1HHKA 3LMJL 4BUGA 5B7MA 3A6OA 4XMLL 5BV7B 1FA4A 4RLDA 2UV3A 3DUUA 2WC7A 1RIVL 2FHFA 3QWRD 3PJSA 5IMLA 1U2HA 3K80A 3LXBA 3Q5OA 1LXMA 4CUCA 2CHXA 2Y06H 3T3PE 4D8PB 4AGPA 1LDPL 3RTLA 5CBAB 1WA2X 1JPFA 1DDHB 2PWFA 3CD4A 4ZFFA 3WHXB 1DQJA 4PCKA 4XMKH 2F1BA 4QHNA 1ACYH 1AJ7L 2EP6A 2B39A 4QRUA 5FA3A 1A22B 4XTRC 1OSEA 4CBPA 3MMEB 3MROA 4EBQH 3PDOB 4AL8H 1J0IA 2HAZA 3FSWA 5KSUA 2BNRE 2AABH 3CXFA 4GUPA 1W91A 1NINA 3RHWK 4IMKC 2Q3XA 3CHSA 4AK2A 3BFWA 4JFWA 4OV6F 4URKA 3FFDB 1CR9H 2UXTA 4IBQA 4P5RA 1F11A 5FGCE 4WW2F 4HIXH 1RUQL 1IM3D 3FULA 2R83A 4IDJL 2WBJA 4QHUB 4Z1PA 4F91B 1M1XB 4KQ4L 4PY8J 1CFNA 3H2PA 3R8QA 3VXUE 2ZJSL 5CF3A 2CKNA 1QQDA 1P1VA 4S0TD 2CO6B 2QVTA 3B43A 3IRPX 5LGHL 3OF6D 1Z1WA 2ZG2A 3GHEH 4PY7A 3NRPA 1KGYE 1AHWB 1YEFL 3ARQA 2C9UA 2IGFH 4NSKB 3D87B 2PO6A 1N8ZB 5I1DA 3RWFA 2OYMA 2JQZA 3P73B 5L9DH 4YC2C 3LNIA 3EHBB 3SDYL 2IALB 3QDMA 2CKBA 3OKNB 5AVRB 4U1KB 4PS8A 1KB9J 5I1HL 3GMLB 4RETB 5H37H 3RAJH 2ZP0T 5ERWA 3MXVL 1GS7A 4YGVB 5FUOH 3QCUH 4QHKI 3CVIH 3AS0A 1FF5A 3I02A 3FN0H 1QLEL 5AOZA 4PJAE 4OLWL 3ZO0A 1TEFA 4Y4KA 2EECA 1OP5K 1T20A 3AG2B 3E9TA 3T1WA 1RZFL 5AKSA 3X12A 4OT1L 3CZFB 5KW9H 4ZFQA 4ANVA 3TN0C 1KJ3H 3FRPA 3F7VB 2WJ7A 4GQ9H 4LKXA 4HWEH 3Q05A 1V8HA 3PL6D 4ODHH 2K4WA 2VXTH 4MDRA 3AS3A 3T8XB 4AM0Q 2O4EA 4XX1G 3T6WA 3X1BA 5DVMA 1VERA 4QOKD 4Z3GA 1ZVHA 4GAJL 1GIGL 2N7BA 4WDIB 4P46D 3ZIMA 5CBEB 3SGKC 3D33A 1RJCA 4PJ6A 4NUGL 1DLFH 5JHBA 2RH0A 4MSWB 15C8H 3W0WB 4DESA 4DW2H 1ZANL 4ELME 2NY2C 1LILA 2WNXA 4JAMA 3VFWB 4X7FC 1N5YH 1F4WL 3LQAC 4PS4H 2LABA 4R4BB 1MJ7L 1WWCA 3HI6H 3VD3A 1XXDC 1VFBB 2X44D 3G5VB 4I18C 4XPGH 4BFIB 1GHFH 4KAQL 1J0HA 2IDFA 1DE4B 1MCWW 1N4XL 3CDCA 2EDBA 1BPVA 2ZUQC 3ARGA 3WDJA 2VC2L 4WI8A 2BCKA 4YSUA 3UOAB 2K8QA 5IUCA 2XKSA 1JXKA 3H6AA 3INUH 2BMKA 1NGPL 4HOXA 4GG6E 1J11A 1DQQA 3QH3B 1M3JA 3MAWA 3MUJA 4LSUH 3Q48A 2Z1KA 4TNWF 5C07A 3WL9B 4RAUB 3ZDYB 2PUQT 1O0VA 2Y07L 4WJ5B 2CR0A 4G8IA 4XVJH 5EZJA 3DMMD 1ED3A 4G9DA 1JNNH 4HS6A 5F71A 4AQAA 2YPVH 2PTVA 3ASOB 4N9GA 4QHLB 2YOAA 2WXJA 2CRMA 3HN8A 4M02A 2NTFA 3LKNA 3Q01A 3RDTB 5KZCB 1A6TA 3X3FL 1K2DB 5EU6D 2VLMD 5HHNA 4AVJA 2X6UA 5IVZB 2ZE0A 3GZKA 5DF0A 5T1DL 3QORB 1DLHA 4M7KL 3Q7JA 4N87A 5ENWB 1AZUA 4WU5B 3O6MH 2FT8A 3VSUA 35C8L 5JPMC 2HP4A 4EVNA 2J5LB 3BISA 1WTLA 4ORGA 2FSEB 3BQUC 4M9OA 2C9XA 2WYTA 3IKCA 3BJLA 4QNPF 3ETTA 3ESNA 3H4FA 1CF8L 4UANA 4KKZA 4BSWA 3FUEA 2VQ4A 4RMTA 3ILEA 1NICA 2EIMB 3PFUA 5DT1H 1V3MA 4P4RB 5HI3C 2HJFB 1EJOL 1UA3A 2R69H 3SCMB 1OP3H 3UBXA 3WKNA 1N5AA 1ZV2A 1HOEA 4JCMA 4E9YA 3QZWG 1D6VL 3AB0B 4L8BB 4HIJA 1JF5A 4AENB 2DKUA 4YBQC 4AGLA 2OZ4H 4LP5A 4H0IA 1KYAA 3TEZA 4ZSOB 3BD4A 5L8LB 2ICES 3VE0B 3N41B 3BH9B 3RBGA 4OUOA 1EGJH 4TSBH 2EEBA 2EINB 4AVKA 3NCEB 4EN3C 4L1LA 5BQ7B 4LVNC 1B2WH 1QSFA 4IW4C 4B3VA 1CU4H 3ARWA 4LLDA 1WK0A 4M8QA 3RGVB 2ZG3A 4AEHH 3TYFB 3VA2C 1K8DA 2DQCL 5F9OH 5DZAA 3JWDC 3KE0A 3T77B 4O9HH 1WFOA 2HLFC 2G9HA 3L1GA 2GK0B 1GRWA 3ZL2A 1AQKH 4KZCA 4XP4L 1K4DB 1OAZL 2BNRD 3CZNA 1U8OA 5BXFA 2CO4A 5ITBH 3IDNB 3GJFK 3MNVB 2X0WA 2Z7WA 2V7NA 3KH4A 4FA7B 5I1EL 2XPGB 1U6AL 5JHDD 3G6AB 1ANUA 4G8FA 1SHMA 4NNYA 5AKRA 2QSVA 2BIMA 5KG9A 4EOWH 6PCYA 2CGRH 2PYFB 4WJG3 2BNUB 3HG1B 1T04B 3VXUD 3O6FB 1TENA 2NR6D 3M46A 2H4EA 1IAII 5E5LA 4B96A 3BO8A 2YUVA 2OYLA 1WAEA 5I9QC 4DP7X 4HU8A 5DHVA 4Y89A 5KOVC 1INEL 4WIQA 1Q0XH 2KZ1B 2ZUWA 4PGBA 3EDDA 3N0AA 3BKJL 2O26U 3GXTA 1IGYA 4XX5A 3NDZE 4F8PA 3G5YA 5TE7L 3JVGA 1J0ZA 1GKEA 3IWUA 5IFAL 1PKQB 1QX1A 3B8SA 3B2XA 1KYOJ 1E4XL 1WAPA 1IBGH 3UJIL 2FB4L 4MXQD 3GSUB 3HE7B 5A3IC 2CJ3A 3A6BH 2FSDA 1GGIH 2DQUH 3MJ9A 1KT2B 1NGYB 2A6KB 2FH6A 2VLJB 3MCYA 3EXLA 4P59H 3NACL 3W0WE 2H3NB 1RK7A 2NY6D 4Z18A 1HQ4A 1K8IA 3V0AC 2H8PA 4NKOA 4NKQB 4LSSH 3FTWA 4RFNC 1NCCL 2EO7A 2XA8H 2DLFH 2JXMA 3TH4T 4JL2A 4BWUA 2Y9RT 2VQ1B 1QLRA 3MUGB 1ORSB 1MZYA 2WYIA 3IDJA 5B38A 3OJMB 5JTWA 3O41A 4X99B 5HI5D 2CRYA 5EG6C 3TBTB 4XP9H 3CH8A 3FUFA 4N2BA 3QYNA 3ARBA 5JYMA 2XXGA 1BQ5A 4EZLA 3AQXA 5D8JH 4A2EA 5D7JD 1EFXD 3L1FA 1K5WA 3TA3D 3CQPA 4UTBH 5DZOA 1D2PA 4HKJB 2E4TA 2GCYB 3HMWL 4FYTA 4NN7B 1JZ4A 3V4UL 1IQDB 1LNUA 2WK2A 4IQHA 3RX7A 3ZDYE 3PWVB 1EMTH 5I71C 4ZX5A 4ISVB 4HGWB 5IP4A 1AE6H 3CWGA 3RNQB 2WXGA 2N3JA 6TAAA 3GRWL 2LU5A 4LKCB 1GXEA 4FQ1L 1QI5A 4WW2B 4P3CL 4NKMB 3NFPB 1EXGA 1OGPA 3KWUA 3VRIB 4M5YH 4JZOA 4TSCL 4IBYA 4XN1A 2HX7A 4D9RD 1KNOA 1MHCA 2XVGA 3VAEA 3EBAA 1HL5A 4OF8A 4BH8A 1JHTA 2J4WL 1QVOA 2DB8A 3DUSA 3GKWH 3GJEB 1Y18B 2F7PA 1QW9A 1LP9F 3ME0B 3MREB 5E6IC 3ZYIA 4DZBB 2WZPD 3I3BA 1RCYA 1JZ8A 3HUJF 4LE8A 4U1HB 4RFOL 4UDUA 5F7NC 4F7TA 4ZPVA 2OPCA 4OAWA 1FVEA 4RDQF 1MREL 2NY1C 4H26B 2WSPA 4AJYV 3S36X 4A1RA 3NJHA 5FECB 3WHE1 1HL8A 4XBGA 3MRHB 2DN7A 4I4WA 2F7IA 2GJ6D 3RHWF 2D7QA 4YPGB 1QUNB 1OD9A 1BG9A 5ICYA 1Z32X 5J8OA 2XPZA 1CFSA 4HF5L 4XP1L 1Z3GH 3KPLB 5AW9B 2G75A 1PG7W 5JW4R 3EYVA 1C9SA 1PAMA 4YHKH 1BVNP 1KCRL 4GSXA 3QK0A 4YFEA 1ESOA 1E0OB 2C1OB 3HS0A 3OB8A 6FABL 5D2NA 1L3WA 3QQ4B 5AD0B 3KEHA 4XZUB 3QZWB 5M94B 3MX0B 4WCYH 1BLNA 3IDGB 3EJUA 2DIEA 4XNZB 4P04A 1A6UL 4ZPTA 3B2VH 1JYXA 3BMWA 4ZMYA 1M7IA 2AGJL 4PJDF 5E8NB 3GS4A 4JPIB 3GBNL 3VI4A 4Z8FH 2VLKA 2Y5QA 3DNKA 4M93C 1YMHA 4FA8A 2WBWB 1DZBA 4Z7IA 5JW3H 2B3RA 4ZMVA 4FMFA 5A2IH 2PKDA 3K71A 5JORA 5GS0D 4ELDA 5IOPB 3HG1E 4M62L 2ZXAA 4APQC 3DWTA 5AWNH 3RWHA 3T4AA 1OV8A 3V0FA 5JYLA 1BREA 1PVHA 2X4QB 4JRXB 2EDMA 3FOLB 4HKZA 4QD2E 2A9BA 2DM3A 4HUKB 2WWKT 4X80H 4AM0B 3EYQC 2TAAA 2VW4A 2XFGB 3ZGHA 4QHPA 5DS8B 1IBHA 1P6WA 4YZFF 3GIVA 4Y9GA 25C8H 3LS4L 4CNIA 5KUKA 3SJVB 2LTQC 3MYZA 4JDEB 1ACZA 3VFTA 1L7TL 4FABH 4KRPB 1PKQE 2DZEA 4KK6C 3SZ6A 4P3DA 2ZCKH 5KVMC 5EF2A 2NX5A 5B3NA 1B9ZA 4ODWB 1FL6A 1BDYA 4ZDHA 1A21A 1INQA 3KBFA 1B4RA 2A83B 1FVCA 4OCSL 4J1UA 3B7RL 3EO1B 3MV7B 2VLJE 4YXKL 4N2IA 4FNLL 5FM5O 1KCSH 1KG0A 1NMBH 4JJHA 5CP3H 5DS2A 2A7BA 3FQNB 1ACXA 4O5LH 2CGZA 1B0WA 4WTZA 4LCWB 4OD2B 1JYNA 5C8JB 3PGFH 1HEZA 2FWOB 4XX1E 2KQNA 2FRGP 4EDWL 3A6CH 4YOKA 3L3OC 4TNVK 2E75C 1BOGB 2H45A 1H3PH 1X9UA 5J6GA 1L0YA 2DQDH 3N06B 5CIPB 1AC0A 1S7SB 3AWEA 3N1QC 1FRGH 1T66D 2VL4A 1XCXA 5GSRB 2WOYA 3BXNB 4LOUD 3F12B 5FUCE 2EVFA 3TBWB 5DR5L 3VG9C 3U4EB 1A4KA 4I0CC 3TVMB 5DGRA 3VVVA 3NMEA 3CGTA 3AVEA 2D3LA 4HIQA 1GYCA 3S34L 4RH4A 2QSQA 3AQZA 2BM3A 5GGUA 3K8MA 1HIMH 4N8VG 5IQ9B 4OI8A 2NY7L 4ETYA 2CDEB 1TZIA 3SN6N 1UXWA 3IDIB 2QMJA 3J27A 4TQPA 1Z9SA 3K0WA 2NY0C 5DUPL 1H0DA 2YAQA 4JDZA 2VDKB 3QRBA 4XE5B 3IDXL 1ETZA 3AY4A 5DEFA 1YMMD 4GW5A 4AQEB 4P3WA 4OFYA 2ATAA 1XQ4A 1RURH 3NCYS 3QJHB 4IOSA 3F5WB 4TVPE 1H5BA 3EYUL 4S1SL 1FGVH 1JFQH 1TJGL 3Q6FA 4ADGA 1U42A 4XN4A 3CFTA 4MJ2A 2ICEC 1WD9A 1FORL 2QZQA 2BINA 4KTDL 4K07A 1SUHA 3ZE1F 1MDAA 1CFVL 1MWAH 2VZVA 2CZNA 4LCYA 5JNYB 4BEIA 2IQAB 4OJEH 4QKXB 3VJ6B 4LL1A 3RDTD 5E24E 1T4KB 4Y88A 2FCBA 2HKFH 5ID1A 2Z3FA 2BHZA 3D7PA 5I0YA 1KN4L 3VNYA 2Z4QB 3NN8B 4PLOB 2UVFA 3I2CL 4WFFD 4NKIH 1TIUA 1YECL 3SBPA 3PUUA 5GRUL 1J0YA 5J06A 3B9KC 1A3ZA 1B6UA 4KY1H 1RZJL 3CFCH 3RY5A 3H6JA 4FFZL 5A16A 1JRHH 2FATL 3PS6A 1O6TA 5DC2A 1RIHH 2OMBA 3VWKA 1J5CA 4G8EA 4L05A 3OAUL 1KPVA 2VKXA 5D1QC 3WXVL 2Y7QB 2ZSWA 3V6ZA 2OSYA 4GRLA 4YDKH 1F90L 4ANXA 1E8WA 5KN5A 3NZHL 4JFXA 1I9IL 4LMQI 4R8WH 3S96B 3DK0A 4KRMB 1A1MA 4M1CD 1G1OA 3P0VH 2EVIA 4XB8A 3S3BB 2XN9A 1J05B 5E5UB 5DMYA 1V7ML 2B77A 3HPLB 1MW1A 4UIMB 3QXVA 4JM2A 3RVVD 4GINA 4P9HL 3SGJC 3GLEA 3JV4B 3FH8A 5DFVC 5B1KA 3EGXB 3NQIA 5FYJH 2X6MA 4JCLA 4J4PD 2X12A 4NT6A 5E94A 2RCSH 2BFVL 3QARA 5F1OB 4NHUB 3CFBB 1WJ3A 3FUDA 1TQTA 3QFJA 4LDEB 2FX8H 5IB4A 1HESA 2BOLA 4JRXE 4EUPH 3L4ZA 4WK0B 3RY6A 3T2NH 3HFML 2IG2H 1XAUA 3BPCB 3QNXB 1CDHA 3RKPA 3U4AA 3E0GA 5I66B 5LBSA 3QAZB 4DJMA 4YSEA 5KYUB 2W65A 3BVTA 4KXZI 2ZXDA 4JG1H 2NXZD 4UUJA 4YHZL 1Q94A 1OKEA 1MCDA 4OB5L 5DJ0A 3CVCA 4XMLH 3SJVE 1IGCH 3MCLH 2WYZA 1FL5A 5GRVL 1RIVH 3IFNH 5I5RA 2ZP9A 3NCWA 3QWOA 3TWCL 4MB5A 3HG1D 4BINA 4FNPA 1KXQA 5C1MB 1LDPH 5I6LA 2B4CL 2W81C 4KI1A 3IT8D 1MCSA 1EANA 1WS7A 1UQSA 4YSAA 4WFHE 1Z5HA 2HB0A 1GKOA 4PR5B 3S6CA 3MV7E 5L2KD 5C0CA 4UNTA 1P7KA 4MMYA 1UH3A 3A23A 1CK0L 3E8VA 4QF1A 5BVJA 1O5DT 4W1TA 3LXAA 3SY0B 4ZX4A 3DDFA 1U9KA 1LP9B 1JK8A 4LCWE 4D3CH 5ID0A 1MJJA 2VDLH 3KS0H 3RWIA 2KHAA 5IFHL 1GA2A 2P5WD 5TF0A 3ULUC 5JXAL 2ITCB 1DBBH 3P2BA 5J12C 3HUJB 4HWBL 4KNSA 2X4UB 2YPKA 5E2VH 2GI0A 1VB9A 4QNPE 1P84K 1IL1A 2NUPB 4XZ4A 1MELA 1BZ7B 1RUQH 2E9JA 1TITA 2HTLD 2MPAL 4MRBA 2Y5TA 1OB0A 2QGBA 4XNMA 4IDJH 1W9XA 2KPWA 4KQ4H 4GBXB 3OJDB 3CSTA 4KJPD 3ROLA 1F6AB 3D30A 1MOEA 1ADQL 5D7EA 5LGHH 2V37A 1HAWA 4M5ZL 1LO5A 1OAJA 1H15A 2DICA 3MRBA 1YEFH 5EPMA 1GS6X 3KPTA 3DDGA 4KK8D 1B4JL 5C0IA 3JWNE 3SE9L 4NUJA 1XF3B 3KWTA 1KYFA 1OB1B 2CGYA 4LLQA 2F7OA 3SDYH 1W0VB 4O2CA 1HKLL 5BS0B 2DJMA 5F7WC 3VQMA 5KUMA 3MXVH 1XSJA 3C5ZA 3EBHA 2R2HA 3IDMA 5H94A 5F6HI 4N8VB 4OLWH 1EEZA 4ZZKA 2FX9H 1VADB 4PJDB 12E8H 1RZFH 5ADOL 4FZ8L 4OT1H 2EEXA 2X1PA 3OKEB 3R7QA 4DGIH 4F7EB 5IJDC 3DHPA 1RV6X 3IEAA 3QWRA 1CICC 1OP4A 4PREA 3UADA 2VMFA 5B3SB 4JFDD 1JNJA 3CIAA 1KLGA 3LIZL 1ITBB 3HHRB 3VGBA 1KTBA 3EJQA 1SN5A 1MNUL 4JY5H 3ZTCC 3WTWA 1DJHA 4WGWB 2M83A 4BK4A 2JIXD 4LPTA 1SUJA 4TXVB 2YAFA 3QXAA 4D94A 4G6AD 3ASWA 4GAJH 4LCUB 1GIGH 2Z4TA 3H3PL 4TVPD 1AGDB 3BH8B 2C7UA 3C12A 4Q58C 5A2JH 3OX8A 3Q9QA 5E99H 2EAEA 2QFRA 1DUZA 4FZEH 4MAZA 3BGMA 4WO4B 1FO0B 2UZIL 1KXHA 3QUXC 5J56B 1F4WH 1DVFD 1WUNT 4CN6A 4PWFA 5SWZB 3CHPA 5GGSY 4UM8B 1TQSA 4XMPH 2FL5A 3TU6A 2DYSB 4WI9A 4KAQH 1DJIA 3AXHA 4F8QA 1IM3A 1WGOA 2G2RA 1F45A 3GNML 4HJJL 1DANT 4OF6A 1UWEL 5DZVA 1T83C 1WPCA 4QY8A 5I2IB 4JFTA 5FKAA 3ZZQA 5A40E 3OF6A 3P11H 3ULVF 4YDIH 3V7AE 1UD2A 1PZ2A 3HMXH 3WSQL 2DQFA 2VLRB 3V4PB 1TTAA 1LE5A 2P5EB 1XGUB 1BZ8A 2ZOTA 3UYOD 1DYZA 1KFGA 2Y07H 4KX7A 2OQJB 4D0CA 2V5RA 5F1IB 3UMTA 2YAPA 3A0OA 3TPKA 3CVBA 2AJSL 2Z9TA 2EYTA 4I2XA 4JZNA 3X3FH 2P80D 4NJ9L 1NCOA 4AGOA 1AFVH 2DMKA 1ZHLA 5LJYH 3QQNA 4L9LC 1PJ9A 4M7KH 3RU8H 5MENE 3KYAA 2FEJA 3GSQB 2HPTA 4HW6A 5I0VA 2JKLA 5ESVA 2BSED 1UJ3B 1HDMB 2R0KL 4CC1A 2K7PA 3PQYB 3PXJA 3PL6A 3W9DB 2WWMC 1MH5B 2A9NL 2GVYA 4JRXD 1G9EA 3KGTA 3LOWA 1VEOA 1FDLL 1I8MB 3ZQWA 2L7QA 1ICTA 3GXNA 2WZ5A 5IEHA 3O3BA 1CLZL 4XO9A 2C9PA 4DPBX 4HIPA 5LQBL 1EJOH 3TEYA 1H3GA 2EYRB 1NL0H 4QOKA 2V2XA 4DN3L 4M4RB 3DIFA 3GMQA 4OF7A 1LP9E 4XMZA 1D6VH 2CBQA 4P46A 3MR9B 1WSST 3V79C 4XVTL 3HG5A 4TNVF 3X13A 3AITA 4M6MH 3ZTNL 4G43B 3HUJE 1B6DA 5E5RB 3NFNA 1I1AB 3GMMA 4BFRA 3ZE1B 1RU9H 1EO8H 2DQHL 3OPUA 1OP3K 1KULA 4MRCA 1H3TA 4X7EC 3U6RA 4PRBB 4TPRL 4HFWA 4OLVH 3GMPB 4M6NL 4JFFD 4P2RB 5EZLB 1OGTB 4LCWD 4YSPA 3WKPA 3FOMB 3HNSL 5F7MC 3FYIB 1ZAGA 3F7PC 2X3AA 2EDOA 3ROOA 4LPCA 2ID5A 1OAZH 3SGEH 4WENB 3RA7H 4I5BB 4LVEA 5C0GA 2E3VA 4JHZA 4ZQKB 3I6KB 5F6IB 3L4YA 5I1EH 1U6AH 5IUSA 2PPDA 5DFTA 4PJ5B 5ELIA 2WQSA 4RZCA 1KLFA 1QA9A 2DTML 2R9HD 3N3EA 4AT6A 1ACCA 2ICWJ 3C5SA 3DMMA 4G70B 4YDZA 4HPHA 3V0HA 1HK6A 3BWUC 4S1QH 1IBBA 4CJ0A 5BS0E 5IHBA 5EUKB 2Z31D 4QHKJ 3ZZ1A 4FTVB 4GRLC 1UOVA 1JPEA 3GJFB 5ABDE 2DJUA 1V3JA 3GXIA 3QPQC 1YY8B 3JWOL 1LO0L 2QBWA 4PJDE 4DGVL 3QQ3A 4L37A 1DVYA 5EU6A 4KVNH 2RALA 1INEH 1XGTB 1J0JA 5AVUB 2P5PA 1QI4A 3ATBA 3FQ4A 1ZHNA 4A2FA 3SZKC 5TE7H 1P5VB 4WUKL 4AV0A 3L6FB 4IIZA 3KLAA 4R5VA 1WBXA 2CIKA 3LRGA 5JUEL 1IX2A 4HDIA 3ZSTA 1QFWM 3UJIH 2D7TH 2FB4H 4AQ8A 1LO2L 4IMLB 4N85A 3CAFA 4HEPG 3DECA 3Q6GH 3TC9A 4FG6D 3UTPE 4LBEA 2NPLX 2VZ1A 2VL5A 4HAKA 2DYPA 3OWRA 3NACH 5I8KL 5FO9A 1BAWA 4CMHB 5E2TH 2LLGA 4YZFE 3QIUC 4EI5C 1S46A 2XWXA 4RRPM 3PABA 5HHOB 3FO1B 3OZ9L 2VISA 1WFNA 1FH5L 1NCCH 2GITB 4XXCA 1TPXC 5SWZE 3ZGIA 3UTOA 1JXJA 1QMUA 3GSRA 1RZJC 3ALWA 3ESOA 4JMNA 5E0FA 4WI3A 2UY7A 1SBSH 1R5WB 1SEQL 4NN5B 2A6IB 1L0PA 2FIKA 3MJ7A 5IBLD 4L3ED 3FL7A 1RZ8B 4XCYA 4QRRB 1DL7L 3DBXB 4F9PC 1P4LB 3L9RB 1A0QL 2OTPA 3BX7C 2AI0L 3VXNA 4BUQA 5ABZA 1N10A 2VLRE 2BNRA 3V4UH 1UT1A 3AZUA 3EYOB 4OFQA 2WINA 2P5EE 4O58L 1AYOA 2JK5A 1M7DA 4ONFL 1F8TL 4IRSB 4JK0D 2EDKA 1P9MA 1NMCB 2A1WH 2WMPA 1KY6A 2IH1A 3GRWH 2OMZB 4P9HC 4E41B 3LKPB 4FQ1H 1NEZA 4P3CH 4G1EB 4GI9A 5D1ZD 4FFYH 4Y2OB 2R0WL 2ZOKB 3VMPA 3W1ZA 1OK0A 5DK3A 3BOVA 5B22A 3FN3A 3VXUA 1ZT4A 2G3ZA 2NR6A 1HXKA 3L3KB 3P4MB 4L29A 4ZXBC 2FT7A 2N01B 2J4WH 1AGCA 2RFXB 4H5SA 1QKZL 3GINA 3MOBL 3MBWA 1IIKA 3WIHA 4A2DA 4AMKL 1LEKA 3LHAA 5I74B 2DMGA 5CD5C 1M53A 2M2DA 1SLUA 3FB7A 1KB3A 5CP7B 3Q8EA 3PQYE 5IG7B 5I1AB 3H3KA 5HPOA 1JV2B 1SHWA 3CDZA 5DI8B 1EUTA 3GT6A 1MREH 5DYFA 3WFHB 4YXHL 4F80A 5DQ9B 2G3XA 2FJGA 1U8CA 5I0ZA 4PIBA 1WAAE 5FYKL 3DHJA 3AS1A 1EAPB 5DJAA 4KK5D 4LFHD 3SEPA 4L1DA 4DGYL 4G7RB 3VMNA 4DOHB 3C5ZC 5B8CC 4H13C 2J2ZB 3IXAA 2XJKA 3HRPA 4HF5H 4H8VA 3WXWL 4TV3A 1M9WA 2EE3A 4RGOL 1Q9LB 4QWWD 4OJFH 2Q20A 4LGRB 4Y8DC 3ZE1E 3FB6B 4YSSA 5E4EB 1KCRH 1T5WB 1M1SA 1YEEL 4MQXD 2J72A 5D9SA 2Q87A 5D2LA 3VD1A 3KDPB 1KTCA 3QPXL 2JWYA 5IVOA 6FABH 1CDBA 1ZT7A 5SX5H 4ZFOL 1SYSB 1T3FA 4NNXB 5KSAC 5D4HA 3OG4B 5CSZA 5EU4B 4U1IB 4P2RE 4WTWA 3THML 1A7NL 1N0XH 1SJMA 4HOWA 4M61A 5BV7L 3DX0A 1A6UH 3NUKA 5D7JA 1EFXA 1YQVL 4ELMA 3TA3A 1BWWA 1AVAA 2FQEA 2XXMB 5EB9A 2K6WA 5K39A 3S35H 4HUWB 4PP1D 3KL0A 4PJ5E 3FONB 1PZDA 3RVXD 1U8QA 4W81A 4ABWA 4WU7A 4HXAL 4PRIB 2VDPB 2Y6SC 3QQDB 1V3KA 4GBXD 4O2EB 2QQLL 4M62H 4ENEC 1XR9B 3SQBB 5KBLA 4YO0B 4XP5L 5AOJA 4CSPA 2O5ZH 1SMDA 2B5IB 1F0LA 2D0GA 2Z92A 2X70A 2BVQB 1HI6B 5T3XE 2XNAB 3SO3C 3NZ8B 5BOJA 4K94C 1J1XL 1NGXB 3ZMEA 3LS4H 2WZPA 1JGIA 2DQGL 4YHPA 1RK1B 5I15L 2R29A 1QRNE 3KJ6L 4N0UB 5HGHB 1FZOA 2JLLA 2WWOA 5C0EB 1NCHA 3JTSA 2XN1A 1CDJA 4CN4A 2VH5H 2X4OA 3ZT7A 1YEIL 5LNGA 4K2UL 3D9AL 1NDMB 5I16B 2BW4A 4JL1A 1NWOA 4M48L 4DKFL 4K8RL 4FNLH 4LPUA 5FO2A 4G9FB 2GJ6A 1OT1A 4NGHH 3V4LA 5EBWA 3QEQB 1G7JB 2J12B 3F00A 3QI9C 3TLRA 4AX3A 5DQDH 1A4JB 2VR8A 5HHOE 4DP6X 3R06B 4OZHF 5TE6H 3ZX1A 3BGFC 2YS4A 3FQ1A 2W38A 4TUUA 1NWPA 3KPRB 1DDHA 1MUJB 5KVFL 2XCMC 1URZA 2GSIB 1S5HB 2K45A 5JXED 2WKOA 4XBEH 1XD1A 4YBHA 3UTPD 3V7MA 5BMFL 3LNFA 5IB2A 5J5EA 3NYKA 5DR5H 5CCJA 3MJGX 3BZDA 3DK2A 1TFPA 1SNRA 3IJYB 3KCPB 1R3KB 2VITA 2UZXA 4K71C 4QRRE 5F3FA 1GOGA 3VB8A 4WO4D 4NRYA 1JF1A 5BW7A 5JPNC 4H20L 1I85C 2MFNA 4FQQB 3S34H 2MOVA 1FYHB 3WEMA 3W3BA 3AY2A 2AHIA 2YGPA 5DEJA 2IPKA 2XBDA 4LNRA 3QAQA 2NY7H 3FFDA 4E41E 1VA9A 3GSNB 3IGLA 4R2GC 4DWHA 5AZ2H 5I28A 4TL4A 1XGQB 3TYGL 3OJVC 1EEYB 4RMVA 1P7QD 1ZK9A 2BVOA 3VI3F 4HH9B 3H53A 5JW5B 1DHKA 1F5WA 1TQUA 4UCFA 2Q1EA 3BPOB 3N1FC 4HFUL 1QW8A 4JG9A 2DOCA 4OTXH 4V11A 3QWQB 4U4BA 2E6QA 2R4RL 2W1NA 3CN1A 5EWIL 2H0JA 4FQJL 2QVKA 3EYUH 3GB7B 4YK4C 1BX2B 1TJGH 3BAYA 1IZJA 4C8XA 5KBNC 7PAZA 2ZOLA 5GS3A 1ZTXE 2IALA 4KTDH 4W4OC 4AQ1B 3MFGB 4OCMC 1HE7A 1RP9A 4U1KA 4X6BB 1CFVH 5C6TL 1UJTA 4GKSB 4JPWL 3MRLB 1JZEA 3LNGA 4LL9A 1UURA 1Y6MR 1XH2A 1I8UA 1MI5E 2VDQL 4YWGL 3D48R 3L48A 1GGCH 4D0BB 2YMOA 2PW1A 1NC4B 1QUPA 3TJEL 3TT1H 2OSLA 2E7DA 4DOHE 4CW1B 1LWHA 3S4SA 3U1QA 2QTEA 1HSBB 3DRTB 5GRUH 3Q8CA 2O61B 3LD8C 2CLVB 1OAUL 3F7VA 2CG9X 4WHDA 2GTWB 1PPIA 3PQYD 3K8KA 3VNZA 4FFZH 4HWZB 5BZZA 3TJHD 1QO3B 3H56A 3T8XA 2VO8A 5A6LA 3OAUH 4DO4A 3OZLA 1HS6A 2A9DA 1WUZA 2W9EH 1F90H 4E9QA 3NZHH 5CKAA 2A74C 4ONGL 4OD1L 3STZB 4MSWA 1NFKA 2YD7A 1T6BX 2Y1ZA 2DM2A 3ABLB 5EN2B 3VFWA 2BZCA 1AOZA 4GMSL 1I1AD 4XHJD 4R4BA 2EC8A 2NUTB 3EF7A 5FGBC 1NBVL 3MJWA 4GIOA 1MQKL 4U3CA 3B7UX 1VFBA 3G5VA 4UMSA 5FW6A 4BFIA 1UCBH 2H6PB 3O2WH 3MBEC 4PRIE 4PJCF 2I9TB 5FYKU 1RFDL 1DE4A 3TXAA 3ARSA 1UB5B 5I76B 1KBGL 1F18A 4P2RD 4EXKA 1WQVT 5C0DA 5E8PB 5AKVA 2VMDA 4YGAB 4NCC1 4MMZB 2X6VA 1JRHI 3L81A 3VUAA 43CAB 3HFMH 1TVBB 2L04A 3G9AB 5IR1A 1YMMA 1KTRL 1G7IA 5DSCB 4R83A 5DJ2B 3H42H 4XCNB 3ZKXB 4JO4L 4YNYB 4PBVC 5I5JA 3FC8A 3ULVE 5J11B 3CFUA 3QH3A 4U3XA 4YHZH 4RDBA 2GJRA 4RAUA 3QHTC 1F41A 2QPEB 4GO8A 3JWOC 4DUXA 3ARPA 2QGDA 3F7YB 5AVZB 3TWCH 4GS7C 3QJTB 2PCYA 3HEIB 5EH1A 2B4CH 4FTVD 3KMDA 1SDYA 4OLUL 3RDTA 4JANB 1MCJA 1K2DA 1NEPA 5IHHA 1PW3A 1TDQA 4G9FE 5HDWA 3GMNB 1CK0H 3TPUB 4NC2B 5IVZA 4AW4A 4IS6B 3QEQE 4NDMB 4XO3A 2DPKA 1XCTB 4KFZC 3SKOB 4AUUA 5ENWA 3CBRA 4KQ3H 4WU5A 3QQXA 3L7FA 5EIQA 2F8IA 3GUFA 1EBAA 1BVZA 1R3HB 1T7YA 2IF7A 1Z9NA 2VSDA 3TIDA 2EKJA 2I26N 2CALA 4HK3N 1TTUA 3KPRE 2FSEA 3AACA 3UGUA 1HN1A 5HDQL 1BFOB 1JTPA 4XHQA 1UH4A 3JTTB 4JFYB 2F19L 4P4RA 3WJMA 2HJFA 4JJOA 3ZTEA 3F04A 1CWVA 5TQ2H 1XGPB 2NYZA 3RP1A 5IEKB 1X7SA 2X4SB 2OTWA 4DKEL 5J6HA 3FH5A 2H0FA 2X28A 1DBKH 2Y24A 4H0LC 4C83B 1RPUA 2VXSH 4L8BA 4Z6AT 1NCGA 3LHPH 1VEMA 5F9JB 4AENA 3WTTA 2BWDA 4KK9C 3C09B 5AB9A 1J1OH 2HPOA 4M5ZH 2OMWB 2OLDA 3HZKA 4ZSOA 5EUOF 2BOBB 3H9ZA 3EYFB 3BH9A 3CFKB 5I23A 1S78C 5BQ7A 3SDCC 1B4JH 2MJWA 1FIGH 3R7RA 3ZTJH 3WN5B 5ITFB 4ZFGL 3RGVA 4J4PA 3TYFA 1F4XH 1YPZF 1V55B 3U83A 3BVXA 4BK5C 4MJ4A 5E8OB 4QLWA 5C71A 5DHYB 4K7FA 3T77A 1JWMB 1HKLH 3CXHK 4NM4H 4QRRD 1ZA3A 2HZHA 3NSJA 2GK0A 2V3DA 1HE8A 3WI9A 1K4DA 4YSDA 4G6FB 1BJ1H 1EEUA 4XOBA 3MNVA 3J2PA 1IARB 4IRSD 2XPGA 4F5CA 2OJEA 4FZ8H 3G6AA 4PJHA 5D7JC 1NZRA 3MRGA 4Y4HB 1OTSD 2JKSA 3O2DA 4JN2B 4TMPA 2XIDA 5I30L 4L4VD 1G0YR 5DJXB 3HG1A 3C5JA 1T04A 3LIZH 2R15A 1UZGA 3PY9A 3S5LA 4NC1E 4XH2A 1I8LC 5CJXA 3KWXA 1N2RB 1IUZA 4JFHE 3LPGA 1XX9C 2PPFA 4ZODA 4YBLB 4Y5VB 5BRPA 5L2KA 1JZDC 5MI0C 4Q6IB 5EDSA 1I9EA 4NM8L 5IMOB 5BZDB 4YQXH 4S1DD 5HSFA 2P5WA 3POHA 2BHFA 3VG0H 1PKQA 1IEAB 5E4IA 1PD6A 1OXYA 5TF1L 2BS9A 1EHLL 3UH8A 3BAXA 5CEZE 4LMQE 4A2GA 4M3JA 2GSGA 3IRCA 1DANU 1KT2A 4FFVD 5FLUA 1NGYA 2IBZY 2A6KA 3GNMH 4FG4A 3SBWC 2GJZA 1UWEH 3W82A 2X9YA 2H3NA 5FV1L 2WLLA 4L3CA 2VERA 1LK3L 2WO2B 2QTVA 3L4WA 5CZRA 1X9RA 4PYGA 4LAQL 3DGGB 4ILDA 1HYRC 3X11B 8FABB 4OZHB 5BV7C 5FM5M 3MO1B 3N6YA 2HT4D 3N2JA 3T2LA 2DIJA 3ISWA 1ORSA 3MUGA 1BLIA 2HTKC 1J9SA 1O9VA 3PAUA 5C0ND 4X99A 1IC7H 1CB4A 1E8XA 4B9JA 4K0OA 4NRZB 5M95B 3MLTB 2AJSH 3MGOB 5CZVL 4MJ6B 5I1GL 1OPOA 1NDGA 4PW3A 5ICXB 1M42A 3H2QA 4YFDB 2GCYA 5IHUH 4CVXB 5B7EA 4A55A 3QJFA 2LFGA 3PWVA 2NW2A 1GOHA 5BW7C 4HIHB 5IHWA 1J0KA 1X5JA 3STBA 1CBVL 4P5MA 1TVHB 1BXUA 2QVIA 4G42B 1KCUL 4Y1SA 1BOYA 1PLBA 4E5XG 5FUZL 4WW2A 4HD5A 2Q8BH 4PSRA 3NFPA 3VRIA 3MGTB 4LLAA 3KLHC 2Z1PA 2A9NH 4JFDA 1KY7A 4FXGA 1A6PA 1FDLH 2ZXCA 2AS5M 3O8XD 4ETQB 3VI3B 3ZKQD 2WXKA 3SOBL 1LK2B 4UWQB 1LQBC 4Y1TA 2IFFL 5LQBH 2JIXA 3GJEA 5JHLA 1Y18A 2OMVB 3B2MA 1OLLA 4FQCL 4GAAA 2W07A 2K78A 5BRZB 1N70A 1LE9B 4D8OA 4WW1B 4HJSA 2ESVD 3UAEA 3JBG7 4K8RC 4U1HA 4YDJB 1AHWC 1XF4B 3GGWB 3EG9B 3UGEA 3BAJA 1DVFA 3OPZL 4U49A 2NNAB 5C3TA 1IMHC 3OGCB 3IM1A 1YNTF 2JCCF 3FUNA 2DQHH 3EHBC 1XMWA 5FECA 4IBVA 3MRHA 3DRQB 1JCVA 3TEXA 1T89C 2CO7B 4G9FD 3RB5A 2DLTA 3LQZB 5EOCH 5J89A 1KLUB 4LSPL 3FSAA 4YPGA 4GQQA 3BYTA 1UT2A 2E76C 2X42A 4FQIL 3WIIL 1RPKA 4OKVB 5I8OH 3O2VL 3KPLA 4LXFA 5DVPA 3KGUA 3CX5J 9PCYA 2DLHA 1Z7JA 2ZKHL 2P49B 1PCSA 4Y5XA 3ISRA 2COQA 1YEKL 1LJMA 4PG2A 1IFHL 2AQPA 3NCMA 3JXAA 2DTMH 1HQRB 2CCVA 3FU6A 2ATKB 3FTVA 3KYKL 4YH6A 3TONA 1W0WB 3IDGA 2YXVA 5AYUH 4PJEF 2I07B 4XNQA 2JTDA 4R4NC 4FXTA 5F6HJ 4Y2DB 2WLYA 4MWFB 4ZNEA 4HHAB 1YEWA 2G9KA 2FH8A 4QUOA 3QO0A 5E8NA 1LDSA 3VTAA 3UO1H 2BH0A 2P80A 4DGVH 4C4UA 3S3CB 3M86A 3HN5A 2NY4B 3CZEA 3QCVL 1C7TA 4FTDA 4B50A 1PTZA 4ONOA 5AENA 4FULA 1NKRA 3T0VA 2AP2A 5IOPA 4WUKH 4JZJB 2BSEA 4PJCB 5E23A 1RP8A 1MAKA 5KEZA 2W59A 5IK3A 4JRXA 1V10A 1HCZA 1H9VA 3FOLA 3IPBA 3SGEI 2GJPA 4LPWA 1LO2H 4G6MH 4JEGB 4KVCL 1QEXA 4IRJB 1I1YA 3F2LA 4MQ7B 4X4XB 4ZOEA 4AM0A 1NAMA 2XBTA 3W2DH 3QUZD 5DS8A 3T1FB 4IIQA 4DQAA 5LGYA 4UMGA 2FVNA 4KJYB 3QUGA 2H1LM 3SE4C 3EOYG 5AFAA 2CH8A 2A9AA 3TCLB 1VGEH 1NBYA 3OZ9H 4CILA 3MNMA 3VFMB 4N2NA 5IJVB 1FH5H 4YHOL 5IZ7A 2WKGA 4A2LA 1U8MA 4GW1B 4DPAX 3WV0A 4A7VA 4JFHD 2A99A 2A83A 5BUPA 5I0DA 4DPRA 1N3NA 5DLLA 1IC1A 1NC4D 1CUOA 4JM4L 5DUMH 4ZMAT 3I9GL 3C08L 1ZLWH 3GMOA 1CD0A 3FQNA 1WICA 3VX1A 5K59F 1ZGLB 2E7MA 1M6OA 4JFFA 4BFGA 1I8IB 4LCWA 1SFHA 1DL7H 3NGBB 5DK0B 3VFVB 4IRZL 3OVUB 3VFPA 1A0QH 3AM8A 4AKPA 2AI0H 4YHMH 3II1A 1E4XI 4AEIH 4OZHE 4KKRA 1X5MA 2HN7B 2HWZL 3GS7A 3QORC 5GRZA 1R5VA 2DI8A 3CMOL 2VDML 4ZUTB 1SBBA 4O58H 4CVWA 2E9IA 3MGAA 4ONFH 1F8TH 2DKSA 2X6BA 2GY5A 1S7SA 3V5HB 5I1KL 1ZEAL 1KPRB 4JLRB 1HZHL 1OAYL 1HH6A 4H1LH 5F7HA 1QPKA 2R0WH 3WENA 1P5UB 3U6XA 1REIA 1T1ZA 2Z31A 1KC5L 4BRVA 5FGSA 3SCMC 3ZE2F 1OT2A 1QKZH 3AB0C 2WIIB 3IJHB 4AMKH 2HT3C 2PWHA 4KGJA 5IQ9A 3CBJB 5EUOB 4ZTOL 2CDEA 3EFOB 5CGTA 1HINL 3IDIA 3FFCB 5J6SA 2XZQH 4UU9B 1L9SA 3DX7B 3PLYA 4AGNA 2IOMA 4U1SA 3K6IA 4G6KL 4HUMB 1SDDA 2BPBA 1YPZB 3RFZA 3TS8A 1M56B 1IKFL 2W9DL 3VI3E 1X5FA 4AQEA 1EK3A 2EDDA 2OL3A 3RGVC 3OAWA 4YXHH 3LEXB 4A6YH 4KDTA 3F5WA 5FYKH 2Q5BA 4FCHA 3WO4C 2P24B 5BRZE 3VXRB 2BK8A 3CLEL 1P2CA 1U3HC 1RZGB 4JFZL 4TTDD 4E5XB 4P48A 3DETC 3JV6B 5F9AC 1S7UB 3OAZH 3E2HB 3WXWH 1Z9OA 1K9TA 1GJWA 3UJJH 4RGOH 2EUVA 3MV9B 3K6SB 4Y2NA 3D52A 5AQ0A 2IQAA 3VJ6A 4F8TA 3HKFA 4PJ7A 4W9FC 4UQ3B 5EO9B 2YK1H 5HYSA 2R2EB 3FKUS 5IT2L 2Z4QA 3QUYC 4H8HA 2OTUB 4KWUA 4F1SA 4LU5L 2ZCZA 2PWGA 2VW7A 3O6FC 4ABUA 3THMH 1KSRA 5HD8D 3MLRL 4AVIA 1F1GA 4YUEH 3BHBB 2VAJA 2ZWZA 4WY7H 3MACL 5IESL 4NC0B 2EIZB 2OZNA 2C1PB 2XZCH 3HE6D 5FHBL 3X14B 2NY2B 5SX5K 1M4KA 1OPGL 2XQ0A 1KB5A 2CQVA 2C9AA 1ZS8B 1QR4A 3K72B 4BCXA 4XGZB 3ARDD 3TBCA 1CQYA 4MKTA 1S9WB 3WMSA 1PDKB 2QQLH 5K9OB 4ODSL 5D1ZA 1AOHA 3HE7C 3LB6D 2DMCA 2VZ3A 1J05A 3BH4A 1D9KD 4HCRH 3K2UL 4PSPA 3HPLA 5ALCL 2WLNA 2ZZUT 3H85A 3PWNA 5JIPA 4UIMA 3QJOA 3RVUD 1MJ8H 1Z0NA 5PAZA 4MAYC 4N6RA 3DYOA 1FNAA 4PW9A 4UB0L 3QC5X 4JFQA 1J1XH 1JI1A 2AEPH 2IDSA 2Z0UA 4GO9A 1OW0C 4YXLL 3T0DA 3PV6B 2DQGH 4EUPG 5FR3A 4G83A 1IAKB 1SRDA 5HYQA 4PJCE 2KYIA 3KJ6H 2X4PA 3CN0A 1KELH 3MQIA 5GZOD 3VRLF 1OTTD 2IO5A 5F44A 2YD0A 1JGLL 4LOFA 4G6FD 1ZXKA 4CSSA 1PJWA 1YEIH 4K2UH 3D9AH 1Y0LB 2HMID 3W81A 5FUCC 4M48H 5KYUA 3DJTA 3MRDA 4R5TA 3T2QA 4I9XA 1R3IL 3MRRB 1FFOA 2P42B 3BVNB 1CN4A 1J86A 4Q6YA 4NN7C 2KDGA 4OFIA 3C9NA 4OZGF 3ILPB 4I8DA 2JQAA 3ZKNC 3JZYA 2AMGA 4JQIA 5JPMB 2YN3A 1MPAL 2JJWA 2VCOA 3QZBA 4PR5A 4TUJB 4WW2C 1P4IL 4GYBA 4NCC2 4F9LA 1QABA 2FBRA 3C6LC 5KYXA 5CILL 5JA9A 3BKCH 2MQ0A 2QMKA 3HLAB 3QT2A 5J1TC 1UVQB 5LGKA 3JSSA 1FZMB 4JREC 4NWTL 1G43A 5DLML 5FHAH 2WIMA 3QXDB 3WEBA 2V8MA 3HCVB 3TO4D 1EJFA 4H20H 5T1LB 1VEPA 2QPFA 5FKPB 5KTEH 3BLPX 4EZKA 2ITFA 4J3BA 2X4UA 3IWVA 3NQKA 2WLIB 2YRBA 4LF3B 2NUPA 3H9YA 1AXTL 5JHMA 3RJQB 4EN3B 1BZ7A 1YNTB 2JCCB 3PE9A 4F57H 2B20A 1I3GL 4JO2H 2E74C 4HX1B 4GBXA 3OJDA 1SF5A 1QZ1A 3K0YA 2IANB 4ZO8A 5F8RC 2CBTA 3MTXA 2XV0A 3LN4B 1WEJH 4HFUH 4K3EL 5F7AA 4NLAA 4N2HA 2HH0H 1ZDSA 4LZKA 5EUOE 1V05A 3CH1B 2YD9A 3GSXA 1A64A 1LHZA 3FFCE 3NIDF 1II4E 1XF3A 4OGXH 3WFBL 5DD0H 3PWJB 1VRSA 2F53B 2ICWA 2W91A 3BT0A 1C5DA 5DZNA 1I4FB 2IDTA 1W0VA 3UTTD 1U8NB 1YPZE 2WXOA 2GUOB 2CKBH 5ILTL 3ZPDA 3L95B 2P7TB 3KYMB 5INDA 4U33A 4WAFA 1A3LH 5BS0A 1CVRA 2NNRA 2ITDB 4PJEB 4L1BA 3RGBA 3SD5A 4B7LA 2VDQH 4YWGH 4FQXD 3RTQB 4N8VA 1SYVA 1AGEB 2W0FA 3UPAA 3TJEH 1VADA 4UT9L 1PZAA 4XNZC 3MLZH 5GIRB 1BMZA 4OCXL 4I1NB 3L1OL 3OKEA 4NFBA 1T6WA 1OAUH 3HZ3A 3V2AR 1SF3A 3MV9E 4J3OH 5F88B 5DA0B 3AUWB 1YC7A 3FUJA 3B5GA 3PJLA 1DN0B 2LHAA 4H8WL 2HXAA 2ZXGA 3MODL 4PH8A 3EXJA 1MY5A 4FN0A 4HZLA 5JXEA 4JCWA 3KW7A 4O02L 4LCUA 3EFFB 4HQQL 5GGRB 1MWAB 4YPJA 3BH8A 3FQWB 4OD1H 1VZIA 1S7WB 2HRGA 4KVPA 4RGNC 4X50A 4G6JL 5DURB 2BC4B 4KMTL 4HBCL 2IBGA 3WNKA 4WO4A 1FO0A 5A6IA 4XO8A 4XPFL 4GMSH 5J57B 4ACTA 1BBDL 3C2AL 5SWZA 5L7XH 1J9CT 1Q1PA 3QZOA 5A6MA 4H0HB 1XF2B 1MQKH 4KRPC 4QXGH 4QRTB 2J7LA 4JGMA 4QRQB 4XMWA 4C47A 2XTJB 1P7QA 5KS9F 3C8KB 1XEDA 5I2IA 4NYLB 3SQOL 3ELQA 4Z7UF 2R23B 4MA7L 5C0RL 2GYSA 3I9PA 3L2NA 5C70A 1NKGA 3V4PA 3V6OE 1QBLL 3VXTB 1XGUA 3WEXA 4MLSA 2OCJA 4DTGH 1P4UA 3AM8C 2CDFA 2OQJA 4U1LB 3WDHA 3RFRA 2VZOA 1XB8A 1J5IA 3V4VB 2X7LA 3AU1B 4Y2DD 4OLEA 3K5RA 1M2VB 1EO7A 4BGLA 4JQVC 3P02A 4OFVA 2XG5B 3ATEA 2B08A 3TVMC 3ZE2B 1PZUB 2J6EL 2NY4D 2Y3NA 3LN5B 5AVWB 5GRVK 2JKIS 4EUPB 3IPEA 1TQBC 2EE2A 1IC4H 4WV1A 3KDMB 4PGEB 5CAYB 1KTLB 5DYOA 4RBPK 1WFUA 4JHWL 4HIEB 4Y19E 3PQYA 3EGDA 1LGVA 1KJ2L 4X7CC 1XZ0A 4PRHB 4U1NB 5AG9A 5ETUA 1SQ2N 1CURA 3QG6B 4IRJD 4YX2H 1EERB 1F4YL 3GO1L 3U0WL 4XNXH 2QGEA 2OR9L 3JQOB 3V6FA 1U8LB 3KPSB 4M4RA 3GYRA 1ET8A 4GXVL 5E70A 4M1DL 1AXSA 1HHGB 3MR9A 4Y9FA 1J12A 1GMEA 4FG0A 3NSXA 4D9LL 4OJCA 3K3QA 2IWGA 4ZO9A 2VJ0A 5CEYA 5DC4B 1JGEA 1I1AA 1PYWB 3GBMH 4G80B 4IJ3B 2ENYA 3E80A 2CDGB 5HXMA 4JGNA 3X1FA 2JCCE 1E5ZA 3FTUA 2ATPA 4K5OA 1RIUL 3HRZA 1KPUB 4R6UA 4EXPX 3QUMA 2WQVA 3L5XL 3GMPA 4JJ5A 4X9BA 5DD6A 4P2RA 5EZLA 4OFDA 1OGTA 4L8CB 3FOMA 1XSOA 3O45B 4FP8L 4OQTL 1N26A 4XTRD 4Q9RH 1J8RA 5E95B 3G04A 1PL3A 2PMZA 2XTLA 3TZVC 1PEZA 2OMTB 1MCOL 2X88A 3I6KA 2H0EA 4JY6B 3I6SA 2ZPKL 5FA4B 3UZEA 1A8ZA 2F53E 5EA0L 1N6QL 1J5OH 1MF2H 2WP3T 3PU7A 2C3VB 4M93B 5T3ZE 4KTYA 5I30H 2OA9A 1OQOA 3QGVA 3P69A 3LDBC 2BVTA 1BQLH 1VDGA 4OLZH 1CGUA 4ZO6A 3X1NA 4BIKA 4KO9A 4PJEE 4FTVA 1Z9MA 3GJFA 5IF0B 5IW3A 4IBLT 5CN3A 1WWWX 3ATFA 3UYRL 4NQVA 1D5BA 5TDPB 3ESVF 1YY8A 1NBCA 1U8IB 4FI6A 4X5RA 3PHQB 2G5UA 5DXWA 5AZEL 5E1HB 3RILA 1CJYA 5DHVH 4NM8H 4OH2A 2DI7A 3V9EA 3WUWA 4G7YH 3GUTA 1NSNH 3PXHA 4H88H 5HJ3B 1CYGA 3L6FA 3PYCA 1QBBA 3SKNB 2J1KA 5TF1H 1BYNA 3D85D 1EHLH 1PQZB 1TZAA 3AG3B 1L6XA 4IMLA 2RBLA 5KANI 3VCLB 1KCVH 3RWCB 4Y4FB 3F05A 1JWUB 2LU4A 3IRZA 1Z0MA 1JXDA 2WTRB 3A4DA 4Y9CA 3VXRD 4WEBH 4HEME 4NAMA 3AUVA 2NXYB 5AB1A 1HAUA 3BZ4B 4RQQA 1XD0A 3TBYB 1NA8A 4KKPA 1LK3H 2ZWYA 1K3IA 1TO5A 4LAQH 5E4OA 3P9LA 3TN0D 1KJVA 2APWA 1AIFB 2GITA 3N04A 1JSYA 1ZTXL 4F15C 3B37A 3MRIA 4OZGB 5LXGH 2O6FA 2R2CA 2XQYK 2VR5A 4X5XB 1VSCA 2E86A 2HVBA 2Z65C 4XXWC 5F9DC 1KZQA 2A6IA 3L3OB 1YY9C 5D7SL 2XTJE 5DD1L 3LRKA 3UZQA 3DVFA 3VXMB 3GBEA 5K59E 1DBJL 3TIEB 3CDFA 1XH3B 2WVVB 3ZL4L 4QRRA 3U30B 1BZDA 1P4LA 3VG9B 3L9RA 4D9QD 1JWSB 3TP4A 1TJHH 4ALAL 2NY2D 2NYYC 3EYOA 2GHZA 5DRNB 1WIOA 1AYRA 3VFRB 2VC2B 4WI4A 2XTSA 3QZLA 3RWDB 1DBAL 4IRSA 3CZLA 3CK0L 3D69B 3N44F 4PWIA 1KCUH 4LOEA 5FUZH 3NEXA 5T5FL 1T22A 2OXHB 3ARZA 3L4CA 1NGWB 2XWZA 2YAOA 2ZOKA 4ZJ9A 4DZ8B 1RUML 3MOAL 1GZHA 5FYJE 3B9VA 3P4MA 3FT4B 1TU2B 4L0PB 2GEQA 2EH7L 3D0VB 2ZKXA 1RQ5A 2BHYA 2IFFH 3D39B 3EH3B 4RA0C 3ZE2E 5IQOA 4Z78A 1MCNA 3WIHL 4I88A 3ATAA 4A38A 5HHQB 2LW3A 3I74A 4FQCH 4PN6A 1ZS2A 3R1GL 2IWEA 1BVKB 4DP8X 5LBGA 1OWRM 4P49A 3NIDB 1MVUB 5CP7A 2G2NA 4MZIA 5AOLA 5IG7A 3LXCA 1T0NB 4KXAA 4PRHE 2YR3A 3LS5L 4MHHI 1AQDB 1JV2A 4HUVB 3RPIA 3PDDA 3N40F 3CSPA 4YE4L 5ABAA 3WFHA 2V9QA 4HA1A 2AJZA 3KPSE 3A4EA 1H9DA 4ZUWA 5J0BA 3FK3A 4ZYKA 2FLRT 2GI7A 1ZLSL 4LSPH 5KSBA 1K5NA 4JY4B 3GM0A 1HWWA 1QASA 4FQIH 2JKJA 4UAHA 4JE4B 5FO7A 1AZZC 3OR6B 3B9KB 2V5MA 1T03L 2ZKHH 1Q9LA 1MN4A 4MCYB 3X2QB 3FB6A 3NP3A 1T5WA 1MRFL 3BQUD 1IAIM 2C3XA 2D03L 4JPKL 1SYSA 4KFMA 4NNXA 2W92A 4H25A 2WAQA 4OIFA 1QLFB 1ODAA 3CFQA 3KYKH 3AXLB 4PS7A 5EU4A 4KTGA 5HI3D 4U1IA 3BT2L 5HGBA 1UKSA 3TA4D 4R96B 4DSYA 4C4BA 1TYJA 4YSOA 5FDWB 1HSAB 2BZ7A 2N56A 2VYRE 2XN2A 2ZUTA 1YNKL 1UD6A 4WHTB 5LG6A 3OM3B 4HUCA 3VTMA 2P8MA 1T0MB 2DEXX 4YBQD 3EOAB 3FMGH 3NIFF 1H8LA 4PCTA 3QCVH 4EN3D 1E5UI 1JGUL 5K9JL 1LEGB 2GIMA 5JQIB 4MYWB 5E6UB 8CGTA 1UD3A 4O2EA 1J9TA 5EBLA 1XR9A 2IAND 2WB1A 3KPNA 2MQGA 2R27A 3C5XA 3DOSB 4U7SA 3QZMA 2FGWL 3FBKA 4I77L 5DMJB 5SWSD 3SKMA 1G94A 4Y9BA 2OXGB 5KS9B 1GSKA 2HLFD 3O8XA 2UY6A 1EZUA 1SEBB 2BVQA 1HI6A 2WUBH 1G0XA 1IAOB 4Z7UB 5EO0B 1EDHA 3NZ8A 4LARL 4Z3IA 2G5BB 2XIIA 1IT9H 1KEML 4W9IC 2P1YA 2F53D 3BMVA 4HT1H 1KBKA 3UAJC 5T3ZD 2XIBA 1AY1L 2GAZB 1T6VN 1XFPA 4N0UA 4OCWL 2R29L 5EIIG 3RX5A 2QSCL 1VLXA 5C09B 2FJUB 4GMTL 2XG4A 3VRLE 5DJYB 4KUZL 1AGBB 2V9UA 5D6CB 5BO0D 1NDMA 2L4OA 2IOOA 5I16A 4JG5A 4P5TB 3I9GH 1L9RA 3C08H 3H3BC 4G9FA 5G4OA 1E27B 4H8WC 4AEFA 4KUCF 1BM3H 3QEQA 3STLB 1G7JA 1J8HB 1A4JA 1T7WA 2VXQA 2XQBL 3PHOB 3VU2A 4CN1A 3CZKA 3TF7C 1H6FA 4EIBA 2EH8L 2Z7YA 5LAXA 1AZNA 4OZGE 3R0NA 3CMOH 4HEPA 2CNZA 2VDMH 2J56A 1ND0B 3DPBA 1MUJA 1L6ZA 1NOAA 4NBXB 5F93C 3SD2A 1A7QL 3Q43A 4EPSA 5J12B 1CE1L 3BP6A 4W9HC 1S5HA 1UJ3C 4HUUA 1AZRA 4MNGA 1ZLWK 4OQ1A 4QIRA 5I1KH 5A3ID 3GPSA 1D5XB 3AT9A 4B53A 3QDGB 3VXME 1J87A 1DSFH 5DURD 3IJYA 3KCPA 5F7BA 3WO3B 3KR3H 1ZSHA 1HVXA 5DFWH 2ZF8A 3VFNB 1QNZL 3EDFA 4WSJA 4FQQA 2V7HB 5HHVL 5ICZA 2F5BL 1SM3L 1TTFA 5FO8B 5LGJB 3F6LA 2LT9A 4UNIA 3PWUA 4WJKB 4ZTOH 1SOSA 1HINH 2J25A 5AYTA 2X10A 3GSNA 2AAVA 3IYLW 5CEZL 4M8RA 2BW5A 1I8KB 2VRQA 3QR1A 3P4NB 5EC1B 1EEYA 3GSWB 4U3SB 4G6KH 1C8QA 4JPVL 3VQ1C 2X4TB 3W56A 3IFOB 1YQ2A 3CFDB 4QKTA 3VGGA 5GS0L 4HH9A 1FJ1B 1AR1C 1FFNA 2VAAB 1IKFH 3GTTA 5EOQL 1BEYL 2LAGB 2IAMB 2F08A 3D39E 3OZKA 1AZVA 4XNYH 5SX4H 3S7GA 1LO3L 2BSSB 4HC1A 2WXLA 2CD0A 4LDLB 3GB7A 3QUZA 4KDWA 3CLEH 1BX2A 1ECZA 1I7ZA 2WHVA 4Q56A 5HVHC 3VW3H 3NIDE 2F1AA 3ETBJ 3O6KL 3CSFA 5F6IC 2M26A 4X6BA 4JFEB 1DVQA 4P4KB 3D4CA 2Y1VA 3OHMB 4GKSA 1CICB 1UENA 5E4AA 4U7KA 3SKUD 3MRLA 3TASA 4HK3J 1Q9OB 4XT1C 3EJZC 2BJMH 2J8UF 5E5MB 4D0BA 3QRFM 1C5CL 4U05A 5KYYA 5IT2H 1E5CA 2P8LA 2BCMA 1NLDL 2LVEA 3BEWB 1HHJB 1E6OL 1NC4A 2CUMA 5E00B 2EUWA 4CW1A 4GSUA 4LOVA 1HSBA 5E6ID 1BMWA 3MLRH 1HOCB 3OAZK 4MJIB 2P48B 2O61A 1H8SA 2CLVA 5IFJB 2WN2A 4PWHA 2GTWA 4NUQA 2VXVL 2Z35B 5EU7E 3ZVVA 5IESH 1ZKAA 5GRWA 4KI5C 1VFAB 1QO3A 1EJ6A 5FHBH 2KBGA 5AAWA 4J2QA 4FS0A 1OPGH 3LIUA 2MEJB 3QUXB 5CJBA 2XUWA 3AT8A 5B1BB 5E0QA 4MB3A 2DQEH 2NY1D 4JHUA 3EO0B 2MHAB 4BZ1L 1JDCA 4ELKB 4FNUA 4Q6KA 4ODSH 1IIIA 2YIHA 5EIVA 2N7SA 3LSOB 3MA7B 3LVEA 5EN2A 5FOBB 4RIRB 4QPEA 1RJLA 3KPPB 5CLYA 3S5ZA 2NUTA 4UB0H 2KT6A 3Q2CA 2H6PA 4LLVB 2NY5H 3ABKB 1XR8B 2K1MA 3P0YL 1UB5A 4NBYB 5G55A 1YHPA 5E8PA 2Y06L 4MMZA 1A2YA 3VU1A 5KS9E 4HMDA 5E6RB 1ZY9A 5D4QA 1JGLH 5DJ2A 4BZ2A 2VOTA 4YNYA 4MZ2A 3TURA 1YAZA 3CHQA 1GC1C 4LSVL 2XWTB 1R3IH 4V2BA 4IBTA 4M7ZC 4NO2B 2AK4B 3L9YA 1RUAH 2JJUA 4L9LB 5D70L 4K3DH 4Z0BH 5C09E 1I82A 3DX6B 2B9BA 1BQRA 2VLLB 1FQ9C 4R26L 5DTFB 3TT3H 1WCBA 3CQFA 3N44B 4QLRA 1RI8A 5FEBA 4APQD 1OOAA 1MPAH 1NMCC 5K9QI 4JANA 1S9VA 4AMWA 3DXAB 5EMYA 1P4IH 1BZ9B 3EYQD 1MCRA 1B0GA 1S7VB 5CILH 3TPUA 4NDMA 1W72A 4P5KB 1L5GB 3BWSA 5T1MB 3SKOA 1J8HE 3T0EB 2RHEA 3I85A 5D6DA 5DLMH 1U93B 4NWTH 3ZT5A 2I7SA 1R3HA 1DDTA 5EIIB