3QZNA

Staphylococcus aureus isda neat domain y166a variant in complex with heme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
ATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINANHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron-Coordinating Tyrosine Is a Key Determinant of NEAT Domain Heme Transfer.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal binding protein
molecule keywords Iron-regulated surface determinant protein A
total genus 26
structure length 121
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qznA00
5D1QE 5D1ZI 3QZOA 2E7DA 4NLAA 3QZMA 4H8PA 3OVUB 2H3KA 2K78A 2Z6FA 3QZPA 4H8QA 2O1AA 5D1XE 3QUHA 3QZNA 3VUAA 4MYPA 3QZLA 2MOQA 3SIKA 2O6PA 3S48A 3VTMA 3RURA 4WJG3 4YMPA 3SZ6A 2ITEA 3RTLA 4FC3E 2ITFA 2Q7AA 3SZKC 3QUGA
chains in the Genus database with same CATH superfamily
4L48A 5IROA 2X4TB 5HHQB 3PNWA 3R1GH 1K3IA 3KPPA 1JVOA 5JA8B 4XPFH 5LGKA 2QADB 2CRZA 4BELD 4EQ2A 4HW6A 3O0RH 3L5XH 2VABB 1U36A 1SLVA 3NUKA 1AZCA 1HHIB 5EC2A 4QRTA 1KTLA 4ZUVA 4AJWA 1G7PA 1TEFA 3CFIC 4XP6L 5AAMA 4AZ8B 1E5BA 3PL6A 2FX7L 2P47B 2WMPB 4OVUA 1OE1A 5FO9A 4WGWB 5DJXA 5GGRA 4EN3A 2QHRH 3IPEA 3FT2B 1BEYH 2WNWA 3AMLA 3MRJB 4GH7B 2FJSA 2MNUA 4XP5H 2EE2A 3MRPB 4PLKC 4HS8L 4PY7A 5FCUH 2BH0A 3G9VA 5E2WL 3V0VA 3GGWB 4FA6A 2Y6SD 4GAGL 4M1GH 4X6FB 3RWCB 1WP6A 2G3NA 2I7OA 1HC1A 5EN2A 3FO9B 3FUJA 1AGCB 3F7YA 5CWSA 3E8UH 3HFMH 1CFVH 4OR1A 3DROB 5BVPL 3UIZA 4QY8A 4KX8A 4Z7WF 1U8NA 2Q76B 3T65A 4YHIB 2O5ZH 3C5JA 1NAKL 3BUQA 4X8JA 3S3JA 5TQ2L 5AB1A 3GXIA 3S88L 3SBWC 3L5JA 4PTUA 1C1EL 3OB0H 2NT1A 5DUBA 5F2FA 2R2BA 4X50A 3V7AG 3ZSSA 3O2DH 1PJWA 1MWAH 4JHZA 5HGGS 4XXCC 3D30A 2F61A 1CTMA 4NBZB 4UU9A 1OP5H 3IMRA 3QEGL 1P6FA 4TVPD 5F1OB 3ABKB 4XNMA 1A6UH 2CIKA 5E6IB 1I7RB 4WV1B 3A0OA 4QRRE 3IGAB 4MXWH 1KJMA 1NMAH 2NY7H 1YJDC 4LBEA 5GS0C 4KKCC 3ZTNL 5B7MA 5IY5B 4U1HB 1GY1A 5H8DA 1E3ZA 4WK4B 5DHXB 3PWPB 4B9GA 3FU5A 3G6AB 3C12A 4R3SA 3NJMA 1JPSH 3ZDWA 4TL4A 3IJHB 3E9TA 2WLHA 4BUQA 5T1LD 1OANA 1UA3A 1AD0B 3FMGH 3M45A 1JRHI 5KW9L 1E9OA 4F2MA 3GI9L 5CIPH 2OL3H 2CGRL 2PR4L 5HD8C 4Q8BA 2WXFA 4BCYA 2JIXA 5JW3L 1F90H 1FNGB 1IIIA 5GHWL 3FQTB 3O6ML 3VA2C 2FX7H 5C0DA 4RISL 3PL6B 4XNQA 3GJEB 1IARB 3QCTL 4OM0L 4KJYB 5TE7L 3NAAH 5LCVA 1X5XA 1VFBA 1I1AA 3QQ3B 5E7FA 2AJUH 2WVVA 3D3VA 1J8HB 4P2RD 3B6SA 4PRNA 4HYTB 1IAIL 1M56B 3QJOA 4XPHL 2JK5B 2Y7NA 4NQUA 1NWOA 2PTUA 4XP6H 5TD4A 1GKOA 5J3HD 2KYIA 1H15A 4RQQA 1RU9L 3U7YL 1A9EB 2LGNA 3PWVB 2KZ1B 2X1QA 2BNQE 4N3UA 3KEHA 5F96L 2PN5A 3UJJH 1ZA6B 3JUYA 2AEQH 2PTTA 1KEMH 1WFJA 1C5BL 3OHMB 1IBGH 5IHZB 1XZ0A 4KKZA 1I9IH 1E8WA 1NC4A 2DYPB 4KO6A 1TMCB 5C2UB 2UVEA 2Z7UA 3HZVB 1A3LH 4BJLA 2YXWA 3VRIA 4ZZFA 4P05A 3KPSE 5FKAB 2AS5M 1NPNA 3RUGF 4KO7A 2CIIA 1N18A 2NZ9C 3GJFK 1SMAA 3BW9A 1L9SA 3W1ZA 1P1VA 4OGXL 4XXWA 2WBJD 2P5WA 5MERA 2G30A 2EICA 2PO6C 1OSPH 1ED3B 5FECB 2PYEB 3ZTDC 2VITB 2NY5H 3H3BC 3LEXB 3SDYL 4GSDH 1GW6A 4QOKB 4UV7H 4Z77B 4FFYL 4QJ4B 5K69A 2X44D 5I15H 1D5MB 1HWHB 1N5AB 5D8JL 1SBBA 1AR2A 3I6LD 3V0FA 3ZJAA 2F2HA 2WXRA 5HHOD 4W4OC 4KZ0A 5KG9A 2NT0A 3C5ZB 5AYTA 2P5ED 3DXAA 5BV7B 4HOZA 3TCXA 5E9NA 1SXAA 1PLAA 3VM7A 3DUUB 2XG4B 4RRPM 4FOMA 5DEGB 3FAWA 4CVXA 4Z3FA 3HLAA 1S7RA 3MSPA 1K5NA 4KX9A 3SJVD 2CLRA 3QJHB 4GYBA 4NRXB 4JX0A 5IMOA 5FGCE 3HG2A 4PJEF 2VJ8A 4TUOA 3RVVC 4DOHE 1QFWI 3LZFH 4E9SA 1S7XA 5I73C 5I24A 5MI0C 1K6QH 3QQ4A 2DWSA 2Q8BL 2VLRB 2AFNA 2BIPA 5A3ID 1PCSA 4ELMB 5KYXB 4IBSA 5T1JA 4X9HA 4QHNA 1KJVB 4TNEA 5AZ2H 2X1PA 5FEBA 3VFSA 5ES4B 3V7MA 4MMYA 5BQDA 4JHWL 1KEGH 2EO9A 3PCYA 3MV9D 3ZR5A 3S2CA 4IRSD 4OLVL 3U9UB 5EWIL 4GKNA 4MCZA 5EU6A 1XXDC 1LE9B 3A4FA 4WDIA 4ZSOE 4KNTA 1XH0A 4PUBH 3GLAA 3DARA 5DJAA 1PLGL 3LH2H 2IQAA 5TQ0L 3REWA 2E9GA 4WEMB 1YN7B 4PJ5E 4LBAA 1BM3H 1XGTA 5GRUH 1BECA 1GS7A 1M7UA 3DIFA 5GISH 3SE8H 3WNMA 1UQSA 3PWNB 4XVTL 2VLLB 3UJTL 1T1WB 3FCGA 5D1QD 3BD3A 1OF2A 4ODVL 4DPAX 1CFSB 2O5XL 3WXVH 2MQCA 4K2UL 1XF5A 4KI1A 3S6CA 4HPHA 4YXLL 2GJ6E 2OYPA 1K9TA 1TZGL 4PVLA 4YN3A 4NSKA 4D9QE 1CBJA 1QHQA 2VISA 3ARED 5AKSA 3RGHA 1AANA 3PJSA 4KX7A 2K6YA 3ZE2F 5BO1H 5G4OA 3OAUH 4Z77A 1MDAA 2F54E 2HA1A 3AAZB 5D8JH 3K6IA 2XKSA 3BP7A 3K4ZA 4FE9A 4PI0A 4FADA 5BMFL 4BCZA 1JERA 5J3HC 2WP3O 4LPUA 3K6SB 3TPUA 4N0CC 4WJ5A 4PMFA 1DJGA 2B3RA 4UNIA 2GBUA 3RWDB 2HJLA 1GHFL 3D0VA 3O9WA 5KSVB 4JY5L 3SN6N 4PRIE 2OW6A 2HT4D 4FQXC 3VFNB 4HFWB 2IANA 3Q2LA 5JHMA 4WIQA 3FQUA 1BBJB 4Y4FC 3U6RA 2CDFA 2AQ2A 4FTVA 3NTCL 1HXMB 3LRKA 4XXWC 5FHAL 2ZXGA 5I9QB 5GRJH 2HFEA 4Z8FL 4Z7WE 4YSUA 4J3OD 2ZOWA 4N2CA 4FC3E 5DFTA 5H94A 4HOWA 2J21A 4H5SA 1TQTA 3IRZA 4IOFC 4EMZA 5E4AA 4HSQA 1NMCC 4AIZA 2G9HB 5D6DC 2F1BA 2LU5A 4H20L 4B60A 3T3ME 1IBYA 3RILA 3LKQB 1T20A 4WEBH 2EXTA 1XH2A 3NCWA 1BP3B 4L4TA 3B5GA 3LN9A 2IWFA 4EUPH 4ETQB 3BEVA 1MCPL 4NYLB 3ZGIA 4CMHB 3Q7JA 5C0EB 1XMWA 2BWQA 4NO5B 5AOJA 4G8EB 2VQUA 4XNQB 1EHXA 4MAYC 1LM8V 2IO5A 3NK3A 5E8EA 1CE6A 2WW8A 3AT9A 5FGBA 1T1ZA 4P2RE 4I18B 4M9OA 5IEKA 1WFUA 3F2LA 5D1ZC 1MQ8A 4M5SA 1OAUL 4GSRA 3REVA 2OAAA 2AKRB 4JFEA 3VXMB 1EEZB 3V10A 3BVVA 3CQFA 1T3FA 4WI5A 2P44B 3IFLL 4H8WL 3SZKC 4IRSA 4YZWA 3O3EA 3O41A 2DWXA 4BE6A 3LXBA 3LPPA 3FRPG 1JP5A 4U1SA 3F8UB 3L13A 5ICXB 2UX6A 2XN2A 5JW4Q 3WN5A 3T0DA 4ICXA 3H6JA 5HHPB 2KKQA 1E2ZA 2W8CA 5BRZE 3MLVL 3ISRA 2XN9D 1A6PA 3CFKA 3RNKB 1DYZA 5CBEB 3CFDA 3LKNA 3RDJA 4CADA 3ABMB 4MNHB 5BVJA 2VE6B 4IMLB 3T2PA 2H6OA 4KI5C 43C9A 2WBJA 5DRNB 2WQAA 1U3HA 3BVXA 2PF6A 4IDJL 5GZND 5DZAA 3TBBA 5EU3B 1FAIL 3EHBD 3PHQB 5D1ZI 1U8CA 4XZ4A 3C8DA 3T65B 2RBLA 3TPUB 4N1HB 2CO4A 1EZSA 3VD4A 2EE9A 5D1QC 2EXWC 5EO0A 2JWYA 3E6HA 1T03H 1I8IB 1ZTXH 4A7VA 2JELL 4ENEC 3RUGE 2KZKA 1N6UA 1N5YL 4L3FA 2IAMA 3RUGB 3WJJC 3CVCA 5SX4I 1LO5B 1VKXB 4JM4H 3GXUB 1B4LA 1VEOA 1KY6A 1M7IB 1ZSDB 4YBQC 2HH0H 2VXTL 4JVWA 5EUKB 4JVUA 5HGDB 5ABAA 4MJIE 1GJWA 1CPUA 5E0QA 3Q8EA 3O3BB 3MRJA 4NI3A 1P7HL 3IBOA 3PQYA 4H5SB 2P3YA 3O45B 1CN4A 3B5HA 4AG4L 1WCQA 3P2TA 1NOFA 2ODHA 2PO6B 5BRQA 1HCYA 2WMPA 3WY2A 3OHXB 1MI5D 5I8CA 3ARQA 1SY6L 2VR3A 5T5NG 2FJGB 4YHKH 4L9LC 3KBHE 2HT4C 3KPRE 3CXFA 4XE0A 3T0EB 3CSGA 4EZJA 1YECH 4PJ7B 4X2UA 4C83A 3CLFH 4HWEL 5DWUH 1CS6A 4B9IA 4ZMZA 5CBAA 5D6DA 2Y36L 2HJLB 3O9WB 4PQXA 3RPBA 4PY8I 3QORB 3CFEA 2HPTA 3VYNA 3I6KB 5IREA 1E9PA 5L4IA 4J3OC 2A9BA 3V0HA 3FN0H 5E23A 4JHUA 2BC4A 4YC2C 2OM5A 3MV9E 2GAZA 3ZZQA 5E8OA 2Z92B 1ERNA 1N3NA 2Q1EA 4XPFL 4Q97A 1UXLA 5KZCB 5DURB 1ZLWH 4JFTA 5TK4A 3OKNA 3WNKA 4ZT1A 2DI9A 4KVNL 1SJEA 2W0FB 4BXVA 4JDEA 2XG5A 4ONOA 35C8H 2O30A 5G5DB 5B4MC 4FEIA 1CYXA 3UJIL 4Z5RB 1N12A 3MJ9A 4PSRA 4OCSL 4TSBH 3IDNA 1VFMA 4F8LA 2BS9A 2YC1B 4BA0A 4UT6L 4XHJD 1E40A 1A8JH 3EJPA 5CINH 4XMVA 4BWTA 3WFEH 4MAYD 3T1WA 2OJ1A 4HJJH 1DO6A 1TITA 3G5ZA 2VTFA 3KS0J 3MPCA 4G59C 4ZO8A 2C9VA 4M7ZB 2P8LA 4PJFA 5DVMA 3ECUA 3CZGA 1F58H 4R90H 3CDYA 3IJSB 4RX4D 2BSDA 3LKRB 4PTTB 3ZHKA 5I66B 12E8H 4DGYH 3PP3K 5DCCA 2ATAA 4FFTA 4FG6C 1XEUA 4ZFGH 5FPIA 4G5ZH 4S1DD 4AIZB 1E2WA 4FQJL 2WM0A 1ZCRA 4KTEH 4IK6A 2PYEA 3JYCA 1PF3A 2CU9A 3VXQB 2MFNA 5DK2B 4M5ZH 4FQXA 4LLAA 4W9ZA 5DQJA 5I1AB 4DN3L 4N2IA 3GBMH 2EDTA 4U6YB 5DZPA 3MRFA 1QZNA 3N42B 1KCWA 1MNUL 4PJCF 2AEPH 1S7SB 2Y69B 4QUOA 3SKUD 3C8KA 3OJVC 5CILH 3UBXA 5E08H 3VRIB 4NDMA 2O6PA 4JM4L 1MFAH 2ZNXA 3ZUNC 1BWMA 1E67A 5C09A 3TGXA 1EZVX 5D1QA 1FHNA 1YEIL 4WNJA 2B20A 2DMKA 1A0QL 2PTTB 1MJJB 2V4LA 1YA5A 3A6BH 2X42A 1TQCC 3Q8BA 4YO0A 2IF7A 2ZKWA 3W56A 3ZYOA 3EHBC 1O75A 1VERA 2GYSA 5IVXE 1A9EA 2BVQB 3BKJH 2VXUH 1IC1A 2EXWD 4N0UE 3EGSB 2LU3A 1Q94B 3F65A 3G5XA 3CX5J 3GZQA 3QQ4B 2W80C 4FNQA 5CJBA 1YAZA 3MCLH 4UAOB 3MGAA 2ZCLH 4WFFE 2VDRH 3GBEA 1ZSHA 3D3VB 4JL1A 4PRNB 5TE4L 5FOBB 2HVJA 2K7PA 1TO4A 1XIWC 2GTZA 3BLPX 4NLHA 4BUGA 2XPGB 4RNRA 3TYFB 4NN5C 3J27A 5D6CA 4CVXB 5T1DH 2ERJC 4W9DC 1OGPA 4HJGB 1NFDA 1ND0B 1SOQA 1FNAA 4N28A 4ONHA 4RIRB 3ZDYB 4NN6B 3KDMA 4I9WE 3T8XA 3RJQB 3AUWB 2WNKA 2XETA 3FQ1A 3KL3A 3JVGA 1FI8C 1FIEA 4ATWA 1CGVA 1D5IH 1D5MA 5GRVK 1DBBL 4C56E 5E4EB 4P2YA 2HB0A 2PXYA 1JRHL 4ZOBA 4YDJA 4JFFA 5F1SA 2AQPA 1NBQA 5JDSB 2V37A 1OCOB 1MCRA 2EIZB 4WHYH 1QOKA 4Y9BA 2XPZA 4I85A 3ZTCC 4CGUB 3ZDZB 4ELMA 4AM0Q 1XBRA 4K8RD 1IKNC 4Q7DA 1KDIA 1KNOA 2DJMA 5KBNC 4OF0A 4IGBA 4WWID 1KPVA 3HRZB 5AOIA 2JK5A 3BW9B 3MRRA 1DN2A 3QA3A 3ZMNA 1AHWC 1H19A 2Y7SA 2VR7A 2VZOA 2Y5TB 3K46A 3P0GB 3VD2A 2FBJL 4LNVA 1IX2A 1CICB 5CD3B 5FDWA 3AREB 3DV6B 4Y2OA 1BV8A 4NZRH 5DVPA 4RMBA 4RZCA 5C0IA 1R34A 2XG4A 3WNJA 2K4AA 1EHNA 1PKQB 4TSAH 3V4PH 4K23H 3DX9B 2F54B 2AMGA 3QJFA 3QZMA 4TNVK 4E68A 4K3JL 1PZ2A 4Q2ZA 4WVRA 4PVBA 2XY1A 5F7UA 5H35B 2DKSA 1KB9J 3DURB 5LB1A 1AGCA 3F7YB 2H26A 5IQMA 5K9JL 4OIAA 1IAIM 2DJSA 4M7JH 2J1XA 1S9VB 2PW2A 2NXYB 4Y2NA 4Y19B 1FO0A 4XXDB 3BAKA 1LO2H 4KOBA 2EH8L 3TPKA 3VXUD 1M1XB 1ZT7A 4X5WA 1SJXA 3AQYA 3CQQA 4J4PC 5DVLA 4EBQH 4DKFL 1YYLL 4KKAD 1E6JL 5EF2A 2DMHA 4PLOB 2F8VA 1ZS8B 3NIGE 1HZHL 1I9EA 5AAPA 1JI1A 1GPOH 4KNSA 3Q48A 5D1XE 5ENWB 4W6XB 3NJVA 5AVZB 2MOQA 2DY2A 4YL9A 3CCHA 1ZLVH 3NJNA 4YPJA 1XF3A 1AAJA 2CZNA 5A2FA 4PJ8A 4OY9A 1JD9A 4N0RA 5IEHB 4TLUA 5JPMC 1GMEA 3SE4C 1LTXA 4JHBA 3SODB 4BFBD 3I3BA 4V11A 1CLVA 4J28A 4GRLD 2OXGA 2R2HA 3CWGA 1AZNA 1UA7A 3CZNA 3PWUA 4UQ2A 2GTQA 2OMYA 5DFVC 3WD5L 3HNVH 3ZN6A 5C0BB 5KBLA 5CSGA 1PCXA 5FC9A 3AQDA 4WO4A 4OZIA 1L9OA 4MD4A 2GIYA 2YN5A 3RPKA 3ES6B 3CK0L 4NJAL 4IRZH 5HHOB 4LCCC 5EUOF 1ZY9A 1F45A 2XWJB 1CBVL 3ILQD 4LCWB 3WGUB 5C0RH 4WFED 2AEWA 1KJ3H 3MNWA 1ZLSH 4XPTL 5J06A 4JPVL 4EZMA 2R2EB 2WINB 1U8OB 1FPTL 4NOBA 2VN5A 3GSNL 3AGVA 3H9SD 1ONQA 2WLJA 3C5JB 1QA9A 3U0TB 2Q8AL 4DCQB 1DSYA 2BOBB 3SPIA 4R26H 4EVNB 2W94A 3LSOB 5F0PB 1AFVL 3DJTA 4AM0A 1JS4A 2OPCA 2VAAB 5DEZA 1F4YH 4TQIA 5H2BB 1A4JA 4PS4L 4XPTH 3RWCA 2FWLB 1BSIA 2PXYD 4E9XA 2XN9B 5DQ9B 3S96A 1ZLEA 4F7EA 4WWPA 3UO8B 1OARL 3KE0A 1TENA 5I1KH 1KIUA 5IJBC 5DHVB 4KXBA 4JRWA 4GG6B 4KJPD 4P2OD 5FYKL 1ZJAA 2JB6B 3P9LB 1NCCH 2HLFC 3S98A 4BWWA 4DCQA 1TQSA 1JZIA 1S3RA 4JY4A 4A55A 2Q0ZX 3BPLC 4R0LC 1VB9A 2C34A 1Q0XH 2B8OT 2GK0A 4AL8H 4RZCB 5IVXA 1F4YL 2K0RA 4YSRA 4AZ8A 3HAEG 1A7PL 4RBPK 2YJQA 3A47A 1MUJB 4LPYA 4NN5B 1LK3H 1HOEA 4Y5XB 1B9ZA 5LG1A 3RNQB 4PTUB 4LAQL 3W9EA 3WEXA 4JGNA 1TO5A 2VABA 3QEQE 3U4AA 2ICWI 3POCA 1P9MC 5ACMA 2Q76A 1HHGA 1NFIB 3W81A 1Z32X 4ABQA 2Y25A 4ZFOB 2AEIT 3OWEA 1KNOB 1PBYA 4POZC 3RG1C 1YY8A 2X4RA 3V0AC 2OMYB 3WJMB 2XOTA 1RUML 4XO5A 2ESVA 2IIJA 1JGIA 2VLKD 5EU6E 2VLJE 4UUJA 3TZVD 3RFZA 5GSRA 2NR6C 3MRPA 1I1CA 1OSZA 2FUTA 5HGAB 4N85A 4L5FL 3FT2A 3B8SA 5FA4A 4IIZA 4YDLB 1CK0H 3ATAA 4FXLA 5GS2H 5ICYB 4NQDB 4H1LB 1F13A 4RGMC 2ITCA 2R69L 2BSBA 3ESOA 1RMFH 5J6HA 4HJGA 3D33A 1KTCA 3H3PL 3VXUA 2XY2A 3GRWL 3MV01 4KKAC 3FFCD 3OV6A 4IKIA 2CBOA 3LQAL 2XWRA 4LU5L 3IFOA 5ADPH 5ID0A 1FNFA 3HN8A 1QR1A 2XDHA 1O6SB 3VFPA 2XCMC 1CFNA 2WLZA 2GITA 4YVNA 4L3AA 6PCYA 1DFBL 1UZ8A 1YUHA 4HV8B 1D9KC 2BJML 3WDIA 7FABH 1TJHH 5DJDB 1UM4H 5IJDC 4MFHA 3RWHA 4RGOL 5CEYA 1MCQA 1N8OE 4YHYB 3OX8A 2VZUA 4UCFA 4ANWA 2A74A 3DX3A 3LS5L 4JR9H 4H8UA 1IQWH 3AZUA 1SBSH 3ZW3A 3IWUA 2OA9A 2WYIA 2P8PA 2CR0A 4NHCH 2J88L 2Z35A 3IMUA 1CICA 5TTRA 1D9KB 5JIKA 1OARH 3FOLA 4X83A 2D03L 5FX3A 4YS4A 2WQVA 2EDWA 1UJTA 4HDIA 5KYYA 3HZKB 4OM1L 3TJPA 2N1TE 1NCCL 4MBRA 1H3VA 5GSVB 2O5XH 4RSYA 5D7KD 3S37X 4ZS6D 4JLRB 4F1ZA 3NFNB 3RYMA 4GRMA 5AG8A 4NC2B 4KK6C 2H6PB 5F3HB 1TVHB 2JKSA 3LKOB 5B7FA 5T3ZL 4BM7A 4QRSB 3VO0A 5LGJB 4YDLC 4HWZA 2GQHA 4P8QA 3NABH 4XTRC 1IGCL 4EDXA 1M2OA 3I6GA 3F6IA 1KV3A 2AK1L 5I76B 3VG0L 2DN7A 3HJEA 3MJ6A 3AY4C 2FT6A 3D1MC 5BQ7B 1LO3H 2YXMA 3GPEA 3KAAA 1MLCB 1NGWB 1PNCA 3HOGA 5HGDA 3S3DB 5D2NB 2K4WA 3PS6A 5LUMA 4X9GA 3I9IA 4NRZA 2F7OA 3G3LA 3SO3C 4HP5A 2VLKB 1KCRH 2FNWA 1IM9D 3K4AA 4PWHA 1AMYA 3VFVA 1H0DA 3QZNA 1ETA1 4GFXA 1DTUA 2X4NB 4HZAA 2HKHH 4PD4J 2VDPB 5DFAA 4OLVH 5E7BA 3QUZD 3Q2VA 4OCYH 4U1JB 5JMRA 3QUXB 2D31B 1AKJB 4MDJA 4GMSH 3QUZA 2KC0A 2DIBA 2A83A 5DVOA 2FO8A 1MAML 2C3XA 2AQ3A 1F1DA 4XPGL 3VCLB 3V5HB 2R0KH 4X4YA 4C56A 1F4WL 1HL8A 3DIDA 4MDIA 4F7PB 4NQCE 1E9PB 3HZ3A 2KZBA 3ARGD 2AJUL 3QZBA 4PJEB 4M6OL 1L9NA 1ORQB 1KWGA 3BDYL 1HJBC 2QQNH 1N0XL 3MRBB 1RPKA 5DA0B 5AAMC 3LNGA 4F2EA 2EIKB 4GMSL 5IWLC 2AJ3B 2OR9L 1KIRA 5INCB 1NFDE 1WITA 1C5DA 3PRZA 4O5LL 2J8OA 5F7FA 2WXMA 4ZFZA 2K7QA 4U1GB 1JUFB 4QRRB 4XMKL 5MERB 5AUMA 3C6SB 2UXVA 4EO5A 5ANME 3W5MA 3N40P 2VM3A 3ZKMC 5AKTA 1OHZA 2WKOA 2WIIB 1KYAA 1T21A 3SGJA 1Q1PA 4W9EC 5DMYA 1BQHA 2P80A 2WJ7A 4UMGA 5IW6B 1V3JA 4YGVB 4PS7A 3P9WB 3S36H 2VLJB 1F3DJ 3JWNH 2R0ZL 4ZUWA 5J89A 2CRMA 4HAFA 5DHEA 4HD9A 3SDDC 5CLZA 4HJIA 1P1ZA 1FL5B 3U1SL 4UNVA 4O58L 5DZJA 1MFMA 4DZBB 3HC3H 4OGYL 2BHFA 1V54B 4LIQL 5D1ZB 3WJJA 4JREB 4PPTA 1HZLA 3ARWA 3UO1H 5DRWB 3WXWH 4F37F 2WSDA 4U1KA 5BXFA 1G7QA 3L3HA 5F8QC 4ACTA 2NW2B 2ICEA 1W0VB 3TEYA 1ES0A 1W80A 1WAAF 4OD1L 4P2QD 4RZKA 4PGCA 4KKRA 1IGCH 3DGGA 3TBSB 4XP1H 1QR4A 2Z4QB 1JZDC 1N7MH 4Q0XH 4X42A 1DBAH 2WZ0A 4OF5A 3MRGA 1CLZL 1QKZH 1NC2B 5I5IA 3PDGA 4IYKA 4TULL 2Z8SA 3LN5A 3HJ0A 1E7VA 2B08A 4K94C 2EDFA 4BSJA 3BRDA 1F86A 5AVVB 4U1SB 3SGEI 4KH9A 3WFCH 2HWZH 3N04A 1FNSL 2R1XA 3COOA 3CVHA 1H3PL 1RP9A 2GUYA 3FTUA 3X1NA 4DQAA 4PRHB 1BIIB 4IEFA 4HH9A 4HUMB 4OIIL 5LBSH 5I76A 2VLJD 5LN4A 3SDCC 2GBTA 3LXCA 1IGFH 5ETUB 1F3JA 4IU3A 4K3DL 1SVZA 4ZMLA 3FW6A 3DRTB 2DQJH 1KOAA 4TKWA 1WEJH 1W16A 3ZMRA 4CKVX 3GXDA 3QDMD 5GGSY 3A24A 5MENE 2YD5A 2C3GA 3FO1A 4TRPL 2ZKHH 2EZ0D 2ALAA 3ALPA 4ODWB 1AQHA 5KYUB 4G6AC 2BSSA 5T5FA 4XCFH 1D5XA 1BCIA 1C7TA 1XF1A 2FK9A 4GXVL 5IQNA 1AD9A 3QVAA 4Q89A 1DUZB 3V0JA 1I3GL 4FZEL 1DVQA 2C3VA 2E0PA 4FQPA 3OKKB 3LHPH 1DSWA 2WV3A 4KUZH 1EBAA 3KR3H 2B39A 2YK1H 3SY6A 1M7IA 5HGBB 1PG7L 1IV8A 4WO4D 5CZVH 4ETQA 1WCBA 4GKZB 2IAMB 3D2TA 3K3QA 2P24A 2HLAA 1NOLA 2K6WA 1HILA 4FABL 1AHWB 1EAOA 4KNUA 1AXSA 3GSXA 5I1IL 4JJ5A 4F7MB 1CGSH 2A74C 4WWKB 3SE6A 5DD0L 1BBDL 1C08A 2EO7A 2VDKL 2EDBA 3FU0A 3KR3L 4KKNA 1U8CB 4FQCH 1C5CH 2GHWB 3UP6A 1I7TB 1FZJA 1U92A 1BREA 3IDMA 4KK5D 3I02A 4PJIF 3S4SG 1N4XL 1Z9MA 1GCYA 5ANMB 5FYJD 2Q86B 4MNHA 5BVJB 3D4YA 1AGDA 4FTDA 4M1GL 3LZLA 5ESVB 1KB5H 3CFKB 4D9RD 4A7QA 5AYUH 4LP5A 1FFNA 4U3CA 2I60H 3E6FB 3IE4A 2VZSA 3FHEA 5DZ9A 3OSVA 5ITBL 3FTSA 1OAXL 4ZXBB 1L9RA 5ICXA 3TJEH 1MZZA 5DRZB 4W9HC 5DJ0B 4M7LH 4DKEH 4Y1SA 4K3JH 2BXZA 4QTHA 3WO3B 3QFGA 3FPXA 1T4WA 1CC3A 4U6HB 4XI5C 3DSNB 4Z7VB 5AQ0A 1WZ1L 4NKMA 4M8RA 1L5GA 2AABL 1I9RL 1HYSC 2XACC 3PV6A 3G6JE 3WEBA 4R9HA 5C08E 1P5UB 3ZYIA 3LX9A 2XQYG 4TNWF 4PGZA 3WIHA 2VDKB 1J1PL 1FORH 5EU7E 4HWEH 3EZ8A 4K3EH 4A7SA 4MHHG 3MLSL 3A6OA 3LH8A 4HD5A 5J7CC 4ZFOA 1JWUB 3ZE1F 2ZSVB 2ZOLB 4G6FD 1QD0A 3X13B 3L3GA 3MUJA 1Z0NA 3P30H 2GFBB 1MNUH 2G3ZA 2ZX9A 4WEBL 4N2GA 4OLWL 5C9JB 3LHPL 1ET5A 3H7BA 3EDEA 2X53A 3PUUA 1MUJA 1A1NB 4ADIA 3BVNB 1A6TA 2P7TB 3FUKA 1EZLA 4GAYB 3EDFA 2IH9A 4MCYA 1RUQL 2YS4A 4RRPG 4JKWA 5FKPB 4F8OA 3FCUB 4ZO6A 1BG9A 4GO6B 4LLMA 1JWSB 1E5ZA 4KKLC 1MIMH 1D5ZB 3T6WA 3TO4A 2JJSC 3FFCB 2BHZA 4O2FB 1UACL 1UZ6E 2WLKA 3P9LA 1UCBH 3CFQA 3U0PA 4HAKA 4DTGL 1BZOA 5C2BL 1QRKA 2I69A 4Z7UF 3TO2B 4G7QB 3BO8B 4YX2H 4LSPH 1HHHB 4FNRA 2G75A 3II2A 5DGRA 2A73B 4S2SA 3FT4A 2X0WA 1FCCA 4Y5VC 3QUHA 3VRJA 1O5PA 1PW3A 4A6YB 1A4JB 2X6CA 3OJMB 1RK0A 4EUPG 3FT3A 4IRZL 4JO3H 3HW7A 5F88A 4AM0B 1MAKA 2OMUA 2VGLM 3DX7B 3A4AA 2ISDA 3O4OB 1ZGLA 1J0HA 1NH6A 4A2EA 4JFFE 3DJSA 3ESUF 3CZSA 4GXUN 4FFWD 4DP1X 3IVKB 2BY3A 5IKCB 2EZ0C 3MUY1 3QIBA 4GKOA 1OW0A 2DM3A 4G6AD 4G5ZL 4JKLA 4POUB 4X6DA 4YAQA 4HC1A 5EZJB 1F8TL 5DEGA 4JPIB 1HL4A 2ADJB 2L04A 1O6VA 3K8KA 1KULA 2IGTA 1CIDA 5K9QG 2CRIA 2EIBA 4JZOA 3SDXB 3VAEA 2DPKA 1FV1A 5B1BB 4N2AA 1TKWB 1BXVA 3BSZH 4G2AA 2F68X 1FDLH 2YMTA 5C07D 3S5YA 1XGQB 4ACPA 3FQRA 1YNTB 1EAJA 3PAYA 4KK9C 4X4MA 3O3AB 4P2RA 3CFTA 4P5MA 5CZXC 2N56A 4S0HA 4OI7A 1PDKA 4UINH 1EGJL 3QR0A 1YDPB 3KH3A 1DBKL 2EUWA 3VI4E 3B2UD 4Z0XB 5F8RC 2E46A 1JNLH 2ICWJ 2DLEA 3QORC 4P2AA 3QNYB 2NY1D 43CAA 1FO0H 4M43L 4DIXA 5EEUA 1I85A 4PJGF 4M7KH 5JXED 1WFNA 3CHOA 4N2DA 1KPRB 3KPSB 4XBGA 2OTUB 4LLQA 1XZ0B 2WSPA 1YMMD 1K4CA 3FRUB 2GG1A 5JQHC 3GRGA 1U8LA 5D7IB 5IT2H 2GSIB 1MIML 1FFRA 3S88H 1WAAE 3KPQB 3VFSB 3CN0A 3V5KB 2J5LB 3EFFA 4DZ8A 4WY7H 3L45A 2WGXA 4LEXH 3RVWC 4M48H 2VIRA 4TQ8A 3Q1SL 3V4VA 4DVRH 4ZDHB 3T5WA 1AXTH 1A1OA 3EGXB 4WWOA 1QHPA 2DQUL 4OV6F 3W2DH 1YYML 2MKWA 1X5LA 1D5IL 2ITEA 2WQUA 1FYTD 1WBXA 3DX0A 2VC2B 4K9EC 3S5LG 4L8BB 4TMPA 3EUUA 1PKQA 2WUBL 1UVQA 2G3XA 3EYUH 4JGUA 4X6BB 4AVIA 1AH1A 1CYWA 1RERA 3WLBB 3SB3A 3DUUA 2CK0H 3MNZA 3LNHA 1NGZB 5C07A 5T3ZD 4XN1A 2B59B 2WP3T 4PJFE 2NW3A 3I9GL 4LSRH 4B96A 1AKPA 2Y5TA 3QZWA 1T7VA 2CH8A 4IU2A 5CEZD 4WSJA 4NQSA 2KZWA 2EDQA 3S4SB 3QA3B 2YA0A 1FIGL 4GQQA 4J1UB 1GSMA 1NINA 1LQBC 1UADC 2OMTB 1FDLL 2X70B 3MRNA 4QHPA 4LEOB 2XQ0A 2H3NA 2J6EH 3HMXA 1Z9LA 2MTPA 4FCHA 2ED6A 3F84A 2ARJQ 2N7SA 2RQ8A 4X0KB 4JFFB 1GGBH 2A6JB 3P02A 3UJJL 3RJOA 1EH9A 5D5MF 3KM2A 5I17A 3CHXA 2ZAHA 4Y4KA 1PMYA 3VD1A 4Y4FB 3T8VA 3N1MC 3S4SA 2XN0A 1EFXB 2J88H 3KPRB 2PCFB 3KDMB 3T8XB 4Q4IA 1A4CA 3NCXA 5CCKL 3S3PA 2ADIB 3E2HC 4P5TC 2HZHA 1OT4A 2YQ2A 3U7YH 1NGYA 4EN3C 2EIMB 4PP1D 4Y4HA 1JZGA 4I18C 4HWBH 1DJWA 3QO1B 2I9TB 1QX1A 1J86A 1AZVA 1IE4A 5CU9A 3L17A 1GIGH 1PKQE 4PJIE 1UGKA 3E7JA 2XPGA 2BSRA 5I0DA 2J5WA 3D0AA 2E7HA 4YR6A 1J8HD 1VGEL 3O3AA 4P2RB 1JNLL 3JTBA 3RBGA 5I1HH 3JTSA 2EVJA 4GKSA 1MJ8L 5E95B 5EC1B 4JZNB 4JFVA 1TJGL 2VIRB 3V0VB 2OULB 1AXTL 1V8HA 4OKDA 1S46A 3FMGL 1SHWA 3BZFB 5ILTH 1CMOA 3GSOA 1VFBB 4MRCA 4JZOB 2LE9A 4YE4L 2OL3L 3GB7B 5JR1L 4D7PA 3MC0A 1OKEA 2NR6A 3DSFL 2FLRT 3VGHA 1XT5A 5DJXB 5GGRB 2YGOA 1EHLL 2Y0SA 4BHUA 2XWZA 3KPSA 4G1MB 3GEFA 1FNGA 3M07A 3T8MA 1KGUA 4L4VB 3WO4B 1P2CB 2VYRE 1YEEH 4PGBB 2WLIB 4E9VA 3OPZH 3DX7A 1AQ8A 3OAYK 4ZAKC 3VGGA 4XVJH 3EGXA 3CHPA 1QG3A 1DVFA 5DO8A 2BNRE 4X6DF 1HQ4B 4HGWA 3X1EA 3QIUB 4HEME 4X6EA 3ETSA 3BO8A 2QJDA 1UGNA 4R4FL 5KBDA 2NY4C 4GEJA 4WW1A 3GSWB 1KJMB 4HUVA 4FKHA 2WSKA 5D7IA 5EG6C 1R5IB 4BSWA 3GMMA 4Y9GA 5D1XA 2Q8AH 2VXQH 4ETYA 3VXME 4PH8A 4XBGB 1TCMA 4H8WC 5JW4N 1JTPA 5I6MA 1BAFL 2H8PB 4Z3JA 5CP3A 2EVHA 2QPSA 3GHEH 4Z3IA 3HPLA 1CJYA 4UU9B 5HPOA 5IFAH 2Y07L 1J0KA 4NUJB 2NNCA 1UZ6F 4PJFB 4QYOA 1QYGH 4Y9CA 4FFYA 1CDYA 1EDHA 4Z7UE 2E7CA 5IQ9B 2ORBL 3HKZA 5H37A 2HFGH 1OWRM 3V5DB 1KB3A 1X7QB 4WUUA 3EJYC 4R7XA 2F15A 4I1RA 2H3KA 1BLNB 5L9DH 3UGXA 2C9UA 2X6VA 1MRFL 1I4FB 3MI6A 4ELMF 4DETA 4RFNC 1WG3A 1F00I 3WTUA 2V2XA 5IFJA 3K71A 3BRGC 4LHJB 4PRDA 1UD3A 3RKPA 4P0DA 3AITA 1CT8B 4FGMA 1INDL 3L2LA 3OWRA 4G9FA 4M61B 1T7YA 4X5LA 2YD4A 2YEQA 5MENB 3GSWA 3EAKA 3QP3A 3BYYA 3WJLA 4UWQB 1QFHA 5F7NC 4G43A 4HF5H 2F5BH 3GHBH 1ACCA 1IQWL 1Q0YL 4BZYA 3LIZL 3I6KA 3T0AA 3WXWL 1IT9L 2FEJA 5JXEA 4I0PD 8CGTA 3HI1B 3FU3A 4P5TA 1UXWB 2LLNA 3U9PL 2FDBP 2FIRT 3VW3L 3R0NA 2ADYA 4JRYD 4WI3A 3HE7B 4HWBA 4CVZA 3WIFB 4JJOA 5ANMA 4Q6KA 5K5YA 2NUTB 1EEYB 2D2OA 4G1MA 5JR1H 3FO2B 4GP5B 1BX2A 2WXQA 5AW5B 2BNUA 2CBTA 3GSUB 2A38A 4L5FH 5AKVA 1JWUA 1X9RA 1UASA 1VRSA 2D4DA 4IOIB 4BQ9A 1J9RA 1J1XH 5AZ2L 1EERB 5G2NA 5BCAA 5EZOL 3ME0B 4GW4A 1RZQA 2OZNA 5SWSA 2ZCZA 3SBPA 2FO1A 1BDYA 3D52A 3NFPB 4JPWL 4PJGE 1S7TA 5BV7C 3APCA 4ES8A 3OKOA 4FG2A 3WIIL 2VXQL 4XH2A 3TOPA 5FKPA 3ZU8A 2IWEA 1BMZA 4F91B 5B1KA 3KLAB 1ZLVK 3MGOB 3ZUCA 5F72S 1KXTA 2Y7LA 3GZPA 4LRNH 3M46A 3QDMB 5IWLA 5IHUL 3L3GB 1GZQA 2M2DA 2UZYB 3M17B 3O4OC 2Q6WB 3ECBA 4DFHA 1FFNB 3UJTH 1AP2B 4KH2A 2EYSA 1WGOA 4J3XA 4YZFF 2ZP0T 1KBWA 1I7ZB 1ZE3H 1FSKC 1HIML 5I0ZA 3IU4L 4KUZL 4JW3A 4OCYL 2YOAA 1JV5B 3IDGB 1HHJB 4CRPA 2H8PA 2OW7A 3RTQB 4JRXB 1SY6A 4IRSC 2IH3B 1J05A 1CL7I 4GLRI 3ZZ1A 3UYRL 1HCZA 4JO1H 2ZP8A 2CUAA 2QQKH 4PJFF 2NPLX 3WV0A 1BZ9A 3P3YA 1AHWA 1MRFH 2NY4D 1JZ6A 3TV3L 1Q0YH 4WLCA 4PV1C 3RWIB 3ZDXB 2YWYA 4QI3A 3HS0A 3B37A 2QEJA 3BP5A 1W0WB 1T1ZB 3TT1L 2IH8A 2IDTA 5EZLA 5KVMC 2XZQL 1MW0A 5IJVA 1X5JA 5HHOE 3EG9B 3S2AA 5ADOL 2BNQD 1CFQA 3CX5K 2P5EE 4HOMA 4WI0B 1W8EA 1LVEA 3U46A 3MV8E 5J6SA 5DURD 5BZDA 4P46A 4P3DA 2WQSA 3DO7A 3KHOA 4N0UB 2BIOA 1VA9A 5C71A 4UF7C 5EA0L 4MXVE 2OZ4A 5I8OL 2O61B 3U9PH 4BHUI 5C0JB 3RZCA 1VEMA 1I1YB 4GUQA 5MEPB 2V6HA 3FQ4A 2ADGB 3FRPA 2XZQH 4I8DA 5HJ3A 4CU6A 3FSOA 1RUKH 4J3WA 1UOLA 1KLFA 4RAVB 2EC8A 1MFAL 3QXWA 1LP9A 5IV2B 3TBYB 3OQ3B 1HE7A 2PNDA 4K5OA 1OM3L 3KWTA 4DZBA 3V0GA 3SPGA 4PVNA 4F93B 2YKLH 1J9TA 2HT2D 3ZE1B 4L9LA 4HUUA 4XAKD 5TGBA 4IBWA 3QGVA 4X7SL 2JKLA 1J5OH 1XF4B 5FF6B 4UDTB 3MCLL 5DD6B 3V8OA 1FVEB 4Z7NF 3R8BB 1DVFC 4R7VA 3TN0B 2N59A 3GMLA 2WPGA 1A4BA 4TV3A 3TBVB 5CEZL 5MEQA 1W0VA 5FYKD 3GHPA 4ZX4A 3O6LH 5TE4H 4TVUA 3FSWA 3UCQA 3D50A 3WY1A 2QQLH 5IHWA 5FA3B 3HS8A 5KVFE 3K6SA 2GIMA 1NCDL 2V0AA 4F9LC 3INUH 1FP5A 1OTSD 3G6DH 1YQ2A 4OFYA 3VCLA 5GS1A 4O02B 4H26A 2VERA 4C4BA 3RL2B 5IW3A 1MWAB 3B3IA 2ZCKL 4L3EE 3WGVB 4TOYH 3N41F 1QFWH 1QSEB 1FVCB 2LHAA 4XNUL 1P7BA 4TTDD 3KCWA 4TSCL 1TLMA 3ZDYF 2B1HL 3HG1D 4H1LH 5CJQH 5I18H 1FV1B 5AOKA 2Y22A 1MFCH 3MZTA 4WHCA 2AP2A 4PJGB 4AXWA 4N8VB 2WBXA 3ML9A 1BVZA 2A4EA 3EDDA 2D7TL 1SEBB 5AUMB 3U36B 5TH2B 2IOMA 3G6DL 3MLYL 3MRKA 3V0EA 2AI0L 1IKFH 1A7NH 3BAIA 3QIWB 3RAJH 3TJHC 3TEWA 2HRGA 4K7PL 4YHPA 3WLWC 2VDMB 3WFEL 2JNZA 3PHSA 4N87A 1ZXKA 2VDQB 2DWYA 3TN0D 5LBSA 2P5WD 2ZF8A 3V4VB 3NA9L 3IFNH 4OCSH 2VLJA 3MRDB 5EUOB 4HCFA 2BHYA 4P23A 4YHLH 2O5YL 3PP4L 1U2YA 2G75B 1CFVL 3QCUH 3BP4A 3ILEA 3BISA 1ID5I 4FD0A 5DD0H 4EIBA 4APXA 4YL4A 4YUEL 5DR5L 4U05A 1MRDL 3C6SA 4L29A 4AH2A 4DUWA 4QTFA 4KJQD 1AQDA 3I75B 4ZFZB 1BFVL 5GZNC 3QULA 2YKLL 4TF4A 2Y72A 1CFQB 1E0OB 3G08B 1VFAB 1Q9KB 4M7JL 1G9MH 2ADFH 1UWYA 2YN3A 1TF4A 5L4MA 4R0LA 3CQPA 5EZLB 1G9NC 4CMMB 5CSBA 2IWKA 1J5OL 2V5RA 3TVMA 2PP8A 4HS3A 3PHOA 3VD3A 4PGEA 4Z0XA 5C9KA 2YSSA 3HLAB 1RJYA 4PJEA 4FLRA 1DVSA 3V6ZB 4EBQL 3Q5TA 4MDRA 3ULAB 3EYVA 5T33L 3NRFA 4U1LB 4MQ7B 1CDUA 1QPXA 2CMRH 2DW5A 1P5VA 2BCKA 2XXCB 4PBXA 3CHSA 3DXAB 5JQIB 4Y7MA 1XGQA 2WVTA 1D7FA 3LPWA 2NQ3A 3QUZB 4IBLT 4U49A 3VU1A 1CGWA 5E0FA 2GIXA 1JF1A 2NOYA 5DVNA 5LNGA 2XQYA 2M83A 4EDWL 2VDRL 1CZ8L 1F2QA 4K5NA 3MLSH 5CZRA 4OCWL 4L05A 5FV1L 4IOSD 4N25A 4DERA 2V3EA 1YNTF 3B7UX 3ECBB 3WD5H 3IETA 3T77A 5TE7H 2Y5EA 3B9AA 3GC3A 5D70H 5HYSB 1XF2B 1NANI 5CINL 5KJ4A 1A25A 2G2RA 3QWQB 5I30H 2VKWA 2Q86A 3OXRA 3I9GH 4KI5E 4LSRL 3V4PB 4B9JA 1CGXA 5CZKA 3HB3D 1UOKA 3LKPA 3EDJA 4NQQA 1YY9D 3BMWA 3IKCB 2DMBA 4UQDA 3NA9H 3ZQXA 2A73A 4OZIE 5LCVH 4NCC1 4G8GE 2EDXA 3V6FA 1XD0A 4PRAA 4YZFE 4M29A 4WWKA 4LKXB 4G5AA 1RIUL 3MN8A 1FN4B 1AXSB 3MRQA 1HHGB 1NFIA 3TJEL 5IB4B 4G6FB 5GSVA 4WGKA 4QHLA 2HJKA 1EFQA 2I5YH 4NO0B 4ONGL 5G55A 5EV7A 4N8UA 1XCQA 4H40A 2OX5B 2BIIA 4E41D 4FI7A 4PJCA 4LARH 3IFOB 5DHYB 1FC1A 3EH2A 3F83A 5E2UH 3KL5A 1GC1L 5ID0B 1CICC 1U33A 3GIVB 1L0PA 3CFCH 4MXQC 3HFML 1PD1A 1XVSA 2YRPA 4HGKC 2MCMA 3CZKA 2AXGB 3KM1A 4NRYB 1WK0A 4ODWA 1UTDA 4H8QA 3MACL 1E9QB 5IBUB 3BT2L 5KSBB 1VGEH 1SHSA 1KIUB 3VU2A 2WBWB 4LVOC 2XV2A 2KS0A 1Z9SA 3WL9A 1IM3A 3DSNA 4P23D 4OZHE 2XA8L 2GITB 4WW2A 3H9SB 3A3YB 1GR7A 4MJ5A 4NKOB 3NIFE 4QF1B 4A37A 3MLRH 5HYJD 1IGIL 2P42B 4MA1B 3TCTA 3V7AE 2CO7A 2KUTA 3FT0A 4ZXBA 4LPTA 1TYJA 3V5DA 4BK5C 5J6HB 4N0FA 1HZHH 3TVMC 3EH5B 5C2BH 1U8QA 1BOGA 2D9QB 5IMMA 1UH4A 3PHOB 5C0NC 2J43A 3EJQA 3KLAA 1NEUA 2R4SL 1YHPA 1F1GA 1XCQB 4AGNA 4FNTA 3RFZB 2DKMA 5C08A 2YXVA 2V2TA 3K5SA 2OYMA 4UQ3A 1FZJB 2WKLA 3IDMB 2EC9T 3C09B 1M57B 3QULB 3N44B 4MJID 4XN5A 3V4VL 1WHPA 3VFGH 4H8HA 2AAAA 3UL4A 4HG4J 5TF1H 5I6LA 4B5EA 1KXVA 2YMXH 2WAHA 4FI6A 4XNYL 2FBRA 3P4MA 4PHZA 2GB2A 3V6FB 2JKWA 4EIUA 2XVGA 2CD0A 5KVDH 2YQGA 4BKLA 3OG6B 5KWYC 5EUOA 4PW3A 1A64A 2YKKA 5HVHB 2AJZA 4FA8A 4N9OB 1I9JL 3BQUC 1JE6A 1YEGL 4NXSA 3I3DA 3QARA 2LTQC 1LD9A 4HJ1A 1X9UA 3TH3T 4X98B 3EYSL 2YMXL 4TLKA 3D5OF 2DBJA 1YZZA 3KBPA 4QRQB 3MUHL 1D6EA 3TF4A 1KN4L 4FXTA 1SYSA 2A0LD 5T3XE 1TZIA 1Z3RA 2AEQL 3MV7A 1HSAB 2JI2A 5DD3H 2NXZD 3DX4A 3BQUB 4N2LA 3HC0B 1G7PB 1RJCA 4LHUA 3VXRD 3ZDYE 3BHBB 5A2IH 4Y5YA 1HINL 3MACH 2NRDA 2EYTA 1M1XA 4NHCL 4AYID 1ZLSL 1ORQA 3AUVA 4AMXA 3ZKXB 3EW3B 5D2LF 4UT7L 1KCSL 3A6CH 3HB3C 3EO1B 1KYFA 2CXKA 3VI3E 2EKSB 2H2SC 1QABA 2DV6A 4RBPH 1YO4A 4G42A 3P2DA 1MY5A 4NI6A 4PD4K 4AEHL 1J11A 3D48R 3IS1X 4M5YH 3MRGB 4Y2DB 3SD2A 1I31A 3GO1L 4HS6B 4AQ8A 4PG2C 4CN6A 4CL7A 3IPBA 3AREA 2Z64C 1MJUH 5CD3A 5KJRH 2X4NA 3E38A 4APQC 3OQRA 5E24E 1EPFA 5ENWA 1JV2B 4YPGA 4WFFD 2QZQA 2NW2A 3MO1B 2CO1A 4Y4FA 4HMEA 3BUYB 4L3EA 4AYMC 4OZIB 1I1FA 5EOCJ 4D8OA 4AL8L 5IK3A 5E1HB 1V27A 5I16A 4NP4H 2L8AA 5GRZA 2CDEA 2G5RA 2OXGB 2R2HB 4JFXB 4F2FA 3KPRD 5KJRL 3ZTEA 5FK9A 5HYSG 3MOBL 4HKBB 3ZXAC 5DUPH 4RLDA 4GQ9H 3V4VH 3IJEA 4MJ6A 3RTQC 1CFMA 3N5AA 1OTTC 3DOSA 1HK6A 3LXUX 4O9HL 3VWKB 1G7JB 1MAMH 3SKMA 1KXQE 1CF1A 4L9LB 1VENA 3DI3B 2J6EL 4X6BA 3ARRA 4M8QA 2QVMA 4WI8A 2E4FA 2JV6A 1BVKB 2A4ZA 2OP4L 4GRLC 4L8BA 2YQ3A 5EOCH 3QG7L 1XSOA 1I8UA 3VXSA 3S35H 1KLFB 2IPTH 1YPZB 3WTVA 1IE5A 1IEHA 3DNKA 5TQ0H 2XQBH 4GAGH 1X4XA 2H0JA 2PKDA 5C0JA 4RFEA 3TXAA 2XYBA 2EXYD 3VWJA 4OF6A 3QUYD 3L7FB 1JZJA 1T7XA 3HZYB 2FEDC 1HN1A 4KI5F 2BSEA 4ODSH 3FRUA 4PN6A 5GIRA 4QXWA 5KANI 3EG9A 3F7PC 4X0NA 3FHAA 3DPBA 4KQ0A 5IBUG 4OZIF 1FVEA 2XQBL 4C56D 4M3KB 1SLWA 4ZMNA 1UB5B 2W92A 4FMFA 1MVFA 3W11C 3VH8B 3ZZSA 2Q7AA 3BN9C 1JVLA 2JJTC 3GD1C 3F5WA 2Y2YA 2VSCA 4LMQI 4N2MA 4QHUA 4LSSL 4JR9L 5K1NA 4PLJD 2E27L 2VMDA 4U6XB 5HGAA 1FFQA 2KH2B 4RAVA 5JOPE 2K8MA 4J8QA 3QDHA 3T4YA 1ECZA 1UWXH 2G0KA 3E9UA 3LRSB 5ACZB 4LKCA 4NM8L 5ERWB 4FFVC 1HKFA 4GW5B 4YHMH 3CSYA 3D3VE 1A6ZB 2ESVB 2AK1H 1OGAE 2XLLA 3QZWB 4BUHA 4ZMAT 1XH3A 2L3BA 4WKXA 2IMMA 5IZ7A 1UEMA 4KAQL 5JHLL 3FU9A 2YBRB 1K72A 2L7QA 1DSFH 5F7EH 5GS0L 1YMHB 1IAOA 3FUFA 3NT0A 4QXGH 4OZHF 2RA1A 4AQEB 4MAYB 1JFHA 2E76C 5EOCL 4DF9A 2TRHA 4OSUL 3IXAA 1WAPA 1UD4A 3VFUA 3NIFF 1YYMH 1JSYA 1UEYA 4LVNC 3UYPB 5F9JB 1IB5A 3O6LL 3NH7L 4TVPL 1EIBA 4RFOH 4OCLC 2AQTA 5CP3H 5KUKA 4I0PB 4NBYB 2XV0A 1N0LA 1LLAA 4GAJH 3ULSB 4EIGB 5I75C 3MV7D 3DMMA 4NQVB 3LQAC 3QCVL 2ZP9A 5ITFA 1YUHB 1RK1B 3Q01A 1QRNE 1FE8H 2QSVA 4PRDB 4Z9KB 2Z0BA 1JHLL 2VN6A 2BCMA 3Q5YA 4M6MH 2BVTA 3FONA 2G5BB 4GUCA 1K4DA 1I8KA 4FXGC 3QIBC 2UV3A 4XRCA 1UM6L 3PAZA 3HAEB 3RTQD 3UBFA 3GRBA 1OTTD 3ALXA 3VXUB 3R8QA 3QPKA 1BMWA 3QS2A 5HI5D 4GT7A 5E6ID 1NCGA 4IGBD 4G43B 4AW4A 5BOPA 2FX9H 1CXKA 2YFNA 3ZBMA 2WXIA 2XV6B 3OLEA 1NCBH 4MA3B 1DZ0A 3VG9B 4DEWA 5E2TH 2GJRA 3U4EA 3LN4A 3QUMA 3DBSA 3B5TA 3DTUB 2IFFH 4LGRB 5EU7C 4NKMB 4ZMTA 2DDQH 3EHBB 2DRUA 4XVTH 3JYBA 4ONFH 4PB9H 1ASPA 2HT3C 2I60L 3RI5F 1G1YA 2VMCA 4G8GB 1X44A 5A2JH 4IBZA 4HS8H 1DVFB 1F3DH 3IWVA 3UO1L 1PG7X 5IESH 1RZ7H 3NOIA 4FXKC 4RGNC 4HIHB 1AGEB 3CDFA 4CVZB 1T03L 5LLIC 5DJCB 1ZGLB 4AMWA 1BGXL 3O8XC 1FNEA 2AABH 2J8HA 2RCSL 2X4SA 5F88B 4P06A 5G5DA 3NFSL 4L9DA 3IE9A 1U8PB 1D5RA 1JGUL 2WAQA 3QXTA 3WIHH 2PWFA 3ARPA 1NCAH 4PJHF 3BUTA 3WS6A 1URLA 4K5MA 3W11D 4IIQC 4TULH 1BWWA 5K93A 5LDUA 3DRQA 4LLDB 5IB1A 4HK3J 1RVFL 5GJTL 1V3MA 4WTZG 4RETB 3GSVB 4ZSOA 2I32A 4B7IA 5CBAB 1M71B 4GUPB 4ZPVA 1MREH 5INDA 2EUXA 2DYRB 5GS2D 3D87B 5FLUA 4Z23A 2H26B 3RHWF 1GC1C 2L7UA 4MAYA 4NAMA 4OU3A 2VOTA 5D7LA 5BUGA 1IAOB 1UUSA 1ZDSA 1T0NB 2XJLA 3UYRH 3P77B 5LGYA 3CAFA 4HH8A 5D7IF 5E4OA 3NIDF 3KYAA 4KGJA 2P46B 2VO5A 1BEXA 4QIRA 1DP0A 5ID1B 5I82A 3W9DA 1XH3B 3NCYP 1IC5H 3P9MA 3CSTA 3BAEH 3VWJD 4NYLA 1YEKL 1VPOL 1DDHA 2P8MA 3GI9H 5EIIG 1B0RB 3BH9B 4M02A 4PW4A 4Y4KB 2XIBA 5ACLA 2VLMD 4YC2B 3UJIH 3BWAB 4JFOB 3FUHA 5BO1L 4GG6E 4W70A 2A6JA 3H9SE 4U6VL 4HUCA 3MFGB 1VZIA 4HH9B 2NY3C 3WSQH 5C3LD 4TQHA 4XCEA 3NYKA 3GJFA 2IALA 5IB2B 2CR3A 3HG3A 4Z6AT 3K8MA 1BZQK 4MZIA 2R1WA 1H9DA 2JVUA 5DD1H 1NC2A 1U3HB 1PLBA 3M8OH 3U82B 3S7GA 4A67A 4KQ4L 4F5CE 3ZT5A 1IM9A 3O3DB 2JB5H 1CTOA 4QR7A 2CDFB 1E4XI 5GGSB 2QELA 5E8EB 3QIBD 2IGFL 1XAUA 3WI9A 1L0XA 1S9KC 5LAXA 3WN5B 5TDNB 5IQ7H 1UVQB 3LRLA 4H7VA 4RMTA 1A1MA 1QI3A 4TXVB 1ACXA 1UA6L 3IPFA 2QPFA 1OAQL 2DL9A 2Y2TA 1OGAA 4TQEL 3SDDD 5JOPD 3WTXA 1WUNT 3HBZA 3QWOB 4LCWE 3HG1B 1JBJA 1HILB 1A3LL 1NZRA 2IJ0C 1QBML 4BCXA 2PW2B 4HJ0D 2P9RA 3C9NA 3BOVA 3JWNG 3REVB 3TP4A 1P7QA 3SE3A 2OQJA 3MNMA 1DBJL 4GFTB 1A4AA 1W9XA 2VZ1A 4F7TB 1JG9A 3RPIB 1J8RA 2G3MA 3UABA 2F19L 2VWEC 2YPVH 1L3NA 1DBMH 4MLSA 4LK4A 2GSIA 4H0LC 5K59F 3WLBA 3MV8A 1C9SA 2WVSA 1QATA 5EB9A 1G0XA 2HT3D 1JUFA 2QQLL 4XC3H 3CZFB 5EZOH 5C0IB 4KV5F 1NGQL 3RVTD 2OTUA 4LLQB 4YLCA 5LWYH 5HVFB 3K91A 1R3IL 4ANXA 2J6WA 1OAZL 5T1KB 2VMJA 3NJIA 1EXUA 3BKJL 1EK3A 1MPAH 3Q1SH 3O8XD 3X14A 1RLBA 3AACA 5DJAB 1DVZA 3EOTL 2EDJA 1DBML 5C0GB 3CC5A 5KOMC 3EOBA 1K8IB 4WSGA 3HNVL 1KDJA 5L0QB 1UXMA 2JQMA 3CVHB 1XV8A 2YUVA 4PM1A 1R3IH 2H3NB 4I5BA 5B1AB 4I0CC 5F7DB 2JKNA 5J13C 4Q58C 1YNTA 1QUNA 4WUUE 4KROD 4NQDE 1EXGA 1TZOA 3D2UB 1NBYA 2JSFA 4KUCF 3A4DA 1Z3GL 4JN2A 4NQSB 3KJ6L 2RR3A 3GK8H 2EEXA 4FTVB 1DBBH 3CJJA 2B59A 1A21A 2MNWA 5J8OA 4XMUA 3G6JA 3UTPD 3ISYA 3G5ZB 2QKIA 1D7CA 4YNYB 1K5NB 3NZHH 3WSQL 1VADB 4HIEA 1KCBA 5E1AA 1KWKA 1BLIA 4QRPB 4CMHC 4EUPA 3HAEH 4RNRB 3TV3H 3ZO0A 2HMID 2R1YB 2DEXX 1G6RL 1BVNP 1UA6H 4KUCD 5AWNH 1EHAA 3M8OL 3T4AC 4J39A 3SCMA 5DS1A 1QFPA 2NX5D 3L2MA 3S0PA 3FH5A 3QK0A 4YWGL 3G5XB 3IN0A 5E1GA 5E94A 4ZMYA 2LLLA 2CA3A 2BVQA 1NMCB 3SO5A 1M7DA 4BWUA 1HHHA 5G4NA 3DOIA 4LHUB 3RJDA 3B9DA 5FW7A 2NY3D 4FHBD 3O2VH 5I9QC 2BM3A 4YDVA 1QWHA 1WJ3A 3HUJF 1UQSB 3PWNA 4ALAH 4OQTA 1JWSA 3GXTA 1R3KB 2FHCA 5BRZB 1IBZA 4IIQB 3POHA 4K8RH 2VN4A 5KVDE 2A2QT 2BOCA 1MJ8H 3WS6C 1X5KA 1LO4L 3UG5A 4OFPA 1F6AA 1NBVH 1LO0H 4WDIB 1LE9A 2BP8A 5DQJB 2KQMA 4AVJA 4KDWA 5D93B 2K8QA 4B9FA 3D4ZA 4JQXC 3QDGB 5IJKA 5T1KD 1FZMA 3L1FA 3WNLA 4URKA 3FAXA 3KWUA 1AGFB 4XCNA 4ATTA 1OAZH 4KKBC 5AG9A 2IGLA 3IGFA 1REIA 2QADC 3DXAE 1KGCE 5FGSA 5EIVA 4KZEH 2VLRA 4Q52A 2OKMA 3T3PE 4DP9X 4U6HA 4GSXA 4MHHI 1F2XK 2QGCA 3WG7B 5GRVL 3PHAA 4P57B 1L6XA 1WTGT 3QQ3A 4UYPA 4CSPA 4Z7VE 3ZL2A 1KB9K 2YAMA 2LW3A 3U1PA 3SEPA 4NOFA 2VLKA 1RZKC 3PGCA 3SPCA 4HIEB 1AIFA 1ZLWK 4B5ZA 8PAZA 2A1WH 3RGVC 5CAYB 2V7HA 3RVTC 5EBLA 3G6JB 4ZRGA 3KBFA 4G9FD 4PR5A 4M6NH 3DVGB 3TH2T 2JKJA 5EN3A 1IGTA 1KTRL 3MLWL 1DQDL 3WTSA 4ZMVA 4JE4B 3MKKA 4AOFA 1Q1JL 3OKNB 1YEWA 2LR4A 4QHKJ 2J6EA 1A3ZA 5HHVL 1D5BA 4BYHA 4A2FA 4FX5A 3BGFC 5D4JA 5F7DA 1QFUL 2VDLB 2ORBH 3WY4A 2FEEI 5DEFB 1EMTL 1NC2D 1YY8B 2X4RB 4XN4A 5E8NB 4ZTPL 4ZD3L 4XNDA 2W59A 4NKDA 4S0SD 32C2B 5DK3A 4I3SH 5BZXA 2B4CH 2OTWA 3BVNA 1Y1DA 2FZ3B 2AF2A 2HFFB 4GG6F 4G8FA 5HHNB 2BNQB 2GI0A 3LXAA 3LV3B 4WTWA 3V4UL 3ZKNC 3X11B 2W91A 4IMKC 5KS9A 1HKLH 4PB0L 3CZFA 1E28A 3BP6B 3UGEA 2H5UA 2YARA 4APQA 2R39A 1S9WA 3FQTA 4MJIA 4Z78B 3MZGB 1HVXA 3JV0A 3PFUA 5IB3A 5AB2A 1RZJC 2AJXH 2C1OA 2FB4L 3AB0C 3IMSA 3P11H 1DJHA 4QJ5B 2CQVA 4NWTL 1YEHH 4PRAB 3WS3A 5C0EA 3SDXE 3UZQB 5CZXD 3BEVB 1U9KA 1AD0A 4K7PX 1B0GB 2QL1A 5I1CH 4D9RE 3LKQA 3HE6B 1A2YA 1J9CT 1AOZA 5GZOD 1WIPA 5JW5B 1WF5A 2VMEA 4PY7B 2VT0A 3N0AA 2NY1C 2Z1KA 3O0LA 3PU7A 4MKMA 1C7SA 4N24A 4AQ1C 4NO2B 1ZHNA 4YE4H 3GJEA 3QZOA 2AK4B 5IHBA 3UTSD 5CLTA 5JHLH 1E4XH 1TYEB 1RUMH 1FLRH 1J5DA 2XQYK 3ARXA 4JKPL 1ZT1B 4MAUH 2X4SB 3KWWB 2BOLA 4JRXE 4L4VD 2UXTA 4L8DB 5DJCA 4ABUA 3QDME 3STLB 4EDWH 1ES0B 3EO0B 2X12A 3RVWD 5HHOA 3ES6A 4C57C 2V3DA 4EI0A 5BXFB 1U8KA 2ZOKB 4OFYD 5B3NA 4KV5E 3MAWA 3STZA 3OKMB 4Y16C 4PLNC 2EYRA 4QO1A 3NACH 3GF8A 1T1XB 3SGDH 1HI6A 1S9YA 4A2DA 4WUUD 4HKJB 4GAJL 4JFEE 2A99A 4L4JA 2LV4A 3NSJA 1XSJA 2BZDA 2AKRA 2EJ1A 4IQHA 4JFEB 2JQAA 5DD3L 5HDOA 1GGBL 1ZLUH 4F9LA 3BH9A 5DUJA 3HMWL 2QADD 3PWLB 3BWZA 5GS1C 4GJTB 4NWUH 1DDHB 4CNIA 4TUKL 2Z8RA 1BFTA 4XMWA 1RJZA 2G4EA 3QQXA 5JW4R 3G04B 4N22A 1A9VA 1SUHA 5D55A 3ARBA 4WNQB 4BFGA 4C8XA 3NDYE 4U1KB 4QT5B 3MXWH 1IO4C 1CE1H 2OP4H 4QWWD 1JGLH 1MFEH 5I8KH 1V7ML 3K80A 1IVTA 2Y7QA 3MA9L 2JB6A 3CTTA 3OAZH 4MRBA 4NS0A 4M5YL 4WU5B 2BWDA 4YXLH 5EU4A 2K6ZA 5DHVH 2IQAB 2V8LA 3M6DA 2AJYH 3K6OA 2ATKB 5B7EA 3JWOH 3RIFF 4BSVA 1OQXA 3AG3B 4Y19A 2TSAA 2CJUL 2G9KA 1BIIA 3V52H 5I1CL 3RDTD 2DJUA 4KMQA 4DQOH 5IP4A 1TTBA 4F5CA 1CXHA 4OM1H 2BOBA 3UTOA 5FUOL 1A66A 2HVKB 1S7UA 2HTLD 3EF4A 4PV9A 4G8IA 4KTDL 4L2YA 4H8VA 3VSVA 1R3LB 2NYZA 1TETH 3QQ9D 5F7HA 3U36A 1RH8A 1KIPB 4P9ML 3VI4B 3ARDD 3VFUB 5TPWH 4PJGA 2FQEA 4TUOB 3ROLB 4AXWB 5J11C 4NERA 5JW4M 5F89A 3RWFB 1D6VL 3VNZA 3IJ8A 4ANUA 1EEUA 3I9AA 1AO7A 4NNPL 1XCTA 4G7VH 3LNDA 1MCEA 2DLHA 3SGKC 5DC4B 3ASOB 1IEBB 3E8VA 3FFDB 1A7OL 3ABLB 4LSTH 3TA4D 1CDCA 1SVCP 1U3YA 3FN0L 4MCNA 2LU7A 2KLTA 1JVKA 4M1DH 4XWGL 5L8LB 4A2HA 1OVZA 5KG9B 1SEQL 4MA7H 1JGEB 1INEL 1TJIH 2G4GA 2VRAA 3ZRFC 3W37A 1IFHH 5L88H 4JPWH 1LEGA 4YBLC 2HKHL 5E8PA 3CMGA 2B2XH 1S9XA 4JO4L 4KRNA 4LOEA 4XBEL 3VXUE 4HVBA 4LGSB 2A9NH 4NT6A 5B22A 4RMQA 1QBAA 2FATH 4F7CB 3H56A 3RGVA 3IMBA 4JG0H 4HISA 3N41B 1FC2D 4QHUB 5IBLC 1TTUA 3NIGB 1Q90A 4NRZB 2J1YA 4QXGL 2EVFA 2H47C 3N44F 4HDIB 3T3PF 5E2VL 1F4WH 3PFQA 3T2OA 5B39B 3RIAF 4NHUA 5CZVL 5E5RB 1QFWL 3L7EB 1VCBC 3QNXB 1ACYL 4Z7VF 1P84J 2J2ZB 4NFBA 1PZUB 2A74B 3B2PA 1TIUA 1FHGA 1XWVA 4QYAA 3HZYA 4XP4L 5ABDE 2IH1B 4IRJB 5IHLB 2V5TA 3QW9A 4P4KC 4HLEA 1SXSA 4NO0D 1NCTA 5F9JA 3H85A 5DJDA 3ZRCC 5HY9B 1MHEA 3DGDA 4PVMA 1QFWM 1E4WH 1CGYA 4X99B 1TFHA 1QSFD 3EH1A 2VDQH 1VFUA 1I3UA 4NP9A 4X7DC 2E9BA 3AXHA 3DV6A 3H2PA 3MA7A 5TE6H 4HG4K 2WIMA 2I9LB 2NX5A 2JMRA 4L37A 5FYLL 5J56B 3VXSB 2YBGA 1Y0LB 1I8AA 2QSCH 1S7SA 1BVKA 3KCPB 2AGJH 2EILB 4R7NB 1DQVA 1WWBX 3CDZB 2AV7A 2YBRA 2V8MA 3LD8C 3VI3B 2OLDA 4L8CA 1S7UB 4QWWC 2QMKA 4XCCL 4LL9A 5BQ7A 1HJCA 2MOGA 4YLBA 2VW7A 4KMTL 1BFOA 4YDJB 2BIQA 5GSRB 5DXWA 2MWCA 3DHMA 1L4IA 5I8OH 4HUNB 1G9ML 4OD1H 1A7RL 5ERWA 3FS9A 1UZ8B 5FHBL 4GO9A 1KFAH 3JV5A 4YHNA 4I0PC 4PS8A 3BUPA 2C7UB 4DEPB 1IUZA 3G6AA 4DPRA 1FORL 3C5XA 3MRCB 2AVGA 1KTJA 3OGCB 3STBA 2ICWB 3UTSB 1QRNA 4DK3A 5DTFA 4AUJA 2CMRL 1AP2A 1KGXA 3SDXF 4OIFA 2IBBA 2X4OA 3EUDA 4JDTH 3ZR6A 1P7KB 3NJKA 2HWZL 2YD8A 3Q05A 3MJGX 2FD6H 1EHKB 4X5XB 1QSVA 4Y9FA 1IC4L 5FKAA 2WO3B 2QGBA 4UTAA 3BESR 1IZJA 2GTZB 3VUAA 5HYQA 2WYHA 3ARDC 3MA7B 1RAMA 2XC8A 3VXOA 4Q6IA 2G60H 4QRBA 2NY2D 2Q5BA 4KTGA 1E2VA 1CZ8H 1JGEA 1X3DA 5DGQA 2OYKA 3MR9B 3C2SA 3SY0A 4WW2F 1AGBA 5JOEA 1EA9C 1AR1C 4PV9B 3FHQA 3K6DA 3RWHB 4JFED 1WA1X 2Z65C 1MCWW 5I74B 3FO9A 4AIOA 2WXOA 4QOKD 2GKIA 2D2CC 2QQKL 3QYMA 3MXVL 4NZTH 1GZPA 2HUEA 1MOEA 5ESAA 2IPTL 1KENL 2ICCA 3L9RA 4OJYA 4MD0B 3EYOB 3K0WA 3K1KC 3HE7A 2CHDA 3KJ6H 3W3BA 2B14A 5B39A 1R5WB 4FABH 1E6OL 1OAKH 3BQUA 3APDA 4NN7B 3HE7D 2VL5A 3AQZA 4C55A 5C0DB 1FZKB 5E56A 3TF7C 2Z93B 4UT6H 5AW4B 2VDPH 3VXPB 1ONQB 3WMPA 1DLHA 3MNVA 3O45A 5IBLD 2CK2A 2GABA 4TSAL 4DK6A 1X4YA 4X98A 4M6OH 4HJJL 5D7JB 1WSST 2QDWA 4AE0A 5E8PB 2GJ6D 4LCUA 4KMTH 1LWHA 4FAAB 1ODUA 2APFA 4MD4B 3DPDA 1ZDQA 1HNYA 1BAWA 2DQDL 3ULVH 3QEHB 5I19L 3I6LE 4JO5A 1W72L 2F54D 1JPGA 3LZRA 3OB8A 1NEZB 4O2CA 1X5FA 5HI4D 3AC0A 2W60A 2X88A 2F8OA 2X38A 5CS7A 1BIHA 1QSED 4BEIA 1NBZA 3TA3A 1J8HE 1UOVA 1M3JA 3ZHDA 3BPOB 3SKJL 2D3VA 4P46D 2YAHA 3N9GL 3ZTNH 1JV2A 4YPGB 1QTSA 2R2EA 2WINA 1NMBL 4BK4A 4PRID 2IV8A 2RALA 5FS5A 3RWEB 3AXLB 3FB6B 1RLWA 3T3MF 2BNQA 4G8FB 4TPRL 4AQ8C 3NN8B 2GC7C 2HFFA 4YDZA 4X8JB 2RD0A 4DO5A 3IDUA 2BWIA 3WAJA 1EJOH 3J2PA 3US1A 3ZDXE 5C1MB 2J4WL 4J6RL 2CO7B 4QHKI 5T3XH 2Q9OA 5TQ2H 1SYVA 2QVTA 3P54A 3TBWA 4Z76B 2YMOA 1RZFH 4RISH 1MIEH 2QFPA 1NDMB 1M6UA 2JKXA 4R84A 1IKOP 1MFNA 2YGNA 3WKPA 5HYJA 4LEEA 4PG9B 5E4EC 3ZMEA 5KYNA 3S8FB 3FQ2A 2FJGA 1P2CA 4W9LC 3HHSA 2CPCA 1SHXA 2C1OB 1IM3D 3WFCL 3MNVB 4P5KA 4Z3HA 3UTQA 4APQB 1OLZA 4YHOL 3VVWA 1Y1UA 2VL5B 1U8OA 1KELL 3BZ4B 5SWQA 5J6GA 3QJTB 4KOCA 3LV3A 4XT1C 3QXDB 4TM9A 1RHHB 3BZFA 3SE4A 3KMDA 4KZDL 3NPSC 5AW2B 3WNNA 4CNIB 2AJZB 4XHJC 1C16B 5HYEA 5E9DE 2DQEH 3U6XA 1GZPB 4Z0BL 3N3EA 4IRJD 2EH7H 3SCMC 1AXIB 3JTSB 3O6MH 2NY2C 4EXKA 1T89C 3UZQA 5IB5A 1JYWA 1T1XA 5L2KB 1MQKL 2IAND 3ZKXC 1YEFH 1AR1D 2PPCA 3NQIA 4JFQB 2P45B 4OGXH 1MHCA 1ZIBA 3QUKA 2CALA 2EKJA 4ZX6A 4XPAL 1S78C 3VSTA 1I75A 5EO1A 4F15B 4GBXB 1NGYB 4KKQA 4XPHH 3DTDA 4OI8A 4S1DC 2VE6A 3WLWD 4QCIA 1PYWB 4E9QA 4AKOA 2EH7L 1N67A 1T5WA 3G5YB 4PJ5B 3TU6A 3S9DB 1BOGB 5IMMB 4JQIH 3TN0C 2WTOA 4FFZH 2V7HB 5LVEA 4U1NA 1BHGA 2X4OB 4N6QA 1ETZB 4OZHB 4RH4A 1LYQA 1BA9A 5D6CB 3LY6A 5HYFA 3I2CH 4U0RC 4B50A 4UM9A 2UWEB 3FUEA 3X12A 1QVOA 3FK3A 3NSYA 4XN8A 2SEBA 4NPJA 3VMNA 5HVHC 2C4FU 2V5YA 1WBYA 3ZKQD 4DP5X 3TESA 1DLFH 3GO1H 3WNPA 1QPKA 4I3RL 3QQDB 5JLZA 3VGEA 5FR3A 1BJMA 1R3HB 3EGSA 3PGDA 1J7VR 2ZUXA 1EO7A 1GSKA 1EVUA 2NNXA 4KHTL 1Z5LB 4XBPB 2XWDA 3MBWB 4U4IA 3WKYA 4DT2A 5ISZB 4OFIA 2IDUA 4KVPA 3DX9A 2ED9A 4PJAE 3PV7A 4P48A 4YO0B 4D0CB 4EUPB 2B9BA 5B3JF 2E6QA 5F9OL 2X2HA 2L7JA 3KYOA 5C09B 3V6BR 2Z31C 5C6PB 5DHYA 2FJHA 2QBWA 3QFJD 3B4NA 5AD0A 3TVMB 5JOFB 1MCDA 2HKFH 5EWIH 2DM7A 5KW9H 3BPLB 4R0LB 4CMMA 2LQRA 1KJ2A 1BYNA 5IROC 4NKIL 3CZJA 1NANH 1G0DA 2XTJB 1Q94A 2W65B 3VFGL 3DBXA 1NLDH 3VD7A 4K94L 4N9GA 3C60B 5KEZA 4I5BB 2O1AA 3VD5A 1PQZB 4YK4B 4ELKB 1QMUA 3CK0H 4NJAH 4G8AC 3TWCL 5E94B 3UP1A 4Y4KD 3L5XL 2NNAB 5BRZD 3UMNA 2NTFB 1AC0A 5LBVA 5D1XC 5BJTA 4ONHB 5F3FA 3BI9X 3KWXA 3U2SA 2NY6C 3GSNH 4OCXH 1TQBB 4PRHE 1MKFA 1MSPA 3MODH 1ADWA 2GEQA 3RLSA 3H55A 4DN4H 5FHBH 2Y3AA 1R47A 1UOWA 1JNNL 1MW1A 5F3BB 2AHIA 1NIBA 3BPOC 4P57A 2EDOA 3FQRB 2AV1A 3KLKA 5CJXA 4EF3A 2ZX6A 1FL3B 3L2NA 4PW9A 2IPUK 4JQIL 9PCYA 3ARFA 3JQOB 1DVXA 4PJCE 5GJSH 4ZG1A 3FTGA 3NA4A 3QJUB 4NSKB 5JHDE 2EEDA 3VE0B 5EF1A 1A14H 1HXYB 1DVYA 1NPJA 2F5AL 2VZTA 3QDGA 5BV7L 5EIIA 3BH4A 4LP4A 3SBWA 5HTSA 4LXFA 2DMGA 4I0KA 1U91B 3LS4H 5F9WB 5I5RA 3CC5B 3MREA 2LFEA 4PJXE 4ODUB 4XNAA 2OYLA 3SKOA 2QKIB 3AM8C 5SX5K 1MI5E 1MH5A 5IVXF 4A2GA 5LNDA 5FYJL 3PE9A 3BCDA 5GZOA 1GGIH 5I8CB 3VI4A 2IBGA 2EDYA 1B4JL 1RURL 1NL0L 4UINL 3GXNA 4R97B 4IKNA 2OK0L 4X7FC 1FJ1A 1A6VH 2Z92A 2XFGB 3FUNA 2XRAH 1HNFA 3CN4A 2IADA 4M56A 4ZNEA 2NXYC 2YAPA 5F7MC 1M7DB 1X5AA 2BW4A 1HX0A 2XZAL 1AE6H 1CG9B 2J8UE 3FCSB 2ZQKA 3OR6B 4I2XE 2ATKA 4UTBH 1BQUA 1WQVT 2FT8A 2XIIA 2H0PA 3APNA 4HQQL 1B4TA 4C83B 2PYFB 1NL0H 1YRKA 2O61A 4AX3A 4M4PA 4L23A 4OGZA 4N5UA 3K1DA 3ZOAA 3Q1EA 3FULA 5JOFA 5C6TL 1J1OH 4RFOL 1S5HA 2J7LA 2CBQA 4A2MA 5JW3H 3ILPA 3PHQA 4HPYH 3IJ9A 1N64H 3WYRA 1QBLH 3EJZC 1SEBA 2R8SH 1MCHA 4JHAL 1F8TH 1NICA 4B41A 4JFZH 4UOW0 2NY0C 2BXYA 2Z31D 3C5ZA 3MLZH 3PXLA 4CADB 1CI5A 2XX1A 3PV6B 3RUGA 2Y07H 4TRPH 3U25A 1WFOA 1JPTL 3D51A 4RWYL 2FH6A 2ILLA 1MJ7H 1BJ1J 3FOMB 2ENSA 5IROD 3GDBA 2GT9A 4O2EB 4BFIA 2BC4B 2NSMA 5IFHH 4N2FA 4PCSA 1RU9H 1TQVA 1LDSA 4WEEA 4JM0A 1AS8A 4ZUTA 2C26A 3WHXA 3DRQB 1KJ2H 3MTXA 4N2EA 25C8H 3OSKA 4M3HA 1TYRA 1FGNL 1T3FB 3L4ZA 3WAKA 4LSVH 2A9MH 2N4IA 2GJPA 5LAXB 3ERXA 3EO0A 1RZKH 2CIIB 1KXQA 3TN0A 2X3BA 2BVYA 3D39D 1AQKH 3KWWA 3T0EA 1VDGA 1DCLA 4RESB 4ZMWA 2HLFD 2JJTA 1SN5A 4AYGA 4E5XB 5TGBB 4HWUA 4ANVA 1RURH 3PQYB 1S5IL 1T0NA 4LZKA 2DWTA 1BJ1H 2H32B 3TM6A 3WUWG 2WYZA 2GBAA 2UXFA 4AYBA 5HPMA 3FQXB 2ROXA 1GXEA 3TTSA 4WHYG 4LRIC 4XO9A 1ZSDA 1IGJA 1NDGB 4F7TA 2GJ6A 3GNML 3GSXB 3CN3A 1B0WA 1WT5A 3BWAA 4JFOA 4W4OA 4RAUA 2FJUB 1B0GA 3VMOA 3RE0A 4YSCA 4NAJA 3TEUA 1JCKA 1FNLA 3E6HB 4HQQH 4POZD 4CSZA 1FH5H 3QWRA 5E6RB 4FMVA 1TTRA 4P3CL 5DA4A 1PIFA 1TTAA 2BMKA 4HCRA 4QLRA 4DP8X 5CKAA 2H32A 1D2PA 3L9BA 4LSQH 5EF3A 2A77H 4XVUD 5A7BA 4WI0A 3S8GB 1MCNA 2VDRB 3BP6A 4UIKL 1DE4B 1SDYA 2BK8A 2UZXB 3P77A 2D3LA 2QLVB 3DHJA 2XXFA 1FZKA 2AEPL 5L4JA 1EFXD 4QD2E 4KRLB 3WDHA 1QWNA 1U2HA 4KHXL 4U7SA 5C0FB 3O3DA 1IM9B 2R83A 2H2PD 1FYHB 2IOIA 4G7VL 4PG9A 4RCAA 2APSA 3FO0H 3ELAT 2G60L 3EYOA 3LQZB 4KQ3L 5EUOE 4ZSOB 1LWRA 3TCLB 1I3RA 3IDXL 5B3JE 1NEPA 4XCEB 4AC2A 2PW1B 4LLYA 5I1IH 2FHBA 5LNEA 3OD3A 4AEIH 4KXCA 1SYVB 4Z76A 3EOAB 3VACA 4BFIB 2GT9B 1EZVY 4O2EA 3I84A 2VAJA 1HOCA 1PS3A 1AGBB 2NXYD 1V7MH 4UYQA 4XNUH 1W2KT 3RTQA 4PJXB 1IEAB 3VVVA 3GT6A 3SPJA 2KDGA 1X5GA 4ZYKA 4JEGB 1T2JA 4HC1H 4DH2A 4JDVA 2WN2A 3V6OE 2MQ0A 3W9DB 4DGIL 3JWOL 4XPBL 1GGCL 4WFEE 4Y8DC 2R2BB 3RWEA 1CQYA 1NUNB 3MRIB 3DYMA 3R4RA 1DQMH 4L8SA 2VLLA 2QVKA 5F93C 5KSVA 4OJFL 4I7ZC 5E2VH 3C2AL 4CKQA 1WIUA 4WJ5B 1DEEA 5I6XC 1E65A 3QI9B 1I1RA 3EJZD 4QAMB 1GIGL 4NIYE 4WUKL 3VFTA 1IJ9A 3MUUA 2L4OA 4F80A 1AHMA 1FGVH 4MX7B 3LIZA 3SOTA 1OD9A 4K9EL 3TT1H 4HUKB 4NCDA 2WGNB 3C6EA 1JRHH 4N5ED 5A1AA 1RK1A 3QE5A 4PJ9C 2ZXAA 1M53A 2JXMA 4U3HA 1N5YH 5AVTB 1UJ3C 3LRSA 3OJ2C 4QRFA 3RZCD 3HIZA 4KK8C 3O9WC 5HXMA 2X9ZA 2XSKA 3OAWA 1CFSA 3EH3B 4NLAA 2W9DH 5FO9B 4GXUM 1HTYA 4MKTA 3UYPA 3UAJD 1XTMA 4G1EB 1EEYA 4H2CA 2H7WA 4R7NA 5LN8A 1OT2A 3FUDA 2H9GB 4JS7A 4MYPA 1U3HC 2HJFA 2YGPA 3TNNA 3FQUB 2VXUL 1WAAA 4D7BA 3D4CA 3MRLB 4XC1H 1SM3H 3NJJA 3VFNA 4XAWL 4WI7A 1G7IA 1ZVHA 5KSBE 3L4VA 2A6IA 5JIMA 1RUQH 1G43A 3HS9A 2YZ1A 1OCCB 5LXGH 4LB8A 4LSQL 2F5BL 3GHBL 2JIXD 3QZWG 1ZANH 4NZUH 1MHEB 3G9AB 2EE3A 4OQTL 3NESA 4Q6IC 2YPVL 1F4HA 4PJXF 4X4YB 4JN1L 1BJ8A 2W1NA 4R4BA 1H9VA 3PNWB 2UVFA 4FQIH 1E4KC 2HTKD 2P4AB 1FA4A 3MJ9L 1Q9LA 1CIUA 5DHMC 4D3CL 3QWRD 1E4HA 3L3OB 1SJVA 4GIOA 1ECYA 2QPUA 2ZKYA 1YPZA 4PWFA 3SDAC 1CD1B 3BXNB 2FLMA 2WZPA 2NDFA 4WUUB 2OFQA 1EGJA 4W6YB 3MROA 4Y1AA 1YMHA 5AFAA 2F1AA 1S6NA 3ABZA 3RX7A 4LDEB 4ZOEA 3IMVA 4WU7B 1DJIA 3KYMB 4EI5C 5KVEH 3D18B 1XGTB 3PL6C 4MJ4A 3D06A 2OR8A 3WIIH 1K4DB 4GRWB 4FTVD 1XR9B 4M93C 2PCFA 3D25B 35C8L 2YK1L 3B1UA 2P43B 3TO4C 4A66A 2CO6A 4YDIL 4MAZA 3VRLF 3ULUD 1LEGB 2OL3A 5DJYB 2AITA 5ACZA 2MIZA 3B9KA 2R56H 2XVKA 3MGTB 2D0HA 1SQ2N 3C60A 4N6RB 2H6PA 4N9GB 5F3HA 4PYGA 3RAJL 5JTWA 1MFEL 3VXNA 4UQEA 2QTEA 2ED8A 3L8QA 1L0QA 1NCJA 4MZ2A 5IVNA 4OD2A 4HIJA 4XBMA 5BRPA 1C12B 2QR0B