3QZNA

Staphylococcus aureus isda neat domain y166a variant in complex with heme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
b'ATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINANHRYTTHLEFEKAIPTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein A
molecule tags Metal binding protein
source organism Staphylococcus aureus subsp. aureus
publication title Iron-Coordinating Tyrosine Is a Key Determinant of NEAT Domain Heme Transfer.
pubmed doi rcsb
total genus 26
structure length 121
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qznA00
2K78A 4MYPA 2MOQA 4NLAA 3QZLA 4H8QA 2Z6FA 4YMPA 3QZOA 3QZMA 3VUAA 2ITFA 3SZ6A 3VTMA 2O1AA 2Q7AA 3RURA 3QUGA 5D1ZI 2H3KA 3QUHA 3RTLA 3S48A 5D1QE 3SIKA 2ITEA 4WJG3 4H8PA 3QZNA 2O6PA 3OVUB 4FC3E 2E7DA 3SZKC 3QZPA 5D1XE
chains in the Genus database with same CATH superfamily
2ENYA 2F74A 1E8XA 3SPGA 1BVLA 1I1AA 2IV8A 3G6DH 4F9PC 2ZG3A 2HJLB 3N0PB 4WTZA 2ZONA 5L7XL 2CHDA 2GCYB 1RUKH 4KTGA 5IMOA 3ZIMA 5JQIB 3HVNA 3TFKD 2L04A 4PJIE 3TCLA 4YXKL 5T3ZL 1H8OA 3MNVA 4RRPG 3WIHA 3QDJE 1UVQB 4HOZA 3BRDA 4FFYL 2Z35A 1A7RL 4XPAL 5ALBH 5DVNA 3ETBF 2K45A 4OM1H 4ZFGL 5HHMD 3LVEA 4KH2A 4TUKH 5T5FH 2J71A 4J4PA 3IF1A 5E5MB 3V4VA 4ADGA 2B4CL 2GY5A 1B0RB 2YC1B 3EYQC 1FFQA 3C87A 1RPQA 3MTXA 4UV4H 3L4UA 3ARRA 3RVVD 1T04B 4Z7IA 3BXNA 4FNQA 1EO7A 3S8FB 5BOZG 1MZZA 4FG0A 1I3UA 5INDB 3DSFL 2ADFL 4BXSV 4TOYH 2IPUG 4LHUA 1X9QA 3P4MB 1XIWA 2UXTA 5CEYA 2H1PL 4X99B 2LTQC 3VFMA 2HH0L 5HYIA 2WSPA 4U6YA 2OMVB 4RGOH 4RMUA 4PW3A 1QTPA 5GJSL 4HJ0C 3MRNB 2VERA 3BGAA 3BYYA 4BJLA 5EZIL 1FNEB 2X1XR 3G5ZB 1K8IA 1EIBA 1R3IH 4FLQA 4OFDA 5TE4L 4P49A 3F6IA 1S4IA 3NQKA 4Q9CA 2VW7A 4KMQA 5J13C 1KB5H 1JV5A 1MFBH 2QDWA 4R26L 1NIFA 2WKGA 5BNXD 5HHVL 3W37A 3Q1SH 4TVSa 4YGAB 4WO4B 1UA3A 1DLFH 3MNWA 4YHMH 1HIMH 3HHMA 2XN9D 4Z7VA 4LEBA 3UPRA 25C8L 4L9LC 1F00I 2H45A 1B2WH 3D69A 3KGUA 1KGIA 1FUNA 3L95A 3L1OL 3VXNA 5SWZE 1SN5A 4XPBL 2MOGA 4PJ7E 2JH2A 2DQGH 2W88A 3G7TA 4Q7DA 1DSYA 4WWKD 1UB5A 2QGEA 4ZUTA 1K5NB 2UY7B 5FK9A 2OW7A 1BX2A 4Z77A 1BFOA 5EHFA 2XPGB 2VZUA 4K23H 1PFOA 4R4ND 1E43A 3SQBB 1KPVB 3U9PL 5E4EC 4G9FA 2JLLA 3MI6A 3S36H 3IPFA 5EC2B 1CXEA 4Q52A 2YKKA 4LESA 2YEVB 1DO6A 4YX2L 3HG1D 4U6XB 5J6HB 1JE6A 2X4QB 2IANE 2JELH 3D39B 1D7DA 4GW1A 3RNQA 5FCUH 3ZLQC 4EE2A 3AB0C 5ADOH 5LBGA 2CHZA 4RIRB 2H5UA 3WFBL 3WENA 2B4CC 1T22A 1J88A 4NCC1 3ZL2A 4JO8A 2DMCA 1G7IA 2JCWA 2PTUA 2PMZA 2UWEF 5CUSH 5JYMA 4YE0A 1AS8A 1KN2H 2I7OA 4HJJH 2WVVB 4FP8H 5FAAA 4KKAD 3S88L 1TXKA 3N1PC 1E5AA 2IH3B 4HUVA 4L5FL 3MLVH 3FONB 4PB9H 2EDWA 3S3DB 1LGVA 4G1MB 4WFHE 4KVNL 2QKIC 3QRLA 5LB1A 1NLDL 3RIFF 3F85A 4KFZC 4KZEL 3UOAB 2KKQA 1NFDF 2G60L 1ONQA 4POZC 5C0AE 1D9KA 4HS8L 1P6FA 1ZDSA 3ALXA 4AIZA 2VR3A 2E7CA 1CFQB 4XP6L 3D3VD 4D9RD 4X42A 4CU6A 5I75B 2NUTA 2W59A 3FU9A 3N85H 4Z0XB 4LKXB 3U0TA 4CVXB 1VDGA 3RZWA 3KPLA 3V6BR 4S0SD 2ETWA 4WKZA 4OB5L 1Q9LA 2HRPH 3K5RA 5I76A 4IGBA 4Z76B 1JOIA 1X5AA 1B0GA 2D3NA 4P2RE 2NDFA 3REVA 4U6HA 3H3PL 1YHPA 4Y2NA 4AYBA 4YR6B 1NLBH 2AAVA 1RZJC 2JXMA 1FAIL 3BIKA 3H55A 3QP3A 4HD9A 1ETA1 5K9QG 3VRIA 4R8WH 4RWHA 1PEZA 3V0EA 4V1DB 2GW5A 3M46A 4PLOB 4R6UA 5HVGB 1GOGA 5KYUA 5IB4A 4XVUC 3U4BL 4HH9B 3Q6GL 3KNBB 4V1DE 5E9DD 4N2HA 3GUTB 5GS1A 2CCWA 4JG0H 1JPST 2EE0A 5K59F 3ENEA 5T3ZE 4KK6C 4AG4L 1U93B 4Z18A 4JDZA 1NGPH 4WNSA 2NXZC 4Z7NE 3VFRB 2FSDA 5I8KH 3F62A 2EDXA 1ZAGA 4LCCC 1GYCA 1ZV9A 4PJIA 3PXJA 3DMMB 1GXEA 3GBMH 2G2RA 4FLHA 2DWTA 4IRJC 4Q0XH 1GHFL 3WD5H 2HN7A 2JE8A 1PKOA 4UIMB 4XO5A 3T2NL 3MCKA 2AJYL 1DE4A 3ZE1E 4G6AC 2V7HA 1MRDL 3O2VH 2JK5B 2F15A 1MVFA 1S7TB 4GLRI 1IIIA 1Y07A 3TWCH 2FD6H 2YXFA 32C2A 5IK3A 5IUSA 1MCRA 2CGRL 5ACZB 5I16A 1YEDB 1CGTA 3NESA 1U0QA 3FB7B 5K9KA 5AOMA 4Z7UB 3ROLA 2MTPA 3JZ7A 4LSPL 4OFKA 1T6WA 1REIA 4X0NA 4YHYC 5EV7A 2EDYA 4WI6A 5FR3A 1DUYA 3OMIB 3GHPA 1Q1JL 3PWJB 3G9VA 5CN2A 1X7QA 3DGCR 5GRJL 4NBYB 2D7MA 3IE4A 5LG6A 3X12A 3L5WA 4I87A 4I18B 4CNIA 3OKEA 1DVFA 2C3VB 3NJVA 1MJUH 1SVZA 3OR7A 4JVWA 3RBSA 2GK0B 1UCBL 5EEZA 3UL4A 1NFDA 2YFNA 1WBZA 2WGXA 1WE5A 4QRPB 3Q1EA 4S1SL 3NG5A 3PL6B 4JMNA 4WEBL 8PAZA 4JRYA 1GZPA 4RMQA 2WY3B 4JGUA 1AHWC 5BZZA 3ZE1B 3VJ6B 1IAIL 3DUSB 2B9BA 1HTYA 3QWRA 1AMYA 4WUUD 5FC9A 3UZVB 3IJSA 1T3FB 1F3JB 4LCWB 5GGSA 2MCPL 1E6OH 3RVTC 5LBSL 5LAXB 5IOPB 1G9NC 1OO2A 3R4RA 3RG1C 3HE7D 5HHPB 3CV5A 3EJZC 2B08A 1AGEB 1AIFB 2MCMA 1DBAH 1E9PB 4RH4A 2X70B 1A3RL 2APFA 3AM8A 1UKQA 4HKJB 4DP7X 2Q3AA 1JYWA 3UTTE 3L48A 5MHSD 2EYTA 3SKOA 3ZHFA 5GGQL 4KAQL 5JHLH 2XQBH 3ALPA 3U1PA 3HPJA 3HE6C 4PS4L 3E8UL 1E28B 3WFDL 4NRYB 1D7BA 1EA9C 2OMNA 1BF2A 5HHOA 43CAB 5CEZL 4PAZA 3E6FB 4BFBD 3O3BB 3P0YH 4B0MM 4RQQA 4I88A 4KDWA 1CDJA 2ZSVA 2LU4A 2DJUA 5JPNB 4LHUD 1KXTB 5AVQB 4BM7A 5B4MD 5AW5B 3S37X 5L2JB 2OMUA 4V2CB 3NDYE 5FV1L 4AV0A 4PGZA 1T7WA 1NINA 2XG5A 3K6IA 2XTJC 3A6CL 1DEEA 4X5WA 1EZVY 3CMOL 5AWNL 4KOBA 3KLKA 2YD4A 3HNSH 1LDSA 4G8IA 4LBEB 2YAFA 4L4JA 3NK3A 5FYJD 2A4ZA 4S11A 1LMIA 4OBRA 5FYLH 5F3FA 3M6DA 5CLYA 4QRTB 2A0LD 4RAUB 5CU9A 3Q06A 5GIRB 4CBZA 1J87A 3HMXA 4K8RD 3RTQB 3VSUA 4HZLA 4HPHA 3BZEA 1C5CH 5FUOH 1IFHH 3MLSL 3PNWB 3WYRA 2BXZA 3BAEL 2WBXA 1HCYA 2Q20A 3GTNA 3QUYC 3U2SB 5B1BB 1AO7A 4MFHA 4GS7B 2D0GA 5E2TH 2EIMB 5FWQA 1H9VA 1WAEA 1FGVL 4UQ3B 3V0DA 5E5MA 1CG9A 2BNQD 3ARVA 3QUMB 2NX5E 4LKCA 4PJDB 1B0RA 1TUPA 1AJ7H 1HK6A 1XB3A 2R0WL 4PW9A 2ROYA 1S5IH 3BKML 3LS4L 5EU3B 5AW2B 4WI8A 4G6ML 2BHZA 1S7SB 3LN9A 1FN4B 3A67H 1A1OA 4WHYH 2J73A 1AQ8A 1OHZA 3NCWA 4JFFB 5FM5O 4R4BA 3ARFB 1HEZB 1GY1A 1XIWB 4MD4A 5CEYB 3ZDZF 4W9GC 1CFBA 5KJ7E 3ZTNL 1SXCA 3GMPB 4Y1AE 4I1NB 3RTQC 2VQ4A 5DRZB 4CC1A 1SJHB 4I8DA 4KRLB 1JGUL 2NY1C 3KLHD 5D7IE 3UBXI 5H2BB 2C1OB 5C0BD 1HEJC 2DTSA 3REWB 1K8IB 5D7JB 3WNIA 3TZVA 3TF7C 2XY1A 3ALWA 3KVDD 1LJMA 4X2UA 2QBWA 3I9GL 5FUCE 4NN6C 3UBHA 4GP4B 1ZVHA 2ZUWA 2W9EH 2JI1A 1R6VA 5C97A 1WAAA 3VWKB 4DUVA 5I8KL 4WGKA 2GK2A 5HHXH 2C7UA 2VIRA 4OY9A 1LMKA 3NFPA 4OI9A 4DJMA 4MA7H 5CD5C 4XE0A 2EILB 3ZN6A 4AG4H 2AXJA 5HPOA 2EDDA 3D50A 3H56A 3PREA 1RULH 4C58B 2FTAA 5EU6B 4A2EA 2JCCE 4PJAF 3BN3B 1VHPA 3RPBA 1D6EA 3TLRA 4FMKA 2OQJB 1BA9A 3TESA 4OIFA 2VR8A 3ULUC 4J2QA 5F7KC 4FJYA 2BJMH 4AK1A 2BS71 1E4XL 4H44C 5D1QC 3BWUF 4XVSH 5AW9B 3SKUD 4E9SA 1HHKA 4K7PX 2PR9A 5FIEA 4E68A 2P3YA 4XNXH 1Z1WA 1LWRA 5FGBC 2VLKE 5EU7E 2N1KA 2NY1D 4PD4K 4U6XA 5TF0A 5J6HA 2NW3B 2GSIA 2DIAA 3CVHB 4HLZG 3US9A 1SVCP 3IFOA 3RTQD 1LM8V 4OI7A 4GBXC 5DHVA 3IU3A 4HULB 1H0DB 4HS8H 3U0PB 1J0ZA 2G75B 1I8IB 2YD2A 5E8NA 4DF9A 4G6KL 3VU1A 3RFZC 1KCRH 4UM9B 2ENJA 4EKXA 3IPEA 35C8L 3L3JB 4XMXA 3MLZL 1W0VA 1G87A 3RVXC 1BF8A 4M7KL 1QMUA 3O9WC 3V0GA 5HYJA 4PY7A 5IHHA 4FF9A 1EV2E 5C7XH 3BAXA 3CPLA 2KPWA 4FP8L 3L2NA 1KELH 4HJJL 2TSBA 5E8PA 1GW0A 3SD2A 4RCAA 4XI5C 2MCG1 1ZV5A 3H85A 4AUUA 1KB5B 3QIWB 3VFPB 1PY0A 1HC1A 4EUPA 4YHYB 5AFAA 1OVZA 4P2OC 5GGTH 2NYKA 4J39A 3WFBH 2XJKA 2FJGB 3ZDYF 5I8EA 2ZUYA 2B7DT 2JELL 4P4KA 1TVDA 4D9QE 3AQYA 1Y18A 3BWAB 3X13A 1E67A 4GSUA 4YPGB 2WJ7A 3LKSA 3EGSA 3IWVA 3L5XL 1L6PA 4ISVB 4WKZB 4KXDA 3OSVA 5LCVL 4Z3TA 4KMLB 4YJZL 1SJMA 5BQ7A 2CBPA 3BOVA 1AGFA 5C08A 2H41A 3KPTA 3O81A 3U9PH 3BIKB 3PV7A 1EUTA 1I7RB 1N0LB 2OW6A 2FIRT 2WNGA 4MD5B 4CKQA 1MCHA 3DBXA 3HMWH 4UDTB 5JLZB 4GKZB 2OJ1A 2JB5L 3BWSA 5ILTL 4OIBA 1KWGA 1F02I 2GQHA 1X5MA 1KJ3L 1NCWL 2IOMA 1MNUL 5HI5D 5IBTL 4GINA 2HVJB 4HCRL 2CHXA 4HH9A 2XU9A 2WZ5A 5E2VH 1JZ8A 2EDBA 1IJ9A 4B7IA 4P2RD 3LZPA 3ARGC 3EJRA 5HGHB 4FMVA 4LPCA 4OM0L 4EZKA 3NCJL 5G2NA 2GY7B 3T09A 2E4FA 3Q5OA 1ORQA 2CR0A 2O5YH 2XUWA 3KWUA 4P9HH 3FO9A 2XV0A 1PD0A 2I85A 3KCWA 4N0UB 3CN1A 2Q7NA 4UOQA 4CBPA 2HN7B 4HK0B 4V1DD 3D25A 5F0LB 3BAWA 4WUUA 4DKFH 5AAWA 1KULA 2CRIA 2HT2D 2Y6SC 3A21A 1R3IL 4IJTA 3JT0A 1MJJA 4OGXL 2I24N 3RKPA 5J1AB 1S7TA 5EZIH 1M7IB 3MA9H 1A9BA 2YJLA 3UJTL 3B6SB 4IJ3C 3EYOB 1OWRM 2IH8A 4XT1C 3FB7A 3E6HA 3JV0A 4MRBA 1XF3B 3OZ9H 1J9RA 5KVEH 5HY9A 5DFAA 3QZMA 1ZT1A 1U8JB 4OLVH 1CDYA 3VGBA 4YEFA 4U0RB 3CFDA 1NA8A 2ADFH 3AXLA 1P7KB 4P99A 3BPCB 3L7FB 1MCDA 1AO7D 1XCXA 5E5UB 2KLRA 1BFSA 1WHPA 2PTTB 2XG4B 3Q8FA 4PP1D 4RLDA 5EU7C 4NC2B 1RH8A 2A6IA 4LFHG 5FO7B 4CNIB 5LGYA 4J3OH 3B56A 2IC2A 3KPMA 4MYWB 1NFDB 3STZA 4PGBB 2JLPA 5DZNA 2AITA 1F58L 4JFUA 2DJSA 4M6AA 2P5EE 5DHYA 1HS6A 4KPHL 4NC0B 3VYNA 4PU2A 2R0ZH 3SKMB 3QXUA 4TSCL 4TF4A 3PDDA 3P4OB 4WSGA 2Z35B 2VLRD 3VJ6A 5H37G 4DETA 1X5XA 2AEOA 2XV6B 1T3FA 4U1IB 1IM3B 1Q9KB 2FATH 1OLLA 2X12A 1WD9A 3QDJB 4CSZA 4XVTL 1ES0B 1OAQL 5HHQA 3VSTA 2EKJA 1YNLH 3DSNA 3OC8A 5HHPA 5HDBB 3H7BA 3MOQA 4LSRH 4PV8A 3U48A 3S48A 4KZDL 2PYEB 2MPAH 3CHSA 4IBSA 4TMPA 3UROR 2XWTA 3ZXAC 1UTDA 1HXMA 2C3WA 4UT9H 1CD0A 1XZ0A 1BVNT 2DQUL 4R0LC 5INDA 4M1DL 3P30H 3LKQB 4N2AA 1XGYH 2F53D 2EYTB 3SKOB 1AS7A 3H54A 3NZHL 1YNTF 3MRCA 5BMFL 2XZAH 1E28A 1IUZA 3DPBA 3HKFA 3WL9A 4Z5RB 5IROA 3BD4A 2WLKA 5DURB 4RMTA 4XHJC 5F1OB 5DJZA 4F8OA 1OGAA 3OJDB 4P23C 5I1JL 5JW4Q 1A7PL 4P5SA 3H3BC 5F1KC 2NY0C 2CK2A 1KXTA 2IH1B 2ADGB 5IG7B 3EDDA 3IDXH 4IRZA 5E4AA 4Z7VB 2OMUB 4RGNC 4NQTA 5BRZE 1D5XB 3TP4A 3LH9A 3S4SB 5A6MA 4XNBA 3D12B 1SOQA 1T83A 1GA2A 3DDGA 1BMGA 2K4WA 2IAMB 3WEXA 3MUY1 3QG6B 1FV1B 1EAPB 3UAAA 1M6OA 2EDMA 3VRJB 3QDGA 5JPNC 4QGTA 2ICWJ 4FXGC 43C9A 3RTQA 3V5KA 5GXBB 4MNQE 4XAKD 1BQHG 2I9TB 1Q72L 2Q86B 2Y5TA 2A9DA 1AO7B 4LB8A 1GSKA 5L4MA 3DOHA 3UTOA 5KS9E 1T1WB 3QUMA 4JHWL 3BEVB 4TL5A 4APXA 2EIJB 2V8LA 5F6IC 2C7FA 3P3UA 2E27H 1ZT4A 3O4LD 4CAGA 4LHJB 2FBJL 2IBGA 1U8CA 5C0FB 5T5FA 5GZND 1BLNA 3GBDA 1TYJA 4S0TD 2X6MA 4PJBE 1A1OB 2L7UA 4WIQA 4ABQA 2HG0A 3NCXA 4QT5A 3TIDB 5CCGE 1MCNA 2H6OA 1QR1A 4X9YA 3DHUA 1CFVL 1Q94B 1UH2A 1BG9A 1Q0YL 4YHLH 1C7SA 4XN5A 5MEQA 1P53A 3NZ8A 2FCBA 3SGKC 4FERA 2HPTA 1MCPH 1L9MA 4PWFA 3EOAA 2C1PB 1SN2A 2EDNA 3T71A 1W8NA 3QJRB 3U1QA 4AK2A 3FB8A 1FLTX 1SBSH 3FONA 3NJKA 3GKWL 4BK4A 2NR6C 3MRFB 4ZTPL 4RMVA 3KJ6H 1YDPB 4LEXH 1OKEA 3CHQA 2E86A 1FE8L 5HDBF 4Y2DB 2BP8A 4O02L 1QBLL 3DX4A 4IKIA 4G9FE 4L3FA 1UYWL 2FYYB 5FOJA 5EIIB 3DPDA 4P8QA 5LUMA 3QUZD 3ZSTA 4I18C 3ETBJ 3BZFA 2DQJH 3D0AA 1EZLA 4OF8A 4Q9RL 4YUEL 1Q9OB 4ZOCA 2J5LC 1ZPUA 2H6UA 4K8RH 1U58A 4OFYD 4IQHA 4KZ0A 5AAMC 3FFCE 4GO6B 1A4KB 3EJZD 4UILH 1HSAA 3VGEA 4Z7WF 5CJBA 4R90L 3GLEA 1PLCA 4U4BA 3A6BL 5DC2A 4PBVC 2BRQA 3BVTA 5BV7C 1NGZB 1JAEA 3C9NB 5FFLA 3MLRH 4XODA 5F1SA 2JXMB 3ISWA 2WQWA 4KROC 5SWQA 4R9HA 3ARFC 4UZSA 1ZTXL 3NFNA 4AEHH 3AY2A 1Z2KA 1P1ZA 4M8RA 4MXVF 5INCB 4BFNA 4TYUA 4L4TD 2ZXDA 3KNBA 1BPLB 4G11A 4MA8H 5IMMA 1NKGA 4NWUH 4B6ZA 2VDPL 4L18A 2CJTA 2ZOOA 4O9HH 3S96B 3OX8B 3KXFD 4AT6B 5I2IA 4AC4A 2YAQA 3DMMC 3VVVA 5I1IL 4LCCB 1U3NA 1MWOA 1XTLA 4PJHF 3QE5A 3ZMNA 5AVRB 2UUDH 2HJLA 3CN2A 2ZKMX 1RZ7H 2X4RA 3IRZA 3TBVB 2QDVA 1LO3H 2J1YA 2VDQH 4NCC2 2G9KA 3PABB 3RVVC 3R1GH 2KLTA 3C60C 4KKCD 5AD0B 3SDDA 4I7ZC 3KGRA 2WWNA 1GSMA 4NLHA 3WO3B 5DVMA 4KTEL 3GXPA 2MQ3A 5ACZA 1EEUA 1QPXA 5IP4A 1IQWL 1FC1A 2FSEB 5J6SA 4OUUB 1RZGB 1F4XH 4D7BA 4JFWA 4RNRA 5G55A 1S9YA 1A1NB 1INDH 2WAQA 5FLVA 4FQJL 3SDXB 4RISH 1WWAX 5DFWH 3MRLB 1NEZG 3PUUA 1CLYH 3VFGH 5D1XE 1ZWIB 3TFKC 4W9IC 5H35B 1M7UA 2VN5A 3HFMH 5DHVH 1ADQA 4HG4J 5EOCH 3QPXH 2I5YL 2MNUA 4XP5L 3RHWF 2FJUB 3OKEB 1Z9LA 5D7KE 3VWKD 4PJ6A 4HAFA 3IDJA 1S7XA 4X99A 4MAUH 4MA1B 1JFQL 2KMWA 5FA3B 3TEXA 3WO4C 3VFTB 2FEEI 4KUZL 5DUPL 1AGFB 4JANA 3FZUD 4MZ2A 2QLYA 2AJ3B 2ATKB 4WWID 4DGYH 3UEQA 4GFXA 1EHLH 3QIBC 2EDEA 2AANA 5C08E 4MXQC 5JMRA 2F53A 4D9QD 2VJ0A 1RJZB 3S98A 2HLAA 4D94A 3Q8EA 4ZW8A 1GCYA 3WFCL 4C83A 4HS6B 3K81A 4P4KD 4JO4L 5CINL 3P69A 4EN3A 4MJIA 1FYTA 4WEEA 3BP7B 3EBAA 5I1AB 3QSKB 3APCA 4KU1A 1N5AB 1QFUL 3GSWA 3MPCA 4N24A 5DLLA 3UPRB 4E9LA 2VH5L 4P5TD 4APQB 1DVQA 4D9LL 2APSA 1V3LA 7FABL 5KN5A 2E46A 3TV3H 1U8NB 3WHE0 2QADD 3MFFA 3AITA 3JTTA 3N1MC 4POZD 1FQ9C 3ABKB 5D5ME 1I82A 2D3LA 2GVYA 2CM6A 1TJXA 1UB5B 2WN3A 1R24B 5EB9A 4W9CC 1N5YL 1WF5A 3MMEB 1BFOB 1R9FA 1C16B 3ECBA 4K7FA 4PJHA 4P57A 3K2UL 4HUWA 1P9MA 2F8OA 4H1LH 1JNNH 5TE6H 4HOXA 5DK0B 4RQQB 1L7TL 1S3KL 4TNFA 2C9UA 3OAYH 4H20H 1A14H 3AMLA 1TF4A 1IKFH 4KTYA 1L9QA 5LNGA 4LLAA 3GXMA 4LSSL 5C3IA 3NH7H 1ECYA 1YYCA 4YGVB 4RIRA 3IE9A 4UANA 4UQCA 1K6QH 4XBPB 1RJYA 4JO2H 4DVRL 4NDMA 5LDSA 4ZTEA 2J1WA 3QI9B 4YDVB 2WW8A 2F5AH 3ZT5A 1BVZA 2VDMB 1RUQL 1KUMA 3FMGH 3GSNH 4NFDA 2WUBL 4WK0B 2G3MA 1BZ8A 4EOWL 1MEXH 3P2TA 1Z9SA 3PGCB 4F8PA 3LQZB 3RE0A 1JWMA 5E94A 1MY7A 1K8DA 3I6GB 2DM2A 3JYCA 2B3RA 3S2CA 1AHWA 3TVMD 3EKCA 1CL7L 1KCKA 1UGKA 4ZZFA 2C4FU 1AKJD 2XY2A 3MNMA 3BESR 2GPZA 1I1YA 2CXKA 3QDJA 3U9UA 3UG5A 5L2KD 3RWHB 4EUPG 3VW3H 4UCFA 1GPOH 4RSYA 3ZE2F 5AYQA 2Q8AH 5EIQA 1BJMA 2AEWA 2CPUA 4BFFA 5LVEA 3CHRA 3WLWD 2BSDA 2ZXBA 1NCBH 2Y7QA 4QOKB 3OTTA 3W56A 4ZUSA 1OWWA 5J57B 4YHPA 1BQRA 2MTAA 1RZIB 1KNOA 4GO9A 1MSPA 1QASA 3ARFA 4LGRB 4R4BB 2J55A 4CMMA 3GMPA 1OK8A 4KQ0A 4EN2A 4ZG1A 3MV8B 4PMFA 3ZDXB 3RUGB 1H6EA 1HQRA 1P84K 2XV2A 5F1NA 4PJ9A 1L9SA 4IHOB 5T3XD 4KJQC 2FE0A 2JTYA 1IZJA 1MQKL 3NA9L 4A2FA 4HJ0D 1VERA 3SBWC 2J8UA 5DS1A 1PF3A 3F58L 5FYJU 1OCRB 2KZWA 1NCCH 3QRGL 1MFAL 3FOLB 5I1HL 5GS1B 4J3BA 3RGVD 5B39A 5F3BA 3AREC 3WLWC 1IARB 2NMSA 4L8SB 5D2LE 3IK2A 4KBPA 3O6FA 3CD4A 2IDSA 4PLJD 2Y1AA 5BZXA 1VCBC 4QI3A 1SDDB 2P4AB 4L4TA 4XBEH 3MUGB 3TNNB 4DPRA 1Z0MA 2XKNA 3QZLA 5BO1H 4JQIL 4RMBA 1FO0L 3I9PA 1O5PA 4B5ZA 3GC3A 4KUCD 3L6FB 2AJSL 2KUTA 4UT7H 3HPLB 4XO4A 2IALA 5KW9H 2D7PA 1ZVSA 1TR7A 2EXWC 2I7SA 3BFOA 5F7YC 5GJTL 1UG9A 5I28A 3BQUC 3BQUA 4DP9X 3IDIA 3LXBA 4DT2A 3SKJL 2L4OA 4HKZB 4NNXB 5AYUH 5AAPA 2Z4QA 5BV7B 3RWDA 1WHOA 2Q8BH 1IBGL 3N9GL 5B7MA 2VAJA 5FYKE 4PJFF 4KO6A 2FYVA 1HHGA 4W9ZA 4OD1H 4F8NA 1IL1A 3OGCB 4LSUL 4TNVK 3PWJA 3MCYA 5DVOA 1BLNB 2F74B 2YXWA 2NY4D 4FNUA 3HC0A 1QVOB 2C3VA 3ARBA 4NJAH 3EDKA 1HWHB 3DX8B 4GUPA 3BAIA 3OGOE 1O6SB 1GCFA 3QEQA 4WW2A 5IMOB 1WBZB 1EJ8A 3VE0B 1A2YB 2GIXA 1CDHA 1VADB 2V2WB 4G8EB 1MI5B 3O4LE 2FAUA 2R9HD 2NYZA 3QC6X 5HYJB 3B2PA 4U7KA 1TJHL 1NAMB 4BZ2H 1KJMA 1F3JA 1RUQH 3FMGL 1BMZA 2BP8B 4KZCA 3ZUNC 1U8LB 2EDJA 1B9KA 2C9RA 1TG8A 4H8HA 3OAZK 3POHA 2JJTC 3WDHA 1K6QL 4LVOC 2K0RA 1SJXA 1U8HB 3EGDB 1T04A 3PJLA 2ITCB 1KY7A 3AREB 1LEGB 3PWUB 1YVLA 4TVPD 4YZFE 2HLFC 1FJ1B 4IU2A 4NPYA 4S2SB 5BS0A 3ZE0B 5LDUA 4MHHG 5F6IB 5C0BA 2JV6A 5HHOD 5TE7H 1GIGL 1AZBA 3LPPA 4ANKA 4JO3H 5CLWA 1QBMH 5CBAB 1DN0B 4KMTH 4I0PD 3HI1B 5IQ9A 5DEJA 3APNA 3KM1A 4PJEB 3WNNA 4ONHB 2HUHA 4Y2OA 2NYYD 1N0LA 2BY2A 1A3LH 4AVJA 1U8MB 2KI6A 5KVFL 2WQXA 4YHIB 4RSVA 1EK3A 5DQJA 5TPWH 1S2EA 3AQDA 1U3HA 2Q9OA 5DYFA 5HYJE 1MREL 4GRLA 2ZYSA 2C26A 3KJ4C 3SDAC 1YZZA 1A64A 5IOKA 1MIEL 1OAUH 1ZLVH 1JXDA 5HPMB 1BZDA 4AT6A 2UZPA 4N8VA 3IGFA 3ZO0A 1EXHA 3V4LA 2VH5H 4JJ5B 1YMME 4N0CD 3HCVB 3ZR5A 3PF2A 2WBJC 4UWQB 5PCYA 2FUQA 5AVXB 4GKSA 3PQYE 5CINH 3ZGIA 4XN7A 2O6DA 4JO4H 4LHQB 5F7MC 5IW1A 2F9BT 4RAUA 2WWKT 3V4PL 4MCZB 1MW1A 4DP1X 3WELA 3KEHA 4P9MH 3BIBX 1JHTB 1N8OE 3BZEB 1H3GA 1DSWA 2GFBB 4NO5B 3UAJA 1I85C 2IADB 3B6SA 3WDJA 4XXDB 4YBQC 2XN0A 5CXPA 2H2SD 2CO3A 1UA7A 1HWGB 5F96L 1L3NA 1FIGL 1XEUA 5MENB 3PS6A 2NPLX 3WIFB 2NSQA 4H5SB 3DETC 3VFVA 5FOBB 4BWWA 2GYSA 2KDYA 4XX1G 4ZXBD 4Z7OE 4O2CA 4ZFOL 4TTGA 2BSRA 3BKYH 3F6JA 3ZRFC 4KHXH 4AIEA 1HEZA 1M2VA 4MD4B 1P7QD 3DDFA 1QLEB 3IDJB 5FA3A 4WJKB 1F4XL 2H0EA 1L0PA 4PHZA 2GHZA 4GBXA 3WIHL 3U1SH 1SXSA 3SKMA 1IQWH 1G5GA 2LGNA 3GXDA 2Q6WB 1G1OA 4D8OA 1AOHA 2NW2A 1QBML 2Q3ZA 4X6DB 1F4YH 1BAFH 3ZZLA 4PCTA 4TUUA 5D7JA 4F20A 3PLYA 4ZMWA 5TE7L 3R1GL 3LPOA 3GKZA 3WN5C 5ISZB 2BRRL 3RI5F 4HS6A 3BSGA 4NSKB 3DSNB 3BP7A 2BW4A 2E9JA 3TJHC 4ANWA 2EDQA 4PV8B 2I26N 5F6HJ 5BV7H 3JV4B 4AIOA 5I6LA 2XWTB 5C08D 5I17A 2BC4A 5T33H 4O9HL 1DBJH 1HKLL 3QCUL 2N1TE 5C70A 1AR1C 3RUGF 2WSKA 4U1GB 1J5OL 3QYMA 2XXMB 2X4TB 3US0A 1C16A 2IDCA 3UACA 2TRHA 1N8ZA 4HT1H 4AQ1C 5DZ9A 4HT1L 1ODUA 3KYMB 2A77L 5DEFA 3QJHA 2ZUVA 3CFTA 5F7EH 5DJXA 3GNMH 3UX9B 1DCLA 4ELMB 5IVOA 2DWYA 1TFHA 2HT3D 2ODHA 4OIIH 3QCUH 4DHLA 5GZNC 4YFEA 2Y06L 5T33L 3QFJE 2CAKA 4K8RL 3TXAA 1CXLA 4YOKA 4V33A 2CU9A 3QJOA 4FJ6A 3L1FA 3BSZL 3LIZA 3S4SA 4XMWA 5EBMA 4NO2B 1EQWA 4PJIB 3QG7L 2RQ8A 3NOIA 4ORZC 2IVFC 1JN6A 3QARA 4K4KA 3TA3A 4O02H 1B88A 2FEJA 4A2LA 4UM9A 1G9NH 3CSYA 4ABVA 5C0IA 1CUOA 4LEXL 2LVCA 3QAQA 3NGBC 5D96C 4JFOB 5JIHA 4R7DA 3NFSL 1DL7L 4PY7B 4PRDA 2OKMA 2V37A 4ZOAA 2DQHL 4Z78A 3U1SL 1MCPL 5KEZA 3W5MA 5CP7A 3U36A 3VXPB 1FO0H 4LXFA 4Y5VC 5BUPA 4P5MB 4MMXC 1EHNA 2P80D 4F5CA 1JYVA 3MSPA 3ROLB 1TLKA 5DWUH 3CDFA 3U4KA 2R29A 1ZT4B 4N1HB 1OAZL 1LO2L 4MYPA 1T0MA 4P4KB 2WTRB 2H32A 3P3RA 2W95A 2IPTH 3FH8A 4QT5B 3TIDA 1NCCL 3QRGH 3WTWA 3KLDA 4JFHD 1Q94A 3KG5A 4TRPL 3DIFA 1MQKH 2UUDK 3NA9H 5IVXE 4NOFA 5BQ7B 5IFAH 1QSEE 4JUTA 4ZDHB 4JRYB 1G7QB 5F96H 1CC3A 3ML9A 4Z9KB 5GRUH 4CDGC 4PQXA 1UKTA 3FQUB 2BERA 4QHKI 1TNNA 4YFLF 2O4EA 5JW4M 4ENZA 2PTVA 5DMYA 2K3TA 4H88H 2HVJA 2DYPB 3WAKA 3STLA 2FYYA 5CAYB 1NCBL 2CZNA 2DBLL 4IMKA 4YBLC 4RAVB 4PWHA 4B41A 1CBJA 5IBLD 3O6FB 4UNUA 4TLUA 3FYIB 2ZSWA 4K3HA 4HIIB 1A7BA 4L8CA 3PGDB 3FF8A 3VH8G 1KFAH 1OAUL 1A4KA 2M2DA 2QADC 4G9DA 3I75B 3DOSB 1HZHH 4JBSA 2FHFA 1F86A 1HDMB 1UT2A 3NACL 1JUFB 1LWJA 1VFMA 2E3VA 2ICCA 1HQ4B 1TOXA 3UFIA 3HPJB 4QJ4B 3ARBC 1UZGA 3BUDA 5C2BH 7PCYA 3NSYA 4OCXL 3HB3D 2KC0A 1B4LA 3UTSD 2NY5H 3GSNL 5FW6A 2O61A 5IFJA 3B7RL 4NNYB 1TYRA 3HA0A 4NT6A 5FECB 1YAIA 4ES9A 1RIVL 4BUHA 5KSBF 5JPNA 1QUNB 4Y19E 5F3HB 3RVUC 1F8TL 3GGWA 4KDTA 5E7FA 5I2IB 5JQ6L 4LSSH 3QJFB 3BZ5A 3ZTDC 1EFXA 3ZKNC 5DO2C 4UI2A 5E00B 4H20L 3DX0A 4XX5A 3MXWL 2XQYK 3AU1B 2X1PA 5ES4B 5KVGL 3BUYA 3RWFA 1JNNL 2QSQA 2C3HA 3LB6D 3WN5A 2ZJSH 2F19H 1VADA 3PABA 4J3OG 4WDIA 5AD0A 2F0CA 5B8CA 1EZSA 3FO0L 4ZFFA 1UD4A 4YK4C 4XNQA 3J2PA 1LP9E 1GGBH 2WLLA 4HGWA 5GZNA 4KPHH 1FGNH 4DN4L 3CIQA 1EHKB 3FQYA 1MFDH 4GLRH 1CG9B 4F15C 4K3JL 3VA2C 5J11B 1AZUA 3TV3L 4LO9A 4P23B 3Q8BA 4JZOA 4NJAL 3SDXA 1T80A 2JTDA 3B9KD 4GRWB 3UP1A 3H4FA 3VXQA 1ZWIA 1QFUH 2H8PA 4LDEB 3RWGB 1OM9A 1JMZA 1O0VA 2WWOA 1EXGA 2Z7UA 3MRIA 5HI4D 5BUAA 4K07A 3CIAA 2XHNA 3WFCH 5DD5L 2EIZA 4ODWB 3W57A 1IBGH 3N9GH 3HI5L 4TQIA 1YN7B 4X4ZA 5I1GH 5A2CA 2WTPA 1NBQA 1A6AA 3DX7B 4FNLH 3K6SA 3WL9B 1I7UB 2FEDD 4ONHA 4Y2OB 1DJWA 2A1WL 1K9TA 2D7TL 3P11H 4PWEA 4HIEA 4XO9A 3TZVB 4GI6A 4NQUA 5GRZA 3K4DA 4OFVA 4AUJA 3M1OA 4Q9QL 2YBGA 3KAAA 3KGTA 4WTWA 1IQDA 2KHAA 3EUDA 4JQIH 1EJ6A 1MFNA 3ESUF 1JVOA 1IAOA 3ZX1A 3P73B 4P9HL 5F8QC 1DCEA 3ULVC 2TRYA 2HG5B 4M1GH 2BSSB 3BKJL 4GKSB 3GZPA 1M6OB 1NGQH 1OF2A 2EH7L 1QQDA 4MJ6B 1E5CA 2NY4B 2EVJA 4YO0A 4KTEH 3RQ3A 4MRCA 1RK1B 5CHNA 3GBEA 5AAMA 1VEPA 3HMWL 2IADA 2Z9TA 2WO2B 4OD3L 1OE2A 4Z0BH 4H26B 2VUOA 1P1VA 3QDAA 4X5XA 5FEBA 2EICA 5FUZH 1OZUA 1S7WA 5FGCB 4UM9D 3AXIA 3PQYD 3T2OA 5C0EA 2F54A 4ZPTA 1WD8A 3GIVB 4J7RA 5HDLA 3WIFA 4DPAX 3MYJA 5C9KA 4JW3A 1KIUA 4HA1A 1PX4A 2NNCA 3AVEA 2NW3A 3LRKA 2WYZA 5IESL 4ZW7A 5DUBA 3VACA 5J7CC 3CFBA 4EVNA 4KOCA 4MA8L 2Y5EA 5ECJE 4KI1A 5J56B 3IMBA 2DWEA 3FBKA 5ANMB 4NDMB 5D1QD 2Q8AL 4NM8L 1M2VB 3RJOA 3V95A 8CGTA 1G84A 4YSCA 5J11C 1DJHA 3IDUA 2P42B 3DJSA 3EH1A 1KELL 5DJ2B 5DHXB 1IB5A 4KKPA 2NW2B 4N2DA 3Q05A 2Y4SA 3GI9L 3H2PA 4GH7B 1RCYA 2J8HA 1AHWB 3B2VH 3MLZH 4R90H 4KK5C 4MCYB 1KCRL 4B9ZA 1TLMA 3K6FA 4KDTC 4OIAA 4ZRGA 1CLOL 1LNUB 2VZTA 4K73A 5JW4R 5DJAB 4Q9RH 3IFPA 3ZYOA 3BZFB 3EJSA 2X4PA 3HC4H 3ARGB 3WJLC 3IDGB 1LO5B 1NFIB 3PAYA 5G4MA 4FA7B 2QGCA 4WHCA 3JV6B 1BMWA 1S7VB 4P5KA 4Z7WA 5ID1B 4XNXL 3NJFA 5AW1B 3WV0A 4QOKE 1L7TH 3ILQC 4AENB 2E5EA 1J86A 1OP3K 1BVOA 4RZCB 3GKWH 4X6DE 3IN0A 1G7MA 1PU0A 4JDEA 1CF8L 3WS3B 1T20B 3CBKB 3TNMB 1JD9A 2X4SA 3PWVA 5DQ9B 5I0YA 4XWOC 2X6CA 2ZKWA 3U25A 1NFAA 3VDCA 1WAPA 3K6NA 2Y1YA 2L0DA 2BCMA 1WEJH 1IO4C 1Q0YH 1MFUA 4PRIE 1AD9B 3II3A 1DVZA 4Z7UF 3VGAC 2IF7A 5EG6C 4ELMA 3RIAK 2V4LA 4Y4KB 4KJYB 5I6XB 4DIXA 3HI6H 2NY3D 2GBAA 4AV5A 2OMZB 1SF5A 2FBJH 3IBOA 7FABH 3WKQA 5HHXL 3I02A 3L3OC 1AIZA 4HWNA 5CD3B 2DM7A 2QQKH 4CUCA 1Q1PA 4OCMC 1VSCA 3VD5A 3I3DA 3NMEA 4JHWH 4WENB 3FZUC 2CE6A 3V6OE 1IEHA 3QNZA 4X4MA 1NQBA 5ID0B 4LCYB 1WC7A 3IJHA 3CSYB 4F57L 1H6UA 3L45A 4Z7VF 5CJ8A 3TBSB 1I31A 3WCYA 2KPNA 3LJ3A 1FFOB 1TFPA 4PRDB 3KYNA 4F7TB 4HVBA 1EHLL 3S35H 4LVNC 5IQ7L 4Z78B 3LPWA 3P1VA 1PIGA 3HAEA 3LOWA 4KUZH 1RZGA 4WWPA 5DUPH 5BZWB 4ELKA 3II2A 3VD9A 3DX6B 1LO4H 1FL3A 2JI3A 4NRZA 1S9YB 4F58L 2H3XC 3JVGC 4P06A 5KJRL 3CFDB 4JY4A 3LRLA 1ORSB 3QPXL 2F1BA 1LO0L 1IM9A 3FU6A 3KPRB 4LF3A 1DJZA 3FRUB 1JZ4A 1YNTB 2VDNL 3C2AH 4JFDA 1T0MB 1XR9A 2AV7A 4U3SB 4G5ZH 2BIQA 4JKMA 5E03A 3VFGL 3CN4A 4WFHD 4UBDC 4U2ZA 2GJ6E 3GJFB 3GUFA 3LXAA 3IBEA 4RISL 3ARBB 1AJ7L 2WXNA 5I30H 4G5AA 1TNMA 1EVUA 3SPVB 5HJDA 2B1AH 4M5YL 2K3HA 3SE8L 1AKJA 4P5TB 2W60B 2OXGB 4APQD 1RURH 5IJKA 2NSMA 3AXHA 3ZT6A 4WY7H 4Y2LA 4FXTA 3LZOA 1YAZA 5D6CB 1ZT7A 3CX2A 5DFTA 1IU1A 2DI9A 3RA7L 4D9RE 2VNCA 2F53B 1NAMA 1C5CL 1SHMA 4IHBA 4PPTA 5E2UL 1NJ9B 2Q2LA 4L0PB 3P30L 4M1DH 2WK2A 4JFHE 4GUCA 1NCGA 1MG2C 2Y6TE 4XR8C 4A63A 1I9IL 3STLB 1AYRA 3HC2A 3HNSL 4RAVA 4KZDH 1A4AA 2HT2C 3E0GA 3VXMA 5I1IH 3A6CH 4I5BB 1PG7X 1NC2B 5GRXG 3QZOA 3QCTL 3RVTD 1PG7W 1IC7H 3WI9A 1YEWA 3LY6A 1DHKA 2D2CC 4HSQA 4NAMA 3RP1A 2VDPH 3MFGB 3DOSA 1OOWA 3LD8C 4L4VB 2JWYA 4LPTA 2P9RA 5AOJA 4B96A 4NIKB 4D0BB 1D7FA 1E30A 1D9KC 3TS8A 1R24A 3NPSC 4JZNB 1VIWA 3ECBB 3E80A 1WYJA 3B9KA 4TUOA 1MCSA 3MJWA 3MOBL 3O8XD 1SGKA 3O3EB 3QW9A 3VCLA 2ZG1A 3LHPH 2WINB 1QP1A 3CFEA 5CSBA 3L3DA 3EOYG 5F3HA 2QGBA 2EIDA 5EO9B 1EHAA 3UGXA 3FO1B 2IH1A 3KVPA 2QFRA 1GKOA 2X89A 2NR6D 1NC4A 2R69H 4HWEL 3NRQA 5AEAA 4AM0Q 1W8OA 4F2FA 4O2EA 2J20A 2RAMA 2OXHA 3WS6A 1S78C 4LOUD 5A2LH 5E99L 4FA8A 1AYOA 5DHMC 5E70A 3B2XA 4IRSB 1WS7A 4RBPH 4HYTB 4WO4C 3T8XB 1UYWH 3WEXB 4AOFA 1HJBC 2ZOUA 4QRAA 4GRMB 2MNJB 5TK4A 2ZXGA 4K94L 1FE8H 2PCYA 4MCZA 3BLKA 3WN5B 4X4ME 4XMZA 3KMDA 2VO8A 3V5KB 4KITB 3KJ6L 1WWCA 1JHTA 2BNRD 3MA9L 1B2YA 2ZCLH 1SBSL 4GT0A 5KYYB 2Y5QA 1ET8A 3QO0A 4N3UA 2BVOA 1R46A 5EWIH 4XTRD 1XSIA 4DO6A 4NO0A 3U9UB 1I1YB 2OR9H 5HGDA 5MENA 3QWQB 4W9DC 4PJGA 3KYOA 2QHRL 4CC4C 2YC1A 5KOVC 1PZ5B 5I1KL 4PJCA 1HXYA 1OSPH 1VFBB 3CSGA 5CFAA 5D9SB 1HL5A 1VF5C 2CMRH 3NCEB 3C6LD 2IPUK 3PL6D 4A38A 2APTA 3DXAD 4M3JA 4YHPB 2YGPA 4AQ1B 4HCRH 5GSRB 5D1XA 3IMRA 2FX8H 1HHJA 4HIHA 2EKSB 2Y2WA 1KTRL 2J7LA 3NJIA 3VFMB 2NY2C 1IGTB 3VMPA 3MLTA 5CZVH 3V10A 2H1XA 5FCSH 5DZLA 2F7RA 1BZ7B 1KXVA 3BW9A 5FHAH 4WI4A 4IHOA 5DGQA 4LASL 5AB1A 3TWCL 1YEIL 4LSVH 1NMBL 3GXUB 4P07A 3BGFB 3O2VL 4CRPA 4X6CE 3MBEB 4TVPL 5IMKB 3F83A 3H9SB 2DLHA 2YPKB 1EMTL 3PFQA 3R06B 4PJ8B 3ASWA 4GSXA 4Q0XL 2PW1A 3H42L 2K9UA 2OX5B 1IGYA 4BWUA 1OHQA 4FRWA 4L4TB 3QZWA 2VQTA 5F9OH 4OV5B 7PAZA 4WTQA 2V33A 4YBHA 5IMLB 3DO7B 1S3RA 1BJ8A 2YD7A 1OF2B 4EI5B 2R2BB 4PG9B 2EYSA 4U33A 4YDMA 1WICA 5F21B 1ETZA 1YA5A 4HAKA 3O2DH 2X4TA 1BX2B 3T4YB 3QNFA 1MKFA 4E5XB 5SWQB 5D1ZD 1L7IH 1DVFD 3DGGB 5E8DH 5K9JH 4X5XB 4WFFD 1R3KB 2ARJQ 2XZAL 3IDIB 4DW2H 1BZOA 2V5RA 1WT5C 3AAZB 2WYHA 5INCA 5FM5M 2HFGL 1T2XA 3N44B 4QRBA 3GIVA 1KGWA 1XGYL 4IRZL 4JQIA 4OVVA 2FB4H 3CFKB 3EF7A 1ACYL 1UB6A 4PJDF 2X4QA 4Y19B 4NC1C 1I3VA 2WP3O 4I3SH 3STBA 2W91A 3D06A 3SDXE 1ODAA 4HS3B 2Z6FA 1UWXH 3KPSA 2DWEB 4N86A 4PGCB 5DQDL 1LQBC 1EEQA 1BXVA 1NDGA 2ZAHA 5DA0B 4XP4H 3DX8A 1CFSB 2LAGB 4GUPB 2BNQE 3OLDA 3WNKA 2BJML 4KZEH 2ADIA 3LXCA 1H6TA 1A2YA 4HWBL 1RIHL 2FQDA 5C0IB 1L9TA 1JK9B 2V2WA 4G8EA 3OBAA 3DUHA 1H8NA 4PJAE 4KI5E 2JKNA 2VM3A 2AQTA 4PP1C 3QIUD 2LT9A 3EJUA 4X0KA 3JUYA 3LXUX 3QUML 4NC1E 2BP0A 2BPBA 4OCRH 2JMRA 4E9XA 1QACA 4Y1AD 4UOJA 1OCWH 2XDHA 1AP2A 2QVIA 4BH7B 3QO1B 4DPBX 2VR6A 2XZZA 1HNFA 4Y5XB 2ALAA 3PU7A 2W65A 2VAAB 3H42H 4K8RC 1UXWA 2Z92B 4BRVA 1ZE3H 2WTRA 4A7QA 2X2HA 3DHPA 4KWUA 3EAKA 3C5ZB 4LKXA 3GJEB 3CSPA 3I9GH 2Y6SD 3R7RA 3KL5A 1QFHA 1DLHA 1G7HA 3BLPX 5C0BB 1Q9LB 5D7JD 4AENA 3DRTB 1NGYB 4M7LH 4A2GA 5KVEL 1E7VA 4LSVL 3X1EA 4NX0A 1YEIH 5IQNA 4D0DA 3NCYP 5IQ9B 3TYGL 4PJ8D 1T20A 3TNMA 5BVJB 1JGUH 3PHOB 5HHNA 5CZVL 3N1GC 2CJ3A 2I25N 1U2HA 2G5UA 1IBHA 5DQJB 2J43A 4OGXH 1GVIA 5AYTA 5E4EB 4PRHB 2LU5A 4C83B 4GRLB 1EEYA 3FS9A 1TQBC 3L4WA 1KTJA 4WTXA 5DZPA 4GG6A 1DZ0A 4XPBH 2DQTH 3JT2A 1QI5A 1KACB 2BK8A 4HCRA 4QHNB 4GJTB 1PW3A 4ICXA 4A39A 5HPMA 3BKMH 5EU6D 1UFGA 5I1KH 1N12A 3VSQA 2W92A 2Z31B 3V9FA 4G7YL 4LVEA 4NLAA 3MRHA 1D5MA 4B7LA 5KWYC 3ZMEA 3MFFB 3PJNA 3T6ZA 2WXKA 5E2VL 4R26H 3EZ8A 5EWIL 1NIDA 1MNUH 3K6OA 1QFWI 3MCKB 5TE4H 1E4HA 5F1IA 3ATFA 4NAQA 3QH3A 1FFOA 5FUOL 3VI3F 3QORA 1JXJA 2CDEA 3CMGA 4CADA 5JPMC 2WZPA 2CQVA 3S4SG 4E9QA 3QFDA 4FQXC 5D7IA 4IOIA 5LCVH 2BWDA 3NK4A 2H1PH 4C55A 3X3FL 4N0FB 3BH8B 3L5XH 2N4IA 5DMIL 3QXAB 4JY4B 3DSFH 3WTTA 1ACXA 4PBXA 4ZJ9A 4JKLA 3SN6N 1YNTA 4Y9BA 1JPGA 4M6MH 3WTSA 2AV1B 4UV4L 3SCMB 3O2DA 4XBPA 2FHCA 4XNYH 3BT2L 5GGTL 2OL3L 4ZX6A 1IFRA 2A83B 3BEWB 1OCWL 4LU5H 2W94A 2XN9B 5F0PB 2L7QA 2YN3A 4OCRL 1MDAA 3N41F 3I6SA 3PL6A 5SWZB 5JIMA 1I85A 1A7RH 4XPAH 5E94B 1DJXA 1BJ1J 3GK8L 3I6KB 4NFBA 3VFSA 5KAQG 3CQFA 5JHLL 5C0GB 3IDYC 1ZGLA 2X09A 1IM9D 4YH6A 1JZIA 1NJ9A 4HWBH 3BJLA 4ZAKB 2QQNH 4XP4L 1VESA 3D9AH 3ILEA 5FYJL 2WXGA 4G6AD 1MRFH 3I85A 1C8PA 2HRGA 1IGCL 3VXQB 1E9PA 1ET5A 2NZ9C 4I3SL 5I17B 4IBTA 5CJ5A 3FU5A 1I9IH 1MCFA 2ITDA 2PP7A 1ACYH 4L2LA 3CUPA 5LBSH 3U6RB 2VR4A 1U2CA 4IRZH 2FBRA 3GZOA 4HC1A 2XWBA 5GSVB 3LNFA 3RA7H 3PDOA 5F0JB 1NFDE 5JUEL 1HQRB 3OPZH 3KWXA 3S5LG 5CEZD 5KUKA 3Q01A 1L7IL 4UTCA 3F8UB 3IS1X 1T89A 4NUMA 1C12A 1CICB 3SE8H 3L3GB 2LTQB 4D3CH 1WDAA 4QY8A 5T1JA 3D52A 1JFHA 5I30L 3LDBC 4EIGB 3FCBA 3KPRE 1HCZA 1UM6L 4PRIB 2JKSA 3MGOA 4GQPH 3WHXA 3LKRB 1JP5A 2Q3XA 3C2AL 1F1GA 1Q1JH 2R4RH 4NQCA 4CVZB 2J21A 1S7RA 4N2LA 4EJ1C 5AVYB 3SDXF 4FA6A 1BYOA 4E9RA 2VN7A 5EBMB 1HFUA 3FU7B 3MUGA 2CIIB 2WXPA 2YD9A 1PLGL 3B9AA 1PTZA 4HALA 3T8XA 3PIQA 1EMTH 4BKLB 3TA3B 2B0SH 4N2NA 5IQ7H 1PZ3A 1SZNA 2CO7A 5F7FA 4J23A 1T4KB 4ZOBA 5MERB 1V3JA 4NN5B 4HZLB 2FD6L 4Z7OF 4IBZA 3DBSA 1QW8A 1KTBA 1NMBH 4JFOA 5TGBA 3AT8A 2VMJA 1HH6B 1TETL 2VL4A 3IETA 2BY1A 3MJ8A 2HLEB 4K5NA 2B0SL 2E9BA 1XO8A 4NZFA 5CP7B 3ULSA 3LS5L 4AMWA 3DUUA 3T2PA 3ZTNH 4D0CA 3KYOB 4TUJA 2V2XB 5BRPA 1F1AA 1TQUA 3NAAL 3SGKA 2BWIA 4KY1L 2FJSA 4JG0L 3FQ4A 5EOCJ 3U0WH 5IVZA 4UU9B 1OE1A 1YEHL 5GRYA 1WEJL 4NUGL 2NNAA 2WWMD 3LKPB 1FGVH 1SJHA 2QQLH 3ZYZA 4B60A 1MI5A 3OPZL 4DEPC 3H3PH 2XTJD 2ZCLL 4OU3A 2X10A 2ZOKB 4ONFL 1NBVH 1SYVB 4C56D 2IIJA 3I3BA 2NRDA 3TTYA 5KVFE 3QDMD 4U0QB 5FYLL 4R4NC 4HKXB 3R06A 4PJ8A 3VX0A 5EUOB 3RILA 1HYSC 1KDJA 3UO1L 3FCTA 5DJAA 1KGXA 4FAAB 5ELIA 1IGCH 3CMOH 2YK1H 3APFA 1MRFL 4OJDH 1MOEA 3AREA 1LO5A 1NFIA 1JHKH 2WD0A 2YUVA 3Q2LA 2QQNL 4GSRA 1P84J 1S7VA 4P5KB 4FFZA 4I1RA 1X3DA 1FLRH 3B2VL 1FI8C 4HAGA 5E8OB 1MELA 3LHPL 4G80B 5H94A 5AALA 1Q90A 1G7MB 3O9WA 1FIEA 1QLRA 2E7LC 5CEZH 1EAJA 2YARA 2X4SB 4K9EC 3DGGA 5DQ9A 3HN8A 3AG3B 1WITA 1U8MA 4LGSB 1ILUA 1J8HE 3AM8C 3ZDYB 4EN3C 1RK0A 3ZRSA 3FTZA 4NNYA 3KHQA 4KK5D 4GAFB 1WLHA 2OL3H 3GT6A 1J1XL 2R0LL 2XVBA 4LCVA 4M6ML 2OMZA 2DLTA 2KS0A 3QVAA 4MNQD 3V4PB 3VD4A 3AT0A 3L2MA 3QJFA 2G5BA 3IFOB 4YFLI 4A55A 2VTFA 1P7BA 3ZKXB 1DBAL 5FA4B 4A7SA 2LLNA 4LLVA 4H40A 3K72B 3WNPA 4AZ8B 4CN6A 4HFWA 4EZMA 3QYNA 3C09C 5FW7A 4YS4A 4PS8A 3TBWA 2OMTA 3CZLA 5I5RA 1E6OL 3F7PC 4Y9EA 5AVZB 5ICXA 4NZRL 1CN4A 3TCLB 5B8CB 2K7PA 4WDIB 3RWIA 1MCLA 3QRFM 2WQRA 5A2JH 2BFVL 5C6PB 4ZFFB 3AQXA 4Y89A 3LEVL 1F90H 4IBVA 4JREB 2C9PA 3CDYA 3T2QA 5AB2A 3V4UL 1ECZA 2EH7H 3EIFA 4MNHA 4WEBH 3A4FA 5BZWA 5SX5H 3BKJH 2IGFH 3A23A 3ESPA 3IMVA 4G7YH 3SOTA 1UCBH 4M1GL 2H2PD 4DO4A 1T7YA 1KLUB 1MN4A 4MB1A 3V0AC 4JRFA 3BVWA 4TM9A 1ORSA 3ZTCC 4P2OA 1T5XA 4G5ZL 3GLDA 5GRJH 4AVKA 2NX5A 3JUZA 3QI9C 2DQTL 1FC2D 5K33A 1F45A 4P5RA 2F8IA 3VXTB 4CMHC 1KB5L 1MFBL 3ATDA 4ECNA 1F56A 4ISVA 4KKRA 1DLHB 3ZL4L 1WA2X 3B7TA 4F58H 1D9KD 3I6LE 3P11L 2D7TH 4PG2C 3QDMB 4PI2A 4OFYA 4PRAB 4RGNE 4X9IA 5T1MA 1L0XA 2A1WH 5IBUB 4P2YA 5C08B 2A6DB 2RMNA 4E0RB 3ATEA 3S35L 3CX5K 2CGRH 3ARTA 4AJ0A 3WTYA 2HH0H 2YWYA 4NUQA 4NAJA 2YXMA 3FUHA 2AJYH 4IGBD 5K9OA 1BQUA 3QNXA 1EEYB 3GMNB 3L3KB 1GHFH 4HIXL 3WD5L 4YMPA 5F8RC 3BH4A 2IXQB 4H0GA 4WO4A 4QPEA 3S3CB 2Y9RT 4ZMOA 1GZHC 1QG3A 3M1BA 5EDSA 3ULUE 3IU4L 1IBFA 5EBGA 4HUUA 2EAEA 3AROA 2CG9X 3UTQA 3N0AA 2E56A 4XOEA 5D71L 5CS7A 2YQ3A 1FGNL 4NCDA 2XWDA 3AS0A 3FQRB 3ELQA 3U4BH 1GGBL 2A6JB 5EUKB 4ZUTB 4YO0B 2AC0A 2E6QA 4YHZL 4YSEA 3FO0H 3KXFE 2AK4B 1Z3RA 2APWA 4RRPM 4BSWB 4R8WL 4CL7A 5EU6E 2A74B 2LLGA 2ZJSL 2MKLC 1FAIH 1RIHH 4PJ8C 1THCA 3QFDB 2R1XA 3SDDD 2F8VA 5DJXB 1PS3A 2YWZA 4FNPA 4FXKC 3CFEB 5HY9B 2P7TB 5L7XH 2B14A 4NBXB 3MOAL 3GXIA 2HRPL 3RGBA 4Y5YB 3T8VA 2XCMC 4R0LB 3N85L 1VACB 3U6XA 3O0RH 4M93B 1X6NA 2LQRA 3HC4L 4XP6H 2WNXA 2MNWA 2M8XA 3WTXA 1X5FA 2HFGH 1UZ6F 2CGZA 3D33A 1T2JA 1Y6KR 3GS7A 4RBPK 2PWHA 3MVSA 2NY5L 5E8DL 5FM4A 4R97C 5K9JL 2EVIA 4OCXH 3X3GL 3PWNB 5CSZA 4LL9A 2IAMC 4PB9L 5HI3D 3MLVL 4W1TA 3EFOA 5E51A 2JCCB 4FFZH 4PV1C 3VG0L 4XMVA 5AKRA 1A6WL 2BVOB 3NACH 3V4VL 1ZGLB 3O11B 3U36B 1KN2L 3VXPA 1WUZA 5HGDB 5D2LF 1SJVA 1SDAB 1E4KC 2EE2A 3HB3C 4QKXB 3LV3B 5HVWA 3ARBD 4G3YH 4S1QH 3TEZA 4ZQTA 5HJGA 5DYOA 1C7TA 4AM0B 1AAJA 2DBLH 6TAAA 4MMZB 2H0FA 2IPKA 3GSQB 4PCYA 4PS3A 1XZ0B 4X80L 5E6IC 1G9HA 3BFWA 4X4XB 2P44B 3OAWA 5I76B 4IGBB 4XPTH 1XV8A 4ZDHA 4LASH 4TS6A 3MROA 3VXSB 5GRUL 5LBSA 4ATTA 1GW6A 3R0NA 3MNZB 3DX9A 3QRBA 2O5NA 3NCBB 4PVNA 5C09D 4HUXA 1PD6A 1PX8A 5JTWA 3BWUC 2WB7A 5DJZB 4TRPH 3VXUA 2FX8L 2Y3AA 2VUYA 3IJEA 2X87A 3OLGA 1BQ5A 3DVIA 4IOSD 2CKNA 5JO5A 3WSQH 3ZE2E 5FLUA 1MG3C 1V8HA 1GGYA 5EEWA 4RA3A 3LNHA 3I02B 2OX5A 1IGYB 3EFFB 1SUJA 2QHRH 2WLJA 1UT1A 3HAEH 4KV5E 1FSKC 4YHML 4FZEL 2CIIA 2BVYA 2PP8A 2OR9L 1OXYA 2B59B 3KPRD 4FG2A 5E9DE 2B8OT 3AADB 1WS8A 2YRLA 1NBYB 2V7HB 1HQ4A 4XVJL 4WK4B 5C0ND 5H8DA 4OGZA 4F24A 1WFTA 2EUXA 3F7YA 1KB9K 3IETB 2AJVH 4LPYA 4X8JA 4MMYB 7CGTA 1FVEA 3ULSB 4UTBL 5CJQL 1TZHA 2AKRA 3OKDB 2XN1A 3VFUA 4NT6B 3K71B 3BVUA 3MR9A 1MCQA 4W68A 2WOBA 4NFCA 1TQCC 3F00A 3LPGA 4MBOA 3FAXA 4P3CL 1A6VL 1TTUA 3INUH 2DTMH 2XQYG 1IM9B 2P24A 4YXHL 2QZQA 1UB6B 3LZLA 3T0EB 1R3JB 1SEQL 3FQ1A 5KG9A 4JFDB 5EPMA 5EF1A 2D03L 1IT9H 1NAMH 1DANT 4JO1H 3ZUCA 3FSOA 5E00A 4XNMB 3IWUA 4HIJA 4RDBA 3DTXB 3AU1A 1CFSA 1J12A 5F7EL 1YPZA 3QIWC 4K3JH 2HP4A 3MOBH 1AKJB 1MWAL 4P5TA 3MUZ1 3CVBA 5T5FL 3QS3A 3S37H 5CN1A 3EOAB 3GINA 3NP3A 5D5MA 3SQOH 3FAWA 4JE4B 1J5OH 4AL8H 1TCRA 1GZQB 2DYRB 3ARDC 3P4NB 1AGBB 4X0KB 1YDPA 5A6IA 1KCUL 4DGWC 4ZNEE 1DSFL 3MV7A 2XVLA 4HQQL 4ZUVA 4AQ8A 5SV3A 1IX2A 4A2DA 1JBJA 1JL8A 3QCTH 4RGMC 1AP2B 5SWSD 3FCTB 1FH5H 2FWOB 2ICWB 4HJTA 3HUJB 3W0WB 2XKUA 3ESMA 2W65B 3NA4A 3FYEB 4QRRE 1DDTA 5LN4A 3TZVD 4I5BA 2JKRM 1CD1B 3D5OF 5T3XE 2YQBA 4FYTA 4WUUE 5C09B 3U7WH 1R75A 4LHUB 1OP3H 5DD3H 1U8OA 4L4VA 5E2UH 4KRNA 4CN1A 2ZX9A 1TZGH 2WLZA 4Y4KC 1YN7A 5AZUA 1RUAL 2LV4A 3Q5TA 2FO4A 1U33A 4K2UH 4JZNA 4I0CC 1NICA 4WY7L 3WIHH 5E1GA 2GT9A 4F33A 1FNEA 3MBEC 4HWUA 1ZRUA 2B1AL 1P1ZB 4M5YH 3VD0A 1X9LA 3GTVA 5MHSE 2LR4A 1YEFH 3WTVA 3EJTA 4LVHC 4KX9A 4RDQF 2OSYA 1HZHL 1NUDA 4Z7VE 2BFGA 4UNVA 4HKBA 2EUWA 2VW6A 1CFNB 1KFAL 1P6WA 5JDSA 4OLEA 2VJXA 4YDIL 1IIKA 3P73A 5DR5H 5FA4A 5F9JA 3T6WA 4BK5A 1J8HD 1IBZA 2NY7L 1A8JH 2HG5A 1Y1UA 4Z7QF 2P5EA 1FG2B 4YZFF 4FNSA 5DC9B 3MODH 4WGWB 5FYKD 1RPUA 2XWRA 4LQ1A 4JJHA 4G6FD 5A7BA 4AH2A 4X8CA 5L4JA 4I3RL 4UIKH 1SY6A 1XTMA 3D34A 4ZXBC 3B1TA 2XPGA 2DW5A 3QYCA 2AZUA 3BI9X 3SE9L 3NRPA 4X98B 1A9EB 4OUUA 5EC2A 3O4OC 1T03H 3BGMB 5GRVK 3KEDA 4FNTA 3NIFE 4UQEA 3UAFA 3AQZA 4C57C 3MYJB 2YAOA 1LTXA 2QQKL 4ZX5A 1DJSA 3CZJA 1FZOA 1NEPA 4DOHE 3QJUB 3VGAB 3RHWK 3UBXB 3CE1A 1S5HA 4HIQA 3H9YA 3CDCA 5I74C 3QEGL 1OAZH 1MIEH 2EO7A 2NY0B 3MN8A 1RLWA 3BDBA 3HI6L 4AQ1A 2HJKB 1S8DB 1NAKL 1HHJB 2NTFA 4Y4FB 2H9GB 2R4SH 1S7XB 1ZA6B 2XN9A 1I7TA 5DC4B 1XGPB 4KHTL 1JGLL 5FXCH 4I1PA 4NHCH 8FABB 1J5DA 4LRNL 2DQHH 3VXUE 2ZCHH 4K9JA 4QXGH 1DL7H 2IH3A 4U7SA 3SPHA 3VFSB 4TVPE 1I8UA 3N40P 4LLDB 4G1MA 4TSAH 2IBZX 1BFTA 5E08L 3T4AC 4NGHL 4KH9A 4GEIA 3FDWA 3H9SA 1FFNB 1NCNA 2DPKA 4TNWF 1UJ3A 1AANA 5EO1B 2BINA 3GRGA 2NZ1A 1N7MH 4W6XB 1QRNB 1MCWW 5KS9B 5C0CD 1D9KB 4PGDA 3LVTA 2JIXD 5G4OA 2ZYHA 3E3QC 3NBNA 4ZYKA 1RJLB 1YJDC 3ME0A 3PY9A 3K3QA 4OFQA 3OD3A 4OIIL 2NY1B 3ZQWA 3G08B 4BZ2L 2HLFD 3FQRA 1SBBA 4Z76A 4NN7C 3GNML 1RUPL 1UADC 2C9XA 5IIEA 1UH4A 2DLEA 2K7QA 5CIPB 1ZK5A 3T4YA 4DAGH 1W16A 2VRAA 4A66A 5F7DB 2LU7A 4AQ8C 2EVFA 1DVSA 4LBAA 4OBSA 3O0LA 1WISA 1I9EA 2RALA 4V1DA 1I8LC 5DK0A 4NI3A 4IRSC 1A4CA 3ILQD 3QHZH 4L9LA 2EEBA 5EN3A 1B3IA 3LN4A 4MSWA 2V3DA 3FPXA 4J27A 2XXCB 4OGAD 5EC1A 3QWOB 4PV9A 3LRSA 3QUYB 5AW7B 3U0PA 1CQKA 4PGCA 3KPSB 2KYIA 1XXDC 2AFNA 4YIQA 5B1JA 3BPNB 3SKJH 2NY4C 4FQIH 1QYGH 4AX3A 1ITCA 2R8SL 1CB4A 1RL1A 5E6IA 3TV8A 1F4YL 4X6FA 4JGMA 5DZJA 2LW3A 4I77H 3BP4A 3JV5A 3TF4A 5HYQA 4AY0A 3CZFB 3IGAA 32C2B 4IDJL 1LHZA 1UT9A 2WXFA 3MJ8B 4N8PA 1E65A 2AJSH 4OGAC 1AHMA 5ETUB 5GS0C 4ZFOB 3E7JA 4PJHE 5ITFB 3DUUB 4D0CB 2VR7A 3OKOA 3Q44A 4MA3A 3CGTA 3AW5A 3QO1A 3F84A 3KPRA 1KBBA 4YSQA 3B37A 5DYOB 3MLXL 3V7MA 3TPUA 3VXRE 3QEQE 1KFGA 2I27N 1CI5A 3LKSB 2CLRB 4UU9A 4X4XA 4N8CH 1OARH 2G9HB 3PCYA 3TC9A 4KKZA 2OP4L 4J3TA 3QQDA 4Z6AT 4QRPA 2W60A 5BUGA 3RUGA 3GZQA 4DTGH 5FFOA 4M6NH 2FR4A 4FNLL 3TO4D 3WMSA 4XMKL 1E8ZA 1UURA 1WFMA 3OHXA 4G70B 1A6PA 3DBXB 5I1GL 1DTUA 2ZP8A 1HH9A 3MRBA 1ZOXA 3BZ4A 1WZAA 4P9ML 3HI5H 4FQQB 4JHVA 1VB9A 4GG6B 3PWLA 5E9NA 4AV4A 4NNPH 5IOPA 1T7ZA 2QELA 3AS1A 2VN4A 4LIQH 1WQVT 4L8SA 3KM2A 4OLYH 4AW7A 4EXKA 1ZEAH 3ULVD 3MKKA 3HS0B 2WB1A 4HHAB 3OR6B 1SDDA 5LNEA 12E8L 4HLJA 2IWGA 4Q74A 1J9CT 2FLBT 1DVYA 1ZVNA 4YVNA 1CWVA 4HK0A 4XPHH 2BSED 3L6FA 4U6TA 1MREH 2WWKO 3LZNA 1YMHB 4CGUB 3SPCA 3QFJD 2I69A 1HX0A 2BVUA 5IVXB 3T4AA 3F7YB 5AW6B 4BCZA 3KCPA 1HESA 5L88H 3OKMB 4BFJA 4GQRA 1JV2B 1NIBA 5JOFA 2XOTA 3PV6A 3E6HB 1XSJA 3O3EA 3D2TA 3MACH 4J3VA 5KVGH 1JJUA 2C9VA 1M57B 1TIUA 2MFNA 5F70A 4PB0H 1ZT1B 1BHGA 3FK3A 3MXWH 1K85A 4XC3H 2VDRB 2DWDB 1KN4L 4PUBL 5EO9A 3QXAA 3B3IA 3MCLH 1IVLA 4OF0A 2P24B 3FCUB 1YCSA 4TULH 3ZY7A 3DI3B 3QA3A 2G5BB 4MAZA 5EPMB 1HKFA 4WSKA 3P9MB 3MCLL 2HX7A 1UASA 1J7VR 1NWOA 2NQDA 3MA7B 3TN0D 1N10A 1RIVH 1UD2A 1T4WA 4GAGL 4LSTL 3ECQA 3MACL 4WI0B 3STZB 2A3TA 3IRCA 3VE0A 3O6KH 3ZKSD 5I23A 2JI2A 5GIRA 3MX0A 2WZAA 1Z0NA 3QS2A 3K8KA 4PJ7A 1TJHH 2WZ6A 3T0EC 1TEGA 2GAZA 4IRJB 4OZFA 3K0WA 4B9IA 1TSHA 3VD2A 2DM3A 5B1KA 1CXIA 3P4NA 1MF2L 2YPLD 1KIQB 1PKQA 4JPQA 4QRFA 4U1IA 4EI6B 2VZSA 4JN1H 3F5WB 5C1MB 5EEUA 4PJGB 2WP3T 2VC2B 4ONOA 2DQCL 1ZKAA 2BSCA 2P5ED 3VVWA 1J10A 1PZ5A 1EJOH 5DURD 1P0SE 3VI4E 4ODUA 5EO0B 4DP2X 6CGTA 2PYEA 1FYHB 2PN5A 3MBED 4NO3A 5DO2D 4LSUH 2CGYA 2VLRE 4FXGA 5DF0A 4NZ8A 4GO8A 4UZGA 4EF3A 4OD1L 2A9BA 1AZZC 4QYOA 4H88L 5DJYB 3P0VL 1U8OB 1QNZH 1N64H 3RL2B 1VFAA 3RVUD 3QWRD 2FH6A 2NY6D 2XTJB 4HIHB 3NSJA 5KSUB 1F4AA 3RKDC 2DYPD 1DN0A 3FUDA 4Z95H 4MZIA 4FQ2H 4ODXB 3AUWB 3DPBB 2JJSC 5CP3A 5ERWB 3PE9A 4Y1AB 2JF1A 5IFAL 3CU1A 4FABH 4BQ6A 1F11B 4MAUL 2PPFA 1OGAB 3OJDA 4UT7L 5C0AB 4KJPC 1KXQE 4IGBC 1EHXA 4PRIA 2IPTL 2N01B 2EVHA 3HZVB 4MXQD 4GRWH 3FTXA 4TLKA 4PRPB 4UNIA 2PR4H 5T1LA 4Z7QE 2H47C 5DT1L 3BRFA 4P3DB 3ARDD 4XOAA 3QQ4A 2CJSA 3FU7A 5I5IA 1ADWA 1TZAA 1E42A 3HB3B 1FYTD 2IAMA 4NUPA 4PN6A 4ZOEA 4OV5A 3GIZL 4QUOA 4MB3A 2DI8A 5AKVA 5I1HH 4AIXA 2HFEA 4GS7C 2RH0A 3FC8A 4JVPA 2OMXA 1CTOA 4Y19D 1JZ3A 2ED7A 4KK9C 1ETZB 1MFVA 4JFEB 5E1HB 3NFSH 4CGTA 4URTB 2N3JA 1HILB 3LN5B 1VGEH 2J3SA 3U9WA 3L9EA 1SLWA 1MHCA 3PGFH 5KSBE 2NY5C 1TEFA 3QDHA 2AI0H 2OJEB 2DQMA 3LAFA 1LO3L 5IJBC 1NSNL 4W4OA 1RZ7L 2VQUA 4MNGA 1P4BL 3KPQA 4UQ2A 3BEVA 3QG7H 2YO3A 4APXB 1QSFE 2BDNH 1FHGA 1EEZB 3GI8L 2CLZA 1E4WL 1E5YA 3BSZH 3IDNA 5TQ2H 1EBPA 4R0LA 1VACA 3QR1A 3VD7A 2AVFA 4OTXH 4DK5A 2QZ5A 2H2PC 4R97B 3QJVB 2MHAA 2C9SA 4NPJA 5LGJA 3FQWB 3QUGA 5IFHH 1N68A 1IEBB 4F2ME 5EZLA 1I8IA 2EXWD 1QR1B 1NZRA 2GUOA 3EFDH 1QUPA 3NN8A 1WIPA 1MI5E 4L3EE 2A2QT 2ZUQB 4C56A 3N43F 4PJFB 4L0YA 1NKOA 4DAGL 1UD6A 2C1PA 4LVHB 3NIFF 4FKHA 2QHLA 2ZQKA 1T0NA 2ICES 2R2EB 1RUPH 5TTRA 4Z7UE 5B21A 1DP0A 4M4PA 2FJHB 3WKMH 2ED6A 2OLDA 1QPKA 3G6JF 1PSKL 5ISZA 1JERA 1O9VA 3D0VA 3ARED 4WW2C 4HKXA 2MJWA 2VRQA 4NSKA 3F7RA 1CK0H 3SJVB 4DVRH 5EIIA 4AJYV 4JO2L 4KROD 2F08A 2DQJL 3LV3A 1MY5A 1UXWB 5CZXC 1JNHA 3K2KA 4ZYKB 1M05A 2A73B 1OAXL 1U58B 3ZKMC 3IJ9A 1QBLH 2HRHA 2X4OA 1A1MA 2ZXEB 5DD1L 5A2BA 4DQAA 2BRRH 1IKFL 4MJID 2N56A 3Q3GA 2QMKA 2YHGA 4AKPA 4DZBB 3GDCA 4BQBA 1S3KH 4FJZA 4TSAL 4LLQA 4HOMA 1BAFL 2WBJB 3ZDZE 3N43B 1J8HB 4YAQB 1TTFA 2WLMA 5MEPB 1WA0X 4L9DA 3MROB 4MDIA 5C0CE 4AGQA 4ZAKD 3C8DA 2R1WB 4LRNH 4M61A 4S0HA 4W9EC 3RZCD 5JA8B 1XXFC 3NFNB 3AU0A 1JGLH 3MNDA 4KHTH 4YHLL 4AWJC 4NWTH 4MBRA 1Z9MA 3VFOB 2BMKB 3MJ7A 4I3GA 3KZ8A 3L4VA 1AGCB 1A7OH 3RIAF 3BKYL 3UMNA 3L4TA 3VH8B 3P9WB 1YUHB 3SKNA 3KE0A 5C07D 4QHNA 4CMHB 2EC8A 4IKLA 5IF0A 3IAPA 1A7QL 5CIPH 5HGAB 4GI8A 3ATBA 1NCHA 4LLVB 1QHQA 4PIRF 1MAML 1D5MB 2IQ9H 3BDYH 3MRHB 1FIGH 4TSBL 3RPIB 1Y0LA 2LLLA 1BQKA 2Q10A 3D2UA 4E5XG 2X9YA 5HYSA 4LLUB 4Z8FH 3PQYB 4J4PC 4B50A 5ICZB 3SDDB 4X6FB 1V3MA 1M7IA 3QQ9D 2YIHA 3QORB 3RX7A 4Q6IA 5CJOH 3ELAT 5JOPE 5EU4B 3V4PH 4LRIC 1H3TA 3VGDA 1E7UA 1RP8A 2V8MA 4EI0A 1XF3A 3MODL 3UCRA 3ZBMA 4FGMA 4P5MA 1MHHA 1NOAA 1U8JA 2FUTA 2VXQL 4XN9A 1V10A 4R84A 2QPUA 3MRLA 4UZUA 5DR5L 4PWIA 3M86A 5EOCL 2IV9A 2H3KA 3J7HA 1JPGB 1O6TA 1P4LA 1PZAA 2XJLA 3QFJA 5IJCC 2KLSA 4AYDC 3IEAA 2CLRA 2X0WA 2Z64C 1A7PH 3CFMA 2R15A 3BEWA 1G0YR 2FJFB 4GQQA 5GHWH 4PGBA 2YUWA 4OLUL 2W38A 4JANB 1TO4A 2WYTA 1G7QA 5CSGA 2QTEA 4M43L 2H2SC 4K2UL 4KMTL 2Y1ZA 5DUMH 3VXRD 5L9DH 3NZHH 3QEQD 4DESA 1WSST 4HUCA 1TZGL 4G8GB 1AGBA 3VM5A 3EJQA 1IM3A 5F7UA 5D7KD 4U1NA 1CE1H 2DYPA 4KXBA 2DQUH 4QOKD 1RKRA 2BZCA 3E9TA 4EN3B 4P4KC 1KTLA 5IR1A 2VABB 2ZYIA 3TJPA 2MPAL 3TGXA 2AZAA 2ZPKH 4M7ZC 3WGUB 1OLZA 1CD1A 1KCWA 5J89A 3UTQB 4MMXB 3BKCL 4PRID 5C09A 3TCXA 3PAVA 3OSKA 2NZIA 4RWYH 3LX9A 3OHMB 2AQNA 4JPVL 2EIKB 1I7ZB 1TDQA 1KCLA 3DX2A 4N22A 3EHBD 2X6VA 1X5KA 2DMGA 1KXHA 2CR3A 2OULB 2WMPB 5I1LB 4AEHL 2NY3B 2JKLA 1V5JA 2KZBA 5IVXA 4TSCH 1JS4A 3BVDB 4Z5RA 4K7FB 4PJHB 1Z5LB 3OVUB 2QQQA 3S37L 3S3SA 3CXDL 3QI9D 3QFGA 1MWAH 5CO1A 4I85A 3P3SA 3HG1B 4GG8A 3CXHK 5IFJB 4AQEA 4JFYA 3A6BH 4J3OC 1PCSA 4A7VA 2VLJE 1ZSDA 3T6XA 3VD3A 2NZ9D 4UILL 4Y5YA 1SMAA 2OM5A 1EH9A 3B3IB 2QR0B 3G5XB 4K5PA 1KGCE 1SEQH 3TVMB 5JDSB 4Y9GA 3ZVVA 1EGJH 3GBNL 4YXHH 4YGVA 4HLEA 1AKPA 4UB0H 2EDTA 3VFNA 4TTDD 4OLVL 2XACC 3QPQC 3QG6A 4Z7NB 5I1EL 4Q4IA 5I6KA 2HTKD 4JGNA 2XNAB 4N2KA 3IGUA 1KJVB 3BPOC 1KB3A 4HGMA 5AZ2H 3LMJH 5GJTH 4ZTPH 5I1CH 3MRMA 3GDBA 4XVJH 1JWMB 3ARUA 1HH6A 1WFNA 3EFOB 2UYLB 1NDTA 2AQPA 2PYFB 1SHSA 4OCSL 4Y4HC 1FRGH 4EI6A 1BOYA 3ARDA 5BQDA 2ZF9A 3BGMA 2DICA 4LOFA 4TUJB 3BSHA 3D6GA 5L0QB 5AOLA 3BVVA 1SQMA 2HRLA 4U2YA 4PBDA 1ADQL 3WSQL 1D2OA 2BLFA 4MQSB 5AOKA 4IBQA 3VXOA 1DYZA 1HU8A 4FQXD 1MFAH 3HN3A 2VDKB 2DZEA 1SXZA 3F58H 2NTFB 4Y4FA 1X5GA 1ZA6A 2RCSL 2H9GA 1RZFH 4XGZA 1T1XB 1TPXC 5DHEA 3L4XA 4JRXD 4RZKA 2F5BH 1DZBA 4HPOL 4O51A 5EMYA 5C6WH 1B3JA 2W9DL 1R17A 1BZ9A 2VITA 3MHZA 4PSPA 5GQBA 3ILPA 4P2RA 2RTTA 3MRFA 3PWPA 1XAKA 2ZOKA 5DU7A 2OMYA 1PVHA 3TFBA 3F64A 3QAZC 3QUZC 3DURA 1WBXB 3VI4B 3IJEB 5BO0D 2VZOA 1Z6JT 4JDTL 2IDUA 1J1OL 1KC5L 4Y0GA 4BWTA 5CP3H 5EUOA 3SGDI 4FXKA 4M3HA 3KR3H 1CDUA 2JB6A 2CM5A 1HOCB 4HXAL 4TNGA 4QEGA 4EIBA 3E3QE 3KPOB 2CALA 3CFCL 4CC4A 5C6TL 5HSFA 1T0PB 4OZIF 1TPXB 3IDXL 3PP3H 3GJFH 4G7SB 4WNQA 3MV8E 3UP6A 1JTTA 3CK0L 1J1PL 3G08A 4KVCH 1CMOA 3S5LB 3ZTJH 5I1JH 2DF3A 1PCXA 3L7EB 3IJ7A 1LP9B 3TN0B 1ZVSB 2V0AA 2FWUA 3WY2A 4H0LC 5ALCH 1O7DC 1QFPA 3DWTA 5C92A 1F3RB 2F5AL 4YDJA 4NZDA 5D2LB 3UC2A 1NKRA 3D3VA 3DC0A 4UYPA 2CHWA 2WLNA 1DQQA 2XXGA 5EH1A 1RFDL 5DGRA 3KLAA 3IDNB 5CGYC 4UT9L 4AI7A 2ICEC 5L8JB 1FNHA 3FFDA 3RI5K 3SGJA 1YC7A 4ETQA 2YOCA 4TPRL 5DUBB 2NXYC 3AWEA 1RHHB 3H7LA 3IFNL 4LSRL 2RD0A 3K72A 3MOAH 1QSEA 2WQ8A 2X4RB 3CZGA 3W0WD 2Z8WC 4XVTH 2RIKA 2FWLB 1JWUB 1XB6A 4B9CA 2FATL 4F7CB 1P5VA 4IOFC 3LQAL 1RSFA 2YGVA 1ZGLM 4CILA 3IVKB 1AR2A 4ZW5A 4NQED 1L3WA 4MNHB 3CHOA 5JZ7C 4ZFOA 2B2XH 2DAVA 1XCQB 2YMTA 1CFMA 5D71H 3SE4C 3KDMA 4PRPE 2CUIA 2Z91B 5KS9F 2F7PA 2YPVH 3GQFA 3VTTA 2GIYA 2CJUL 3NJLA 1MWAA 2DWSA 3H0TA 2X4PB 4HOWA 2NX5B 4PJDE 3IDGA 2HMID 2DV6A 2GTZA 1W91A 3VXTA 3K2IA 2Y1VA 2P45B 5JOEA 5CD5D 5IB1A 5GRVL 4GRLC 4LLQB 2H0JA 4JQVA 4KC3B 3ZW3A 3UTPE 4PRAA 5T1MB 3OZ9L 3B8SA 3H2QA 3H9SD 4JDEB 2DBJA 5B7FA 2A6DA 5AUMA 3HAEG 3MTRA 3PWVB 2R1WA 4WU5B 3UZQB 4OZIA 3UJTH 4KROB 2YQGA 4GXVL 3G5YB 1C1EH 1ZLWH 3WNLA 4QF1A 4MAYD 1ERNA 2BMKA 3G6AB 4L1SA 1CVSC 2I5YH 4XP5H 2NNFA 5D7HA 2CCLA 2AK4D 3N3EA 4RFNB 3MJ9A 4NRXB 5EZPA 1CLYL 3T3MF 3ZZQA 1S5IL 3D51A 4UT6H 5ESAB 1INDL 2J6EL 1M7DA 1WG3A 1H3WM 2BY3A 4ERSH 5BW7A 1DEDA 2AP2A 1H8SA 2AEPL 1B0WA 1FFTB 3OWRA 1UM5L 1WC7B 2HXAA 3D2UB 5HYSB 1H15B 1A02N 1NCWH 2A6JA 1KJ3H 2A9CA 4PR5B 3RFZA 3TBSA 5C07E 1PMYA 5GZOA 5ILTH 2UXFA 2BFVH 3HC3L 3I84A 2K6ZA 4PIBA 4Y5XC 2CBQA 2A74A 4G83A 4XXDA 1F2XK 4JY6A 1YMMD 5HGBA 4LP4A 2N7SA 3GBLA 4QAWA 3GEFA 5T1DL 4ELKB 3TBYA 4R96B 1ZLWK 5KSAA 2P7TA 2F7QA 3K0YA 3C6LC 5FOBA 2JKXA 1DQVA 3UBXA 2P48B 4XMPL 4KI5D 2ZNWA 5HJ3B 3MV01 4CSTA 5JQHC 2ATPB 2PPAA 5IT2H 4A6YA 1RJYB 2UVEA 5GRWA 4R7NA 4P2QA 2FJFA 3EH5B 1OGTA 2BOCA 3QI9A 4YDVA 4URKA 4JY5L 2CDGB 1IEAB 8FABA 1GRWA 3MX0B 1Q4NX 4OZGE 5J06A 4FLSA 3PWNA 5CSZB 1F6AB 3I9AA 3MLRL 4JRLA 2E76C 4FQXA 1CGSL 2WQSA 4JHAH 4BZ1L 5J6GB 2EECA 4M7KH 1ACCA 2DRUA 2D9QB 4KAQH 3UH8A