5JNYA

Crystal structure of 10e8 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
235
structure length
235
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCSASGFDFDNAWMTWVRQPPGKGLEWVGRITGPGEGWSVDYAAPVEGRFTISRLNSINFLYLEMNNLRMEDSGLYFCARTGKYYDFWSGYPPGEEYFQDWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10E8 Heavy Chain
publication title Developmental Pathway of the MPER-Directed HIV-1-Neutralizing Antibody 10E8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 235
sequence length 235
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jnyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jnyA01
1K4CB 3WFHA 2Q8BH 5BMFH 4PRHA 3TYGL 1CR9L 1AQDB 4PJCA 5TQ0L 1J1OH 1FNLA 5E2VL 5DT1H 5E94B 5ICXA 3VFNA 5I1LA 1OSZB 3QFJA 3QXDA 2EE9A 3WL9A 3BPNC 3RL2A 1MCDA 1DP0A 3OG6B 4WEBL 6FABH 3RNQB 4ODUB 3OZ9L 3L3KB 4M7JL 4NQDE 5KVDL 4AMKH 4LBEB 5FKPA 4F7MA 1ZS8B 4P46A 1D9KB 3V4VL 1RSFA 1NDGB 4JGUA 4KKBD 1Q9WA 2VXUH 4KUZH 1QZ1A 5JPMA 3PP3K 4QOKA 4G7YL 4F9LC 2Y6SC 4YHIB 2NX5E 1DQJB 2LTQC 1A1MB 4GJTB 5TFSH 5C07A 1KN4H 3CFJB 4RCAA 3UJTL 2ZPKL 3LS4L 3UX9B 4YJZL 1CGXA 4BFGA 4OCRL 2JB6B 4UINH 5E9DB 3QIBA 3L6FA 1YEHL 3P30L 5KZCD 1F00I 2BOBA 2YPVL 4NKIH 5D1XC 3IXAA 1TVHA 2GFBB 4HAGA 1T1WA 2WQ8A 4D9LH 4BH7A 3BPNB 3PL6C 2Y07H 3LMJH 3MLRH 5ACZA 5EN2B 3EFFA 3VE0B 3QQ4B 4JY6A 4GW1B 1K5NB 3BKCH 4EDWH 3V8CA 5DMIH 4YGVB 4P2QB 2IGFH 3CSGA 4JO4L 3SGKA 1BBJB 1XGUA 5BZDA 1OGAD 4JFPA 4NYLA 2LTQB 4HXBH 2MKWA 3BRDA 3HMWL 5C0JA 3C2SA 1I7RB 3TBWB 1DN0B 4ZS6C 1HKLL 5IHLB 2X9XA 4PR5B 5KN5A 1KC5L 3WCYA 4GG6E 4HPYL 1MRFL 3OF6D 3GBNL 3MV8B 5SX5H 4J4PC 5F88B 2CKBA 5KVEL 1I1RA 2C26A 2FJGA 3EKCA 4ONHB 1TZGH 1NAMA 5CILL 3LVEA 4I0PD 3O6LL 5D1XB 3SE3A 3OXSA 1ONQB 3GSVA 1FJ1B 1LEGB 4XP6H 3UBXA 2ERJC 3PL6B 4Z18A 1XGPA 2YUWA 1A7OL 3CXHJ 1QYGL 3ULVC 2JB5L 3DO7B 4DZ8A 3QYCA 3KXFD 4N0YH 4WW1A 2MOVA 4PV9B 2HJFA 1VEOA 2LAAA 4PV8B 3LRSB 5JQHC 3ZSSA 1JNHB 2RGSA 3ZKND 3LN5A 5DO2D 3I84A 4P3CH 3P0VH 1F2XK 1OM3L 1U8OA 4XAKE 5HYSB 3CUPA 2V5TA 4K2UH 4FQ1L 3QO1B 4JJ5A 4U6XA 5IUSA 4L3CA 1WZ1H 1MCQA 2YA2A 4KVCL 4DGYH 3WNPA 3PWNB 3AU1B 5DMGC 2X40A 2YPLE 3PWUA 5DGQA 2AABL 2V2XB 3QUXC 1FYHB 4LF3A 3DHMA 1FG9C 4PGBB 2VB5A 3SDDA 3O0RL 1KB9K 5C0BE 1UH3A 3MRGB 3IKKA 4Q2ZA 4LNVA 1YJDL 3QCVL 3NFPB 3HI5H 4IHOA 4F7CB 1E4KA 4LSTH 4JVWA 1X7QA 5HHVH 4U6VH 2ERJB 4YWGH 1T80A 1P7KB 1MWAA 4ELMA 5F7YC 6CGTA 4IOFC 5C0GA 4M8QB 4GQ9H 5IV2A 4ZFGH 4KRLB 5F7EL 1EXUA 4D0BA 2W38A 3HR6A 4HXAH 3RRQA 2IALB 2F5BH 2Y4SA 4EI5C 1OW0C 3F5WA 3QPXH 3CVHB 2R56H 1PG7X 1WLHA 3D3VD 5KSAA 4L4TE 2AJSL 4O51B 2F58L 1ZAGA 5D6DC 3KGRA 2BVPB 2P5WB 3MLTA 3BZ4A 2R2HB 2XOTA 4JLRA 1A2YA 4FQLH 4I77L 1VGKB 5C0DB 2AS5M 43CAA 3QUXB 4NP4L 1EMTL 2FGWH 3SGJC 5DVOA 4UIKL 3PQYB 3W81A 5IB3B 3FONB 5C0IA 1G0XA 5AG9A 1HCFX 1BD2B 1UM6H 3T2NL 4UI2A 1MHEA 2V5YA 5A2JH 1OSPL 1T20A 3VXRD 3AREA 3SHSA 4UUJA 2KQNA 5FOJA 4IS6A 3O8XC 4LHJB 1LO4H 3U0WL 3X11B 2FO4B 4NHCL 1LE5A 1QFUL 5IFAL 4ODWB 3WN5A 2EIZA 1XGRA 4PJ5D 1KENL 4NN5C 5I30H 3ARUA 1ZA6A 4LGSB 4ONGH 2HRPL 3MRCA 3NGBC 3WJJC 1QA9A 3MRKB 1CFNB 4DEPC 1ZT4A 4N5ED 2DICA 3OKMA 4EI5B 3BHBB 3MNZB 2M1KA 4KKCC 2UY7A 1PKQA 1HXMB 4DKAA 5HSFA 4N9GA 5EOCJ 5DMYA 2H8PA 2L0DA 2GSGB 3QUMH 4Z7WA 4PP1D 1WFOA 2YSSB 1B0RA 3VWJD 4R3SB 1T0NA 1IL1A 2KBGA 1MNUL 1ZOXA 3CSYA 3C5JA 4U1MA 1RIHH 1TCMA 3NTCH 1F13A 5GGVL 5D7JD 4DWHA 5IVXA 4XBPB 3MODL 3GMLB 4X7DC 4W81A 4IRZL 3VFMA 3BN9C 1CE1H 3C5ZD 1JZ6A 2EEDA 2EXYC 5CBAB 2C1PA 5D2NE 4F3FA 1R3IL 2CRYA 1FVCB 1QO3B 1XEDA 2NTFB 5CD3B 3O8XB 5K93A 2A73B 5IMOA 1QLEL 1VGEH 2W9DH 5CJOL 4NN5B 1U58B 1IGJB 4LPTA 2B0SL 3NGBB 3NN8B 5D5MF 1YEJH 4MAYC 2AV7B 3T0EC 3EUUA 1YNTA 4M1GL 1LO0H 1CWVA 4RBPK 4OF5A 3MJ7A 3THMH 5KVGL 4DGIH 5FYKD 4PGDB 5T3ZD 1SEBA 3LDBC 3IFLH 5ETUB 4UAOC 1MFCH 5DI8A 4TULH 3ULUF 4YZFF 3MR9A 3A6BH 3GSUB 3B9EA 4HWZA 3L3OB 4DQOH 5MEND 4JEGB 1A3LL 1WBZA 3V7MA 3QDJA 2H3NA 4PRNB 5FECB 3BVNA 3RWGA 1R3HB 1EHLL 3OJDB 3LKPB 4QNPF 4LSSH 5DUBA 1UKSA 4EQ2A 3OX8A 4N90E 5I1HL 1F90H 2F54A 1YEGH 2VXVH 3RZCD 4K7PH 3TC9A 5CEZE 3QUKA 5DJ0A 1KFAH 2DLIA 1G7PA 4QT5A 3DURA 4KK5C 1RHHB 2OI9B 4MNQB 2JELH 1RUAL 3U83A 3WE6A 3QEHA 1CG9B 4HS8H 2V2WA 3QHZH 4MAYB 4WW2F 4LFHD 3T0EB 3GSNA 3LZFH 5E7BA 1KTLA 4P4KD 4Z8FH 5I15L 1YY8A 1T4KB 3FZUC 3OB8A 4Q9QH 5CSBA 4S1DC 4PJBB 1SBSH 5ICYA 5CINH 2EH7H 4UAOB 2IANB 4DOHB 5F7UA 5HPMB 5GRWA 5IB1A 2VWEC 3WFBL 2Z4QA 2EDRA 4HDIB 1JV5B 3R4DA 4F9PA 4ZPVB 1JGLL 2QHLA 3B5HA 3FOLA 2VL5B 1AQKL 4PJ7E 1YYMH 2NYYC 2EXWC 2XZCH 2YEZB 1CXHA 3TZVD 5JORA 3OAZH 1MCCA 2H1PH 4N1HB 5F7MC 4TQEL 3H8NA 3K8MA 4HSQA 1FNFA 2Y23A 4C56E 2OR8A 2BSSB 1T1ZB 3NAAH 4XPBL 3DXAD 2B2XH 4KTYA 2WP3T 4U1KB 3NCJL 4J2XA 4YE4L 5IHUL 2FHCA 4JG1L 4WTXA 2PYFA 5HGDA 1NBYB 3MRDB 1XCTB 4CU6A 4HMDA 4XAWH 4RWHA 5GXBB 1YJDC 3QULB 3O2WL 4MVBD 5E8EB 3VFPA 4XHQA 1JN6B 2BVEA 5FCSH 3HCVB 4EXPX 3N1MC 1DLFH 3P40A 4R4NC 5DK2A 1C5CL 2NY4D 4OZFA 5FA3B 1OP9A 1MEXH 4NQXB 1DSFH 4F8TA 2R4SL 5EUOE 4YHYC 3HC4H 2AI0H 1N64H 5CBEB 1I7ZB 5B38A 3B9KA 4WHCA 4I9WE 4HV8B 1IILE 3GI9L 2DOCA 3L7FB 2VITB 4G42B 1INQA 4JREC 5I17B 1CFQA 3DPBA 1SJVA 5IEKB 3HE7A 1J87A 5EBMB 4QRPB 4P46C 5T1MA 3DX7B 1MIMH 5T1KA 5D72L 4YHPB 4HKJA 3CFEA 5DC9B 5IBLC 3KPPA 3QEQD 4GBXC 5D2LA 1PZ5B 3QJFB 2JJTA 5CJ8A 4FABL 2X05A 1MQKL 5CGMA 3C08H 4I0KA 2Y5EA 2AJYL 4AM0A 4CN4A 1BQUA 1EVTC 3C8KB 4D0CB 5L9DL 5CKAA 1MCFA 1AGBB 1UWGH 3U7YH 1IGFL 4X98A 4YHYB 5ICXB 1UWEH 3VFNB 2CDFA 3BPOC 1J8HA 3FQXA 3QFJB 1FZMB 3RL2B 4JRYA 5DJ2A 1MJJB 1VKXA 4JREB 4Y4HC 4M6OH 2NW3B 3Q3GA 4R9HA 3DSFL 5FKPB 3T65A 1IBGL 3RTQC 1CZ8L 5EU4A 4P46B 4DN4L 5JW4N 2MPAH 3U6RA 2Y06H 5FUOH 1LHZA 3ZHDA 3UCRA 2F8OA 4XVJH 5B3JE 2GAZB 3FQTA 5T33L 4UOW0 3ZT6A 5F1OB 5FO7A 3VD7A 4MXVF 4YXHH 4GBXB 5ISZD 2X89A 3TO4D 4IRJD 5AEAA 4BZYA 1BP3B 1KPVA 2VZ3A 5E5MA 3I3BA 3WNLA 4H25A 1H3GA 2DQFA 1AJ7L 2MNUA 2PNDA 3QIBB 5DLML 2PTTB 3L6FB 1KCSH 2DQIH 3WIIH 1BVLA 1ACYH 2Z31A 3VI3E 2XWJB 3BH9A 4RGNE 2CIIB 3SE3C 1UXSA 4X5WB 2Q3ZA 3SO5A 1BX2A 2HFGL 4NM4L 2DQJL 2AJVL 3BPOB 4MNHA 3ALPA 4EJ1C 4LASL 4MQSB 1JI2A 3BAEL 3IDXL 4HF5L 4PTTA 4F7TA 1J9CT 1YY9D 2DYPB 5LWYH 2IJ0C 2A77H 1UEYA 4Y4HB 2Y7QA 4QTIH 4JY6B 3FQRB 3W2DL 1F3JB 3RTQB 3EDKA 2XWTA 2DI8A 2VE6A 5EOTB 2DB8A 1TLKA 3H2WA 1FGVL 5DQDL 4ENEC 3SKJH 3DVIA 5BZDB 4P0DA 4X9GA 2VDNH 1VADA 1TZIA 4N5UA 5FGSA 2R1YA 2VABA 4AEIH 2C3HA 3CFCL 5DD5L 1IC1A 1YEKH 3BPCA 5HI4D 5LAXA 5KSUB 2R0LL 1PSKH 2A0LC 4JQIL 4OT1H 1DR9A 4TTGA 2P8PB 4O02L 4NKOB 4CNIB 1WSST 4J23A 4Z7OF 5KN5B 3S88L 5E24E 3GJFH 4M00A 4LCWE 5F96L 1BJ1J 2CKBB 3MO1B 4E41D 4F57L 1RJZA 1CF8L 4AG4L 1I3RA 1KPUB 3O3EB 4GXVL 1CICD 1KTKE 1NFDE 1TXKA 4PRID 4X9FA 4YHKL 2UWEF 3GSVB 3O2VH 5TQ2H 4RNRA 4YDIH 4J7RA 4X9IA 1VPOL 4E5XB 2YA0A 1XGPB 4I2XB 2DIAA 1AO7E 2RJMA 4NDMB 5JXED 4WW1B 2E7LA 3BSZL 2BDNH 3JXAA 1A3RL 3HUJE 3GHBH 5KVFH 5DD6A 4HKZB 1OCWL 4F15C 1N6QL 1U8OB 4P5MB 1YYLL 5MENE 4ZUVB 4ZOBA 4UQ3B 4JJ5B 5AYQA 1CIUA 3VRJA 1NL0L 5HHOD 2PXYD 3QIUD 4DVRH 1WWCA 3JWOH 4G7VH 5E70A 4JPIA 1FZKA 1QPXA 2HYMA 3LEXA 3L1OH 4O4YH 2J88L 1N8ZA 3FB5A 3QG7H 4I4WB 1QSEA 2ZSWB 4G6MH 4Q2ZB 2Z8SA 4PJ9A 1SEQH 1A6TB 4IHOB 1G7LB 5J12C 4E42A 5A2FA 2BMKA 3BWAA 2OTUA 4ELMB 1VACA 3RUGA 1G1CA 3MPCA 4TUKH 5IV2B 5DF0A 1MHHA 1J5OL 1G6RH 4G9DA 5GRUH 2AXGA 3QHFH 5E2UL 1LDPH 4F15B 5C09A 4WI3A 2ZCKL 5KS9A 5EOQL 4WFGE 3BKJL 2FHBA 4I3SH 4L4VA 1EUTA 1NC4B 2IFFH 4X7CC 4B53A 2R9HD 3MLVH 3EDFA 1MUJA 1FLRH 1FO0A 1FG2A 1TTUA 3MLTB 2JCCB 3UTTA 5GSRA 4JLRB 3AMLA 3EOAA 1NKOA 3T1FB 43CAB 4BZ2L 1IARB 1RURL 4L29B 5CUSH 2X09A 4ODXA 5C0IB 4OJFL 4KV5E 1BQHA 4ZFZA 1J1XL 4JFQB 1MHEB 5SV3A 4MB5A 1CFTA 1T20B 5BZWA 1G7MB 4JRXE 3EFDH 4MDJA 5DS8A 5J12B 3QH3A 4Z0BL 1LE5B 3ARFD 3FQUB 4M6NH 2X10A 3H9SE 3MRNB 3CX5J 5F1IA 1NGPL 1ZA6B 4KROD 1F5WA 4NNPH 3MRCB 2A9NL 1S8DB 4XC1L 3FFCE 4PP2A 1A6AA 4P2OA 2A6KA 4M1CD 2BP3A 1VFOA 3EYQD 1MFAL 2VUYA 2CLRA 1H5BC 1I8IA 1WBYA 1A7QH 1C5DA 2VLMD 4M1DH 4XRCA 3VXUD 4DZBB 4N9GB 4Q97A 3BESR 5LJYH 2DBLH 3QFDB 1AP2A 2HWZL 4Z7WB 4LPWA 1A0QH 4UTAL 4U1MB 3CSYB 3HNVL 4GO6B 1A7NL 3ZE1E 4FQXA 5D1ZC 5JHLH 2XZAL 3G6DL 3X17A 4Q0XH 1U41A 1MHPL 3MRLA 4QXUH 2V5SA 3H3PH 2COQA 5TF1H 3VW3H 4F3FB 3MJ9L 1NCDL 5FB8B 5IMOB 1TQCC 2CUIA 1OAXH 1WUNT 3KR3H 3BJLA 3D85D 2E9JA 1QFWI 2DKUA 2F53D 3D6GA 4MD5B 4PJIE 3QHTC 1KJVA 2R0WL 3QPQC 5E2TL 5CFHA 3NMEA 1FZOA 1FHGA 2VL4A 3TH3T 5GS0D 1QHOA 4QKXB 1H5BB 4CKVX 2DWDB 3MJ7B 4ZSOE 2VXTL 3Q5TA 1KB5A 2HVKA 3WD5L 3LKQB 1SEBB 3LIZH 2OJEA 4K9EL 5DR5L 5T5FL 3MR9B 4HWZB 3FMGL 4MZ3A 4ONOA 5D1ZB 1KSRA 3RWGB 3IRZA 2VDQH 5IBUB 3NIFE 5EC2A 1N2RA 2GY5A 1JHTA 3TJEH 5AWNH 3HC3H 3GSWB 5DUBB 5ICZA 3OX8B 5FYJL 2VERN 5I16A 3QUKB 3HAEG 1D9KD 3ZDYE 1CBVH 4QT5B 2QKIA 4ZYKA 4G3YH 4MS8D 2R29L 3MV11 3WE6B 3QEHB 5FK9A 2V2WB 2GK0A 4H0GA 4PBVC 3ARYA 1QSFA 1DQDL 1KTLB 5CEXA 4GSDL 5E9DD 5C08B 3MUGB 5CWSB 5EBWB 1IKFL 5I1EH 2ARJA 5IJKC 3FB7B 1ITCA 4K3DL 2JIXA 4EZMA 3GJEA 4A6YH 3LHPH 4QHNB 1RZJL 2QQNH 4YDLC 5DJ8A 5E5RB 4LK4A 1Y6KR 2C3GA 4U1JA 3MLUH 1REIA 3HE7C 5IB5A 5I1KH 3HI6H 3WXWL 1KJ3H 3A67H 3HAEH 1DANT 1UYWL 3I9GH 4H20H 4XWGL 5K59F 1EV2E 3CC5A 4XB8A 4UNVA 4PREB 5EU6A 1UADC 5HGDB 5GIRB 1T04A 2A74B 4P2QD 3SQOH 1NEUA 1NLDH 2JJTC 4JO3L 5HDQH 2C3WA 3RWEA 3SKNA 2AQ1A 2OK0L 4U1NB 1UWXK 5DQJA 5ENWA 4OUOA 1JCKA 1ZLSH 2O5XL 5ID0B 2XIDA 2EH8L 5DK2B 4LAQH 1UJTA 4OZFB 1ADQH 3AVEA 1OTTD 3K46A 1V7NL 4FN0A 4XCCL 5D9SA 3T0VA 3MLSL 4PLNC 4XCYA 4XBGA 2AQ3A 4YDLB 3SDCC 4KQ3L 4G8GA 2ZWLT 3EYUL 3EAKA 1INQB 3DX6A 5TDOB 4ONFL 1MSPA 3CK0H 2H32B 3HE7B 2H45A 1ZANL 4EUPH 2GJ6E 3LH2L 3PWVA 3K8KA 5T1MB 3SQBA 2BY2A 3EYSH 3HLAB 1CL7H 3BE1H 1X5IA 4HKJB 1KLFA 2V17L 2GITB 3UPRB 4X6CF 5I76A 3DX9B 2Q8BL 3ZE2F 4OM0H 5D2LB 5BMFL 3SDXF 1V3JA 1J1OL 5DT1L 5ILTH 5TGBA 2OR9L 1X5XA 4QCIA 4QRTA 3TCLB 4PJGA 3CLFL 4R6UA 1BEYH 4YFLF 3QZWG 5F6IB 2EIDA 3AB0C 5FEBA 4AH2B 1N7ML 4NKDB 3KPSA 4AMKL 1A6VH 3I2CH 2CDFB 3P11H 5JW5A 5CIPB 4KXZH 1J8HB 4NKMA 3G5VA 5I0ZA 5FYKH 3SDCB 5T3ZH 2D2OA 5DJ2B 2VXUL 1VKXB 4KUZL 4EVNA 3WNKA 3DGGA 1F8TL 1T5WB 1EO8H 4I13B 5EU4B 5TFSL 3TV3H 3V95A 3MRMA 3ZKXC 1KN4L 4POYA 1FYTB 5D7IF 3QXUA 2X4QB 4ODSH 4PRBA 1W8OA 1T1YB 1YPZF 4FTVE 4MQXC 4YPGB 3U4EA 3RGHA 2PO6D 4HUVA 3A6OA 4NKIL 1S9YB 4XPHH 5E5MB 4H25B 3T0XA 1LK3H 2BVOA 4LIQE 2EZ0C 3H9ZA 4D9LL 3WLWD 1PLGH 1PY9A 3AB0B 3LMJL 4XP1L 3BH9B 3QUXD 4QTHA 4PGEB 1H9VA 1F6FB 3RL1B 3AUVA 3BKCL 5DMIL 4LLVB 4TUOA 1DEEA 2VXSH 1S7SB 4JANB 5DHYA 1MVFA 3ZDXF 2IGFL 4F7TB 3UAJD 4PGZA 5E1HB 3EJJX 5E56A 3V6BR 2E7LC 2FGZA 4X7FC 3R06B 4DK3A 4X4YA 3M1BA 4K9EC 3G5ZB 4IOFD 4XNXL 3ZKXB 3ARDD 5SWSA 4NOFA 5D70H 2RAMA 4N8CH 4BZ1H 1VADB 1GHFH 1RULH 2J8UA 2R1YB 3T0DA 5DJCB 5FKAA 1DLHA 3OG4B 3B8YA 4HJJH 1G7IA 2YR3A 4G6AC 4Y2DC 5CKGA 3V5DA 4JFFE 3C6LD 2OTWB 4BELD 1ZSDB 4HEME 4Q9RH 4RA3A 2KZWA 4MD4B 1FFRA 5ALCH 4HJGA 4FS0A 4N0YL 3DVNA 4JFHD 1A4JA 3KJ4B 4QHLB 4RGMC 4OTXH 5EO1B 5T3XE 4P3CL 2VOTA 3P0VL 3IU3B 3MRQA 3VMPA 4K2UL 1FP5A 3PDOB 3DV4B 4ZOEA 3UBXI 2BNQD 1OQOA 1WZ1L 4DGYL 2VLLA 1RZJC 3CXDL 4PRPD 1GVIA 3I6LE 1FNSH 2XKNA 4HH8A 3ES6A 5H2BA 3ISWA 4M62L 1R5IA 2I5YH 4P2RE 1KULA 1U8QB 5KBNC 4Y2DB 5D7SH 4R2GC 4PG2A 4PB9L 2JJVA 3HI5L 3TA3D 5KSBB 4LSTL 5C0CD 3LEXB 5HHVL 4YWGL 1K9TA 4FQCH 2L7UA 3FB5B 4OGAC 2QTEA 4WWKA 1W0YT 3L3HB 4ZFGL 1LDSA 3VXSD 5MEPB 4PJ9B 2EDLA 3TO2A 2C1OA 3BN9D 4HXAL 2BMKB 3UTSE 4N0FA 4FMFA 3EYOB 2OTUB 4NQDA 2XQBH 1VACB 5ID1B 2F5BL 2WBJA 3RUGB 3QT2A 5KOMC 4PJAF 1VB9A 4HCRH 2HT4D 4HUUA 2QQLH 4XTRD 4G9DB 5D7LE 3U36B 5CD5D 4MNQD 2QHRH 4K94C 1SMAA 3L5WA 4PJHF 4J3OC 3EOBB 2NX5A 1E4XH 1QHPA 1OAZL 1LILA 4FQLL 4L4VB 3GSOA 2X1OA 1U8PA 3T0ED 4NT6A 2FGWL 1A1OA 2B20A 1FG2B 1EFXD 4XH2A 3MFGB 5BOZG 4KJPC 4P23A 4W4OA 4ZFFA 2YBRA 5DHXB 5GSRB 3UTTB 1HQRB 3B6SA 4QY8A 4I18A 5J6GA 4R2GB 1FAIH 2YD6A 4FG6C 1N6VA 3GMPA 3T0BA 5GZND 1IAOB 4LLWA 4ODXB 1BQHB 4ZFZB 3DTXA 1HHHB 4M7KL 4ONGL 5FM5O 1CFTB 4LKCA 3IAGC 4H88H 1B9ZA 5BZWB 5EO0A 3ROOA 5GZOD 3EO9L 5HGHB 1KJMA 1S7UA 5HDLA 1RUQH 3Q0HA 4G9FD 5GSVA 3EJZD 5F1IB 2DIJA 4MJID 4RFOH 4UV4H 1A6AB 4P2OB 4KJWC 5L8KB 3QUML 2D03L 2WNGA 4EN3D 2F74B 1ZLUK 5I75C 5IESH 3WDIA 2CLRB 1J05A 5JW4R 2G60H 1RIHL 5ESVA 3X12A 5JNYA 3NTCL 4HFWA 4F58L 5FV1L 4S0TD 4KVNH 3MYJB 3VFSB 5L2KB 4FFYL 4ZODA 1XIWA 5IW6A 2F8VA 1CE1L 3QXVA 4JVUA 4GG6A 3Q6GH 1NMBH 1OF2A 4R8WL 3INUH 2FATL 2PW2A 3ARTA 2B8OT 1VGEL 2W9DL 4NQEB 3U7AA 4BKLA 1ORQA 3ZLQC 1I1AA 5FA4B 5J11B 5L7XH 1JWSA 3S34L 5FUCE 3IJSA 4XP4H 2NYYD 3F58L 4POZC 4I48A 1YEJL 1F4AA 1AXTL 5M94B 2CDGA 4U1IA 4Y2OA 3FO2B 3TF7C 3CGTA 3DV6B 4HBQA 3BQUD 3S3PA 4LQ1A 3C9NA 2AXFB 4KK6D 4MX7A 3THML 3K2MC 4ZD3L 4DGIL 3RU8L 5JUEH 1OP3K 3TBTA 3G04A 4TULL 3A6BL 3BGAA 4H1LA 5I75B 4LLDB 1F6AB 3QI9A 2VZTA 1S78D 4ORZC 1RJLA 1HDMB 2R4RL 4FXGB 3ZDZF 1RI8A 2YPLA 4R90H 3JBG7 1KCUH 3QWOB 4PRHD 5C92A 1PJ9A 1MCBA 4LSSL 1U8LA 2DIBA 1F90L 1YEGL 3DX8B 4K7PL 1N4XH 1U8MA 5C0BA 3QFJD 5EC2B 1N2RB 4ZNEE 3IF1B 1JHTB 5D5ME 2JELL 4JPKH 4R0LC 3WHXA 1IEBB 4OM1L 4HS8L 5I16B 1WIPA 3RVUC 1FIEA 2HKHH 3QHZL 1I9JL 4P46D 5C0AE 2O93L 5IW3A 3LZFL 1MREH 4Z8FL 1NUFA 1QRNB 4YHNA 4NUGH 4QOKD 3ULUE 4YZFE 5FK9B 1SBSL 5CINL 2ADJB 2EH7L 5EPMA 3WNMA 5ANME 2GK0B 5C07D 3V6FA 1QSFB 1SQ2N 4L4TA 5CEXB 5JR1H 3MUHL 4JFDE 1JFQH 3O4OC 3MLXH 2FIRT 3QIBD 4NGHH 4QNPE 4L3EB 2XZCL 1OLZA 2ARJB 2OMBA 1HEZA 5KVMC 2H1PL 2JIXB 4MA1C 3F7VB 2YD5A 3LSOA 1A1NA 5DJ8B 2P7TA 4U7MA 1KCVH 2UYLB 1MLCB 3NAAL 1XF3B 4U1JB 1IGIH 5F9DC 2UZYB 2VLKB 2ARWA 2IWGA 3AS0A 5DFVC 1RUKH 3D39E 5IB5B 5I1IH 3GSRA 2B1AH 4XAWL 3ULVF 4R0LB 5DZNA 3P9MA 1N26A 5T5NG 3UTPD 3VGDA 5EU6B 2XTJE 3FOMA 4HBCH 3DETC 4LVEA 1DLFL 3MV9E 2OR7A 1FFQA 3OKLA 1MEXL 2R39A 2C3VB 3HC4L 5EIVA 4HUWA 1N64L 5AD0B 5DQJB 1KT2A 1BF8A 2VDOH 1T83C 4KRMB 5D1QA 2HFFA 4CU8A 1JK8A 3O4OB 4Y4KA 3EZJB 5HY9B 2GSIA 1RUPH 1S9XB 3KAAA 2AAVA 4R96B 3ARVA 4JM2A 4MA1B 3DBXA 3HA0A 4LU5L 4NQSB 4XBGB 4WFHD 4K8RD 3IFOA 1MIML 4G8GB 1BLNA 2ARJQ 4K3EH 5L0QC 3D69B 3IDYC 4TUJA 3DX6B 2D7PA 2YWZA 4EI6A 5D2NA 1FFNB 2D0GA 3RWIA 3B9VA 3PWVB 3VXPA 2ATKA 1BVKB 4K7FB 1U95A 4HKBB 3K4AA 4PRDA 3C08L 3QA3B 1PEWA 3NABH 4XC3H 2DTMH 1CFSA 2NR6D 2FJFA 2N7AA 3CDFA 4ZOAA 5C0CE 2GW5A 4D9RD 2EYSA 1UWGL 4QYOA 4JCLA 1HK6A 2NLJA 5EOCH 3U7YL 2H2SD 4XXDA 1CYGA 4W4NA 1S9WB 5TGBB 3MV7E 4QRTB 1O0VA 1UWEL 3G5XA 4PJGB 5E1AB 5FUZH 4KRNA 5F72S 4BFBD 3KPSB 4M6OL 4K71C 3SDDD 5GS0H 5JW5B 1X44A 5DYOB 3G5VB 3V6OC 2ITDA 2MPAL 3PNWA 1RK0A 2Y06L 5FUOL 5K9OA 4XVJL 3IDYB 2EECA 2VQ1A 4WV1A 5L0QB 3MNVA 5B39G 1AY1H 1P4LA 1X5YA 5JPNB 4NSKB 2IADA 2FEDC 1MJ7H 4YXHL 3MRMB 5EU7E 4BFIA 4MXQD 1QLFA 4U1HA 2DLTA 2DQIL 3WIIL 5K33A 1LO3H 3U4EB 1ACYL 5HYJB 5KSAD 4GKOA 2OL3A 2XG5A 4HIJA 5E8NB 4Y5XA 2IMMA 1KGCD 2E7MA 1Z6JT 3QJHB 3AMKA 2WWMC 4Y1AE 2BHYA 3STLA 5FCUH 4Z7QF 5MERB 3RP1A 5LWYL 1OGTA 4F37K 2A77L 4QTIL 5JO5A 3VG0L 1QBAA 4K71B 3QUYC 1B88A 3QUMB 4PJ7A 4FA8A 3VGGA 1DEEB 5DWUH 5DHYB 4M7LL 4RMQA 1A8JH 3ARED 1UB6B 3SKJL 1I9IH 1WQVT 1MCOH 4TPRH 2EDYA 4C56A 2XA8L 4X6EB 3TBVB 5F3BA 2W0PA 1L7IH 5F7KC 4AEIL 2ZUYA 3BT2H 3P9WB 1MCNA 4X5XA 1YA5A 5DRXA 1ZHNB 1PSKL 3HZVA 4OT1L 1Q72H 3GSXA 1VHPA 1VFUA 4MA3A 5FKAB 4GRWB 2PTVA 3DJ9A 3QNYA 1CGYA 3MREB 2V7NB 5F1KC 4PJBF 3V5DB 4GKNB 3K81A 4XGZB 3LQZA 4O2CB 4ZAKA 5TQ2L 3O2VL 4AK1A 5AYUH 2G5BB 4YDIL 3D2UA 3ZT7A 3DUUA 5GGUB 3WFDL 1JPSH 3U2SB 1PAMA 5EUOA 3OJVC 4Z95L 3TVMC 5ACMA 1UZ6E 5IMMB 4KK8D 5BV7H 1L7TH 2BDNL 1UWXH 3AAZB 4YFDB 3DVNB 1A4JB 3QUYB 2RFXB 3K8LA 4UDUA 3GHBL 5KVFL 3S37X 3MGTB 3RVVD 4QRUA 3NZ8A 5DUMH 2ZJSH 3CFBA 2CLZA 3LY6A 3ARGA 3LV3A 2JE8A 4RDQG 3OL2A 5FDWB 1L0YA 2PR4H 3KLAA 1CVSC 3RAJH 4OIAA 4YR6B 4Z7OE 3P4NA 4FRWA 1YN7A 2XKNB 3EHBD 4DVRL 3W9DA 3JWOL 4G7VL 3CH1B 5H2BB 4MMZC 3O11B 3L1OL 1R5IB 3QG7L 4JFEE 4W4OC 4OD1L 4G6ML 3O6KH 2ZSVA 1SEQL 4AT6A 4DFHA 5GJTH 4CGTA 1HINH 3GMNB 4RMVA 3QDJD 4TUKL 3QQ9C 1TFHA 3EO1A 2NY5H 3MBEC 4Z77B 2J5LC 5GRUL 2C1OB 3RGVA 4N0FB 4NQDB 1LDPL 2ZOLA 1RZIA 2WBJB 5JQ6H 4IIQA 2F54D 5T1LA 5D7KE 5CZVH 3IGAA 1JGVH 2IFFL 5J0BA 1IE5A 1U3HA 4Z78B 3CD4A 3N0PB 4OKVB 1FLRL 3VDBA 3S5LA 3L5WB 3TBYA 1YNKL 1AC6A 4HK3N 1AR1D 4IRSC 3VXME 5HI3C 1U8PB 3MCLH 2VSDA 3KPRE 2HT2C 1JF6A 1S7WA 2X9WA 4K55A 3E2HB 5CUSL 5HYFA 4UU9B 1A1OB 3G6AA 2HMID 1XIWC 2P8MA 4XH2B 3V52H 4P23B 4ZFFB 4ODVL 3QISA 3MJ8B 4QY8B 1MPAH 4YDVA 5J6GB 3NCYS 1VFBA 4ZXBA 3CVHH 4OD2A 1J11A 3GMPB 3RIAK 5DVKA 5J1TC 2CDEB 3DTXB 3MXWH 3IDGA 1BWMA 3NFNB 5EO0B 3ILPB 1KJMB 2J5LB 1JPGA 2Q3AA 1MAML 1CGVA 1U8KA 1NCCH 4WUUB 3SOBH 4RFEA 2X4PB 1DE4B 3ME0A 5F9WC 3CCHA 5I2IB 4XI5D 2KH2B 3C8DA 4TRPH 3L95B 2FL5B 4DCQB 3S4SG 1A0QL 1C12A 3UTOA 4IRSB 1MCKA 3X12B 4ETYA 3HZKB 5SWZE 1NGQL 2P5EB 3VWKA 5JHLL 3PGDB 5ABDE 2ICWI 2P47B 2DWEA 4BSWB 1WK0A 2Y5TB 4Q0XL 1XIWB 1EO7A 4HC1A 4JZJA 3Q6FA 3ZYJA 4GG6B 3H3PL 5E8PB 4GFTB 4LCWA 4ZPTA 1OF2B 3PP4H 2PW2B 3B9KD 4Y5YC 4D0DA 1ORQB 3IDIB 1I1AB 1OAXL 2YZ8A 1NFDA 3KR3L 3MOBH 5J3HD 3REVB 1JRHL 2YD4A 3IJSB 5DMKA 1S7RA 4HS6B 5DRWA 2DLHA 4I48B 1KN2H 3HE7D 4HIEB 2ED9A 2CDGB 1NCUA 1AO7A 4U1IB 1EBPA 5F97E 5J57B 4MJ5B 3FN0L 1ZTXH 5GRVL 5T1KD 4NO2A 5ERWA 1D5MA 3HUJA 5F9WB 3VJ6B 2VN4A 4H0HB 3IFPA 2VZUA 1MI5E 3GMQB 3LIZL 4JQXA 4OZGB 3G04B 4PLJC 1KIQA 3TBTB 1ROWA 1HSBA 3DIFB 4X9HA 1OAQH 3HKFA 1Q1JH 4GRMA 4NHUB 3WBDA 1QQDB 1U8JB 3MRBB 1P7HL 1BJ1H 1RJLB 3S3JA 4R26H 4WI8A 2VH5H 1CR9H 2YPLB 3TJEL 3HC3L 5GGSY 3TCXA 1U8LB 5H94B 4NZJA 1QKZH 1ZEAH 5EH1A 3R1GH 3NIDF 3PHQA 1J8HD 4JN1H 3QZWA 4KC3B 5C0BB 4Y5YB 4WEBH 1T7XA 1CBVL 4JRYD 3OZ9H 5BRZE 5KVDH 4G3YL 4WU7A 3JTTA 3WHXB 1BOGA 1K8IA 2EYTA 1KTDA 1LP9B 3C60A 5IFJB 1JPST 2R23A 3S35X 3JV0A 4EBQH 1WWWX 2ESVB 3CDCA 4UQ2B 1ZHLB 1BZ9B 3OKKA 2E6PA 5BS0E 4G7YH 4MDIA 2NY2D 4URTB 3IAQA 5EPMB 2AV1A 1Q9KB 3W82A 2AJXH 4OQTA 3V6FB 2X89D 4R4BA 3OHXA 4A6YL 3LHPL 3P73B 2QQNL 4YHLH 1RIUH 1Z5LB 3IDJA 3HR5A 2EEBA 3MLUL 1PYWA 4GRLA 4LSQH 2Z31D 2YPVH 1NGYB 1GOFA 2Y72A 3HI6L 4QHKJ 3KPNA 2P7TB 3UTZB 2WQRA 5IJVA 3A67L 1DQMH 2X4TA 3I9GL 4MQTB 4JZOA 4X9BA 1AGDA 1OWWA 2Q7YB 3JWOC 4PLKC 1EEZA 2H26A 2VZOA 43C9A 1AHWA 4WHTA 1J1PH 4JRXA 4ELMF 3SQOL 1NLDL 3P9MB 3MX0A 1D5IL 3H9SA 1NEZG 2EDDA 4M48H 2XPGA 5E95B 3FFCA 4H5SA 1ZLSL 1JL8A 1IGMH 3PGCB 4LAQL 1B90A 5E8OB 2CKNA 1JZ7A 3LN9A 5F9JB 1N3NB 4NRXA 4OCNC 4G6FB 2XFXA 3B2VH 5IFHL 5E08H 2HFFB 1JK8B 2JCCF 2DM3A 3TPKA 2X5PA 1W72A 5IIEA 1MRFH 4J3SA 2IPKA 1PG7L 1JTTA 3QEUA 5IG7A 5KVEH 4F37F 4WJ5A 1ZLUH 3UC0H 5CILH 2HKFH 4KKBC 1CDUA 3O6LH 1X3DA 1TPXC 3S96A 4XP9H 3UYRH 5K59E 1TNNA 4FQ2L 3EYSL 1CL7L 1OAUH 1YN6A 2MWCA 1YMHA 1HH6B 1LD9A 3WS6A 5DRZB 2JB5H 1A47A 2IPUK 4HUKB 5EZLB 3RWFA 4OM0L 2AK4E 2JK5A 3W0WE 2UV3A 5DEFA 2NQCA 3GM8A 1CFSB 1FL6A 1JF1A 2GJZA 1KELH 1F97A 3TNNB 2ICES 1BEYL 1DJSA 5KW9H 4X8JA 1NDMB 4PJIA 5DEZA 3LB6D 1AGCA 1Q94A 4QYOB 1FV1A 4BFEA 1LO5A 2LV4A 5IT2H 4RISH 1UGNA 3KYMA 4GW5A 1A6VL 4ISVB 5KSVB 3I2CL 4LAJH 1TZHA 2DKSA 1ZMYA 3P11L 1V5JA 4ZSOA 4Z7WF 5FFLA 2HJKA 2CUHA 2AABH 2BNUA 3Q5YA 5BJTA 5IQ9B 5IQ7H 5FYKL 3V4PH 1L9MA 2P24A 4WFFD 1OP3H 1NJ9B 1PG7W 4UOJA 4AY0A 2BCKA 3PJSA 2CH8A 4HJ0D 1YJDH 4XXCA 3TV3L 3U46B 2ITDB 1QSED 3CDGA 3DVGA 4RAVA 1RK0B 3R0MA 2CLVA 4PJ9D 1JGDA 4M61A 4X6CE 2VQ1B 3MNVB 1ZVYA 4L8SC 4ODSL 4IBLT 4KKNA 3ARWA 2DDQH 2IADB 3SDXE 4HG4J 5DGRA 4S2SA 3G6JB 2E7HA 4BFIB 3Q1SH 4XPHL 3CH8A 2WLZA 1S5HB 3DRQA 2BXYA 3VA2C 1J0ZA 1QLFB 2C9AA 4LLQA 3CAFA 5C09D 3MRHA 1PLGL 4GMTL 3WUWA 4I0PC 3FN3A 3V8OA 4L4VD 1J10A 3P0YH 1BFTA 4HIJB 5D93C 4ORGB 5FHAH 4M7ZC 2E9BA 3KPLA 4PJXE 2E8YA 1MH5A 1M6OA 2C5DC 2VXSL 3O6FA 1IAKA 25C8H 1EMTH 4IJ3C 3UTTD 4UIKH 3BKYH 2X4UA 3FHQA 4GG8A 3ESVF 1N5YH 3JV5A 3PHOB 5A16B 4PY7B 1OSPH 1I7TA 4X0KB 3OTTA 4N0RA 5D70L 2XQYK 4N8CL 1OGAB 3FJTA 3FKUS 4RAUB 4BZ1L 1QFUH 1YPZE 4G8FA 3ARGC 4L8SB 4C56B 3I6KA 1GHFL 2X70A 1RULL 5F3BB 1WJ3A 4HJJL 32C2B 4X5XB 5CGTA 4ZUUB 3HZVB 1A9BA 3BRFA 4HAFA 4P2OD 3GSXB 5C0RH 2JTDA 1I8MA 1NCBH 3TWCL 3WJLC 4Q7DA 5JZ7C 4TVPE 5IVOA 3IVKA 1RK1B 4DW2H 4Q9RL 1C16B 2A1WH 5D93B 4QHKI 5ALCL 1U8HB 4M7ZB 3KPMB 4WU5A 1U91B 1UCBL 3X3FH 4Z7VE 3DUUB 4KJPD 4OTXL 4Y16A 1HHKA 4P9HH 3HMXA 3RIAF 1T0MB 4IJ3B 5EUOB 3ARSA 1CD9B 3KXFB 4FQXD 3MODH 1DN2A 4FG6D 3FO1A 1KXQE 1U92A 5J6HA 2V7HB 3O4LE 3OAYK 4UDUB 3VFUA 4OUUA 1OY3B 4G8EB 3CFBB 4GH7B 4PJEE 1QLEH 2CLZB 2GJ6A 1JBJA 1FNSL 2CKBH 3ARGB 3LV3B 3QCTL 4R7NB 5IW1A 1NAMH 4FQHB 1QBBA 4K8RH 2B0SH 1T1XA 3RPIA 2I5YL 1D5XA 1RVFL 2N56A 1EIBA 5HYEA 2GQHA 5D7SL 4FXKA 3MLWH 5HVHC 3PWLB 2DAVA 3WLBA 5JIHA 1TETH 2AVGA 2VIRB 35C8H 1WISA 1MVUA 1JIBA 2LE9A 4U6HA 4F2MA 2ZSVB 4AT6B 3BD5A 5CP3A 2I9TA 3OKOB 4CN6A 2XQBL 5C0FA 2FSEA 4CVXB 1P2CB 3MUY1 3RVTD 5JHDE 4KJQD 3BP5B 4HCRL 5J1SC 1ORSA 3EO1B 4N5EC 2QQLL 4N9OB 4V1DE 4DAGH 4JHBA 2R2EB 2ZOLB 1RZIB 4LDOB 4A6YB 4GUPA 3TNMA 3D3VB 1G9EA 1S9VA 3PIQA 1UT9A 4QRRE 3WIHA 3IGAB 4PP1C 4X7EC 1RUAH 1JPTL 3QB7C 2AK1H 5D2LF 3TBYB 3ARBA 5E2WH 1XT5A 3DRTA 3HAEB 4FTVA 5D7JC 4ELKB 4Q6IA 1MWAH 2ICEA 1FAIL 4OF0A 3VWKC 1QSFD 3C5ZC 1E6JH 3EBAA 1KJ2A 4CW1B 2C7UA 2P8MB 3FB8A 3SJVD 5HHMD 5DJAA 3VXRB 2UWEB 3I85A 1T5XA 2PCPA 2IQAA 1J0IA 1J12A 1UZ8B 4C83A 4OD2B 3RWCA 2JIXD 4PJ5B 1RUQL 1YEDB 2IAMA 3S36X 1ZA3A 4RFOL 4UV4L 5D6CA 3GMMB 4QHMB 4PJHE 1EGJH 2GY7B 1RZKH 4F80A 3DOSA 5SX5K 1WCQA 4WO4A 3H42H 5INCA 4ZG1A 1ITBB 5IESL 5IBTL 4RFEB 1QR1A 2G60L 1A6ZA 2I24N 4PJFE 4LNRA 3UZEA 5EU6D 4KVNL 4R7DA 4GT7A 4EUPB 1BOYA 4Z0XB 4KI5D 4RWYH 2O26U 3Q6GL 3VFRA 5D7JB 1IZJA 3BWUC 5DA0B 1G6VK 3INUL 3VWKB 1T2QH 4RMWA 1GJIA 3C5ZB 2ICCA 2E9WA 3LPWA 5CJXA 1FGNH 1X4XA 1S7XB 3BMVA 3JWNC 4GAYA 4HUXA 1A4KA 4JFFA 4OAWA 5E99H 5L7XL 3BO8A 3RZCC 3CMGA 4XP4L 1NBZB 4DKFH 1Y18B 2HH0H 4K23L 4WGVB 2BVTA 2I9LA 2Z35A 3GI9H 1EERB 4D0DB 1NFDB 4G8GD 4DJMA 1B0GA 5CMAA 5L8JB 2QLVB 1S7RB 2M2DA 5C2UB 5JUEL 4K3GA 5F9AC 4MNGB 4P4KC 4NPYB 5DSCA 3WS3A 3H7BA 4NO2B 5ERWB 3TH2T 5IR1B 1D5MB 3HUJB 2H9GB 3FO9B 3P4OB 1KIQB 4GMSL 4R90L 1MLBA 1KCUL 5HGAB 5MENB 1EHAA 4DUVA 3CX2A 5M95B 1IQDB 1HSBB 1U8NA 3QCUL 1N4XL 3TZVC 4P2RA 4O2EB 4GRLC 1BPVA 1PX4A 4RRPG 3NOIA 1MY7A 1Q9OB 1J8KA 2PN5A 4JPKL 2ZG2A 5I1JH 4YUEH 5HD8D 3KPSD 2APXA 4NM8H 3C09C 2X4OB 3QNXA 2HKHL 4XPTL 3QZWB 1G7JB 1G7HA 1U9KA 3VD9A 1MREL 1KACB 4WU7B 3JTTB 3DSFH 5EIQA 1BOGB 1K8IB 4MVBC 4NUGL 3UTSA 1AGFA 2WIIA 3QBTB 4KMTH 1UQSB 2R23B 4X6DB 5HVGB 2VAAA 4PJ8A 2CK2A 1BFSA 2YRZA 5D7LA 5JR1L 1OWRM 1EPFA 4M3KB 5B39A 3KHOA 3VI4E 2N4IA 3MV8E 3MLXL 3M8OL 4NGHL 4U1SB 4UMGA 2VMFA 1ETZB 4YK4C 1RU9L 4R4BB 1NMAL 1WIUA 2XN9E 3FT4A 1NCNA 1KCVL 3IDJB 4I3GA 3HR5B 3SGEI 3T8XA 1A6UL 3TZVB 5KSBF 1IGIL 3LCYA 3MA9H 1E27A 3MRRB 4GRLB 3ARZA 5I1IL 5I18H 1RUKL 5F70A 3L3IA 3L7EB 4R4FH 3KPNB 1L4IA 1SYSA 4UILH 3SKOA 2B1AL 1T6VN 3DXAB 3GSNH 2JJSA 3BISA 3C09B 2X4TB 4OSUL 4P48A 4JZOB 4NBXB 1HNFA 3EO0B 2XZQH 3BD4A 5F1NA 4HF5H 2H26B 2XT1B 4JRXB 5HHXL 4RAHA 4HBCL 3RUGF 2ZNXA 2R1XB 5IEHA 5IKCA 3H9SB 5I9QB 3IDMA 5B38G 2X1WL 4QRSA 3VGAC 2XPGB 5SWSD 1F45A 5LGKA 3FFCB 3ARPA 2VDOL 4HGWA 4OCXH 4X6FA 4WFED 4U6YB 4JB9H 2BSRB 4XBEH 2XNAB 3ECBA 4NRXB 1ZV5A 3BDXA 3U0TA 3CFCH 1RUPL 4QXTB 2XFXB 4QF1A 5KOVC 4YK4B 2W59A 3TLRA 1JUFA 3K4DA 2ZUWA 3FQNB 4M43H 3KPQB 2OQJA 4O02H 4K3EL 4ZO8A 1JGEB 1QACA 2IPKB 5LXGH 1IC5H 4PY8J 3ZSTA 2NPLX 3ULVE 2APBA 4WWID 4P3WA 1CF8H 4AG4H 3U0PA 2YUXA 3F8UB 1FFOA 5INDA 3D18B 4YNYA 1B2WH 2NY1D 5IVZA 4APQA 4XC3L 3QEQB 4XPAH 1LD9B 2BVUA 4FFZH 1EFQA 4OZFH 3RWFB 3BSZH 1A3RH 5EOCL 1ZHKA 2JK5B 4HIIA 3EGSB 4XB7A 5HBBA 5MEQA 1OCWH 5GS1C 2P5WE 3ZKMD 1JF1B 2GJZB 3MLYH 5FUZL 3BZEA 4X8JB 1AGCB 3B2UD 1FV1B 3PQYE 2C4FU 2NMSA 5F7HA 2VDRH 2YUVA 2BHUA 1Z9OA 3B43A 3KYMB 4GW5B 4I1NB 1KUMA 5DK3A 1NUNB 2GTZB 1HI6A 5GS0L 1NL0H 2HJKB 2Y25A 3X13A 5BJTB 1WFNA 1ZT1A 1A7RH 3SY0A 3O6FC 4CMHC 2HG5B 1A64A 4CJ0A 2A6IA 4RZCB 1JYXA 1A3QA 2EC9U 2J88H 5CCKH 3PHSA 1CQYA 1GGBL 5DRNA 2BCKB 3HI1B 1MJ7L 4UBDC 4WWKD 3CDGB 2OZ4A 2CLVB 4ZNEA 4LVOC 1ZHBA 3O3AA 5D5MA 4KKAD 2NZ9D 2G9HA 1BGXH 4NQDD 4UT6H 4JZNB 4HZLB 1BFVH 2WBJD 4S2SB 4NUJA 1LO3L 1J5OH 5HI4C 5C0AA 5JA8B 3SJVE 3DRQB 5GS1B 1ND0B 3OAZK 5EOQH 5I1CH 3EZ8A 3MRHB 2NX5D 3DVFA 1TVBA 2MHAB 4YC2C 3ZE0F 3BIAX 5ANMA 3H0TA 5FCUL 2BVQA 1CICC 3CPLB 4WDIA 3SKUD 3LQAH 1R3KB 1OOAA 5TF0A 3KPLB 1P69B 2ZP0T 4MMXC 4JFDA 1C8PA 4WGWB 1Y0LA 2BZDA 4HG4K 4P23D 4DVBA 3K2UL 3EDJA 4CVWA 5GGSB 2NY7H 2X6MA 1M6OB 3O6FB 1IAKB 5DWUL 2ED8A 4CMHB 5HHNA 5JXEC 3REWB 3AS2A 3C2AH 1I9IL 1MCOL 4GG8B 3KPTA 4OJFH 1CXFA 1IGYA 3JVGA 1MCWW 1L7IL 3BW9A 3VFWB 2FX7L 2MFNA 4WENB 3BT2L 2ITCA 5DA4A 4Z0BH 4XWOD 1HE7A 3D39A 3UPCA 1YEIL 4G8FB 1Q72L 5I1GH 3I6KB 4PGCA 1NGPH 4XC1H 2PXYC 3QIUC 3P9LB 4XCFL 4X99A 3SPVB 1TCRA 3DI3B 3OR6A 1A9BB 3IKCA 1MAKA 4WEMB 3MV9A 5AYUL 1I8MB 4Z7QE 3O3UN 3MCG1 4O5LL 4YC2B 3D0LA 4LCIH 4PRIB 1CICB 2HWZH 1V3KA 1HOCA 3I02A 3N85H 5BV7L 3S4SA 1RZ8B 3L3JA 4UTAH 1XIWD 3EDDA 4B7IA 5A2KH 3R8BB 1A7NH 1NBQA 1DDHA 2O5YH 4RX4A 5CEYA 2CUMA 1ODAA 1MRDL 1WCBA 4KGJA 1EHXA 4EIZC 1AIFA 3FCTA 3L3GA 4RA0C 1U92B 2EYRA 1I1AD 5D7IB 3AM8C 4P5KB 1CTNA 4OUUB 1NGZA 5DDHA 1HHIA 4LLYA 3MRJA 3RI5K 2Z93A 2R9HC 2D7MA 2I27N 2W65A 2XWBA 1J18A 3QXAA 4M93B 5B3NA 5JOFA 4FZ8H 3BIKA 1AE6H 3AFLA 4OV5A 4PJBE 4U33A 1U93A 2PXYB 2YC1B 2A2QT 2IANE 2R0WH 3QIUB 3RHWK 4DOHE 5EDXA 4KI5F 5E2TH 3BP4B 3O6KL 5C0CA 2VAJA 4XAKD 4HWEH 5GRZA 1FNAA 1X4ZA 5IMLB 5GJTL 3WLBB 1MCEA 3MV7A 1HINL 5C9JB 3GRWA 3F7YA 4GKSB 2HN7B 1MVUB 3QI9D 5DR5H 4F2MB 2VXQH 5K9JH 4NQUA 2NY5L 3ARFC 2YPLD 2OMNA 2F15A 2FECL 5LGHH 2I9TB 5E6IA 4KROC 3KLSA 1DUZA 1H3VA 3O2DA 4M6AA 5C0FB 3DYPA 5JQ6L 5MHSE 1S7QA 3VGFA 3T77A 5CZVL 1JGVL 3WEXB 5C0BD 4LMQI 1HSAB 4M1CC 3DNKA 3EYQC 4HH9A 1ZGLP 4HIXH 3PIQB 4NRYA 4LVNC 1NSNH 1U3JA 2R0KL 3UZVB 4XMPH 3WV0A 1IM3B 3G5YB 3PV6A 3V52L 5EBLA 1BZ7B 1JMXA 3V6ZA 4YHZH 2VWEE 1DQDH 3RVXD 1XMWA 2WAHA 4PJGF 4L4TD 4LVHC 1BWWA 3DMMA 4AENB 3BH8A 2MMXA 1W0WA 3FB8B 4Y1AA 3MXWL 3SDYL 2PCPB 2IQAB 2R0ZH 4QRPE 5JDSB 2GK2A 4QHUA 5HYSG 3ARFB 4FFWD 4NN7C 3RWCB 1R5VA 1QFOA 2VLRE 4AJ0A 1T2JA 1XZ0A 2BY0A 2O61A 1FO0H 2OTPA 1F58L 1PQZB 5IB2A 3BXNA 2MQCA 5GS0C 5INCB 1UYWH 3GHEH 4HX1A 3U9UB 1PEZA 3VXUB 1N5AA 4XWGH 3F12B 4LVNB 1LEIA 4KDTA 1QR1B 1ES0A 4LNRB 4M5YL 3UO1H 5ESQA 3CU7A 4R7DB 3B3IA 3MRFB 4FQIH 3HE6A 3SBWA 4OLVH 1ZGLA 2OK0H 4FXLA 4M8VA 1QSVA 1NEZA 5F44A 3MROA 1P1ZB 1CFVH 3PP4L 5TJWK 1IGTB 4LVHB 5EZJB 5IMKB 4HUXB 5D1QD 4G8IA 1UA6L 4JFFB 4OAWB 1XGTA 1T2XA 1HILA 3BO8B 1MHCA 4Y4KD 2RBLA 2EICA 5L6YH 1D9KC 1H15B 2I9LB 2Z35B 4FQPA 4JM2D 2IC2A 2OYPA 3D85B 1ZTXL 5J1AB 4ODTH 5J4MA 2F53B 4ONFH 4U0QB 1KNOA 3ARXA 1YDPB 5EU3B 1U6AH 3CVIH 2WUCH 2UZXB 3LH2H 1FL5B 3A6CH 3RKDD 1QFWL 5DD0L 1K85A 1OVZA 3V5HB 1DQLH 1Q1JL 3OAYH 4E9LA 3I75A 1CDYA 2RR3A 4R26L 2VH5L 1AXSA 4GRWF 4G80B 3GKZA 3PF2A 2OR9H 1U8NB 3CLFH 4FQQB 1DFBH 1QKZL 1ZEAL 4TTDD 3R1GL 4JFEA 5SX4I 4P2RB 1KLGB 4JN1L 2Q86A 1N7MH 4C57C 5A3ID 1HHJA 1X5KA 2QQKL 4OZHE 2HVJB 1I8KB 2RIKA 3QNXB 3OKEA 4EBQL 1G7HB 2H41A 5HGBB 1KB5H 5TE4H 5JW4Q 1NH6A 1SJEB 3GRWL 4XNUH 1ED3B 3F7QA 5AUMA 5HDBE 3D5OF 1KYOK 3UTSB 5C8JB 1F8TH 4N90D 5BV7C 2YD3A 4X7TA 4PJ8B 2AJXL 4MCZA 5CEZD 5HHPA 4Z76A 5DFWH 5IWLC 3O2DL 1LGVA 4YHLL 1RIUL 4NWUL 5B39B 1G0YR 2YRPA 1OTTC 1T66C 1EAJA 2BJML 5TE7H 3TPUB 3SE4A 3WDJA 2JKXA 5F89A 3DROB 5DJZB 4LSQL 3VXMA 2R2BA 4GW4A 3U9PH 3CFIC 2D4DA 3KPRA 3FT4B 2DN7A 5C0EA 4LLMA 1DQML 5IVNA 3T8XB 5BXFA 4JM4H 4N1CA 1BQSA 3IFNH 4I2XE 5I8EB 2ZUTA 2CRMA 5L2JA 3F6LA 4XP1H 1J1PL 3EYVB 3L3IB 3T1WA 1A02N 3GSQA 3V0WH 4WI9A 1M7DB 1KIRB 5F1NB 4KUCD 5HVWA 4I3RH 4M48L 4EDXB 4MD0A 2W0FA 2A83A 1TJGH 4ZO6A 2MQ3A 1IGML 2IFGA 1X5AA 3H3KA 5T1DH 1K4DB 1HZHL 4C56D 3LEYH 4XNXH 5BV7B 3E1F1 4ZUTB 3IDMB 2NY5C 2P49B 3B2VL 4QRSB 4XX1E 3K74B 4X6FB 5E08L 3P0GB 2IEPA 3ECBB 1FLTX 3UC0L 2M26A 2HKFL 2V5RA 1QRKA 5SWZA 1X4YA 3QWRA 4XP9L 3UYRL 1FNGA 4MA8H 1I75A 5I66A 1BM3L 5I8CA 1XF4A 1OAUL 4ZAKD 2QR0A 1K8DB 4MZ2A 3D2UD 4UOW1 3BI9X 3HZYB 2HTLD 1CDIA 3GMOA 5GRVK 1JZ2A 3FT3A 2W0KA 3MUJA 1FFOB 1WZKA 5ADPH 5INDB 2ZOKA 4I9WD 1SVCP 4NO5B 5IVZB 4APQB 2YA1A 4WIQA 1M7IB 2FD6H 2PYEE 1KELL 1CDHA 5KW9L 2PO6C 2E9IA 1GZPB 4NC0B 3QDAA 3VXNA 3ARGD 5IT2L 2DJUA 3QDGE 3QR2A 4RISL 5MEQB 1A7BA 3OMZA 5EFIB 2JCCE 3CXDH 3WLWC 3RDTA 2KZ1B 2ED7A 3BZEB 1MI5A 5IQ7L 4JQVA 3V4PL 3VFVB 4LARH 2QADD 4M62H 1T0PB 2DI7A 3LKNA 5BQ7A 3S36H 2HFEA 4D3CH 5FYJU 4YDKH 5JZ7D 3B9DA 4LKXA 3PXHA 2JJUA 3ORJA 3UAJC 2Z0BA 4PB9H 1RJYA 4GG6F 3MA7A 3P4LA 2A6IB 4OZIB 5DJXB 4GKZA 1NGXA 5DRNB 3WO3B 2XXMB 5FGBC 2DDQL 3ARDC 3JVGC 5IK3A 2DMBA 2W0LA 5BVJA 3TIEB 5BW7A 2G2RA 3RI5F 1ZHBB 3Q1SL 4NRZB 5BRZA 5BVPH 2G9HB 1HIMH 2G5RA 5FYLE 3RGVD 4JE4B 4WVRA 2PO6B 4NUJB 5T1LD 2MSPA 5J9PA 1GAFH 3P0YL 3RHWF 4NJAH 5FHAL 3VFTA 1U3HD 3C6LC 4FMKA 3FTGA 5BS0A 1SJHA 5GRXG 2BNRD 4JFYB 1EGJA 4OZGF 5AAMA 1OAZH 2W92A 4JKMA 2FZ3B 2CMRH 2V2TA 4RIRB 25C8L 4S1RH 4LPUA 3PWPE 2BVQB 4X4XA 5IHZA 3BKYL 3QXWA 1N5YL 4HW6A 2NZIA 4XNMA 1OL0A 4PIRF 1H0DB 3EOTL 4LRIC 4ZXBD 1DQQB 4LGPB 4BQ6A 4RGND 1IGYB 3ARDB 4M7KH 4NQVB 3W9EB 3BW9B 5ALBL 5J89A 5JOPE 3EO9H 3OSKA 1NFIB 2ITCB 1VFMA 3X3GH 2J4WH 1LP9F 1B4JH 4HS3A 4PGCB 4PJDB 3VRLF 4Y4FA 5C0RL 3SDAA 1NCBL 3IDUA 4E0RB 5FO8A 3VGEA 4X99B 4DW2L 3E6FA 2A1WL 2BOCA 2D03H 3TA3C 3C6LB 1Z2KA 1VA9A 1FORL 5B8CA 3X3FL 3O3BB 2J6EA 3IYLW 5FGCE 4P9HL 4F58H 3MRIA 2FR4B 4PG9A 3BP7A 3VWKD 5EO9A 4FFYH 5I74C 3RKPA 1MFNA 5DEGA 3S4SB 3L3JB 2OM5A 2RB8A 5AZEH 1JWUB 4R8WH 1NMCB 1O7VA 2Z8VC 1KV3A 4LCWD 2VDPL 3KHQA 2FATH 3JV6A 1WCBB 2HT4C 1ERNA 3ET9F 1AIFB 4WI5A 2ORBH 4XTRC 5DHVA 4GRWH 2CKBL 4HKXA 2BNQB 3AY4A 3QG6B 2OI9C 3QIWA 5CD5C 5TDNA 3S34H 4OB5H 1NAML 4L9LA 3QNZA 4J1UA 4K8RL 3ZT5A 1NGZB 3F58H 1UXWA 1BQLL 4PRPB 4F33A 1AXTH 3MRJB 2Z93B 1I85A 1AD0B 1PKOA 4Z9KB 3NVQA 4I0CC 3MLWL 2XWBB 4LPXA 5JOFB 1AO7D 3O9WA 5EU7C 3BIKB 2BFVH 2AK4A 3W0WA 4ZD3H 4GAJH 5C08E 3RU8H 2XRAH 4WHYG 1BIHA 1TETL 3S3SA 35C8L 4DN3H 4HUMB 4YBQD 3TA3B 1RMFH 5C0CB 3RY6C 5KG9A 3TIDA 2NY6D 3QUZA 2R1WA 1AGEA 5GZNC 1CT8A 3O45A 1NGWB 4KHXH 3OKNB 5CSZB 3L9RA 2WBKA 3MGOB 3MV7B 1JPFA 1QPPA 3EOYG 4Z5RA 1I4FA 3VXSB 5I0DA 1HHGB 2R4RH 5GZOC 3W11D 5I74B 2F5AH 3MMEA 3MLPA 4DAGL 4YEEA 1LEKA 1UJ3A 2FEEI 3EJZC 2VUOA 2CXKA 1DUZB 2VISA 1S7QB 3E6HA 5EIIB 3HPJB 1MCIA 3SCMA 1BIIB 3BUTA 4EN3C 4RRPA 4HH9B 4OM1H 4X6CA 2AK1L 3KWWB 4Y5VC 3N1GC 4GLRH 5IM7B 5E2WL 1E6OH 2C3XA 3C60D 1J0KA 3SDXA 4NRYB 1I9JH 3GDBA 1MWAL 3RWJB 15C8H 3GIVA 1EFXB 1E6JL 3PV6B 2QSQA 3SO3C 3IXTB 2AERT 1RFDH 3MSPA 3P4MA 1ZVSA 1UC6A 4WI6A 3HZMA 3E8UH 5HTSA 4WFGD 4H26A 3OXRA 4EQ3A 3T2OA 1ULVA 4P57A 3UXFA 4WI7A 2K7PA 1S9KC 5E5UB 1SY6A 1XGQB 4PJXA 3TT3L 1FC1A 2DQEH 4QHUB 2AEQH 4GRLD 1EGJL 1RZKL 4NO3B 4G9FB 3BQUC 1DVFA 4KK6C 3H42L 3RBGA 2HLAA 4MJIB 1P5VA 4Z7UE 1EHNA 1YUHA 2O61B 2AKRA 4G43A 1IKNC 2P8LA 3JZ7A 4XX1G 3HG1E 3TBSA 4EN3B 3UJIH 3VD3A 1F4YL 4JRXD 1YPZA 4HX1B 3P77A 1A6WH 4Y5VB 1WIOA 3RVWD 3G6JF 1N5AB 5DJYB 4LEOA 4RWYL 3MUZ1 4MQ7A 3MFFA 1LEIB 1S78C 3H9SD 3V0VB 3VFOB 2Y36L 4PRAA 2PW1B 3AXLB 4ZUSA 1T2QL 1XR9B 5ESQB 3FFCD 4WNQA 4BM7A 4XCNB 1FGNL 4J8RB 2KL6A 3SO3B 5FOBA 5E99L 4AQOA 4L8DA 3QRGL 4S1SL 1KG0B 1KCKA 1UVQA 1K2DB 1NEZB 4DKFL 2WW8A 2HH0L 4J6RH 1CDBA 4JFOA 2X1QA 2APVA 2EDXA 1UFUA 1XGTB 1XF2A 4KY1H 2ATPB 4TYUA 3WKNA 4MJ4A 2P42B 4Z7VA 3J7HA 1NKRA 1EA9C 4W68A 4LU5H 2YOCA 1FYTE 1O7SA 4H1LG 2J6EL 3BQUB 4ZDHB 4KUCF 3O4LA 1QVOA 1KNOB 1XR8A 3FRUB 3X14A 5HYQB 1MQ8A 4OGYH 1EEUA 4L8CA 4PJEA 4ZS7L 1KEGH 5IHBA 1R0AH 2QSTA 3IDNB 2HRLA 1QEWA 4ZTPH 5C9KA 3QIBC 5FF6A 2W9LA 2BRRH 1JNJA 4JN2A 3WFHB 1G9NL 1P5UA 1LE9A 3I75B 4LMQE 1N59A 4P4RA 4PRHB 3ZHKA 1CLCA 4PJCB 2DKMA 4RSVA 3MACH 3IJYA 5I1JL 5GGRA 3JV4A 4YUEL 4MAUH 5I1LB 4NM8L 3QXDB 1TJIH 4JFEB 3WL9B 4MLSA 4Y0GA 1VDGA 2Q86B 5H8DA 1JZ4A 4DFIA 4U3XA 1HHJB 5EUOF 4HIHA 4OLZH 4M6MH 2BY3A 4F7MB 4H1LH 3U82B 4KMTL 2Z8WC 2YD7A 3HFML 5JHDA 3GGWA 1Q9WB 4LCYA 2BNRE 3SGKC 3T3MF 5JPMB 4P9HC 5IROA 4QOKB 2LAGB 1NBVH 1I8LA 3JTSA 5AUMB 4V1DA 1FIGH 1HYRC 1NCTA 5C07B 4FQJL 2FWOA 4QRRA 4MCZB 1J86A 4NNYA 5EBGA 2D0HA 3TN0A 5DFTA 2X2YA 2AXHA 2Q20A 4GXUM 3MA9L 3N9GH 5ESAA 5FM5M 2BOBB 4K8RC 5I18L 2PUQT 4R4FL 1FFPA 3IXAB 1TVHB 4UILL 4OI9A 4LLMB 3GSNL 1T1WB 4HGMA 4P9MH 4ETQA 4BH7B 4CUCA 2BSTA 1MOEA 2XZQL 1PW3A 2RQ8A 5IOPA 1X6LA 1IVLA 5ACZB 4JDZA 3SGEH 3EFFB 3O6FD 4PLOB 5EWIH 3FAXA 4LPYA 3GMRA 3VG0H 4YLQT 3ULSA 4LHUG 1ZE3C 2NR6C 1FVEA 4DGVH 3HC0A 1E28A 1JE6A 4UBDD 4M7LH 2UY6A 4BH8A 2W0FB 2A83B 5CP7A 3BEWA 1XGUB 2H2SC 4PJHA 4OCXL 4JFPB 2XA8H 4NYLB 3UDWA 4JB9L 4B7LA 4XBEL 4NCC1 4P2YA 5C0JB 1LNUA 5B3JF 3C5SA 2EE6A 1T7YA 5D8JL 5FYJE 4PJFA 4M43L 1M1SA 5KSBE 3ALXA 1OP5H 1AQDA 3TFKD 4YO0A 1E4JA 3VRIA 2L7JA 2QV2A 3SDDC 5LXGL 1DBJH 1IC5L 2GIYA 4D2NA 1CK0H 2FJGB 1OSZA 1NAMB 3OXSB 3VH8G 2G75A 3VD5A 1FNGB 2ZG1A 1YEEH 3MLZH 4XVTH 1E4KC 3BUYA 3P2TA 5I8CB 3UBXB 3WFDH 1B2WL 1GGUA 4LBEA 4XPAL 4Z95H 4Y16D 3N1PC 4FFZL 4NKQB 4DZ8B 1NDGA 4JAMA 2HJFB 1YC7A 1F02I 4MXQC 3FO0L 3FL7A 4EEEA 3LN5B 4OLYH 4TVPL 1DQJA 4U49A 1CN4A 1A1MA 4C54A 3FHAA 3MLYL 3DSNA 3BDYL 3CFJA 5KSAC 1MJ8H 3CUPB 2GJ6D 4Y19E 5C0ND 2QJDA 4U6XB 2ID5A 2VDRL 2JB6A 4L3CB 4B41A 4N0UE 1OTSD 3CXHK 1RZKC 3BEVA 3PWUB 4JRWA 1A7RL 4NNXA 5BCAA 3TP4A 4LF3B 3LKNB 5CCKL 3ESUF 3SDDB 1UB5A 1CCZA 1UG9A 4JGJA 4OD1H 1IC7L 4LKXB 4F7PA 3AREC 4KK9D 5A1AA 1X7QB 5EN2A 3VE0A 4LSPH 3QQ4A 4GKZB 2Q6WA 1MWAB 3WN5C 3RJQB 4GW1A 1K5NA 5C0GB 1QP1A 3H9HA 1BGXL 4L5FL 4UT6L 1AKJA 1BFVL 4AIXA 5IK3B 1NFDF 3ZYZA 1EXUB 4D0BB 5I8OL 5BVJB 2G2RB 5BRZB 4F9LA 2OP4H 2HAZA 3F5WB 5I1CL 3RZWA 5KSAB 1WITA 3DUHA 5J9PB 3LKRA 3HUJF 4K7PX 1I7RA 5L2KE 3LQAL 3FTGB 1D3CA 5CHNA 1YNKH 2CD0A 3BZ4B 3NA9L 1NAKL 4H8WH 3MV8A 1A2YB 3ARBD 2GCYA 2NY7L 3O41A 1P4IL 1D6VL 4AEHL 4FTVD 4KK8C 4NQEE 5D1XA 3C2AL 2XN9A 5CEZH 4YHOL 2NCMA 3RVVC 2NNAA 4ODVH 3RX5A 3PL6A 4NWTH 3AREB 1FNEA 4UUJB 4IS6B 2R69H 4PV9A 2BX5A 2EIZB 1XGRB 3WN5B 5I1GL 1G9NC 2OL3H 3LRSA 1JNHA 2QSCH 1KB9J 5AZ2L 2IAMD 1QA9B 3EHBC 1ZT4B 1TVDA 2ICWA 5HYSA 1MAMH 3OKMB 4HS3B 4X6DF 4Y4FB 4WO4D 1PKQB 3HPLA 5KAQG 5FO8B 4LCIL 2H8PB 3NIGF 3PXJA 2VDLL 2L4OA 3N85L 1B0RB 1T0NB 2ZNWA 1IL1B 3C5JB 1ZKAA 1Q8MA 2O5YL 2CXGA 4YDJA 4D9QE 1RZFL 3OB0H 1NGQH 2GTWA 1CIDA 3MRGA 3ZHLA 5IVXB 2IQ9H 3NFPA 3VFMB 4F7CA 4OGXH 3CFKA 5GHWH 4JFFD 2C1PB 1UJ3C 1P7KA 2W91A 4FZEH 3JV6B 3SKMA 5DHVB 2BSED 2FB4H 4KV5F 4HKXB 4FZ8L 1DL7H 1QRNE 1JRHH 3KPOA 5C71A 4UV7H 3NBNA 4J1UB 1AE6L 4KQ4L 2IALA 4GAFB 1AR1C 1UXWB 5GJSH 1I3VA 5T3XD 1YNTB 3FN0H 2APWA 4HWEL 2CJUH 2HMIC 4LCCA 1L9NA 3W0WB 3D9AL 5F3HA 2BVPA 4L3EE 2P5WA 3JWDH 4D8PA 2JF1A 2R2HA 5DI8B 1VGKA 2VXQL 3GBMH 1H8SA 4M7LT 4HWBA 5KG9B 2EDJA 5K9JL 1NQBA 3I50H 1CT8B 1C08A 3I6LD 3PQYA 4IOSD 4F9PC 9CGTA 5LGHL 3L9RB 3FONA 1WBZB 5TPWL 3QDJB 1FN4A 1JPFB 2H3NB 2ZUSA 3WSQH 1OQXA 3BVNB 1YZZA 1I4FB 5CLTA 3TYFA 2IF7A 2VLKE 5J7CC 2DF3A 4LL9A 3NFSH 4P2RD 2NY0D 3MMEB 2VQTA 4LSRH 3T2QA 1BBDL 2FO4A 4JO2L 3S5LG 4F8QA 4ODWA 1UJ3B 1WICA 2F54B 3FRPA 5DJ0B 3TESA 3W39A 4HIXL 4A2MA 4XI5C 3VCLA 3SCMB 2NY3D 1G7PB 3UPAA 3DURB 1NSNL 3MRKA 1CFNA 4XMPL 3RX8A 1CGUA 1XGYL 4EI5A 4J3UA 1IJ9A 3BHBA 3KYOA 1OW0A 3UTSD 1HXMA 4TN9A 3GSNB 4YHZL 8FABA 5JTWA 1YY8B 4PJ8D 2GSGA 4HHAA 3SJVA 5D6DA 4JDTH 5D7LD 3NCEB 2YSSA 5ICYB 2ADGA 2XTLA 2FLBT 1I7UA 2Y1VA 5IB1B 2R0ZL 3B9KC 2DQTH 3OXRB 3SGJA 2Z4QB 4UTBH 5F8RC 4XBPA 4JVPA 5J3HC 3GMLA 3S6CA 4G6KL 3FOLB 4NCDA 1QTYT 4PJXB 4BQ9A 3MQIA 5CBAA 5JORB 4U3HA 1FO0L 1FVCA 2NTFA 5CD3A 3O8XA 2A73A 3D0VA 3GHEL 4NIKB 4ZTOH 2HFTA 4PBWD 1IGJA 4F7EA 5F7NC 3NIFF 3NN8A 2AKRB 1I3GL 2PYFB 4G43B 1YECL 1A14L 2P8LB 2JJWA 3F6IA 4O58H 3LAFA 3RWHA 3TBSB 2AV7A 3UO1L 2KPNA 1SBBA 4DKEH 4YHML 4FQIL 3T4AA 4OLVL 1D5IH 4DTGH 1G84A 3VFPB 1A7PL 4LEOB 1R3JA 1EUUA 4PRAB 5ETUA 1CFVL 5F6IC 3SE8H 5B4MD 1FVDA 3BZFA 1J0JA 3GK8H 5DURD 3GSUA 4ZNCD 3L3OA 1T66D 2WWKO 1UVQB 3TM6A 5B38B 2ENSA 4PRNA 4BQCA 3B9KB 5L6YL 4OI8A 5IFHH 1R3HA 4JR9H 1QSZA 4HUNB 1GRWA 3LKPA 1PG7H 4ODTL 1CFQB 4Z7VB 1U6AL 3CVIL 4XNYL 2WUCL 3LQAC 3QDME 2VSCA 1EK3A 4V2BA 3A6CL 5HYIA 4FQ2H 5T1KB 3KJ6H 1DANU 2FBJH 2P44B 3CFEB 1XR8B 2NY2C 3X14B 4APQD 3KPPB 3L5HA 1DQLL 2D7QA 1TDQA 4HC1H 4MAYA 5HYJE 4L8CB 1CU4H 3T3PE 4NFDA 4PJEB 5I8KH 4X80H 1T4KA 4AM0B 1QEWB 1I1YA 3PGFH 4NJ9L 1CXIA 1DFBL 4PJBA 5GPRA 2IANA 2Z31C 1N59B 4P4RB 2E7CA 5J13C 2YHGA 4X98B 1JV5A 3IJYB 4KDWA 4A2LA 3FQXB 3V6OE 1HKFA 5C3LD 4WEUD 3F7RA 4JRYB 1JZ5A 2MCPL 3S9DB 5TE4L 1KB5L 1D7FA 5LBSL 1Z3GH 4HIHB 4XNUL 3Q3GB 2X1PA 3T65B 2EDBA 2AW2A 4OCWH 2ZCLL 2ZUUA 3KYKL 4U1KA 3U6RB 3K1DA 2WINA 1HNGA 4LCYB 3MRDA 3FQTB 4S11A 3JTSB 4V1DB 2NY2B 3ZKQD 5FO7B 5TE7L 3QULA 4HQQH 1I1CA 3FQWA 1JN6A 2FWOB 3ZTNH 4TVSa 3TT1H 3U9PL 3HCVA 1KPVB 2ADFL 5C0AD 4TNVK 2DQFB 5F7WC 5FA3A 3WHE1 1TTFA 1BVLB 4NQXA 4JM4L 4POUB 3HTLX 2Z31B 3IFNL 4GMTH 3ULUD 1GZQA 5J13B 5CBEA 5ESAB 1I7ZA 3O3DA 1UXSB 1FFPB 1BX2B 3L7FA 3KJ4C 4MNHB 2VITA 4G42A 4JFDD 3V0WL 5I17A 4QGYA 2BSTB 5IEKA 1P53A 4I3RL 4PTTB 5EBMA 4QRPA 4JDZB 1TJGL 2A6DA 2Y7QB 1TQBB 5T1DL 4OQTH 4OCLC 4O9HH 3ULSB 4YHPA 3LEYL 2XWTB 1FVEB 2VLRA 3HC0B 1E28B 3B8SA 2VE6B 3UJJH 1H8NA 3OV6A 3LB6C 4JO1H 5CP7B 2P1YA 4RFNB 1NANI 5E8DH 1XF5A 3D39D 1TZIB 5E6ZA 4CU7A 2VABB 1KOAA 3BFOA 1GXEA 2ADIA 3C8KA 3CSBA 3BPCB 5LAXB 4PJFB 1AGBA 3UZQA 3A0OA 4MA8L 2XTJD 1OD9A 5FHBL 5KJRL 4YO0B 4KXZI 3TWCH 3VRIB 5DC4B 3MV9D 4HJ0C 4KZDH 1RJZB 1I3RB 1FZMA 4NC1C 2G75B 4PJ9C 1MJJA 1UCBH 5F6HJ 5ADPL 3BUYB 4RNRB 3V0AC 2NW3A 2IH1A 2VLJE 2N1KA 4ZO9A 2FD6L 4RX4D 1SHMA 1U2HA 2ILLA 4N0CD 4JAMB 1I9RH 1VSCA 2GAZA 5DD6B 3H9YA 1W72H 5IB4A 4GBXA 3UYOD 4XNQA 3QCTH 4EOWL 2ZZUT 4TNWK 1FE8H 4LARL 1D5ZA 2EDEA 2EO1A 3GUTA 3S36L 3PWJA 3VRJB 4D3CL 1W2KT 2PTTA 1RVFH 4X4ZA 4YDKL 2I25N 3BEVB 4NNXB 5K9KA 5T5NF 2XWJA 2LVEA 1FZKB 4JPIB 1CLYH 2CIIA 1N8ZB 4X5WA 1UB5B 3KLDA 3RPKA 2HLFD 1QSEB 3MV7D 3CIQA 4F7PB 3ILQD 4E42B 2DYPA 4WUUE 4Y4HA 3BWAB 2Q6WB 5BVPL 4OZHA 5D71H 1HIML 1WBXA 3FQRA 3H9HB 1F3JA 5E6ID 3RTQA 1AKJB 3WUWG 3S8WA 4OD3H 1MHHB 5EOTA 4JG0H 5DJ6A 4XVSH 1GAFL 4P2OC 2AXGB 4NJAL 5A40E 5JW4M 5JA9A 5C09B 4G5ZH 4OZ4A 4CDGC 5KS9B 1T7VA 2B39A 2CMRL 2P5EE 3GI8H 3LKRB 4S1RL 1JPTH 5KSUA 2MJWA 1MUJB 2SEBA 1FO0B 2P8PA 5CHNB 4NKOA 4CNIA 1R5WA 3VFGH 3OAUH 2BHZA 1IEAA 3EOAB 2GCYB 4FQXC 3O41B 1WFUA 1AFVH 3MO1A 3MYZA 4L8BA 1KPUA 2QEJA 3O3EA 5J11C 2XN9B 1YMME 4G6JH 4JFZL 5C7XL 3DMMD 2NNAB 4KTDH 1MCWM 3UEZA 4E5XA 4I2XA 4Y1AD 1FNEB 4MDJB 1QLRA 5DS8B 3X3GL 2J4WL 3QH3B 3RY4A 4NDMA 5TH2A 3QO0A 4TSBL 1B4JL 4IEFB 1BFOA 3HNTH 2DM2A 3C87A 2D0FA 5FO9A 5CZXC 4HKZA 4PP2B 3N50A 4OZGE 4P5MA 2ICWB 4PFEA 2A6KB 4KJYA 4ZUVA 5IBTH 4UQ3A 4LCCC 1I8IB 1WBYB 1C5DB 3HPLB 4XRCB 2YD1A 2VQUA 1AP2B 5CGYD 3GEWB 4YX2H 3HE6D 1DQTA 3CX5K 3AC0A 5AZEL 4YDJB 2NXZD 3RVTC 4FQXB 3FT2A 4I4WA 4KJQC 5DMJB 3ZL4H 2GTWB 1PVHA 2ZSWA 1BMGA 1RZ7L 2ORBL 3G9VA 1A6TA 1G7LA 3CFKB 4OB5L 3MRLB 2KQMA 1LP9E 1WV7T 4K23H 1V7MH 3VRLE 3M07A 4NZDA 1OD7A 4JKLA 2ESVE 2YXMA 4OLEA 3SKMB 2WANA 1E4XI 1CI5A 3KPOB 2BFVL 4GAJL 2YMXH 3PE9A 2VJXA 2FIKA 2XRAL 1KJVB 4DN3L 2PYEA 3NACH 4AZ8A 1IFHL 3AS1A 4XP5L 5FYKU 1PBYA 1NC4A 1FZOB 1RMFL 3HMXH 3L5XH 1QNZL 2DQCH 4LCCB 4KHXL 1GPOH 3QDGA 2DRUA 5F3HB 4CBPA 1KB5B 2HVKB 1HH9A 4D8PB 5FDYA 2JCCA 3T2PA 2OJEB 4GMSH 2F5AL 3T1FA 5F6HI 2BRQA 1C08B 4L29A 3VG9C 3QCUH 1FN4B 4KKLD 4KZEH 4JFQA 3MBXH 4OLWH 4JFED 1G7MA 5C6WH 5ICZB 5GGTA 3FQUA 1FH5H 1FCCA 1MFDH 3MRNA 3W39B 1E6OL 4XPTH 1CXEA 1U36A 1S8DA 1WVZA 3VCLB 4KU1A 1CGWA 2QKIB 4ZYKB 15C8L 3JUYA 3V79C 3QXTA 3EDEA 4KI5C 1JGUH 2A6JA 4GAGH 5DQ9A 1XH3A 1RFDL 3KYOB 2EDTA 2FX8L 1EDQA 5CP3H 2HT3D 3E8UL 4DZBA 8FABB 4NOBA 5D7KD 4OV6F 3KVQA 4L9DA 3QFDA 4HHAB 1U2CA 1AD9A 3SJVB 5HHMB 3CFDA 3M8OH 2ADGB 4LPCA 1I7UB 1RU9H 4RDQF 4XT1C 2DQEL 1NMAH 2AEQL 3GJEB 4I8DA 3VXMD 1WC7A 3PWPA 3VG9B 3KPRD 3WIHH 4YFLI 2W07A 1A6UH 4W70A 4Y7MA 3PV7A 4BA8A 3MOQA 4MJ2A 4OZIF 3WFCH 5FB8A 4U2YA 1OAKL 3UJIL 3D0VB 3NH7L 3AROA 1A6WL 4OSUH 1X5GA 3CC5B 4F7EB 1KJ2H 3TYFB 4MD5A 5HHXH 1T04B 3RWHB 4LIQH 4DEPB 2EDNA 1EEYA 4L1DA 3T4AB 3I3DA 3RWEB 4M5ZL 1H5BA 4LHUA 3D1MC 2DWDA 3SKNB 4LRNH 2PTUA 4TNVF 1FSKC 4ERSH 4OLUH 1R3JB 3LKQA 5ENWB 4UB0H 4J6RL 2J8OA 4JKPH 1FVDB 3BZFB 1PZUB 4YQXH 5HD8C 5HI5D 1S3KL 1ZXQA 4KY1L 4YXKL 5D9SB 4MXWH 4HK3J 2VZVA 5D1ZA 2ZUVA 4XCYB 4HT1H 1V8HA 5SWZD 3QWRD 3W5NA 4HK0A 1YEFH 5EZOL 3GSWA 3GIZH 4IDJH 1NUGA 4OGYL 3G6JE 2VDKL 3VH8A 1KEGL 1R0AL 1FAKT 1AI1L 4ZTPL 2VO5A 2YS4A 2BRRL 5I76B 1C5BH 4PJDF 2DM7A 2VC2H 1U3ZA 4NN6C 1E4WH 2CR3A 3MRPA 2Q8AH 1IQWL 4HEPG 3MACL 3RNKA 4QCIB 1I1YB 3EIFA 1FSKB 4MAUL 5C08A 1PD6A 2DQHH 1TJIL 3LDBB 3MUGA 5CWSA 5EBWA 4HWUA 3RDTD 1MI5D 3FB7A 1CLOL 2YD2A 4L1HA 4QHNA 4OKDA 5T3XH 2WMPA 4OLZL 5MEOA 1CD8A 4M4PA 4M6ML 4NKMB 4JY4A 2MKLC 1FQ9C 1X5LA 1F3RB 1OGAE 1BAFH 1I3UA 1TENA 1GGBH 1NBVL 4EVNB 4CDHA 1FIGL 3DGGB 5JXAH 4KPHH 4PREA 2WINB 4UT7H 4LSVL 1QFWM 5GIRA 2A74A 1MRCH 2GYSA 2FNBA 4PRBB 5BRZD 4TNWF 3FQWB 1AH1A 4NN6B 4LDLB 4U1NA 4HUVB 5GGTL 1L0XA 3N9GL 4FFVD 1P7QA 1MCHA 5ID0A 2BVOB 1EZVX 2GEEA 5BS0D 4P9ML 3E3QC 5FM4A 5CZKA 2XY1A 2K3TA 1GZQB 2V6HA 3KXFE 5IJKA 1UM5H 3G08A 3O3DB 5CS7A 5EWIL 3JUZA 1H3WM 4QTHB 2ICWJ 5FYLL 3T0AA 2X4RA 7FABH 2NY1C 1KEML 4TUOB 4Q9BA 3K2UH 4DGVL 5TDOA 3T3ME 5LG1A 2H32A 5GS2D 4MXVE 2A6DB 4LCUA 1F2QA 5M7QA 4X4YB 3HLAA 3M1BB 3ZKMC 2FX7H 1XF1A 2VLRB 5SWSB 3CSPA 1IT9H 2GITA 2XYCA 3UPRA 4Z7UA 2DL9A 3B2UC 4OGZA 3DX9A 1YEIH 3V9FA 3HG1A 1FRGH 1XF5B 2DJSA 2J8UB 2EIEA 4Y4FD 4OIIH 1DLHB 1DBJL 2P45B 4OF3A 3SDAD 4M3JA 1CK0L 1G7IB 2ADIB 2IBZX 4XCFH 3TCLA 5KANI 2YD8A 5C3TA 1CXKA 1QBMH 4PG2C 1YEEL 1NPUA 3MLZL 4XVTL 1A9EA 4LDEB 4AH2A