5DT1L

Crystal structure of human fab cap256-vrc26.25, a potent v1v2-directed hiv-1 broadly neutralizing antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
215
structure length
215
Chain Sequence
QSVLTQPPSVSAAPGQKVTISCSGNTSNIGNNFVSWYQQRPGRAPQLLIYETDKRPSGIPDRFSASKSGTSGTLAITGLQTGDEADYYCATWAASLSSARVFGTGTKVIVLVQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy chain of broadly neutralizing antibody VRC26.25
publication title New Member of the V1V2-Directed CAP256-VRC26 Lineage That Shows Increased Breadth and Exceptional Potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dt1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dt1L01
1Q0YH 4OZGE 4XC1H 4TUOA 3QUZB 3T2NL 4L29A 4IS6B 3HI5L 3SJVE 3VD5A 3DV4B 1CYGA 3VH8A 4I48B 1A6WH 3IYLW 4Y2DB 4N9GB 2Z31D 1LO2L 5EU6A 3TNNB 1X3DA 5CJXA 5T3ZL 4YHZH 2J12B 5EOCL 1YDPA 2JJUA 3RPIA 2QHLA 2ADGB 3S4SA 2GJ6B 5IFJB 4MMXC 3PL6A 2UYLB 3ULUD 3KPSA 3CFEB 5IFAL 3KLAB 3MRMB 5C70A 3QI9D 5DZNA 4DZ8A 4U6YA 5CZXD 4LLWA 3IETA 5F9DC 3NA9L 3S37X 4ELKA 1LE5A 4ODBD 2XN9D 1EXUA 5C0JA 1L0YA 5HHQA 5FYKU 1S9XA 4HS3B 5CWSA 1ZLUK 1FFQA 5LVEA 3H9HB 2VC2H 4UT6H 4XAKE 4OD2B 5D7KD 4PJ9B 5J56B 5D6CA 2H9GA 1HCFX 3KPMB 3KWWB 3P4OA 1U93B 3AS2A 4NZUL 4CN1A 5JUEH 2PO6A 3IDXH 1JHTA 3IFPB 5F7UA 3SOBH 1RUMH 4LIQH 1C5CH 1NGQH 1NCBH 1YEIL 4WI8A 4OZHF 4G8FA 4JFOA 4NKDA 5EPMB 3M07A 4PJHA 2FWOA 2YZ1A 5GISH 1JPFA 2IH1A 3QDMB 4OIIH 1IILE 2WLZA 3VXMD 3VW3L 1OTTC 1UM6H 4Y5YB 4K23H 4NSKB 2C4FT 1MFCL 3GJFK 2NX5A 1I1AD 2APXA 5C86A 1Z5LA 1A9BA 2PYEB 3MRHA 4KRPC 3CDGB 5IBUG 1UKQA 4UV4L 5IBTH 3ET9F 5C07E 1AI1H 1EFXD 4OLYL 1P7KB 4EN3D 3KG5A 4LHQB 4U1HA 4RGOL 3QUXC 3TBYA 1BOGB 2UWEA 1WUNT 2A9MH 4J3OC 1PLGL 4GS7B 4PTTA 1FC2D 3EYVB 1OAZL 4X4ZA 3LSOB 4KTDL 3QUKA 3SDCA 2J8UF 5BRZA 3D25B 4OFKA 3W5MA 5EU3A 2R2BB 4HCRL 4HWUA 5I73B 2YKLL 4O2CA 3TCLB 1U6AL 2WP3T 2Q87A 2C1PB 4DGVH 3SDXA 4CMHC 3PWVA 2N7AA 3IKCA 5CMAB 4AH2B 3MA7B 1QYGH 4FFVD 2BVOB 5DI8A 2RBLA 1FV1B 1QFUH 4WO4A 4RMQA 3GHEH 3B2VL 3AS3A 1QQDB 5C2UB 3LKRA 4CW1A 2ZOKA 1JBJA 1NGWA 1YPZA 2X09A 5GPRA 2OSLA 4FHBD 1GCFA 4HUXB 1WIOA 3OX8A 3I2CH 2XG4A 5C71A 5D71L 3SO5A 2FL5B 4EXPX 3SDAD 1TVBA 3NMEA 3PWJB 4K7PY 1KTDB 1IM3A 4EI5B 3QDGB 3CFIC 2ADIA 4J4PD 3T8XA 5FM5M 3T77B 3SGJC 2W9EH 4LHUG 2ZJSL 1F02I 2NY0C 2XWBA 1N0LA 3PWLA 3RU8L 1UVQA 2A6KB 5HHPA 1ZT1A 5DFVC 1ZLWH 1LK3H 1YJDC 1KUMA 3QFJA 4YXKH 5IVXA 5EBLB 2HT2C 2HFFA 1N5YL 3DX9A 2GI7A 4FS0A 3R8QA 1WT5A 1HXYA 2F19H 5I30L 3D39B 4OIAA 4UINL 4PS4L 3VXQB 4FZ8H 2B39A 5HI4D 4Y5XA 4PRAB 4KTEL 4X98A 3MBXL 2VNCA 1X5IA 4JPKH 3L9RB 4K07A 1FZKA 1NGPH 2Q20A 5C9JA 1BEYH 5ITFA 3ZMRA 3H0TA 2QADC 2OQJB 3BZFA 2OK0L 3FT2B 1R0AH 2DD8H 1U8JA 3HCVA 4DGIL 4NQUA 5GGVH 3E3QC 4MCZB 2R69L 4UILL 3ARED 3ALXA 3BKJH 1NMCB 3O2DA 3PDDA 3VWJD 4QO1A 1R3KB 1UB5B 3UYRL 4MSWB 1PY4A 3CX2A 4F8TA 4XB8A 1NMBL 4PJXE 1UQSB 4L9DA 2WANA 3FQXB 4YHOH 5I0DA 1HQ4A 5E6IC 2KZWA 3FB7B 2Z31B 1ZVYA 2V5YA 4LCWE 3VXRE 1I8KA 4ODVH 3CFCH 4DKFH 4YDJB 1C08B 2D7NA 4IOIA 5DD3H 4U05A 4LSVL 5EC2B 4UUJA 3BEWA 3ZHDA 4JM2F 4AT6A 5ADPL 3WIHL 4Q9QL 4WUKL 5BJTA 3U48A 2Y1VA 2VWEC 4JFDB 1FNEB 5E1AB 2OTUA 3LS4L 1JPTL 1B2WL 2P7TA 1W0VB 5MHSD 3WLWC 2XN9B 3FFDA 1CE1L 1XGYL 4ETQB 4Z7QF 2VDML 4PJFF 5IB5A 5T1KD 1FVEA 4L8DB 4B5EA 1JNHA 1OT2A 3L7FA 4GW1B 3DV6B 4Y88A 5DQ9B 4PGZA 4HPOH 3FT4A 1I3GL 5DEFB 3QIUD 2UZYB 4UDTB 4UBDD 3VDCA 1MFBH 3UAJD 2D31B 1QSZA 1QKZH 1FZOA 4YDLC 4NQDD 1N0XL 1ZT4B 2IPTH 4PRDA 3BESR 2I5YL 4P4RB 4C59B 1QBLL 1KIUA 1AO7B 3U7AA 1BJ8A 3DSNA 1BECA 3LPFA 2BVQB 4OQTH 2HN7A 2X44D 1ED3A 2X70B 4GRWB 3WS3B 2DQDH 3DVFA 1T1ZA 3K80A 1I9JL 1JE6A 1P4BL 2WNGA 4JG0H 4Y4FD 2HFGH 1EFXB 4U2YA 1B4JL 3HZKB 1OSPL 3AM8C 1N26A 1RIHL 5FYKL 1REIA 5IROA 1EEZA 4Y16A 4KZEL 1KOAA 2A74B 2MCPL 3SJVD 1K8IB 1O7SA 1NC2B 1WAAF 1VA9A 2BNRD 4CJ0A 1DP0A 1F45A 1OTSC 5GGRB 5IHZA 2PCPA 1FSKB 4CVUA 1TZGL 1OGAA 1C1EL 1NMAH 2A73A 1YMHB 3C5ZA 3QO1B 3VXSE 4OT1H 3BN3B 3EJYD 1JYNA 4Q74A 3W9DA 2C26A 1XH3B 3EZJB 3DMMA 1CGYA 4PGBA 1I9EA 3QFDA 5IW1B 5I74B 4AG4L 3OSKA 4ZSOB 1IAII 2E6PA 4HS8H 3FN0H 2B0SL 4TTGA 4U1LB 3PF2A 4LSPH 2W1NA 4BELD 4JRXA 1EUUA 3HZVB 1S5IH 3VGEA 3QHTC 1QRKA 5F96H 1VGKB 4N1CA 2RR3A 1NLDH 4M1DH 1MWAL 1CICA 4FNLL 3E8UH 4R90H 5GXBB 4OD3H 5KSBB 5IT2H 3KPPA 4GAGH 5CKGA 1DQQA 3KDMA 1UCBH 3ZHLA 3IS0X 1FFNB 3FQTB 5LG1A 3EFDL 1NH6A 3HLAA 4ZNEE 3BKYH 1DSFH 5TQ0L 3EYOB 2YRPA 1CLZL 5CSGA 4IJ3C 2V5MA 2J8HA 4QRRA 1U36A 1UWEH 1B90A 1NBYA 2DQCH 3WJLC 1P5VA 4TYUA 3GSXB 4KQ3H 2C3HA 4LLMA 2VSDA 1SMOA 3RVUD 3FQNB 3D3VA 3UO1L 3TIDA 1QG3A 1VFOA 5SWSA 4HW6A 1ORQB 1TPXB 4DGYH 5IFHL 4HK3J 4NKIL 3N1GC 4QHMA 5T5NG 1J8HB 4OCXH 1VSCA 4HKXA 3PIQB 5D7IA 5KOMC 1HILB 3LQAL 4K9EL 1CFQA 4QEGA 3HN3A 3MJ8A 1KIPB 5KZCD 3WXWL 4YEEA 1OT1A 4HKBA 1IKFL 5TFSL 3MOBH 1GYAA 3SEPA 3AREB 3RA7H 4UDUA 3NFNB 4OZHE 4JM4L 1WBZB 1EK3A 1ZA3A 1H0DA 2FHFA 2MFNA 2NY2B 3KPLB 3VWJB 2X10A 5LJYH 1BVLB 3BWUC 1SM3H 3RWIB 4WCYL 4XPFL 3HE6A 1T7XA 3KYOB 3NIGE 1KTLA 1PG7H 4YHPA 2AAVA 2FSEA 5TPWH 4U1GC 1FAIH 3P9MA 2ZNXA 2XTLA 2AEWA 4FABL 1TJGH 1ZXQA 3FO0H 5C8JA 4GXVH 3K4DA 5IIEA 1T03H 3ZKMD 3VFVB 43CAA 2XOTA 3CVHL 4NUGL 8FABA 5HHME 4P3DB 5KG9B 1JF1B 3RNQA 2F53E 1KEML 4OGXL 4YWGH 3FTGB 5FM5O 4P5TA 4WHTB 2HLFC 3RY6A 3L7EA 3DXAA 4NWTL 2LU3A 3OR6A 3MODH 1FNFA 2J8UE 1OTUC 4JN2B 2OI9C 4LSUH 1FBIL 4M7KH 4G6FD 1VFMA 3UC0L 3V0VA 2VL4A 5CIPA 1EBPA 1U8LA 2ZWLT 1FCGA 1WZ1L 4FQHB 5TDPB 5DEGB 3KJ6L 1RULL 2QSCH 5T1KB 3ZYIA 3IDIA 2ORBL 4RMTA 2NXYB 2AGJH 2CDFB 2R0ZL 1DBKL 5FK9A 4M03A 1N5AB 4K7PX 3EOTL 4NO3A 1NCDH 5B38G 1M71B 1E6OH 4F7CA 1DQJA 1NUGA 4CVWA 1MJJB 3OKNA 4FQXA 4NQDB 4Z76B 2CRIA 3HUJA 4YAQA 3MACH 2DI8A 3WS6C 4OFYA 1CGSL 1U3ZA 5IHBA 1XF1A 3MMEB 1CFTA 3DHMA 5JZ7C 1TLKA 1KLUA 3MGAA 4IOFD 2BSSA 5H35A 3VXUB 4JPVH 1UFUA 3CXDH 3SBWA 1SYSB 4Z7UE 2B1AL 1P84K 2W38A 3S96A 4R2GD 4N0CD 3LIZH 2K9UA 2DLIA 4HWEL 4S11A 1QSFD 4MD4A 5DJDA 2PW1B 2E9BA 4OB5L 5HHOE 5JOPE 1I7TA 4PB9L 5IB1A 4PJ8D 1T1YB 1GPOL 1P4IL 2Z8WC 1E4JA 3SJVB 4QXTB 4G43B 1MFDH 3CSPA 5HI3D 1U8IB 1T0MB 5LXGL 3ARYA 1W8OA 1T2JA 4Z5RA 5GS2H 2E6JA 2EYRB 3RNKA 5ISZB 2GFBB 4YDKL 3CVIH 3GSNA 3VXRD 3ZDXE 3OBAA 2D7TH 1HHGA 4QYOA 4ZUSB 1JNLH 5ESQB 1DBAL 1FYTE 3IDGB 5FKPA 1KJVA 3WN5A 1A1MA 1XGQA 4JFEB 1GXEA 4K55A 2NW2A 3SE9L 1WZKA 3P4LA 5GGSA 4FFZH 1Q9WA 1DBJL 1MI5D 1AJ7L 2BRQA 5GQBA 3DUSA 1FC1A 2JJTA 3OAZH 2HTLD 3BKCH 4KQ4L 1IGCL 4DWHA 5FKAB 2Y06H 1P4LA 4TTDD 4ZPVA 5GS0D 1RI8A 4L3CA 1FFRA 4PJIE 3U1SL 2AK4A 3WO3B 4KHTL 4FQQA 4PRNA 5EA0H 3W11C 1YJDL 3WYRA 5K9KA 4LLUA 1MCLA 2AJUH 1WWCA 1CXKA 3DUUB 4Y4HC 1G7QB 1K9TA 1OB1A 2VDRH 3PQYA 4XP5H 4M93B 1NEZA 4OF3A 5I18H 2Z91A 1GGUA 4LEXL 1Q94A 1ZHNB 5JLZA 5HVHB 3MX0A 3D87B 4ZAKA 4QRSA 5EIIA 4KU1A 1SJHB 5DK0A 5DRZA 4R96A 1UJ3A 5C07B 4XI5D 3QQNA 4OCRH 4Z7QE 4CVZA 4F33A 1CI5A 4PJGF 4WI4A 1FVDA 1M7XA 4YO0A 3TO4A 3LV3B 3I6GB 4G8IA 1XMWA 4KJQC 2VDQH 3KYNA 3K46A 3RWCA 4NQTA 4KK6C 4OUUA 1BREA 3C6LC 1T04A 2EIZB 5KZCB 3GI9L 1Q9OB 5J13B 4JJ5B 2R0KL 5FYJE 4FN0A 3WCYA 2GJZA 4EUPG 4I2XE 1YNKH 1O5DT 1F13A 3EDFA 3CH8A 3GK8H 4PP1C 3GIVB 3DTXB 5DJXB 2VISB 1R3JA 1BVKB 1KNOB 1WZLA 1NAMA 3BPNB 5E08L 2GSIB 2FZ3A 3I75A 3MLXL 4U3CA 3VXSD 4DVRH 3KJ4C 1TQCB 1MAMH 3MXWH 3QAZB 3BIKB 2X40A 2P5EE 3P9WB 2DQTL 4HJ0D 3MJGX 4ONFH 5F21B 1BD2A 3CZFB 3C60C 5CCKL 3O2DH 4KRPB 3HC0B 2ITCB 4JEGB 1H9VA 4C57C 1G6VK 5C0DB 1WBYB 4P23C 1WAAE 4PRHB 5IMMA 1NCAL 4LSDA 4MJ5A 2QTEA 3QUXB 5TJWK 4M3JA 5B39A 4AK1A 4RAVB 4EQ3A 7FABH 2ZCHL 1CIUA 3OJMB 3LPWA 3BAEH 5FO8B 4B41A 3BUTA 4D0BB 3ARFA 4PGEA 1EHLH 3IDJA 1DVFD 1K6QL 2YPVH 5HHVL 1JJUA 1IVLA 5CSZB 4N0FB 3ULVC 2PXYD 3OG6B 3P4MB 1KJ3L 4OGYH 1OPGL 5T3ZE 3U6RB 5I1EH 1CFVH 1DUZA 1HHHA 2YEZB 1I3RA 3GSRB 5I1CL 2BHUA 5E9DE 2A2QT 3NAAH 4GAYB 4RGMB 5DMYA 4GG6B 4APQB 5KSAC 4PY8J 3MNZA 3EDJA 1Q0YL 1MEXL 1TZIB 1UZ8B 4XC1L 2P46B 3MRKB 4QHUB 2F9BT 3B5GA 3REVB 4Q2ZB 1I4FA 4GBXA 3V0WH 1KIQA 4MMZC 3TZVC 4R2GB 3NN8B 1RZIA 3NCFB 4FXGA 1A6WL 4G6AC 2A83A 3TV3H 4V2CB 4PJ8B 4YHZL 2CRYA 1IGFH 3CFBB 5DDHB 1OP5K 2DDQH 4JB9L 4PJXB 3WHXB 4YZFF 2ZSVA 1JPGB 3C08L 4I9WE 1G0DA 4LCWB 1A3RH 1D6VH 5ADOH 2DIAA 2EDRA 2C1OB 1ZEAH 3UTTA 3BPCA 3HPLB 5DUBB 3ULVE 5HHMD 5FECB 1EEYB 4HK0B 5ERWB 2F53D 3STZB 4P2OD 2V17L 3L95A 5JXED 2VC2L 5CJXC 3RGHA 4XZUA 3B5TA 5D1XA 2A6IB 3FKUS 3QWOA 2IAND 4S10A 5JUEL 2JB6B 4E41E 5BV7C 1U8NA 3SOBL 5CEYA 1RUML 4DCQB 1K2DB 1C5CL 1NCBL 2L7JA 2Z93B 5DJ6A 4KFZC 4CU8A 5CD5D 3QIBD 5GISL 4OIIL 1FG2B 1UEYA 1UM6L 1KB5B 4K23L 3RWFB 3TGXA 1DEDA 1V7MH 2QSTA 3VFRA 1FG9C 5C0AE 4A2LA 4NYLB 4LRNH 4YDVB 2PUQT 3CDCA 5IBTL 1RY7B 4Z77A 1BP3B 1AI1L 5CJ8A 4HXBH 1ORSB 2YN3A 5FGCE 5T5NF 4N8VA 5FXCH 4QCIA 3WKMH 2PO6C 3S3SA 2EDBA 3H9SE 1Q9KA 2A9ML 2GT9B 3UPRA 3GSVB 4LMQE 5DTFB 2B1HH 3TCXA 3WIFA 1E27A 1EAPB 4MDIB 3ROOB 1R5IA 1I1CA 3GBLA 3FB5A 3K4ZA 2F58L 5E2TH 4PV9B 1QLRA 5JOPD 4HFUH 2J2ZA 5H94B 2VABA 5F7EL 4QF1A 3UDWA 4BK5A 5C0CA 1INQB 4NUJB 4XGZA 2FB4H 5CP7B 1S7TA 1XGPA 4DGVL 5JHDA 1WCBA 3D5OF 4LVNC 1RZ8A 1NJ9A 5D5MA 4GW5A 3MV9A 3AMLA 2Y5TB 1MIEH 1QYGL 4H0IA 2NW3A 1KEGH 1LO5B 1CVRA 1IQWH 5JXAH 1QFUL 1H8OA 4EIGB 2ITDB 3FOLB 2BX5A 3OF6A 4UOJA 1FYTD 1MCBA 4ALAH 5DMIH 3VXSB 1KJ2A 4YDLB 1AGCB 3SDDB 2D4DA 2UY6A 4Q6IA 5FOBB 3VI3F 1FL5B 3DO7A 4RMVA 3SDCC 4HJGA 2VLKD 2VZTA 3CPLA 3OGCB 1KB9K 1WZMA 1D6EA 1I7RB 1ES0A 2ZG2A 1F4YL 5C0FA 4GKNA 1A6AB 4LOUC 4GRLD 1YNTB 2W9EL 1XR8A 3CUPB 4PR5A 2BMKA 3BSZH 5B22A 3T4AA 2IAMD 5HD8D 1JN6B 1J0IA 3DX6A 4K8RC 3GNMH 1J11A 3P73B 3VXOA 1Y0LA 5HYJA 3RWDB 4BH7B 3VI4F 1LK3L 5EC1B 3B9EA 2IF7A 3OHXA 1TQBC 4YXKL 5TDOA 3GFUA 2ICWI 3QNZA 1N4XH 3OGOE 4DUXA 5IOPB 3BQUD 3K8LA 5DK2A 4HGWB 4J12A 4AL8H 3VFPB 5SWQB 4M6NH 1T4KB 1XF5A 3IDNA 4V1DD 2F19L 4KY1H 2J5LB 5C0BE 1WK0A 4YPGB 1HHKA 1PEZA 4FZ8L 4JM2D 1OP5H 4M7ZB 2H1PL 3AXLA 2VZSA 4B53A 4JPKL 2Z35B 1KG0B 4MQ7A 1NGPL 1I8MA 4JKKA 1BEYL 3LZFH 3O3EB 4MXQD 4AJ0A 1FPTH 1UH3A 4QHKI 1R0AL 2DD8L 2VE6A 4I0KA 1IAIM 5GGVL 3B4NA 5CIPH 4OD1H 4G6KH 5KS9F 3BKJL 3PE9A 1X4ZA 2RGSA 3F7YB 3UCRA 1IAOA 2VQ1A 1NBVH 4WGWB 1U41A 2D7PA 5DJAA 5D96C 5FYJD 3OZ9L 4FQCH 4H1LA 5KVDH 4YHOL 2BSRA 4OZHB 3ZKXC 4K3JH 4B50A 4XBGA 4ODVL 5IR1B 3CFCL 3CFDA 2P8LA 2CK0H 2HLAB 3TBVB 5TF1H 5IQ7H 3CSYA 3NZ8B 4HKZA 1IFHH 5TE6H 4O51A 3KVQA 3UTSD 1AXSA 3MCKA 5EIQA 2MOVA 2D7MA 1AGEA 2P5ED 5FHAL 2NTFA 4M00A 4IJ3B 4PJGE 4QWWD 4KAQH 2UUDH 3A6BH 3MRNB 2VDLH 3EKCA 2ZP0T 5HHMB 1IMHC 2YOCA 2F53B 3VMOA 2YD4A 3KR3H 4ZUTB 5C0RH 4HWZB 5HPMB 1CDCA 2DYPD 5INDB 4HPOL 2J8UB 5IG7B 3HAEA 1J87A 1U3HC 3T0ED 1MFBL 3U0WH 2GAZB 3GMRA 5E2WH 3GSNH 5FYKE 2IPTL 4HG4K 5E8NB 5JMOC 1XR9B 3BN9C 1S7UA 3QIBB 4XWOC 2MHAA 2C4XA 4NFBA 3U7YH 4OQTL 4GJTB 3I50H 4LVOC 1EMTH 2FO4B 4PLKD 2R1WA 1DQMH 1QFWH 4BQ8A 2DQDL 1LGVA 1C12B 1IEBA 4Z7OF 5T3ZD 4QLRA 1C7SA 2R1YB 1NFDF 4JG0L 4MJ6B 3S35X 5K59F 4G6MH 3GB7B 1F4HA 2VQUA 4MA8L 5D2LE 4HV8A 1AXTL 2NZIA 4LPXA 4C56D 2ICEB 3IRPX 3KPRE 2A6JB 3JWDH 4J3TA 4Z7UB 3CU7A 2Y4SA 1FL6B 4OZIF 3OKEA 1JI1A 1MCIA 4XMLH 5HHOB 3LEXA 4ZUUB 1A2YB 1NC4A 2HVJB 3P9LB 3FHAA 1ZWIB 1UXWB 5HYQB 4ZUWA 1EDQA 4LVHC 5KVGL 1NMAL 1CF8H 3FB8B 4OT1L 3LD8C 4IMLA 4I4WB 1A14L 4U1MA 3MRDA 4CDGC 3IB4A 4I9WD 4LLVB 4U3XA 5D9SB 5IROC 4F2MA 3FN3A 3MR9A 1V3MA 5IVZB 3HI1B 4ODWB 4WHYH 1I1YB 3PWPB 1JGDB 1RV6X 4N5EC 1PW3A 3FO2A 3BPOC 4HS8L 3FN0L 4LSPL 1WWWX 2HJFA 4IIQB 2V9RA 4HUUB 1S5IL 1UB6B 3CX5J 1C16B 1L7IL 4UOW1 5F96L 1NLDL 2Q7NA 2EXWD 3N1QC 4M1DL 1MVUA 4PLJC 3E8UL 4R90L 3MLZH 4E41D 2XIDA 4OD3L 5IT2L 3KHOA 2IAMB 3C5ZC 3UJTH 4GAGL 4XNMA 1CK0H 2YC1A 1UCBL 5EO0A 3DMMC 4FTVA 1NAMH 4YZFE 4TSCH 1WBXA 1IC1A 3FRUB 4PJIB 3VXPB 4X6DF 2G2RA 1GZPB 2VLJE 4J2XA 1HINH 2DQCL 3VH8G 4KXZH 3PNWB 4YXLH 3WD5H 1YYLH 4Y8DC 4YQXH 4F7PA 4WTZA 1NCCH 2B7DT 1U8MB 4JM2B 1LDPL 4NBXB 3MRRA 4OZ4B 1ZVHA 5FYLH 4DGYL 1S9KC 1CICC 2JK5B 3S4SG 3H9SD 3PG2A 1F3JA 2H6PA 2D9QB 3QQ3A 3QZWA 4L3AA 4UNVA 3MV01 3E0GA 3EOBB 4OCXL 4BSVB 2NNAA 4PJCA 5F7HA 3VD4A 1L6XA 4G8GA 5C2BH 1TMCB 2R1XA 4NRXA 2P8PA 5HI5C 1PQZB 3ZKSD 3X3GH 3NCBB 1ZGLA 2YHGA 3RA7L 4BFEA 1CDYA 2H32B 3UTZA 2GW5A 2BCKB 1KPUA 1SM3L 2XA3A 1K5NA 3IU3A 2P47B 3F58H 1JHKH 1PG7L 3C87A 1VEMA 4I5BB 5TPWL 4I2XB 1FAIL 1DE4A 4WW2A 5GZNC 1TJGL 1G1CA 1AGBA 1LWRA 2NY3C 4GXVL 4NNYA 2EICA 2GUOB 5I1LB 1T03L 3BXNB 1R3LB 1ONQB 3ISWA 4O4YH 1MCOH 5MENA 1QBBA 1J12A 5BS0E 3MROB 1Y18A 4YWGL 3AVEA 3OTTA 3RY4A 1UKTA 2P5EB 4CADB 4ZPTA 4LK4A 5D7JD 5A3ID 5E4EC 3MODL 4L8BA 3TT3H 3JTSB 4LSUL 3HE6C 4M7KL 2D2OA 2DMBA 5HTSA 1CFSA 3V4PH 3RGVA 3QXWA 5HGAA 3GSWB 1P6AB 4LBEA 3DX7B 2FJFA 4TVPH 2RCSH 3C5SB 2DYPB 5MERB 2AGJL 3B9VA 2IQ9H 4NNXA 4AMKH 4OCYH 4QXUH 1QTYT 1XF4B 1MRFL 4IRSA 3RIFK 5C6WH 4GXUN 3D0LB 1NCDL 1E6OL 3LRSA 4U4BA 3MACL 4P5TC 1XCTB 4CKVX 4Y19A 3PGDA 1H3VA 1CGUA 1GIGH 4HZLB 3A0OA 5K9JL 3SGEI 2CUHA 2X1QA 4FQ1H 4QT5A 1G7IB 3X14B 4JPVL 3UX9B 1B0RB 2MQCA 3CXDL 4M6MH 4L3EA 3VGBA 5GIRA 5E9DB 3BGMB 2CR6A 3LIZL 5FUZH 3O2VH 4PJBA 2ZUUA 1RSFA 1MHEA 1G7HB 5J12C 3VI4E 2XWTB 1IEAB 3F6LA 4C83A 1MJ8H 2HP4A 4FQXC 3VXTB 5BMFH 2BOCA 2CO7B 4GH7B 1MFDL 4U0QB 1Z9MA 4PRIE 4RMRA 4C58B 3CVIL 2D7TL 3RTQD 3BHBB 2BZDA 1JNLL 4O2EB 3SBWC 5ENWA 4R4NC 1HHJB 4BQ9A 3MPCA 4YLQT 5L8JB 3K74B 1G9MH 3QUML 1HSBA 4FFZL 2HVKA 3D1MC 3BUYA 4JY5H 3QT2A 5CINH 4N0UA 2C9AA 1N6VA 2P48B 3GGWA 1OLZA 4ZTOH 1IM9A 2YD2A 1X7QB 3H3BC 3BKCL 1Q72L 3BIBX 3VFUA 5FA4A 1KN4H 2XPGB 5E8EB 1R5WA 2ESVD 5DD1H 2V2XB 1N8ZA 5KSAB 1KLGB 1WF5A 3KLSA 2EO9A 3OWEA 3WN5C 2CXKA 4LCIH 5FYKD 2G60H 5B8CC 1QSED 4RIRB 5FUOH 2AJUL 4JFPB 4JFHE 4P59H 4HH8A 2VDRL 4BFIB 4XP5L 4EDWH 1DANT 3BH9B 5HHNA 4KI5C 1HI6B 2VQTA 5I18L 5HJ3B 1GGIH 1X5JA 1S5HB 2JJSA 2JJTC 3QUZA 5J8OA 3RVWC 2VIRB 4IS6A 1CD9B 5C0AB 1G7LB 4M02A 3ETBF 5C9KA 2VZ3A 3DV4A 3OB8A 4K71B 4I48A 4BH8B 1A4JB 2ZUYA 4XCEB 4OCRL 1IZJA 3PP4H 4N9GA 4Y2DA 5FGCB 3TNNA 3JWDC 1YUHB 1J86A 3H9SB 2VDQL 4FQ2H 2ADGA 3UZQA 2GJ6A 3KPRD 3VA2C 5IFJA 4DQOH 2UYLA 3CFEA 1KULA 3KLAA 2CLZB 3MRMA 4PIRF 4NQCD 5EU4B 4HULB 5F7WC 3QWRA 1YNKL 2FBOJ 3LEYH 4XC3H 1RFDH 1FE8H 1MCNA 4RAUB 3FZUD 4ZAKC 3SQOL 3M1BB 4NZRH 2EC9U 3R8BB 3O6MH 5LCVH 5BV7B 4DVRL 3PJSB 2QLVB 4HS3A 1HH6B 4Z7OE 1MAML 3H9HA 3E6HB 1NFDE 4PJ9A 3TO4C 3CXHJ 3MXWL 4M7LH 3RVXD 5K59E 1ZA6B 1ADQA 2EIEA 2DM7A 3KPMA 1U93A 2F54E 1YEFH 1GHFH 4X83A 2B4CC 4ONFL 5M94B 3NFPB 1Z9LA 5CSBA 3H2WA 3O2DL 1PKQE 2V5RA 4NN7C 2AEIT 2LU7A 4WTWA 3I85A 4NO2B 5EPMA 1IGIH 3B9KD 5F1NB 4UTBH 3QDMA 1OARL 4JREC 5D7JB 1A6TA 2JIXA 4Y5YA 4H1LH 4NSKA 2WUBH 4NN6B 3L3OB 2JB5L 2VDKH 1JHTB 2YPLE 5JQ6H 3CDGA 7FABL 5IKCB 4G42B 3QG7H 3TEUA 3VFSB 1V7NL 4JFOB 2VZOA 1U3YA 4KGJA 4NKDB 1J9CT 1CXIA 4MCYB 1P7KA 2IH1B 3BAEL 4LAJH 2IBZY 1CDJA 2YPVL 1BOGA 4JFQB 2R0LH 2PTTB 1Z5LB 4YK4B 4BUGA 4OGYL 3EYVA 4UB0H 5IK3A 4KRMB 4QHLB 5C0BB 4D8PB 1JVKA 4LVNB 4XP9H 3LSOA 3V2AR 2R4SL 4P2QE 5C0EB 3NAAL 4H5SB 4TSBH 2KL6A 3D25A 2ZKHH 1R5VA 4UQ3B 2EZ0C 2JF1A 2R2BA 5EULV 2MQ3A 4AQ1B 4DFIA 5KAQF 2C1PA 3SGDI 1KC5H 1MFNA 2I9LB 3HAEH 5CMAA 1A7NH 3T08A 4AH2A 3MA7A 4POUB 3QNYB 3QUKB 5BRZB 2AVGA 2BVOA 1FV1A 3KNBB 5EU3B 3TV3L 4Z7VF 2BVPA 1IGFL 1EHNA 1QQDA 4YH6A 1KGCE 2BJML 5DMGC 4OCNC 4X6DE 4MS8C 4YJZL 5EZIL 4NC2B 2DDQL 2XXCB 4HUXA 2ZPKH 3HPJB 2FL5A 3PWJA 2D9CA 4YHKH 4EI5A 2D0GA 1A3RL 1D6VL 4M5YH 3VGHA 3O9WD 3QDGA 5ADOL 3T77A 1AFVH 1ZEAL 4OLUH 2LAGB 2A6KA 3OX8B 5DHYB 4ZOCA 3G5YB 3BZEA 4WHDA 3BGAA 5F44A 3TH2T 5EBLA 4PG9B 3D2UD 4PJGB 5JQHC 1X5YA 3WFCL 4YC2C 1CFBA 2XWBB 2C3XA 1NKRA 3P0YH 3FCTA 1I7UB 2WIMA 3D39A 3F7PC 2OCFD 4D9QD 1AD9B 5T5FH 1MAJA 4PRAA 4KJYB 2DJ4A 5FF6B 2H2PC 2HFFB 2L4OA 3ARGB 3EJZC 3HRZA 3DX9B 1P1ZB 2X2YA 4JZNB 2OQJA 3FT2A 4MGXA 1V7ML 2UZXB 4LRNL 2YUWA 2VUOA 2E8ZA 2P44B 5T3XH 4MCZA 1KELH 3DPBA 4XVJH 4X98B 1A7PH 2FX9L 4HXBL 5D1XC 2EDNA 5T1DH 5HDOA 4PRBB 3WKML 1ZS8A 4QKXB 4D9LH 3OAYK 1R3KA 1UB5A 2OXGA 4L9LC 4MSWA 3WFBL 2B1HL 5E6YA 5CBEB 1UQSA 3TA3D 3U79A 4M1CC 5D2LB 4M9PA 3FB7A 2Z31A 5E2TL 4HFUL 3HMXH 1JL8A 1H15B 2JKXA 2NTSP 1U8HB 4YDJA 1C08A 5I19L 4OIBA 2FB4L 2W9DH 3EZ8A 3L5WB 5EC2A 2CGRL 3SPVA 5DWUH 3LRHA 3MV8E 3QI9A 5F7YC 2A9NH 1FNEA 5E1AA 1MIEL 1KEGL 3MLYH 5J3HC 4PRID 1IQWL 1RUPL 1Z9OA 1WFUA 1W0VA 1FH5H 1U3HB 4H26B 2XN9A 3GM8A 4EOWH 2Y36H 1G9MC 4ALAL 1CFNB 1IKNA 4AT6B 3AB0C 4H8WH 3V6ZB 4JAMB 1B0GB 4L8DA 4KUZH 1XIWB 7CGTA 4GW1A 3RVTC 3DV6A 3KYAA 5DQ9A 4YR6B 1BHGA 2AABH 1CS6A 1DFBH 1OP3K 3UDWC 2Y7QB 4RGNE 1BBJB 1WISA 3LKSB 5DEFA 4UDTA 2DIJA 2A1WH 4JQVA 1IL1B 4MA1B 3S36X 2D31A 4CN6A 3BSZL 1ZT4A 2I9TB 4P4RA 1RIVH 1A1OB 1AO7A 4GLRI 3B9KB 2DTMH 2BVQA 2X70A 3OB0H 5BQ7B 1RJZB 3MNVB 4AL8L 4RMUA 4PY7B 1I1AA 4LGRB 3F12B 2DTSA 1RZFL 3B6SB 1RZJH 2DQUL 4IOSD 2NY4D 4Q6IC 5IHLB 4KY1L 5J6GB 5EFIB 1EFXA 1LHZA 3HZKA 2NY1C 4N0RA 3WNKA 5L6YH 4X6FB 1NUFA 2VLJB 4MLIA 3CLFH 3LZFL 4BZ2H 2A74A 4LMQI 5GGTL 1NL0H 1FPTL 4GAJH 4WI7A 2YBRA 3MOAH 3K8MA 1K8IA 2OTWB 1OVZA 3LD8B 1BZ9B 1J0HA 5GGUB 5GGRA 1N6QH 3H9YA 3QYCA 1EEZB 4X6BB 4NC1C 4KROD 1JGUH 1NBVL 1ITCA 1SYVB 5CJBA 5D70H 1YMHA 3QO1A 3BPOB 1MQKH 3HNTH 3R1GL 4FQCL 4XP4L 1XH3A 5KVDL 4LPCA 2R29H 2OS7A 1F42A 4HIEB 3PWNB 4K3JL 1QBAA 1BFVH 4MNQD 5IW1A 4KK9D 2BDNH 4L5FH 3ZO0A 2CK0L 2HKHL 1JMXA 5TF1L 1JMZA 3ARQA 5IQ7L 4ZSOA 2X4OB 32C2B 1IFHL 4U1LA 5IVXF 3V8CA 2KQNA 3W9DB 1HIMH 1AQDB 2VH5L 2G9HB 3HZVA 4PGBB 1VGKA 1AE6H 3D9AH 3EW3B 2ARWA 3A6BL 5JDSB 1AR2A 2DLFH 5KSBA 2VDLL 4LP5A 2DN7A 4F37K 2Q86B 4DN4L 5J06A 5BS0B 5F70A 3OAYH 1FFNA 3FQTA 3GBMH 5DRWB 3KR3L 3QEQD 1NEZG 3RL1B 5C0RL 1CXHA 3EYOA 4JHAH 4HUVB 5SWZE 1CICB 1SHMA 3U0WL 4A6YA 2P5WD 5E2WL 2YPLD 3GSXA 3GSNL 2A38A 4OLEA 4D0CB 3FQNA 2MTPA 4ZS7H 5CJOH 3RDTC 4WHYG 4X5WB 1ORQA 1UH4A 2OBGA 3EO9H 3U7YL 4K3HA 3I50L 1EMTL 5HGGS 1I8IB 1DQML 1HE7A 1QFWL 1T66C 3PIQA 4AEHH 2ED7A 5DR5H 1KIPA 5D7LD 3TIDB 4G6ML 4KJPC 4P2QD 3T65B 2IQAB 4NRYB 3AREA 1LEKB 3NFNA 1WBZA 1QFHA 1Y6KR 3ALWA 3KPLA 5H8DA 3LMJH 2NY3B 3VWJA 4HD9A 1BVLA 4JDZB 3RWIA 4HSQA 2IBZX 5FOJA 3KYOA 3JWDL 3TA3B 2F5AH 3F5WA 4JKLA 4OFVA 4XMLL 1FO0A 2E27H 5E4EB 4BFBD 1QO3B 3VFVA 1KGCD 3RQ3A 3ZDYE 3HE6B 3T0BA 4P3DA 5KG9A 4X9FA 1CF8L 1JF1A 3DLQR 5LQBH 3LCYA 3OKLA 3FTGA 5DJ0B 2ARJQ 4WHTA 1CLYH 3DYOA 4ZODA 5IIEB 1RJCA 5B39G 1K3IA 4U1NB 1WFTA 4YGVB 4U6XB 1PYWB 2X1XR 4M5ZL 5CJ5A 4QRPD 1ULVA 4KKAD 3BT2H 4O02H 4FQHA 3RJQB 5TDPA 5DEGA 5T1KA 4NJ9H 3DXAB 2CDFA 1NFKA 1H5BC 4QOKD 4MWFB 2MWCA 1N5AA 4Z7VE 1M71A 3MLZL 1MJJA 4NQDA 4Z76A 3UJTL 3JUYA 1CK0L 3GRWA 4AZ8A 1WFNA 5F89A 2V9QA 1NAML 4TSCL 3RP1A 4P2RE 1VCAA 5DC0A 5J12B 2H41A 1W0WB 5HXMA 1BM3H 2X4NB 4YNYB 3VXUA 2GY7B 3LB6D 1HINL 2NY4B 5E94B 1ADQH 1MLBB 1VB9A 4YXLL 4YAQB 3WD5L 4PD4K 4DW2L 1YYLL 4JHWH 4YQXL 1P7QB 1NCCL 4GKZB 4PJ5E 1CDUA 4RSVA 2PW1A 5FYLL 1T1YA 4OZGA 2DLHA 2NY7H 3ZKND 5H37H 1LP9F 5DVMA 3I6KB 1AHWB 3SJVA 4HIJB 4QXTA 5C2BL 3LH2H 5FEBA 4G43A 1U8IA 1MJ7H 1T0MA 2YWYA 3X3GL 2EYRA 3HZMB 5JW4R 1OD9A 2GFBA 2IWGA 2O61B 1CVSC 4ZUSA 4K7FB 4KROB 2GTWA 4WUUE 5ESQA 1CDHA 3IDGA 1BFTA 1DLFH 1GGBH 1T3FA 3F58L 2BNQE 1R3HB 1TCRB 1S7SB 5JHLH 4J3VA 5LGJB 2DOCA 4H8WC 4KUCF 3TJHC 1HHGB 3WBDA 2LTQC 2RQ8A 2MJWA 2EE2A 1HNFA 3CCHB 2YD5A 4O4YL 1MCOL 5B8CB 4X9BA 4S0SD 4YUEH 4S1SH 1NFDB 5FKAA 2AJSH 2IEPA 2YD3A 4GKSB 2F54B 4RGND 3HFML 3C9NB 3DUSB 3TT3L 4EI6A 2WK2A 4YEFA 4YE4H 3L3JB 3IU4H 1PKQB 3MBED 3DUUA 3SKOB 1G7QA 1K3ZA 4YHIB 4FFWD 2ATKB 3BGFB 2RCSL 4N8VG 4G5ZL 4TVPL 4CU6A 4NM4L 4X4YB 3QDJD 4RISL 5DQDH 1LO0H 2ICWA 2C3WA 5DO2D 1ZHNA 4AIZB 4AMKL 3INUH 4OCYL 4QXUL 1NANH 1MCSA 3GI8H 5HVWA 1SJHA 4F57H 3V4UH 1YC7A 3QQ4B 2OR8A 5C07A 2EDDA 1OY3B 1E4KA 4ZOEA 2ENYA 3N1PC 4L8SB 3LV3A 4H88H 4NHUA 1GIGL 3I6GA 3QB7C 2EECA 3UZVB 4ZAKB 1RAMA 4FQ1L 3O2WH 5DFTA 3EOAB 2EIZA 1Q9OA 3UJIH 3AU1B 1FZJB 3QPQC 4JO2H 4JJ5A 4M6ML 1A21A 4P2QB 4HEPG 4UT9H 5FUZL 3TBSB 3TO4B 3O2VL 4FP8H 1CDIA 2DWDB 3GDBA 4IRSC 3GIVA 4F7MA 5DJXA 2BOBB 4TVSa 2VISA 3OXSB 1MJ8L 1BVKA 1KNOA 1A22B 1I7ZA 5BMFL 2XQYK 1U8OB 3MRLB 3JUZA 5FV1L 4RFNC 3DYMA 3S5LB 4NN7B 1FCCA 2FGWH 2HAZA 2DJSA 3RKDC 1T1XB 3BIKA 3MRFB 5EIVA 1JZ8A 4JREB 3KXFE 3RVVC 3TH4T 3RI5K 3CZFA 3ARSA 4X6DB 4YHLH 2FZ3B 2R9HD 4FG6D 5GRWA 3HC0A 2ITCA 1JCKA 3UBXB 1F2XK 5C0DA 2FATL 1WBYA 2K7PA 2ERJB 4ERSH 4DN3H 4JO3H 2V6HA 4P49A 5CINL 1JZ7A 2C4FU 2FH8A 5IW3A 5DJCB 1NCTA 4RAVA 1AKJD 4ZTOL 4Z9KB 1AIFB 3C09B 4MZ3A 1OF2B 1V05A 2CRMA 3ULUH 5FO8A 1KN4L 3SN6N 4D0BA 4M8QB 5SWZD 3U0TB 5D6DA 1KXQE 4L4VD 3UJJH 2WP3O 5CSZA 4W70A 4N0FA 4JLRB 3P4MA 1RHFA 2RB8A 3H3KA 5GJTH 3U6RA 1M7DB 3MYJB 4LCIL 4EKXA 2G60L 4X7SL 2YEZA 3GSRA 2H8PB 3MQIA 5FUOL 4P59L 4GAYA 4ZFOB 1BX2B 4EDWL 4APQA 5H2BB 4OTXH 4KJQD 4UIKL 4Z7WE 1GGIL 1TZIA 1UZ8A 3FAWA 3BH8B 3MRKA 4PLNC 4QHUA 4Q2ZA 4HLZH 1QR1B 1HWGB 4V2BA 4ONGH 4H1LG 5TE4L 3NN8A 3NOIA 5I1HL 5J9PB 5F6IC 5IV2A 2HWZH 3PP4L 4X4XB 4PJ8A 2WQRA 3CFKB 4FQ2L 4F15C 3CFBA 3SGJA 4HUNB 5DDHA 1QUNA 3W0WE 1XGTA 4DQOL 4PJXA 3WHXA 4GFTB 4GRWH 2VDNH 1JPGA 4LCWA 3VXRA 5FM4A 1D9KD 3RL2B 1MCDA 1RFDL 4JE4B 3GMMB 3QUZC 1FE8L 1BF8A 3L3DA 2JJWA 3HPLA 4NZRL 5DUBA 5FECA 1EEYA 4HK0A 5ERWA 3MV8B 5LCVL 1G7MB 1MFAH 2EKSB 4P57B 3STZA 2CKNA 5FA3B 4LPTA 4Y2DC 2APBA 4KKBC 3DOSA 5F9JB 3B5HA 1E4XH 1PKOA 4M7LL 3TH3T 1I3VA 3HAEG 5EH1A 2XY2A 2A6IA 1YEFL 1SJEB 4TUJB 3DWTA 5L2JB 3UTTB 2JB6A 3ARBD 4XPBH 3BD3A 4GMSH 5EU5B 2WAHA 4DCQA 1NGZB 1JIBA 2Z93A 3MLTB 2WIIB 3VWKD 4NN5B 4HIIB 1OGTB 2D0FA 8CGTA 4UTBL 1ZT7B 5LGHH 4RGNB 1JPSH 1FG2A 2K1MA 2H2SD 1KB5A 4LFHG 1IRAY 4ZD3L 2VDKL 1S7VB 4DEPB 4NYLA 4YDVA 4F3FA 4L9LB 5ALCH 5JQ6L 3MBEB 2DWEA 3QG7L 1D5ZB 4PJ9C 1KCLA 2NZ9D 1G1YA 2GJJA 2QKIA 4P2RD 3U83A 1I9RL 2R0LL 4F7TB 1LO3H 3RBSA 5F3BB 2CRZA 5DTFA 4UB0L 1EAPA 4MDIA 3P0VH 3ROOA 2HJLB 4EZMA 5IEKB 3HE7D 4PJ5D 5ETUB 4TSBL 4PV9A 5CKAA 5FIEA 3N1FC 2ZKHL 1QRNE 4Q6YA 3LEVH 1VEPA 3MRCB 1INQA 2FD6H 4Z0XB 5F1KC 5CP7A 2W0LA 1ERNA 3WIFB 4NT6B 1A7NL 4XCNB 1N6UA 2BERA 5I1GH 4A6YH 5JW4N 4HZAA 1LO5A 5C09E 3BP4A 3GJFB 5D1QD 3UXFA 1A6ZA 2ITDA 3FOLA 4R9HA 2VZVA 4WUUD 4GS7C 4XGZB 1NUDA 3GSOB 2AXFB 3WIIH 3DBXB 2LABA 3EGSB 3VXSA 3C8KB 1RZ8B 1NJ9B 3SDDA 1H3TA 3UROR 3GUTB 4KJWC 5FOBA 1FL5A 2ZPKL 5GHWH 2YWZA 3EHBD 3HHRB 3HR5B 5EU6D 3WHE0 3BYYA 1LVEA 3OGCA 3W81A 2WZPD 4YHKL 3VG0H 4M5YL 1TVHB 3J8F7 3NABH 5I73C 1LK2B 1I7RA 1VADB 3G6JF 3ARXA 5EUOF 5KTEH 1A6AA 1AFVL 1YNTA 3PL6D 3CUPA 1KJ2B 3KPSD 4U49A 4OLUL 4PRPE 3EYFB 1LP9E 1NCWH 1SVZA 3P73A 2PN5A 3LN9A 3ILQD 3JV6B 3RWDA 4BH7A 2DBLH 5EC1A 2NY1B 4BQCA 1WWBX 2DL2A 3AM8A 4X6EB 5IOPA 4M48H 2PKDA 4HGWA 2YA2A 5SWQA 3C8DA 3SO3B 2BMKB 3HMWH 1T4KA 1AKJB 4WTZG 4WEMB 4WEBH 1HDMB 4ENEC 3VXOB 4ZNEA 4YPGA 5DUPL 1D5IH 4P5KB 5T5FL 5SWZB 3FOMB 3GHBH 1DVFA 2Z35A 1KG0A 3O3DB 5DK2B 2R23B 2PO6D 3QZWG 3TIEB 1CD8A 3O3EA 4EBQH 4LARH 1L0XA 3IDNB 4MYWB 5AWNH 5IJVA 2F5BL 5IP4A 3QEUB 3HNSH 1MCRA 5EBWB 1HHKB 2OXHA 1OAQH 5T3XL 5DZOA 3QXDB 4XVJL 1NDGB 2FBJL 4PGCB 2FIRT 2R2EB 4PREA 2DM2A 1MNUH 3F7YA 3GMPB 1YN6B 4D9LL 4XCCH 2F74B 2AK1H 2C7UB 3MRJB 3MO1B 3O41B 4OKVB 2NLJB 1BQHB 4OZHA 3GRWH 2QSQA 2KQMA 1YECH 3HMXL 5IR1A 2DQEH 3LKQB 3LN5B 2HLAA 3TBVA 3VFWB 1W0YT 5AZ2H 3NZ8A 2W9DL 5DJAB 3T04D 2AEPH 5DWUL 3CSBA 4N5UA 4B7IA 3SDCD 2A9NL 3G6AB 5GSVB 4OLVH 1NMCC 3MLYL 4RBPK 1FH5L 4K3EH 3MRNA 1YEKH 4EOWL 2Y36L 4XNZC 2F53A 1A64A 1TNNA 3K1KC 1MIMH 4ZUTA 1DEEB 2Z31C 3RDTB 4HWZA 4KUZL 4U2ZA 1BF2A 5HPMA 4WO4D 1N3NB 2XZCH 2AABL 5INDA 3TF7C 1DFBL 2J8UA 4UV7H 3BZ4B 2OP4H 1C5DB 4JHZA 2A1WL 2XWJB 1YEJH 4KC3B 4HDIB 3ULUC 1HYSD 1T7WA 4X9GA 3CNKA 3QI9C 1G6RA 5E8NA 5F88B 4WI3A 1XR9A 5E7FA 3QIBA 2DTML 2BY0A 1F6AB 1TXKA 2GK2A 4WJ5B 4G8EB 1MLCB 2YUXA 2JLLA 4RAHA 2E5EA 4Z7VB 5CFHA 5I66B 1IKNC 1TZHB 1DDHB 1RZJL 5I8CA 1Z6JT 3ZL4L 5CGYD 2R1YA 4MJ6A 5JW3H 3MYZA 2ATPB 3GB7A 1U42A 2DMCA 2OJEB 3LOWA 3QFJD 1B3JA 4S1RH 4P2RB 4D2NA 5L6YL 4JQVC 3WDJA 4MAUL 2ICEA 3V5DB 5D5MF 3CLFL 5FO9B 4BZ2L 3V79C 3FMGH 3V8OA 3ROLB 1NL0L 4GAJL 2A6JA 4Z7UA 3JV0A 3MOAL 3T0WA 3HE7B 1YEDB 1FL6A 1FIGH 1WEJH 5HHOA 4ZUUA 1A2YA 2HVJA 2XRAH 3P9LA 1N6QL 2R0WH 2QR0A 3WE6B 1UXWA 5HYQA 1I1AC 1JGVH 1G7JB 1J0YA 4R0LC 3W0WD 5D70L 1MQKL 3DETD 3RJDA 4I4WA 3HNTL 3EYQD 2NXZD 4EN3C 2KUTA 4LLVA 2R29L 1PDKA 5D9SA 3Q2CA 1H5BB 1BFVL 2HMID 4WUUB 3DVNA 5FDYA 1FYTA 2BDNL 5IVZA 4L5FL 3BDXA 4KK8D 3V5KB 1ODAA 3EO0B 1JGDA 1N59B 1A1NB 2ENSA 5MI0B 3ZE0F 2BNQB 2AJYH 1P7HL 1HIML 4NQSB 3WS6A 4IIQA 3GSUB 4HUUA 1FDLH 1UB6A 1FSKC 2NY6D 5DS8B 1INDH 1QD0A 3KLDA 1NAKH 2F8VA 1AE6L 3D9AL 4BKLB 4IRJB 1AQKH 3TLRA 2VN7A 3RFZC 4QHNA 5BVPH 2DLFL 5SX5H 3NA4A 2IAMA 4OF7A 4NOFA 4XHJD 4QRTB 4DTGH 4DZBB 3IVKB 4ODSH 4XPAH 3GBML 4FFVC 3RIFF 1JZ3A 3TNMB 4MQXD 3VXME 3GEWB 3FRUA 4PJIA 5I74C 6FABH 2IALB 3VXPA 3GJEB 3MXVH 4WNQB 1JGLH 4HQQH 4UAOB 5SX4H 3PNWA 4X6CF 3KPQB 4ZS7L 5CJOL 1QACA 4FTVB 3SDAC 1U8MA 4JM2A 3WLBB 4OZ4A 4J4PC 4JHBA 2AI0H 3G5VB 1GC1H 2ICWJ 2JK5A 4OSUL 2YSSA 5I2IB 2JJVA 3EOBA 4BSVA 2X6MA 4RZCB 2IPUK 5IUSA 4P46D 3ALPA 4HHAB 4PYHA 4J1UB 1PQZA 1VFBB 4M6OH 4MJ2A 2VXSH 3ZE2F 2ADFL 2H32A 3LMJL 3OJVC 3LKOB 2LTQB 2BCKA 2NNAB 3FB6A 4LCCA 1OW0C 2R1XB 4QHKJ 2P8PB 2IADB 5HI4C 1UCTA 1TPXC 4I2XA 3BP6B 4N0YH 5C09D 4U33A 2YD9A 3QA3B 2GUOA 5I1LA 4D0DB 4Y16D 5B3NA 3BXNA 3U9PH 1P2CB 1R3LA 3QUMB 4LLYB 4NZTH 3RX8A 4NO5B 1ONQA 2GSGB 2M8XA 5LQBL 3MROA 3B2UC 4FMFA 5H37G 3AREC 1NGXA 3NCMA 3QO0B 1CLYL 3VFTB 1GAFH 1DE4B 1KPRB 2P5EA 3BPLB 3K7UA 4CADA 4NNYB 3VWJC 5HGHB 3KXFB 3NBNA 1OGAD 3JTSA 4PLJD 4ONHB 4XNUL 2X89D 1OLLA 3OMZA 3TO2B 2ID5A 4O02L 1G0YR 2E7BA 3PWUA 3GSWA 1KSRA 3DX7A 3EBAA 4WU5B 4NJ9L 3C5SA 1WAAA 2DYPA 5MERA 4U6VH 3O4OB 2YS4A 3VD3A 1XF4A 5I8EB 1A6UH 3D0LA 1W72B 5F9OL 2IMNA 2EXYC 4XB7A 4RDQF 3JZ7A 4NKQB 1H8SA 1UWGH 1TITA 4HZLA 5EORL 1F58H 4LNVA 1BM3L 1G7IA 1WQVT 4KUCD 3G6JE 5EUOE 1MFEH 3PV6A 1B0RA 1ADQL 3LQZB 5CAYB 4JHWL 4PYGA 2HJKB 5E9DA 3BGMA 4Y19B 1RIUH 2Z92A 4R97B 2ZCLH 3U82B 1G7HA 4JPWH 4Z7WB 2XWTA 2NY7L 2R8SH 4RFEB 1IEAA 3VXTA 5SV4A 5C0ND 1GH7A 3EFFB 4PLOB 1KB5H 3LH2L 4TNWK 5SWSD 1EEUA 1MJ7L 3Q5OA 5GZOC 1OSZB 5EZJB 1PG7W 1MSPA 2Z8RA 4J3WA 4I0PD 1T7YA 4R3SB 4C83B 3BHBA 2VXTH 4O2EA 4LSQL 3W0WB 1ZK9A 2O5XH 1HHJA 4Y4FC 2ZUTA 4S2SB 1LQSR 1DLFL 4IRZH 4H20H 4U6HB 1CGTA 2NXZB 4M43H 2X4PB 3L1OH 1HYRC 3QUYD 2VERN 5HY9A 4KGLA 1SY6A 4YUEL 3R06B 5JNYA 4S1SL 2XPGA 2AJSL 5E8EA 4X4ME 2V2XA 3G6DH 5KSAA 1K4CB 1KLGA 2PYFA 4ODTH 3T2OA 4HFWA 4YE4L 1RJLB 3TM6A 3EJYC 3IU4L 1WJ3A 4WFEE 4XTRD 4L8CB 1PSKH 4RIRA 3S37H 4OF8A 4JFPA 5FA4B 1RUQH 3SDYH 3FT3B 3BH9A 1HI6A 4ZG1A 1U2HA 3TWCH 5DQDL 1LO0L 5HGDA 5HJ3A 4LSRH 3K0WA 5E2UH 3INUL 1S5HA 1LD9B 2VIRA 2XICA 5C0AA 3GI8L 1G7LA 6CGTA 1BPVA 2NQCA 2Y23A 4F57L 3V4UL 2Q6WB 4BH8A 2ZOLB 5DLMH 1A4JA 1RJYB 1S7QB 4XCEA 3QIWD 4HH9B 1YUHA 4H88L 1DBMH 3O6FB 3H9SA 5LAXB 1SJVA 1J1PL 4KDWA 5TF0A 1ZLWK 1JWMB 2BP3A 4P46B 1D7FA 4JO2L 4WW2F 2CLZA 5EU4A 2BNRE 4M93C 5KOVC 1PAMA 4UT9L 1ZKAA 3JTTB 5T1LD 1QRNB 4FP8L 1DQDH 5HVHC 1UGNA 4RAUA 3M1BA 3QXUA 2R56H 4XXDB 4PJDF 2DF3A 5C6TH 3RVUC 4ELME 3PJSA 1AP2B 4IDJH 5CD3B 1HH6A 1HN1A 2FGWL 1E4KC 4EXKA 3H7LA 3E6HA 4HLZG 5EN2B 4X8JB 5C09B 1ZA6A 3VGGA 1FNLA 4JFFE 5DJZA 4ODHH 3NFPA 3KYMB 1T5XB 5J13C 4YHLL 3TPKA 3ARWA 5KVEL 1OAUH 4ZO6A 5TH2A 4NO2A 5JPMB 5F1NA 4ZFFB 1WTLA 5D7JA 2AEQL 4ERSL 1OAYH 3IFNH 4JO3L 3RUGF 1W2KT 3OKMB 3L3OA 3F6IA 3WUWB 3BPNC 3ESVF 2Q3ZA 1ND0B 2LVEA 2W0FB 4PRPB 5FUCE 1LP9B 5HDQH 5IKCA 4G42A 1TQCC 3VFSA 1QLEH 4JQXA 4MCYA 3QAZC 3ULUL 4WDIB 1A6TB 1SBSH 2JIXB 3BD4A 3GMLB 4MHHG 3ZKMC 2FEDD 4ACPA 2YA0A 4JFQA 2PTTA 2HFEB 5E6ZA 1Z0NA 5GJTL 4QHLA 1GC1C 5C0BA 4D8PA 1BIHA 4UIMA 2GCYA 1FFOB 1MCCA 4NWUL 4QY8B 5C0EA 4H5SA 3ZE0E 3CGTA 1LE9B 4O00A 3IFLL 5EO9B 3ZT6A 1ZTXH 2APVA 4UQ3A 3Q0HA 3C6SB 4BUHA 2XYCA 3WHE1 5L8LB 2D7QA 5IK3B 5JIKA 4TRPH 2I9LA 4KH2A 4ONGL 5LWYL 4DAGH 3PQYD 1CN4A 1EO8H 3QNYA 1JWUB 5D6DC 3KNBA 3WIHA 1QNZH 1R5VB 3W39B 5E70A 2XQYG 5DRNB 4EIZC 2XKNB 4FZEH 4HF5H 4OKDA 4JDTH 3HPJA 2VDNL 1GZQA 4KKLD 4RGMC 3QH3B 1F4AA 3MFGB 4X6CE 4S1DD 2YD7A 4Q7DA 4APQC 2FLBT 4I0PB 2BVPB 3QRGH 4IOFC 2YD6A 1CXEA 3OAUL 1D5XB 4X7EC 4R2GC 3V7AG 4N0CC 3T3PF 2FJHB 5DHYA 3P2TA 1EERB 3G5YA 1A3QA 4NHCH 3R4DA 3WFEH 5FDWB 4PJ8C 1E4XL 4PG9A 2R4RH 2VKXA 4PJGA 5L0QC 1AR1D 1ZLSL 1CBVH 4XPBL 1VGEH 2YMXL 5HI3C 1I7UA 3BZEB 1AD9A 5K33A 2XFXB 3IXTB 4KJYA 4RNRB 4O9HL 4QXGH 5FF6A 2AV7A 5LGHL 4ZUVB 3NCEB 3ARGA 1BD2D 1XGUB 1P1ZA 4JZNA 1DTUA 1XFPA 3FCTB 3KYKH 5ECJE 4WI6A 5ALCL 3QXAB 1J0JA 1CLCA 2QHRH 3HRZB 4XXCA 1HKFA 4PRBA 3Q3GB 2KBGA 2HTLC 1RD6A 4WEUD 5I1AB 5CBEA 4YBLB 4XMPH 4TUKL 4KI1A 3P0VL 2IGFH 5D2LA 2WWKO 1QSFE 3QIWB 3FO9B 3ARFD 4PY8I 4P3WA 2VDOH 3U46B 1Z2KA 1H15A 4OV6F 1T5WB 3LEVL 1ZS8B 1U8HA 2YPKA 3VG9C 3J7HA 1FLRH 2FD6L 2M2DA 3KPRA 2FDBP 5D8JH 3L5WA 5DMGD 4XNZB 1HK6A 2AJZB 3FQWB 2WSKA 1HXMB 5JOFB 1VDGA 4YFEA 2DLGA 3V4VH 5J6HB 2NYYD 5IMKB 2JELH 5T1LB 4PJEE 4UNTA 1U3HA 4H26A 1W8NA 4PBVC 4GBXD 3SPVB 1CFNA 1NSNH 3QI9B 4XI5C 3QQ9D 3V6ZA 5D93B 1T21B 4JAMA 1B0GA 5GHWL 3V9FA 4MAYD 1XIWA 2WV3A 4QNPE 3ARDD 4YR6A 3VG0L 1MI5E 2Y7QA 4F37F 1BBJA 2HH0H 3EOYG 2VXUH 3LKSA 1T6WA 3BO8B 5KTEL 5HDLA 1IL1A 4LDLB 3B8SA 5BO1H 4MNHB 4WFFD 3JWOH 1KFAL 2H32H 2I9TA 3A67H 1NCWL 3UTPD 1UYWH 5ABDE 1A1OA 2E7MA 3B9KA 4K3DH 1F3RB 1VACA 2DBLL 1U0QA 2IPKB 2H2PD 5FYJH 5KSVB 2J6EL 5EWIH 5BQ7A 2MPAH 1RJZA 3MNVA 4M48L 2FEEL 5T3XE 1M1SA 2G75B 4PY7A 1KTRL 3F12A 1IC4H 3B6SA 3HMWL 3SDDC 4G9FE 4WFED 5F93C 5J6GA 5EFIA 1QFOA 4WEBL 3HS0A 5JA8B 1D5IL 4HJ0C 3VXMB 5FO7B 4I13B 5IB3B 3PP3H 3GHBL 5KN5B 4X6FA 3BKMH 2J88L 4JRYE 2VLJA 3CMGA 2E7CA 1FQ9C 1I1AB 4U7MA 4MB5A 5EZOL 4R0LB 3G04B 5AWNL 4J3XA 3RHWK 2OTWA 4XWGH 1D5BB 2HG5B 1BZ9A 3W9EB 5GGUA 4EN3B 4CVXB 2X4RB 4HUKB 1MNUL 4X6BA 4LU5H 5CUSH 2BHYA 5TGBB 4XCCL 2YBRB 3V5HB 2AK1L 1SYVA 4MB4A 2J5LC 5GRYA 5FB8B 1MREH 4M7ZC 5HYSB 3G5ZB 4HIEA 1DVFC 3PWNA 1IAMA 5F97E 1YEGH 4XVUD 3GSQB 2DQEL 1VERA 2X4QA 4RRPG 3ULSB 1D3CA 5AZ2L 2X4OA 32C2A 4LQ1A 5DGRA 2AEPL 4Y1AE 1OWRM 3QISA 1AQDA 3VJ6B 2HT4D 3ES6B 2G9HA 4JFXB 3O9WA 4JFFD 1YA5A 1KT2B 5IW6B 3K2UH 1MRDH 4K3EL 5JDSA 2OZ4A 1YEKL 2WINB 5JHDD 1CLOL 1RURH 5IESH 2Q86A 5BS0A 2FX8H 1RZ7H 5DRWA 3QG6B 4ODXB 1MIML 3O11B 3SDAB 2F8OA 3RL1A 5LGKA 5KVMC 4HUVA 3I6LE 3DVGB 1MUJB 5KW9H 4X80H 1B88A 2OP4L 3R0NA 4JPIB 1YEJL 3MLRH 4TSAL 5JMRA 3W82A 5HYFA 2XZQL 4I3SH 4U7KA 4EEEA 5JPNB 4D0CA 4L4JA 4PJDE 4M8VA 4X5WA 4KDTC 3QPXH 1MCJA 5KSUB 2V7NB 3B9DA 1NBZB 4YIQA 3QEGL 1I8IA 4X7TB 4A6YB 1VEOA 1GGCL 1TFHA 4PPTA 3UPAA 4CJ1A 5DVKA 2E9JA 4JO1H 1XCQB 5JW3L 4P5MB 4OGZA 3ULVH 3T65A 2IQAA 5T33H 4NRYA 1LEKA 4S1RL 3OAZK 4L4TE 1SY6H 4OCSH 1MFCH 1VENA 5F7KC 4I1NB 4JDZA 4JR9H 3G6JB 4Q58C 5EUOB 3RUGE 2D03H 3SCMD 3C8HA 3TA3A 1T0NB 2EDXA 4MZ2A 1ZMYA 4DKEH 4K7PH 3QIBC 5CD5C 1FIGL 2N7BA 1WEJL 1PGRB 2DQHH 2Q8AH 5IF0B 2XRAL 3HZYB 5I1KH 1QO3A 1JGVL 2DKMA 3F5WB 2A6DB 4HPYH 4Z6AT 5DJ0A 5A2JH 4MA3B 3M8OH 1JK8B 4C4KT 1FO0B 2Y6SD 4NP4H 2YKLH 5AUMB 4U1NA 4YGVA 4U6XA 1PYWA 4KK5C 4JVUA 4NC0B 3OKLB 1Q9LA 3IJSB 3N50A 2AJYL 2CKBL 4MAYB 5B3JF 2BNUB 1J5OH 1FDLL 3ARDB 1INDL 3LKPB 1NAKL 4MWFA 2IANE 3EAKA 2LFGA 4Q0XL 5D72H 4OZFB 3VDAA 1AQKL 1Q0XH 2VXVH 4OI9A 4WGVB 5DVOA 4DTGL 4ODSL 4XPAL 4O5LH 4P48A 3O3BB 5BV7H 3QIUB 2MCG1 2M26A 6FABL 3MXVL 3RIAK 1W0WA 2X4NA 4YNYA 1JGLL 2VKWA 4PV8B 4HQQL 4NBYB 3RU8H 5E94A 1MLBA 3O4LE 3F7VB 1P7QA 3QXTA 4IIQC 5F89B 4P2CG 4OCWH 4GKZA 1S7RB 4GSDH 1UZ6F 4QRUB 3T3PE 5MP6L 2AI0L 1GC1L 4GRLC 2IAMC 5HD8C 1DL7H 2B20A 3I6KA 4IM8A 3B3IB 1AHWA 3U4BH 4Q9CA 4P9HH 4Y4FB 4HIJA 4UOW0 5MEQB 1RPQA 4M1GH 1I3UA 3H7BB 3MBXH 4R7NB 4M6OL 2R2HB 5TE7H 3HZMA 1D5MA 1IAKB 5DD0H 1EHAA 4LP4A 3BQUC 2VXSL 4NJAL 3D6GA 2O61A 4HXAH 4OZGB 43C9B 4EDXB 2E9IA 4K7FA 4KVCH 2OK0H 4LFHD 1TDQA 3C2AH 2LV4A 4NBZB 1T80A 3ELAT 4QRQB 5I1JL 1HZHH 1S8DA 3QP3A 2BNRB 4OI7A 4JM2C 1F6LL 4P4KD 1R3HA 3IF1B 1TCRA 1S7SA 4ZFGL 3RI5F 2KZ1B 5KSBF 4NO0D 4N0YL 5LGJA 4W4OA 1F97A 1A6VH 3LAFA 4X5XB 2GTWB 5L9DH 4NZTL 1UEMA 3CCHA 2BVYA 4ELMB 1T3FB 5B8CA 1X44A 1B6UA 4FOMA 2EH7H 2DI9A 1NFDA 2VLKE 3JWOC 3UPCA 1GAFL 1NC4D 3OKOB 4GKSA 4JFFB 2F54A 2X5PA 3C9NA 4W81A 4LCCC 3W2DH 3L3JA 3FQUB 3WIHH 5L2KE 1YN7A 1PKQA 5E4IA 3ZYZA 1QFWI 1VKXB 1I75A 3SKOA 4YHIA 3V6OE 2ATKA 1DANU 4U6VL 4X4YA 4AIZA 4K8RH 4EI6B 1X6NA 5DJ8B 5T3XD 1QPPA 1A6UL 4CAGA 2YPLA 1T1WA 4XNXL 4V1DE 3UTOA 2GYSA 3ZKQD 4Z0BH 3WFZA 4G9FD 4MD5A 3QQ4A 4I18B 3I3EA 2B5IB 5JR1H 4L8SA 2ICWB 1UWGL 4QWWC 4JRYD 3MJ6A 3A6OA 2IPUG 4PG2A 2PYEE 4PJ7F 3EOAA 3AU1A 1FZJA 1EGJA 2D0HA 2VN4A 4TQEH 1CDBA 2EEAA 2W0PA 4P2QA 1M7IB 1RIUL 4PJFE 4WU7B 3DARA 3TBSA 3B43A 3P11L 4XX1E 4NHUB 4J23A 2DWDA 3T0EC 2DM4A 4JPWL 3O8XD 2BOBA 1T2XA 2WLYA 2R8SL 2LAAA 3OXSA 2QSVA 3SCMB 3QJFB 1CGWA 4POZD 1U8OA 3MRLA 3S5LA 1KB5L 1PEWA 3AUVA 1RIHH 1KXVC 5FYKH 4MXVF 1T1XA 3MRFA 4PLKC 3VA6A 2WW8A 3VGAB 4Y5VA 3TJHD 4F7MB 3TYGH 4LPYA 4QTHB 5ACMA 2VXTL 1I7ZB 4X6DA 3H9ZA 5C6PB 4G8GD 1JPST 2O5XL 2CJUH 3RY5A 1U95B 4Y1AD 4M3KB 3UTSE 4LASH 4IRZL 3UBXA 4H20L 2HYMA 1S7WA 5IB4B 4M43L 3L1OL 5T1MB 2IC2A 1AGFB 2CIIB 1H3WM 3G5XB 1C1EH 2BSED 3NPSB 3SKJL 1E28A 1UM4H 3CDYA 5DJCA 1X5GA 1S7XB 1AIFA 1WCQA 4GUPB 1P53A 1OF2A 3F62A 4KXZI 3I6LD 4M8QA 3U0TA 1MCKA 3T0EE 2IMMA 3G6DL 1YMME 4ODTL 4G6FB 4JLRA 4M4RA 2ZUVA 4N90D 4WW1B 5MEND 1M7DA 3CJJA 3MYJA 2VLME 1PSKL 2H8PA 2W91A 4HT1L 3S37L 1DZBA 3BDBA 3IT8D 4ZQKB 5IMLB 4ZFOA 2FJGB 3OG4B 3SDYL 1FGVH 1BX2A 1XF3B 5H2BA 4IHOB 3I02B 3TWCL 5JORB 4NQEE 4LSRL 2X4UB 5E2UL 4OFIA 5D4QA 3BH8A 3IDUA 1QR1A 3K3QA 3RGVD 4M6AA 1T22B 3ZTJH 5J89A 2AXGB 2CDGB 5DLML 5J9PA 5IHUH 5HDBF 3STLB 1MHPH 4L4TD 4X4XA 2EXWC 1DBML 3IDYB 3CFKA 5DHXB 4C56E 5CBAB 2NR6D 3DIFB 2EIBA 2VB5A 4WWKD 2C3GA 2N4IA 4O2FB 3SKMB 1QSFB 1KCVH 1YEHH 5IV2B 1NFIB 3JVGA 1RZKH 5BOZG 3AGVA 1JZ2A 2DQFB 3RL2A 1FNSH 3GMMA 3S88H 2X4TA 2ZUQB 1BIIB 4K9EH 5L0QB 2R56L 1BQSA 1XGTB 3WXWH 1RUAH 4K71C 3MV8A 1IKFH 1G7MA 2EKSA 4P57A 3H8NA 4P4KB 5FA3A 4IDJL 5AAWA 4XBPB 3MCLH 3MRBB 4LF3B 4FQJH 1CL7H 5F9JA 3VXRB 4NO0B 3Q6FB 2W65B 4PJEB 2XA8H 1V3KA 3IJHA 5ALBH 1SJEA 4TUJA 5L2JA 3L3DB 4JZJB 1V8HA 5ICZB 3BP7B 1QOKA 5EU5A 4HAGA 1NGZA 1OAUL 3MLTA 4JFDE 2WIIA 4UT6L 4HIIA 1OGTA 2NMSA 1ZT7A 1MI5B 1OAYL 4OLWH 3IFNL 4F58H 3B83A 3IDXL 1S7VA 1YNLH 3FAXA 5K9OA 1FRGH 3D0VB 4LIQL 4L9LA 1NGQL 1U91A 3MBEA 4GG8B 1D5ZA 5IB2B 3FO1B 4NWTH 5DJYB 1BWWA 4PGDB 3BJ91 4HJJH 1SBSL 1KN2H 2KDGA 3VG9B 5FGRA 4F7TA 5F3BA 3EYUH 4G9FB 4F3FB 1IM9D 3ZDZF 2DWEB 3O4LD 5IEKA 2HJLA 4JY6B 4YBQD 2WWMD 4W4NA 2OZ4H 4XMKH 1AGDB 2R0ZH 5ETUA 5ACZB 2UUDK 3PV7A 1DBKH 2QKIB 1KV3A 5D7JC 3TN0D 5A3IC 3VCLB 1U8PB 4P9HC 1ZTXL 2CDEB 3CDFA 1CD1A 4JRYB 2IG2H 5IWLA 1U9KA 4NN6C 1MF2H 1AXIB 3MRCA 4WHCA 2HT3D 4Z0XA 4J6RH 4XAWH 4NT6A 4XCNA 4JQXC 1IGTB 4DAGL 1EO8L 1FNAA 2O5ZH 1KBGH 1QNZL 3GJFA 3DI3B 3O8XB 4YK4C 1WSST 3GSOA 2AXFA 4ZXBD 3QCVH 1O0VA 3DBXA 4OF5A 3EGSA 1C7TA 4FQIH 4LDEB 3C8KA 3GUTA 2VLRE 4HF5L 3FQRB 5D2NE 2ED9A 2OL3B 4JDTL 4Y2DD 3HR5A 4KKBD 3CX5K 4NCC2 3BP4B 4BSJA 1TVHA 1A6ZB 1LK2A 4YHYB 1VADA 3QRGL 4U31A 3GHEL 1TTGA 4ZO7A 1UZ6E 1EO7A 2GJ6D 1A0QH 1Q1JH 2ZCKH 1DQTA 1PX3A 4Y1AB 3EYFA 5DSCB 1JF5A 3WL9B 3I2CL 3JV6A 5BZDA 4X9IA 3WFEL 1F4WH 1P5UA 4FQLH 3ME0A 1CIDA 4X6EA 2R4RL 5D1ZD 2NY5H 5DHVB 1CBVL 4ZS6D 3VFGH 1VGEL 5L2KD 1FFPB 1AKJA 3BP5B 2XTJE 3LVEA 4OFDA 4GG6F 3U9UB 1HDMA 2PNDA 3NGBC 3HB3D 2BHZA 4P5KA 4KKCC 3TVMD 5SWZA 3FOMA 3KPNB 3BRDA 2WBWB 1S9YB 4WFHE 3MLUH 3RTQC 2V5TA 4I77H 3O3DA 2SEBB 3MV7E 5DA4A 2R23A 3TIEA 3VE0B 1K8DB 3FJTA 1WGOA 3KYKL 5EO1B 5CZKA 2JE8A 5ID0B 4PJDB 3QEUA 5EBWA 5I6XB 5F7FA 2Z8VC 3QXDA 2Q1EA 5BZWB 3AFLA 4LSSH 1NDGA 4LRIA 1DVFB 4PGCA 2R2EA 2QHRL 3GMPA 1TETH 1YN6A 3RWHB 2P43B 2PXYB 2PYED 1HNGA 2F74A 3WNPA 4JDVB 1GOGA 2C7UA 3MRJA 5KANG 2FRGP 5IJVB 3MO1A 3O41A 4XMPL 1J0ZA 4OKVA 2IGFL 2XNAB 2IFGA 2NLJA 1BQHA 4L4TB 4LEXH 1IBGH 5DGQA 2AW2A 2VDOL 4PREB 3ARGC 3SE3A 3G08B 3MUGA 2EYTB 3LKQA 4A2MA 1J8HE 3LN5A 4XCYB 3O3AA 1FLRL 3VFWA 3RUGB 5D8JL 4WWKB 5DZLA 3NTCH 4XRCB 4BZ1H 1FZMB 5GRZA 4LGSB 1UWXH 4XCFH 25C8H 1JNNH 3G6AA 5GSVA 1IQDB 3V4VL 1BQUA 4XXCC 3S35H 4DKFL 1KYOJ 5DD3L 3EDEA 2R0KH 2A0LD 3HG1E 1NSNL 1IC5H 4PJ7E 3PABB 1DEEA 3RDTA 1H3UA 5CJQH 4B7LA 2WWKT 5JIHA 1N3NA 5DD6B 2G5RA 2HH0L 3BZ4A 2VXUL 1C5DA 2XWJA 4HDIA 3OJDB 5BO1L 3JWOL 5CEZH 4P2OB 1CE6B 1U8QB 3A67L 5GGVY 1UYWL 5F88A 4EI5D 1A7RH 1X5XA 5DT1H 2ESVE 3LN4B 1HSAA 1F6AA 5FYJL 3B9AA 2IANB 3FZUC 4WJ5A 4G8EA 2BFVH 1MLCA 5EWIL 1YMMD 2MPAL 4Z7VA 5I66A 1TZHA 1IC4L 1DDHA 1QKZL 1QSEE 1ZLVK 4DVBB 1G6RB 2VLMD 3L5JA 5I9QC 2ATPA 1XIWC 3RVXC 2OJEA 1PZ5B 4PJAF 4P2RA 3QULB 3BKML 4MA1C 1JTPA 4NQED 2UZIH 3V5DA 5FO9A 3EJJX 2AP2A 3ROLA 5I8CB 3QEHB 1T83A 2HA1A 2FCBA 3TFKD 4XWGL 2HFGL 3B9KC 1F00I 3HE7A 3X11B 1YEDA 2ZG1A 4PJ5A 4ORZC 3TN0B 3ZHKA 2FIKB 4OCLC 4ZFZB 3FL7A 3WE6A 3ZT7A 4LU5L 5CUSL 1G7JA 1S9WA 1U3JA 3U36B 4H25B 1RZKC 2PW2B 3S6CA 1HH9B 5I1CH 3SKNB 3S8WA 4NQCE 1MREL 3D69B 4K9EC 3ILPA 5FCSH 3VGFA 5DC4B 3IJYB 5D1QA 1H5BA 1MEXH 2QR0B 3ARUA 4OV5B 1YEGL 1AH1A 3BFOA 3L3KA 4WUUA 5GS1B 4X0KB 1P6FA 4ZXBB 3V5KA 1A7OH 3EO0A 5J57B 1N59A 1A1NA 2Z0BA 2BNQA 4LKXB 4AM0B 3IS1X 4NQSA 1GGYA 3GSUA 3MUJA 5ISZE 1CT8B 1JUFB 5DS8A 3AROA 1HHIB 1EGJH 3DVNB 1FYTB 3ARZA 2XKUA 5HDBE 4BKLA 4IRJA 1CZ8H 2RFXB 3K2UL 1AY1H 3T3MF 1MRDL 1ZANH 4JB9H 5GGQH 3IDMB 1RURL 4QRTA 5IESL 4JFEE 3X3FH 1R6VA 4WI5A 3PGCB 4DZBA 2B4CH 2FX8L 2Z8SA 3C08H 3IVKA 1RZ7L 4JFDD 4I3GA 3WO4C 3P4NB 1A9EB 2VLKB 4HKJB 3TNMA 4OGAD 2P4AB 2Y07H 1TJHH 2IALA 5KW9L 3T2PA 3GJEA 3KLHD 4WNQA 5D1ZB 4X80L 4GRLB 3EUUA 5MEPB 1FHGA 4QHNB 4CNIB 3MLRL 5EOQH 5L2KB 4Y2OA 5A40E 4MQTB 4I3SL 2FR4B 2V17H 3KPQA 1KTKE 1XT5A 3BKYL 3WLBA 1DSFL 3TVMB 2AXHA 3O9WC 3O45B 4BQ6A 3QPXL 1DR9A 2DKUA 3BQUB 3G5VA 1UWEL 3MJ9A 1F2QA 2P8MB 4WY7H 1JRHH 4I3RH 5I2IA 2BSTA 3BW9B 4V1DB 4RZCA 5CLTA 4ODUB 4KQ3L 2H3NB 5JIIA 2C3VB 4HHAA 2V7HB 1AO7D 4J1UA 4JO1L 2AJVH 1VFBA 3ULVL 5T33L 4RFOH 1SY6L 2YRZA 3NIGF 2DQGH 4OCSL 1U58B 5IM7B 2DBJA 3G9VA 3LKOA 2YSSB 2P42B 4TNWF 4NKOB 4JR9L 1NCNA 4LCYA 3VFMB 2D03L 4E5XB 3BDYH 2IADA 3MOBL 1G9NH 1XF2B 4DKEL 4MVBD 4PJFB 4K7PL 3CXHK 2UVEA 3BP6A 1QFWM 2DQHL 4HMEA 2Q8AL 1KJMB 3QA3A 4D0DA 5I1KL 1QR4A 1LMKA 4J7RA 1P2CA 3QUMA 2EDOA 3FB6B 3HI6H 3MREB 3MJ7B 4LCCB 4LLYA 4NO5A 1WTGT 1YQ2A 1LEGB 1DBBH 1NC2D 2GSGA 2VLRD 2VSCA 2APTA 4C54A 2EH8H 4HPYL 2F58H 3ZDZE 3QO0A 3L6FB 1ZLVH 3VFTA 3M8OL 5F7EH 1KPRA 3FO0L 5HGHA 3KXFA 4NP4L 5DYOA 2O5YH 4D3CH 2DRUA 3HNVH 1CGVA 3VDBA 4RQQB 4ONHA 4FQPA 5BCAA 3TA3C 1BLNB 3TO2A 3UTSB 4Y89A 4GW4B 1A3LH 1NGXB 5B4MC 4YHNB 2YRLA 4WU5A 3EDDA 2HRPH 1KIRB 2NY5C 1F11B 1J5OL 5I71B 2BVUA 4TPRH 2I07B 3JSSA 4N8PA 5D72L 5I8EA 3MTRA 1DUYB 1W72A 5J1AB 1FL3B 1Q0XL 2VXVL 5E8DH 2XTJD 5BOPA 1FYHB 1PD6A 2QSCL 3PWUB 4D9QE 2D7OA 4O5LL 4PRHE 5BV7L 4M62H 4WFHD 1F4YH 2VOTA 3T0EB 3MV7D 1YMMB 4Z7UF 3RX7A 4X9HA 2KKQA 1JHLH 4Z78B 1SEBA 5IGXH 3X13B 3LQZA 3N85H 2HJKA 1Q38A 4HX1B 4OCWL 3M45A 4GSDL 4HUWA 3VI3E 4HC1A 3UEZA 4NQEB 4Z7WA 4RFEA 1RUKH 4LHUD 1DL7L 3PV6B 3EFFA 3DGGA 3U4BL 2DQIH 4P9HL 3RZCD 4M1GL 3ZDXF 2H1PH 4GKOA 4JZOB 4W6XB 2Z92B 1UH2A 3F7RA 5TE7L 5DD0L 4GG6E 4XP1H 4JFYB 5C7XH 1OSZA 5EZJA 4PTUB 4C56B 4HXAL 2CUIA 2XZAH 2W07A 3MLWH 2YZ8A 4NGHH 3D18B 4R3SA 1J8HD 1MCEA 4KVCL 3UZEA 1V3JA 2NY4C 3C2AL 5CHNB 3W0WA 1LEIB 3MUHL 4JG1H 4S2SA 5LKNA 5ESVB 1JZ5A 3TT1H 4HWNA 1HZHL 4U6HA 3B2UD 4KKNA 3IAGC 3DGCR 1F6FB 2EDEA 3BVNB 5I17B 2EIDA 2X4PA 1ZLUH 2NY2D 5CGTA 4W6WB 1EBAA 1RK1B 5F71A 1A6VL 2WBJD 2VUYA 5L9DL 2ADJB 1J0KA 1AHWC 5GSRB 3OZ9H 3HG1D 1MH5B 1MHHB 4FXKA 2EYSA 4PJIF 2EH7L 3R06A 4Y4KD 1EV2E 5J1TC 1CU4H 4NQXA 3U0PB 5EOTB 4KROC 1K4CA 5KS9E 3MRQB 1E0OB 3W2DL 1RJLA 5HY9B 3GJFH 1CTOA 2EXYD 2OR9H 1A47A 4L8CA 3BMVA 1IJ9A 3L5XH 4RX4A 5JNYB 5FHAH 2Y06L 2G5BB 1BZ7B 3FT3A 4W4OC 3IGAB 4KK9C 3LHPH 2PYFB 4K8RL 1EIBA 3C2SA 4HFWB 4E41B 1LD9A 1CD0A 5EA0L 5A43C 1VESA 3I3DA 4Z0BL 5F9AC 5A2LH 4OUOA 2Q6WA 1EUTA 3STBA 2ZOLA 2P49B 3E3QE 4WFGE 4GT7A 1S7QA 1RJYA 2NXYD 5IBLD 1KJ2H 5JR1L 4HH9A 5HGBB 3CZJA 1UACH 2X7LB 2X1OA 2JCCF 3O6FA 5HGDB 4CUCA 5F7DB 5LAXA 4UMGA 2DM3A 3OR7B 1A4KB 1ACYH 1JWMA 1JI2A 4NKMB 4P46A 4RA0C 2AQ2A 4TQEL 3BGFC 5GZOD 3JTTA 1QRNA 3VXUD 4XXDA 1CG9B 1AP2A 4MA8H 1FLTX 4PP2B 5CD3A 2VWEE 1AXTH 1BFOB 4L8SC 4MNGE 5EN2A 3TPUB 4X8JA 5C09A 4MNQE 1R3IH 2ZSWB 3GK8L 4M61B 2FGZA 4XPGH 3ZTJG 1N2RB 4PJAE 3TYGL 3RPKA 2CLRB 1BJ1H 4PG2C 1FN4B 3KYMA 2OM5A 1T5XA 3O3UN 2FX7H 5IBUB 4N1EA 2VLRB 2CJUL 5D2NB 3QHFH 3MRPB 1GJIA 4OF0A 1HOCB 4LASL 2FYYB 1J05B 5JPMA 5ISZD 4ZFFA 1MHCB 4DKDC 5DJZB 4X5LA 1Q8MA 3OKMA 3WUWA 5KVGH 3Q48A 1UM4L 4NFDA 1ND0A 2X89A 2W0FA 4PRPA 2AJ3B 1LP9A 4JFED 3WJJA 1A14H 2HTKD 4WENB 3QEQE 5TH2B 3LQMA 3BEVB 1AD0A 4WDIA 1JGEA 4IEFB 4Y5VC 4OZIE 3GMLA 2EE6A 2HFEA 2P5WE 2J8OA 4P3CH 2OJZH 2XTJB 4WV1B 1J18A 4OAWA 4NZDA 3OKYA 4XAKD 1FFOA 4QY8A 2ERJC 1L7IH 2V2TB 1LE9A 3GMQB 2IBBA 5EO9A 4NCC1 1FGVL 2CIKA 1EHLL 2K3TA 1F3DH 4LCUB 5GRVL 1UXSB 3MV7B 1L9MA 3C6SA 3JXAA 3CK0H 5I8KH 1I1RA 4KKAC 5D7LE 5I1EL 1CFVL 4UQ2B 3T3ME 3C09C 4UIMB 3N0PB 4BA8A 2GCYB 3KPTA 1CCZA 4R7DB 5EB9A 1BJ1J 1JWUA 5IHUL 1MHPL 4U3HA 4BZYA 4MD0A 3W39A 1G9NC 5DRNA 4LHUB 2VO5A 2XKNA 4LEOB 1BOYA 3V0WL 3RZCB 5C07D 1LDPH 3OB0K 1WITA 3OJ2C 1QFPA 3MRIB 3CSGA 1YEHL 1KCVL 3QH3A 3X12B 3KPOB 4E42B 5AAMA 1RZKL 5KVFH 3ULVF 4MDJB 1J1XH 4I0PA 5J11C 2OYPA 1FNSL 3UYPA 5IEHB 2DL9A 4LPUA 3LB6C 3S88L 1D5XA 3ORJA 1RUAL 3E6FB 4ORGB 2FJHA 1GZQB 3NGBB 5F1IB 2AKRB 3N9GH 2IH3B 3MCLL 5FDWA 4FQJL 1CL7L 4LIQE 3QUYA 3ZKNC 2WBJB 3RTQB 2XA8L 5ALBL 1I1FA 4U0RC 4QRPE 3V6FB 3HG1B 3MLSH 4PJ7B 1NANI 1F3DJ 4Y4KB 3JVGC 1U8KB 1LO4H 2XFXA 3IXTA 4RNRA 5ID1B 1EJ6A 4QOKE 1OTTD 3OPZH 4ZUVA 1XGUA 4OLWL 4F58L 4L