3EFFB

The crystal structure of full-length kcsa in its closed conformation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
224
structure length
219
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNISSYSIHWVRQAPGKGLEWVASISSYYSSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARQPSYHMYSWWVALDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB
publication title Crystal structure of full-length KcsA in its closed conformation.
pubmed doi rcsb
molecule tags Membrane protein
total genus 36
structure length 219
sequence length 224
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3effB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3effB01
2BDNH 5EPMB 5KW9H 5I1KH 2FX8L 2F15A 5FUOL 4DAGL 3OZ9L 4F3FB 3EYQC 1DTUA 1DSFH 2CMRH 1J0JA 3S98A 4HD9A 1KBGH 2L7JA 3KYKH 4PRHE 2OCFD 1DZBA 3JWDL 4HPYH 4HWZB 4PRPD 4WFHE 4P48A 3NIFF 1WZ1H 3FTGA 1ERNA 1F3DH 1PVHA 3P11L 3LDBC 5HYJE 2AGJL 2AKRA 3TGXA 2AS5M 1EZVX 2K9UA 4RZCA 1CU4L 3N85L 1PKQA 1UCBH 5F8RC 5E94B 4NKQB 2DWEB 5E8OB 1XF2A 4LF3A 1G7MA 5KSVB 3PL6C 2IGFL 3NACL 4ELMB 4BFIB 5KOMC 3IXAA 3QR2A 4D0CB 2EYRB 3IDUA 5T3ZE 1FYTD 4UTBH 3T77B 2FD6H 4K9EL 4GKSB 1V7NH 5C0IA 4I9WD 4PJ8A 4LLVB 4AZ8A 4J6RL 5I73C 2W9EL 4NUJB 4YDIH 5ESQB 1AHWC 5SWZA 3VXOA 2QHRL 1F2QA 3AREA 4TVPH 1NCUA 2CIIB 4XB7A 1KB5H 4ODSL 2LVCA 3BVNB 1Q1JH 5ANMA 4OGXH 3PQYE 4K7PY 1MAMH 4XNZC 5JOPD 3TLRA 3EDJA 4J8RA 3RNKA 4ZPVA 2X4RA 1INDH 3BAEL 5E56A 4OZIB 4O58H 2VXVH 3UO1L 1KIRA 3FHAA 1TVHB 3CX2A 3N1GC 5DD5H 4KDVA 1EHLL 3O3EA 1D6EB 4U05A 3BUYB 5I74B 5LBSH 3O8XD 4YPJA 1JPTH 3CSYA 5I1CH 5SX5K 2BNUA 1BBDL 2EXYC 1DLFL 4LAJH 3H7BA 5B39G 4JN2B 3L3HA 3FN0L 1X5FA 4N9OB 2R2BB 3HAEA 5BZWB 4PJAE 3O4LA 4GBXC 5CEZE 4EQ3A 1QLFB 3DYMA 1R3LA 1HQRA 3QHFL 3T04D 2VDRH 2FEDD 4MMXC 1OF2A 2DLHA 3FT2A 1UQSA 2Y9RT 1I9IL 1CDGA 1I3UA 3ARDA 5I1HH 4HBCH 3NTCH 2QSQA 5T3XL 3VFOB 4HIEA 5E8EB 5HHMB 1KN2H 3A6BH 3K2UH 1C16A 2P5ED 4K3HA 5CJOH 5CZVL 5IBUB 3RUGA 4YEFA 1ES0B 2DLFH 4GG6E 5ISZD 1KCRL 1DBBL 1NUDA 3LKQB 3P77A 1SY6H 4BSVA 2DQFA 1U8IB 4OGZA 1NDMB 3C8DA 3I02B 1KPUB 2ZUVA 3HMXA 3TFKD 1S8DA 2R0KL 3O8XC 3PWPD 1U8JA 3ULVF 4KPHL 5H94B 3DLQR 5DHYA 4QOKA 4H8WC 3VI4E 3TV3L 4Z7VA 2DICA 4QY8A 4KK9C 5HI3D 3MNVB 4OTXH 4A2MA 3CUPA 2FLBT 5DRXB 2Z35A 4S1RL 1QO3A 1I8IB 2FEEL 4RAUB 2FEDC 4E5XA 1VKXB 1I9RL 4XP1H 1CT8B 1NAMA 1JFQL 2VXSL 1UACH 2F8OA 1IZJA 1HILB 5D2LA 3MNZA 1F4YH 4RGMB 1IFHH 4P9MH 25C8H 5DHVA 4LARL 1MH5B 4M3KB 4XNXL 4LCWB 3ZE1E 2RAMA 4KRNA 5F1IB 3H3BC 1I1AB 1CD0A 1AGDA 2E7MA 4C56E 1U3HB 4C83A 4EDXA 3IS1X 1W72A 3TFKC 2EE9A 4X9BA 3L1OL 4IRJA 4P23B 2VTFA 4P9HL 1VCAA 3EO0B 2YXFA 1LNUA 3I3EA 3SDCB 2BX5A 1Z6JT 2YD8A 4MNGB 2NW3A 5ALBL 4ZFOA 1FL5B 4WFGE 5IBLD 3J7HA 2YBRA 4DGIH 3DI2B 3LKOA 4S1SL 4PJFA 1KJVA 1N59A 1AE6H 1UZ6E 4HUXA 5BVPH 4RFNC 5HI3C 4QHKI 5AAWA 2XPGB 5C8JA 4L8SB 3QZWG 2AXHA 5DJXB 4HFUL 2Z4QA 1D9KD 1UH2A 2X89A 5T3ZL 1X7QA 5LKNA 2YD4A 1BOGB 1R6VA 3IFNL 1XAUA 1P84K 1ZLSH 3N1PC 2EDBA 1VFBA 3IU4L 5F96H 1NBVL 4LL9A 1UKQA 1B0RB 5IB5A 2IQAA 2XRAL 5IFJB 5HYEA 5I1AB 3RDTB 1SBBA 2DAVA 2W9LA 1KEMH 3FB7B 1MFCH 5TPWL 3RKDD 2UYLA 3WLBB 1F11A 3WKNA 1EJOH 5EC1A 3RWDA 1GPOL 1RZJC 4KMLB 1A1OA 4UU9A 4EOWL 1I8MA 3EOYG 5TF1L 1SM3H 1IEHA 4POZC 5KANG 1UB6B 4QLRA 3MREA 1A4JA 3QO0B 2A6JA 1J11A 3I84A 5CSZA 4PB9L 2APFA 4MJIB 5E03A 2L4OA 5ACZA 1DQQA 1X3DA 4X6FA 3CFDB 3LS5H 5CFHA 1ITCA 1NLBL 2VIRA 4I3SH 3OKYA 4MB3A 5I8EA 1D9KC 3H9HA 3OX8B 1DBKL 2AJXH 2EDXA 1JF1B 2OTPA 3P4LA 2OJZH 1HXMA 3QDGD 2R4RH 5IQ7H 4JY5H 2VDLH 5IFAL 4BQ8A 1ADQA 3DX8A 1HEZA 5D7IA 1JBJA 1BD2E 4P2RA 4U6HA 4LVOC 2KL6A 4ZOBA 4RISL 5EH1A 4TULL 4GAGL 4M93B 3VXMB 1KTDA 3O6LL 1TXKA 3RKDC 4X7CC 1PW3A 5FYLD 1MLCB 1CFQA 4PJXE 1A5FL 5I19H 2HKFH 2XV6B 3NCFB 1A64A 4BA8A 2WBKA 3IGAB 3S3JA 3TBTA 1AKJD 3CFJA 4JO2L 3PP3H 4RMQA 5I74C 5IQ9B 4HH9B 4AJ0A 3GMLB 1TITA 3SEPA 3U7YL 3NCEB 2FGZA 5EU3B 4MAUL 1G0YR 2NY5C 3S4SG 1LVEA 1RJCA 4RFOL 3BEVB 4MVBD 1G9NC 3BH9B 1BIIA 2DTML 1PY9A 2D7NA 4XP4L 5AYUH 4TOYH 1R3JA 3ZKSD 3ZZ1A 5E2TL 4XC3H 2VE6B 1U8LB 4NN5C 1SJHB 4JFDB 3QXUA 3MV8A 1C12A 1RFDH 4DVBA 3U0PB 1DBMH 1TIUA 2Z91A 4JPWL 4N0FB 1VFOA 1I3GH 3T1FB 4NYLB 4QRUA 5IEKA 2XKSA 1CLOL 4LSTL 1A6PA 2FSEA 1UC6A 1NMAH 4LCWD 32C2B 3UJIH 3VJ6A 4PRAB 1CGYA 4JO1H 1I1AD 5HHNB 4G80B 4PJ5A 3PGFL 4YNYA 3OKNB 1H8NA 1YEGH 2DJUA 5IBTH 4IMKA 2BK8A 1WAAE 4OGAD 4FMKA 3BOVA 1I1FB 4X6EA 4NM4H 5SX4I 4XPHL 4PTUB 3K80A 4RCAA 5IMMA 4X5WB 4HJJH 2JELL 4R2GB 5ITBH 1S5IH 1KIQB 1QVOA 2YPLB 3HI5L 4MVBC 1LDPL 3AM8C 4Z0BH 4YK4C 4JFQA 4KJYA 1FGNH 1DVFA 4FMFA 5A16B 3UXFA 3GBMH 5C6WH 4QXGL 4ZTOL 3QQ9D 5CMAA 2HRPL 5DD6A 4A6YA 5DI8B 1Y0LB 2QKIA 2OTWB 3GSUB 1QFWM 3P0VH 2V7HB 3LV3B 4CVXB 2ZP0T 3MJ9L 1RUAH 5F9OH 3T3PE 1XMWA 4RGMC 2VDNL 2X4UB 1D5IL 5K9QG 3NIGF 3FFDA 4XVUD 2Y7QB 3LPFA 2X4OB 3K3QA 3IJYB 2ZG2A 1Y18A 2CO6B 1U36A 5E2UL 3ZDZE 5KVDH 3VDAA 1BBJA 3WFBL 1H3VA 3H0TB 4IHOA 3G5ZB 3RVVD 1MPAL 1UB5A 3LH2L 2CPCA 4WU5B 3OR7B 5IJKA 4H0HB 3MLTA 1EHNA 2KKQA 2CIKB 2M2DA 1NSNH 3S88H 2BC4A 3JV4A 3QJHA 2OL3A 5DMIL 3GSNL 3R06B 2ED8A 3WXWL 4L8SC 4ODWA 3QEGH 1J5OL 1ZLVK 5HDQH 3T0AA 1QRKA 4I4WB 3DBXA 5I18L 1L7IH 1D5BB 2HT2D 1IAIL 4OLYH 3BP7A 4Z7OF 5DD3L 3BN9D 3IDJA 1JYXA 2VH5L 4PGJA 4NWUH 5ADPH 3BMWA 4YDKH 3MRPB 4JJ5A 1G84A 4FQLL 3VGGA 5KJRH 3VXMD 2IALB 2VLME 2EDFA 2G5RA 1B0GB 1MCLA 4M6NL 1KELL 4U1IA 4P59L 1JMXA 4XVUC 4N5EC 4M4RA 5DEZA 4DWHA 2VDQH 3HB3D 4OZFH 3B6SA 4GKNA 5LAXB 3IDYC 1QBLL 1S7UA 5D4QA 3TA3B 3RVVC 7CGTA 4ELKB 5BRZA 4XCCL 5BOZG 1RZKL 3MNWB 1EXUA 3L3GA 5I8OL 5F7UA 4YGVA 1QLEH 3CH1B 1TPXB 4Z7WF 3VXTA 2MPAL 3V5DA 2CK0L 3RUGF 2ZUWA 2HT2C 3SE3C 2WIIA 3OKEB 2QSTA 5DT1H 2YD6A 2FR4B 1MFDL 5BW7A 1F90H 3BN9C 5KAQG 1GYAA 2C1OA 3SDXB 4PPTA 4LKCB 4LCCB 4JHWH 1HHKA 4MA1B 7FABL 1A6TA 3RWIA 5E4EB 4UQ3B 5I9QC 4XMPH 3OB0H 5I76A 4IM8A 4M6OH 4Z78B 3S35X 2ITCA 2VXUH 1A21A 1IKFH 2Q20A 3V6OA 3GGWA 2AJ3A 1YQVH 3WJLA 5CIPH 4XXDB 3MRIB 3HB3C 1FIGL 5C0EA 1CDBA 1RULH 5D8JL 1FC2D 3K2MC 5LGHL 1KB9J 5SWSE 5INCB 4XCEA 3RVUD 3SO3B 2YUWA 1HWGB 4R2GD 1K6QH 1E4KA 1MAJA 1DBAH 4X0KB 5B8CC 5L2KE 2FNBA 4JHAL 4WV1B 5FGCB 5CEYB 3MCKB 1F4WL 3LRGA 1EGJH 4EZMA 4OF3A 1NC2A 1PLGL 3DXAE 3JXAA 4NQDE 5CD5D 1WEJL 3HCVB 1FFRA 2VL5A 1AQKL 1J7VR 3VFMA 4L9LA 2DQJH 4OIAA 3RY5A 1U8PB 4LSUH 3N9GH 2UWEB 3P4NB 5BO1L 3OXRB 2VKWA 3MJ7A 3IAGC 4RFEB 5GS2D 3ZYJA 2C3VA 1HNGA 2NTFB 2ZG1A 1A7QH 4CRPA 5FOBA 4F8QA 3AU1B 3ZYOA 5JOFB 1GGCL 4I3RH 1I4FA 3QXAB 4JO4L 3KYNB 4OCWL 4HF5H 1ZVYA 3UDWA 1KB5B 2CUMA 4LHQB 2FHBA 4XPTL 3FRUB 4G3YH 3RVUC 3W0WE 3IDMB 4R2GC 4WEUD 5T1DH 4AEHH 3X17A 5DWUL 5JR1L 4DKDC 1T1YB 3MBXL 1F4XL 2CKBH 5DJZA 4JREB 1YPZA 3WNNA 5CD5C 3T0DA 4X6CF 5JXAH 2O5XL 4B5EA 3GB7B 4FQQB 3MV9B 4R7NB 1ZT7A 5F93C 1Z9OA 5GZND 2WBJD 1YN7A 3EYSL 3LHPL 3ARVA 5DJYA 1A8JH 3DNKA 4W68A 4DKFH 1JWUB 4DVRL 4L3CA 1LD9A 3GI8L 4WI6A 3QUKB 4HX1B 3HMWL 1JGEA 3BT2H 4AQOA 2BY3A 1YJDH 4PGCA 2Z93B 4QHLA 4ZUWB 4ZO8A 1NCNA 4OM0L 3QA3B 1FV1B 4XPFH 3TA3D 1YMHB 3VGDA 4D0BB 2XWJA 3LQZB 4Z9KB 4NKDB 4HK3J 3VD7A 2Y72A 1EBPA 4M5YH 3WO3B 4P5KA 2AQ1A 3GRWL 5ENWA 5I8KH 2ZCHL 2PO6A 4DK6A 4GUPA 5HGDB 2D7OA 4J2XA 4L1DA 2OI9B 2GTZB 4XVSL 2YUXA 3QG6A 1G6RA 1R5IA 1NEZB 4JG1L 5CCKL 3KPPB 2UZIL 2W65B 3SGKA 2VQTA 2D0GA 4OV5A 2XKNB 5IVXA 3NZHL 4BQBA 1BZ9B 2Y1VA 1H8OA 4PJBB 2A9ML 4M8QB 2WBJC 5MI0B 2CLVB 4RX4A 3LZFL 3HE6B 5GGQH 1RIUL 1QBML 2DMBA 2MQ0A 1U3JA 1FJ1A 1WUNT 1BFVL 4F7MA 3I6KB 4M1GH 3QCTH 4NRYB 3NA9L 1A9EA 1HHJA 1MCBA 1A6AA 3LS4H 6CGTA 3MYZA 4DKAA 3IETB 2H8PB 4JQIL 2HVKB 4S1QL 3SE4A 4N1CA 5K9KB 3U7WL 4JRXA 1QD0A 4RIRA 3O3BB 4UIKH 5FYJU 4WHDA 4BZYA 4BH7B 5C2BH 2FBJH 4PBXA 3VXNA 3VXUE 5SV4A 3LN4A 4XH2B 4G9DA 2OQJA 3JZ7A 4PG2C 3VXPB 2BNQD 2WLZA 4ONGH 2DQHL 3HAEH 4HUMB 3BHBB 4YHIA 5IMOB 4YWGL 4RGNC 3W39A 3GJEA 2VLJA 1URLA 3PWNA 4LCCC 1QR4A 1AO7D 5E4EC 1V8HA 3L7EA 4AK1A 2BJMH 4JRWA 3ARBB 5IR1B 5L9DH 3HNTL 2VXQH 3H9ZA 2MHAB 3T4AA 1MCOL 4P57A 2J4WH 2Z92A 1IRAY 3HMXH 4NGHH 4P4RB 5DRWA 5INDA 4PRIA 3A6CL 4V1DA 3SO3C 2YKLL 3U2SB 1T7YA 2MTPA 2HKHL 1DQML 1MI5A 3NVQA 4U6YA 4G5ZH 1UM4H 3TWCL 3BEWA 4FABH 2V2WB 3SY0B 3MJ8A 1QSFA 3HS0A 2DWDA 3STBA 2R2CA 1DQJA 3R4DA 1IAKB 2CRZA 4Q6YA 3S35L 1JZ8A 4MAYA 3C5ZB 5D7LE 5C0AD 4YE4L 4JY6A 5LCVH 3PJSA 1L9NA 1KN4H 1FVCA 2G9HA 1KENL 3MV9D 1NAMH 3MLSL 4XGZB 3TESA 1ZS8A 1KLGB 1JN6B 5EZIH 2DTSA 1X5IA 1CGWA 2DLIA 3VFNB 5CJ5A 4Q9BA 5CLWA 4WFFE 1INQA 2CDFA 1I8LA 2JTDA 2OK0L 4YHML 2ADJB 3MV7A 2NY0B 2DDQL 3G08B 4HPOH 1J18A 4WTWA 3EFDL 3IFLL 4ONOA 5C08D 3R1GH 1ZHLB 5I1JL 2APBA 3TO2B 4NNYA 3ULUE 3DGGB 3ARGC 4EBQH 2BSSB 2HFEB 4KTDH 3O9WD 4LU5H 2VR9A 2EE2A 5IMLA 1QR1A 3TCLB 3MRQA 4S0TD 3FN9A 5GJSH 2VLKB 2QADB 2YD3A 3DI3B 3ROOB 5HTSA 4X8JB 4HXAL 3WFHB 2V2TB 5AUMB 1RZIA 2B1HL 1AY1L 4FTVB 1RU9L 4OIIH 4PS4H 1OLLA 3F12B 2XNAA 4UQ2B 4JREC 5HGAB 2EYTB 3IU3B 1IAOB 3FB5A 3DPBA 1T1XA 3IKCA 4LDLB 4TSCH 1P9MA 4GMTH 5DVLA 1YNLH 3DURA 2Z0BA 3CFKA 4PJHB 4FQ1L 1HI6A 5T1KB 1Q9OB 1UEMA 3HN3A 4WNQB 4MNQE 1BJ1J 4G7YL 3U1SH 4MLIA 5GSRB 2YA0A 4JVWA 2ATPA 3WFEL 5JW4R 2X4NB 1F6AB 1MF2H 5IOPB 1WBXB 3BD3A 3R8BB 2PNDA 3S5LB 4N1HB 4PJIA 1H0DB 5J0BA 3S3SA 3O9WC 4MCYB 4PGDB 5A43C 2OI9C 2ZCKH 1OQXA 4G42B 4OLZH 3T0EC 15C8L 3LIZL 3TVMA 4P2OD 3QUXA 1UYWH 3LAFA 2R9HD 4H5SA 4ZSOB 3EYVA 2YPVH 1UM5L 4NQXA 1CDIA 2QJDA 4CMHB 5FB8B 4Y5YA 4FQCH 4PG9B 2NZ9D 3F5WB 4IS6A 4OAWA 1IAMA 5DQJB 2EDYA 4LPCA 3ILQD 2NZIA 5MERB 5LXGH 1WISA 3OJ2C 1AJ7L 5C0JB 5IB2B 5MI0C 4ZUVA 5J57B 2QQKH 4X4YB 3ARBD 4NCC1 1M4KA 2CUIA 3IDIB 1CN4A 2P8MA 1CG9B 4Y19A 4KK8D 4FFWC 3HZMB 5F6HJ 3P30L 3LKPB 1P69B 3PHOA 5B3JF 1SVCP 4WW2A 1CGXA 1AI1L 4CU8A 3QJFB 3PIQA 3STLB 1I1YA 3QDJE 3CLFL 2QR0A 3O6FB 1FGVL 1TTFA 3AMKA 3QCVH 4D9RD 5CJXA 1KGCE 4N0UB 2FL5A 3ZTJH 2DJSA 3TC9A 3HPLB 1MJJA 1Z9SA 4YIQB 1J8HD 4YUEL 3ROLA 3KPSA 1T3FA 2RFXB 1S7VA 1ZHNA 4P2OC 1D5XB 3KXFB 3RZWA 3C87A 2R9HC 2R1YA 4HK3N 4IIQA 4FQXB 3VXRB 4NZUL 4OCMC 3OR6A 2A77L 5ABDE 4UMGA 5CKAA 1P6FA 2AJVL 2A6IA 3GNML 2NZ9C 4LCUA 5EUOF 5I16B 3ILQC 1I7TB 4Y7MA 4ODXB 1IVLA 1IEBA 3L5WB 2KPNA 3ARBC 2ICWA 4QRRE 4UT7L 4JFPA 1G7PB 4Y88A 4QHMA 5KS9E 5D6DC 1CYGA 1D6VL 2NY0D 1U9KA 4H88L 1QG3A 1JF6A 2EO9A 3GMOB 1L7TH 4GQPH 5I30H 1FORL 2BDNL 5A2JH 2FO4A 5BVJA 5I1KL 3A0OA 4UT9H 4OZHB 1B6UA 2IPKB 4J1UB 4QF1A 5J6HB 5A2LH 2SEBA 2D7MA 3D0LA 4NN6B 2DI8A 1QYGH 1DSFL 4LOUC 3GFUA 5FGSA 4GRWF 1CL7H 1JUFB 3MRKA 4Q58C 5IIEB 1KJ2A 2XWBB 4I77H 1TCRB 2HTLD 4L1HA 4P2CG 2VLKD 2QADD 4I2XA 4XNQB 2DQTH 3RWJB 4L4TA 4JPVH 1QFOA 1FFQA 1BIHA 5JIHA 4FTVD 4OZFB 1JZ7A 3MODH 2E7LC 2ERJB 4PJCF 1WZ1L 3KYMA 1FLTX 4JAMB 1XGPB 4A6YH 1JK8A 2FIRT 1UCBL 4P3DB 4JZJB 1KOAA 4GG8A 4O2CB 4ZFGL 5GGVH 5E2WL 1FG2A 3UJJH 4HWNA 3QIWA 4R26H 3T09A 4WUKH 4WWKA 4UTBL 2NY0C 3UTPD 3V4PL 2JCCA 2FD6L 1M7XA 3BYTA 2NW2B 1LO2H 3TNNB 4WFEE 1V7NL 1IGCH 5E9DD 3QIBC 3STZB 2R2EB 3PGCA 2EDLA 3BGFB 4YDIL 1MHCB 4AH2B 2EEAA 1RUKH 4TVPL 5IVXF 1UXWB 1KB5L 2R23A 4U2ZA 1ZEAL 1Q1JL 2OL3H 2B0SH 2HJLB 2HTLC 4OGXL 4ZFZB 2QADC 2A73B 4MHHG 4Y16B 5CIPB 5C0CA 2J6EA 3G9VA 2QSVA 3VXSE 4HS3A 2I27N 5FKAA 5JA9A 1DQTA 2VXVL 4J3TA 1OAZH 4N5UA 5E0QA 4M4PA 1X6NA 3ARRA 3BKML 4QCIA 3X14B 1T83A 1PYWB 5DD5L 4MLSA 1EAPA 5ESAB 3IXTB 4FQHB 1CIUA 3FFCB 3MX0A 5LBSL 1P2CA 3NIFE 1JPTL 5I1CL 3KWWB 1SYSB 3JVGC 1A3LH 2E7HA 1BEYL 4OKVA 1R3HB 4LAQH 1U8HB 4JJHA 1T7ZA 2WUBH 4G8IB 1OGTB 3BIKB 5D1XB 1EX0A 1GZQA 4NSKB 3LPGA 1CXHA 5E5MA 2GW5A 1QFUH 4P0DA 4NKIH 1Q0YH 3Q3GB 1Y6MR 3UTZA 2QV2A 3NZ8B 1H15B 1ZSDB 1A4KB 3LKNA 3NTCL 4HBCL 5D9SA 3UPRB 3ELAT 3K2UL 4LCYB 3UTTB 1S3KH 3V5KA 5D2NB 3CFCH 3DJ9A 4OSUH 5FECA 1X5ZA 2DLFL 3KXFD 1GOFA 4HUVB 2VLRB 3O41A 4FQXD 3VXRD 4D0DB 4GRLA 4K3JH 4MX7B 1KCUL 4Z7QE 2FJFA 4ZS6D 5IV2A 3PV6B 3SCMA 4NQCD 3DO7A 3D39A 4OQTA 5EWIH 1FC1A 4IJ3B 1G7LB 3X12B 3O6KH 4L4VA 4Y4FB 2HTKD 1XGUA 4ORZC 4KV5F 2WV3A 2XTJD 2B2XL 4MJ5A 4Y4HA 5EOQH 5EN2A 3DETC 4FXGA 2J88H 3BGAA 4G6AD 5FF6A 2Q87A 1BJMA 3S34L 5DS8A 4MXWH 4XP1L 5IKCB 3I9GH 1DLHA 3GMPA 2J8UB 4KRMB 3QRFM 5F7NC 1UACL 1OGAA 5E6YA 2CQVA 3GSWA 4LLUB 1XT5A 3V95A 1MLBA 2AXJA 4DCQA 1F4YL 3FTGB 3NFPA 1IFHL 4P9ML 1QSEA 4FQXC 3UPCA 2AKRB 5FM8A 4RZCB 3BKYL 5C0DB 4IOIB 4LQFH 4X80H 4ZS6C 4UAOB 5CJ8A 3WHXA 4LF3B 1G7MB 1OARH 4PJDF 5KN5A 4IRZH 5ETUA 1OAKH 4PRBA 3IXAB 4KJQD 3TYGH 4QRQB 4LRNL 5TGBA 1FL3B 3MRJA 3M1BA 1AE6L 3ULVE 5BVPL 5C0IB 2CDGB 4PJ8B 2XTJC 2IWGA 1OAUH 3D2UA 5ICZB 1IKNA 1ZGLM 1DANU 1MJ7H 5SWZB 3VXOB 1AP2A 4JM4H 4G6AC 1EHAA 4UINH 5ANMB 3LSOA 4XNYL 1Q72H 4DUVA 2CD0A 5L7XH 4TTDD 4QHUA 3THMH 3DO3A 5FV1L 2ZOKA 5H37G 4ZPVB 1BFOA 2P5WE 9CGTA 1NMCB 4Y16D 1FYTE 2L7UA 3G6JA 3GBNL 1MFCL 3AXLB 1OAXH 1KIRB 1FFOB 1TQCB 1I9JH 3AB0B 5B3NA 2Q76A 4JRYA 2MQCA 3O3EB 4BK5A 4E41A 1R3IL 5GJTH 1SM3L 3VG0H 5EO0B 3RIFF 3WXVL 4NNXA 2BNUB 3DVGB 1ZOXA 4KQ3H 1J1OL 3H7BB 4KJQC 1UJ3A 1YEIL 2YWZA 2VSDA 4PJIF 3HAEB 2XIDA 3O4LB 4ORGB 5FO8A 3AS2A 2BRRH 4XI5D 1RHHA 5D1XD 4FQJH 3X3FL 4X7EC 1BVLA 1HYSD 4NPYA 1KXVC 5HXMA 2FHFA 1OF2B 3TO4B 4B7IA 1UQSB 2Z31A 3TT1L 1FO0A 1O7SA 2OJZL 3BGFC 3EIFA 3V7AG 4JY5L 5DJAA 2VDLL 3P0GB 4GXUM 1C16B 4W4OC 1H3GA 2PYEA 3AGVA 4HDIA 1ZLUH 5JHDD 2ZCLH 4FRWA 2OR9H 3MCLH 4KRPD 4Y16C 2YK1L 1LO5A 1G6RH 4BSVB 3SKNA 2DQFB 2VLRD 5I19L 2NMSA 2EDRA 3MRDA 3DWTA 43CAA 3OXSA 1RAMA 5EU5A 4ZOAA 1CVRA 4X7DC 3IYLW 1KCVH 2BVPA 1IQWH 3KGRA 4QOKB 3MRNA 3RI5K 2R29L 4EUPA 2X4SA 3TJEH 3WIIL 4MA7L 4Z7VB 1UWXK 3VGAB 4J7RA 2P5EE 2IANB 3CVHL 4HFWA 1T0NA 4XI5C 5D1XC 4PRHA 3CUPB 5F9WB 5HHPA 5ISZE 2V9TA 2Z35B 5GS1C 2PTVA 2MFNA 1ZK9A 4HS6A 1CGSH 1HYSC 2W60A 4G8EB 3BKJH 4OZ4A 4F15B 4W6XB 5CP3A 4TOYL 1NL0L 1UGNA 1ZT4A 1NAMB 4XC3L 3HI6H 3PWPE 5HYJA 4OUUA 4OFDA 5D2LB 3B9EA 3MNZB 1DBML 1P1ZA 3JWOH 5F6IB 1I3GL 4KRPC 5DHVB 1T89C 5L6YH 5D2NC 3GI9H 1LP9B 3SBWC 3TH4T 2VISB 5DURD 3KLHD 1AGDB 4TSAH 4EDXB 4C83B 3IRZA 1KIPA 4N8PA 1NMAL 3UJIL 2H2SC 4X5XA 1JWMB 4JO1L 4IRJB 1R0AL 4J23A 3REWA 3WIHH 2BNRB 1ORSB 3SKOA 3MLRH 3T2OA 5T33H 3NOIA 2EC9U 2NW3B 3TIDA 2Q86B 4ZFOB 5IWLC 2YBRB 3CDYA 4CN1A 4PJFB 4IJ3C 1KJVB 5F7DA 4HBQA 3ZDXE 4HJJL 1LGVA 5FFLA 5ITBL 5C8JB 1KJ3H 2FH6A 3QDAA 1QHPA 1P4BH 1X44A 4PJ8D 4Z0BL 1FGNL 4WUUB 1X7QB 1NCWH 2CXGA 1H3UA 5SWZD 1ONQA 2Y36H 4EJ1C 1RZFH 1E6JH 3GBML 1L0QA 2AK4D 3CVIH 5FXCH 1FNAA 3X13A 1QLRB 1I7RA 2IQAB 3UBXG 4LDOB 4F9LA 1FRGL 4EI5C 1EERB 3EGSA 4Z77A 3P0VL 3VGFA 3BWAA 1F11B 3CSPA 5EC1B 1RUAL 3KYOA 3RWDB 5F9OL 1A1OB 1YJDC 5JNYA 2XA3A 3ETBF 1I8MB 4NC0B 4ODVH 1YYLH 3F8UB 3C6SA 4AL8L 1M71A 1T03H 4KJPC 3ZKND 4ZO7A 4PJAA 1IGFH 3MREB 2VZOA 4UAOC 2A6JB 5GIRA 5CSZB 1A7OH 4BK4A 5ACZB 1DQQB 3AFLA 5EZOH 4K2UH 4TUKH 4YHKH 4PY8J 5GRXG 2Q6WA 4M8VA 2VIRB 4AG4H 3H9HB 3CFBA 2OLDA 4X9FA 1AGBA 4F9PA 4S1DD 3NPSC 4PREB 3BDBA 4GG6A 3M8OH 1BF8A 3S96A 3TO4D 1L7IL 3DX8B 5D7IB 5J4MA 2VYRE 4XCYA 4P2RB 4U6HB 1UJTA 4HLZG 1KTDB 3INUH 2BHZA 4GO6B 1F6LL 4HMCA 1NMCC 1T22A 3FJTA 1G7QB 1YEJH 1YEKL 1TQCC 1NFDB 3AB0C 4J3XA 3ZKNC 2P46B 2Z8SA 3CFJB 1SHMA 3MBED 1JRHH 2C26A 5DFVC 5E24E 3QDGE 2C9AA 4K3EH 43C9A 3LD8B 3O2DA 5E1AB 3FRPG 1BQHG 5KOVC 1GGBL 2V5RA 2Z8RA 1QSVA 2Y06L 2AI0L 5D5MB 4DGVL 3H42H 5E00A 4G6KH 3RVWD 2IAND 1ULVA 1CICA 1BIIB 5FYLE 1QLEL 3SKJH 4S1DC 1BFTA 1R3JB 5JW4Q 3PG2A 3B3IA 3IS0X 3SDDC 1PJ9A 3TH2T 3TO4C 4YAQA 3F7VB 4AMKH 4DVBB 2A2QT 3QUML 1NBZA 3MACH 4C56A 1CE6A 2Z91B 5HYQA 4QRUB 4Y5VA 4LSPH 4BYHA 5IEKB 4PJ7F 4WHTA 5JO5A 4NBXB 3VJ6B 4HSQA 2VXUL 5GRYA 3CMOH 1IKFL 5CD3A 3AS1A 4YNYB 4UDTA 4O9HH 4JFZL 4KQ4H 1MFEH 3MBEC 4IRJD 4APQB 1D5ZA 2DMCA 2BNRD 4XCNA 5BZDA 3F58L 4GAJH 3WDIA 4X6EB 1HQ4A 1RULL 4GS7B 2B4CL 3SE9H 4XC1L 5IMMB 3KPNA 4BFBD 4X4ZA 2Y5TB 2RJMA 1F3DJ 1QVOB 3FHQA 2DD8L 4D9QE 1MFBH 2AK1H 3RVWC 2QQLL 1T80A 4JFQB 4KJYB 2X41A 1DVFB 1XIWA 3RGVD 3VFVA 3KDMA 2VDPH 3W5NA 4WUUD 4HCRA 1DBJH 2VUYA 1EGJL 1NKRA 5DD6B 4A6YB 1DR9A 2QKIB 5KSAA 1Q0XL 1K5NA 3LEYL 4PLKD 4Z7WE 3QHZH 2CH8A 4TSBL 2ID5A 4M02A 3T2NH 3TN0A 4K3DL 4OFYA 1J88A 3ES6A 5CAYB 4P4KA 4XWGL 3EHBD 2PW1A 1XZ0A 2X6MA 1Y18B 1A7QL 1C5DA 1A7PH 3L3KA 1GH7A 4H26A 1F45A 1BBJB 3K8KA 2HJKA 1UB5B 2BVTA 2P1YA 3TIEB 5GGTH 1NQBA 3UYPA 3MLTB 3VFUB 2BC4B 3JV4B 3QJHB 2OL3B 4G3YL 5J7CC 4X7TA 1H3PH 5FGBA 2IH1A 4AEHL 3RGVC 2V17H 1EEZA 3PDOA 4WI5A 3BP7B 4PJXA 4O4YH 2BERA 3V7AE 5F3BA 2H3NA 4R97B 5C6TL 4PLKC 2GJJA 2WINA 5DVOA 2ADFH 1FQ9C 5JXAL 4JJ5B 1FVEA 5K33A 3RZCD 1EUUA 2UUDK 2EKJA 3EDKA 1FNLA 1F02I 1HNFA 4J4PA 4M61A 4WI3A 5DD1L 3DX9B 3RVXD 1BAFH 1KJ2H 5CUSH 2DQUL 4HXBH 1HCFX 3U9UB 3EHBC 3TPKA 4KH2A 5SX5H 1A14H 1F58L 3MLWL 5IB1A 5HDBF 1JPFB 3GM8A 3BT2L 3GK8H 3RWHA 5IW3A 3RPIA 5BRZB 4CNIB 2GI7A 1EXUB 3BUTA 3L3GB 3QRGL 4UBDD 1CLYH 3F7PC 4MZ3A 3N1MC 3GUTB 3DARA 3GSRA 3WE6A 1YDPA 4M5YL 4P99A 3QIUA 5EO1B 3VXME 5BMFH 1MNUH 1B6DA 1TENA 5I71B 3V5DB 3BZ4A 3L3DA 5I1IH 1N2RB 1J05A 2WIIB 3QG7L 4CL7A 2FGWL 2AJZA 1DQLH 1YEDB 2HJFA 2P7TA 4V2CB 3WFDH 1HHKB 3B5GA 1YZZA 4N8VG 1A6TB 3RZCC 3O6MH 3RWIB 3CDFA 1UWGH 1WAAA 2ADGA 1YMMB 3OPZL 1J0YA 5FHBH 4NKOA 4EVNA 4EQ2A 2ITCB 3ARQA 2J5LB 5EU7E 2K7PA 4X6CE 3GGWB 5E95B 2AJ3B 4G7VH 4CAGA 2J6EH 1TJHL 2NY1B 4M1GL 3QCTL 4QHKJ 1A0QL 1QP1A 5C0EB 5FO7A 2YEZA 1MHHA 3TT3H 4APQD 1NEZG 5BQ7B 4Q9QH 4RDQF 4UBDC 3QCUL 3BO8A 4UIKL 1JPGB 2GHWB 2VXTH 4MQSB 2XZCH 2FBJL 1OY3B 3DMMD 2B1AH 4MQ7A 3CMGA 1FFPB 2ADIA 4R3SA 5FYJD 3BPCA 4KZDH 1EO8H 2ATKA 1NC2B 3C6LB 4IMLA 5HI4D 4OLXL 4JFXB 2VL5B 4U31A 3B2UD 5HJ3B 4RMRA 4L9LB 3K4AA 4XRCA 5JXEA 5FYKL 4KVCH 1OD7A 4M43L 4KZEH 2R0WH 3MJ7B 3M17A 4JFEB 2AJUH 2BJML 5B39A 5HGHA 1IEAB 1W0WA 2GJZA 3QQ3A 4UOW0 2IMMA 3HZKA 3JV0A 4APQC 1FG9C 2LV4A 3MRGA 5CEXA 4R96B 1H3WM 4L9DA 4GS7C 5LGKA 3HMXL 4HJ0D 2O5YH 1MRFL 3LKSA 4LLQA 1N26A 3DMMC 4KKAC 4OQTH 3JWDH 1MRCH 3VFPA 2UY7A 1BQLH 3SGEI 4FP8H 1E4XI 1H5BC 4ZXBB 3TH3T 4G5ZL 1UM4L 1CS6A 5HI4C 3K8MA 2AGJH 4XPGH 5DJZB 1YPZB 1XH3A 3N85H 3B2UC 4Y5XA 2XQBH 2YSSB 3MRBA 2UY6A 4JFOA 3EDEA 1ZT7B 1GOHA 1F3JA 2IGFH 4MSWB 1KN4L 4OIBA 1NAML 5DJYB 5EZIL 1YNTA 2X10A 4LIQL 4L3CB 4KDTA 1JGEB 1J86A 4K9EH 4YEEA 1R5VA 3QH3B 4J6RH 5DZLA 1I85C 5HHVL 4HPOL 2QHRH 2XWJB 1W72L 4HJ0C 5TDOA 4RAVA 4MDJA 2XXCB 3EJJX 2KZWA 4CGTA 4Z7UF 2PO6B 3BE1L 1R5WB 4ZFOL 4EIZC 4LU5L 5ESVA 3QG6B 1G6RB 1R5IB 1ED3A 5GJSL 3UO1H 5JA8B 3CD4A 4JQVC 1EHLH 1N8ZA 4OIIL 1AQDA 4R97C 4XZUA 5JPMB 1CBVH 1G6VK 1A7RL 4EKXA 3MOBL 2YPKA 4JO3H 5DVKA 3ZKMD 3LN5B 1UADC 4KU1A 4PYHA 5EC2A 5J6GB 3D3VB 1YMMD 3FN0H 1FJ1B 3QXWA 2LABA 4GMTL 1A47A 5SWSA 1JGUL 1A9BA 5L2KA 2NY1D 2DI7A 3U1SL 2XXMB 3WBDA 4BZ1L 3VA6A 4RIRB 5GGRA 3QZWA 4RGNE 1NBYA 1I9IH 4TPRL 3K74B 2E9IA 3KHQA 4JFYB 1K8DA 4NQDA 1T7VA 3LN4B 4G9DB 2PF6A 1IGYA 2OQJB 3WUWG 4QYOA 4L8DA 4OF6A 2AEIT 5C3TA 4PP2A 2APVA 4YFDB 1MCSA 3SKUD 5DEGA 3FQTA 4ZUUA 3C6LD 2ZCKL 3FAWA 4YHIB 3RL2A 5DHXB 3W39B 1YY8A 5FHAL 3GJEB 2J8OA 2VLJB 4X4XB 1UYWL 2R0KH 3PWNB 4W6YB 2XTLA 1C1EH 4FOMA 4FQCL 1ADQL 5LXGL 5CILL 3S5LG 2AAVA 5L88H 4JFED 4WGWB 3RWCA 1S7QB 3CDGB 2QQKL 2BNQE 3W0WA 1OM3H 2NY1C 3QNXA 1FFNA 3L3OA 4S1RH 1S7TB 1ZXQA 4P57B 2VZTA 2R39A 1I9RH 4Y1AE 4XMKL 5DRWB 5INDB 2VZUA 4PRIB 1JFQH 3S37H 3TZVA 4B53A 3DUUB 2YC1B 1AO7E 1MI5B 1XCTA 3EDFA 4CMMA 4EUPH 3O3AA 4FNLH 4U6YB 1ZHBA 3MFFA 3BEWB 1FAIL 4K94H 2G75B 3MJ8B 1QSFB 3HS0B 4KTYA 4GXUN 1DN2A 4XNXH 2LTQB 3DX7A 4PRDA 2VZSA 4CN6A 2XG4A 1DQJB 3C6LC 4ZXBD 4RMSA 1HCVA 3GSXB 4MAYB 4G43B 2EECA 4JY6B 3L1OH 1LEGA 5KTEL 5MHSD 1P6AB 5CP3H 2G9HB 4HJGA 1ZS8B 2GTWA 1HXYB 2W0FB 3OG4B 4Y0GA 5ALBH 1DEEA 4S1SH 3FO2B 2X70B 4OM1L 5HHOE 2CDFB 3S4SA 4Q7DA 3MV7B 1TJGH 4JFHE 4CJ0A 5T3ZH 1U8KA 4YFEA 5C0AE 3DHJA 2AEPL 5I30L 1P4IL 4NNYB 1NC4A 4NKMB 2C5DC 4U2YA 1S7XA 5JOEA 5B3JE 1YNKH 2PO6D 2GK2A 1ZLVH 4PV8A 5IMLB 1QR1B 2WP3O 3DX6A 3MRQB 5F3HA 1QYGL 4PLNC 5MENB 2VERN 1EJ6A 3HPJA 1CL7L 1GPOH 5IEHA 4ZXBC 3RWGB 3C09C 3UTSA 1RZIB 2X1XR 4FQIL 4UV7L 4EDWL 2XNAB 1DUYA 4F57H 1NFKA 5HYFA 3OKDA 3MODL 2EEDA 3FB5B 4WEMB 3IKCB 4I0PA 2H26A 5C08E 1NCAH 3DYPA 3VFTA 5CBAA 4A6YL 4RX4D 3PWVA 3CFKB 3D3VD 1HI6B 1RUML 2LVEA 2NY2D 4KUZH 4LFHD 3AY4A 3VG9B 5DJ6A 2MMXA 3VXUA 2VABB 3WNPA 5EUOE 3WNMA 3NGBB 1DBKH 4R26L 3T0EE 1T5XB 3ARFD 8FABA 1QFWI 2DN7A 2WP3T 4PD4K 4YQXL 2ICES 4U1HA 1HHGA 1Q9WA 2Y07L 3HE7A 4RISH 2PO6C 3P4OA 1NAKL 4TULH 5HHXH 3QEHA 2AV1A 2P44B 1RUKL 3P9LB 1FNHA 4YXLH 5HBBA 2ZSWA 3V0WL 3F7QA 3ZT5A 2OL3L 4MXQD 3TVMB 1PD6A 5A2IH 4YC2C 1HSBA 4H5SB 3EYVB 3FO1A 2VLJD 5DC0A 2NQCA 4GRWE 1M7IA 5I0DA 5FDYA 4IS6B 3W81A 4OAWB 3U7YH 1WWWX 1N0XH 3MTRA 4ZUVB 5A2KH 3VGBA 2NY2C 4S11A 3VFWA 1GZPA 2DBLL 2WWMD 4PJCE 2P8MB 4Y19B 2PXYA 4I18A 3E6HA 2C3GA 1A3LL 4QO1A 3VRJB 3PHOB 4LAQL 4WW2B 4AEEA 1BWWA 3HZYA 3RTQD 3SE4C 3ARFC 4XP4H 2WUBL 3Q2CA 5E2TH 1CQKA 4ODUA 3SHSA 1QZ1A 3O2DH 4QHNA 2EEBA 5D7LA 4JPWH 3SJVE 1FE8H 1QFUL 2W0PA 1AGFA 1MJJB 4NKIL 3ROLB 4FG6C 2VWEE 1ZWIA 3HI1B 1XGYL 4LSTH 3KPSB 1AR2A 1QSFD 4NT6A 4ALAH 4C58B 1ZHNB 4MXQC 2Y6SD 4NWTL 2VOTA 4O5LH 1AGEB 3KPRB 5L8KB 2R1YB 4IIQB 3CFCL 3F7RA 3PGFH 1SEBB 2B8OT 3PHSA 4OSUL 3OR6B 4Z76A 2HWZL 2GSIA 2A6IB 4POYA 3BI9X 4LCUB 1DE4A 2GEEA 4XPHH 5AZ2H 2I9TA 1I7ZA 1IEBB 3DVNA 4QT5A 2ICWB 3RAJL 2WWMC 1QFHA 4GMSL 3HI5H 4JFPB 3UTQB 1J8HE 4QHMB 2ZNXA 1T21A 3O6KL 3RTQC 4XMLL 1IC5L 1OSZA 4HK0B 4JRXE 3B5TA 1P7QA 4NQUA 1MQ8A 4ZTOH 3DV4B 3KPMA 2FO4B 1HE7A 2M1KA 5BVJB 2HRPH 1T2QL 4QF1B 3R8QA 5J12B 4EN3A 3WL9A 3WJJA 4P46A 5D1QB 5FCSH 1JIBA 1MVUA 3DRTB 4ODBD 3MRKB 1CWVA 1WJ3A 3I9GL 3T2PA 1KJ2B 1T0MA 4I2XB 5MEND 4ETQB 4L4TB 4YPGA 1D5IH 4JGUA 1WSST 3L3JA 3JBG7 5ILTH 4MNQA 5E2UH 4EI6B 3KYMB 3BP4A 1JK8B 1X6LA 3TBVA 5IGXH 2DYPA 5AWNL 4GW4B 3MV01 4GG8B 5J1TC 1BMGA 1CF8H 1OARL 1WK0A 5K9OB 1OAKL 3WXWH 3QIWB 2YD9A 4BSWA 5ELIA 2BSRB 4RA0C 5F6HI 2D03H 4WWKB 2F8VA 1J5OH 2VLKE 3ZHDA 4YHZL 2JCCB 2ICEA 2OYPA 1FP5A 1B4JH 2IMNA 4LGSB 4NO5A 5DSCA 2EO1A 1IAIH 5DD3H 3PGCB 3ALXA 4JDTH 4FA8A 3QPQC 4H1LG 4AIZA 2DIJA 4R0LC 4JM4L 3MRRA 2G60L 2IG2H 2JLLA 2X1WL 4LSQH 3ZE0F 4FQLH 4KV5E 5I2IA 4NQVA 4UINL 5EBMB 1Q72L 1KELH 4G6ML 4M48H 3CSGA 4P59H 5I1LA 5C0CB 2ZSVA 2HVJA 3VW3H 1TVDA 3VFSA 4WENB 5FKAB 2DL9A 3UTPE 2GFBA 5C1MB 1QBLH 2R2HA 3ARPA 5E9DE 3SQOL 5I6XB 1VFMA 4XBEH 1M05B 3PP4H 3VG0L 5HPMB 4XPAL 1IAII 3OTTA 3G5YA 2P8PA 3I3DA 3QDJA 4KQ3L 1HDMA 1Q9KB 4OKVB 5CBEA 5JLZA 3VG9C 1MCRA 2FIKB 2OSLA 5CZKA 1OT2A 1GZQB 4PJDE 4LGRB 1BREA 1FNGA 2BRRL 1KPVA 1WVZA 4FQJL 1FH5H 5ID1A 3G5XB 2GSGA 5E5MB 1MFDH 3GMQA 4ZSOE 1VB9A 4ZYKA 7FABH 2H32H 2PN5A 5HSFA 1S9VA 3P9MA 2YRLA 1CFNA 3LKNB 3VRIA 4HAGA 5F1OB 4WY7L 2X44D 3V5KB 4UOW1 1D5MA 1AFVL 5FECB 2AXFA 1BHGA 2ZCLL 3KPRD 1S7WB 2OR9L 3MCLL 3PUCA 2V9RA 3O41B 1KTRL 3MR9A 4QRRA 1JVKA 1IGMH 1ODAA 5EOCL 2V2XA 1GC1C 4GRLB 5IFHH 1G6RL 5KS9A 4ZAKD 3I2CL 5D7JC 2CDEB 5K9JH 1JPSL 4GW5B 3SCMB 4JDZA 1QA9A 3C2SA 1KCVL 1IQWL 3AAZA 4L4VB 4ZDHB 5GS0H 3SDAC 2I26N 4RQQB 4LSRL 4U6XA 1F4WH 3H6JA 3LB6D 5BCAA 1LMKA 1PLGH 1IGJB 1VFAB 4MJ5B 3KXFE 4Y4HB 5B38G 5EN2B 4M03A 1JYNA 4FXGB 4GAFB 1AQKH 3BKJL 3NAAH 5FKPA 4GRMA 3B9KD 5DS8B 1M7DA 3V0AC 5D1QD 1WCBA 1DLHB 3GMPB 5EU6B 3K8LA 5JDSA 1OD9A 4NQCE 5FCUH 3D18A 1OGAB 3WSQL 3GSWB 4HMEA 2C4XA 3OF6A 4L4TD 4DCQB 1IC7L 3JWOL 2D7TL 2VLLA 3NFPB 3WS6A 2O61A 1GGCH 5EZLA 2GJ6B 4JO4H 3OKOA 1AC0A 2HMID 5L8JB 1LO3L 2XTJE 2A6KB 2H6PA 4ZAKC 4PJEB 4U1GB 3ZKXC 1NDGB 3QI9A 3HUJB 1QRNB 5KN5B 3BESR 4PRBB 2IAMA 2NXYD 3MLRL 5T33L 4WO4A 5EB9A 4R9HA 3CCHA 3QXDA 1IQDA 3QIWD 2MWCA 3MRJB 3M1BB 4HZLA 1X5JA 4WWKD 2PKDA 3Q5TA 1FZKA 4QNPF 1K3IA 1F4XH 3D2UB 1KJ3L 2JK5A 1P4BL 5DZOA 3MUGB 1AP2B 4Z95H 3I6LD 3E8UL 1NCWL 1RZGA 4LCIH 3WEXA 3VXSA 2Y36L 3B9KC 1WT5A 1RZFL 3LSOB 5D1QC 3WN5A 3CVIL 4PJ9A 4QHUB 1Z9LA 1R3KA 1DP0A 3BJ91 2ZOKB 5J1AA 1BFOB 5HYSG 3B2VH 3G6JB 3GI8H 1MRDH 5C0CD 1GCFA 3NIDF 4LLYA 1NMBH 3ZTNH 1OTSD 5GISL 3Q6GL 2HMIC 4JE4B 2Q76B 4E41B 1LO4L 1FSKC 3HG1A 3ECBB 4J3SA 2ORBL 4NNXB 1T03L 1CTOA 4HUWB 1IGFL 3RX8A 4XAWL 3RNQB 2NXYC 1UJ3B 3GRWH 3IB4A 3TBSB 1RK0A 3KPQA 5IROA 1A7OL 3CAFA 5SV3A 4K2UL 4R7DB 1RHHB 4RDQG 1JI2A 1BVLB 4JG1H 5CCKH 2UZIH 4NPYB 4AG4L 3TP4A 4O2FA 3NZHH 4EIGB 3IDGB 3IJSA 5IMKA 5DJAB 3VWJA 4WCYL 3LZFH 4HDIB 4POUB 2O26U 3TBWA 1I8KA 3TPUA 3SOBH 4XAKE 3INUL 3MYJA 4GXVH 1LO5B 4R4BB 2H1PL 1F42A 4PP1C 3SKNB 5HPOA 1CTNA 1OTSC 2P4AB 2EXWD 4S1QH 3MXVH 4HH8A 3GHEL 3MRDB 4GRLD 43CAB 1YEJL 5C0GA 3OXSB 5TDNA 3WYRA 4G8FB 1C5BL 5EFIA 4RMUA 1G0DA 3QHTC 2E27H 2OMNA 2DKUA 4YHLH 3MRNB 2R1XA 4EUPB 3OGCA 3D85A 4L4VD 4JFFD 1S5HB 4HFWB 5JHDE 4PRHB 2VB5A 3U48A 4G6KL 3PL6A 4HS6B 4IRSD 3V6FA 5DJ2A 2W60B 4OZ4B 2XACC 2F19H 3VXQA 2XKUA 3SKJL 3DSNA 2EICA 1KJMA 3CX5J 2OR7A 4XNMA 1ZT4B 5CZXD 5D93B 3LKRA 4OUUB 4AMKL 5EU6D 2HAZA 4MQXD 3MACL 1P1ZB 3MLUL 1KIUA 2MJWA 1N7MH 3ZTJG 1CGTA 2CKNA 3C60D 4LSPL 4ZFFA 1JP5A 1MCOH 1KIPB 2EXWC 4X98B 2GJ6D 5JQ6L 4A2LA 5IJVA 3GMNB 5BV7L 3OKMA 3SKOB 4LSSH 4HHAB 3J8F7 1QRND 3TIDB 2LU4A 1F4AA 4MJ6B 3E2HC 2YKLH 3JWDC 2AJYH 1TVBB 1E6OL 4RMTA 3BPOB 5F7DB 3NCBB 3PHQA 2J8UE 5KAQF 1IE5A 1TQBB 3MUZ1 1U8NB 2RR3A 3PQYB 4IRSC 1FL6A 3S35H 4K71B 4H0IA 4NN7B 1OCWH 2P5WA 3TBYA 4YE4H 1FYTA 5K59F 1YN6B 1DBJL 4DQOL 5CZXC 3X13B 3B83A 5KSBF 4GBXA 1I7RB 1VADA 2YHGA 4MQXC 2FECI 1GVIA 1OL0A 3K46A 5JPNA 5T5NG 2PTTA 4Y8AA 3QHZL 2HT3D 3BWAB 3C60C 3BQUA 3PWUA 3KYOB 4PTTB 4K9EC 3ZHKA 2OK0H 2D0FA 5F89A 1RJZA 1O0VA 2DDQH 3OJVC 4HW6A 3C6SB 1M71B 4PJAB 3VCLA 1AGCA 4E41D 4PJ7E 4U1GC 1FVDA 4PY7B 1A7PL 2R0LL 3AC0A 4LHUD 5T3XD 2AK4E 1A6VL 1EAJA 1BQUA 3QULA 3O2VH 1JYVA 1G7HA 5DXWA 4CJ1A 2DQDL 2Q6WB 1SBSH 4S2SA 3O8XA 3PABA 4PJGA 4MJ2A 1O7VA 4K7FA 4M9PA 4HXAH 3CFBB 4O00A 2G2RA 2B1HH 1AGBB 1HH6B 1RU9H 2QL1A 5DK0A 4GG6B 2F54D 3AMLA 4NZDA 1Q8MA 3K81A 3FT4B 4XCYB 5DYOA 3U4AA 1XR9A 1EEUA 3VA2C 1P5UA 1KNOB 1S78D 3QEUA 3UPAA 4FQ1H 4Q6IC 1QPPA 2HT3C 2BSTA 2WBWB 3O3DA 1T22B 4G7YH 1JHTA 2DQCL 1HSAA 1MJUH 1BAFL 1KJ2L 2ARJA 4HXBL 3PWLA 1VA9A 2P5EA 3FCTB 4WIQA 3BSZL 5HY9A 1MSPA 4YLQT 2P8LA 1A14L 4JM2C 1MIMH 3BH8B 3QUMA 5ISZA 5TE6H 43C9B 4OCLC 3GK8L 4B41A 4ZUSA 3HC4L 1UJ3C 5AD0A 1CLYL 1IM3A 4OB5H 3NH7L 4OI8A 3PWPA 1ACZA 1CICB 4X83A 4XP5H 1ZT1A 4NZRL 4YHPA 2V5TA 4X6DF 3W9DA 1S7RA 4WFHD 3R0NA 2X5PA 3S37X 1NBZB 5C07E 1CE6B 1DQLL 4TTGA 1S78C 5CJBA 2BVOA 2KQMA 1JHLL 4D9LH 4Y5VB 3WFDL 1OLZA 4KJWD 3MA9H 4WHTB 3O6ML 1UWGL 4F3FA 5JO5B 1NCDL 4KKLD 4RGOH 3ARXA 4P49A 3P30H 4MNHA 1XFPA 3QBTB 5T3ZD 5CD3B 5LGJA 4JRYE 1QHOA 5CGMA 2J6EL 3IVKB 1D5ZB 5BZDB 1Z2KA 4XCNB 3DV6A 2PTUA 4R4FL 5IVOA 1MCWW 2K1MA 2R8SH 4HWBA 3KPNB 4Q9RH 4Q9QL 3RIFK 2IBZY 5B22A 5HDBE 1A1NB 5C09E 2VXTL 4J12A 5J3HD 2XZCL 5A40E 3IFOA 1XIWB 3GSVA 4JM2F 3KDMB 3PQYD 3BDYL 3FQXA 4D0CA 4NZUH 5EUKA 2N7BA 2A77H 1CQYA 4P9HC 1GHFH 4KUCD 1LWRA 3KVQA 3GNMH 4LEXL 4OZGF 5FO9A 1K5NB 2BNRE 2LFGA 2PYEE 1D9KA 3BPNB 3C08L 4X7SL 4KJWC 2AERT 4NUJA 2OZ4A 3TN0B 1NGXA 3WS3A 4KVCL 4KKLC 4NHCH 4QRSA 2CIIA 3ES6B 3MZGB 1MEXL 2PW1B 2XZAH 4KXZH 1XZ0B 5FA4B 1JTOA 4H88H 2KQNA 3L3KB 4NCC2 4X5LA 1FORH 4WUUE 4O02L 4PGBB 2PCPA 1ZE3C 3U0TA 3P0YH 2O5YL 1PX4A 1MUJA 1BD2B 4X7TB 4FXLA 4YHNB 2IH1B 3ULUH 4OQTL 1UA6H 5GZOC 1RK1A 1MRCL 2IPUG 3OAYK 3QUYB 1BQLL 4K71C 1Q38A 4FP8L 1EEZB 1EO7A 4JN2A 3L5HA 4PJXB 2C3WA 4LASH 2I60L 5BZWA 5F3BB 4XPGL 1WZMA 2WINB 1VEMA 2WQRA 1FVEB 4HAFA 2XQBL 3AUVA 1EMTL 1ZMYA 1LK2A 4ZFGH 5MEPB 3QDGA 5E2WH 2Q1EA 4KGLA 4L3ED 3FQWA 3MZTA 1HKFA 2O93L 2ARWA 5E8EA 3CZFA 3V4PH 3CXHK 3N50A 5IB1B 5IW1B 3RWHB 1CFSA 4L8BA 2H32B 2DLEA 4QXWA 4X6BB 3MSPA 4C55A 1NDMA 3I02A 1KPUA 1ZEAH 3GSRB 3WE6B 3F7YB 1AKJA 1YDPB 5IVZB 2EIBA 3QIUB 3JWNC 1KLFA 3SE8H 1CICD 3MLVH 3BZ4B 3L3DB 3QQ4A 4Z7QF 1XEDA 3UJTH 1J05B 3I50L 2AJZB 1U8QA 1TLKA 1HH9B 5DC4B 1NFDE 3HKFA 4OBSA 3U0WH 1OP3K 2HJFB 2P7TB 1LEKA 3BKMH 3AM8A 2D4DA 5DGQA 4BZ2L 5F9DC 3GIZL 4HKXA 1A6UL 4LEOA 5DUPH 1A7NH 3PNWB 3T2QA 2ADGB 5EA0H 1CBVL 4NKOB 2AABL 3EDDA 4HUUA 1BEYH 4XCFH 4JO3L 5D5ME 4KUCF 4WFGD 2NY6B 3QFJD 2WM0A 1HILA 5FO7B 1PGRB 4WJ5B 2YEZB 1NGZB 1MHHB 1G9EA 4GLRH 4XHQA 2IADB 1U3YA 1MH5A 5EBLA 1UWXH 4U3XA 5IT2L 3BO8B 5F1IA 2WSKA 1RUQL 2X42A 4U7MA 4YXHH 2ADIB 4Z7WA 5DUMH 3QEQD 4R3SB 1NLDL 1WFUA 3BPCB 4PLOB 1JPST 1V3KA 2ATKB 4LFHG 4MNGA 4K8RL 3FB6B 5C0ND 5EORL 4Z7UE 2M26A 4O51B 1TZIA 1QNZH 1KCUH 2KH2B 4XRCB 1UKSA 1KF9B 1EV2E 3ZT6A 1C1EL 2X4QA 1V3MA 1FO0L 1HHHA 2GY7B 5F7FA 3M17B 1XF1A 3TN0D 4NOFA 4KGJA 2B7DT 4LLDA 5L88L 35C8L 4M1CD 4JZNB 1W0WB 2A9NH 3GJFK 1B0RA 5FYJE 1GGUA 5E5RB 5F1SA 2B2XH 3HZKB 1OM3L 4JGMA 5CEXB 3MRGB 4JPKH 3FB7A 2AJSH 1G7IA 5IHLB 3S34H 3CH8A 3LKSB 1YYML 4J3OC 5FUZH 4ZD3L 1UB6A 3QUZB 3S37L 1XGRA 3LY6A 1BD2D 3DOSA 3VFPB 3QO0A 1FN4B 2VITA 2Q3AA 4FNLL 1ITBB 3QUYD 4K94L 3HNSL 5C0NC 1YC7A 5C9JA 3CFDA 5F7LB 1XH3B 1PEZA 2E6JA 3BKYH 1J9CT 4R8WL 3MRBB 5JMRA 3U36B 3BPNC 2DKSA 3NN8A 3SE3A 3N1FC 4N0RA 3FB8A 4LRNH 1QSZA 1YNTB 1E28A 4M1CC 3Q5OA 5J11C 1R5VB 2YD1A 2YN5A 4PJGF 3BZFA 3KYAA 3VXMA 1TJGL 1Z3GL 2GT9A 1DUZB 2NXZB 3RJDA 3ZYIA 1T7WA 1MLCA 3KJ4B 4RAVB 5TDOB 2FWOA 2OJEA 4FQ2H 4OI7A 4XNYH 2YD5A 4BJLA 5CKGA 1JNLH 3ARYA 3QIUD 1YNKL 4F7CA 3EOTH 5ESVB 3NCYP 3GBNH 3ZHLA 3QUYC 2CRMA 1ED3B 3V7MA 3WFCL 5C0FA 2DL2A 3HRPA 5B8CA 4X6CA 5IESH 3BZEA 1R3IH 3O11B 1AQDB 4F57L 4XZUB 1RZKC 5E7BA 3WXVH 3A6OA 1J1OH 5EC2B 3WHE1 1YEIH 1NCAL 5SWSB 5IBLC 2AEQH 1U8LA 5L2JA 4M7KL 1CD9B 4HGWA 3PE9A 1YEHH 4KUZL 5H2BA 1X9QA 3X3FH 4N0FA 5JW3H 5GGRB 1WBYA 2XT1B 3QZWB 2EDNA 1R24A 4Z18A 1NBYB 3TT1H 1SQ2N 3DXAB 5ECJE 4U1MB 3HC3H 3GSQA 5FUCC 4NQDB 5CEZL 3T0VA 1EDQA 4OFVA 4QYOB 4KKBD 3RRQA 4L8DB 5HHMD 1U58B 3UBXA 2YK1H 5HHXL 3FOMA 1I1FA 2ZOLA 5DEGB 3FQTB 1VGKA 4ZUUB 4PTUA 4YXLL 1MCNA 3LQMA 3IAQA 4ZOEA 2XN9B 4GW1B 1DN0B 5JXED 4NHUA 1S9WB 2X9XA 4HUKB 3ZDXF 5FGRA 4M6MH 2EDHA 2R29H 1WIOA 4P5MB 2WUCH 1N0XL 3WIIH 4LRIC 1LE9A 4MA7H 2FCBA 4TNWF 3CVHH 1E4WH 1YEEL 1NJ9A 3W0WB 4TUJB 3QNXB 1FFNB 1V5JA 3L3OB 3O2WL 5JDJA 4KMQA 5DEFB 2N7AA 4DZBB 4ELMF 2FJHA 1NL0H 1B90A 2X4UA 3UX9B 3I6GA 3TZVB 1KEGL 3NABH 3IJYA 2AQ2A 1N6QH 4KKBC 4CMMB 3O2DL 3O3AB 3QPXL 3QUZD 1ZHBB 2OR8A 2CXKA 3MFFB 1FE8L 4PRDB 3DX7B 1NUNB 1DL7L 4YJZL 4WU5A 5F9AC 4ZMAT 4JQXC 4JZOA 4ALAL 4V2BA 4O5LL 4QTHA 1WTLA 1LEGB 1VGEH 5F70A 1R0AH 1U3HD 2ZPKL 2KDGA 4HJGB 2GTWB 2WIMA 4NO0A 4P23D 2RCSL 4S0SD 3UZQA 5KBNC 3SDCD 1D5BA 1UM6H 5AZ2L 4NUGL 4OZIF 3FRPA 1WFNA 2AVGA 1BQHA 3Q6FA 1A2YB 4HMDA 4Z0XB 1JGLH 2E8ZA 3OGOE 5DRZA 3MO1B 1D3CA 2WBJA 3S6CA 2IALA 1U8KB 1JGDA 5D72H 1FYHB 2YR3A 4L3AA 2NXZD 3ULVH 3U6RA 4NZJA 5MHSE 3MA7B 1NC4B 1S7XB 3DRQB 2NNAA 1FRGH 4G6JL 4PV8B 1RY7B 3QUZC 5F3HB 5IB3A 4FFYL 5LAXA 4XBPA 3RDTD 4ERSL 2HT4D 3HPJB 4NO3B 5IEHB 4WHCA 3MNWA 4YO0A 1X5XA 2JJSA 2FDBP 1RJLA 4AL8H 1I1AC 4PG2A 1U3HC 2B39A 2UUDH 5DFWH 4AT6A 5ILTL 4RWYL 1PEWA 4HCRL 2H26B 4OGAC 4P23C 5CBAB 3U79A 2X1OA 3PWVB 1QTYT 3SDCC 5DQDH 4JY4A 1A6ZA 4MJID 5IGXL 5SWSD 3B5HA 5FYKU 3MMEA 1CF8L 4LCCA 3EW3B 4E42B 4UQ3A 4UI2A 4XXCC 2D03L 1S7SB 4CW1B 3JUZA 1B4JL 3KJ4C 3DXAD 5C71A 3I75A 3OBAA 3QQ9C 4U1HB 3SGDH 2X4PB 1Q9WB 3VFGH 3HE7B 5IP4A 3MLPA 2IQ9H 3P4OB 4JDTL 2AV1B 5TE4L 5F7YC 4WWID 1DEDA 2IG2L 4LSQL 3RDTC 3IDNA 2HT4C 5INCA 1YEKH 1HSBB 4M48L 3QP3A 4YFLI 3FO1B 2XN9D 3EJYD 3VW3L 4H20H 6FABH 2BNQA 4HV8B 5CEYA 4E0RA 3MCKA 1RIVL 1GGBH 3G04B 2FYYB 1JMZA 2XA8H 5GRZA 2P45B 2Y06H 2AI0H 2XZZA 4XBEL 4Y1AA 4DGVH 3PP4L 2PXYB 3G6AA 1AO7A 4MA8L 2NY7H 2OBGA 3KPLB 3OMZA 1N6VA 5DJ0A 1F00I 1UFUA 2XG5A 4DKEH 1U92B 1KCKA 4ODUB 2NTFA 3QUMH 1FH5L 2EDQA 1ZANH 4QHNB 4JFDD 3KJ6L 3O81A 3CX5K 3TZVD 5JOFA 1AGFB 1ZGLA 1PQZB 4M93C 3KPOB 4OUOA 3IJHA 1EUTA 5EOTA 3ARSA 4FN0A 3ARGA 4Z76B 3V6BR 4HLJA 3ZE0E 1WV7T 5DMGD 4JFZH 5BXFA 3EJYC 5HHOA 2GSIB 4NQEE 4MXVF 3SQBA 2XFXA 3F58H 1IGML 3HNVL 5IFHL 1XGTA 3FO0L 1BX2A 2B4CH 2QQNL 3O45B 2I9TB 4XC1H 1PY4A 3DVNB 1T1YA 4QT5B 4AY0A 1U95A 3GSOB 5IHUH 5C0AA 5K9JL 5E8PB 2Z8WC 2DD8H 3GO1H 5I15L 4LPVA 2D9QB 2CLZA 2D7QA 2QQLH 4FQQA 4G9FE 5GS0L 2YPLD 4R7NA 1PBYA 1FZOB 1OSZB 4ISVA 2W1NA 2YRPA 2AP2A 3FT3B 1P7QB 4AENA 5EIVA 3BMVA 1KTKE 1IARB 2C4FU 4YDLB 4JDVB 1Q0XH 2JB5L 3WL9B 3LEYH 4P46B 4F58L 4KI1A 4TSBH 1MVUB 1AIFB 2JJUA 3NAAL 4DOHE 3BDXA 4N8VA 3JTSB 3QA3A 3AROA 1F6FB 5C08A 4K3DH 2MKLC 5FCUL 1F8TL 3L3JB 4XWGH 2A6DA 5DMGC 4ZNCD 3O9WA 2KUTA 5HGDA 4FFZL 3HC0A 4KHTH 3BP4B 5EUOA 1GAFL 2GTZA 3TBVB 1SY6A 3WUZA 2DYPB 3T0EA 4CUCA 1BPVA 1W0VA 5JMOC 2NY4B 2W65A 1OW0A 1WLHA 1U8OA 2OZ4H 4ZNEE 3T3ME 1BZ9A 3VWKB 4OFPA 5MENE 2N1KA 4ZPTA 4IDLA 3KLAA 5F88A 4AYFA 4NO5B 5DSCB 1IAIM 1XR8A 4HG4K 3LQAL 4FHBD 2KBGA 3I6KA 5C6TH 4Z95L 3MRRB 2EC8A 2I07A 2H8PA 3BISA 4LCIL 2HVKA 3ULSA 1L6XA 5K9KA 4KMTH 1I1CA 5DD1H 4AEFA 4DN3H 2ZUXA 4QKXB 3OAZK 4OF5A 2DQUH 5I1LB 1ZVSA 4BH7A 4WDIA 2HVJB 1FBIL 3D87B 3L95A 3VFSB 3B2VL 1F58H 4PJCA 5TJWK 1G9ML 1MRDL 2GYSA 3MLWH 3EOBB 2GFBB 2MCPH 4MA3B 3QO1A 3VXPA 1NMBL 1C08A 2R2HB 3ZTNL 3X11A 3QRGH 3AS0A 2A1WL 3RIAK 4P2OA 1U91A 5KSUB 3G5YB 2P8PB 2F9BT 2Q3ZA 4XVTL 3QDJB 1HDMB 2BSED 2X2YA 5CBEB 5ALCL 2OSLB 4EEEA 3SJVA 4B7LA 4JB9H 2NX5E 3F65A 3WFZA 5M7QA 4MB5A 3QG7H 1FNGB 2FGWH 4WVRA 1KPVB 5ID1B 3HRZB 4OT1H 3X3GH 3ARBA 3GMQB 4DEPB 5GGUA 1T20A 4ZYKB 2CJUL 2MHAA 4I0KA 2DRUA 5D6DA 2JJTC 2EIZA 3P9MB 1BZ7A 2ED7A 3QSKB 5FM4A 4QNPE 1L6ZA 4LHUG 3OPZH 1B0WA 3VRIB 2UV3A 3PWJA 2Z8VC 4QGYA 5GZNC 1D5MB 3UTSE 4P4RA 1JNHA 1MHPL 4ETYA 1LDSA 2WWKO 2AXFB 1BLNA 4LVNB 5BS0E 2DKMA 1TJHH 3ZSSA 3LN9A 4ONFL 1A0QH 3MR9B 4QRRB 4RRPG 4WFFD 2ZUYA 3SOBL 3KNBA 2YD2A 2W9DL 4GXVL 2X09A 1J8HA 4MS8D 5KS9B 2V7NA 2EDWA 1C7SA 3MXVL 2V2WA 5GRUL 3QCUH 1LK3H 4L5FL 4QEGA 3TA3C 3V5HA 3VH8B 1QQDA 4D8PA 2P42B 3NIDE 2E27L 1QA9B 2E7LA 4CU7A 4YHLL 5E08H 3ULUD 4U6XB 2K3TA 2AW2A 3S97C 1OTUD 1TPXC 2NLJA 3RU8L 1U3ZA 3P73B 1JN6A 4NJAH 3KPRE 1IT9H 3EYOB 1EO5A 3VFNA 4OLXH 2BVYA 1U8MA 1J1PL 2F19L 5K93A 4KRLB 4GRMB 1M7DB 4P46D 5FYKH 3WNOA 1WCBB 4DUWA 5KVMC 3KS0H 4LNRA 3QNZB 4MA1C 3MFGB 4M43H 5JDSB 2WMPA 3PDDA 3D18B 3QIBA 1RIHL 4DFHA 1II4E 1EEYA 2F58H 3FQNA 4YZFF 1N7ML 3TO2A 2O61B 2IJ0C 1OAQH 5EZLB 4UNTA 3OKOB 4MS8C 2UVFA 4D3CH 3G9AB 3QFDB 2H6PB 3TCLA 3FO9A 1S9YA 4MD4B 5E6IB 5JORB 2VLKA 3QI9B 4X8JA 2DYPD 3WFHA 4TVPD 2V2TA 3PGDB 3EJZD 1MRFH 4LSSL 4FTVA 4XP9H 2NY4D 4UQ2A 2CGRH 5GRVL 3F6IA 3CCHB 2D31A 3QXDB 1IQDB 3IU3A 2PYFB 2AJYL 3PV7A 4HZLB 5D6CA 3VWKD 1OTUC 3WUWA 5D1ZA 3D9AL 5C0BE 3ZL4H 4WV1C 1FZKB 4HC1A 1I3RA 5I17A 1NANH 2JK5B 3JVGA 1HIMH 1Q9OA 1WFTA 2NYYD 4U6TA 1OP5K 3QDMB 1RZGB 3WEXB 4X9HA 2Q8AL 1OCWL 3VXSB 3WN5B 4C59B 1R3KB 2R56L 3RKPA 4X4ME 1RD6A 3S36H 2DQGH 5E9DA 4XBGB 3T4YA 2DQIH 4LIQH 1O5DT 4NRZA 4CADB 5E70A 2IFFL 3S5LA 1K8IB 4JN1L 2E9JA 1H0DA 2MSPA 3GDBA 2E9BA 5DHVH 3V0VA 3SDXF 1UG9A 4MCYA 4N1EA 1NGQL 5HHVH 3L3IA 3RJQB 4PJDA 1W72H 4JGJA 3U4EA 3I6LE 1U42A 2JKXA 4MMZC 3EJZC 1V3JA 3KHOA 5DUBA 4HIXH 1RK0B 3GIVA 1KT2A 4LK4A 3BE1H 3QDJD 4ZSOA 3OSKA 2APWA 1EA9C 3O2VL 3VWKC 4D94A 1SBSL 5MERA 1I1RA 4XPBL 5C0JA 5IB2A 1RSFA 4YDJB 2NYYC 4X4YA 1T5WA 4O2FB 2ESVB 3IDIA 1CG9A 5IMKB 4IOFD 3DSFL 3VWJB 3LKPA 1Z0NA 1A7RH 2X9WA 3C8HA 4UNVA 3MOBH 1RQ5A 2VMFA 3STLA 5EU4A 3CVHB 3TBWB 1I8KB 5K59E 3HE6D 1JGUH 4TQEH 3T65A 3FQRB 5KSBE 2Z9TA 4BZ1H 3HPLA 5E5UB 1MJUL 5C0GB 5TDNB 3MRFB 4PLJD 2ARJQ 3L9RB 3L6FB 2UWEF 5E2VH 5JZ7D 4TPRH 5BJTA 4K3GA 1D5XA 3KXFA 2EYSA 1UKTA 2JJWA 2R1XB 1MIML 3SDYH 3IKKA 2X40A 5TE6L 1CXFA 1ORQA 3MXWH 3QNYB 4FQXA 3OGCB 3VXRA 3D85B 5DMYA 1IGTA 1P4LA 3JTTA 4UIMA 4OB5L 1I7TA 4FXKA 4LGPB 2C7UB 3PL6B 4CVZA 4NQCA 1BFSA 1JNNH 1NGWA 4PRNA 1FNFA 5FHAH 3VXQB 1SYVA 4XP5L 2AEWA 4PUBL 4XNMB 1LHZA 1ADQH 4Y4KB 5I73B 5CILH 1U41A 4D9LL 3HE6C 3OF6D 4JFFE 4OZHA 3MA9L 4LVNC 3S7GA 1JV5A 5FM5M 3MUY1 2VAAA 4RGOL 1ZV5A 4PLJC 4F80A 5IIEA 2XWBA 3OKMB 4XMKH 5E6ID 4PBWD 4XNQA 5JZ7C 3MRMB 4XTRD 5D71H 2G5BA 2R8SL 2X1QA 5GGSB 3PHQB 4Q9RL 1FAIH 1XGPA 5DMKB 2YA2A 3REVA 1PAMA 3O3UN 5I1DA 3U30B 5DA0B 1N64H 2X05A 3UYOD 4N90D 4P3DA 4O2CA 1A3RH 2QEJA 2P5WB 3TBYB 1QKZH 4XT1C 5KTEH 2GJ6E 4OD2A 3RA7L 5L0QB 3C5ZD 3QDMD 3VXSD 4GBXB 4PJEE 1GHFL 4I48B 5CP7A 4C57C 3WV0A 1QRNE 2E5EA 1SJEB 3D25A 4X6DE 1VACA 3BRGC 3BQUB 3PWUB 4OM1H 1HZHH 3TCXA 3DUSB 1Q9LA 4HLZH 1RJZB 1MHCA 4YHOH 4KK8C 5LWYL 5GRVK 1UZ8B 4NHCL 1UXWA 4W4OA 1IGIH 2XZAL 4YXKH 4HQQH 4PJBF 2HJLA 4WTZA 5E6IC 1BVZA 4QRPB 5IM7B 1FVDB 2AEPH 4M7JH 4U6VL 4DGYH 4Y16A 4XTRC 4F7EA 2P47B 4WU7B 4TNVF 1P4IH 1P7HL 4NO2B 4HWUA 3MRHB 3UP1A 3QULB 4JVPA 5FK9A 4Y2OA 4CU6A 1I3VA 3OKKA 1OB1B 3PABB 4G8GE 4JKKA 3CXDL 1PYWA 1CVSC 3P0YL 1RUPH 2G2RB 5TQ2H 2VL4A 1E27B 1JTTA 4FQIH 4GKZA 4UV7H 4ZO9A 5DK0B 4EDWH 3ULUL 4LDEB 1UA6L 1SYSA 5CJQL 1R3HA 2ESVD 1U8HA 3C5ZC 4P2QE 2NTSP 5DYOB 2WW8A 1CR9L 1XR9B 4BFEA 2X7LB 4LASL 1OGTA 5D1XA 1AH1A 5JUEH 1W8OA 4NSKA 5GS1A 5T3XE 5LQBL 3GMRA 2AXGA 1RUMH 3LOWA 4YR6B 3O3DB 1JHTB 1DDHB 1KXQE 4OZGE 5T1KD 5GPRA 1HSAB 2FHCA 2WK2A 2ARJB 2HFFB 3UC0H 5FDWB 3NZ8A 3PWLB 2P5EB 4HT1L 3HFMH 5AEAA 4BFGA 3U82B 4YQXH 5JHDA 2P8LB 3L7FB 4JKPH 4YGAB 3UPRA 4OD3H 3QUMB 2F54E 5ISZB 1CL7I 1T89A 5D2NA 4ZUSB 3IRPX 3SBWA 3VGEA 2F53B 2Y07H 1RURH 1NAKH 3MGTB 1XGQB 3H9SE 1IM3B 1PSKH 1X4XA 5DR5L 1FZJA 3PWPB 3CFIC 5IF0A 2COQA 3V0WH 3PV6A 4ZS7L 1KYOJ 2A38A 1E4XL 1ZT1B 3BD4A 3OKLA 3MLVL 3SE8L 2W0LA 3TEUA 4YHPB 5HDLA 3RL1A 4BUGA 2MQ3A 5IWLA 3W9DB 1S7RB 3K7UA 3UJTL 3NFNA 4RFNB 4R90L 3RBGA 1H3TA 4DTGH 3RY6C 3U0WL 1WIUA 2CKBA 2DI9A 4Y4KD 3GJFA 3VD9A 5DUPL 2DBLH 2E9WA 1A7NL 1T0PB 2J8HA 5EA0L 3WKMH 4F2MA 4MNHB 4J3UA 4XCFL 4KDWA 3HLAB 3RX5A 5LGJB 3C2AH 1AD9A 5IKCA 3V4UL 5CHNB 4EI5A 3HG1E 2J8UA 4X9GA 4WI8A 1JZ6A 2ZKHL 3DV6B 3ULVD 4LLUA 5GXBB 4Z5RB 4U33A 4NM8L 3O6FD 4R6UA 4RNRB 4WI2A 2I9LA 1F97A 4H1LA 1FAKT 5C0DA 4IOIA 1XGYH 5GRJL 5F9JA 3IFOB 4DZ8B 1BVKB 3GSVB 4YXHL 4NWTH 2EXYD 1F3RB 4LBEB 3FQXB 5DUML 4LMQI 1FNEB 1OOAA 3MLZL 4OF8A 5EUKB 4QRQA 1SMAA 2P5WD 4Z6AT 4M7LT 2HA1A 2HWZH 4EXKA 4RSVA 4ACPA 5FO9B 1FL3A 1ROWA 2VDML 3S3PA 4GBXD 5JHLH 2EZ0D 1QNZL 3RGHA 4CMHC 1D9KB 2CDGA 1EFXA 4Y4KC 5ICZA 4PJ7A 3DYOA 1Q94B 3RAJH 3P40A 1NGXB 4YH6A 4GMSH 3BQUD 3WS3B 2BP3A 2AK4A 4QRSB 3FL7A 4ZTPH 4XMLH 4LVOB 1IC5H 2V9QA 4NJ9H 1X5LA 4NP4L 5CSGA 2A9NL 5IBUG 3ULVC 3K4DA 4QRPD 2FB4H 1T2QH 4PJHF 5E8NA 4JPKL 5KVEL 3CC5A 3AXLA 2PCPB 2AJSL 3O6FC 1FFOA 3U0TB 1QACA 2VKXA 5A2FA 3WD5H 2JB6A 1MUJB 1CD8A 5FUZL 5EO0A 2Q7NA 3DVGA 1RK1B 3EYFA 3U30C 2IC2A 1J0IA 4ZQKA 1FDLL 2OXGA 5L0QC 1CDHA 2IBZX 4KK9D 3CFEA 4ORGA 1PKQB 2EZ0C 1BECA 1KUMA 5AWNH 4JPIA 1LEIA 1RV6X 2PR4H 1LK2B 1XF2B 1U6AL 3QDGB 2YD7A 3SDDA 3NCJH 3BQUC 4NN5B 3TO4A 2R69L 1TCMA 5MP6H 2J2ZA 1CLZH 1B88A 4M1DL 1XF3A 2HTKC 3FQWB 2RHEA 2A83A 5DLMH 4MYWB 3A67L 3CZFB 3DHMA 2LAGB 4UUJA 4YHZH 5F7HA 4PRPE 1BJ8A 5LJYH 4XP6L 5FV2A 1CFSB 1GGIH 3U4BH 5C70A 4L8BB 1B2WH 2F53D 3AREB 3NFSL 5B38A 2G60H 4PFEA 4GAYA 1AKJB 2R0ZL 4FQ2L 4NN6C 1IM9A 5C07A 3QISA 1RI8A 3MBEA 4QWWD 1G1CA 4G6MH 1TMCB 3QQ4B 1JNLL 4J8RB 3RNKB 3ALWA 4L3EE 2X4RB 3EOTL 3EUUA 1U8QB 4OLUH 4U1SA 4W70A 1LEKB 2ERJC 4ODHH 2IANA 2QBWA 4YK4B 5IESL 4I9WE 4HKXB 3SQOH 1A1MA 4LEOB 3CSYB 4XPAH 4GRWH 3FFCD 4G8EA 4HUUB 4JZJC 3L3HB 2JIXA 4JKLA 2AEQL 1PG7H 4YBHA 1MFNA 3UCRA 5JOPE 1YEHL 5C09A 2FATL 1PFCA 5I0ZA 1R3LB 4YFLF 3GBLA 1HQRB 3QWRD 5JW3L 2YOCA 5EBLB 1LP9A 2VISA 3FT2B 2YZ1A 3SPVA 1KULA 4O2EA 3ARDB 3TNMA 5HVFB 1MCFA 2HG5A 4POZD 4PJGE 1JWMA 3HC3L 4HIEB 4QWWC 4Z7WB 4TTDC 4WY7H 2BNRA 1ORSA 2BXYA 1AFVH 3BP6A 4BQCA 3RUGB 3U9PL 1I7UA 2HP4A 2VQ1A 1EVUA 3UTTD 2Q86A 2EDTA 5CGTA 5HYSA 5EOCH 3P77B 3QFJE 4OZHF 1TZIB 1GJIA 1BGXH 1N3NA 3I2CH 2BMKA 2B4CC 5I8CA 1ACYH 1CE1H 4UDUA 1S8DB 3RGVA 1JPSH 4KKNA 4XWOD 4KVNH 1U8JB 2X4QB 1HHHB 4K7PX 2QSCH 4WUUA 5J9PA 3FN3A 5DHYB 4M6ML 4LLDB 1KB9K 4S10A 2WUCL 4LSRH 1N4XL 2YN3A 3QEQE 4Y4FD 4U7KA 4QY8B 1QLRA 1Y6NR 3W5MA 1E4WL 3SGJC 4BKLA 1QFWL 1QO3B 1G7IB 4E5XB 2RBLA 3DROA 1T1WA 2VR4A 1XGRB 2EE6A 3IDYB 1HOCA 3NABL 5DJDA 5ERWA 3WSQH 5I1GL 1N6QL 1WICA 2H9GA 3KR3H 2BY2A 1IC7H 2D7TH 2VITB 3D69A 3P4MA 4P5TA 1VFUA 2DOCA 3VI3F 2W07A 5C9JB 1IC4H 1ZTXH 1LO3H 5C0RL 5AYQA 1W72B 1VGEL 4XWOC 1MFAL 1QPXA 2W38A 3ME0A 1TZGL 1LNUB 3NN8B 4PREA 1DQDH 3FB8B 3V4VH 3B8SA 1E28B 3LKOB 1KCSH 1UM6L 1N59B 4Y4FC 4HUXB 2ENSA 3RZCA 4OFKA 5I9QB 1X5YA 1JGLL 3BZFB 1T04A 4I5BA 2Z4QB 2GT9B 1E4JA 3IDXH 3E8UH 2FWOB 2OJEB 1G7QA 5D72L 3ARED 1BF2A 3B8YA 3ULVL 1VFBB 1NFDA 5H35A 4OCYL 1MIEL 5IB5B 3DIFA 1MAKA 3JV6A 3Q0HA 3W2DH 4F7CB 4ELME 2O5ZH 5E1AA 2UYLB 5C0FB 4HC1H 3KLHC 5GISH 3Q6GH 5B8CB 4X6CB 5D5MA 3W82A 3BZEB 4UU9B 3BZDA 1OAYH 1LO4H 4N8CL 2ORBH 1WZKA 1MCPH 1A4JB 4XAWH 5E99L 5SX4H 4JR9L 5IW6A 5KG9A 1IL1A 2F5BH 5FUCE 3CIQA 5HGBA 5L2JB 3K0WA 3F7VA 1DANT 4X6FB 5DQDL 4HGWB 1ETZA 5H2BB 1A7BA 4U1JA 4D9QD 5F21B 3O4LD 1WBYB 2FX7L 5I8EB 1R24B 4PJ8C 3C9NA 1CXIA 4OZIE 1RZ8A 1HXMB 5FYKD 4ODTH 1MCJA 3AREC 4WCYH 3GSQB 4Z7UA 5ICXA 1HEZB 3EZ8A 3ARDD 2XY1A 3VFGL 4LPUA 1SJXA 4WHYG 1WBZA 1ZHKA 2IQ9L 3NPZB 5EO9A 3UBXB 4APQA 3FOMB 2ZOLB 5KVGL 1VGKB 2H1PH 3GEWB 1CFQB 2Y5TA 4U7SA 3GHEH 2V6HA 1SEQH 3DMMA 1PG7W 1C5BH 2DBJA 1Z5LA 4H8WL 4NHUB 3TBTB 5GSVA 4H20L 2J8UF 5H8DA 6FABL 4C4KO 1H5BA 4KI5D 4LNVA 3H8NA 3LRSA 3EO9H 1T4KA 1LE9B 4QOKD 5GHWL 2XA8L 1NJ9B 1MCQA 5CGYD 3BX7C 2ZNWA 5HHME 5MEQA 4N0CD 3JUYA 3MGOA 1ZGLP 2NY7L 2BFVH 4HIIA 2FJHB 1Z9MA 2KZ1B 4JHBA 2GAZA 1CXKA 4N9GA 4DKEL 3I6GB 4N5ED 4X99A 5C3LD 3MV8B 1C12B 3ARDC 1ZANL 3MLUH 3FONA 1I85A 1TTUA 4LVHB 4MD5A 1N5YL 3U46A 1JRHI 2Y25A 3TIEA 3V52H 4C4KT 2FSEB 3OV6A 4JZOB 5EZJA 3VFUA 4QTHB 4BSJA 4I8DA 5JQ6H 4PJ5B 5BV7H 5FEBA 2P49B 2GK0A 1QBBA 4UNUA 1NPUA 5EBGA 4NO0B 4KI5C 3KLSA 3G5VA 3RPKA 3S36X 2BHUA 1E6OH 2FX9H 3RHWF 1VENA 4JQVA 1BQHB 3Q6FB 2OXHA 4MD0A 5CGYC 5IHUL 1K2DA 3TJHD 2RIKA 3VGAC 4N0CC 1VPOL 1JZ3A 3GO1L 5DRZB 1J8KA 5T1MA 4NRXA 2WBJB 5F9WC 4Z7NF 1JGDB 5TH2A 4LCWE 2X89D 3DX9A 3VDCA