3QZNA

Staphylococcus aureus isda neat domain y166a variant in complex with heme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
ATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINANHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein A
publication title Iron-Coordinating Tyrosine Is a Key Determinant of NEAT Domain Heme Transfer.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal binding protein
total genus 26
structure length 121
sequence length 121
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qznA00
3RTLA 3QUHA 4NLAA 4FC3E 2Z6FA 3RURA 2ITFA 2Q7AA 2H3KA 3OVUB 4H8PA 3S48A 3QZOA 5D1XE 3QZLA 3QZNA 2K78A 2O6PA 4WJG3 5D1QE 3VTMA 5D1ZI 3QZPA 2E7DA 3QZMA 3SIKA 3VUAA 2ITEA 4YMPA 2O1AA 2MOQA 4H8QA 3SZ6A 3SZKC 4MYPA 3QUGA
chains in the Genus database with same CATH superfamily
3ZE2B 4ACPA 1HEZA 4XVSH 4DZBA 3MLZH 3FU7A 5TQ0H 4C58B 1N64L 4JW3A 1T5WB 4YBLB 4A7GF 4RGOH 4TUUA 3BUPA 5JHLA 5HDBF 1NCAL 5FGCB 5F7DB 2QEJA 4FNPA 3WIHL 3MACL 4P59L 1E28B 4PWGA 5E03A 4XRCB 3VRIB 3MV8B 4ZW6A 3LVTA 2NUPB 3TV8A 1ET5A 1RJYA 4Y2DC 2X89D 4ODXB 4Y19D 3VG9B 2QQKL 2P8MB 3LH8A 3SZ6A 1JV5B 3UABA 3GBDA 5B4MD 4BH7B 1UM5L 1AKJD 5KTEL 4JM2A 1AGBA 1LMIA 1ADWA 3BJ91 2R4SH 1L6XA 3TU6A 2NZIA 1O5DT 3L3JB 3NDYE 3GM8A 5F9OL 3SQBA 3NT0A 4KI5C 4ANWA 3CFDA 1B2YA 1CWVA 2DL2A 4HD9A 4ZMNA 5T1LB 4QLRA 4B9FA 1J8KA 5ICYA 3V0EA 2FH8A 1ZHKA 3MNZA 5DHXB 1ETB1 1E9OB 2AQRA 1W16A 2DQIL 3BT0A 3K91A 5AZUA 5EUOA 2NUTB 4KVNH 1FVCB 4HS8L 3FONB 3PHQA 4P23B 1RK0A 4OD1H 5D1QC 5HHOA 4NQED 2MIZA 5L2KE 1TTAA 1RIVH 3T0AA 1FZMA 4L5FL 3BAIA 4YQXL 2J44A 4P5SA 3HZMB 5I75B 5SWQB 2XY1A 5FCSH 4NQSB 5C08E 4ATTA 4WFHE 4JPQA 2J25A 4ZMAT 1MCOL 3WGVB 1KJMA 4F80A 2VMFA 4KJPC 4D9QE 2CLVA 2VSKB 2ZX7A 3QCUH 4HP5A 3ARPA 1WWBX 5TE4H 1X6LA 2XPZA 3GSQA 2NSQA 4AQ1C 1N6QH 3C8KB 3M1BB 2XBZA 2FZ3B 3EDEA 1U58B 2ICWB 3S0PA 4AQ1A 4PY7A 5ABDE 2LLNA 1YZZA 4HZLB 3LV3A 5I74B 5BUPA 3MJ7B 3A4AA 4UDTA 4MZ3A 3CH1B 5F3HA 3P2BA 2ZKHL 4PG2C 1CBVL 3O9WD 3MNWA 4I89A 3V4PL 3QFJD 4RH4A 2CG9X 1AH1A 2CK2A 2P5WE 3QG7H 5IVOA 1THCA 3WS3B 4LLYA 3FHAA 3L8QA 3GUTA 4I0PB 1WZAA 4V2CB 1TU2B 2H47C 4TSAL 4KROB 1BVKA 4MS8C 4PJ5E 5DS2A 1HKLH 1H8NA 1JPGA 4I85A 3CSPA 3ARGB 3KM1A 1EO8L 3W39B 3C6LB 2IANB 2ATPB 3H9SB 4WW2C 3HE6C 5DHVH 3HC2A 1QSEB 1KBBA 5EMYA 4I87A 3FB7A 2WLIB 4NUGL 1HILA 3HE6A 1MAKA 2WBWB 5I73B 4K3JL 1R9FA 1KGCD 1XH0A 2HCZX 2OXGB 3BAXA 1ZRUA 5DLLA 2D7NA 1IAIH 1NANI 4U7KA 4XP6L 4U3HA 2V9RA 4L3EA 2FD6L 3OPZH 4YE4L 2NTFA 3SEPA 3V4VA 4P3DB 1XB6A 1HAUA 3KDPB 2R0WH 2ITCA 2CJSA 3INUH 3O4OB 3UAJC 5DD1H 5EOCJ 4JM2D 5E8EB 4NQVA 1ZLSH 3DROB 3M7FB 3KE0A 4G6JH 4PLJC 3UAJA 4ZUVA 4N2MA 5FF6A 5IESL 2KQMA 4LPVA 3FQWA 1IAOA 1PFOA 2VXSH 1S7WA 2F5AL 4ALAL 2QLVB 3GMQB 2DJ4A 2VDLL 1SYVA 3MSPA 4PAZA 3AU1B 5CLTA 3OX8A 1QR4A 3S3PA 3PUCA 1AY1H 4G8GD 3RGHA 4X5LA 5CP7A 2BH0A 1S5IL 3TEUA 4ETQB 2GEEA 2JIXB 5HHNA 4DN4H 4ZMOA 3H3KA 5KS9E 3HZVB 1IC0A 1UH3A 3GSUA 4LGSB 4TVPL 1PMYA 3APCA 3KJ4C 4JEGB 1OPOA 4XN4A 2BY0A 2FJGA 1MJ8L 5E5LA 5HDQL 5DZPA 2DQCH 1AR2A 4GSDL 5B39G 1O9ZA 1RUQL 4FQHA 1G94A 2IPTL 4YAQA 1VDGA 4LSUL 4IIQC 4NQTA 1F45A 5GRJL 3EO1B 4MBOA 3L7EA 3LEVH 4U3SA 4YLQT 2K9UA 2VT0A 4UQIM 3T3MB 2O4EA 3QPKA 4IIQA 2E4TA 5DQJA 3QULB 3RA7L 5I71B 3I3DA 3ETSA 2XCMC 3QZLA 4KITB 1BJ1H 1E5AA 5TE7H 1CF8L 3JVFC 3BVNA 5ESVB 3ROOA 5BXFB 3TJHC 1KEMH 5E08L 2VR5A 3VWKC 3D85A 3QH3B 5C6WH 4KO9A 4G3YL 1ACZA 3T2NH 1DQDL 3VWKA 3NAAL 4ZFFB 5B3JF 3MV01 2VRQA 2L7QA 3MJ8B 5FO8A 2Z64C 4K94L 4NO2A 1DVUA 3GI9L 1DLFL 3B8SA 1G9EA 1K5WA 1SM3H 1H8SA 1ECYA 3MLYH 3N04A 2QSVA 4PY8J 1G1OA 1I85C 2D4DA 3LH2H 3FCUB 4Y1AB 1MJJA 4S11A 3OMZA 3VFVA 1C5DA 4DK5A 3MBED 3KPSA 4P3CH 2FCBA 2FQFA 4KKCC 2ZCHL 4MS8D 2UUDH 3REWB 5EF1A 2B59A 4P0DA 1ZLDA 2AXFA 3PWVA 3UCRA 4HPOL 5CF3A 3RG1C 3VQMA 5F1KC 3KCPA 2G3ZA 3PGDA 1YY8B 4K7FA 3IYLW 2EC8A 4U1KA 3FUFA 1IEAB 1XHHA 1DJIA 2VLKB 4GOSA 4DN3H 4FLQA 2WLYA 1K2DB 5AWNH 4PRPD 4FNRA 4X7FC 3ZVVA 3QQ3B 4F20A 1BQ5A 1LEIB 2UY7B 1NINA 4O2CA 5B39B 1MREL 5F3BA 2JCWA 2MCPH 3C75A 3WLBB 3FT4B 5K9JH 3ASOB 4TQIA 4H1LH 4M48L 4NRYA 5E56A 4Z0XB 1UASA 3WFZA 3CFTA 2FJUB 3W11C 1OOWA 3RKPA 4JFOB 4DK6A 4OV6F 4AKPA 2WXLA 1AZZC 4L1DA 1XIWD 4PLJD 4M61B 2BFVL 1HEJC 1CXLA 4X6CA 1YEDA 5CZRA 2J2ZA 4MHHI 4X6DA 1ADQA 2VERA 2OZ4L 3D12B 5FAAA 3IDYB 2A9NL 1O6SB 3DX7A 3AS0A 4JCLA 4M1GH 4WENB 1R3KB 5HYJD 2ITEA 4W9EC 1N10A 1RULL 2R27A 3ZYIA 4AL8C 4BUHA 4BUGA 1ZHLB 2IH3A 1OCCB 4JRWA 4JY4A 4JO1H 4MLIA 1QBLL 4DERA 1SBBA 1XXFC 3E2HC 1UEMA 2O5YL 4NWTL 1JJUA 3TBWA 5EO1A 2VC2B 4ZXBB 5C1MB 5I6PA 4Y19E 2K70A 4MSWB 4LLVA 4WK0B 5F44A 4MA3A 1YPZA 3D85D 4UNUA 4F7MB 1JHKH 4BFRA 4GIOA 3GKWH 1A65A 1FVEA 5C0BD 1KB9K 1EO7A 1RVFH 3RDJA 3SPVB 5CZVL 2O26U 3Q05A 4W9KC 3CFBA 4HZ1A 2L8AA 1UM4H 4YHML 3EFDL 1T03H 1A3ZA 3L1OH 1XR9A 3L3KA 1XF2A 1A4JB 2HVBA 4YGVB 4PW3A 2WP3T 4N0UB 2F58L 1EJ6A 4GP4B 4FG6D 4S1SH 2JQZA 1JOIA 4HU2A 4O5LL 3ZMRA 3F7RA 1G0XA 2VLRB 3H7BB 4I88A 4M9PA 5FDWB 1T2QL 4PG9B 1GYUA 4NQEE 4KKCD 3I9PA 4ZNCD 1IBFA 2AEIT 2CRYA 4O02L 3ZLQC 2ZUSA 4F8NA 3L17A 1KB9J 3Q8AA 3VX1A 4H5SA 2ZOTA 4AVHA 2ITDB 2A73A 5LO7A 4YL9A 3M6DA 5IEKA 3T0DA 1CDIA 4PV9A 2WO3B 4R90H 3FCSB 3EH2A 2J7LA 4F93B 2V5TA 5CILL 4N6RB 2P7TA 5C0CA 5IKCA 5FB8A 3IRZA 1TJGL 3VG0H 4ZFOL 1IBGL 1RMFH 1RHHA 3GPSA 2A1WH 3MODL 4PCSA 1BX2A 1WCQA 1B6UA 2ARJQ 1JGVL 3EFFA 1OAUH 4F1SA 2YC1A 5EU6A 3V52H 4X6EA 5BOJA 3QFJE 2Y25A 2CKBB 4NAMA 1Z9PA 1A5FH 1FH5L 4MCZB 2WJ7A 3ARFB 3MV7A 5EF3A 2WBJC 4QRQA 4URKA 1CFTB 4YSEA 3S96A 3L4ZA 4ZPTA 1OAZL 1SJXA 2ITFA 4GAYB 2GJZB 2WBJA 2XN9B 3HC0B 4TPRL 1KCRL 1WGVA 2ADFH 2ARJA 4RISH 3VXUD 3DMMD 3N85L 3T2LA 3BPOC 1MFBH 4QXVA 3NTCL 4M6NL 1JGUL 1WAAF 4OIIH 3EOTH 4JHWL 3IWUA 2X2IA 4U0RC 3I9GH 4LPUA 2FE0A 3OKMB 1KGCE 3V6ZA 4I0KA 3LNEA 1JHTA 4MNQA 3LNFA 4DJMA 3VVWA 5I30H 2FT7A 2WYHA 5KEZA 1M3JA 1V3JA 4EAEA 4WFED 4FS0A 2I5YL 2BNRB 1I7RB 1T66C 5D5MF 3IDXH 3JV4B 1CVRA 3V5DA 4PJIB 3LPWA 5JXAL 1EHKB 4P5KA 4YXLL 2HJFA 2YAFA 4NUJA 5KYWB 1UVQA 4M5ZH 2V7NA 2WCSA 4KUZH 1SLXA 4A2GA 1I1AB 5SX4I 2XFXA 3U9WA 4JFTA 5FA4B 4B9IA 4LIQH 4X6BB 2EINB 1J11A 4MXQD 2AP2A 2ALWA 3EYVA 4GQ9H 5HVFB 4G8GE 4NT6B 5D2LE 1JZGA 5IJKA 1AGFB 3FPXA 2GUOB 4DQAA 1PZ5B 3MCLL 2AK4A 1WIUA 2Z7WA 5GSVB 1BMZA 1RZ8B 3S8FB 4FNLL 4OQ1A 3NSFA 3BAWA 1M1XB 1O7DC 3WJMB 1NGZB 1URLA 3HRPA 4ONHB 2ERJC 4EBQL 1RJZA 4U1MB 5D1ZI 2EYTB 4GW5A 1DVZA 1JTPA 3MUGB 3GF8A 4FQXD 2QKIB 4KC3B 4TUJA 2K7PA 4YIQA 4QRTA 4EOWL 4BD4A 1N0XH 3G6AA 3IDNA 1SJHA 4KWUA 2J8OA 4WEMB 4GXVL 2Z7ZA 4QRUB 4NERA 5FDYA 5C0CD 4KK5D 1QYGH 5H8DA 3U46A 1PBYA 5J7CC 3IJ8A 1VESA 4WTWA 1FN4B 3ATDA 4LCUB 5EOQH 1RZKH 3CD4A 4HD5A 1OP5K 3V8OA 3VI3A 5EU6D 3KYOB 4AGMA 4YPGB 1IGJB 1EFXB 2D7TL 3ESVF 4BGDA 4L4VB 3BZEA 2IH9A 2GAZB 4KX8A 3QFDB 2XJKA 3H6JA 4JM2F 1YAIA 1BMWA 2UV3A 3TWCH 3MV7D 2XZAL 3ECBA 3NIGB 2RD0A 3IDUA 5IEHB 3QUZB 2X6BA 2NY5C 5BS0A 3MLTB 4D0DB 3X1BA 1CCZA 2JKJA 4P59H 3VU1A 4XMWA 4AYMC 1FP5A 4F7EB 4KI5F 4FTVB 3MLWL 3PRZA 5DQDH 1BIHA 3MJ9A 3NDZE 5DUPH 3ZDYE 1IL1A 1U8JB 2P8LA 4KXBA 2ZG3A 4CL7A 5CLWA 4X2UA 4AMWA 2QQKH 5DJAB 4L8SC 1I4FB 3VFNA 1KEGL 1VFAA 1DEDA 3EYOB 2OAAA 1HCYA 1UM5H 5D2NA 2G2PA 3NCMA 3RKDC 3F6IA 1MCLA 2QGBA 5D1ZA 2C9AA 4KVPA 1JXKA 1I8LC 4PRPE 4UAOB 2J1ZA 1CLZH 1I8LA 4EE2A 4UQ2B 1OE2A 1T66D 4JO5A 3LDBB 5AZEL 4ZMTA 3CFJB 2IPUK 4ZAKD 4NXKA 1A1OA 3Q6FA 3P1VA 2EIZA 2Q86B 2AF2A 4XVTH 3PWPA 3ZE1B 2HJLB 1TDQA 2J55A 1AOHA 3CQPA 2HT4C 3DWTA 3G5WA 1J7VR 1GGBL 4TQ8A 4L5FH 4P5TB 1OAYL 4TOYH 2W9EH 3O3DA 1VEMA 4MAYC 4LIQE 3WL9A 3QWQB 4C59B 2FO1A 2QADB 1ZHNA 1PGRB 2VABA 4K9EH 2FEDC 2Z8VC 3RVWC 4MAYA 5HYJE 5DUMH 2F5BH 3GZOA 2VDOH 4HFUL 2MCG1 2OMYB 1HZLA 1Z9SA 3O41B 3Q2VA 1XGQB 4MZ2A 5DU7A 1TEGA 3DTXA 3AQZA 4XPBH 3B9KB 4G6MH 3TT1H 3ZDYF 4OCRL 4G1MA 4JN2B 1G9MH 1VLXA 3CFEA 3V4PH 3ELQA 5EO0B 2EYSA 5HDOA 2NTSP 1LHZA 1I8KB 1M2OA 5MP6L 5C0BE 2DLFH 3FU5A 2XXGA 4NN7C 4ZUUA 3VXOA 5C92A 2NY7L 5CIPB 4JZOA 3CHXA 4NC0B 4JFSA 1JK9B 3R06A 2R9HD 3PHAA 4FL4B 4F8TA 2X4QA 3GXMA 2Z65C 1QO3B 1CDHA 1JZHA 4K3JH 4Q6YA 1NFAA 3W0WB 1BIIA 1NBVL 2X4UB 1ZA6B 4W9FC 1TEFA 3QXAA 4KTDH 1J9SA 3OHMB 5E4OA 2IDFA 3FN0L 1M56B 3FOLB 4YDIL 5DEGA 4PS7A 1DP0A 3A47A 3B3IA 5ERWA 43C9B 1E3ZA 3IMRA 4GP5B 1OWWA 5DS8A 3PV6A 1WWCA 3PE9A 4G9DA 3U30C 3RVTC 3UIZA 4G9FB 5D1ZD 1EDQA 1RURL 3LRKA 1XAUA 2BSTA 3MRRB 1HQRA 4YHKH 3WCYA 4X4MA 5IJVA 5E9NA 2A99A 5E1QA 4HKBA 4PB9L 5G4NA 1CXEA 4IDJL 4TVSa 1LDPH 3CVHA 3QJZA 4KUCD 2X7LA 3L9RA 4BFNA 1PEZA 4NM8L 3L6FA 1E4XH 1UYWL 4BZYA 4FYRA 4ZOEA 4HUUB 4YO0A 1QUNB 1V10A 1ZVSB 3PWPD 1BZ7B 5IFHL 4F37K 3QHTC 2Q0ZX 5HDQH 1YNLL 5E7BA 3CC5B 1AIZA 1JGEB 2I9TB 4X6DE 4S0TD 2KT6A 2IPTH 4IMKC 3UPRB 3U7YH 2N1TE 2NZ9D 5EZIH 1JFQH 5SWZB 2RJMA 3VXUE 5IOPB 1CXHA 4IMKA 1CFVL 1V27A 3CWGA 3HB3B 4FKKA 3PQYD 4MAYD 5A6LA 3MX0A 1Z66A 1UT2A 4RCAA 1S3RA 4CGTA 2IPKB 4L5FE 4AK2A 3RVWD 1OD7A 2FEDD 2H6PA 5ACZB 3ET9F 4UV7H 5TQ2H 3G5XA 3GSWA 4M7JH 1BVZA 3BWSA 3EYQC 3GS7A 2C9RA 4P3WA 4WFEE 5JIKA 4PJEE 4QJ5B 3OC5A 1TCMA 3ZKND 1LP9A 1UWXH 1E4JA 3CH8A 3MRDA 4I3RL 4NHUB 5LB1A 3PL6B 3T8XA 1SEQL 2G9HA 1AS6A 3CMOL 3OKLB 3WKQA 1AXIB 4TMPA 1PG7W 5KSUA 3IETB 5AKRA 5J4MA 4WHYH 1G9NL 1KGWA 3B83A 4CVZA 1IILE 2O72A 4PRAA 5TGBA 3OWEA 3BPNC 4ONOA 2E59A 3ZT7A 5FFOA 1U3HC 3S8WA 1KTJA 2AGJH 3E6HB 2ED8A 1BVNP 3DGGB 3LIZH 5GXBB 4LE8A 1KZYA 1U3HA 4XN2A 3W2DH 1ITBB 4A6YB 3FRUB 4FERA 4NCDA 2C26A 3D2UA 1PLAA 2H32A 1NIFA 2W92A 4GFXA 1OLZA 2ZX9A 5D7IA 3JTTB 5C09D 1HNFA 2EEAA 4PGBA 4X6CF 4JRLA 2J6EH 1JS4A 2F08A 2UZYA 2WV3A 4X6DF 5JOEA 4NI6A 2BVOB 2UXVA 1UOVA 4ZZKA 3ESMA 5LAPA 2VSCA 2JKNA 1OE3A 4APXB 4Q0XH 3QA3A 3MYJB 3HUJE 2VQ4A 4PWEA 3OKKA 2K7QA 3QORB 3V6BR 4YDJB 4G8FB 3RVTD 2XXFA 2EDWA 5C0CE 1JWSB 1MLCB 4OJDH 4K3GA 2Q7YB 5EZJB 2DTMH 2F2HA 2G2NA 2IALA 3F5WB 4F37F 4FQ2H 1Q9KA 2Z34A 5SX4H 2O6DA 5EU6E 1QWNA 3HE7B 1J8SA 1RP9A 4OLUL 3W5NA 3A67H 1HKFA 3FH5A 2A9NH 3AY4C 3FSAA 5HPMA 3SODB 1R1CA 3UGUA 3IVKB 2JB5H 2JWYA 3AY4A 1BAGA 3MV7E 3BPCA 3MJ9H 4UTAH 4WUUB 3GXFA 3QJRB 3CSBA 2P3YA 1QBLH 2YA0A 3AT9A 1JWUA 3RAJH 4J3OG 3BP5B 4K23H 1BZOA 3PG2A 1FFRA 4NWTH 5MERB 2AEPL 1LO0L 3QRFM 5SWSA 3FCGA 1J9RA 1QQDA 2CO7A 3W82A 4R5VA 2CDFB 4KKPA 1EZVY 4J27A 2NY4C 1H5BB 2WWMC 1ET8A 1HWWA 4W9DC 3BP7A 5IFAL 3TBVA 2L7EA 5LG6A 1U8IB 2EO7A 1UXMA 4Z7VB 5BV7C 4F7CB 1MIML 5EOTB 3ZDZE 3HNVL 4IU2B 4RDBA 3UAEA 4HSCX 4PI0A 4QHMA 3O4LA 1KGYE 4I5BB 2LAAA 2X2YA 5J56B 5JW4R 4QTHB 3QWOB 3SKMB 3B9EA 4IBLT 4PS4H 1FE8L 1H8LA 4NKQB 1X5HA 3MO1B 4W9IC 4UM8B 4ZX4A 4NBYB 2EDMA 1R5IA 1T2QH 3OB8A 1KYAA 1U3HD 1KYDA 2VQ1A 4MXWH 1T04B 5E2TL 3V0GA 3BQUB 1SQMA 2CQVA 4NSKB 2ID5A 1ES0B 5EBWB 2EDLA 3J7HA 2Y07H 2R8SH 2FLMA 3TVMB 2XG5B 3L45A 4HS6A 2VSDA 2DWDB 4YEFA 3RJOA 4DP9X 1BYPA 2IDQA 3O45A 3TTYA 3KWUA 2F53A 3IJHA 4W9HC 4DEUA 5BRZA 3NBNA 1O7DE 4ZS6D 1E9PA 3ULVC 1C16B 4OFVA 4UTBL 4GMSH 3BDXA 4ZG1A 5IVXA 1N67A 4JKPH 1YDPA 4EIGB 1W91A 3QIUC 2EABA 2G5BA 5INCB 2H0EA 1A6WH 1PG7L 3AAZB 1FLRL 4XOEA 3VGEA 3QIUA 1ZDSA 4DVRL 1NDGB 1CYXA 1G6RA 3HC3H 2HLAB 3CFKA 5DZLA 3KLHC 5D7SH 5JW4N 2WXOA 3IFPB 3NVQA 3EO0A 2P24A 3NA9L 5DEFA 4ZYKB 4TXVB 4OU3A 4ZI8A 3KHQA 3RUGB 3BT2L 3ZDZF 4EZMA 1KLUB 1WEJL 3U7AA 4TPRH 3L13A 3ZN6A 4EI0A 2DIAA 3R4RA 3DIVA 2FEEI 3E6FA 1NAMA 3MRIA 1EQWA 3NTCH 3EYFA 4M6NH 4ANKA 4BXSV 1NCCL 5JIIA 4R96B 4HOWA 4WWID 4YHPA 3WGUB 4O58L 4I3SL 3NFPB 2AITA 1XMEB 3IJEA 1CZ8L 1XD1A 3OAZK 3OKOA 2JKXA 2OJZL 5IW6A 1KB5L 3DO4A 3EOBB 1S7SA 5E8DL 3KPQB 5TH2B 2EAEA 5SWSD 4RGND 4I48A 1NFIA 4L1BA 5F7BA 3BYYA 3RL2B 1YUKB 1DSFL 4K7PH 1FA4A 3ZTDC 1KCLA 4JFPB 5KBKA 5D2NE 1U8KA 3NGBC 5JPMC 1INDL 5EC2A 1M53A 2A9ML 3CVHH 1NBZA 3QDGD 4Q97A 4HAFA 5CLZA 1BM3L 2EEXA 5JPMA 4DKTA 4JFXA 4XNMB 4XCEB 3HPJB 1NIBA 3O4LD 1IAMA 1TKWA 2PCFB 2AJUL 5GZOC 1RL1A 3PXJA 4LF3A 5JIHA 2GHZA 5GZOA 1NPNA 4LARL 4OTXH 4LOUC 3IJSA 3BP6B 3PYCA 5KZCB 3ML8A 3ZZ1A 1E27B 1S7RB 2K6YA 5DC2A 2JKWA 5ADPL 3DJ9A 1SOQA 3VB9A 3UOAB 4MCYB 2G9KA 5DFTA 2DH2A 5F9JA 5MENA 4YR6B 3D09A 4Z7QB 3VI3F 2H2PC 3FB8B 4KTYA 3MZTA 5F96L 5H4YA 4R4FH 1HNYA 4OGYL 4PPTA 2BXYA 4EOWH 2LE9A 3DOHA 1N0LA 3PQYE 2ZICA 4MQ7B 5BRZD 2NDGA 3VGBA 5EPMB 3GJFB 4MNGA 5CFAA 3U1PA 4ZW5A 4PJFA 5EN3A 1YUHA 2CCVA 3ZL4L 1AI1L 1YEFH 1QX1A 4NPJA 1D5ZA 1P9MC 1UD3A 1VZHA 3SJVA 4NQUA 4EZJA 3LXUX 4LPCA 5KN5B 1RJLA 3APFA 3E9UA 1P9MA 3B9AA 1G7QB 3CNKA 1TQWA 2VZOA 3JBG7 3LRSA 5IVNA 5C97A 2AABH 3LN5B 5AUMB 1P4IH 3DDGA 5FOBB 3FOMB 4FQJL 3VFGH 4RQQB 1IKNA 2PP8A 3ZK0A 1J5IA 4DKDC 2J4WL 4UQBA 1J1PL 1MCPL 4MDRA 5C0GA 3VFSB 3EHBC 2VITA 4K8RD 1A4BA 1LWHA 5EO9A 1HXYA 5C2UB 2FUTA 1JAEA 2NY6D 4KUCF 5KSAC 5K39B 3ZL2A 2CAKA 1BPLB 3GMRA 3KEHA 3BKJL 3POCA 3WAKA 3ZKSD 5KSAA 3DVIA 1WYJA 2OQJB 3B7UX 5C09E 3C5JB 3DURA 1I8MB 1D9KB 1CDCA 4CILA 3QZPA 4E41B 4FLOA 4X7SL 4P2OB 4Q9RH 4ODTH 5I1HL 2QR0A 4UUJA 4N68A 4QT5A 4M6MH 2BNUB 2HG5A 1YEKH 3A21A 2NY1D 2HLFD 5DVMA 2RB8A 3ZGIA 2WYZA 3OBAA 2IAMC 3FTXA 1ZJBA 2BERA 4L4JA 4A37A 1TMCB 3UBFA 2HT2D 3COOA 4EDXA 2HVKA 3CU7A 3L3IB 1X4XA 3QS3A 4X4ME 1NEZG 2FYVA 1TJMA 1AHWB 2WOYA 1KELL 4I4WA 4BH8B 1GGBH 2IGLA 3IAGC 2H0FA 4GQPH 2ZG1A 3CHOA 3EFOB 1JBJA 1NBQA 1JCKA 4LHQB 4PJCB 3UTSA 3OKYA 2V7HB 3F05A 2P5EB 4BINA 5LBSA 2YEZA 4QDGA 3NEOA 4UQ9A 3WAJA 4JRYD 1OP4A 1OSEA 4G5AA 3N50A 5DJXA 5F7DA 5MEND 3O8XC 1E28A 1GH7A 5AQ0A 2ICWI 1KIPB 3P3RA 5JW3L 1FYHB 2H2PD 2NUPA 4YJZL 2YFOA 3VMOA 3VG9C 1R46A 5E6ZA 1GCFA 3GDCA 4HFWB 2VL5B 3Q3GA 3BAKA 4IDLA 3IFOB 2P8MA 1OHZA 1FCGA 1AQDA 4JPVH 2DQGL 1NGXB 4HWEL 4X50A 3ZR5A 2IDTA 5G5DB 3T2OA 3IFNL 1V7NH 3HAEH 3QEQB 1JWMA 3L3JA 4DGYL 4XOAA 1XAKA 4P99A 1TIUA 4QRFA 3D6GA 3KVQA 4XMLL 3NFSH 1LP9E 3SJVD 4EO5A 3PP3K 4Y5VC 3WELA 3GI8L 5T1LA 2DJUA 1KY7A 2VUKA 2AK1L 3HI1B 5CD5D 1USZA 5ETUB 1OQOA 3BO8B 3ECVA 3JZ7A 1NUDA 3MA7B 4OD3H 1MRFH 2NUTA 4P23C 2FQGA 1FVCA 1MQKL 1U6AL 4TNVF 3A6BH 1NBVH 3APDA 4P23A 2QSCH 3FRPG 5HHVL 2WXRA 3U6XS 1PJWA 3FU8A 2XZQH 2HT3D 4CDHA 1UATA 4YDIH 4R2GD 2G4EA 2YK1L 3IRPX 1NEZB 5J0BA 4AV4A 1JIBA 5EU3B 3CN3A 4P46C 1D7CA 1WBZA 3IAPA 5FO2A 3THMH 1MELA 5D7JD 3F58H 2IGFL 3VWJD 4XMZA 1AANA 3LIUA 3P40A 2YJQA 3Q2LA 5DRNA 1UXSB 2ICWA 3VFUB 1G6RH 4BQ8A 4DQOL 4E9RA 1MWAL 4F7PA 3QPQC 4HZLA 4L3CB 4EIUA 4PYHA 2EXTA 3JWDC 3RX5A 1BFOA 1DSWA 4L2LA 3WJLC 2BVTA 1MVFA 3LQAL 4GXUN 1XF4A 5IOKA 5DK2B 4K8RH 1ZPUA 4HKJB 4U1IB 1OCOB 2OL3A 4HCRA 3GLAA 3S34L 1CG9B 1UT1A 4HHAB 1HCZA 3FO1B 1A64A 5C7XH 1RXLA 1E9QB 1LP9F 3C6LA 3H9SA 3RE0A 3WNLA 1DBAL 4MX7A 1I3UA 3UYRL 3N40F 4N6QA 5F0PB 4Z77B 5HVHB 3OHXC 1A4KA 1B4LA 1JHLL 2ESVB 3SPJA 2CJ3A 5CP3H 3AABA 5DHYB 3OHXA 1GA2A 4ODVH 2OXGA 1L9NA 3CG8A 3EGSA 3MV8D 1R24A 3L5XL 2F9BT 2ENJA 1FZKA 4I9XA 5F7EL 3W1ZA 3ZDXE 4QHLB 4NP4L 3WFDH 5DJDB 4P3DA 3FRPB 3O4OC 4RGNE 2GJPA 5SWSE 4KZDL 4XBGB 4Z95H 2HMID 4NHCL 1IC5L 3ETBJ 3NZHL 1WC7B 2WNKA 3OLGA 5D7IF 2CDGA 4IK7A 3WKPA 5E8EA 2GHWB 2PXYB 2X1OA 3DROA 1OM3L 2CHWA 1WV7T 3MUUA 1CGTA 3QDGE 2VYRE 4KI1A 4N2NA 4OI8A 4DVBB 4ZO6A 1RD6A 2ZOLB 2XKNB 4M8VA 5T1LD 3GEFA 5KUKA 3O4LE 5T3ZL 1U92A 4LP4A 2JIXA 5HI5C 2AS5M 2X88A 1KYUA 3DXAA 4N5EC 3B2VH 3ESNA 3PJNA 1FV1A 4LLQA 8FABB 5KBNC 3KL5A 1RPKA 3JWNG 4HUMB 4P23D 4YXKH 3FDWA 1LLAA 2WTRB 4HF5H 3ZKMC 1QSFB 3ARRA 3EO1A 3MV9E 5L4MA 4ODWA 5E6SB 5I5MA 3GNML 1ZA3B 3NQKA 2B4CH 3OZKA 1TENA 3QO0B 4G11A 1GAFH 4OSUL 1U93B 1FGVH 3HBPA 5IBTH 5BXFA 4MBRA 5KSBA 2A3TA 5BRZE 4L9DA 4JG9A 5D93C 3VMPA 1E50A 3T1FA 1JL8A 1J18A 3ZDXF 1XGPB 2GTWB 1EGJA 2UXTA 3MJ8A 2AEWA 4P9HL 3ATEA 3PAVA 4F92B 4HIXH 4OLUH 2E5EA 4PHZA 3HKZA 4B96A 4HK3N 4I0PD 4IKNA 3NJIA 4WWNA 4Y1AA 3ZW3A 1BDYA 3LN4B 2NR6C 1SJMA 3D39B 3H42H 1SYSB 4KROD 3HLAA 3IMTA 2LVEA 4LLWA 5E8OB 1B4JL 3IMSA 1JSYA 2NR6A 3AMKA 3NJJA 3P9LA 5IVZA 5A2BA 3ARGD 3HVDA 3MNMA 5T5FL 3REWA 5ADOH 1JK8B 2IAND 3C6LD 3H9SD 4G83A 4XC1L 5IMKB 5I1CH 4RGMC 1QSED 4HKZB 3UO1H 4Z7OE 4L8BB 1QWHA 5JHMA 3JSSA 1YY8A 2Y72A 1OKEA 1J5OH 1U8LA 3GS4A 3CDZB 2HFGL 2V0AA 3MHZA 5L8KB 2VLKA 1X5ZA 5KG9B 1BVLB 1HHIA 1FG9C 4WGWB 5EDSA 4N3UA 2OYKA 3QQ3A 1LEIA 5F71A 5B39A 5IB5A 1DQML 1HCVA 1Y0LB 3MNVB 3CN2A 5ANMB 2Q6WA 4DKFL 4UMSA 3FQNB 1IV8A 4X4YA 2GFBB 4Z0XA 3ECQA 1GJIA 5I2IA 4HMCA 4X5QA 2ZYSA 1N8OE 1RUAL 5ECGA 5GS1C 4JFOA 4DW2L 3ALWA 3G5VB 2Z35B 4LU5H 4M61A 5EZOL 1BECA 4B53A 5GS1A 4EN2A 1I82A 2YD3A 4XN1A 1IC4L 4PRBB 2JIXD 2PYEB 4FQQB 3AXLB 3BGFB 3DOIA 2AV7B 5DVOA 4N2HA 1O6SA 3CCHB 4L9LB 3RVVC 4D7PA 1YN6B 4OJCA 4G8IB 4XPFL 4LVNB 1KN4H 3IMBA 2DI9A 3BSZL 4M02A 1BMGA 1JF1A 2N59A 4JRYE 3EOAB 4U49A 5I6NA 4UCFA 4NIYE 5TDNB 3PDOB 4PJ9C 1R19A 3QEHB 4GAFB 4N2AA 1J0JA 5A16A 2OTUB 3BD5A 4U1GC 4PJ9A 1IT9H 4KV5E 4ZFGL 4Z7OF 1A0QH 1A8ZA 1DHKA 3N06B 1A7NH 4QTFA 3IMWA 3F84A 3X3FL 4MSWA 5C0FB 4F27A 4DK3A 1R47A 4FQLL 2AJSL 4F7MA 5GJTL 4HJGA 1UD2A 4AZ8B 4FAAB 2P47B 5FECB 1JNLH 1JXJA 1MRCL 3GXPA 2O5ZH 2Y2YA 1SN2A 1V05A 4PJFE 4ZDHA 2BMKA 3IFLH 3SPVA 4DGIL 4JG0L 3KVPA 1DQQB 4NOFA 4RMTA 5TF0A 1INEH 5IV2A 3DTUB 5D7LB 4KVCL 4KH2A 1A4JA 3P2DA 2EIBA 4NN5B 5AB1A 4YGVA 1FF5A 3CV5A 1PJ9A 3CJJA 3DX2A 3G6JA 3LEYH 4N0UA 4Y1AD 5HGAA 3KW8A 3RWGA 5BZDB 5IMOB 3H0TA 4WDIB 4K55A 4X7EC 3OC8A 1QATA 4B9GA 4PTUA 4OGXH 1QFWM 5GGUB 2VLRA 4NJAH 1TVHB 1NGQL 2OJZH 4R0LB 4YN3A 2PKDA 3AXIA 4ODHL 4KMQA 5BCAA 3PF2A 1CFQA 2ITDA 1ASQA 1S78C 2X2UA 3FQ1A 2DLEA 1YJDC 4BDVA 1U8NA 2VLKD 3F7QA 4QYAA 4HBQA 5JDJA 3HIZA 4XP1L 1HOEA 4N6RA 1MCHA 1MPAL 1J0HA 5AOIA 3K71B 1GL4B 1JRHL 1RZ7L 4HALA 1QFHA 5ILTH 2PF6A 1KV3A 4AC4A 4GH7B 2D7PA 4KV5F 4H8PA 4UZUA 5LCVH 5DMYA 2K6ZA 1X9UA 1TCRB 2AI0H 2AJUH 1IRAY 2ZP0T 2J12B 5GISL 4GUCA 3BWAB 4AE1A 4BFGA 5C0NC 2CKBA 1P84K 1Q1PA 1G1CA 1N70A 4MCZA 2MOQA 2B2XH 4PJFF 2N0MA 5EIQA 3CPLA 3SPCA 3VXTB 2VO5A 4PRIB 3GK8H 4U7SA 1DZ0A 1I9JH 1QSZA 2GJZA 1A6ZB 3QXWA 1I1YB 1M7XA 2YQ2A 1CDYA 1PX4A 4U3CA 1WSST 3ZE2E 1JI2A 4R6UA 5F96H 2JI3A 1YQVH 2Z0BA 1OAKH 4P9ML 1EEQA 2B8OT 2XV2A 4K3HA 4OGYH 3PWNB 3VGDA 3B7RL 3ZOAA 2P80A 4FMFA 2OCCB 4RWYH 5FGCE 2WYTA 3WIIH 1NM9A 1SHWA 3I3BA 2K1MA 4N9OB 1A1NB 3N1FC 4Z7WB 3SGEH 2APWA 1K4CA 3MV8E 4LEBA 5EEZA 1E67A 1L3NA 4BE5A 1TJXA 2WKOA 4ZXBD 3D4YA 2BNRA 5I18H 2YJLA 3JV4A 3KPTA 4IOIA 1IGYB 4PJIA 3D69B 5IHLB 5KYWA 3BFOA 3GSXB 3WIHA 4JJ5A 2X42A 1EXUB 5KYUB 3AT0A 2CGZA 4WO4C 4OLVL 1CB4A 4RNRA 5CU5A 1KSRA 5CCKL 1NOAA 4K07A 1TZ8A 2WM0A 4XMKH 4BV1A 4C83B 2F68X 4MAZA 4H0LC 1P7QB 2KDYA 2R69L 2GUOA 3TURA 3HJEA 3QUKB 3MRNB 3IF1B 2ENQA 3FULA 3LMJH 4ZX3A 2BRRH 3K5RA 2XRAL 3TIEA 2VLRD 3NJKA 3WJMA 4AYID 5LXGH 1S46A 4F9PC 4U1MA 5GGQH 4AIOA 1MF2L 1U8MA 5E2VL 4F9PA 1FFOB 4A04A 4XBPA 3ZE2F 2PCPA 5I1HH 3ZR6A 1E4KC 4E9LA 2KS0A 3PFQA 4LSPH 4WQOA 3A0OA 1FBIL 4QRUA 2VLJB 2B1AH 4E42A 4XXCC 1E5UI 2DIBA 4QXUH 1IKFL 1B0RB 1TXKA 5H35B 4N2OA 3QW9A 2D31A 3ZYOA 4XXCA 3N6YA 3BVTA 3LZPA 3KYOA 4N2CA 3MQIA 4YPGA 1IGJA 3UJTH 5E4AA 1EFXA 3EJSA 1OAJA 2BOCB 4L4VA 4UQ3B 1AXTL 3GYRA 2R1YB 3KPPA 3RVXC 4JPIB 4C55A 5J57B 3ARFD 5I8OH 4PSRA 5IEHA 1OSZB 4HCIA 3S35H 2W5PA 1OALA 2XN9D 2H45A 4OT1H 5DQ9A 2ZXCA 2DICA 2IANE 1D6VL 1E5ZA 3H9SE 5IR1B 1BAFL 1QSEE 4FTVA 4OKVA 1RKRA 4YDNA 4B3EA 2VISA 1ID2A 1ECZA 3CX5K 5FR3A 4MNHA 3L3HB 2YPLA 2AEOA 1AZVA 1HSBA 3V0WH 4KKQA 4WKZA 3JV6B 3UDWC 3W56A 3EYOA 1NLBL 4X42A 3FZUC 3MLRH 2XXMB 3WEOA 3UDWA 1Y18A 1NGYA 3TYGL 2NNXA 5FUCC 1G4MA 3VSTA 2BPBA 2E56A 4ELKA 4AYBA 3ISWA 1QKZL 2BNRD 2K8QA 5A3IC 1N26A 2XUWA 5J11B 2BCKB 3Q8EA 4UQ2A 4PJ7A 5F6IB 2Y2WA 4YFEA 4OF6A 3CFJA 4OFDA 4H8WH 3GBMH 1FFPB 6PAZA 1I1AD 1OXYA 5DVPA 3NJGA 2Q86A 3PWUA 3OQRA 5GGRY 5JW5A 1G0DA 1MQKH 2W95A 1GYVA 2HJLA 3MDJA 2FJHB 4YDLB 3K2UH 1SEBA 2GJ6B 4IOFC 5DUJA 4KKZA 3QQNA 3TCLB 4M7ZC 3ZUCA 5TPWL 5BO0D 1O0VA 2DQTH 4NZDA 3PDGA 4NWUL 3V8CA 2C7UB 4PREB 4ALAC 3ESPA 5BJTA 2G75B 3AGVA 2OR9L 2A6JA 2YN3A 1ZLEA 3HNTH 5I1JH 1J86A 2VC2H 4KKRA 2YARA 3IJ7A 1KPVA 1X6NA 2V2XB 3FO9B 1KPRB 3TESA 1LO2L 5HBBA 2OMYA 1WAEA 2VN4A 1U4FA 3O41A 2AEQH 4QTIL 1TZIB 2JKIS 3B9KC 4G43A 3T3ME 1R0AH 2DLGA 3CHPA 4KPHH 4UIMA 1IGMH 2HFTA 3B9KA 3BH9B 5I6LA 4JN2A 4PV8B 1DJGA 1VRSA 3I84A 2Y24A 5EO0A 4XI5D 4NLHA 4PRNB 4HIHB 5K1JA 4ZMWA 1T0NB 3S34H 1F3RB 4JO3L 4IGBB 5FO9A 3WO3B 1EFXD 3FFCA 3JT0A 4L4VD 5DC9B 1KIRB 3HN8A 3QJTB 4ANUA 1H3PL 2VM3A 5F93C 3AW5A 3PDDA 4Y1AE 4YSTA 3QIBB 3EJYC 3G04B 3QUZD 1QO3A 4K94C 5AKTA 1I9RL 5M7QA 2QT6A 3RY5A 1ZANL 4HISA 1OPGL 4FTVD 3IN0A 1KT2B 1EJFA 2NX5A 4H88L 4CDGC 2KKQA 1RPUA 3VACA 1KENL 3DO3A 43C9A 3LHAA 2X38A 3ARUA 3LRHA 5E0QA 4OF7A 4JO2H 3I3EA 5DD0H 7TAAA 3TWYA 2DQJL 5AVYB 5HHQB 2MMXA 1FWXA 1GYWA 1U8QB 4QO1A 3QDJB 3LKQA 3MRRA 3WY4A 1GZQA 2CKBH 3UACA 3RBSA 1FDLH 2VXQL 5D6CB 4DETA 1ZLVK 5A3ID 2DJMA 5IFJB 4CN4A 1IM9B 3AG4B 1WTLA 3D3VA 2XWTB 1HIMH 5FHAH 2F8IA 2HPOA 4GAJL 5KSBF 3F6LA 1HAWA 4N0FA 3CLEH 1RI8A 1TLMA 3ABMB 4HLJA 1RU9L 4AQZA 1KIUB 3CC5A 1JZ6A 4E5XA 2I9TA 2XN1A 2OTWA 5J13C 1XZWA 4P5TD 2I9LA 1N4XL 3RQ3A 5SWZA 5IOPA 1CU4H 2DS4A 2QADD 2Z91A 1ZD6A 3Q6GH 4UT6A 4RAUA 3KR3L 2IPKA 1XGUA 2PO6B 2H1PH 1ZLUK 5I6MA 2OZ4A 2UX7A 3MXWL 1ZK5A 2X3AA 3L08A 4S1RH 4I2XB 2EECA 1MCQA 4JN1H 5HYSG 1ET7A 1IM3A 3B9KD 3FB5A 4LSRH 1N5AA 1J87A 2GC7C 3C5SB 1QHPA 2ZAIA 3KYKH 3FO0L 1EUTA 1IBYA 4M7KH 1UQSB 3OKLA 4UIKL 1E7UA 4DO5A 3TO4C 2AJXL 3FH8A 1S7QA 2EUZA 1BBDL 3TO4A 2ZSVB 3J2PA 1NJ9B 1SY6H 4WAFA 2MCAA 1BAWA 4OZGA 4CA4A 5F1IB 3U4BL 3DGGA 4R8WL 5GGRB 4L2YA 4A6YA 3FRUA 5D70L 4N0UE 4KQ4H 3HC4L 1WA1X 1BLNA 4GKNA 3D50A 4R4NC 3JTTA 3W0WD 2VERN 1O6VA 3EJYD 5DXWA 1R3IL 2VLRE 1NEPA 4LEXL 1DUYB 4WIQA 4YK4C 1PNCA 3GXDA 7PAZA 1E0OB 3DETC 3ASWA 3UAAA 1TQTA 2BVOA 2IOOA 3PAZA 4YHOH 2ZOUA 3O2VH 1NCBH 4JUTA 1G1YA 3RX7A 3UXFA 3CBJB 1KCUH 1L0XA 1N8ZB 3LEXB 1OTSC 3MYJA 4AEHH 3QORA 4G9FD 4YDJA 5JQ6L 3HS0C 4KAQH 4QHNA 4I3GA 1ZVHA 4FZEL 2J5LC 2YMXH 4GRMB 1JWSA 2QDWA 3HS0A 1MLCA 3UO8B 2VMEA 5E99H 4OM1H 3VXQA 1E4WL 3HE7C 2AFNA 5B1AB 1K85A 4Y16B 1IC4H 3HE7A 3VGHA 1U8HB 4RFOL 5FYLD 4EI5C 3G6DH 3HMWL 5HYSB 4H40A 1TJHH 4QF1B 3L16A 3E8UH 3IVKA 3KYNB 1TQBB 1P4UA 1M7IA 5I0XA 4JUSA 3AU0A 4TTGA 2DAVA 3UJJH 1LQBC 1TQCB 4Z7IA 4Y2LA 3BSZH 2EVJA 1XGRB 2XN9E 1A7PL 2A77H 5DD6A 2VXVL 2G0KA 5SWZD 3NCFB 3L3DA 2A0LD 1L5GB 4HH9B 1NQBA 4N2FA 3HB3D 3VM7A 3GMOB 3EJZC 2XVGA 1Z0NA 2Q3XA 3TA3C 5IP4A 5LNEA 4FQ1L 2H26B 3FMGL 3TA3A 1ZIAA 1H5BA 2MPVA 5F88B 1RLWA 3IGAB 1FVDB 2D3NA 2V9TA 4YXHH 1E5CA 4Z7VA 4F7CA 1GGUA 4IU2A 5C7ZA 2BHYA 3PL6D 4BE6A 1NDMB 2EDKA 5JR1H 1M7DB 3Q8FA 4YSSA 4BCZA 1IQWL 1KJ2L 1AQKL 3DGCR 4QTHA 3AITA 2BHZA 2D7MA 1G87A 1KFAH 1QBML 3BKML 3HHSB 3HKFA 3OL2A 4PJDB 5EC1A 4M9OA 2XG4B 3P0VH 4MQXC 5JNYA 4PGCB 4QHPA 3LCYA 3KPLB 1KG0B 1ED3B 4FZ8L 4QUOA 1YYMH 3A23A 3HPLB 1I7UB 3SGJA 1NGQH 2BW5A 2QFRA 4L1TA 4IBZA 4KK8C 4TUKH 3TVMC 2I7OA 4NSKA 5EBWA 1ES0A 4UYQA 4KZCA 4PCKA 3TVMA 4A38A 4M43H 5KYXB 3GMMB 5JPNC 3CZSA 4MDIB 5E5UB 5AAMA 3TJEL 5JPNA 4XP1H 3LNDA 1C16A 1KDIA 5T1MB 1RK1B 3JWOL 4KOBA 5JW4M 2CBQA 1NUFA 4IBYA 4LBEB 1P69B 3WHE1 3TLRA 25C8L 4IJ3C 1BEXA 4NNXA 4MDJA 4XMPH 4WY7L 1X7QA 5CLXA 3GGWB 2ZTBA 3QORD 3ZRFC 3QEGH 3QT2A 4AEIH 1V8HA 5HYQA 3CBKB 4POZD 4EI6B 3SCMC 2BSDA 5CIPH 2HLAA 1V7MH 2OMXB 4F24A 4DO4A 3SCMA 1JTTA 2Q20A 3RPKA 2EZ0C 3V5KB 3VCLB 3T6QC 2WKOF 4KU1A 5FM8A 3RUGA 2A83B 3C60C 1A6UL 3AREB 3E9TA 3HE7D 1E7VA 4C4BA 1KLUA 4B97A 3DX1A 1LJMA 4L4VE 4IBWA 2IFFL 3C60A 4PJIF 5DK3A 1ID5I 3QXDA 1EK3A 3D4GA 5AW6B 1ZTXL 3QEUB 1EAPB 4G7YH 3T0VA 2RIKA 4PJBE 4F8OA 3NIGE 4R96A 1KTCA 4WUUD 3V0FA 4EQ3A 3SDYL 4M3KB 4JKLA 1NSNH 2FQEA 1AXSA 4L18A 4FMVA 4M00A 5FA3B 1SZNA 3L2MA 2AZAA 4FTVE 5TH2A 2BWDA 3BZ5A 4KHTH 3E1ZA 4EDWL 1SOSA 3WTWA 2NNRA 4F2EA 4A1RA 4W70A 1JP5A 4PYGA 3EJZD 4HDIA 4MASA 1MJ7H 3RL2A 1C08A 4XMTA 2EEFA 3GIZL 4BZ1L 4JFPA 5CUSH 5I15L 3GLZA 1MCRA 2GJRA 3IDIA 3RPBA 5KYYA 4JFEB 5DO8A 5AVQB 1DANT 5FYLH 4OLVH 5CGYD 4XNMA 4XCEA 2HP4A 4LSQL 1MAML 3RNQB 4FFYH 3D52A 2Y7QB 3TOPA 5EEWA 4BSWA 1UB6A 4DGWC 2EVIA 2ZJSH 1NL0L 2W0LA 4JGJA 1J12A 1HDMB 2WCGA 2EUXA 1QRNA 2YD2A 4HIEA 2RR3A 4GT0A 1Y6MR 1E27A 1S7RA 3LS4H 3ZYJA 4KTEL 4OGQC 3ZE1E 3GD1C 1DTUA 4CW1B 2VDKL 5F89B 3MLVH 4UT6H 2C9SA 3PXHA 2XWCA 3BQUD 5J6HB 3FB8A 4AIXA 1LK3L 4RFEB 3DC0A 4LFHG 5E2VH 1D6EB 3HG1B 3PFUA 4NM4H 4OIBA 1YMMB 3TVMD 3U48A 2NY2B 4OCLC 2EACA 2P9RA 5FKAA 2KZBA 4HWZB 2CO6B 3NIGF 3SKJH 4MQ7A 1FBIH 3MV11 3SGKC 4AM0B 4ZD3L 1G5AA 5K9OB 1LYQA 4B7IA 2R15A 3S88L 4JFDB 2E74C 1OCRB 3SGKA 4LEOB 3CSTA 5DSCB 3P3YA 1SQ2N 5E1HB 3RGVB 4V1DA 1AR1C 4JY6B 4R3SA 1G7JA 4J3OD 1EVUA 5IIEB 3GIVA 5K93A 5FLUA 4W4OA 3II3A 4TULH 4LRNH 4YHZH 4P48A 1I31A 4IEFB 2GK2A 3FT9A 4U1HB 2V2TA 4CN6A 1QI3A 4A6YH 4DWHA 2NW2B 4JNXA 1MOEA 1OGAB 2I25N 2UXGA 3LN5A 5AUMA 5FOBA 5D5MB 2BVUA 2JCCB 3IXTA 4YFLI 2OXHA 1N12A 2E7BA 4ADIA 1D6VH 2E6JA 3BDYL 3VFSA 3ZMEA 1ACYH 1R3JA 4OB5H 1NMCC 2Y9RT 4KKBC 4OAWB 1OGSA 2CBPA 3KM2A 2ZUQC 3MOBH 5MI0B 4ZUWB 4XODA 4YDZA 1CMOA 3F83A 3W0WE 2QQNH 1D5IH 3TCXA 1QEWA 3IDMB 3QRGL 2ZXWB 3QR1A 4D3CH 4FXGC 5HHPA 4XR8C 1I8MA 4P2OC 1D9KA 4PGEA 4I77L 2GUYA 4ELMB 3EDFA 4FXGA 2X0VA 4P2OA 1A2YA 1MQ8A 2HRLA 4WW1B 2H3NA 1ZSDB 1DN0A 4ONGH 3SDDC 2V5RA 4ZQKB 1P5VB 4CJ1A 3FH7A 1KMGA 2W91A 5JXEC 1KF9B 3QPXH 3QVAA 2V17H 4G9FE 4QXTB 2B77A 3UBHA 5JXEA 2IWFA 4KJQC 5BW7C 3O6FC 3WEBA 3SKOA 4XNQB 3U6RB 1S5HB 2XOTA 3L3IA 4HUKB 5BW7A 1DQLL 1MNUL 2YUZA 2FIKA 3O6FA 1AHWA 3FK3A 5LGYA 4DZBB 1YNTA 3FU7B 2AAVA 4OLWL 3UC0H 2BVPB 1GZHC 2CZNA 3UG4A 2XPYA 3C87A 3EFOA 5FYLE 3SE3C 1BEYL 3ARBC 3CTTA 1GZHA 1UZ6E 4NWUH 4S1DC 5CU9A 5KZCD 1B0GA 3U83A 1MY7A 2P5EA 4GRWB 1LO4L 2B0SH 3GHEH 1JZDC 2ZUYA 5LWYH 4K15A 2XA3A 3WKML 1IEBA 4UT7L 4Y2DB 5C3IA 1Q0XH 5I1GH 4Y4HC 5SWZE 3VX0A 3UH8A 3CZFA 4HFWA 4I18C 2VL5A 5GZNC 4WEBH 3IFOA 1YG9A 2DZEA 4A39A 3F7LA 2VDRL 5F97E 1G9HA 5GZNA 4GKZA 3NZ8A 4AMXA 1REIA 1NGXA 1CE1H 2BZCA 3KCWA 3QR0A 3CFDB 4JQVC 2YOAA 1L9OA 5G5DA 2CBTA 4X99A 1E8XA 5DMIH 3A6CH 2MPAL 3SO3B 1ZHKB 1VGEL 2G4GA 3MNZB 4B5ZA 1FHGA 2OLDA 4OCWH 4DGUA 1HWGB 5EUOB 2Z92B 4HS3A 3QJUB 35C8L 4HIQA 1P1ZB 1W72L 3PHQB 1IFHL 1RK0B 5ETUA 5HHOB 1ZPLA 4GSRA 1W15A 1FZMB 5D1QB 2ZX5A 3MUJA 1FRGH 1I9RH 1KBGH 1UM6H 4TM9A 5F7YC 1KJMB 4WCYL 5DDHB 3OB0H 1G9NC 2CLVB 5LKNA 2QZQA 1NEZA 5HYIA 5CZXD 3HHRB 5B1CA 3GSQB 2O61B 3VI4B 1UZ6F 2IDCA 3M07A 3UTZB 1KN2H 4TYUA 5I1KH 4LKCA 4G7SB 2DQDH 4BQ6A 1VF5C 4PY7B 2B9BA 2JF1A 4QY8A 1D9KD 1AZNA 1ASPA 4J3OH 4E41D 4UDTB 5F3HB 5AVUB 4AT6B 4P2OD 4GXUM 4BFEA 2MNJB 2ZF8A 3MNWB 5HHMB 1CLYL 5CINH 2IPUG 4G7QB 4OFYA 3S36L 5I1IH 4ES8A 4HWBL 2VXQH 4XNAA 2WK2A 9CGTA 5I0ZA 4G72B 1BVKB 3ILQC 4U1SA 1X5JA 4JFHD 4WV1C 4YHLL 4FCAA 2W9DH 4Y9CA 4FD0A 4DF9A 5DK2A 4GO9A 4WV1A 4XX1G 3P69A 4RMBA 5DJCB 4BJLA 3FB7B 3FQ2A 1CG9A 5IK3A 4WW2B 3FO1A 3HE6B 3S5LA 4KJWD 1ZT4A 4PIBA 1E9QA 4GB9A 3V9EA 2WZ6A 4XPGL 5E5RB 2EXYC 3SYAA 1NCWH 4X5WA 1IE4A 2N7SA 3KG5A 1JI1A 1PFCA 3TBTB 4CGUB 3TFKD 1OLLA 2P5ED 4L3EB 1X5MA 3U7WH 2AKRA 4KMLB 1A4AA 4YBQC 3CN0A 2DD8L 2NTFB 4GIPD 4WUUE 3K2KA 4UT9L 1RZGA 5E6RB 2ENPA 4M8UA 4LT7A 2H4EA 2EDNA 2QVIA 2O5XH 4HC1L 1DE4A 1KC5H 4QHLA 1F58H 1IGTA 2ARWA 1N19A 4JCWA 1T21B 4J6IA 4MJHA 5FF6B 3H2QA 3DJSA 3O2DL 4HULB 4ZUVB 1WC7A 5CMAB 5GZND 1DANU 3FQWB 5GGVL 1S7WB 1M2VA 1G7HA 1XV8A 1SYVB 1RFDH 3OX8B 1NWOA 4TSCL 3UTTA 1MFAL 2BCMA 2Z93A 5AL8A 5CP7B 2E7DA 3UEQA 3QEQD 1ZT1B 5HHNB 2YPVL 3WFCL 4Z7VE 1QFWH 5D1XC 5JOFA 3UFIA 1IB5A 2XKNA 4BWUA 3BWZA 2B1HL 5D1XA 3WHXB 2FJGB 1BFVH 5M95B 3TF4A 3LZLA 2X0WA 1TFPA 3KJ4B 4RDQF 5I0YA 5E2WL 5JHDA 5D70H 2BSCA 12E8H 2CLZB 4FQHB 4YSOA 4J5VA 1O6TA 2XZCH 3NCXA 2W81C 5KJRL 2XV0A 2FL5A 3RWEA 4CU7A 1F2QA 4TRPL 2V6HA 1CXKA 3F12B 3GRWA 3L7EB 3QQ4A 1MFVA 4NDMB 4U3SB 4DTGH 2J8UB 2WTRA 5L88H 4IIQB 5DQJB 1FL5A 1VFUA 3GSNL 1IGCH 5FYJL 3ASNB 4ZTPH 3PREA 3N1MC 2I85A 3GJFH 2FWLB 3GTNA 1N9PA 3BKYH 1SHXA 4WK2B 2DYPA 3TEYA 2BOBA 1ZA3A 2MTAA 5I1DB 5DC0A 2HZHA 3A4DA 3C8HA 4NFBA 2EH7L 3VRJB 1N5YL 1U93A 3VWKB 4A2HA 1CE6B 4XPHH 4KDVA 3ULAB 1UWGH 2EIEA 2D2OA 2UZIL 2X70A 3N40P 3G3LA 5IBLD 3HBQA 1C12B 1IC7H 4NGHH 2D0GA 4OLYH 4OCXH 5C70A 2DI8A 4HV8B 4OFYD 4Q58C 3Q06A 1KYOK 1YEEL 1VCAA 4MRBA 2EQDA 3ILPB 4H0GA 3NJNA 2JQAA 2PWGA 1DBBL 3I50H 1VB9A 2QGEA 1M7UA 3KPSB 4KXCA 4FOMA 3ILQD 3UZQB 4L0YA 3O6KH 2WXQA 1WS8A 1TMQA 2AXFB 2IF7A 2HUHA 2VZ3A 3EYSL 3LN4A 4WK4B 1SYSA 4ETYA 5E8OA 2DKUA 4Z7VF 3NZSA 3PGDB 4K7FB 2DI7A 3RUGE 5IMKA 2FH6A 4JRXE 4U1KB 2X3CA 2X1XR 1KYOJ 5CJ8A 2B5IC 2ESVD 4OY9A 3NSYA 1SOXA 3CDZA 3KL0A 4O2CB 4CVXA 4H0HB 4K73A 3VE0B 4L4TB 4FFTA 4E68A 1KTKE 1BVLA 3JWNC 1S7XB 4YHYC 4DGVL 4AYDC 3FF8A 4NRYB 2BWQA 3RU8L 4LSTH 5GS0D 2F7OA 5EB9A 4G7VL 3LPPA 4K5NA 1Y0LA 5DT1L 1G1KA 5ANMA 4MHHG 4MAUL 2R23B 3K7UA 4XMXA 2CRMA 4NIKB 3VD2A 2YKLH 1JD7A 4XO4A 4X6CB 2PXYD 4JGUA 4HUXB 3RNKA 3OTTA 1KB5A 1TNNA 3BD4A 3AUWB 3T6VA 3G5VA 4D9LH 2Z35A 4LCWB 5DJ0B 4A2MA 4M1CC 4YMPA 3FSOA 2QGCA 3DX7B 4HBCL 4RMWA 4JLRA 2HTLD 4N0CD 1F4YL 4PRBA 3KBPA 2OMTA 2PYEA 4L8DB 4TUOB 2ICEB 1BQRA 3AXLA 4LLMA 2IH3B 3CCHA 1RERA 4BFFA 2IDUA 3FU0A 5ES4B 1YN6A 2FX8H 3IMUA 4Z5RA 1SOKA 2AXWA 4KY1L 5LAXA 4LVOC 2CIKA 3HFML 5ICUA 1H6TA 5FYKD 4HJUA 3E2HB 2APFA 4UWQB 3TBWB 15C8L 1QSFD 1ZHBA 1T0MA 5DVKA 3ULUL 4Z7QE 5TDNA 3PDOA 5E2UL 3RUGF 1J1XL 3QEHA 1LE5A 1BA9A 3QJHB 1GKEA 2OTUA 3JWOH 3MJGX 2BY2A 1FGNL 1YPZB 1DVSA 4MA3B 3ZUNC 4AOFA 25C8H 3AG3B 2XTJC 4MGXA 1BF2A 1YNKH 2LLGA 2MWCA 3HNSL 4QXGH 3QUXC 3BP4A 1XH2A 2VMJA 4N1EA 4X9IA 3CFBB 2FJSA 4Y9FA 3T65B 4AZ8A 3QUXA 1H6FA 1UADC 4AWJC 2ADGA 1XR9B 1XF2B 2DKMA 4EUPA 1G7LA 1DQQA 1YEGH 2HJKB 4JVPA 4J4PD 5L6YL 3K8LA 4OGAC 1OF0A 2CLRA 2Y06H 3JTSB 4F2FA 3TBSB 4LDEB 5BOZG 1WITA 2MNUA 4MRCA 4CMHC 3D39D 5T3XL 4LRIA 2EE3A 2IXQB 5FUOH 2HRPL 2WQVA 3QFGA 3QARA 3JQOB 3VFRA 1BBJA 2ZYHA 4KMTL 4AZUA 4RSVA 4M7LH 3TN0B 4X7TA 1HS6A 1FO0B 4NQDA 3VXSB 4TSBH 1GZPA 4OJFL 3OKDA 2ZXDA 3VAEA 1Q72L 5HGDA 5GRUH 5FB8B 1GIGL 4XP5L 3BUIA 3ZTJG 3PNWB 3DPBB 3WTUA 1NCOA 3UAFA 1RHHB 3GIZH 1MG2C 2J5WA 1BX2B 3K71A 3EFFB 2YC1B 4E41E 4Z7QF 4X6EB 3T0EE 2X4TA 4NI3A 2DBJA 4JFVA 1JPFB 4Y2NA 3UJIH 3BWAA 4QRQB 2EH8L 3FBKA 3L4VA 4JFHE 4ZPTB 2D7OA 4XP9H 5DS1A 2WBJB 4MS6A 6FABH 1T1XA 2R51A 1HC1A 1HH6B 2ARJB 1KDJA 1WZ1H 3VXTA 1WA0X 2RTTA 4TVUA 4QD2E 4RZCA 5EZLA 3MUY1 1A6ZA 4LLUB 5CN2A 2PYED 3M45A 3BPOB 3DI3B 4G1EB 1LK3H 2F1BA 3V6ZB 2XU9A 2TAAA 4HPYH 3GO1L 2R59A 2WXGA 1X4ZA 2YD5A 4F3FB 1XWVA 4KZ0A 2Q76A 3IEAA 4J6RH 4MNQB 4PJCE 2P49B 2WIIB 1I9IL 3C08L 2P5EE 3PWNA 1T6VN 3KL3A 5GS0H 1Z9NA 1DEEA 5FHBH 1WS7A 5I1EH 2X87A 3P0GB 3LRMA 1PSKH 3KNBA 4MJ4A 4G8EA 1A7QL 3FB6A 4Q56A 4P57B 4ZO9A 1CT8B 4IS6B 4CNIA 4OLXH 1CTOA 1LNUA 1MRDL 1W8EA 1FL3A 5DMGC 2DM4A 2QPFA 4GG6A 1UVQB 1BQUA 2R0LL 3V6OA 1JPEA 1AD9B 3SN6N 4DIXA 1ZMYA 4R84A 4LDLB 3QQDB 1IGYA 2XFXB 3LYRA 4PEEA 1VACB 2F74A 1U33A 4N5UA 3TA4D 2QELA 3RWFA 4E9WA 1EXUA 5KYUA 2DQHH 2VDPB 3QEQE 4IRZL 5JYMA 1L3WA 2AK4B 5IB2B 4X4XB 4C83A 4BIKA 5D7LD 1MSPA 3GRWH 4H0IA 5FYKH 1Z9OA 2NPLX 1F42A 2YFNA 3O11A 4B0MB 3MRNA 4J12A 2IOIA 3WN6A 1BGXL 2ERJB 2NXZB 2VRKA 2DKSA 5DFVD 4GW5B 4Y9GA 1DLHB 4TUJB 5I19H 2D9CA 4WKXA 5FX3A 4NAQA 3QRGH 2R29H 4QRTB 4YIQB 1MNNA 3L4YA 3QUML 1QR1A 4I77H 1S3KH 3CXDL 1CGXA 3IDNB 1SJHB 2P28B 2W0KA 2GC4C 1IMHC 3ARDB 5GGTL 5LBVA 1PAZA 1AJ7H 1G7PB 1PZUB 2VR6A 5C2BH 4IKKA 1CL7I 1FAIL 1NCUA 2DMKA 1OTTD 1XTLA 1WA2X 1NBYB 3FUIA 4AGLA 3L5IA 4BELD 4IHOA 2VLJA 3VI3B 5IQ7H 2WQ8A 4WSGA 1KBVA 4YFLF 5H35A 2O6FA 3P3UA 4XNYL 2CR0A 4NKMA 5FUZL 3CSYA 5ENWB 1MNUH 1BFTA 5J3HD 1T0OA 2L4OA 3R7QA 4QEGA 2BOCA 4GSXA 3QJOA 4C4UA 1FNLA 4JHVA 4XHJD 3TF7C 3OLEA 5C0RL 5BS0B 3WLWC 5IF0A 1MCJA 4JPIA 3WS6A 2AV1A 4GMTH 4KKLD 4FABH 3VA2C 1BQLH 1A3RL 1LO4H 1MWAA 4LNRA 1OSZA 3I85A 4PRID 1WFTA 4XCCH 4KZEL 4G6FB 4XC3H 4MB1A 4P2QB 4J3SA 2P8LB 3BVUA 4LAQL 5D7KD 2X4OA 5IR1A 4N2GA 3DSNB 3WU1A 1HI6B 2EVGA 2MCMA 4L8SB 4P06A 3JWNH 2ESVE 4N2KA 3QO1B 2Y36L 4FHBD 3BAJA 3TC9A 2HB0A 2LTQC 4JREC 3K0WA 5IHBA 1YLBB 5AB2A 5I9QC 4ZUSB 1GXEA 3K72A 4M62H 5E1AB 5CN3A 4LLAA 2NYZA 1II4E 4JQIL 1ZEAH 4NKIL 1XF5A 2WUCL 4W81A 1UJ3C 1KYFA 3IWVA 1WVZA 5F6IC 3Q6FB 3BLPX 1JPSH 2GIXA 1CN4A 2EIZB 2BS9A 1UJ3A 2YGNA 3LSOA 4FQIH 1QFUL 5TE6H 2R2HB 4LPXA 2XBTA 1CXFA 4K9JA 1N7MH 3RIAK 3ZMNA 3LD8B 4LP8A 5AOLA 3WTXA 4J8RA 3GWJA 3AS1A 1KGUA 1MCBA 4FYTA 5AKVA 3O3DB 3VW3H 2FGWH 2PPCA 4XVSL 3MLZL 4KDTC 5TQ0L 2IFGA 2MNWA 3GSOB 1OY3B 4O4YL 2MQGA 3K6OA 4RGOL 1P7QD 1QACA 3E3QE 4KDTA 1OANA 4MAYB 1QLEB 2YD1A 1CI3M 2C7UA 2ZCZA 3B2XA 1FZOA 3IDGB 3S9DB 3VDBA 3W57A 1RAMA 5CJBA 5EUKB 1AHMA 1XEDA 3BHBB 1OCZB 4R4BA 4WWPA 2WO4A 4RBPK 1EUUA 2BNQA 4MYPA 5FYKE 3IXAA 4JPSA 3DTXB 1QSFE 3VFOA 3BVXA 1CD8A 5D72L 1TZIA 4BM7A 3IT8D 1QI5A 3N5AA 3CFEB 4FLRA 4UOW1 1HU8A 4MMZB 4BK5C 2EYSB 3K5SA 2R4SL 5CJQL 4CU8A 1RIHH 1TZGH 3BD3A 4CRPA 2VXTH 4LSSH 2J21A 2VLJD 3HN3A 1TG8A 1FG2A 2OM5A 2XYCA 2APXA 4FQCH 4JKKA 4KRPB 1JXFA 4ZUUB 3VXOB 3HMXA 2YA1A 2OYMA 4DEPB 4PRNA 1ITCA 4JZOB 4IGBC 3CIQA 4ISVA 1A9EB 2OX5A 3R06B 5HDWA 1T0NA 1T0PB 3IU3A 5EWIL 3LB6C 3BEVB 4IGBA 3HG3A 2VXUH 4KVNL 3FJTA 2PTUA 1KIRA 1BIIB 5ELIA 4OD1L 5LDSA 4QNPE 1RIVL 4A7UA 4P9HC 3WLWD 3D39E 2HVJB 5F0LB 5DRWA 3G04A 2BHFA 3QDMB 5DEGB 5DJ8B 1CYWA 5I6KA 3B3IB 1WISA 3ESOA 4GAGH 4LL1A 3PV6B 4G9DB 5TE4L 3CN4A 3QCUL 2WO2B 2Z7YA 3RIFK 3Q13A 3LZFH 1N6QL 1S9VA 3U30B 4UM9A 1WZLA 2BSTB 1H6UA 2HKHH 5PAZA 2WINA 1HQRB 4WI3A 5LNGA 1E4HA 1B88A 1KY6A 1HX0A 4KX9A 4OUUA 4W9CC 4JJOA 4HKBB 2D3LA 5ID1A 3JWNE 3H9ZA 2X7LB 3L9RB 2YPVH 1W6LA 2LW3A 2K4WA 5D6CA 5ANME 5FM5O 4TF4A 2AZUA 4HW6A 2E4FA 3UYOD 3LQZB 1QAWA 1IM9A 3UMNA 3MGOB 5LVEA 2XXCB 2XWTA 4JBSA 3MRKB 4PJGB 2BM3A 1HKLL 5ALCL 4K71B 5E2WH 1NC2B 3RFZC 3UZEC 4JRFA 4H8UA 1QLFA 5I26A 1XMWA 1D3CA 5IQOA 2DQ6A 3UZEA 5KBDA 3K74B 4YVUA 1EXHA 2GJ6D 4U7MA 5ECJE 5JLZB 1OGTB 1TPXC 4I1RA 2GCYB 4JDEB 4AYEC 2PYEE 2ZKMX 1HXMA 1HWHB 4UF7C 1NMBH 2H6PB 3GSRA 1IAIL 1T7YA 2YMTA 4RMQA 2J8HA 3SD5A 3G5XB 2C34A 3VD7A 2PO6C 3OPZL 2EH7H 1BXUA 3HZYA 4JFFB 2PO6A 5CJ5A 1MCFA 2R0WL 4NOBA 2OYLA 3C6SA 1N6UA 3INUL 3T8XB 2JKSA 4ORGA 4R26H 4EKXA 2H8PA 3OGOE 1ZLSL 3A5VA 1YHPA 4G6JL 4KGLA 2XQYA 4XTRC 2BSBA 1WGOA 1UA7A 2ZCLH 2VXSL 4FFZL 4PRAB 1BFSA 1GOGA 2JVUA 5TGBB 1CS6A 3H2WA 3EJPA 5I28A 2CUMA 1UQSA 4XCFL 3MLXH 4S2SA 4OQTA 3D1MC 5FWQA 4UILH 1AGDA 2ZSVA 3ELAT 4DN4L 1X5GA 4DOHB 3BUQA 4CC4C 3D2UB 2H32B 4IGBD 3MREA 5MEOA 5F1IA 5D7IB 1F1GA 5GGRA 1JYXA 1L4IA 5D7LE 1PKOA 2DQCL 2GPZA 1TTRA 3QWRA 2Z6FA 4BYHA 1DBKL 3RIFF 1IGIH 3QIBD 4FLSA 2UZYB 3F7VB 2FBRA 4XB7A 4PVNA 1A6VL 1DUYA 5EBMA 1I7ZA 5TE7L 4DGVH 3CSFA 3OKKB 3TZVB 1TTFA 2NZ1A 1KEML 4WI7A 4BFKA 2CPUA 1QNIA 2I7SA 2WCPA 3T6WA 2A7BA 3DI2B 3IKCA 3M86A 4PFEA 2IALB 4C4KO 1Q9KB 5T33H 1P7KB 3QDJD 1PCXA 1E6JH 2QHRH 1UB5B 3CN1A 4W68A 1XL6A 4KJYB 3MLYL 1GGIH 3WUWA 4XP4L 1WCBB 5JMRA 3PWLA 4IHBA 3LH2L 3SBWA 1VKXA 1IM9D 3N0AA 4G2AA 4G7RB 3C8DA 2JJWA 2XIIA 5FGBC 3BPCB 4P3CL 4AY0A 4GQQA 5HYSA 5CSZA 3H4HA 5FGBA 2E8ZA 4MB5A 5KVFH 1EMTH 1NDTA 1JWUB 3KYNA 3DX8B 1Z32X 2J1WA 1BF5A 4PRIE 3N3EA 1XGRA 1ZE3C 3D08A 5E6YA 1AYRA 3SKUD 1UUSA 2PYFA 1QQDB 5D7KE 2CO7B 5SX5K 4PY8I 3EBAA 4DN3L 1WF5A 4XBEH 4Z0BH 5AWNL 3MRLA 4GSUA 2NY4B 3ATAA 1RUMH 4JGNA 3U1QA 3AS3A 2PO6D 2VWEC 3K0YA 2MCPL 5LNDA 2Q8BH 2WXHA 4XXDA 5F88A 4X6FA 1CL7H 3F04A 1H15B 3IGAA 4Z7WE 5K9JL 3P11L 5BV7B 4UNVA 4UANA 5EN2A 3IN2A 3RBGA 1YC7A 2SEBB 4S0SD 3V6OE 3X3GH 1E2WA 2K3HA 2LU5A 1AGEA 1NDMA 4A66A 2FR4B 4Y1TA 1B2WH 1FHNA 4JCMA 1P1VA 5DTFA 4YNYA 1QZ1A 2EO9A 4X5RA 1BZEA 1R5IB 4QAWA 4LCVA 5D71H 4HJTA 4WJG3 2VQ1B 4FGMA 5JHLL 4P2RA 4PJDA 1SXBA 3K80A 2FWUA 2MKWA 4PGCA 3BFQG 1NFDA 1KG0A 4QPEA 1ED3A 2AQ2A 3HPLA 1I7UA 5C0AA 1JGDB 4HS6B 3QWRD 5L0QC 3O45B 4JG5A 4OJFH 4JO1L 2F53B 4UDUA 3MLUH 5DURB 5CM1A 4IBVA 1BPVA 4HAKA 3T6ZA 4GKOA 5FFGA 1E9PB 5KYXA 3WV0A 3T3PB 2XTSA 4C47A 2CCWA 2CGRH 4MDIA 1GS7A 1DJSA 2P26A 1HQ4A 4AH2B 4GEIA 5IVXB 4Q9QH 5IZ7A 4JE4B 1FNEA 2G5BB 3BUBA 2ATKA 2BLFA 5T1MA 1L9PA 3NRFA 1P7HL 1X9RA 4JY5L 3QIUB 1GMEA 1JHKL 2QTEA 4KBPA 1DVFB 2XN2A 5AVSB 3GKWL 2NYYC 3GGWA 1DQJA 1RVFL 1GGTA 3NJFA 3Q7JA 4LOFA 5CO1A 3DV6A 4BFIA 2P24B 1KNOB 5DEFB 3DPDA 1UM4L 4EI6A 3PUUA 5TK2A 3WFEH 1T03L 2OMXA 4YHNA 4Z7WF 4Y7OC 1CDUA 1L9MA 2BVQB 5ITBH 4FE9A 3PCYA 2MQ0A 4IRSB 3E6FB 1NAMB 2ENYA 6PCYA 4Y16D 2A83A 3MRIB 3MXVH 4S1SL 3EYFB 4YZFE 1FSKC 4GFTB 1FZJB 4YHPB 3VFMB 1X5FA 3GO1H 2J3SA 1ODAA 3IJEB 4DPCX 2H2SD 4UBDC 2YRPA 1EAPA 3QEUA 1EAJA 1I9IH 5DGQA 4DP8X 4B0MM 1S7SB 3H85A 2EUVA 4I48B 3T9WA 1EANA 4FJYA 1NFIB 5EU7E 5KVFE 2RCSH 4NNYA 5FA3A 1LILA 3OQ3B 4JB9H 4NZJA 2OPCA 2PR9A 3FT1A 2UWEA 5GJSH 1U8KB 4XN5A 1LTXA 1J05A 2B9AA 4JANA 3TO2A 5EC2B 5KJ4A 4YSDA 4NCC1 3NGBB 3VG0L 4Z8FH 1RMFL 5JPMB 2A1WL 4JFXB 5IGXL 3TX4A 2O1AA 3OJVC 4LCYA 1OAUL 4HEMA 1TKWB 2YXVA 3EH1A 3V52L 2WZ0A 4LF3B 4HX1B 4BK4A 2CPCA 4MD4A 3IJSB 3B5TA 4FI8A 1KJVB 2YAHA 3BN9D 3MKKA 5E00A 3VA6A 4ZOCA 3EZJB 1G4RA 3PHOB 3MLSH 4KKNA 4XO5A 1YEHH 4NZTH 2YD0A 2XWBA 4DP5X 1NCGA 5F9JB 3LJ3A 1XCQB 2ZX8A 5MEQA 4JZNB 4UB0H 1PZSA 2E9BA 4PS3A 4CW1A 1Q0YH 3SDCB 1MFBL 3IPBA 4PHXA 2GJ6E 3U6RA 2FWOB 4ZS7H 1ZXQA 5IMLA 4FA8A 3VM5A 1HFUA 1BWMA 4OIIL 3EOTL 3V4VL 1AQ8A 4YZFF 2NY2C 1D6EA 2WTOA 3HG1A 3I9GL 1QG3A 4F57H 1MCKA 1YMMA 1I7TA 5I30L 4MNGB 2DMGA 1MFCH 4AEEA 3P9MA 4XPAH 1I1FA 4HWZA 1X7SA 2CO6A 4M6OH 4OFPA 1CJYA 3NABH 4QI3A 4AM0A 5KWYC 2X3BA 1D5ZB 3IDXL 3X13B 3IE4A 5K9OA 3NCCB 4U0QB 1PL3A 1QVOB 1JGIA 3NP3A 1U41A 5DSCA 1EDHA 3OF6A 2HTKC 4M5ZL 1SXNA 4JGMA 4KUZL 4QOKA 5HDRA 3LRSB 2BDNH 2PLTA 2AMUA 3B5HA 5DJZA 1XQ4A 1P2CA 2W0FA 4KK9C 4R7XA 5AVVB 4LIQL 1HINH 1MZYA 3QJQB 1IX2A 1KPUB 2F0CA 2GW5A 3C09B 4GQ9L 3MRMA 1YA5A 5BPPA 2PTVA 4AG4H 5C0GB 1U0QA 1C5BH 1F00I 1OGAA 2VITB 5A2JH 5EO9B 1HXYB 2GB2A 3FTUA 2NT0A 3ARED 2XETA 3WXWH 3ORJA 2FJFA 1WD8A 3EHBB 3GMRB 5AD0A 4A2LA 4N22A 2Z9TA 2VR9A 3CZEA 3U0WH 5KSAB 3OAWA 5I5JA 1CD1A 3GT6A 3TNNA 4UBDD 4KNSA 1VGKB 1LM8V 3INOA 2Y36H 3P0YH 2WQRA 4IOSA 1JCVA 1RUKH 1GR7A 4XVUC 2FATL 1BZ9A 4QT5B 4UUJB 4WHTA 2M26A 2LLLA 4WSJA 1N0XL 3KH3A 2DOCA 4XB8A 4ELMA 4MJIA 4RRPA 5IMMA 1QYGL 2BOLA 1DJZA 4U6YA 4ZQKA 5I24A 2IAMB 1YYLH 5EOQL 1OWRM 1LE9A 3T2PA 1B9ZA 4EDXB 5C9JA 4KK6C 1C7TA 4NQXA 4QXTA 3QE5A 4JFED 5DO2D 1MI5A 4I4WB 3QDJE 1UA6H 4KOCA 5KVGH 1CDBA 3O3AB 1AP2A 1S5HA 5HDLA 1GVIA 1K3IA 1HTYA 3OSVA 5JIPA 2XA8H 5CBAB 3UTSB 3TWCL 4O4YH 2BVPA 2YEZB 1HZKA 3SQOH 2VJ0A 3AQYA 2V3FA 3UBGA 2GT9A 1VADA 5DJXB 5CBEB 5E51A 4MXVE 2NY0C 3O0LA 4X9HA 1ZE3H 4PB0L 5EOCH 4HIJA 4OLZH 3O8XB 2WD0A 5DQDL 3B1TA 1KXQA 5DUPL 4EQ2A 1TETH 2XQYK 2FDBP 3Q3GB 2H9GB 4GUPA 3HG1D 4LPYA 2QTVA 4Y2DA 5D72H 1AQDB 1YMMD 2DV6A 1DQVA 2YS4A 3B1UA 1YY9D 2FO4B 1QPXA 2NY2D 2WVSA 4ICXA 1ILUA 3MC0A 1ZKAA 4FNSA 5AOJA 1SN0A 3QHZH 5CJQH 3N43B 2WSKA 3BWUF 1JWMB 5BZWA 1PZDA 1CLZL 1A4CA 2CKNA 2XWDA 3SO3C 4JFDD 4YLCA 1AMYA 3TEWA 1T2XA 4TTDC 4I2XE 3JVGC 3SOBH 5JZ7C 2OJ1A 3RGVD 4NJ9H 1GTNA 4Y5VB 2EIJB 4YS4A 5HI3D 2AVFA 3BUDA 4Y5XC 1AKPA 2CUAA 3JVGA 5EWIH 2HTKD 4AW4A 2C7FA 2Z92A 4XVTL 1CIDA 4Y5XA 1WZKA 1P1ZA 3BMVA 4QIRA 4XOCA 1F3JB 3CFCH 4ZTEA 2D3JA 2HFEB 2W07A 3NIDB 2KZ1B 3QRLA 4HSQA 4TOYL 1D7FA 1OGAD 2W9EL 4G6AD 5D1QA 4P8QA 4AL8L 1W0WB 2YSSA 3BVWA 3K2IA 1R5WB 3QYMA 1ESOA 2Y6SC 1JZ5A 1WBZB 4K9EL 2P52A 1VFOA 5DUML 5DDHA 1WFNA 32C2B 2F5BL 4P46B 3BAYA 4FI6A 2VDOL 2O61A 5E6UB 3VI4A 2A5UA 1BP3B 4MXVF 3UTZA 4QGTA 5DRNB 3DNKA 4IOSD 1QI4A 5CWSA 2FT8A 4F7PB 4XPBL 4G6ML 2R83A 3TT1L 2R0KH 4YVNA 4AT6A 3LRGA 5BZZA 1G9ML 3CIAA 1W0VB 4M7LT 1BFOB 4HUWA 4PG2A 1P6FA 2BSEA 3CSGA 2GBVA 4B50A 4LFHD 5DHMC 2BP0B 1XF4B 3B6SB 5ANHA 1UT9A 1OF2B 1XGZA 2CO2A 2DLFL 2OL3B 4Z3GA 5ALCH 2WZPA 3NACH 1G0YR 4DCQB 1BOGB 4MX7B 1VCBC 3QNYA 5FV2A 5DJCA 2PPFA 2KZKA 1KTDA 2OSLA 1CPUA 2Z1KA 1WFMA 2BIOA 4WW2A 2WSPA 1A4KB 4XNDA 5HJBA 5A43C 3OXSA 3EBGA 3UROR 4AK1A 5KVGE 3OHXB 4EJ1C 2VH5H 3TBTA 2EDBA 1SDDB 2EE9A 4KTDL 1AQHA 3EGSB 4WTZG 1R24B 4FKEA 5B3JE 1FZKB 1FLTX 4M5YH 3D48R 3WSQH 2CNYA 1TVBB 4Y2DD 5DLMH 1JDCA 2NCEA 4XNUH 2GTZA 2CDGB 5ESQA 2VGLM 2VRAA 1P6WA 3T0BA 4WNQB 1T21A 5C0EA 2IG2H 1OSYA 5CMAA 2GI7A 4FFZH 4O2EB 3MBXH 4L1SA 4YHKL 4XCFH 3P9WB 4WU5B 1G6VK 4QWWC 2APVA 4KI5D 4FYSA 1LDPL 1OAQH 1U92B 2DEYX 4HG4K 1ZT1A 3K46A 4PSPA 3VFPA 4GUOA 3DXAB 3BIBX 3OGCA 1E4XL 4WGVB 1DVTA 5AB0A 3QISA 1FV1B 5EG6C 4LLQB 3WHXA 1VENA 4XAKD 5GS2D 2V3EA 5IWLC 5HHOD 1TSRA 1DBKH 3GB7B 2CLZA 2ZT9C 5IWLA 5D1QD 4H4NA 4PJDE 3U7YL 2FX7H 1ZTMA 4Q2ZB 5EZIL 2OK0H 1JFQL 3F12A 2OTPA 4ODWB 4EKJA 4NDMA 1A6VH 2J8UA 3PIQB 3MZGB 2XYBA 4JPWH 1RZJH 3E1F1 1BVNT 5J06A 5DYOB 5F7NC 3B9DA 2Y6SD 4EF3A 4HG4J 1JN6B 1AO7A 4KJPD 5KSBB 3VGAC 4AVKA 1TUPA 4UV7L 5TQ2L 3T1FB 5I1DA 3RDTC 1B6DA 3PAUA 3VRJA 4M7JL 5D93B 3ZXAC 2QVFB 2DH3A 2Z4QB 1CE6A 3N42B 5E7FA 3RDTA 2IJ0C 2NNAB 4J3BA 4V2BA 5I6OA 1X3DA 2EDFA 5DWUH 1C12A 3GPEA 4FC3E 5HHMD 3UL4A 1PZ2A 4HV8A 3QJXA 2G3XA 4X9GA 4AVJA 3HFFA 2BSED 1J5DA 4RIRA 4XP4H 1TVDA 3ILPA 5CXPA 2OR7A 2P46B 1I85A 3HLAB 4F5CE 4LLWB 3P9LB 2NQCA 2JKRM 3D05A 5EA0H 1PAMA 5IVZB 2WZPD 3UZQA 2AGJL 1RUPH 1L7TH 3LIZL 3IU4H 3W2DL 4PJAB 4LCCB 3LX9A 3QJVB 4GINA 3UYPA 4HIPA 3VNZA 3HE6D 4RGMB 3Q9QA 4JDZA 4E9SA 1LEGB 1U8LB 5AVXB 4HHWA 1NCNA 2ZF9A 3EYUH 1K5NA 2J6EL 2J57A 3BSGA 1NC4B 1R4XA 2F19H 4L3ED 1HHIB 2EO1A 4OJYA 4NZUH 4PJDF 1WBYA 3VE0A 2FLBT 2VQUA 4L4TA 2W94A 5IB5B 4BQ9A 2Q6WB 4Q0XL 4H25B 4KFMA 3G5ZB 3E38A 5DD5H 1S7XA 1U36A 3P11H 2PMZA 1QD0A 4X4YB 2UX6A 5F9DC 5DVNA 4BWWA 1OL0A 3HG0A 2VUOA 5AVZB 5I2IB 3LNIA 3S3CB 3UAJD 4DFIA 2ZXAA 2R23A 1QA9B 2MFNA 1UC6A 5GS1B 2DTML 1XB3A 4FQ2L 2FNBA 4HUXA 1DCLA 5CS7A 3TNMA 1FFNB 2ZQKA 1S2EA 2FRGP 4JFEE 1TYRA 4ABWA 5JHLH 5KVMC 3KHOA 5HHXH 5DJ0A 3A67L 4LCWA