5JNYA

Crystal structure of 10e8 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
235
structure length
235
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCSASGFDFDNAWMTWVRQPPGKGLEWVGRITGPGEGWSVDYAAPVEGRFTISRLNSINFLYLEMNNLRMEDSGLYFCARTGKYYDFWSGYPPGEEYFQDWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 10E8 Heavy Chain
publication title Developmental Pathway of the MPER-Directed HIV-1-Neutralizing Antibody 10E8.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 235
sequence length 235
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jnyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jnyA01
1MJ8H 3C6LD 4P9MH 4Z0XB 3L7FA 5AG9A 4XWGL 1G1CA 1KTDA 2OZ4H 1FNSH 2Z35A 2R1WA 3HR6A 3RNQB 2BHYA 4HLJA 4L4JA 4CADB 3OAUL 1X5ZA 3V7AE 3VD7A 4G42B 4JN2A 4YHKH 4PJ9D 5D2NE 1ZHKA 2DWEB 5F7MC 5D71L 1OB1A 4Y8DC 1T03H 1LNUA 1Q72L 2NYYD 5C9JB 4FFYL 1I7ZB 4L4TB 1IGIL 4L8BB 4PLJD 3QDJE 3BAEL 4YHOL 1B9ZA 2IQAA 4Z7WF 2NY4C 4E0RA 3CFDB 6FABH 3O3UN 1JF5A 1P2CB 5GS2D 3NVQA 5CZXD 1FGNH 2V2WA 3BIBX 4ONHA 4NQTA 5D1XA 3U36B 4P2RD 4G8GB 4KK5C 1FZKA 3REVB 3QUMA 4WWID 3S35L 4M7KL 4RGOH 2ORBL 3IDGB 1SJHB 1MQ8A 4KHXL 5I8KL 5ENWB 1T3FA 3EJZC 3NFPA 3BHBA 4NYLB 4ERSL 3OXSB 3TEUA 3W0WD 2I27N 4LHUB 3U4BL 2IAND 2QR0A 5F6IB 1OAZH 4M5YH 5TF0A 4K9EL 2WQRA 3O11A 1CFQA 3MNWB 1TPXB 2NMSA 1RIVL 3BIKA 3JBG7 4JO2H 4JPVH 4LDOB 3RY5A 3S8WA 1QSEA 5JW4R 4OLXL 4LSDA 4PP2B 3I9GH 1H8OA 3MRLB 1IT9L 5INDA 1GSMA 4KJWD 4WJ5A 4OZHB 4HWBA 5AG8A 3RWJA 3M8OH 5E6IB 1QEWB 1V3JA 4N9OB 1T0NB 3I3DA 1U36A 1XF5B 4XVTH 1UA6H 2JK5A 3PV6A 4ELMF 5B8CA 5AYQA 1Z9SA 2DQIH 3IJHB 4R2GC 4EVNB 3BIAX 4LCWD 4CMHC 3KPTA 2JB6B 3UDWC 4UU9A 4PJBF 1P5VA 5I15L 3ESVF 3MMEA 4N0RA 3MRMB 1UM6L 4APQA 4FG6C 3L3IB 4XPTH 4ETYA 3HZYB 5A2KH 3SQOL 4J3WA 1F6AB 2QADB 2OQJA 1A7QL 3VGFA 1OGAE 3TH3T 1I1AC 1ZT7B 4OCYL 4BSVB 5C0BD 1BWWA 1NDMB 2DQUL 5JR1L 1J9CT 1JPST 4LLQA 3C5JA 2QHLA 3VXRB 5C2BL 2CR3A 1U0QA 5DJAA 5F93C 4Q6YA 3DI3B 3RKPA 4MJ4A 5FO8B 1NGPL 1RZIA 1XF4A 4XX1G 3QIBA 4ZO9A 5GS0L 1FDLL 3ULSA 3DPBA 4G6KH 3SDXE 1HH6A 3BPOB 2XWBB 3GMOB 1FH5L 1T21A 2ZNWA 4TUJB 2KUTA 2ZKHL 1F90L 1WICA 5T3XH 1KSRA 4U05A 2B7DT 4HDIA 3O41B 3MLRL 3MJ9H 2X4RB 3RY6C 4HUXB 2AEQL 3SO3C 1GZPB 1A9BA 2E7HA 5D6CB 5IV2B 1REIA 3PJSB 4ZUVA 5DJ0B 4WEBH 1OAUH 5DUMH 1RJZA 3MV9A 1R3KB 3VI3E 5J57B 1JYWA 1AGDA 5TDNB 4R0LB 3N1GC 2IBBA 1BJ1H 3DXAA 4IIQC 5JPMB 2N56A 2I5YL 3L3KB 4K9EC 1TNMA 5A16B 2NR6C 5GSVA 12E8L 1DUYA 3MV7E 2OJEB 5CJXA 2YPKB 3PP3H 2D4DA 1S9XA 1L7TH 3V6OA 5JTWA 2BC4B 3H9YA 2AJYL 4HIJA 1RZJH 1PG7W 2EDEA 3CD4A 5FGCE 3L95A 3U30C 2O5XH 1TETL 1QLRA 4I0PA 4FOMA 4KI5C 5DJZB 5DRNB 5JXEA 4G7VL 1RULL 4MS8D 5IMMA 3IAGC 2BNRB 4PJAE 4EXKA 4PP1D 4X8JA 1FNEA 3AXLA 3L3OB 1S3KH 4DUXA 2UYLA 3JWOH 4F33B 5MEOA 1DLFL 3ULUL 1CLOH 3ARUA 5JHDD 1IAKA 2DIJA 2I26N 3TESA 2PTVA 4L9LB 4O51A 2OL3L 5KSAB 5TE6L 2V9QA 2E6PA 3N06B 2DLFL 4C57C 2FB4H 3DYPA 1AGFB 4N8VG 3G5YB 3FFCE 3UJIH 1EFQA 3P9MB 5I30H 4Q9QL 2YMXH 4PRHB 5KVDH 1TNNA 1AR2A 1EA9C 5FUCE 2KQNA 1BHGA 3ZDZE 3WE6B 1K2DB 4I5BA 5EBGA 4MVBC 3CZFB 4MA7H 2NY4D 3IFNH 3EDKA 2IH3B 4JKWA 4F7MA 5C0JB 5GS0C 3T2PA 3TYFA 4U1JB 4LPWA 5BRZD 3KG5A 3DX8A 2XQYG 5SX5K 4O2EB 1OP3H 2XXMB 1JHTA 4KK5D 1Z3GL 1CXKA 1Q1JL 1FNGA 5SWSE 3IB4A 2J88L 2ZNXA 2DYPD 3EJZD 1KXQE 7CGTA 4L8BA 4XB7A 3HPJA 1YJDC 2H3NB 1QP1A 4OSUL 3IS0X 1P7HL 2H45A 4GAYA 5EIIA 3W2DH 1UWXH 1GCFA 1MHHB 4WFEE 2WWMC 4C83A 1J8HD 3HMWH 3U36A 4Z7VE 4ZUSA 3FAWA 2HFEB 4G8GA 5D7SL 2DWDB 4EI5C 1RAMA 4DN4L 3IDGA 4OF7A 2VZ3A 1PD6A 2A38A 4X5WB 4RBPK 3LEVH 5ENWA 1C5CH 2OX5A 5IROA 4I77L 5ID0A 4NYLA 4HPYH 2YRLA 3ZE1E 5D2NB 2HG5B 1NL0L 4P4KA 3QQ9C 3ARGB 5IMOA 1QYGH 3EW3B 5ICXB 3HC3H 2GTWA 5IWLC 3H9SA 3QDJB 5I8CA 1DVFD 3RGHA 1BLNA 3KLAB 4KI5F 1EHNA 4S1QH 3C09B 2VH5L 5IW6B 5J6HA 1FIEA 3L3DA 4R2GD 3SE9L 1KCSH 4PP2A 3FHAA 3K7UA 1BIIB 3FKUS 4HWBH 4P3CH 4LK4A 1QFPA 3V8OA 3ULUC 4XMKH 1FGVH 3KAAA 3BT2H 4X6FA 4KK6C 4PYHA 3RWCA 2BNUB 4FG6D 3NCYS 4D9LH 3GSWA 2B0SH 3KS0J 3BW9A 3P0YH 2X4QB 5AD0A 1I1AD 4M6MH 2ADGA 3X11B 2HT2C 1MREH 5AZ2H 4MQ7B 1HHJB 4KAQH 1MAML 5GSRB 1XF5A 4HS3A 3X17A 1UENA 2VERN 4MNQE 4WWKB 5KZCD 4R7DB 3SE8L 1FNFA 3HMXL 3QBTB 3MRMA 3QHTC 4TSCH 4DVRL 3BFOA 3QCVL 3L3IA 1FNLA 1NAMB 1GGUA 2JCCA 2VMFA 4OZ4B 4BYHA 5FECB 2OTWB 3NIFE 4NSKB 4BA8A 1WEJH 1NDMA 2IAMA 1VERA 2IFFL 5ETUB 1BEYL 3VXRA 2W9EL 2MCPH 2MHAB 3QO1A 4CL7A 3A6BL 3U48A 4LLYB 4OZGE 4LCUA 3F62A 5KSBE 3AS0A 1P4LB 2P24B 3GMOA 1FPTL 1WFOA 2H8PA 3RDTC 5C0IB 2OR9H 3DRTB 3KNBB 1FL3B 1ZLVH 1JV5B 3Q1SL 2NZIA 5EU5B 1CICC 3HUJE 1E4WL 2Z8RA 4YFLF 5CEZL 1QHPA 3SGEI 5ICZA 2NR6D 3LQAH 4JHBA 4TUOA 1V3LA 3TC9A 4XVUC 2X70B 4FN0A 2X4RA 4X4ZA 1CN4A 4P2YA 1GZPA 4R4FL 1XIWD 3PJSA 1OGAB 1NAKH 3NCMA 1MJUH 5DJ0A 1ZMYA 5F1NB 4IRJB 5F9JB 1HHIA 5KVGL 1C5BL 3C5ZB 1CLYH 1R3KA 4KI5D 2RHEA 5BV7H 3FB6A 2GJJA 5TDNA 4MZ2A 4OIIH 1JL8A 4OZIF 4M7LT 1H3PH 1A1OB 3L3KA 3RWDA 1A3LL 3AREC 3MUJA 3SDXB 5A16A 8CGTA 4JGUA 5E2TL 4EN3C 1XF2A 1KUMA 2OJEA 4OAWB 3UXFA 4NC0B 3X13B 4N0UE 3K1DA 5MEPB 4KZDL 4PJXF 5J4MA 4RGNE 1R3IH 4OB5L 5FDWA 4P5KB 3T65B 1I3GH 4WFHD 2BNRA 4CMMA 1U8HA 5JA8B 3P30L 4K55A 3DSFL 3ORJA 4ISVA 2D9QB 5K9JL 1HHHB 1ZLWH 4F33A 2B8OT 4MVBD 4YX2L 3NABH 2X05A 1JZ2A 4YNYB 1GYAA 2OM5A 3TT3L 1G0DA 3DLQR 1S8DA 3ZL4H 5EZOL 2FECL 3V9FA 5GS0D 3I02A 4LQFH 4K23L 2ZG3A 4GXVL 5MP6H 2PUQT 2FWOA 3MV7B 1A7PL 1AGFA 1E6OL 2FO4B 3TFKC 3P9MA 3I6LD 1S9YB 1A7NL 4IDJH 1CGYA 5HYJD 4QRSA 1FN4B 3EKCA 2VDRH 4UT7L 5I1AA 5IFAH 4NKDB 5FGCB 2N1KA 2D03H 4WI7A 5ACZB 4PJAB 4MSWA 5LGHH 4X6CF 2P5EE 4RAUB 3AGVA 3C60C 4IOFC 5C7XL 3EYOA 1MJ8L 2W60B 4MJ2A 15C8H 2W0KA 4YXKL 4U1JA 2WWMD 4HUUB 3TZVA 3P3YA 2OZ4L 4F9LA 1P6AB 1FNSL 4O2EA 5I1GH 4EI5D 3SPVB 1SMOA 5E5RB 4NFDA 4MDIB 1DQMH 4WHTB 2YPLE 4O5LH 5F70A 3TJHC 4YHKL 3CDGB 2H26A 1KCVL 3UTQA 1T03L 2DM7A 3KYOB 2MFNA 2Q7YA 4M3KB 1ZK9A 3FFCB 2H3NA 1NGZB 3SE3C 5IB1A 4PG2C 3PUCA 2X4NA 1U8LA 1NCAH 1YEIL 3HTLX 4DTGH 1XGPB 6FABL 1MHHA 3GHBH 5EUKB 3KPRD 2VABA 1FGNL 4FXKA 1IBGH 4JPIB 1NCDH 4LCCC 2IF7A 3BKCH 3CMOH 2X4UA 2AQ2A 2IEPA 2FLRT 3ZDYE 3ULUD 3WS3B 3NCEB 4XHJC 4BH8B 1HHGB 1K3ZA 5JDSA 3EDDA 2DMKA 4X0KB 5LJYH 4KK6D 3RX7A 5D2NA 1SEBA 5SWSB 1VB9A 5EPMA 1CFNB 3FO2B 3AU1B 1UM4L 5IB2B 4LSTH 4HJGB 2HT2D 1OAZL 1YY9C 4M5YL 2BFVL 3BESR 1KB9K 1F11B 3OR7A 2EDOA 3KLAA 3VFMB 5IMLB 1C16B 5DHYB 4JVUA 3MRPA 5HY9B 5IJKA 4HEME 3BDXA 5MEQB 1BIIA 4JO2L 4Z7VB 1N8ZB 1P9MC 3I9GL 1HSAB 4X7EC 3SGDH 2ESVE 3HC4L 2UV3A 1S7VB 1K4DB 3LKNB 3PP4H 2EYSA 3HLAB 1FZOB 2W9LA 2XFXB 4Z7UE 3L3JB 4PJGF 3X11A 2B20A 3Q48A 3M8OL 2OR7A 3VXUE 3M45A 1IC7H 2AJ3A 1HYRC 4HGKC 4HIIA 4PGCB 5GS1C 4WNQA 5ANMA 4XVTL 1UA6L 2G9HA 4JFDE 3IDNB 3VU2A 4Y5YC 2DQIL 2Y6SC 4JM2B 4WFFD 3RDTD 3BJ91 3R0NA 1CICD 3OKMA 1AXIB 43CAB 1PZ5B 3CFJB 2ZSWB 1AGEA 2GK0B 2D0HA 5HTSA 4XPTL 3IYLW 3WXWH 1NANH 3FQXA 2E9JA 4XVUD 1R3HB 5I6XC 5DWUH 3THMH 2MHAA 1N2RB 3VGEA 3SJVA 1P4LA 2P24A 4HUNB 5D7LB 3AY4C 4JE4B 4B53A 5C0IA 2O26U 4MAUH 3DRTA 5I9QB 4G6KL 2JE8A 3GFUA 3QUYC 5EU5A 3VXOB 4FQIH 4MNQB 3OMZA 1AH1A 1U6AH 3ARED 3LS5H 3WHE1 3G5ZA 1M4KA 4EN3D 2C1PA 3JTSB 5T3XL 1TTGA 3KPPA 5DMKA 5KOMC 3WIFB 2FHFA 2X1QA 1MF2H 4Z76B 1BQHA 1WWCA 2ICCA 1OGAA 2EDFA 3BKMH 3B9VA 3TJEL 3MJ9L 5F1NA 2R2CA 4I4WA 1DUZB 1P7QB 3J7HA 4KMTH 4HZAA 4WEBL 1OAUL 3FRPA 5DUML 1KNOB 3NACH 3ULVF 3MJGX 1SY6A 2HRPH 1UXWB 4RFNC 4QHKJ 4OZGB 3RNKA 3PWJA 5KSBB 3SDXA 5IFJB 3F5WA 4DEPB 4FQXA 1UB6B 2NXYB 2W1NA 5GGUB 5D7IF 5SWZE 5C8JB 4NHCH 1I7UB 3HUJB 5ICYB 4MQXC 2OI9C 3WEXA 1IC1A 2YN5A 1AIFA 1L7TL 4NRYB 3BGFC 1FVDA 4LHUG 4KPHH 1RZJL 3TFKD 2A73A 3HE6D 1S5HA 4NNYB 2O5XL 3HPLA 2H6PA 2YBRB 1DJSA 3ARVA 4A6YA 3WDHA 3TVMA 4JFPB 3BP6A 4K7FB 2OK0H 2F54E 4PRBB 1S3KL 5T1MB 4K94H 1GOHA 3FB7B 5DRWB 2VLKE 3JWOL 3C60D 3HB3C 4G6FD 2YHGA 4IOFD 4ENEC 1CLOL 6CGTA 5FKPB 4M3JA 4UUJA 1VCAA 3GKWL 5F6HJ 5EFIB 1MY5A 3A6CH 4N0UB 2AXFA 4M61A 1K9TA 3QUZC 1EUTA 2FB4L 3QIWC 2QSCH 5I66B 4U0QB 4RGNB 1FN4A 5CEZD 5DI8A 3H0TA 3UJIL 3TJHD 5I30L 2YMXL 4OM0H 3O3BB 4PJAA 5D9SB 3LS4H 3S37L 1M71A 1HNGA 3TBTB 2A6IB 2W60A 4MA7L 3PQYD 3IFNL 2ZJSH 4Q74A 2P8LA 1II4E 4HUUA 3T0EC 4UI2A 5GRUH 3L6FB 1XAUA 1OQOA 5A43C 5IHBA 2V5RA 4J6RH 4MDIA 3WUWA 4WHTA 4GKZB 4HGWB 1QRND 3QULB 4XHJD 3MRRA 3L3GA 4W4OA 4NKMA 4YBQC 1PX3A 4YHIB 5IHUH 1QD0A 4PRPD 4V1DB 1Q94B 4RWHA 1PKQE 4Y2OA 5IVXF 1RZFH 2MQ0A 4PJCE 1XGPA 4XNQA 4MJ6B 1YY9D 4CVXB 3W2DL 1CD9B 3GBNH 4NHUA 2P5EB 4D9RE 2C9AA 1IZJA 3QUML 3V6FB 3HMWL 3O4LA 4EKXA 1SBSH 4YHMH 4CRPA 4BFEA 1FIGH 2VZOA 5K9KA 3ARFC 2O61A 4JRYE 4P2QE 4QHLA 1C5CL 1D5MA 4ZOEA 4LHQB 3D6GA 1CFNA 1VACA 2YPLB 2NY5H 4HPYL 4YR6A 5IB2A 2JELH 1UKQA 1KJVB 5DFWH 2AJVH 5HGDB 1QYGL 2Z31B 3CPLA 1RZJC 2P7TB 1AP2A 2QEJA 3CH1B 3HC3L 5E7BA 5IMLA 1H8SA 5DHYA 1CFVH 3GMQA 4P4RB 4S10A 5F1KC 4WDIB 5CD3A 1X5JA 4S1QL 5HXMA 5I73C 5JHLH 4Z7VA 8FABB 3TO2B 2EE2A 1KCSL 2ERJC 4X98B 4JDZA 3FB8A 4KKAC 4HWBL 4FFVC 4LCIH 3JWOC 5DSCA 5HVWA 4N1EA 4XMKL 5EBMA 1FGVL 3D9AH 2A83B 2XFXA 4D9LL 3FOLA 3QJFA 2B0SL 2A9MH 3P0YL 1BWMA 3ARRA 1INDH 5I18H 5L2KA 4PV8B 3TYGH 4M6ML 4PJ5B 3STLB 3T4AB 1MREL 1D9KC 5AZ2L 3S34H 1FFNB 5CS7A 4KAQL 1HWGB 3KLSA 5F97E 4DZBB 2AJUH 3IDNA 5DA0B 1NAMH 3SBWC 1SQ2N 3D18A 3I3BA 1RUMH 3WO4C 2MJWA 1EBAA 3GJFB 1UGNA 3QUYD 3DOSA 4A2MA 2EKSB 2ZSWA 1UCTA 5F89A 5C07E 2GK0A 3QEQA 1RFDH 4TSCL 1IQDA 3RX8A 5DZLA 3ZE0F 1EEYA 5E70A 2Y23A 4YWGH 1R3HA 2ESVB 1JUFA 5E8DH 5IFHH 1WEJL 5GGRB 1P1ZB 4XZUB 4Z7UB 5GGVY 5BZDB 1U93B 1R5IB 2JJSA 4IMLB 3VXUB 1ONQA 2FIKA 1AGBB 1SBBA 3LAFA 4OLYH 3T3PF 3RPKA 3SGJC 2NX5D 4UOW0 2GJ6E 1MHEB 4MNQA 3UZEA 3O8XB 2OR9L 1T5XB 4Z7NE 4RZCB 4JFDB 1S7TB 1X4ZA 2X2YA 3JTSA 5D1XC 3FOMB 3V4UH 4FQQB 1KCUH 2UWEE 5DGRA 1DP0A 2NY1B 1MJJB 4MQXD 1IC5H 4I48A 3OB8A 3BP4A 2IADB 2Y06H 4QHKI 1P7QA 1RZKH 2VXSH 1NAKL 3SKOB 1MJUL 1C08A 5BXFB 3B9KC 2V9TA 3VFUB 5HI4C 1YPZA 4CNIB 3RUGB 2X89D 4TNVK 1CLYL 4G6JL 1UXWA 5INCA 5JOPD 5BV7L 4OIIL 4OFKA 1IEBA 5GISH 1H3PL 5DJ8B 1UQSA 1XR9B 5C8JA 4ENED 4JREB 4MQTB 2CUIA 2EDDA 1KIQA 5ICYA 2YRZA 4U1IB 1JE6A 2EIZA 3SGKA 4HFWB 1AQDB 4M03A 1MLBB 5MHSE 4A6YH 4WW2C 2D0FA 1R3IL 3QUZD 3QIWD 1XF1A 5ISZD 1BD2E 1X5FA 1I3GL 2YBRA 1KIPB 1J05B 4K7FA 4HV8B 3OL2A 3QG6B 5BS0A 1WJ3A 1NCTA 5JIHA 5F6HI 2ED8A 5DYOB 2BVQB 3QNXA 1I9IH 3L5HA 5FKPA 5TF1H 4YZFF 4HT1H 4PB9H 3BVNA 1UEYA 1YMHB 3MNVA 4GQPH 4M1DH 3STZB 5E2VH 3ZL4L 4EQ3A 5EFIA 4LPYA 3T0ED 4F9PC 2FJFB 2P8PB 3LKSA 3HI1B 1KJMA 4LQFL 3T3MF 3MLTB 5SWZB 5IM7A 4APQC 5MP6L 4H0IA 5I66A 2ZCLL 2HJKA 2X4TB 5K59E 1OTUC 2IQ9H 3IDYB 5T3XD 4IDJL 2FO1A 2VDRL 3O3BA 5IFAL 1J1OH 1P53A 4LIQE 4YBQD 1KPRB 2XTJC 2D03L 3CZJA 3QXAA 4XCYB 3QIBC 2A6IA 1M05A 2G60H 2ID5A 3SDDB 1EH9A 3E3QC 2F54B 5LGHL 1VEOA 3U9UB 3M17B 3CSGA 1EFXB 3GEWB 2ED7A 3MOQA 3REWB 3MV11 1WBZB 2VLKB 15C8L 4FS0A 2VR4A 4D0BB 1JGDB 2WSKA 4XP4L 4GRMB 1JK8B 1ES0A 5I1GL 4WV1C 4P9HH 4HGWA 2VXVH 5T5FH 1YQVH 1DQML 5IHLB 4JCMA 4O5LL 3VW3H 5CSZA 2LTQC 3E2HC 3LQAC 4Y5VB 4YHIA 5FGBA 1C7TA 2YD3A 1A6ZB 2EICA 3OWEA 5FYKU 2VOTA 4PY8J 2E3VA 4MJ6A 1DBBH 3LN5B 4CVXA 5DD1H 2P5EA 4DTGL 4ZFOA 1YMMD 3LIZH 1CD0A 3GHBL 1XR8A 4YAQA 4NBZB 5F7EL 2VWEC 2VDQH 2ZUXA 1NH6A 5BV7C 4YHNB 3P40A 4PBXA 3HZMB 5C0DB 1NCDL 4JO3H 3BKCL 3CMOL 5CJXC 3H3PL 3W5NA 3GSNA 5C6TH 1HILB 3BE1H 4KKAD 4FFVD 4XNMB 3WLWC 4GH7B 3MJ8A 3D5OF 4UDTA 2IFGA 2EC9U 3IDIA 1TQCB 1BZ7A 2DL9A 3DI2B 3E0GA 5E1AB 1ZLUH 4XNXL 5HGDA 2FBJH 5JXEC 5J1TC 2R8SH 2P7TA 1MCEA 1CDYA 4LARH 4X9HA 4OKVB 3MREB 1RUAH 3F65A 3O3EB 4LSTL 1PKQB 5DK2B 5FM4A 1D9KD 4X4YA 2VITB 3TA3A 2BOBA 4AIZB 5F1OB 5IGXH 3RVWD 2LU3A 2HTKC 1ETZA 3V6ZB 1XFPA 4KY1H 5DTFA 1CK0H 2P42B 4C58B 2WMPA 2ICWJ 4MXVF 2ZG1A 2VL4A 3AB0B 2GY5A 1BVLB 1NMAL 4NNXB 1JPTH 1QR1B 1JF1B 3PP4L 3OGCB 2VDNH 4JRYB 4P2QB 5IBTH 4K7PH 1QSZA 3TBWA 3DX6B 3MNZA 1AE6H 2LVCA 3DWTA 1IC7L 2QBWA 5C08A 5JMRA 1TZGH 4FXGB 1MAJA 1JHLH 2XNAA 1X3DA 5CIPB 1W8NA 3EJJX 5D1XD 4YXLH 4OF5A 4X7TB 4L3EB 3P73B 3VD4A 3WXWL 3QNYB 1GGTA 2GHWB 4HPOH 4Z7WE 4ZFFA 2WBJB 5GGRA 4XZUA 4Z7UA 2NLJB 4NWUL 1A6VH 4IJ3B 3T0XA 1U93A 3C8KA 2UZIH 5BQ7A 3B9KD 3EO1B 3V4PH 5HI4D 3O45B 4HXAH 4MD0B 4E41E 2X4SB 5DVMA 2FZ3A 4YFLI 4UV4H 4JLRA 5ERWB 1XT5A 4MAUL 3WFHA 2WLYA 3BEVB 3K8MA 1E4KA 4HFUH 2CLVB 5DMYA 5I74B 1BBDH 4FQIL 3FRUB 2J8UF 4OLEA 1U6AL 1P4IH 2DLEA 3O6MH 1UXSA 2IG2H 2PR4H 1QSED 3FONB 4RNRB 3T1FA 5C07B 4NO0A 3S7GA 5FYLE 1MJJA 1DL7L 1MF2L 2AK4E 5J89A 5IROC 3DUSB 5JXAH 4FHBD 3SKOA 4Y4HB 3VFUA 4Y2DB 1U8QB 1VFAA 1VFBA 3VDBA 4P4KC 5F6IC 4FZEH 4S1RH 2ITCB 4KMTL 4JN1H 4H8WH 4L29A 3WDIA 3O3DA 3NACL 2A6KA 4LCYA 4FTVE 2HRPL 1E28B 4OLVH 4P48A 2GJ6B 2LU4A 4J8RA 3NZHH 3FQUB 4U1IA 3TPKA 3U82B 3NN8B 4OV5A 4HFWA 4NHCL 1ADQA 1T83A 4YEFA 5C3LD 3RWFB 2UWEB 4APQD 5FV1L 2AV7B 3SDAA 1J0HA 4KPHL 1J05A 1OTUD 5D8JL 4ELME 1KTKE 3QG6A 1U8OB 1FZMA 4DZ8A 1J88A 3UBXI 2FX9H 5EU3B 5EO0A 1A7OH 4PJBE 5DJYA 4PGZA 2OK0L 2ADJB 3DROA 3HI5H 2XTJD 4XCFH 3EYSH 3QIBD 4K94L 2IBZX 2VLMD 4HAFA 5LG1A 3VCLA 3VDCA 5JORB 1OCWH 2B39A 2MQ3A 3V2AR 1TVHA 2VXQH 1N5AB 3MLTA 3B2VH 2XQYK 1JZ3A 4KMQA 3ZKMC 3A6CL 2C5DC 1MRFH 2FJHB 2QSCL 3KJ6H 4KRLB 2IAMC 1MFDH 3IKCB 3FQNA 3MYJA 3QJHB 5FK9A 1ZGLA 1KPRA 2BSTA 2F9BT 4OM0L 1BD2B 4LPTA 3VWKA 5IEKB 5BO1H 4JFEE 2NY0B 4KMLB 4OCXH 2ZUVA 3LS4L 3BPOC 1EFXA 3MV9D 4XGZA 1TCRB 5I1JH 2ZJSL 1L4IA 1UC6A 4D0BA 3BXNB 1JK8A 3P4OB 1P6FA 5GRUL 5F88A 1BM3H 5KSVA 4XBPB 3P0VH 4J6RL 4PY8I 2J6EH 3U7YH 2RCSH 4CUCA 3B5HA 3D39E 3WLWD 3D0VA 3K3QA 5TQ2H 3QFDA 4HS6A 4RMTA 5FV2A 5IHUL 3BP5B 3LPFA 4I0PD 5HPMB 5JXED 3LN5A 1RZFL 1IEHA 1UACH 2GITB 4JY6B 3S36H 2Z9TA 3ES6B 4DOHE 3GBNL 3C6LB 2AV1B 5F71A 1XCQB 3NPZB 5BW7A 1UH4A 4PGBB 3KPQA 3VI4F 4XP6L 2HTKD 3P2TA 4YHML 5C6WH 3SHSA 5B39B 4LLMB 4LP4A 5ITFA 4UNTA 3PHOB 3ZKXB 3GRWA 5K93A 3MODH 4PJ9B 1MH5A 3U2SB 2NY5L 3QHFH 3U46A 4OQTA 3MROA 3RQ3A 3MREA 5DK2A 5ID1A 2AJVL 5IHZB 4PJCA 2MTPA 1Q9KA 4XNUL 4FMKA 1F3DH 3MBXH 1FE8H 1PY4A 3Q2CA 2ICWI 1PZUB 1CFVL 1RU9H 1FL6B 1FHGA 1EXUA 2HJFB 4L9LC 2EH7H 3CFCH 5JHLL 1GAFH 2YD7A 4K94C 3VFOA 3KPLB 4LCIL 4NNXA 3WD5H 1RZ7H 1QR1A 1F4HA 1JZ8A 1EHAA 3DV4B 4JKLA 4JKMA 3D9AL 4U1MA 1XZ0A 3B6SB 4ZMAT 3DX6A 2VAAB 1INDL 3SKNB 5T1KA 2JCCF 3TYGL 1DR9A 1FBIH 3GJFH 1RZ8B 5I2IB 4D0DB 4NUJB 1VEMA 4Y19A 3S34L 4FXGA 2UVFA 1AQKH 4BQBA 2AJUL 1F5WA 1WFTA 1RUML 2DOCA 5CIPA 3H7BA 3OKKB 5EO9B 5DJ6A 2R23B 4OF8A 1T0MB 2UUDH 3TZVC 4HG4K 2Y9RT 4F9LC 1RFDL 3VFTB 4G8GD 3U0PB 5H8DA 4YWGL 3S4SG 4TPRH 3LPWA 2AW2A 4LP5A 2NLJA 5EO1B 5E8DL 5IFHL 4MA3B 1YEKH 1Q9LA 1HINH 3DX7A 2XZZA 1XGQB 3EO1A 2R39A 4M4PA 1TJHL 4MD0A 2F5AH 5F3HA 4P4KD 2XN9E 5ERWA 5F9DC 3H9SD 4HX1B 4OLYL 3IETA 1ZS8B 3SO5A 3FRUA 5GRVK 1OOAA 1A6AA 1H8NA 4KK8C 1K6QL 1C1EH 3BZFA 1BREA 3V4UL 1KCUL 2NY7H 3BUYA 2VDPH 4EEEA 1IC5L 1XCTB 2Y06L 3WCYA 5D2NC 1ODAA 1U8QA 4Z7WB 3ARGC 5C0BB 4BM7A 1RZKL 2VXSL 2WUCH 3DRQB 4NCC1 2NNAA 4KI5E 4PJ7A 4ZUTB 1QFUH 2EDRA 1W0VB 4QHUA 3QHZH 3D25B 2G5BB 2NY5C 5HPOA 2GJ6A 5IJKC 1ADQH 5FFLA 5JW3H 5GISL 1MFBH 3AM8A 1CFSB 3MCG1 3NN8A 4R7NB 1ZLSL 1NUNB 1A6PA 1A1MB 2PW1B 2UWEA 2E7LA 3ZKMD 5T5NF 1OAXH 4A6YL 4Q6IA 5CJQL 4GRLB 5EZLA 1NEZB 4NJAH 3MRDA 2AK4B 5CGYC 3VD3A 2IAMD 4KQ3H 4Z8FL 3GI8L 3VXRD 5ESAB 2FR4A 3BKJH 3QISA 1Q0XL 3H6JA 5HGHA 5JIKA 5EULV 4YHPA 4MXWH 4M62H 4M8VA 4WWKC 1Z9LA 5E8EB 1VGKA 1T2XA 2E9BA 4QNPF 1MWAB 1S7XA 4FTVB 1I9IL 1CGXA 3KR3L 5TF1L 1I1RA 1IGJA 4ZUWA 4HT1L 3GSXB 4PB9L 4BFIB 5JLZB 4M1DL 3MV01 5E2VL 1F6FB 5C0EB 3KPMB 4XPBH 4Z7OF 5FAAA 4KDTA 4GW1A 5DD6A 4H5SA 3IU3A 3QJHA 5HYJE 1T7XA 1I9EA 2IQ9L 4LGRB 4RDQF 4G80B 1QRKA 5IEKA 1U42A 3DO7B 4FQ2H 4ELMB 4ZDHA 1J1OL 1ZGLP 1I4FA 4NKOB 3QG7H 2DM3A 5F9OH 1ZSDB 3S35X 2GCYB 4PJBB 4U2YA 3VMPA 3FT3A 3MRBA 2G60L 1AR1C 4PV9B 5AZEH 2QSTA 3BXNA 5CKGA 4NO2B 5KVEH 1JNHB 4XC1L 5FB8B 4MNGA 1R24A 5FA4A 3LV3A 3TBSA 4LASH 2M8XA 4G8IB 4YUEL 1WBYB 4P9HL 2VXVL 4ODHH 5T5FL 1YQVL 3ZO0A 4YPGB 2MKLC 1G1YA 4CN1A 2YD1A 3VW3L 4OZIE 3PGCB 3BP5A 5IIEB 4HKJA 3QA3B 5HGBB 2BNRD 3SKUD 1Y0LB 3RX5A 2GK2A 5FYJE 1UT9A 3GDBA 2HP4A 4GMTH 3QB7C 3ES6A 1DBBL 1RZKC 5GRJH 5L0QC 1PX4A 4H25A 4JFEB 5DD1L 3SGEH 1XF3A 3GSOA 3LIZL 3C9NB 4PJXE 1T6WA 2VDQL 4LOUC 4FQXC 3WFDL 3GRWH 3GI9H 4LLMA 3P4NA 2HRLA 4JO3L 1QA9A 4I13B 5C6TL 1SJXA 1KPVB 4OQTH 3BE1L 3SN6N 4QYOB 5E8NA 4KGJA 3V4VH 2Q87A 1OAYH 3HCVA 1RSFA 3BD4A 3D39B 3CFKB 4LVNB 2DYPB 5E6YA 4B7LA 2PW2B 3WMSA 5IHZA 2FBJL 2R8SL 5IF0B 3N1PC 3M07A 4WU5A 4LARL 1OLLA 4JDTH 3G9VA 4C56A 4JFZH 3JTTB 3QRFM 1FJ1B 4UB0H 3FO9B 1OM3H 1FAIH 1VFMA 1L6ZA 3NTCH 5IGXL 4DOHB 4JVWA 2VQ1B 3Q6FA 2FCBA 3H42H 3LB6C 1WSST 4X99B 2Z4QB 5EWIH 4RMWA 4KY1L 1CK0L 2D9CA 3T8XA 1ZKAA 1H3GA 2R2HA 3TZVD 3DV4A 1JPTL 2FEEI 4LSQH 4X6CE 1PG7L 1WT5A 2VDNL 4G9FA 3SKNA 2ZCKH 5IBTL 4K7PL 1QBMH 4FXLA 4D0DA 1N64H 1AE6L 3ARWA 5CIPH 2C3WA 1TZIA 4L3CB 1TZGL 4WFFE 4QT5B 5DEZA 3MRNB 5DK0B 1DVFB 1JHLL 3LN4B 4M1GH 3LCYA 2R23A 3U1SH 4R2GB 4LSPH 1HDMA 3ZTJH 4YXLL 4KK8D 4M8QA 3PL6A 4NZUH 4FFWC 1LWRA 5F7YC 4HPOL 5C92A 4RAVA 4P9HC 4W4OC 1A6VL 4MQSB 4NQDE 5JW4M 1I1AB 1KTRL 1F45A 2UZIL 5FUCC 1MAKA 3V4PL 4HX1A 4JZOB 4HXAL 3SKJL 3QDJD 4UV4L 2WUBH 1ZS8A 4N0FA 3EYVB 5D7KE 5KZCB 3F58H 3X14B 3MRQB 4HFUL 1BBDL 2X9WA 4YHYB 4U6TA 1CGSH 4JHAH 2BXYA 1P4IL 3MFFB 2V5TA 3O6ML 2IG2L 2PR4L 1FG2A 3H9HB 3MGOA 3W9EA 4JY4A 4LMQI 1QFWM 3PWVB 1ZTXH 4Z7WA 5JXAL 1X5IA 1I75A 1LD9B 2Q7NA 5CGYD 1D5IH 1W0WA 4FZEL 5JUEH 4S1RL 1K5NA 3I2CH 3NFSH 4AEIL 1MCCA 4M1CC 4XAKE 2GW5A 4NO5A 3GBLA 4E41A 4JN1L 3EOBB 4H8WL 5HHPA 3V6BR 2XN9B 4ETQB 4WWKD 1CFSA 4OLVL 2Z92A 4PJIE 1BVKB 5D1QA 4R7NA 3HA0A 3NZHL 4K3JH 1ZWIA 4PJGE 3VGGA 4UDUB 5IQ7H 2VKWA 4XBEH 4GRLA 3RAJH 1UZ8A 1EAPB 2AK4A 4LEXH 5DC4B 2DQEH 1XIWB 2PETA 2E6JA 5DRZA 1A7OL 1VDGA 4U1KB 4F3FA 3KS0H 4PIRF 1F4WH 4KTDH 2FEDC 1WBXB 4FTVA 4XCFL 4JM2C 4JFYB 1AR1D 3GSXA 3D2UA 4BFIA 2ZUSA 1WQVT 4I18A 1PFCA 1S7SB 1OCWL 1WIOA 1D5ZA 2VXQL 5JNYA 3B2VL 1KB9J 3BWAA 4QXTA 2J7LA 3Q5TA 5I0ZA 1NGYB 4Q2ZB 1AXTH 2PXYA 1J0ZA 1MRFL 3OKDA 4WHCA 3ZT6A 3KJ6L 2EO9A 4G80A 3N1MC 1MFDL 1U8JA 1OGAD 1NLBH 4N5EC 1YUHA 4XMPH 3ZKNC 5F7KC 4QTHA 1KBGH 3X12A 1LEIA 1I8LA 1UYWH 5BO1L 4PV9A 4CAGA 3PQYE 4OCXL 4YDLB 3MRIB 1RIUH 2RIKA 3DV6A 4NO2A 5BOZG 1HH9B 4RQQB 3OKOB 5I1JL 1JNHA 1Q9OB 1WCQA 4H88H 3K80A 1XGTA 4LOUD 1DEDA 4FQXD 1B0RA 5FUZH 1BM3L 3IDUA 3QQ4B 4PTUA 3T0BA 2PNDA 4LSRH 1OF2B 4N0CC 4YPGA 4DUWA 2RJMA 1QKZH 2J6EL 3ZTJG 3U7YL 2RCSL 4LIQH 3ULVE 2H41A 1QFHA 5EUOF 5TQ2L 5HYJB 4PRPE 2VRAA 3W5MA 4ZFOL 1Y0LA 1AI1H 3SDYH 4CU6A 1BFSA 3MSPA 1IGMH 5ACMA 4JFEA 5E0QA 1R3LA 1Y18B 4MD4B 5D7IE 3PWLB 3TVMD 1UACL 2Y7QA 1H15A 3S36L 3GMMA 4DEPC 3GSNL 3RGVA 4HKXB 2NXYC 1U3JA 1YEGH 1L9MA 1KN2H 4H8WC 1WV7T 2AQ3A 3LB6D 2BY2A 5DMIH 2BVOB 4R8WH 4EI5B 1ZHNB 3NGBC 4Y4FA 4YGVB 2HVKA 1A3QA 3D39A 2FHBA 2XKUA 3MODL 5DLMH 4IRSB 5HGAA 3QHFL 4EDWH 1A0QH 5I1EH 5IOPA 4OZIB 4HK0B 1ZHBB 2CUMA 4PJ8A 5EC1B 4PRIA 4WENB 3DMMA 3ALPA 3MBXL 1BIHA 4IMKA 2VQ1A 3KPRB 1MIMH 1RU9L 4LNVA 3QEGH 2W9DH 4PJXB 1D5BB 2EH7L 2QV2A 3CFCL 2JJTA 2L0DA 3C2AH 5H35A 1CL7I 1ZA3B 2YN3A 1SYVB 2COQA 3WD5L 1YDPA 2IBGA 1RZ7L 2LU7A 3OKNB 4OCWH 4RGNC 4NQEA 5C86A 5M94B 5E8PB 4FFWD 1GGYA 4JJ5B 4L8DA 1IZKA 1PY9A 1FP5A 2PCPB 2ZCHL 3MV8A 4BJLA 5DQDH 5CFHA 2D31A 3OHXA 5FM5M 5C0CA 1AQKL 4HLZH 5CHNB 5MENE 3CIQA 4OI9A 1MLCB 5EC2B 1CXHA 3MRJA 1JTTA 1NFIA 3O4LD 2R29H 1VFUA 5IEHA 4U6XA 2DD8H 5IVXE 1MRCH 4H20H 4KROC 4NQCA 2JKXA 3UYOD 4G8FA 4TPRL 5CINH 1GGBH 5GZND 2KZWA 3BGMB 1CTOA 5SWSD 3GM0A 1HINL 4X6CB 4X6BA 2GSIB 5IJVA 5FO9B 4QRUA 1F2XK 3CK0H 4DVBB 1KLGA 4M48L 1CQKA 1CIUA 4M1CD 2W65A 1EERB 5EOCJ 1CXFA 2R9HC 4CVZA 1YPZF 2W0PA 3RDTB 1UJ3A 1F13A 3P77B 3IU4H 4K3DH 4J12A 1CICB 3QNZB 3WO3B 3PDDA 3F7YB 1EDQA 3E6HA 1C1EL 3QQ3A 3DTXB 2XZQH 4NN7B 3VFVB 2NY7L 3GM8A 3MZTA 2VDPL 2YXMA 3IT8D 3S96B 1H0DB 4EUPA 4L5FH 5H37G 2W92A 2WUCL 3I84A 2MMXA 1QFUL 3EOBA 2NY3B 2XN9A 3QHZL 4JFXA 4Y1AE 5DR5H 3TA3C 3MYZA 1D6EA 3A67H 2DQJL 2V7NA 1ZT1A 2FEDD 1TDQA 4I8DA 3CFEB 5FYLH 1ADQL 4JM2D 3BEWA 4IHOB 1T20B 5B39G 2G5RA 5JW3L 5IW1B 5J11B 1MFBL 2OCFD 1L7IH 1HN1A 3EUUA 5GJSL 4EN3B 5FA3A 5DJXB 2CDFB 3K2MC 3LEXA 3QEQD 4X7FC 1GZQB 4G9DA 4BSWB 5F3BA 1U58A 2AK1H 1JGUH 1NLDL 1C5DA 1OAXL 4PJDB 5ISZE 1PSKH 4NJ9L 4NJAL 3MLUH 2KDGA 3CC5A 4KDWA 2D7QA 2Q20A 3D3VA 3IJYA 4KQ3L 3DSNA 2HJLB 3BKJL 2BNQE 4N5ED 5HHOE 3ZKND 5TGBB 4MXWL 4M62L 4L8SB 2KZ1B 3ZE0E 2APXA 2OMBA 3QSKB 2HVJB 3CU1A 4N90E 1HEZA 1S7SA 3TN0B 4MNQD 1T5WB 4CU8A 3T0EE 1V7NH 3NIGF 3VA6A 4OTXH 1T1YB 4PJIB 3BZ4B 1NC4B 2RQ8A 2V2XB 3B43A 4GFTB 3VH8A 1NGYA 4XPBL 3K8LA 4PJGB 3EO0A 1TJIH 3FL7A 2FSEA 2CK2A 4N0CD 1KIRB 3PABB 4JB9H 4NQVA 4BFBD 5T3XE 3T3PE 1FYTA 3WV0A 3WBDA 1E6JH 5E56A 1GRWA 3HE6B 5GZOC 4OZFA 1P7QD 1M6OA 3UTPD 1CS6A 4FQ2L 1EPFA 3WJJA 1AXSA 3QG7L 2HKHH 5F9OL 3PWNA 4I2XE 1N3NB 4HF5H 3ROOB 3OKOA 1B2WH 4FFZH 4XNZB 4EZMA 5KVFH 2NXYD 1VA9A 5CSBA 3WFEH 4LASL 1LEKA 5DS8B 4ODHL 4GS7C 4CW1B 2VLJA 1HKLH 3GSRB 4X4ME 3TO4B 2AJSH 3B3IA 3IAPA 1K4CB 2EE3A 2P8MB 3GUTA 4M7ZB 4MD4A 4Z6AT 1UZ6F 3PWLA 2VZTA 2BSRB 5BS0D 5IESH 1AGCA 4GMTL 4NIKB 4QGTA 1T1XB 5IK3A 4EBQH 3PQYB 4H1LB 1IAIM 1O7VA 1WFUA 4AQ1B 2WBWB 4JREC 2C7UB 3QO0B 3R0MA 4Q9RH 4JAMA 4UTBH 5H94B 4ZD3H 3GRWL 4U4BA 1IEAB 3GI9L 2H2SC 1ZHNA 1BBJB 1SYSB 1MCPH 4OQTL 1DEEA 3CFBA 4DCQB 2ZUTA 2VL5B 3KWWB 3SDAC 3V4VL 4IRSA 4BK5A 3EFFB 3EYUH 1OAYL 1DSFH 1ND0B 1ZHBA 1BFVH 5EH1A 1KG0B 4YZFE 1LMKA 1MCRA 4PRPB 3KPSA 5EBLB 3O6LH 2Q3AA 1HWHB 1LDPH 5I76B 1MUJB 4JDTL 5CZVH 1E27B 5DXWA 4F37F 4JFZL 3T3ME 1KPUB 5D7IB 3ROLA 3QIUB 4UB0L 1CE1H 1MPAH 1OM3L 1FAIL 1G7PB 1A6UH 1JWUB 3WL9B 2FGZA 4DKFH 3RRQA 3H42L 2Z8VC 2MSPA 5EWIL 5EU7E 3VDAA 2ADIB 1JWSB 4GG6A 1NEZG 5J8OA 1FG9C 4XCEA 5HHNB 4OT1H 1NCCL 1G7LA 5KTEH 5E8PA 3IDYC 4KROD 1EJOH 4LSQL 2ICES 5J9PA 4I0KA 2ZCKL 2VZVA 2EDYA 1QBML 3UBXA 3VWKC 3IRZA 1N64L 4NN6B 3UTSE 4BZ1H 1X44A 3SDDC 3DBXA 3HN3A 2BRQA 1EAJA 5CHNA 5KS9F 1E0OB 3ZYOA 3WLBB 4G3YH 2P5ED 5EC2A 4M1GL 5CMAB 3NCJH 5EBWB 2BDNH 4LSPL 4YK4B 5DK3A 2CDEB 3HKFA 4U6VH 4H26B 4HCRA 2XT1B 5FO7B 5F72S 4LNRB 3BJLA 4Y5VC 3BPCA 1NBYA 2VDOH 1IKNA 2CJUH 3BGMA 4NZUL 5L7XH 3PGDB 1RJLB 5I6XB 5FO9A 1LVEA 1IGIH 1NGQH 3BAEH 3UCRA 4Y4KA 5EN2B 3DVFA 4N8PA 2PTTB 4YDKH 1OY3B 5JMOC 2WUBL 3TA3D 4BZ2H 1F02I 1MCHA 3P77A 5JDJA 4ONGH 3F58L 3CDCA 2EDBA 2XWTB 2ZOLB 2AKRB 3U6RA 5BW7C 5MENB 1HXMB 3QUYB 1ORQA 1JI2A 1OP5H 1CGSL 1KTLB 4NUGH 4XRCB 2VDLL 1MVFA 4JHAL 3DTXA 4EUPH 4UT6H 3JSSA 4HC1H 4GKNB 5I1DB 4KUCD 1GOGA 3S96A 1H0DA 5KAQG 5IVXB 5KANG 5IBUB 1ZTXL 1BFOB 4DAGH 4GRWF 3KYMB 5IW3A 3HFMH 4NQDA 3CUPB 4URTB 1D5IL 2W07A 5JUEL 3KXFA 3I2CL 4QF1A 1DQQA 3MX0A 3KDMB 4NGHH 3JV4B 1MFAH 2NX5B 4MXVE 5C08D 2D7TH 4QOKA 4XXDB 3QZWG 1JGVH 4P5TA 4MXQC 1YN7B 4K3JL 4BSWA 5JIPA 3QUKB 3IFPA 2VZSA 2AJZB 2GJZB 4ZAKA 5IQ7L 3MJ7B 4MX7B 5J1AB 4XBEL 2OI9B 4BKLB 3RAJL 2OXHA 3PNWB 4LEXL 2OJZH 4AM0B 2DQEL 1JGEA 3BGFB 4N8CH 2PYFB 2R4SH 2JF1A 1UKSA 2AVGA 2HJLA 3R8BB 1W72A 5ALCL 3MR9B 5ESVA 3VXUD 2XTJE 3HG1E 4PTTB 2CRZA 1F4WL 2HVJA 4KTDL 1JCKA 2ICWA 4Y1AB 5D93B 3TN0A 2YA1A 5HYFA 4CDHA 1O7SA 1NC4A 3BZ4A 2Q6WA 4JFDD 1PEZA 4F57H 4JKKA 3L9RB 2PO6A 5FCSH 1A4JB 3Q3GB 4OZFH 2IPTL 2ITDB 4NO0D 1DTUA 1KIRA 3PABA 4KV5F 1FFRA 4ORZC 5HYQA 2YZ8A 5DHVB 5ISZB 1CFTB 1FC2D 5IVZB 1JNLH 1NLBL 4XMPL 4I9WD 5HDQH 1KBGL 2J8UE 3CX5K 1MIEL 1UYWL 1EO5A 4NPYB 3NPSB 1IFHL 1RIUL 5I74C 1DN0B 1HOCB 3O9WB 2CD0A 3DXAE 3BP7B 1AFVH 2NTFB 5HHQB 4UQ2B 4ZFZA 2BMKA 4H88L 3T0EB 2VR5A 2DTMH 1WCBB 1QVOB 4JO4H 4X7CC 2FH6A 1HI6B 2H2SD 5DVOA 3MLRH 1RY7B 4LSRL 2Z8WC 3V6OE 1QKZL 3H3BC 4Y4HC 4LIQL 4Y2DC 5C2UB 4K8RH 1JZ6A 1MHCB 3SDAD 3T0WA 5DGQA 3QXDA 3B9AA 5FOBB 1AI1L 1S9WA 3SDYL 2YUZA 1IGML 4Z5RA 4H1LA 3QWRA 4I2XB 4TSBH 4LLWA 2I9TB 3O6FA 5H94A 2I5YH 3AM8C 5GGSY 3GNMH 1IEAA 3BQUA 1YEGL 3OAYK 1KN2L 5J13B 3BRFA 2PKDA 3HAEA 4DUVA 2VE6B 3B8SA 2NW3A 4R8WL 4DCQA 2HYMA 3KWWA 1HSBB 4Q6IC 2R1YA 1ZANH 1G7MB 3BYTA 4IOIB 1HQRA 3MBEA 3DX9B 5FYJH 1KG0A 5DLML 3S88H 1LEGA 1K8DA 4G7VH 4EDWL 3NBNA 1A0QL 5I1EL 3LDBC 3VWKD 4GW4B 1I7TB 3QIUA 1RUPH 5C0GA 3SDDD 1BVZA 2F54D 1YMMB 3MLVH 4AYFA 5IG7B 1JWUA 1EFXD 3WL9A 1U2CA 1MIML 2E6QA 3H3KA 4M5ZH 4O02H 4ORGB 5I8EB 3QEGL 2W9DL 3MOBL 4LVOB 3C2AL 3QWOB 1KLUA 3F7VA 1IVLA 5TE6H 3QEUA 4JDVA 5HHNA 4KDTC 4OCWL 1M7IA 5F8RC 1G7QB 1EGJA 4OZHF 1I8KB 1X5KA 2HT4C 3HE7A 4XMLH 4M43H 1VADB 3CAFA 4YBLB 1KT2B 4ZNEA 4UINH 3LRSB 2NY0C 3VRLE 2DLIA 3VE0A 5DQDL 1D9KB 5LGJA 3WLBA 1O0VA 4U6YB 4JRWA 4HCRH 1A14H 5JZ7C 3L7FB 3PE9A 2BSSA 2OXGA 5CD5C 1ZVHA 3RI5K 2R29L 2Z35B 5FO7A 2R1WB 1FFOA 4LNRA 2DD8L 2F8OA 1MRCL 3W82A 5J12C 1XGUB 3TF7C 1JPFB 2CXGA 5CINL 1GGBL 1WZMA 5DQJA 5DJ2A 4JN2B 5HYSB 2J8HA 1ZHKB 1MCLA 1WVZA 4HUWA 4M93B 4MJ5A 5EN2A 3S3SA 3MRHA 1I3VA 2PTTA 3VI4E 3QWQB 5A2IH 3CK0L 3UTSB 4RRPG 3KYAA 4CVUA 3K81A 3SCMA 4H0HB 1MCQA 2X1XR 3QH3A 2XWTA 5MENA 2AKRA 1MCOH 4X9IA 1JPSH 1LO0H 4D9RD 2V2WB 4K3DL 1T2JA 4ONHB 5MERA 4J3OC 2N7BA 4GKNA 2XPGA 5D1XB 3VMNA 1CDGA 4KVCH 1KCLA 5IVXA 2XZQL 3QUMB 1SJEA 4NC2B 4I77H 4F2MA 4S0SD 4JRYD 2NYYC 1PDKA 5E6ZA 1T3FB 4A2LA 3NFPB 2Y07H 4HGMA 5E2UH 3BHBB 1OW0C 4MAYA 2DDQH 1QO3A 2VXUH 2HN7A 5T1KD 4MB3A 3JV4A 4QY8A 2QR0B 4Y19D 5DR5L 3DNKA 5CZXC 3A67L 4XXDA 4UIKH 5FYLL 4PRNA 1I7RA 3STBA 3BIKB 1L7IL 2GJZA 3VXSA 1HXYA 5DJDA 5J1AA 2JCCE 5B21A 4GJTB 4RSVA 2AK1L 3LKQB 1JGUL 3GB7A 4HH8A 2I24N 5E9DA 5FXCH 5INDB 3V95A 1WT5C 1PSKL 4WJ5B 3MLUL 4Y0GA 1I1FA 3RWJB 9CGTA 4GW5A 3GJFK 4UIMA 4JRXA 4Y1AA 4FZ8H 1IC4H 4Y88A 3MACH 2JK5B 1ZVYA 3ZSSA 5KBNC 5C0NC 5B8CB 1V7NL 2EC9T 3L9RA 4OTXL 5F1IA 4DVRH 4UU9B 4RFOH 1ACYH 4NP4H 3NCBB 2ITDA 2DRUA 5C07D 5C1MB 2BY0A 3TV3H 3MMEB 1TJIL 1HNFA 3QPQC 5F44A 3PL6C 4POUB 5DHVA 3HS0A 1CFTA 1U3ZA 2CRMA 4JB9L 2IFFH 2OQJB 4Y4HD 4Y2DD 4MDJA 5ILTH 4NQSA 2QHRH 3VRIA 1G7JA 4LLQB 5HHOA 2BNQA 3A6BH 3C5JB 4P5MB 3JV0A 1PJ9A 2HKHL 2XTJB 1IAOA 4OLZH 3HG1B 3QIBB 3BP7A 1AC6A 4HF5L 4ONOA 4QRRA 3ULSB 1B2WL 3Q1SH 2GJ6D 4FFZL 3AROA 1HH6B 5HHQA 1AKJB 3KYKH 2DJUA 5IMKB 1FFPA 2RR3A 1EZVX 1WCBA 5CGMA 1T21B 5KVFL 4ODSL 2FJGA 3WFEL 3DVGA 4HDIB 3NIDF 1N26A 3IDMA 4P2OA 5GXBB 1DBKH 1HKLL 2R0KH 4H1LH 2BHUA 2HFFA 4OV6F 2AJSL 1BECA 1F3JA 2PF6A 1A9BB 4DFHA 1KGCD 2CLZA 4ZUVB 1YYLH 1WWAX 5E95B 4XNYH 5LAXA 5IESL 4I2XA 1RJZB 3MV9B 3S5LA 2RGSA 3HAEH 3FQRA 4XVSL 3RWEA 4FP8H 3DXAB 3DVNA 4ZD3L 1X6LA 3ARZA 4K3HA 3ULVH 5BV7B 3KYNA 4S1SH 1VGEH 3G5XA 4NM8L 5CJ8A 5GSVB 1DUYB 1MCPL 2VNCA 4GRLC 4KFZC 2E5EA 4XP9H 1S9XB 2R69H 2RFXB 2ATPB 3EYUL 1P84J 3LKRB 4HIJB 4QRPE 4X4MA 1DSFL 2HT4D 3P30H 4QNPE 1BFVL 3L95B 2BY1A 2X1PA 4I0PB 1I7TA 2HMIC 3O6LL 5IMMB 2NY0D 1LDPL 2GYSA 4X8JB 2APBA 1CD8A 5IG7A 5CZVL 2VLRA 3AXLB 1R5VA 4Z7OE 4J3UA 1CE1L 2UYLB 1MPAL 5ADPH 4OCRH 3ABZA 1PQZA 4I18C 4WUUE 5MEOB 1A6UL 4DKFL 2W59A 1HK6A 1V3MA 1J7VR 5SX4I 5CD5D 2PXYC 4OT1L 4TNWF 4GG8A 3KGRA 1I8KA 4ODBD 5KTEL 4NWTH 3RZWA 2GY7B 1D5XA 1EJOL 1KT2A 3LRSA 3ARYA 4XHQA 1A4KA 1W0YT 4JY5L 4AZ8A 5BVJA 4BZ1L 4HBCH 3P11H 4GUPA 1IMHC 2EDNA 3PHSA 2MCG1 4UILH 3ZHKA 4G3YL 1INEH 4OD3H 3NCJL 3NH7H 1KB5B 4LFHD 2ATKB 4YXKH 4F7MB 2BDNL 1V7MH 3TYFB 5TPWH 2A1WH 4U6VL 4ODXB 4I0CC 1XGUA 2VDMH 3EAKA 1JPFA 3DX8B 2IANA 4MA8H 3MLXH 3VFPA 1JHTB 3L7EB 5HI3D 5HYSA 2VDOL 2CJUL 3MXVH 5L7XL 1KCVH 4X80H 1FNGB 3PGFH 4NKQB 2AEWA 3AFLA 4U1LA 4W6YB 1A8JH 4JZNA 3UTSA 3MZGB 3RKDC 1FVEB 2FD6H 1NGQL 2WM0A 1G0XA 3HPJB 1YEIH 3CXDL 2VN4A 4YDKL 5DUBA 4C56D 4BZ2L 4GAYB 3EIFA 5EIIB 4UMGA 4ONGL 3C5SA 4C83B 1KXVC 4NUGL 4ZUSB 2A2QT 1YYMH 4UT6L 4HC1L 3FN0H 2Y72A 4C59B 1B4RA 2J8OA 4Y4FC 3QUXA 1A6WH 1U8PB 4LVNC 1D7FA 2XZCH 4DAGL 5ID0B 1UM4H 5CSGA 3HFML 1R5WB 2KQMA 4LCWA 3AS1A 4P4KB 5E1HB 5IMOB 3UTTE 2BFVH 3DMMC 2GTWB 2J3SA 3H9SB 5DD5L 5ANME 4NGHL 1MFAL 1MVUA 4QLRA 4Y7MA 5I8CB 5AWNH 2D7TL 1BLNB 2AABH 3C8HA 4HWZA 3HR5A 1JGVL 5C0ND 5J6HB 3L3DB 2JJWA 3VGBA 3LKQA 3HC4H 5CP3A 3RWHA 4U2ZA 2VXTH 4M7LH 4DFIA 1QBLH 4X7SH 4X6FB 3QPQD 3RWCB 2D7OA 3PL6D 2QLVB 2OJZL 3GSWB 1FVCA 3RY4A 4N8CL 3BW9B 2R4SL 3AMKA 3S3JA 2VISB 3P0GB 1OT1A 5AD0B 1T66C 2ADGB 5J56B 3SJVE 3VG9B 4HULB 5F7WC 1DVFC 4HS3B 2GT9A 1RURH 2C26A 1ZE3C 5C3TA 1EMTH 1EZVY 2HLAA 3RIAK 4J1UA 2CIIA 5DHVH 3GMPB 4F57L 2WQ8A 2LQRA 2JIXB 3ILPB 1DDHA 1X5YA 3LQZA 4RIRA 1HHKA 5CCKH 2JCCB 2VLLA 1MCSA 3IXTB 3DGGB 4LAJH 2KKQA 4CN6A 1LQSR 2IAMB 4HH9A 1JNLL 4P5MA 2HWZH 2BRRH 5HDQL 3NFNA 3HG1A 3QO1B 4E41D 4LCUB 1J0IA 1J86A 1GOFA 1AKJA 1KV3A 3SOBH 5IMKA 4YHYC 3U7AA 2H8PB 1UJ3C 4HS8H 1AFVL 5D1QD 3MUY1 3RL2A 2DTML 3OQ3B 3RVUC 1KELH 4JO4L 5ICZB 5GPRA 5FYLD 3V0VA 4TUOB 3VXMA 4S2SA 3TJEH 4GRLD 1DQLH 5F9WB 2AK4D 4K8RL 3LPGA 1WUNT 1RPQA 2YR3A 1J0JA 3CSYA 1EX0A 4R3SB 3WKMH 1HHIB 2J8UA 2HMID 1G7HB 1Z9MA 3QQNA 3FB6B 2EDTA 4CKVX 4FTVD 5SX5H 5TQ0H 4TSBL 3WIHA 1FSKB 3D2UD 3GNML 3RWDB 3EYFA 3QI9A 1XF2B 5IBUG 5M95B 2ARJQ 3JUZA 5D1ZA 3A6OA 1V5JA 3F12A 2RFXA 1XIWC 2ATPA 3LKRA 1J1XH 1VESA 1ZANL 2PXYD 2NQCA 5FYJL 5FDWB 4MJIE 4NQXA 5I1IH 3S88L 2VZUA 2DKMA 4CMMB 1U8HB 1C12A 3MLWH 5F7DA 3MCLH 4ISVB 4PY7A 2IALA 4HD9A 1MJ7H 1TVBB 1RUPL 5BRZA 3MLVL 2CUHA 3O81A 1U8KA 3K46A 4M5ZL 4O02L 3GKWH 1S8DB 1ITCA 3I02B 4L4VA 2WNGA 3H8NA 5E5MA 4MCYB 2FWOB 2NW2B 1JJUA 4MHHG 4OF0A 1J12A 4QRTA 4XMLL 3ZE1F 4M43L 4QRPB 4QRSB 4CDGC 5I1AB 3WJJC 25C8H 4UINL 4YDLC 5IR1A 4I3GA 5CEXB 3RKDD 3S37H 4PUBL 4JFED 5GIRB 5EU6E 2IH1A 3L5IA 1YA5A 2A6JB 4MSWB 1KB5A 2ATKA 1UM5L 1T1WB 2PTUA 3O4LE 3EYOB 4HCRL 1A14L 5EUOE 4HW6A 3DGCR 4ODXA 3TZVB 4BH7A 3L7EA 1NMBH 3O0RH 4MWFA 4WCYL 4Y4FD 2IJ0C 1S5IL 4DKAA 1L0YA 3D39D 2H26B 1FVEA 1CCZA 3UTQB 2XQBH 1U3HB 2Q7YB 5IB1B 4K8RC 2FH8A 4U33A 2X4NB 1U8LB 4X4XA 3DMMD 1T7YA 3BRGC 4AENB 3QUMH 1MCOL 2VABB 5E99H 1JPSL 1E4XI 1LO0L 4FXKB 5ITBH 2XV6B 4JFOA 2X4UB 4KVCL 1U8PA 4L1HA 5EZIH 4QHMA 5D96B 4G8EB 4IRSC 4I3SH 5L88L 5JDSB 3G6JA 5L2KE 1R5WA 3DVIA 1SEBB 5IKCB 5E2UL 2Y07L 2W0FB 5EPMB 3K4ZA 4BQ6A 2DDQL 2VXUL 1CTNA 1T66D 3D48R 3MV8D 4O00A 5C0CD 3OR7B 5CP3H 3U79A 4UIKL 1R3JB 3QYCA 3MRPB 1CLCA 1OT2A 3QEQE 3NCFB 4UQ3A 4DJMA 1NKOA 4DQOH 1FL5A 3VJ6A 1ORSA 2EYSB 2VISA 5J06A 1H9VA 2APWA 4YGAB 1A3RH 4OCNC 1CXLA 3GIVA 3IJSA 1FCCA 4IIQA 3AVEA 2FX7H 4GAGL 2AJ3B 3ETBF 4FZ8L 1CL7H 2DAVA 3EDFA 1IC4L 4HIIB 3UTTB 3MACL 4WNQB 5ANMB 3VFGH 1SHMA 1GHFL 2G9HB 4OD1H 3GMPA 3G6AA 3LRHA 4NZJA 1KC5H 2DS4A 4C55A 5E8OA 2JIXA 3ILPA 4RFOL 1ACYL 4NP4L 1LP9A 5ESQB 5AEAA 2K3TA 5K9QG 3OKMB 3F8UB 4NFBA 1AGEB 3RVUD 3TV3L 3IXTA 3DGGA 3CGTA 5AUMA 1IKNC 4R96A 2DLTA 3FQXB 4HXBH 4CJ0A 5E5UB 4PGJA 2YC1A 3PV7A 3UTPE 2RAMA 5ILTL 1CDHA 3GKZA 1YPZE 2QHRL 3T4YA 2R2BA 4FQCH 4ZQKA 2XN9D 3SJVB 1F97A 4OLZL 3B2UC 1BZ9A 3P4MB 3V52H 3QP3A 2B4CH 3HRZB 3MCKA 3KYKL 4KRMB 4UZGA 3TWCH 3G5ZB 4NN7C 4D8PA 4FABL 2C1PB 1M7DA 3KPPB 5DMKB 3GJEA 2XZAH 1VPOH 4Z78B 1BQHB 2R2EA 5DDHA 1B3JA 3QDME 4U1HB 1DBKL 2R0KL 4R3SA 3RHWF 2NY3C 4I4WB 5I1KL 2J5LC 3RWIB 3D3VD 4G6JH 5BS0E 3EGSB 4WW1A 3WIHH 1YYLL 1G7HA 4Z9KB 5KG9A 4XNYL 5TFSH 2DLHA 2LFGA 5DUPH 5L0QB 5J11C 1J0KA 3OXRA 3RNKB 5I16B 1B6DA 1TZHB 3LD8C 3PWJB 4LLUA 1RJYA 4QO1A 4NDMB 4FP8L 4K7PX 3F5WB 4FQXB 3MRFA 3ULVL 4UOW1 4ZAKC 4S1SL 1WC7A 1VGEL 3CVIH 4OQ1A 3WEXB 4XP9L 3O3AA 1AIFB 2R69L 5T3ZE 1LE5A 1WITA 1JGLH 1IQWH 3D85A 1FVDB 5FHBL 1FYTD 4GG6F 2GKIA 2A73B 4BSJA 1S5HB 3HPLB 3NIGE 5IQ9A 1YZZA 2H6PB 4AEEA 1TVBA 3EHBC 3P9LA 4L8SC 2J4WL 4A6YB 4R6UA 3TVMB 3BP6B 2XKNA 4E5XA 3E8UL 5FKAB 1I3RA 3TN0C 4HMDA 5B3JF 1DLHA 5ADPL 4OCRL 1UFUA 3G6DH 4UUJB 3VGAC 1TMCB 2PO6C 3SKMA 1CE6A 3CFIC 4MCYA 3SGDI 2NW2A 2ZCLH 5F7UA 2AXFB 4M61B 4WTZA 3HE6C 2VLJD 4NWTL 3KPNB 5CKAA 2VUOA 4QRPA 5DI8B 3H0TB 3FT4A 1KB5H 5CEXA 2QSQA 4XVJH 5GIRA 4OUUA 2A6JA 3C2SA 3P11L 4HBCL 4K8RD 3OB0K 4XNZC 4YDJA 1MI5A 1IM9A 1M71B 4X7DC 1T1WA 5CEYA 1KJ2A 1ZEAL 4UILL 1HCVA 3FB5A 1INEL 4OD3L 4NOFA 4WUUA 3NH7L 2OSLA 2P8LB 4XP4H 2GTZB 4XPGH 1V7ML 1LO4L 5TPWL 3JUYA 4RMVA 5A2FA 2A1WL 1R0AH 3WUWB 1UZ6E 2VDML 1NANI 4MA8L 3MLXL 3TBVA 3TO4C 3LZFH 3MXVL 4X80L 4IRSD 3U4EA 4M7ZC 3MRRB 5JPNB 1U3HA 3PGFL 1BX2A 1JN6A 3FO0H 3L3GB 4NKMB 4XWOC 3U9PL 4W68A 3KPSD 3T2NH 2FD6L 1BF8A 3K8KA 5FYJD 1U92B 3U0TA 2VN7A 4XNQB 4AENA 5E00A 1TIUA 1QQDA 5F7EH 3O6FC 4U7MA 5EU6B 3Q5YA 3CLFH 4NHUB 3ZYIA 5E94A 1UCBH 3BQUC 4LKCA 4Y5XB 3O4LB 2AXJA 2APVA 3H3PH 1YYML 4FQ1L 5EUOB 2BK8A 5LGKA 2F74A 3FN0L 3ARQA 4G8EA 2DLGA 3L5JA 2BOCA 3V7MA 5K9KB 3ULVC 1AD9B 1A6WL 3MBEC 1EO8H 4QHLB 4RAHA 4ZO8A 5IKCA 2O61B 1CXEA 1YEDA 1D5MB 1V3KA 1QLFA 2XZCL 2W0FA 1VACB 4XNXH 2P45B 2K7PA 2M2DA 1JYNA 4YR6B 3RUGF 5HVHC 2IGFH 2MKWA 1VKXA 4XI5D 3QIUC 5C08E 3CPLB 1AP2B 4K07A 4P59H 4I1NB 1R3JA 1DQDH 3GMQB 1NUDA 5LCVH 4AY0A 5A2JH 5AWNL 4LDEB 5CD3B 1QZ1A 2AABL 4PGEA 5LQBH 3GMLB 1QUNA 2VB5A 4JDZB 3LH2H 1T7VA 3FB8B 5DSCB 1NMAH 1GH7A 4B50A 2VXTL 5EBMB 1DBAH 4M7LL 1NFDA 1QBLL 1NGXA 2E27H 4X7SL 1BF2A 5BCAA 5KS9E 4JANA 3HE7C 4FMFA 3FOLB 3QJFB 4NN6C 4GXUM 2EIEA 5L2KB 3ZE2F 3ARPA 2NXZC 2Y36H 3FN3A 3UTTA 5C0FB 5M7QA 4Y4KD 3H2WA 4OJFH 1IL1A 5CBEB 1RURL 3V0AC 4KKBC 4PJEA 3B2UD 2Y5TA 3CH8A 3RTQB 5HYEA 1S7WB 3D18B 1EMTL 4YK4C 3BDYH 3DURA 2IMNA 4LVEA 5ESQA 2FEEL 2HTLC 1J5OH 1F58H 5F89B 2XACC 1FNAA 3QEQB 2OYPA 1IQDB 2YSSB 1X7QA 4L3AA 5EB9A 3HHRB 4WI5A 5CCKL 1EEYB 1IGTA 3QCUH 2C3VA 4OFYA 4NWUH 1JUFB 3SDCA 4I9WE 1A2YB 5F8QC 4NQDD 4OGAD 2HWZL 1V8HA 2NY3D 2BRRL 1KACB 3KXFD 1ONQB 2FIKB 3SCMC 4JM4H 3P4MA 3VXTA 2WK2A 2DQDL 4NO3A 3HRZA 4ODUA 3SOBL 4J23A 5D7KD 4F15B 2P43B 4PLOB 4K7PY 4HS8L 4D0CA 2BY3A 4QOKD 3HC0A 4GRWE 4P5TD 4Z0BH 5EOCH 4TTGA 2P5WA 1DL7H 1KELL 5F7LB 4KI1A 4ZAKD 4JFFE 4Z78A 4ZYKA 2E9IA 3OG4B 2AS5M 2VIRB 4I48B 1G6RB 1DQLL 2BVPA 4U1HA 3BP4B 2YKLH 4YH6A 3GSUA 2X41A 1WZKA 4WI3A 3RWIA 2VZ1A 3EGSA 4MAYC 5GGQH 1QFOA 3JVGA 1C08B 1F2QA 2XYCA 1YPZB 3WKML 3LMJH 4ZO7A 1NBQA 3EHBD 4XAKD 5INCB 5FUOH 5I16A 35C8H 4KJQC 1TZHA 4YDVA 3TN0D 4NDMA 5TQ0L 1IEBB 3TH4T 1G9NL 1GIGL 4XC3H 1NC4D 1UQSB 1H3VA 4JG1L 1KIQB 3M1BB 5EORH 4F7CA 2PO6D 2EIZB 1BFTA 1J8KA 1DBJH 3NGBB 1J1XL 5D8JH 3WS6A 4NOBA 5I1IL 1HQ4A 4OD2A 5F9AC 3MLWL 5FKAA 3MCLL 5D93C 5BS0B 4MA1B 4IBLT 1MJ7L 4LGSB 5T1DH 4G43A 1X5XA 3QNXB 4KV5E 2AI0L 3BVNB 3MNVB 2G75B 3OBAA 3LKSB 1KJMB 3RWGA 5IM7B 3WIIH 1U3YA 3KPNA 4IS6B 2HJKB 4C4KO 3TO4D 4MJIA 4TTDD 4JFHE 1LO5B 1JTOA 4QKXB 4GLRI 25C8L 2UZXB 3BO8A 3NPSC 4XWOD 1YEJH 4QXGH 3BD5A 3O9WC 3QXAB 4TN9A 1M05B 3QWRD 3WNMA 4KTEH 2C4FT 3IFOA 2GTZA 3O6FD 1JFQH 3DYOA 3BQUD 5I71B 2ZOKA 3CSPA 5FGSA 3N0PB 1ES0B 3MA7A 5DRXB 3U0WL 1NMBL 1PGRB 3O0RL 2FYYB 2HT3C 4KROB 3ARDB 5JPNA 2GSGA 5IB4A 3ULVD 4MNHB 4ZPVA 3MBED 4X83A 5CSZB 5GS1A 3ZDXF 2XQBL 2OTUB 1N0XH 3BN9C 1U92A 5DC9B 3BMWA 3OKEA 1OSZA 3QIUD 5EU6A 1ZV5A 4ZFOB 3TCXA 4Y5XA 2DBJA 5J13C 1XR8B 4YAQB 4KVNH 4XP6H 3HZVA 4LEOB 5DD3H 5E99L 5EUOA 5B38B 5ITBL 2CRIA 2P1YA 1ZT4A 2F15A 2HA1A 3QDAA 1JBJA 2CR6A 3R1GL 3GSNB 3VA2C 1AD9A 4KK9C 5EZIL 2IWGA 2RB8A 2NCMA 3MJ8B 4UDTB 4I3SL 1DE4A 3IDIB 1OD7A 2YEZA 3HE7D 5T33H 1BZ7B 3ARSA 4Y19E 2XA8L 3Q6GH 4JHWH 4Y16B 4XNUH 4G5ZH 2NXZD 4X4YB 5C0RL 3W9DB 4OGZA 3TA3B 2DIBA 2BOBB 4QCIA 4U1NB 1QSFA 3IKKA 4KKBD 4LVOC 4W70A 1T7ZA 3GMLA 4OZHE 5F96L 1ETZB 3CCHA 1AY1H 5DTFB 2BXZA 4DQOL 5HHXH 2HTLD 5DJCA 5I0DA 1CZ8H 1AD0A 4XXCC 1HZHH 3H9ZA 5DQ9B 2J2ZA 4P23A 1HCFX 3MRGA 1FV1A 4YBLC 1J10A 1JZ4A 3MRKB 3G5VB 3CDFA 2QTEA 4YDIL 1YNTB 3GZKA 3MXWH 3TBWB 3MNZB 3PF2A 3RPIA 5C0FA 1A3RL 3KHQA 5CBEA 2FX7L 1LO3H 1CL7L 3RVWC 5C08B 5T5NG 3RTQA 1RHHA 1S7WA 3SCMD 2Y1VA 3K2UH 3VFGL 4RFEA 5MEND 1YQ2A 4HJJH 4OD1L 2XNAB 3B5GA 1KC5L 4HUKB 5EU7C 2VR9A 2YSSA 4NCC2 3JXAA 5IB5A 4PPTA 4N8VA 4TVPE 4HXBL 4M93C 4ZFFB 1H3UA 1A2YA 1CT8A 5DD0H 3IVKB 1TJHH 4PJ7E 4EDXB 3C8KB 1GPOH 4MAYD 5BQ7B 3QDGA 4FQCL 1SJVA 2ARJA 2EYRB 2FZ3B 4P46B 4JLRB 1GJIA 5GRXG 1MCDA 4KJQD 3WFCH 3WFHB 1CD1A 3V52L 3X3FH 5CJOL 5D6DA 4RDQG 2B4CL 1LE9A 3WHXA 1K6QH 3TWCL 4FQHA 1UXSB 3VXSD 2DJSA 1PKOA 3T1FB 5F21B 4NO0B 1T1ZA 1SM3L 2VIRA 2P49B 3QUXC 1G6RA 2XZAL 2CIKA 1VPOL 1IGCH 4GS7B 1SY6H 5DVLA 1GGIH 1KGCE 3UYPA 4G6AD 5BZWA 2Q76A 1VFAB 1VFBB 5GGRY 1AO7E 3WIHL 5B3NA 1I8IB 1CI5A 3IDJA 4JRXD 2C1OA 4HHAA 3KPOA 5TFSL 4L29B 4Y1AD 3O3DB 5DUPL 2A6KB 4LCYB 3TPUB 4O9HH 2R1XB 1K3IA 2AQ1A 1ZLSH 4J8RB 3E6FB 4KKCC 3M1BA 3QPXH 4IRZH 3V7AG 3O2DA 4GRWB 5HJ3B 4V2BA 2E8YA 4OV5B 4Z95L 3CVIL 2IC2A 5CJQH 2GUOA 4JFFB 2P48B 5KN5A 4M7JH 3SDAB 5CP7A 4ESKA 1JGLL 5E2JA 1IQWL 5HBBA 3QDMA 4Z8FH 4RCAA 1FC1A 3GI8H 2J1KA 2EDXA 4ZFGH 4JCLA 1Q0XH 1FZMB 4DZ8B 4KH2A 5EO0B 5HHOD 2BNQD 4ODWA 3HNTH 5GGTA 5DJYB 4ZPTB 2F53E 3DROB 2P46B 5B8CC 3O9WD 1H3TA 3KR3H 4QRRD 5C6PB 4KRPB 3G6DL 2G75A 4N90D 3IS1X 3CVHB 1NC2B 1RMFL 3ARFA 3VCLB 4MNGE 2H9GA 1TVHB 2H32A 1FO0A 4JVPA 2UVEA 2JJVA 5IB3B 3N50A 4IS6A 2QKIA 1V05A 3WYRA 1JF6A 5B4MC 1OAKH 2CH8A 2SEBB 4R9HA 4P2OD 1CDBA 3ZLQC 1LO5A 4BUHA 2HT3D 3FQNB 3MYJB 5FK9B 4HIHA 1KB5L 1ZGLB 5TDOB 2BSTB 3ZZ1A 1YEEH 3E1F1 4KUZH 3TBYB 5DEGB 4XVJL 3VWKB 3BN9D 1NDGB 2ARWA 3OKLA 2EDWA 3NIDE 4XGZB 1DFBL 3CXHK 1U8NA 4XC1H 1IM3A 4RMUA 4XPGL 4YIQA 5F88B 4YUEH 1OGTA 43C9A 4R26H 1OARH 5DRXA 5KSVB 3QFJE 2B4CC 1R0AL 4XPFH 2FYYA 3ARDA 4YEEA 2EE9A 3FHQA 3QDHA 4MNHA 4KK9D 3MUGA 3LZFL 3ZKQD 3D0VB 4Z77B 4WFGD 4HIEA 4JO1H 3QFDB 4HS6B 2CKBA 1RJCA 2OTUA 3FO0L 3SBWA 1UB5A 3T2NL 4C56E 5GQBA 4RWYH 1C7SA 2VLRD 1CG9A 3T77B 4LEOA 2AXGB 1NJ9B 3CLFL 3WFDH 4JG0H 5B38A 1UCBL 1EJ6A 5D5MF 3QI9C 3KPQB 3Q0HA 5D1ZC 4E9LA 1BQHG 4RMSA 5ITFB 3KHOA 3V6OC 2KPNA 3FCTB 2EEDA 4G9FE 1EO8L 1JNNH 3DUUB 2EZ0C 5ECJE 4I0PC 3FRPG 1MH5B 2BP3A 3SGJA 3U46B 4Y16A 3MROB 3X3GH 4S1DC 2IGFL 3BZEA 3W9DA 5ID1B 3GMRA 4PJCB 4OIBA 1Q9KB 4U1NA 4HJ0C 4P59L 1NFKA 1DQDL 2BERA 2I60L 5LCVL 4PJFA 2Q8AH 1EXUB 5LQBL 4YBHA 3UTZA 2HAZA 2B5IB 5DQ9A 3VFOB 1QPPA 3LH2L 1VSCA 1A6TA 3B9KA 5L9DH 2A0LC 3CX2A 1DBAL 1FFQA 3OPZH 1PG7H 1J1PH 4GSDH 4LAQH 2E27L 3MRKA 4M02A 5HDLA 2V2TA 2LABA 3G5VA 3TIEA 1OP9A 3MRCA 4U1MB 3EJYC 1YNTA 1XZ0B 4KKLC 3WNKA 3D1MC 3FQWB 5JOFA 3GSVA 4K2UH 3EFDH 3ZYJA 5T1KB 4HZLB 4PB0L 4U3CA 3UTSD 2Y36L 4Y19B 4ZTPH 1NMCC 3VFWA 5HI5C 3IGAB 3T04D 4OJFL 5DEFA 3VFSA 3VFNA 4FQLH 3GSQB 5SX4H 2WIIA 2ADFH 3V79C 3BDYL 1ERNA 3H7BB 4XTRC 4HIXH 4WW2A 5DJ6B 4GOSA 3ZT7A 1J5OL 3LKPA 1F58L 5AYUH 3WJLA 1NQBA 4GKSA 3UZVB 5BVPH 1NCBH 1H3WM 3QCUL 3QUXD 5KS9A 3IVKA 4F7EA 4EDXA 1Q9LB 3DX7B 3UPCA 4PGDA 1CWVA 4LKXA 3MLZH 2EYRA 3SKJH 5F3HB 7FABH 1G84A 1YY8A 4P46A 4QRQA 3BYYA 4YC2C 4NRXB 1OHQA 4JM4L 4F9PA 1LILA 5EOTB 3IETB 3RL1B 1ZAGA 1RZGA 5EDXA 1G6RH 1A6AB 3WUWG 2YD5A 3OX8A 4Z0BL 1J87A 2WBKA 1DZBA 3I3EA 4KKCD 5EOCL 3MUZ1 3BZFB 1T2QH 1TTUA 3PHQB 5L6YH 3BUYB 2ZZUT 2DI9A 1A5FH 2YKLL 3J8F7 4IDLA 1I8MA 5KAQF 4OF3A 5GGQL 2NNAB 1I8IA 4AEIH 4PJ7B 5GHWH 3MC0A 5ABDE 2X7LB 2X09A 3D69A 4QHUB 3LMJL 3TPUA 5FUOL 35C8L 2R1XA 3O2DH 5LXGH 5ACLA 3MGTA 4WV1A 5LBSH 3E6FA 4AEFA 4XC3L 5AAMA 1U8IA 5HJ3A 1YJDL 1KIUA 4UBDD 5EORL 1AJ7H 4O4YH 4KXZI 4Z7QF 4JFFA 3TGXA 1DBJL 3HNSH 1OPGH 5B4MD 3MGAA 4Q6IB 5GRWA 5EZLB 5A3IC 5GGTH 1YNLH 1RUQH 3MRDB 2WIMA 3VG9C 4XCNA 3VXQA 2FR4B 3LDBB 4ZPTA 1AO7B 5HGHB 4YHPB 3HG1D 1A7RH 5TE7L 2H32H 1FO0H 1VGKB 5T1DL 3CVHA 5EA0H 1NC2A 1AKJD 4Q0XH 1S7XB 4XBGA 1IGJB 4ZUWB 1YN6A 2O5YL 5CWSB 4O2FA 1Y6NR 5T3ZH 5IB3A 3IF1A 4KDVA 5C09A 2SEBA 3I6GB 4OGXH 3WIIL 4GW1B 5DD6B 4H5SB 4XB8A 3IU3B 3VXMD 5D7JB 1EVUA 2A74A 3C8DA 1A1NA 1BQUA 3OJMB 5T1LA 1F8TL 5TDOA 3IFLH 3TBYA 4FQJH 5DEGA 3MLSH 2W91A 1KJ2L 4AJ0A 4ZDHB 1I4FB 3DIFA 1NDGA 1PEWA 1YEJL 4QXGL 3VG0H 3FT3B 3MRBB 4KTYA 5LVEA 1X5HA 2F53B 4KTEL 3T0AA 1CDCA 3DXAD 2VUYA 1JFQL 3SY0A 4PREA 2ZG2A 3QI9D 4MNGB 1R24B 1MOEA 1F6LL 5D1ZD 5FA4B 2CKBH 3LV3B 4AL8H 3TBSB 1LK2B 5F9WC 2W38A 5J12B 4Z77A 2Z93A 5HGGS 2BCKA 1NBZB 4UT9H 4Z0XA 4N1HB 1A64A 2EZ0D 1RIHH 4KRNA 4OI8A 4HKJB 5CZKA 4PRIE 1N0XL 4S1DD 4GKOA 3D0LB 4M6AA 3G6JF 3RNQA 3T77A 4HMEA 4CADA 3VMOA 4H25B 2AXGA 1NJ9A 2L4OA 3GSNH 1FSKC 1XF3B 3GSOB 4HJ0D 3BMVA 4G42A 2V5YA 4KVNL 3K1KC 4CJ1A 2DWEA 5DD3L 3SQBA 3T0DA 5DFVC 5C9JA 1I7ZA 4L4TA 3P4NB 3PP3K 4WI2A 1QA9B 3FCTA 4L4VD 4NQEE 3QFJB 5DFTA 3DUUA 5E8NB 2A0LD 2YA2A 3CFDA 1CGWA 5HHMD 1P2CA 4OGYH 3HCVB 2EH8L 5CUSL 4HSQA 3EJYD 3JV5A 3TM6A 5T33L 4KKLD 3MV8E 3Q6GL 4JHWL 2YD9A 5C0CE 4WU5B 4G5ZL 4C56B 3REVA 5HI5D 2XKSA 3I75B 1SJHA 2OS7A 3EBAA 5LKNA 5JW5B 5FYKE 4J3SA 1UJTA 3Q6FB 4OBRA 4XTRD 1AY1L 4JHZA 3T8XB 3KLHC 3OXSA 5HHXL 3VRJB 2R2HB 3JWNC 1CZ8L 4LHUA 5I75B 1MCIA 4NQCE 5CLWA 1HZHL 1SEQL 1KF9B 3FQWA 1LP9F 4G9FB 4GBXB 4JPWH 2VKXA 4C54A 3MNWA 2ZCHH 4HZLA 3BZDA 3MXWL 3IGAA 2FNBA 5H2BB 3GSQA 1MRDH 1T22B 1LO3L 1TZIB 1S78C 3MRLA 1A22B 3K2UL 3B9EA 2R4RL 4HJJL 1QLEH 3BPNB 4OZHA 2FBOJ 5I17B 4DGYH 4X9BA 4Q58C 2P44B 1HDMB 5E6IA 2PN5A 1QEWA 1OP3K 1T0NA 3C6SB 1I1CA 5D7LE 3QCTH 4M8QB 3PL6B 2OMNA 2MQCA 2DQGH 1U3HC 5DD0L 4EVNA 3IJHA 4RAVB 2JB6A 5L2JB 1N6VA 2FX8H 1GPOL 4M48H 4NRXA 5EOTA 2WAHA 3RL1A 2I07B 1UWXK 4N0FB 3TLRA 3RVTC 3HZYA 3WFCL 1F6AA 3X3FL 4RA3A 2XY1A 1C8PA 2X44D 2E9WA 2F5BH 1OWRM 3INUH 1ZT7A 2HH0L 4BSVA 4N1CA 4S0TD 3PHQA 4RMRA 4U7KA 3B83A 4XPHH 5D96C 4G7YH 1FG2B 4ELKB 5FO8A 3MGOB 3W9EB 4JY4B 1IGCL 1WAAF 1SY6L 4DN3H 1GGIL 3D3VE 2XWBA 5A3ID 3S98A 2X7LA 4KQ4H 5BOPA 2FGWH 1VHPA 4TUJA 1W0WB 3SE4A 1K5NB 1E4XH 5KOVC 3FT2B 4NO5B 4E41B 2DQJH 4GRWH 5HHPB 3RBSA 5B38G 3O41A 3BPLB 2BJMH 4O9HL 2Z92B 5D1QB 5GJSH 4HUXA 1OAQH 4N5UA 5I19H 4P57B 2BSED 3QPXL 4IRZL 5D6CA 5IV2A 4K3EH 2JIXD 1ZWIB 3MOAH 4JJHA 4AG4H 1NLDH 5EG6C 3NCYP 5TH2B 3ARBB 5AAWA 1BP3B 1FYTE 3OR6B 4NJ9H 4JGJA 1UZ8B 4PJHF 4M7JL 1JYXA 2GFBB 4R0LA 2MNUA 1SMAA 5DRZB 4F7TB 5JPMA 1LHZA 4ZFGL 3ZT5A 3NZ8B 1AO7A 3CVHH 3RJQB 2R56H 4N68A 1H3XA 3BGAA 4F3FB 2G2RB 3HNTL 1ZGLM