5DT1L

Crystal structure of human fab cap256-vrc26.25, a potent v1v2-directed hiv-1 broadly neutralizing antibody
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
215
structure length
215
Chain Sequence
b'QSVLTQPPSVSAAPGQKVTISCSGNTSNIGNNFVSWYQQRPGRAPQLLIYETDKRPSGIPDRFSASKSGTSGTLAITGLQTGDEADYYCATWAASLSSARVFGTGTKVIVLVQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy chain of broadly neutralizing antibody VRC26.25
publication title New Member of the V1V2-Directed CAP256-VRC26 Lineage That Shows Increased Breadth and Exceptional Potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dt1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dt1L01
2VZ1A 4KQ4L 4JE4B 1N4XH 4LDEB 1KYOJ 4P23D 3ZKSD 3D39B 1J05B 5F96H 5CBEB 4IOFD 1ORQA 5IGXH 1JUFB 3TBVA 2Z93B 3C6LC 3RVTC 3V95A 2Q6WA 4P2RD 4P2QD 1INDL 2F74A 3MRCA 4IMLB 3ALPA 2NY6D 4ZPVA 4DZ8A 3SE3C 2DWDA 4YDVA 5F9AC 1P6AB 3CK0H 3FO9B 1DE4B 1EGJA 2W91A 4JREB 4OM1H 4M1CD 3B9AA 2J12B 5DZOA 1N6VA 5E1AA 5D72L 1I7RA 1PEWA 2QHRH 3BVNA 3MRPA 2WLYA 2NW2B 2P24A 1WSST 5DRXA 4HK3J 1X5GA 2VLKE 4NQXB 1ZLUK 4WFGD 1A6AB 3VGGA 4BH7B 2E27H 2JB5L 1JWMB 1WWWX 5DYOA 2X1PA 4QRUB 1T0NA 3SDCB 3S35X 1I1FA 1UXSA 5T1LD 3V0WL 3SQBA 3RPIA 2PO6B 2IPKB 1H3PH 4CGTA 4PJ5E 3WNPA 3JUYA 1R5WA 4CBPA 5D7LE 3S96A 5DO2D 4W4OC 1XCTA 1FFQA 2X4UA 1CFVL 3CD4A 3V4VH 2AVGA 1RFDL 1XF4A 1TJIL 2JJUA 4H5SB 4O2EB 1IE5A 4OGAD 4PJ7A 1F90H 3U1SL 2R2EA 2LVCA 4ZUUB 3NFSH 3BP7A 3I85A 1MCJA 3FZUC 4BSVA 1IEAB 4MX7A 3HAEA 4NZRL 1C08A 4H8WH 3FB6B 2RR3A 5D71L 1C5DA 2YKLL 2Y5TB 1X5IA 4MGXA 1LK3L 3GSNA 1UM6L 3W39A 4XNUL 5J9PB 3OHXB 1J0ZA 4JFEA 5DVMA 5B39G 2RJMA 3NZ8A 1ITCA 1FJ1A 1H3UA 5L2KA 1XGPA 4LCYB 4JQXC 2BZDA 4OQ1A 5GSRB 4HWBH 4NRYB 4PJGE 1PVHA 4XBPB 5GS0C 3V79C 4FQHB 1IQWH 4ZAKB 1OLZA 3SE8L 1BGXL 1DFBH 4ELMA 5D1XC 4IRJB 3D9AH 4HS8L 3BE1H 1JL8A 4F7MA 2R29H 3MQIA 3HI6H 3ARTA 1HHJA 4BZYA 4P5MA 2W0LA 4LPYA 3IRZA 1ORSA 4UT6L 4HBCH 3VCLA 3LVEA 2Z31C 1YMMB 1G7HB 4S1DD 4X6BA 2CKBH 1N26A 1UWXK 2K7PA 3GIZL 3HMXH 5TQ0L 1MCWW 4XP4H 3VXOB 4XMKL 4LRIA 5ALBL 4G42A 1J86A 1DTUA 4KKLC 4YNYA 1UM4H 2FEEL 1DBKL 1QOKA 4MA3B 3GFUA 4UIKL 5L9DH 2FEEI 3CVHA 5CZKA 2Y6SD 1CVSC 6FABL 3LQZA 4XP6H 3QQ4A 4JFFE 1KENL 4KTDH 2J4WL 4K94C 3O11B 3FOLA 2R1XA 5KBNC 2HRPH 2ZSWA 3MXVH 2R69L 3QDJE 5B38A 2RFXA 5C0GA 1JYXA 3UYRL 1V7ML 1WGOA 3ARGA 4WFEE 3C8KA 1JN6A 5IBTL 2YMXH 5TFSL 4M7JL 5IK3B 3OAYK 3L3KB 3SGDI 1EGJL 4KJPC 3R0MA 1EFXA 5DD3L 3G5ZA 1INEH 1YPZF 4QOKD 3O9WC 2EXYD 2WWKO 2CPCA 5ID1A 3IKCA 1CK0L 4H26B 4WUUD 2H2SD 4KJWD 5GGUA 2HVKA 5FHBL 1IMHC 1QEWB 2FHBA 1DQQA 3WXWH 4RZCB 4E0RA 4JJHA 3T1FB 2KZ1B 1LEKA 1JHKL 1I8IA 3MXWH 1RIUH 5EZJA 3TH3T 2I07B 5JHLL 3RNQB 4N0CC 2AJZA 2B1AH 3NIDE 3TJHD 1U36A 3GGWA 4HMCA 5C09D 3AAZB 3T0WA 1E28A 3G08A 2WBKA 1PQZB 4ZS7H 3UTQA 4FFYH 4NN6B 4RBPH 4MMXC 5BQ7A 5IMMB 4JFPB 1YEJH 3BPNC 4NQUA 5TDNB 1MWAH 1DLHA 1U91B 2ZCKH 3RZCB 1QFWM 2G2RB 4NQED 4KK5D 4EXKA 2MPAL 1I3UA 1NFDB 4E41B 3V4PL 3G9AB 4KQ3L 1G7LB 3WNKA 3GSNL 5ESQA 3KR3H 2ESVE 3ZDXF 4J8RB 3V7AG 1EHAA 1QYGH 3MNZA 2FWOA 2FO4A 1Z9LA 2KZWA 3W0WE 1RUPL 5IB1B 1IGJA 2YZ1A 4D9QD 3QRFM 4V1DB 1VADB 3U0WL 1WUNT 1G7IA 1GAFH 5DI8B 3AM8A 1AXSA 5FEBA 3RKDD 2WIIB 4ZPTA 3VGFA 1PY4A 5FV2A 3OXSA 4KK6D 5DJCA 4LSSH 4ZXBA 4WHTB 4OCWL 4Y1AA 5IW1A 1DSFL 2YR3A 2DF3A 3NA9L 4KKAC 4MNQE 5HYIA 2O5YH 1R3JA 5K9OB 1FFNA 5IG7A 3VWKD 5JA9A 4HUUB 2MJWA 5F9JA 2AEQH 1WIOA 3NTCL 1SEBA 3D3VB 4ZSOB 1ND0A 3MOQA 4HJJL 2OYPA 3K74B 1I4FB 5F21B 3H9HA 2XWTA 1DBJH 1DN2A 4P57B 4LAQH 4RRPG 3BP4A 4NZTH 1BQUA 4HGKC 4EN3A 3CVHL 3SQOL 4QCIB 4ZYKB 1D3CA 3ROLB 4AMKL 3LKPB 1RZJH 2WIMA 3F12B 3TLRA 2ILLA 1TVHB 3N1GC 4FS0A 2GJ6D 2ZCHH 4K9EH 1YY8A 4AIZB 4BQCA 2H32A 4JZOB 4POZD 4GAGH 4EI5C 3SGKC 1RMFH 2E8YA 3B4NA 3H9SA 1A5FH 5IESL 3CFJA 1WBYA 2NY2B 4M02A 2P8PB 5J12B 1OTTD 2FDBP 2VDNL 4N9GB 4Z0BL 5AD0A 4MDIB 1FLTX 4NM8H 4LCCA 4DVBA 3BQUB 1FG2B 3E8UH 1LO5A 5INDA 4C59B 5ERWA 3QEGH 1C7TA 2HJKB 5FECA 3FKUS 1MCBA 3U0PB 2W65B 3HE6C 1MIML 3L95A 3F7YA 3HUJB 5DLML 1JGVH 2XPGB 3EO0A 4JFZL 4KC3B 3E3QC 4PRHA 1ZTXL 4L9DA 3FAXA 2OBGA 2IG2H 5FUOL 5CCKL 1KIQB 1DZBA 1KLUB 4Z7VA 5CIPB 1T2JA 3S5LB 1WK0A 3B2VH 4CU8A 3R1GH 4YGAB 4TULH 3DV4A 3MLUL 4NGHH 3BPOB 5H94A 3SCMA 4JDZB 2FZ3B 1CQKA 4K55A 5FYLD 1KB9J 1UH3A 1KCKA 1T6WA 4JHWH 4LHUA 4ODUA 1YNLH 4ONHA 1H9VA 4PGEA 4OJFH 3PP3K 1JCKA 4G9FB 5CGYD 2Z8VC 1CFNA 4YDKL 2J88H 1NGXB 4K3EH 5DEFB 4R7DB 3TT3H 5FO8B 5GZND 5DS8B 1ZVHA 5FYKU 5JPMA 1FYTB 4MMZC 4ACPA 2NY2C 3HN3A 4ZAKD 1KIPA 5F71A 1MFEH 2AABH 4LLAA 4GOSA 5EOTA 3LY6A 2G5BB 2V7NA 2GYSA 1IKNA 1NBQA 5IFHL 5DFTA 3LEVL 5HY9B 5GGRB 3G9VA 5IT2H 2FRGP 4HGWA 2VZSA 4XB8A 2QSQA 4FXLA 4L4JA 5I6XB 1GGBH 5HVHC 2UV3A 5ECJE 3GMLA 2DQTL 3CFBB 4HJGB 2OLDA 2HP4A 2GTWA 2WWMD 4JB9L 5IB5B 3CPLB 3TVMB 3PNWB 5HGBB 5BRZE 5E2VH 3GMQB 4WFFE 3WHE1 4LCWA 1CLZH 1FGVH 4MD0A 4U3XA 4K7PL 3GSWA 2OL3B 3OTTA 1PGRB 2D9QB 2NTFB 3BPOC 5EZLA 4ZFGH 2BSRB 4PJGF 4I3SH 3RGVB 2Y1VA 5ADPH 5JOPE 5F1NB 2R2HA 4LLYA 3BEVA 5EU5B 2IGFH 1WCBA 1A47A 4F3FA 3PL6B 3UC0L 2Q1EA 4DGYL 4R4BB 1PLGL 3I3DA 1T1XA 2D9CA 3DVNA 1S8DA 1RU9L 3MNVA 5GIRB 5B8CB 3U46A 4NHUA 1UB6A 3UPAA 2ITCA 1J8HD 2NX5E 2E6PA 5FA4B 4QT5A 3QRGL 1N8ZB 4OF6A 3ULVH 1NFIB 4KKCC 4DCQB 3UCRA 4HKJA 5IKCB 5HBBA 3T0EE 1BAFH 3IU3A 2N1KA 5IWLC 4Q97A 1DUZA 4MAYC 4EBQH 3UTSB 4FQJH 4FTVE 1TPXB 2X4PB 3WEXB 5I6XC 4ZOEA 1WTGT 1HEZB 1NUDA 4XXCA 3MGTB 1EHXA 2SEBA 1N7ML 3OF6D 2VLRE 4R2GC 3FQRA 2PTTB 1YECH 15C8H 1EK3A 3QWQB 4G8GA 1ZANH 4EI6A 2F54E 2F9BT 3AS1A 5FUZL 5C7XH 5IP4A 3VI3E 4LQ1A 4WENB 2HT3C 3GZKA 3I9GH 5AZEH 5HHME 3QIWC 3SBWC 1U58B 3P4OB 3MJ9A 5JIIA 3IYLW 3RZCD 2DTSA 2H2PC 2FJHA 4OTXL 4YXHH 4TSAH 5EBGA 4WI8A 1U8LA 3RDTA 4XWGH 3JVGC 4E41D 2CLRB 3TYGH 4OV6F 1SY6H 3MRRB 3AUVA 2EEBA 4HV8A 4JY4A 3JV4A 4AEIL 4WEBL 2M26A 3GNMH 4ETYA 2WZPD 2O61B 4K8RC 3PQYB 5HYQB 3GB7B 3EYOA 4NC1C 4PJCA 1CE6B 2BCKB 2NW3B 1TITA 2FX8H 1YY9D 3C6SA 1A7RH 5C07A 5T3ZL 1XZ0B 1BX2A 3ET9F 5KSAC 3H7BB 3UZEA 3NIDF 3MA7A 3FL7A 4OIBA 4OM0L 5FYJE 4YE4L 1P1ZA 4H1LG 4QRRE 2CK0H 4JM2A 5JIHA 3IDXL 3JWDC 3QCUL 2X40A 4MXQC 2X9WA 5EO0B 4GRWE 4I0PC 3LSOB 2ZSVA 4JPKL 4AL8H 3E0GA 2CO6B 3I6KB 1MHPH 1WFOA 5DA0B 3U9PH 5L6YH 1RUMH 1NGPL 1A7NH 1MY7A 2AJ3B 3GMMA 4JPWL 2DN7A 3WIFA 4LHJB 2D4DA 4PJIA 1LEGB 2MMXA 4K7FB 5D7IA 4ZOBA 2V5YA 1ZA3B 4U31A 2YRLA 4BZ1L 4CDGC 5KTEH 2ZCLH 3SE4A 3BGMA 1JF1A 2EE2A 3V6FA 5BS0D 2Q86A 3N1PC 3TO4A 1RZIB 2P43B 5AEAA 4OIIH 2LU4A 5E5MB 3QUXB 4YC2B 5E8PB 4NN5B 3T4YA 4W81A 1SJEB 2XWBB 1IGTB 3Q3GA 1Q9KA 5IVZB 3N9GH 5IHUL 4O00A 3RWJA 3HZMA 3VXRD 1VFMA 1KXQE 2AW2A 4JM4L 2FB4L 3OR7B 2EIZB 5BV7H 2APWA 2IPUK 4R97C 1HXYB 4ONGL 4TVPE 4LSDA 4XZUA 3U0TB 1LEIB 5C9JA 3QFJB 3KPMB 5FO9A 4FRWA 3KLHD 3V52H 4B0MM 1IEBA 1ZLVK 1SM3H 5MEQA 1JPFA 4JDVB 1FE8L 2F8XC 1DQMH 1H5BA 2P5EB 1DANU 4I8DA 2FJGB 4KZEL 1IAOB 2V5TA 5GJTL 3VGAC 1ZGLA 2UWEE 3FRPG 2DDQL 2Q76B 4PRPD 2R15A 4CMHB 3O41B 1ZT1B 1CD1A 4MCZA 3DXAB 1CFTA 1B0RB 4H88H 4CRPA 4BH8B 5ILTL 3BKYL 5I8EB 1YPZB 5F72S 3VXSE 3CNKA 3O3UN 2JE8A 5FM4A 1KPUA 1QFPA 5BMFL 3FO0L 3O45B 3BT2L 4NO0A 4TPRH 3VE0B 4D0DB 5E9DA 4OCSL 4YC2C 3QEQA 5CFHA 5CHNB 2I5YH 4KRPC 3MJ9L 3VFRB 3OSKA 3BW9A 2GJZA 4DGVL 4ODHL 4P2OC 2BVPB 4IJ3B 3VD5A 1EH9A 5D70L 3OL2A 4KMTH 3W5NA 5J3HD 3HG1D 1BJ1H 4KTEL 5EZIH 4CJ0A 1FYTD 3U36B 1R6VA 1P7QB 5HI5D 5KVGL 5GS1B 2FCBA 5IQ7H 4DKFH 2AJYH 4HPYL 4MAUL 4ALAH 2E6QA 3E6HB 1ZXQA 4NQVA 5CP3A 1CF8H 4S0SD 4DQOH 1D6EB 5FYLH 5L88H 1YEHH 1N64H 1WIPA 5ADOH 1XGRA 1ADQH 4ODSL 2OK0H 3AS2A 4MQ7B 2VMFA 1YDPA 3WD5H 2RB8A 4CJ1A 1L7TH 1Z0NA 2HH0H 1ZSDB 3CZFB 4XPHL 2LVEA 1U8IB 4NUGH 2WUCH 1WC7B 1BHGA 1YEIL 4WU5A 3G6JE 4RMRA 2PF6A 2F15A 1I7ZA 5ANME 3OV6A 4OBRA 4CADB 1S7RB 2WBJD 3O4LB 4Y8DC 3VRIB 3JTSB 3RGVD 4F80A 2JF1A 4LOUD 1S78C 3L3GA 4P46B 4L9LA 2BNQB 3FT2A 3LCYA 4RX4A 1KB5A 4L3EB 5I15H 3PL6D 5F7HA 4UBDD 2ZOKB 2YZ8A 4APQD 1NC4A 5B22A 2P46B 3KPNA 4JFDD 5FDWB 1CICD 2H8PB 1MHHA 2V7HB 5F6IC 4GRLC 1HWGB 5GRXG 3M45A 1U8QB 2VC2H 3TA3A 1K8IB 3LQAL 4QNPE 1R5VB 3MV9B 5C08B 4M6ML 2JKXA 1RZKL 3HR6A 3RVXD 1A1NB 4MXVE 2GK2A 2UZYB 1U8OA 2XZQH 3TZVB 5FKAB 2VYRE 2GUOB 3OZ9H 3NAAH 4L8DB 5GSVB 1MQKL 1X5HA 5J7CC 4FZEL 2J1KA 4R26H 1GGTA 3MUY1 2VR9A 3UTSD 3VXUB 4JEGB 3LPFA 4M7LH 5FCUL 3QXAB 5EU6E 4B53A 2BVQA 1MHEB 5KVFH 3ILPA 2NY3D 2X89A 4RDQF 4XRCA 4WFHD 5E03A 5IVXE 4U6XA 4L29B 3D69A 3QI9B 4XCNB 3IGAB 4XNMB 2HTLD 2IBBA 4WW2C 5K9JL 3WL9A 4HKZB 3IT8D 4LBEA 3MLSL 2YD3A 1QZ1A 4QRTB 1NJ9B 1REIA 4XGZA 5GGVL 1K2DA 2E7LC 1IC7H 2A73A 3IFNL 2HFFA 2D7TL 1W72H 4U6VH 4PJ8B 1KFAL 2HA1A 2CKNA 1JGEA 4P4KD 4GLRI 2PETA 3C08L 4HH9A 2Z8WC 3BKJH 1OTSD 3K8MA 3CX5J 5B39B 2XTLA 1F2QA 4R3SA 3PQYD 2VUOA 4NT6A 4NDMB 3BYYA 3TJEL 4X98B 3GSOA 3RPKA 1IM9B 3TCLA 4OLZL 3HA0A 5MI0B 5FKPA 5I8KL 4A6YB 1NMCB 5IJKA 2LABA 4GMSH 1MRCH 1I85A 4FABH 3MLPA 3LRHA 1P4BL 2VLKB 3VI3F 1U3HA 4D3CH 1T1ZB 4NRXB 3EOTL 4M8QB 4BFEA 3ZTJG 3GHEL 1C5CL 4X4XB 3QQ3B 1DBBH 1BFVL 1JHLH 1RJZB 5EULV 4KJYA 3DVIA 1Q9LA 1X5JA 5I1GH 8FABB 3FRUB 4Y89A 4PJ5B 4Z7WA 2ZUUA 4HT1L 5D7LB 5J11C 3QIBA 1TCRA 2HKFH 3MRGB 1IGYA 4P5TB 2YA0A 3O8XD 1AO7E 2E7BA 1WVZA 5BVPH 5JR1H 1QA9A 1DBAL 3F7VB 4OKVA 5DTFB 1V3MA 3C5ZD 1KJ3H 3RUGE 4YZFE 2V2TB 1MCPL 4OV5A 4HIIA 1DN0B 2BOCA 1KT2B 1NUGA 4MA1B 2VABB 4ZO9A 3VGDA 4YDLB 1WJ3A 4E5XB 3KYNB 1KB5L 3MLYH 4ZTOH 5JDSB 4WTZA 5LGHL 1OSPL 4GRWF 3FQUA 1DQDL 1A7QH 5HHPA 3TO2A 1U8JA 5LAXA 4OLYH 2AJXH 3F65A 4PJGB 2KKQA 4PR5A 3WHXB 2E7MA 3RWFA 2HKHL 3FT3A 2WUBL 4U05A 3EYFA 2YPLE 3QA3A 1F58L 3KPOA 3OJDA 1MCCA 4EDXB 3NFPB 1RUKL 3CSPA 1A8JH 4RNRB 4NOFA 2W9EL 5TE4L 5TQ2L 3HRZB 3AC0A 1EMTL 5EA0H 5KVEL 1IM3B 1Z3GH 3KHQA 3C6LA 2VL5A 5C0CE 1TJHH 2BFVL 1OAXH 4OCMC 4PB0H 2VXQH 1IC5H 3KYOB 1IZJA 3OKYA 2OQJB 2DTMH 5IQ9A 5TE6H 3SE3A 1IGFH 4M62L 2G75B 5C2BH 1TNNA 4XPFL 4LGSB 5I1AB 1Q94B 4WUKL 4XT1C 4HXAH 3SKNA 4WI7A 4O02L 1F97A 3IVKB 1XGTB 3FCTB 3Q5YA 1MCEA 3KNBB 4LU5H 5KJRL 3OR6B 3FQNB 4JFFB 1QR4A 3BZFA 4MNGA 5EC1B 2PCPB 3MBEB 3VDCA 1QPPA 4GXVL 5IFAH 1U42A 2FSEB 5CSZA 3QDJB 5CIPH 1G6RA 5IM7A 3GK8H 3O6KL 3QIUA 4ODVL 2UWEF 3V0VB 4L5FL 5FGRA 2W0PA 2QADB 5CZXD 4Q2ZA 3RWDA 4X99A 3GRWH 4PJBE 5D7JB 4W4OA 3QXUA 1EAPA 2BOBB 4EDWH 3CLEH 3CLFL 5DXWA 3QWRD 2AKRA 3U2SB 2HLAB 1RUQL 5HDQH 3UTTA 2AK4E 5CEZD 5EU7E 5K93A 3D39A 1J05A 5CBEA 1C5BL 1F02I 4RGND 4XH2B 1JUFA 3EFFB 4WEUD 4ZNEA 4LVHB 1IGIH 4IMLA 3NABH 1I1AB 3EJJX 1B4JH 3MOBL 4HFUL 2FBJH 3CZJA 2EDYA 1DE4A 4UI2A 1Z9OA 4BJLA 4P46D 4JQXA 3NH7H 5JW3H 4I77H 5KVDH 4CMMB 4FG6D 4L3ED 1S9YB 2VDOL 3DX6B 2NW2A 2I26N 5E6IB 5DUML 3FO2B 4NQXA 5D1XA 5T3XD 3UBXG 3UJTL 3RA7H 1SYSB 1A6AA 5DRNB 1R5IA 1E6OL 3GHBL 3UP1A 1NCTA 2AGJH 3WDIA 4BH7A 5J1AA 1JWMA 4PJ7E 3GIVB 3SDCA 3CFCH 3QG6A 2ESVB 1K3ZA 3RAJL 4G6KL 4KVNL 2QQNL 1PFCA 2Z31A 1EZVY 2FHFA 2IPKA 2OL3H 4XAWL 2UZIL 1NSNH 2Y06H 5J1SC 3TZVD 2LV4A 1WIUA 2QADC 5CGTA 1SJHA 1CLYL 2AQ3A 3DTXB 2VDMH 5D7KD 3DX8A 1VFBB 2EXYC 5D7JC 3L9RB 3G6JF 2XRAL 4CL7A 4LFHG 2EC9U 2R0KL 1LP9F 5IMKB 5JXAH 4JFEE 1F4YH 4H5SA 2H2SC 4KJWC 2CXKA 4O2EA 3DUUA 1XFPA 1A22B 3QDGA 4WI6A 4U7KA 1NCWH 2BHZA 4Z18A 3MRDA 2X7LA 2FR4B 2HTKD 3EO1B 2YUWA 1OOAA 1MI5E 2Y5TA 1DQJA 2IBGA 4NNPH 5HHQB 5J9PA 3TJHC 1D5ZB 4XXDB 4MNQB 2FGZA 4UV4L 4QNPF 1BQHB 1F42A 3BYTA 5BO1L 3RTQB 3LKRB 4MXVF 2RCSH 4XBPA 4FQHA 1E4XH 1HSAB 4PJ8D 2EDWA 2QQLL 4KK5C 3RIAF 4Y19E 1FSKB 3C60D 1ACYL 2APTA 3O9WA 1LD9A 3LEYH 4S11A 2YEZB 5IBUG 3SDDC 4GS7B 4S1SH 3WN5B 5INCB 1HI6B 1BD2E 4U1HA 1YMMA 4PS4H 1CTNA 4BYHA 1ZT7B 4NCC1 1CDYA 1G6VK 5I76B 1WEJL 3VRLE 1G6RL 3MBXH 1B6UA 5IVXF 1S9XB 4PUBH 3AFLA 5EWIL 4XVSL 5CJOH 3RKDC 5JA8B 1OW0C 3QXWA 1AXTH 3X3FL 3MRKB 2JIXA 3R8BB 4AEHL 5DRZB 3WIHH 3V6OE 1V5JA 4DVRL 2FX9L 3ARUA 5LGJA 1AHWB 1RZ7H 5H37H 5EFIB 2CRZA 4FQLL 1I8LA 5HXMA 1PJ9A 5BV7C 4GXUM 4UT7H 4NQCD 4Z5RB 4P5TD 3VXTA 1MCIA 1UKQA 5LKNA 3HI1B 4R96B 1CXFA 4WI9A 1IL1B 5GHWL 4RQQB 5GRJH 2IPTH 3NCBB 5DJXB 3DRTA 4C57C 4NSKB 5GS0L 3VXMD 1OWRM 2YA2A 3S34H 3RNKB 4H26A 4UAOC 1P2CA 3MRJA 3WN5C 1A4KB 2VTFA 4FOMA 3BKMH 3KG5A 2R39A 1B2WH 1QEWA 3QUYC 5BXFB 5FAAA 1OAUH 3T1FA 3WXVL 3MUGB 3OAZH 4TSBH 3N85H 1JK8B 1CTOA 4JG1H 3BXNB 2BJMH 2I07A 3ZT6A 4DAGL 4XP9L 2DM2A 1RULL 2NNAB 5IV2B 3MLVL 3LN9A 1BZ9B 2AAVA 3O2WL 1XIWC 5B38G 1J10A 2A6JB 4ODTH 4UDUB 3QUZB 1IARB 1IC1A 2FYYA 4YZFF 5DD1L 5IMMA 1HZHL 4JFPA 3BEWB 5CKGA 2FO1A 2KQMA 1LVEA 1CBVL 5TPWL 1OAKH 2G2RA 4G6JH 1GH7A 1MREL 3UTZA 4WI5A 4L4VD 1UENA 3ZKND 4GKNB 3ARFC 5AG9A 1NFDA 2P8LA 4N9OB 3SY0B 4YK4B 3AXLB 3CU1A 5BRZB 1G7LA 1NCCL 4RCAA 1BP3B 3A6BH 3CSYB 4QRPD 5D5ME 2C3XA 2DQIH 4XPBL 3RGHA 1S5IL 4AH2B 3SGKA 2VH5H 5IB1A 2DI8A 5CAYB 3KLAB 4V1DA 3DRQB 3S98A 1GCFA 3KS0J 4Y1AE 3H42L 3AGVA 3HE7B 4JFFD 5DHVB 1MFDH 4GQ9H 4XCEA 1CL7H 5A2FA 1ES0B 1JVKA 5DI8A 4HC1A 3W9EB 1UC6A 3FONB 5BVJA 2WIIA 3MBED 4YIQB 5IB4B 1EEUA 4XVTH 1A02N 5EC2B 4HWEH 5GZNC 3HE6A 4WFED 1MJ8H 3D18B 1KOAA 2JB6A 4X4ZA 1D5IL 3MRMB 2EDDA 4FZ8L 1UJ3B 3RY6C 3TF7C 2BRRL 1YEDA 5DVOA 2IQ9L 4H1LB 1Z0MA 1XGUB 4GUPB 4PP2A 2DLFH 3D3VA 3T0EB 4DN3L 3AB0B 3REWB 3B2UD 5F3BA 5E94A 2OTUB 2E7CA 1MEXL 3QZWG 3ULUD 2Z4QB 3H9SE 4FTVB 4JQVC 5HJ3B 3ZL4L 1BOGB 2WWMC 4QCIA 2VLRB 4EQ3A 1FBIL 5ESVB 3KWWB 1J88A 1G9NH 2ZG2A 1XR8B 3ROLA 5C0DB 3LKPA 3FTGB 3WSQL 1TVHA 1MOEA 4HPOH 1U2CA 4K7PX 4Y5YB 3ZKMD 3DV6B 2XN9E 2F54B 3OX8B 3JSSA 1N6QH 1CIDA 1HQRB 3LN4B 1JYNA 5HHMB 2X4SA 3GSXB 3ZDZE 1SBBA 4ZOCA 5E8DH 4F37K 4DN4L 1KEMH 2B4CH 4OZFH 5D2NE 2VN7A 4N9GA 5CEZH 2GW5A 4MDIA 1CR9H 3X17A 5KZCB 2YRPA 4G6AD 1NLDL 3BQUA 4KXZI 1L7IH 3B9KB 2G60H 2HJKA 3SPVB 1ZOXA 2ESVD 2W65A 4N90E 4NQTA 4WTXA 3HUJA 4MD5B 2D0HA 4RSVA 1QRNA 3ABZA 3IFPB 2XZAL 3WNOA 1KIQA 1Z5LA 4JLRB 2JELH 3S4SB 5IVNA 2FGWL 3TNMB 2BSTB 5BZDB 4QRRB 3IAQA 4JDZA 1W0VA 2FZ3A 1YEKH 5T3XH 4GRWB 4XMPH 3PDOB 1FRGL 4D9RD 3P9MB 1FLRL 4MVBD 4F58H 2FL5B 5DR5H 2Y72A 1YNKL 5LXGH 4MNQD 4G9FA 1TZGH 3K2MC 5FYKL 4PJ7F 3KJ4C 5DEFA 5LQBL 4PJFE 1RUAL 4WHCA 1R3IH 5FO8A 1CLCA 3RTQD 3CMGA 4YPGB 1BLNB 1UGNA 2I9LB 2PW2B 1GYAA 3CH1A 1OLLA 5E4EC 4ESKA 2D03H 4I9WE 4HK3N 5KSBE 3SHSA 1F13A 2G5BA 4YDJA 4LCWE 1QBML 2NTSP 4EIGB 4WDIB 1YEFL 3RWEB 1NBVH 2HYMA 4HC1L 2AEPL 2R4RL 3AROA 1F8TL 4MAYA 1FL6B 2X70A 5CILH 5I2IB 4M43L 3SDYH 4PGBB 1MRDH 5FK9B 1KGCE 3NCYP 5GGTL 5F7DA 4PJ9D 2PN5A 2EECA 3CFBA 1X5LA 4LHUG 3GI9L 4PJDE 3CPLA 5IB5A 3RI5K 5HGBA 1F2XK 2XACC 2AP2A 1UG9A 2EDJA 5I16B 4K3JH 3NPZB 5MP6L 2Z35B 4FXKB 1J0JA 4WWKB 5T5FH 3QIWA 3SBWA 1J0KA 5D1ZB 2IADB 4QHMA 5F1NA 2IEPA 4UT9H 4XP1H 4EZMA 1S9WB 4F33B 1WWAX 4XNXL 4U1LB 1NC2D 3S3PA 2UWEB 3CDCA 3JVGA 1ZA6B 3G6DH 4R4BA 4KKBC 2QKIB 2QSVA 5E8EB 4N8PA 5SWSE 2H6PB 4A6YH 1FVEA 3BN9C 5GIRA 2HLFD 3L3HB 3OKDB 1J1OL 5C8JB 4XC1H 3X11B 2JJVA 1DDHA 3LD8B 1N8ZA 3Q5OA 2A9MH 4QY8A 5AZ2H 2HWZL 3VRLF 4C54A 4NFCA 1AP2B 2W07A 5MHSE 2GITA 3MUHL 1FZMB 4OFYA 5IKCA 3GBMH 3QO0B 1NEZB 2OXGA 1G7JB 1A14L 2W60B 2BXYA 3RWIB 4I0PA 2X4PA 1GGIL 1HEZA 3MGTA 5CLTA 2DWEB 3MTRA 2PTTA 5I1EL 1MNUH 4HS3B 1TZHA 3WV0A 2ADFL 3UEZA 3VFTB 1NMAL 2W9DH 3GSUB 5E7FA 4N1HB 1I3VA 1UADC 1MY5A 1PX3A 3PJSB 35C8H 1U58A 5KANI 4F9LC 1RJLA 3ES6A 3MFFA 3MRBB 4Y16B 5HVGB 1X5KA 2YUXA 1CGTA 4X80H 4DZBB 1JTOA 4FP8H 4LARL 4YUEL 4DFIA 5BRZD 3MRRA 4XMLL 4JHAH 2GSGB 4JO4H 3G6JB 3UJIH 1R3HB 4BZ2H 1CU4L 3MOAH 2MOVA 3UXFA 2OZ4A 1TETL 5ANMB 5E00B 1LP9B 3P0YH 3T77B 3L3IA 3GJFB 5HYQA 2X1WL 3LD8C 4NNYB 3CFEB 4KVCH 1CE6A 2NW3A 1AI1L 5J06A 2YPVH 1XZ0A 3TBYB 2F8VA 3H7BA 4HIJB 1M71A 1YUHB 2EZ0C 4KGLA 4BSJA 3ALXA 4QHKI 1EHLL 5KW9H 5JUEL 3EYUL 3KGRA 5L7XH 5D7IE 2PYED 4CN1A 5JNYB 7FABH 5F3HB 2ADIB 5J3HC 1VFUA 3LSOA 4GMTL 5I1CH 4FA8A 1RJYA 1VACB 4XI5D 4YDIH 4S1QH 3FOMB 3IJYB 4JRYA 3BESR 3LMJH 5DC4B 2AJ3A 1INQA 4J1UA 3NCEB 5K33A 2EE3A 4ZFZA 3QJHA 1P53A 1LEGA 4FQXD 4K7FA 2E7HA 4LEXL 4L8BB 2VXSL 4LSPH 5D5MF 5E99H 1NAMB 1IAIL 2FIRT 4X9IA 4JRXA 2V9QA 4HMDA 5IW3A 1RZIA 4M1DL 1IAII 1JIBA 5EU6B 1K85A 1JF6A 5E5MA 3QUXA 3EOAB 5EBMB 3O3AB 4JO2H 1AJ7H 2CIKB 3BD5A 5D6CA 2XWBA 1IGTA 1IC4H 4JY6B 4DUWA 1A1OB 3QPXH 5C6TH 5IVXB 3SJVE 2F54D 1ZS8B 1E4WL 2WBJC 3WYRA 3MZTA 4PJXE 5C0EB 4LOUC 1A6VL 3MLWH 2X2YA 4P0DA 4Z0XB 2EIZA 2CXGA 1FO0A 4J3TA 4XBGB 4MQTB 4U6YA 1FNGB 2ICCA 3HC0A 4K8RL 4OSUL 4W6XB 3U0TA 1LEIA 2FECL 3HS0B 4OCRH 4HJ0D 1CICC 1EJOL 3QFJA 3MLZL 1J1XL 3KPMA 4L8SC 1AGBB 4J3SA 3T3PE 1JPGB 4Q6YA 1NBZB 2FECI 4JDVA 1SBSH 1C12B 2P5EA 4YAQA 1I9IL 4IBLT 1EO8L 4X7SL 2FJGA 4HX1A 1RPQA 3JWDL 1IAOA 1I3RA 4ZUVB 1UB5B 1FN4A 4PP1D 1C8PA 1ZT1A 1ZK9A 4WJ5A 2IMNA 5CWSB 5F6HI 3BGAA 2Q8AL 1WZ1H 3P30L 4MJ5B 5I8EA 1YPZA 1U3ZA 1YQVL 3L1OH 3DETD 4C56B 4N0RA 4QTIL 2VLJA 3Q2CA 4Z78B 5J4MA 3TBSB 5C0AE 3WNNA 2IFGA 4NC2B 3ZDZF 3NCJH 5DJ8A 2AJSH 4HK0B 3PWVA 4LLQB 3VE0A 4XHQA 1D6VL 3VG0H 4TUKL 3WE6B 4RIRB 2QQQA 3B5HA 3VFRA 2UY6A 3U7WL 5HI3D 4JDTL 2PNDA 5DRWB 4OLVH 5HYJE 1ZHBB 3K1KC 1TQCC 1IKFL 2K9UA 4D9LH 5LWYL 3S88H 1AQKL 3THMH 4G7VH 3KYKH 2P44B 1P7QA 1AO7B 1LO0H 5GS1A 2OZ4L 1NGWB 2VAAA 4NRZB 4M6OH 4RFOH 3UROR 3S37L 3E6HA 5CZVH 3BWAB 4IIQC 1JNNH 4IOIB 4JKPL 3IDYB 2DMKA 3VFMB 3D85A 4O2FB 4JR9L 5T1MA 4R7NB 3TV3L 4NQDA 5CINH 3MLTA 1TCMA 5GJSL 3I75A 2X10A 3MCKB 1T5WB 1QTYT 4N5EC 4Q9CA 1UJTA 3LHPH 5GRVK 5JZ7D 4MJIA 4K07A 4Y5VB 1WC7A 2XY1A 1A6TB 2HT4C 4BKLB 1I8MB 3TESA 4DK3A 4M6NH 3WFDL 1CDHA 4L1DA 4L3CA 1KNOA 2A6DB 1U8NA 2YPLB 2EE6A 4PJFF 4WU7B 2R0WL 2EYRB 2JLLA 3T2NH 3K8LA 1S7RA 3WIIL 4CADA 3O4LA 4PV8B 3JTSA 4WW2A 2VRAA 1QLEL 4WWKD 1VGKB 4S10A 5D1ZD 2Z92B 2R9HD 3TWCL 1J5OL 1ZGLM 2DJSA 2BNQA 1MFBH 4XNYL 1MUJB 2I25N 3O6FB 4PY8I 2BNRA 5KSBF 4LLDB 3RWCB 5JXED 4Y4KB 1WFUA 2R29L 4I3RH 1G1YA 1N5YH 5HGDA 5C0CB 3TNNA 1MH5B 1JWUB 2V7HA 3MV8A 3OKLB 2FIKB 1U8QA 3L7FB 3O8XC 1K8IA 2D0GA 4NHCH 1A0QL 4JG0H 4JAMA 4PGJA 3EOBB 3MV9A 4M48H 3C5ZC 5C08A 3O6ML 2JJTC 5IB2B 4PJDF 5IIEB 3A67H 1QFUH 5FOBA 2GUOA 3UAJC 5D7SL 1D5BA 4I13B 4XWOC 3IDYC 2O5ZL 1FO0L 1UWEL 4QXWA 4IRZH 1BZ7B 2VLLB 4R6UA 5L9DL 4LSRL 4HLJA 3VXUA 4HUWB 5DZNA 1S7SB 3QXAA 3DPBA 2A0LD 4P99A 3VD7A 1MHEA 2EH7L 2X4OB 8CGTA 1MFCL 3OBAA 5GPRA 2HRPL 4WV1C 1ORQB 3TBVB 3TCXA 1NGZB 4L29A 3QI9A 4XCNA 2W0FB 1QSFE 2F74B 3ZT7A 1A9EA 3O2VH 4XNMA 4A2LA 5DC9B 4DZ8B 4YDVB 4GRMA 1FFPB 3K0WA 3TPKA 3O0RL 1FDLL 4R4FH 4U1NB 1X4YA 1NJ9A 1R3LB 2AK4B 5GRUL 3FQTA 3HI5L 2DQUL 3SGEH 3DGGA 3TPUA 2IBZX 5E1AB 1GHFH 1KCUL 1SQ2N 4P2QA 1LO4H 2DQEH 3BVNB 3MRPB 4AQOA 1GGUA 3BH8B 3OPZH 3JWOL 5HHOD 5DRXB 2DAVA 3G04B 4NO3A 1BWMA 3H9ZA 1IGCL 5MENA 5C1MB 1F00I 2DIJA 4YHIB 4DW2L 4OD3L 4N0YL 1FP5A 2B1HL 3I2CH 4X98A 2J5LB 1HHIA 1T0NB 5JQHC 1IM9A 1UXSB 7CGTA 5AUMA 2IMMA 4KDTA 4M5ZL 2HJFA 4RGOL 2BY2A 4ZUWA 4DEPB 1R5WB 4R90L 3S96B 2VLKA 2NY4B 3HPLB 1DEDA 1CGSL 1J0HA 3A6CH 1NLBH 3QXDB 3MA9H 1Z9SA 2CRYA 2IH3B 1G9NC 4PJ7B 2R2EB 1D9KC 3QQ3A 4MSWA 1OHQA 3BP7B 1EX0A 4HF5H 3W11C 2ZKHH 3HAEB 4MX7B 2OTWA 2VDRH 3FRUA 1C5DB 4X9GA 3LDBC 4TUJA 5D7LA 1ZVSA 5C0RH 5T1KB 2O5XH 2I60L 4RISL 5DHVH 4CU7A 1EXUB 4JFEB 3MJGX 3C09B 3NZ8B 3D1MC 3F7VA 1XGPB 1LILA 5DTFA 1RIVH 3T0AA 3RJDA 3ARBB 4RGNC 2OS7A 4HWUA 1KT2A 4I48B 5JMOC 1P4LB 2VABA 5JLZB 4OLXH 1MI5B 4LNRA 3KYNA 3PGFH 1QVOA 4PJIF 1K6QH 5CJQH 4ELMB 5D7IF 4OFDA 4G3YH 4F7MB 3O2DH 3QUMA 3HPJB 4MNHB 4FG6C 4UILL 4H1LH 3TN0D 4EOWL 1ORSB 4I5BB 4PJGA 1OY3B 3VCLB 3TT1H 3WNMA 1I3GH 2XZZA 4JN1H 4X6BB 2NZIA 4DEPC 4NYLA 2NY1D 5DZLA 3QDMD 2C3VA 2NY4C 3GBNH 4RNRA 2XICA 2OJZH 4OI7A 3WJJA 1AH1A 4G42B 2EIEA 2H9GB 3HZKA 4HXBH 2AJUH 4OCYL 5CJBA 3HZYA 3HRZA 1BD2B 4OBSA 5AYUL 4LAQL 1PBYA 4WRLA 3CVHB 4ZFFA 2ZUTA 2FLBT 4HS6B 2OQJA 4DUVA 4C56D 2VXUH 4PREA 4PJXF 2R1XB 4LKXB 4WTZG 2ZSWB 3C09C 5E2UH 3KYAA 2RFXB 4YWGH 3S35L 2DMBA 5C0GB 2ZNXA 1IBGL 5K9KA 3SOBH 4OD1L 1CFQB 1I7TB 4NKIL 4NM8L 2VISB 3OR6A 5A2JH 2J8UA 1QSEE 2GK0A 3G5ZB 3T3PF 1V3KA 3GDBA 4YHYB 3FFCD 3FMGL 3VD3A 3LKQA 2PCPA 2OP4L 2FSEA 3QDJA 3STZB 3DECA 4RFNB 3WO4B 3QB7C 3UTTE 1AO7D 4D0CB 5GGUB 1MF2H 3VFPB 1PZUB 2QQKL 1PG7W 2ATPA 4OI9A 2MHAB 3C60C 2R8SL 1LEKB 1I8IB 2EDTA 4G43B 5D7JA 1ZGLP 1KCSL 1X4XA 3MYZA 5TDPA 4Y4FD 3U2SA 4WUUA 5GXBB 2JJSC 5JMRA 5SX5K 1HDMB 2HLAA 4CVXB 4ZODA 4WIQA 1L0QA 1DL7H 1E28B 2NXZB 3G08B 3UTQB 3H6JA 2YD7A 3KPPB 2C5DC 5EU4A 1RHFA 1YNLL 3MNWA 5I18L 4G6MH 4KAQL 1BQLH 4J6RH 3MRFB 3RX5A 3EFFA 3P9LA 1FCGA 5E08L 3C87A 1I1AA 5D1QD 2R2BA 1BBDH 1N0XH 3UMTA 1MJ7L 1VCAA 5ESQB 3ZYZA 1IEHA 5EO1A 1HIML 2BK8A 4CMMA 1GC1L 3MODH 3O6FD 1FVDB 1CGXA 4U2ZA 5A3IC 3DX6A 4GH7B 5DA4A 1IGJB 3FO2A 1SYSA 4JGUA 1G7IB 1A3LH 3KAAA 3SDDA 1AXSB 5EIIA 5I30H 1HKLL 2DBLL 4RFNC 2HT2C 4KZDL 4QRSB 4KI5D 4NJAL 1NUFA 4X8XA 5D5MB 3W0WA 4IHOA 3QUML 4ZXBB 3CDYA 2IAMB 1HYSD 2DQCL 4Y1AB 5IW1B 2XQYK 4XP5H 2QSCL 5HHVL 3HNTL 1OW0A 1FFNB 2A74B 5A16B 5IG7B 4MLSA 2VITA 2OMNA 4QF1B 4NN7C 1MLCB 1ED3B 3QHZH 3K81A 1QFWL 1SEBB 3HC4H 3LPWA 4ZO7A 3MGAA 3F58L 2FX7L 4P59H 3H9HB 2EICA 3BPCB 2NY0B 5IMLB 3EUUA 5T33H 5HHQA 4B7LA 3MV7E 4NKDB 3BP4B 4FQ2H 5J56B 2ZUQB 2KQNA 3CU7A 5D96B 1BQHA 3KXFE 4UV7L 4HEME 1YY8B 4RGMB 2H32B 5ITBH 3Q48A 1S7XB 2YBRB 3H9SB 4N8CL 4JPVL 4OGYH 3W5MA 2V5RA 3CFJB 1WTLA 1KN2H 3CVIH 2ZUSA 3OG4B 3BN3B 2X4NB 5AD0B 3OAZK 4DVBB 2GJ6A 3MRQA 3HNVL 4LCCB 3RVVD 4PFEA 3T3MF 4WO4D 1LO5B 3WN5A 1HI6A 5CD5D 5INDB 3ZTNH 1MAKA 5DUPL 3QUYA 5FECB 2OMBA 3L95B 1VEPA 3EO0B 4R9HA 4PRDB 5I76A 2IAMC 1Q9WB 1S9XA 3TBTA 3R06B 5DT1L 4ZD3L 4U6TA 4YEFA 3ZHKA 2R23A 1BEYL 3RVUD 5C7XL 4HWZB 1E6JH 1QSZA 1EUUA 3I9GL 5FGSA 1XIWA 2MTPA 3MRKA 1UQSA 4X6DE 5DQ9B 1XGQA 1CZ8L 3IJSA 5H94B 4Z76B 4HQQL 1QPXA 5EFIA 1X9QA 1BM3L 3FJTA 3ARRA 4U1GC 2IAND 3LZFH 4LHUB 4NPYB 3IS0X 3ARFA 2AXGB 2ZUQC 1FC2D 3BKCH 3X12A 5L2KD 4WW1A 2VE6B 2IF7A 1J1PH 3BAEL 4RGMC 4PTTB 4X5LA 2CMRH 4R8WL 3ULUC 5F9DC 5A2LH 1TJGH 5DJXA 4D2NA 2EH8H 4Z7WF 1MRFL 4P49A 4NSKA 3RNKA 1X5YA 2BDNL 1U41A 2R0LH 1BVLB 2V7NB 4M7KL 2X09A 4PJFB 1IZKA 4J3UA 1PW3A 3U9PL 1EVTC 4Z7NE 1NANH 3WFHB 5KAQG 1S5HB 5M94B 1T7WA 1JK8A 5FYKE 1HOCA 3ARDC 1MJUL 2NNAA 3GMLB 4G6AC 4XVUD 5D2NC 5IV2A 3FN0L 5KSBB 2GTWB 3V4UH 2X4QA 1FIGL 4LLMA 4J4PC 1AR2A 1W0WB 4LCWB 4MD0B 3RZWA 2QV2A 2A6JA 4UDUA 3QUZA 5GISH 5DQDL 5EZLB 3LH2L 4DK6A 2XT1B 3BEWA 4MHHI 3UYPA 5AWNH 1QR1A 4JQVA 2IPUG 5FGBA 3X3GH 1A1MB 1T4KA 5CEYB 4GKNA 1JPSH 2P5WA 3BEVB 2QR0B 1GPOH 2Y36L 2Y4SA 4PJDB 5GGSY 3AXLA 1Q72H 2NR6D 3BSZL 1CLOH 1KELH 1VENA 4JY5H 3CSYA 4FQIL 1S8DB 3ARGD 3MNVB 4AH2A 1NGQL 3U46B 4NHUB 3P0VH 2ITCB 2BVOB 5TF1L 1F3JB 4KQ4H 4Q6IC 1FNEB 1EFXD 3PXHA 1ES0A 2OM5A 3OGCB 4V2CB 1HYRC 1OT2A 3IU4L 3W9EA 2Y25A 3FONA 1Q9OA 1INDH 4HKJB 3STBA 5EC2A 5DMJB 5SWSB 5FO7A 1CDJA 2QHLA 3IU3B 3D18A 1DUZB 4PY8J 4RMVA 5E95B 2NX5A 2D7MA 3HNSL 3MRMA 1YYLL 4EJ1C 3PGCB 4NKMA 2DOCA 3MLRL 3HKFA 2PKDA 1UJ3A 1VEOA 5J6GA 5C0ND 5D72H 3IXTA 2DQJL 4F15B 5DC0A 3L3OA 4JFXA 1I9EA 4FXGB 4GUPA 3IDUA 2W1NA 3K46A 3REWA 4HULB 2NXZD 1H15B 2FD6L 3OKNA 4PJAE 2JB5H 2Z4QA 4K23L 1GJIA 3PWPE 4PTUB 3P11L 2VZUA 1BOGA 3N0PB 1FHGA 2CD0A 3W82A 4WHDA 1CDIA 2FJHB 5ESVA 4Y2DD 1XR8A 4QKXB 3WJLC 1U8LB 4HUVA 3FTGA 5FGCE 3BRGC 3VA2C 3KPSA 5F7MC 3OKOB 3OX8A 5EZIL 1UWGH 3EHBD 1CFVH 1YA5A 3H3PL 1RFDH 1HQRA 4HV8B 4Q74A 5C3TA 1TJIH 4Y5XB 3DMMB 3U1SH 1QRNE 3GSXA 4LEOB 5LBSL 1E4JA 1TDQA 3I3BA 4DQOL 3ZMRA 4NZRH 3C6SB 1X5FA 2AQ2A 2OCFD 5D71H 1BX2B 2YKLH 1TNMA 5E8NA 1LK3H 3B9KA 2APVA 4OZ4A 3J7HA 3SPVA 4XNUH 5L0QC 1P1ZB 4FN0A 1OAQH 1S3KL 3WFCL 1T03L 1EV2E 2UUDH 3IFPA 2V9RA 2ZSVB 3WLBA 4ZXBD 2R0ZL 4XTRC 1KTDB 4Y1AD 2B20A 3GEWB 2QL1A 2RIKA 2W59A 4JLRA 4YHKL 3S4SA 4F15C 3SE8H 1KUMA 1BGXH 4G8EB 3WIFB 4QRRA 3QHFL 4PJIB 4XCYB 4HS8H 5I1JL 5D7IB 3GMRA 5EORL 4OZIE 1K4CA 3PDOA 3LRGA 3H3KA 5I15L 2LFGA 1XF5B 2CDEA 2Y7QA 3ROOB 4QXUL 3G6AA 5JHDA 1JF1B 2YS4A 3V6FB 4UT6H 2Q86B 2FL5A 2NY0D 5J6HB 2H1PL 4ZO8A 1HNFA 4EN3D 3I50L 3GIZH 4LGRB 5TQ0H 4O2CA 5E56A 3S6CA 4XMKH 3Q3GB 1Q9KB 4M93C 1LDPL 1C1EL 1QHPA 5ALBH 5E6YA 2L0DA 4N0UA 5B3NA 4OAWB 4F9PC 1UFUA 1DBKH 3H9SD 3T8XB 4UIKH 1IAMA 1CXEA 3BPLB 4HZLB 5KN5A 6FABH 1GGCH 1P4IL 3EAKA 5C9JB 3S5LG 2J4WH 4WDIA 5JOEA 3GSRA 3RWEA 2Q87A 5I8CB 1KLGB 3PHQB 4P3CL 3SJVB 1IEBB 3SDAB 1NGYA 2R69H 4PJXB 5MEQB 3GMPB 3QQ9C 3UYRH 5FK9A 1FZKA 1V7MH 1XGYL 4PRHD 3SKJL 5IBTH 4U7SA 5TFSH 4M7JH 3DGCR 2FLRT 1ZGLB 4GG6E 2OI9C 1EGJH 5D6DC 5GRVL 5DD3H 1CD1B 4MCZB 1SHMA 3NZHL 1PYWB 2YUVA 2HJLB 4GAYA 1T1WB 1CK0H 3SCMD 1HQ4A 3GSVB 1QO3A 1KPUB 4POYA 1W72L 3MO1A 5FHBH 1S9WA 4F33A 4LHUD 1EPFA 4NO0B 4OQTA 1ZA6A 1JHKH 2WANA 4FQXC 4RA0C 2CH8A 4RMUA 3EKCA 2GJZB 5JHLH 3VXSA 3L5WA 4XX1E 4F8TA 2UY7A 5SWZE 4DKEL 3BOVA 5KAQF 5C8JA 1A7PL 5T3ZD 3OJVC 4GMSL 1DQLL 1EERB 1FZMA 1VKXA 1LO3L 4NQVB 1NEZA 3HAEH 2MPAH 1G7JA 4XPAL 4G8FA 5HYJB 4X6DF 2W60A 5B4MD 3RWIA 3ZE1E 3V4PH 4KQ3H 3GSNH 3CC5B 2DICA 5SX4I 5EOCL 4JVUA 5I1GL 2ADGB 4EIZC 1RUPH 3INUH 4RFEB 3P77A 4HS3A 2EYTA 4IEFB 3V5KB 4OGZA 5HYFA 1TIUA 3GM8A 3VFTA 3BDYL 5DWUL 3U0WH 5DURB 2QJDA 2VQTA 2OTPA 5FHAL 1I8KA 3GSUA 1I7ZB 1NKOA 1F4AA 3ELAT 5FYJL 3L3GB 5JO5A 4Y16A 4L9LB 1I9RL 4PP1C 1KB5B 1IAIM 3L5XL 4NKOB 4M61B 4DZBA 3E2HB 4M5YL 1DSFH 4I2XE 1NC4B 2GSGA 3DETC 3KPNB 3G6JA 3NA9H 1R3HA 1J0IA 3HB3D 4WEMB 3MR9B 3T77A 5ANMA 5E00A 3DIFA 3D87B 3UX9B 3GJFA 4NNYA 3CFEA 5JW4Q 3NTCH 4HJJH 3PHOA 2B8OT 2A2QT 1XH3B 4M9PA 1U8OB 3BD4A 1AIFA 5HI3C 4L8SA 2R4SL 4JKLA 5T1DL 3HZVA 4TYUA 3CVHH 3SQOH 5DK0B 2ADIA 4G8IA 4AMKH 4XAKE 5A2KH 5DJ0A 1F4WL 2EYSA 4BQ8A 43CAB 2VXQL 1QSVA 2BVQB 3ARPA 2G5RA 3D0LA 1IGFL 5IESH 5CP7A 2XTJD 3U7AA 2VDNH 4G8GD 4L8BA 4TVPL 4F7CB 4Z0BH 1M7DA 1NAMA 5K59E 4KI1A 4HXAL 5ALCL 5DMKA 5DJ6A 4U1IA 3WL9B 1MIMH 2AXFA 5EU6A 1KC5L 3PG2A 5DLMH 4JFZH 4XGZB 3EOAA 4NFDA 3NPSB 5EG6C 3WLWC 3O3AA 1ZTXH 3RDTD 2HFFB 5FUOH 2HN7A 3PABA 2C26A 5CCKH 5K9QG 5IVXA 4OQTL 4HH9B 4DGIL 2VZOA 2H45A 5EUOE 2R9HC 2D0FA 4C58B 2J8OA 4R3SB 3ARED 3MLUH 4NT6B 3FFDB 4IM8A 3WS3A 2CUMA 5C07D 3TCLB 4IIQA 4NP4L 3HS0A 1TMCB 4TSCL 5FKPB 2V6HA 5E2WL 1AGBA 2NCMA 3VU2A 1JPGA 3OAUL 1N5AB 3BHBB 1NBZA 1FNSL 1G9ML 2VLJE 5EU3A 4JM2D 4YDKH 4Z8FL 3VRJA 2WSKA 4QHLB 1JYVA 1EEYB 1CWVA 3K3QA 5F89B 1HCFX 4KJYB 4MJ5A 5KG9B 2LU7A 1IAKB 4Z7WB 1PZ5A 3QIBB 3V5DB 4FFZL 4Y7MA 2IH1B 2AK1L 5IFHH 4HK0A 3P2TA 3LEVH 2EXWC 4OKVB 4JFHE 3TO4D 2BNUB 3JV0A 4OV5B 4FFVD 4HIIB 4Z95L 1FFRA 2BOCB 1M7IA 1A6PA 5GZOD 2HG5A 1BVKB 2DQTH 4JB9H 1CFSA 3PWUB 4NQDE 3O8XA 4OLWL 4K7PH 3TO2B 2PXYC 3C5ZA 1U8JB 4NRZA 3RUGA 4MJIE 4IOIA 2CQVA 1UA6L 4QWWC 1W0YT 3BH9B 4RWYL 2GFBB 3VFMA 4D94A 1PY9A 4O2FA 4EUPA 3QA3B 1NUNB 4KROB 3UC0H 4DGYH 1PLGH 4OZIF 3QDHA 2VKXA 1T5WA 1RU9H 1P6FA 4M8VA 5E6ZA 1U6AL 1T66D 3VGHA 4QO1A 2BNRE 1EO7A 2BSED 3QRGH 4BKLA 3VFUA 4WV1A 1I8MA 3C6LB 1CFBA 2H32H 2ZUYA 2NLJB 2VL5B 3GSQA 4WU7A 2VDKL 2YPLA 3SDXE 2EYRA 3MV8E 2XIDA 3JV6A 4FQCL 4PV8A 5IQ9B 5HHNA 4M1GL 1D5MA 2DYPA 5JDJA 4UUJA 5F8RC 1NAML 4HUMB 4LLDA 3SKNB 5TF0A 4G6FD 3RWCA 5E9DD 4Y4KA 1YN7B 1JPTL 3QEQD 4PRNA 3I6LE 5C0CA 1N7MH 1WF5A 4PYGA 4LGPB 5SWQA 5IEKB 2YHGA 5C9KA 3OKLA 4FMKA 4O9HL 3U30B 4MNGB 1Q1JL 4ZS6C 4M7ZB 4LL9A 1OP5H 3IFLL 5FUZH 4MXWL 4MZ3A 5CSZB 2ADJB 4O51A 5IB2A 4IRSC 1G6RB 1SEQL 4GG6F 4WY7L 3QFDA 2E8ZA 4OTXH 3GMNB 4X99B 3RWDB 4M00A 3VG9C 2IFFL 1EAPB 4U7MA 4NWUL 2VLLA 4KGJA 4IOSD 2AKRB 4X7FC 1BZQK 1S7SA 5I17B 4OI8A 4YQXH 1QQDA 4AEIH 3TN0C 1D9KA 3UTTB 2H3NA 3RX7A 2PYFA 3P4LA 2X4OA 1CG9B 1OGAD 4P2QE 1ZV5A 1NGZA 2NY1C 3FB8B 3VFVB 2W0FA 5T3ZH 4PJBA 4PYHA 3S9DB 5MENE 4OM0H 1CDBA 2XZCL 1FFPA 4YE4H 1PG7H 3NIFE 4U1NA 2AQ1A 1R3LA 3IDXH 2AK4A 3QCUH 3QEHA 3FB7A 3G5VA 4YHOL 3WUWB 1JRHL 4RX4D 4JPKH 5GGQL 1F4HA 2E9JA 2CJUL 1JRHI 3BH8A 1QBLL 1NGPH 4WFGE 3G04A 5D1XB 3U30C 2BMKA 2JJWA 4M7ZC 1R5IB 4YHIA 2P4AB 1B0GA 4J3VA 1U8PB 5J1AB 3TA3D 4G9DB 3GBLA 4LP5A 1UT9A 3QG6B 4BZ1H 5C0JA 3N85L 2DM7A 5IHLB 3NGBC 2I9TB 2Z31B 1NMBL 1RVFL 1R3KB 1SJHB 2D2OA 2F5BL 3DX8B 1KXTB 3HPLA 1PKQE 5DD0L 4FFWD 4MS8D 4KK8D 3QXDA 1A6UL 2IH3A 1NCNA 3DUUB 5IHUH 4HHAB 4NBYB 1OAKL 3QDGB 4CNIA 1H3VA 1OTUD 4P48A 5F88A 2APFA 3MRDB 2X7LB 3DSFL 1MAMH 4B41A 2FB4H 2FEDC 4YFEA 2X89D 4ONGH 1DQJB 5T1KA 2V9TA 4JZNA 4Y4FC 3RVWD 1EXUA 3LKNA 4DOHE 1QG3A 1YC8A 1U93B 2DIAA 4PB9L 3ARBA 1FE8H 4I48A 5J0BA 1CL7L 1BJMA 1P4LA 5JLZA 3LOWA 3WFEL 2XYCA 1MI5A 5I1KL 1BIIA 4HCRA 4NCC2 5D1QC 4KZEH 1MPAL 5ELIA 5GJTH 4IMKC 1CL7I 3A0OA 4YHLL 2DDQH 2CRIA 3O9WB 4X6EB 1LD9B 3MV7B 4AT6B 4PD4J 3DX9A 3UPRB 4H20L 2HRLA 4D8PA 5ILTH 3BKYH 3HPJA 4K71C 2OR9L 1NCDL 4MNHA 4E42B 2D4FA 3KXFB 4U1HB 3DUSB 4I5BA 2WQ8A 2A6IB 4KMQA 3ZE0F 4N0FA 5BMFH 1RY7B 3FO0H 3BT2H 4Y19A 3VA6A 2VJXA 4OCSH 5LCVL 1OAYL 3MJ9H 1VPOL 3BUTA 4OCNC 5I1LA 1QFHA 2H9GA 1U3HD 4XPTH 2JJSA 4DGVH 1T1YA 1P7KB 4ODHH 3NOIA 3ULVD 1BD2A 5D70H 4LPTA 1KTKE 1FL3A 2JIXB 5EUKA 1X44A 4JVWA 5C0BD 4LCIL 5TH2B 5LGJB 3BPNB 1WWBX 1HYSC 5KVGH 2XKNB 4HS6A 2J8UE 4HPYH 4MAUH 4G7YL 4MJ6B 4LKXA 1MCHA 3GO1L 3QIBD 3TFKC 2JK5A 5EUOF 3VH8B 3DYOA 5A40E 3VXTB 4ODSH 3K2UL 4GBXC 1XEDA 2BERA 1KCRL 4X6DB 5B21A 3LRSA 3TGXA 3V6OA 2XXCB 3NBNA 3IXAA 1CFQA 2LTQC 3ARQA 1I7TA 2E9IA 2VISA 2W0KA 2YWYA 4XPHH 1L7IL 3DRTB 4QOKE 5EBWA 2XFXB 3KS0H 2NZ9C 1B88A 5MEPB 5JQ6L 1EHNA 1YEIH 4WUUE 3VFGL 3STZA 1P2CB 3MRJB 3B9EA 4UB0L 1CDUA 4D0CA 3VFPA 3ZHDA 4AM0A 2PUQT 4YX2L 4HKXA 5F1KC 3EZJB 1P9MC 3QJFB 4F7EA 5IOPA 2MHAA 1T2QL 4G43A 1DUYB 1T0MB 4URTB 2XWJB 4S1RL 3DOSA 1XR9A 5C09E 3VWJD 4WO4C 1HDMA 5T3XL 4CVXA 5HYSA 2ICWA 4XMPL 3D6GA 1JBJA 3LKOA 5BW7C 3U7YL 3KPPA 1ZLUH 3QCVL 2FYYB 3LQAH 4MCYA 2E3VA 3MRFA 1LK2B 4X7TB 4NQEE 4M6MH 1TZGL 1RZKH 3C6LD 3RVTD 3UTZB 5I74C 5DHXB 2P8LB 1Y18A 3NMEA 4JZJC 1MQKH 2GCYB 1MJJB 4TUOA 1QLFA 4FZEH 1WBXA 2ERJB 5I9QC 1FVDA 2GIYA 4EI5B 1ZWIB 4D9QE 1D5XB 2HFGL 4AG4L 4AY0A 5FCUH 2GTZB 4L4VA 1MCFA 5I1IL 4W70A 4XCEB 5JW5A 5FXCH 4YBQD 4HCRL 4WW2F 2CUHA 12E8L 5BVJB 1IFHL 1L4IA 3MC0A 4QRSA 1S9VB 3PIQB 2L7JA 5D5MA 2G9HB 3HE6B 1KEGL 5K9JH 2BVTA 4LSVL 3QIUD 3ZKQD 2XI9A 2JB6B 1NBYA 2WK2A 3MLSH 4QGYA 2IAMA 1I1RA 2OXHA 2Q20A 1VGEL 5GGVH 4O58L 3SDXF 3IFNH 1U92B 2D7TH 1S7TB 1YEDB 1KFAH 4QHUA 2A74A 5A16A 4JFOA 4QF1A 1MLCA 1ED3A 3C08H 4HSQA 4WCYL 4PP2B 4JPIA 3UTTD 4U33A 3KLSA 4YGVA 3D39D 2CLVB 5E94B 5F3BB 5IB3B 3DO3A 3TJEH 3BPCA 5IMLA 4YXLL 1R24A 4NKDA 4XVUC 4OLZH 3NACL 3GJEA 5I8KH 5I66B 2GJ6E 1P4BH 1UWXH 1F3DH 2ERJC 1ZLSL 3L6FA 5CP3H 1II4E 4RMWA 4WNQA 1S7XA 1W8OA 3EOTH 2YBRA 1I7UA 5GS0D 2X4SB 3GHEH 1Q0XH 1K9TA 1C5CH 1ONQB 3PWPB 1EEZA 4ERSL 5ISZA 1BFVH 3EYQC 1T3FA 4XNZC 2X4NA 5D1XD 3BRFA 2XKUA 3L3DA 3D5OF 4M3JA 5FGCB 4HT1H 1JMZA 2XN9A 3SDCD 3SO3C 2EKJA 4HIHA 3ME0A 4PRDA 2PO6D 1GXEA 4XVJL 4RRPA 4ZNCD 1EZVX 1PD6A 1QRNB 1DBAH 5CJ8A 1Q9WA 1MCPH 3R06A 3ARDA 5HVHB 2Z91B 2ZJSL 3T0XA 1FNLA 5D2NA 4HWZA 1Z5LB 2RQ8A 5A2IH 1RHHA 4CVZA 4PY7A 1M4KA 1KB5H 1NFKA 4J4PA 4AEFA 2Z8SA 5LGHH 3V6BR 5DQ9A 1BQHG 1OSPH 3QDGD 2B39A 1BJ8A 5FYLE 5H8DA 3BFOA 2IQAB 1DQDH 4Z76A 1W0VB 1FH5L 1LQSR 5CUSL 2BXZA 5ITFA 2N4IA 5C0NC 4NPYA 4U0RC 1A2YA 2ICWI 4TRPH 2AXGA 2HVJA 2MCPL 2HKHH 1JYWA 2WUBH 3P0YL 4OT1L 1F58H 2VE6A 2UZXB 2MKLC 1X3DA 1OWWA 1RUKH 1NCAL 4RAVA 4JCLA 4PTTA 2W9EH 5TE4H 5TQ2H 3D0VA 4OZIB 4KFZC 32C2B 1PDKA 1EMTH 4KJPD 2WINB 5KVEH 3CH1B 4Y2DC 4IRJD 3O9WD 2BFVH 3Q6FA 3GKZA 1BVLA 1KN4L 4YDJB 3EHBC 3U83A 4QHNA 4PJFA 4M62H 4X83A 4KUCD 4XPFH 4MAYB 1YMMD 3S97C 2C4FT 2X70B 3WFHA 4F37F 1S5HA 4WUKH 2EDFA 2CR6A 4X8JB 1JTPA 5F7DB 2P5WE 4O02H 4R2GB 5KSBA 1HN1A 3R0NA 2XXMB 4N0CD 2FATL 5KJRH 1W0WA 3QH3A 3U79A 5CMAB 5KSVB 4NJ9L 1FZJB 1KG0A 2JIXD 2NY7L 4GXVH 4ENEC 1WQVT 5DMGD 4JGMA 3QIWB 4P5KA 4U1SA 1A1MA 4QHMB 5CEYA 3HFML 1N6UA 1ZMYA 3O3EB 3CX2A 1A7OL 3O6KH 4ODVH 2QR0A 5C6TL 4L5FH 4NQSA 4PJDA 4GG6B 1OSZB 1CGWA 3BIAX 3FT4B 3CLFH 3MCLL 1KCVL 1FVEB 1FG9C 3U4EB 2KPNA 2P49B 1J8HE 4NNXB 2BVOA 1RUQH 2ZUXA 1F3JA 2VXVL 1DDHB 4BQ9A 1JZ2A 3S36L 4QY8B 3ULSB 1FNEA 3OGCA 1C5BH 3ULUL 1YEEL 4EN3C 1A3RL 4NWTL 2JTDA 4Z6AT 1JGLL 3KPRA 2GITB 5KSAB 2WBWB 3CAFA 3MOBH 4HFUH 5SWSA 4PGCA 1T2XA 4OF8A 1TQBC 1HHKA 4I0PB 1GRWA 3DVGA 3PGCA 4PLKD 5TDOB 1DLFH 1G0DA 1OB1B 2CUIA 2J8UF 4Q9QL 3UPCA 3QP3A 4W6WB 2VDOH 1OVZA 4ODWB 1TZHB 4XBEL 2F5AL 5DUMH 3KPSE 4FXGA 4NM4L 5JW4M 3UJTH 3Q0HA 1OD7A 1E6OH 1H15A 3GHBH 2YA1A 1RZGA 1EEQA 3PV7A 4UTAH 1IGML 3RAJH 4PTUA 1S9KC 1RJLB 3ES6B 5IVOA 2F53A 4G6KH 4KVNH 3MFFB 2QQNH 3RI5F 1A6WL 4XAWH 4E41E 2UZIH 2XQBL 3OB0K 4OLVL 1CLYH 3QHTC 4MD4B 5CBAA 2NXYB 3WFBH 2ZG3A 3RFZC 1L9MA 5F8QC 5T5NF 5ICZA 3OKOA 2XRAH 4RDQG 4AENA 2R0KH 1DVFC 5F7WC 4Y5XA 3DMMA 4RFOL 3L3IB 3J8F7 4LEOA 3EYSL 4F9PA 5D8JL 1KCLA 4V1DD 4R97B 4DKAA 3IJHB 2GQHA 1KXVC 1M71B 1RURL 1AE6L 2AXJA 4NOBA 2EC8A 2RGSA 4O5LL 4UV4H 3HE6D 5I73C 3D25B 3PP3H 4YHZL 3RU8L 5BO1H 5JHDE 1RJYB 5F9WB 3TH2T 3NCCB 1KTDA 4U2YA 4OB5H 3VGAB 4QXGL 4Z9KB 4JRYB 2DQDL 1INQB 3LS4L 4J1UB 4PG2A 4G8EA 2V2XA 1ACYH 1FORL 4ZFZB 3QG7L 3QJHB 4ZSOE 2ZWLT 4XCYA 5B4MC 3D3VD 4N0UE 3U4BL 4JHBA 1XF5A 4BK4A 5BS0E 1RIHL 2VO5A 3ROOA 4JRXB 3BI9X 4ZFOA 2COQA 4ONFL 2DKSA 1CE1L 5J6HA 4GSDL 2NXYC 3HMWL 4KRPB 1WEJH 1J9CT 3CXHJ 1G6RH 5D6CB 3VXRE 2L7UA 5EWIH 2AEIT 4XVSH 4WHYG 5C6WH 4P2OB 4LSTL 2D7NA 4UQ2A 2ZPKL 4OAWA 3X3FH 1NDMA 3WS6C 2LAAA 3T8XA 4FQ1L 4QGTA 5D93B 2NY2D 4G80A 4AEHH 4HZLA 1FO0B 4DVRH 2FX9H 5EZOL 3TC9A 4U6YB 4FQLH 3HC0B 3S4SG 4LIQL 3VXQA 3BQUD 3HB3C 2VN4A 2XNAA 4H8WC 5I8CA 2CSPA 1KLGA 3PHQA 3SJVA 1KBGL 3SDAA 5M7QA 4B5EA 3K4ZA 4PJXA 3GMPA 4Y0GA 5EUOB 5HDOA 4YAQB 1QRND 5FFLA 1UXWA 1GOGA 3RY4A 5F9WC 4U6HA 4W6YB 4HX1B 5GHWH 2V17L 4PRPE 1I3RB 1FN4B 4KJQC 4LMQI 3DO7B 2R1WB 2R2CA 4WJ5B 1YJDH 3L5IA 3OKKB 1PYWA 2HJLA 5GS0H 3MGOB 1T1WA 2C4XA 2VLJB 4AK1A 3GSVA 1FYHB 3VDBA 2DQEL 5DJ8B 3PWVB 3WXVH 2VZTA 2XTJC 4IDJL 4G9FD 4DAGH 4XP9H 1RULH 3F5WA 3VMOA 4X7CC 4X5XB 3MLVH 5F6IB 3HG1E 4GRLB 4Y4HB 3DARA 3NVQA 5E2TL 1FYTE 3O2WH 5C0AA 4UIMB 5D93C 1RZFL 4JQIL 5DD1H 1HZHH 2VAAB 1CBVH 5TPWH 5HGHA 3QUKB 5FF6A 4KKCD 1MREH 4LLUA 4TOYL 1T6VN 5F7LB 4YR6B 3REVA 5HYJA 3D85B 1MWAB 5T1MB 5GRWA 4B50A 4NQDB 3MLTB 1NCCH 4J2XA 4MAYD 3CC5A 2ORBL 4LPXA 3AREC 4KPHL 3I75B 1IILE 2ADGA 4XPBH 4F2MA 1CDCA 2GI7A 1S5IH 4AEEA 4RFEA 3TEUA 4MJIB 2YK1L 4NC0B 4R2GD 3V5KA 3TVMD 3H42H 3BGFC 3H0TB 4HDIA 4L3CB 1KNOB 1U8NB 4JM2C 1QKZL 2DLGA 4WW2B 3ZDYE 3S7GA 3QNYA 2HT3D 3OKEB 3QIWD 5DD5L 3ZKXC 4OLXL 2A77L 5CJ5A 2H2PD 1K5NA 5IBLC 3ARXA 1T21B 2UYLA 4M61A 4NKOA 1D5IH 2BNRB 1MCWM 4JFDE 4ZFOL 4FZ8H 3H7LA 5HGDB 2BRRH 3TNNB 1NAKL 3MPCA 3MR9A 3SDXB 3D2UA 3MV8B 1NEZG 2IQ9H 4Y4HC 5EPMA 2B2XL 4K3GA 4J3OC 2EDXA 4JAMB 4K8RD 4DN3H 3CMOL 5DJYB 1MEXH 1XH3A 4HUXA 3V5HB 3DHJA 2DQGL 5FOBB 4LPWA 4TNVK 1D5BB 4OFYD 1AKJB 1MCSA 1UZ8A 3ZL4H 2VWEE 5DK0A 1FBIH 3H3BC 3QO1B 3VDAA 3CSGA 1DBML 4NKQB 4MWFA 2AV7A 3K1DA 3WSQH 3UTSE 1J18A 1FPTH 4MXQD 4I0PD 2VDPL 5J89A 4QRQB 4NZUL 43CAA 1OCWL 5I75C 3Q6GL 4AJ0A 3VMPA 4WFHE 4DN4H 1F5WA 1AGFB 1P84K 4F7CA 2DKUA 1MFNA 1A9EB 5J11B 1NLDH 2AI0L 3BMVA 4UDTB 2J3SA 1H5BC 4GRMB 3SOBL 5BZWA 1Q8MA 5DF0A 4EQ2A 2VDLL 1T66C 4P23B 3GKWL 3IDJA 3FQTB 3DGGB 4X0KA 3TPUB 2XZAH 4OLUL 3IFOA 1NCBL 4P2QB 5E5RB 4LASH 1QSFA 5BOZG 4Y2OA 3RWGB 1WFTA 3W2DL 4NO3B 2A1WL 5MENB 2ITDA 3PQYE 2FGWH 2K3TA 3FFDA 2PXYA 1HHIB 5DEGB 5AUMB 1FRGH 1HWHB 2PTVA 1A9BA 5FCSH 3AY4C 3B83A 2HJFB 2GKIA 1N5AA 3BHBA 4ZUWB 4M9OA 3L5JA 2P42B 2VR4A 1HHHB 5KSUA 5I0ZA 1CYGA 5FYKH 4QHLA 3QWOA 5LQBH 1EEYA 1QD0A 1RUAH 4ETQB 5T1LB 4X6FA 4ZDHA 1QLRB 4MSWB 1RZJC 5F89A 3U4AA 1N59A 4CKVX 3LIZL 4K9EC 4JRYD 1JNLL 1MFAL 5KG9A 1IAKA 2OTWB 4UINL 4TUJB 1ZVSB 2X4TB 1MCOL 3V5DA 4QTHB 5EBLA 2H26A 4P3DB 1PKQB 3OB8A 1UM5L 1QBMH 2IH1A 4JFQA 2EDLA 1YEFH 3T09A 2VXTL 4JRXD 4HG4J 3WBDA 4HC1H 2AEPH 4P23C 5DD6A 2R4RH 2BNUA 1F8TH 1CD9B 4M43H 4IOFC 1OP5K 3QUXD 5DMIL 4KRPD 4LNRB 1HE7A 1BVKA 1UCBL 3BIBX 1QBBA 2NY6C 1QVOB 4G5ZL 4KDVA 3GI9H 3VFSB 3PWUA 3QYCA 1IT9L 5IF0A 4HKBB 2EDOA 3LPGA 3DVFA 3VFWA 1MCDA 4DOHB 3QUMB 4M1CC 1LWRA 1G7QA 1FIEA 5MP6H 1FZOB 4IRSA 3DWTA 4U3CA 3QCTL 3BH9A 2GFBA 3QFJD 1N0LA 2DI9A 4XNXH 4NYLB 1ZEAL 5DFVD 3K4AA 2C3VB 1EVUA 3ARSA 3TA3C 1O7VA 3JWNC 2LAGB 3HZKB 3QISA 2P5ED 2XY2A 1E4KC 1KJ2A 3HZYB 2CDGB 4LK4A 1ULVA 2EEAA 2YXMA 1J1OH 3LV3B 3F8UB 1CT8A 3GI8L 3IAGC 2HWZH 2NLJA 3CIQA 3DXAD 3ZYJA 5DO2C 5F44A 3QDMA 1VESA 4ZFFB 2ZP0T 3EDEA 5KVMC 4JJ5A 4YXKL 5C3LD 1Y6KR 1OGTA 4PREB 1WWCA 3M1BB 4OGAC 1N2RA 2XA8L 5ICYA 3B9VA 3EBAA 1S78D 4MB5A 1A14H 1KV3A 5K9KB 1GGIH 1YN7A 5AAWA 1UKSA 2AV1A 5D9SA 5IEKA 3MRNA 3RVWC 1KIRB 2J8UB 2GK0B 2VLMD 2ARWA 3LKQB 3LN5B 2LU3A 1FNAA 2W92A 1NMAH 5F7EL 2ADJA 1P7QD 4BFBD 1EA9C 2DL2A 4L1HA 2ATPB 3GMNA 2PR4L 4QOKB 5AYQA 3C2AL 1QSEA 3FO1A 3D85D 5SV3A 1M1SA 4LARH 4YUEH 1OQXA 5TDPB 3RQ3A 4WUUB 4HIXL 4XMLH 1UYWL 2P45B 5I17A 4Y88A 5CEZE 1CU4H 1JI2A 4Q0XL 1EBPA 1TETH 4RGNE 1K8DA 1CG9A 5EU4B 4S1DC 4ODXB 3MNWB 4LVOC 1AI1H 3FB8A 3BZEB 3P9LB 3VFVA 3DJ9A 3SE9L 4JO3L 1YZZA 4O4YL 3EJYD 2W9LA 4Q9BA 1U3HC 1H8NA 2R2BB 1GIGL 1EHLH 2JCCE 3O4LD 3HC3L 5C09B 4DTGL 3P73B 3ULVC 5JUEH 3EYUH 4OIAA 3PWLA 2J7LA 3LS5L 5I19L 3DYPA 2BNQD 3KPLB 3MLXL 5EO1B 5HHXL 3WUWA 4GMTH 2Y6SC 4M4PA 3TYFB 1JP5A 1I9JL 4ZTPL 4NQEB 5T3XE 4IMKA 4TTDD 2MKWA 1BFTA 4NO5B 5AAMA 2NY5L 1TTFA 2V2WB 3QR2A 3MV8D 3RX8A 1U8PA 3SDDB 3EZ8A 4G9DA 5EIIB 2E6JA 2VXSH 3MV9D 5C08D 1WZLA 1IAIH 2ENYA 2I9TA 4QYOB 1NANI 5D7KE 3W0WB 4IHOB 1R3KA 4M1DH 3V4UL 1B9ZA 4GW4A 1QNZH 1MIEL 4OGXL 4YJZL 1M05B 4GKZA 5GISL 4TQEL 3ZDYF 4HHAA 2VITB 1T0PB 1E4WH 3A6OA 3VXUD 4LCUB 1R0AL 2B5IB 1A6VH 4CDHA 3MRLB 3PV6A 1UZ6E 4ORGB 2WW8A 3RRQA 1Q72L 5EO9A 3UBXA 1KJ2L 4FMFA 4LSQL 3QI9D 4K8RH 3VWJC 5BV7B 1EDQA 1EJOH 3MLZH 1J1XH 1ZHNB 4LNVA 3VWKB 2EIBA 4LVNC 1U93A 4GBXA 3MREB 5B3JE 3SKOA 4TVSa 1JGDA 1I9IH 3CXDL 1UVQA 1EO8H 4X7SH 3ARYA 3JWDH 3L3JA 2VR5A 4MA7L 3ETBF 4X6EA 3MV7A 4AT6A 2BY3A 3VJ6B 2Q8AH 3UPRA 5J13C 3P30H 5MEND 25C8L 4UAOB 1YQVH 2GJ6B 3MRQB 4F57L 4E42A 3RWHB 4QTIH 3KXFA 3DUSA 1ROWA 1IVLA 3QUYB 1IM9D 2L4OA 1P9MA 2A6IA 1BIHA 3IS1X 4KTYA 2J6EA 1QFOA 3HAEG 1D6VH 4TUKH 4PJHE 2VL4A 3TBTB 4YBQC 1V05A 4RBPK 2VLKD 5F1IA 2R23B 3U7WH 1P7KA 4JDTH 4WO4A 4N1CA 1YYML 2B0SL 4IS6A 1XIWB 1MSPA 2B5IC 4XCFL 5BW7A 1IKFH 2A9NL 1UQSB 5F9OL 5LWYH 1AQKH 3QIUC 4KK6C 1XGQB 4ZMAT 3CFIC 3IJSB 5TH2A 1G0YR 3Q1SL 2XKNA 2CDFA 2OZ4H 4PJ5D 4C83B 3OJ2C 3S37H 4MJ6A 5D7LD 1UWGL 3ARFB 4NQCE 3VH8A 1PSKL 3IETA 3VWKC 1MCKA 4JKPH 3I6GA 4JZJA 3X12B 4JR9H 1F11B 3H8NA 4WW1B 3TV3H 4KY1L 4X6DA 5GJSH 3E6FA 3ZHLA 5MERA 4QXTB 1RK1A 2YD5A 2IANA 2XFXA 1KPRB 1WBZA 3VXME 1AY1L 3N1FC 5MEPA 1OAQL 1CD8A 3QXTA 3WFDH 1CQYA 4JREC 4BFGA 4OF0A 5CSGA 2R0WH 1S7VA 3WIIH 4POZC 1YJDC 4YO0A 1QLEH 3T04D 3QJFA 4QEGA 3TWCH 1AGCA 2XOTA 1J5OH 1LE5B 1DUYA 1XMWA 1T0MA 4XNYH 1OTTC 2XWJA 1HOCB 5DJ2A 1YEGL 4X6CE 2I27N 5EN2B 3MRIB 1B6DA 5DVNA 3CUPB 1O7SA 2X4QB 4N68A 4LLMB 3SDCC 1RD6A 2A83A 4R0LB 2DM4A 3RUGF 1ZVYA 2PO6C 1A0QH 3OMZA 1LK2A 3M17B 4X7TA 3O6MH 4L4VE 4WI2A 1QR1B 2DQHL 1ZHKB 1T4KB 2P5WB 3JZ7A 3RL1B 4GW5A 5D7SH 2O5ZH 1KF9B 1FO0H 1MJJA 1F45A 1UWEH 2GCYA 4MB4A 3VW3L 4P9ML 4K94L 4QRPE 1OPGL 3UBXI 4K2UL 3JV5A 1G84A 4LSRH 4P2CG 2CR3A 2E9BA 4EI5A 1ZWIA 1D5XA 3GM0A 1GGCL 5ABDE 2GTZA 4MLIA 4BQBA 3MUZ1 4ZUSB 3EGSA 2K7QA 2LE9A 4KHXH 2E9WA 1GZPA 3QEUB 2EH7H 1MFCH 4XPGL 4HAGA 5CGYC 3V7AE 3ECBB 1Q9OB 1S9VA 3QDJD 5HYSG 4N8VB 3PIQA 1ETZA 5GGTA 2G9HA 5FO7B 1J8HB 4ZAKC 3O0RH 1FDLH 2NX5B 5GRUH 2QADD 4NKMB 3HI5H 2DQUH 4IRJC 2Y9RT 5D7JD 5J6GB 1U92A 1S7TA 1KCUH 3IXTB 2J6EL 4J3WA 3L3OB 4JFXB 3JWOH 3MJ8B 2ARJB 3NA4A 4R0LC 1IGCH 1W72B 4DW2H 2A6KA 4K3DL 4OD3H 3ULUE 1I1YB 2CLVA 2WAHA 5E24E 1NL0H 5IB3A 4N0YH 2B1HH 3OKNB 4NIKB 3QQNA 5CS7A 5EOQL 5I8OL 5ISZE 1I1AD 1LO2L 1Y6NR 4M5ZH 5I66A 4RGOH 3UJJL 1F4XL 3MACL 3KDMB 4HUVB 1WV7T 4NO2A 4P9HH 3KPSB 4R90H 4CW1B 1AC6A 3KJ4B 1CGSH 5DMGC 2OR7A 2DL9A 5DJAA 4PJAA 1URLA 4BUHA 4RAUB 3PWPA 1ONQA 5H35B 5E6ID 5DJDA 1I8LC 4HMEA 4Y2DA 4PJBF 5E4EB 4X4ME 2DD8L 3EFDL 3K7UA 3AU1A 5E8NB 3SDDD 3GMOA 3PDDA 4OZ4B 1NCUA 4LSUL 1BF2A 2I60H 2XV6B 4OCXL 3QZWA 4RISH 2YD4A 1V7NL 4I18B 4NZJA 3INUL 2B7DT 1RSFA 5F97E 3W0WD 3WLBB 3S36X 3UO1L 2Q3ZA 2VOTA 2Z91A 3O4OB 3ZSSA 4BA8A 5HPMB 1AD9B 1VA9A 3VXPA 5J8OA 1JGUL 2JCCF 2D31A 3BP6B 3CH8A 2KUTA 3TIDB 3HLAA 5L8JB 1XF3B 2IQAA 1S7WB 4YHML 3GMRB 4PLKC 4D9RE 1K4CB 1E0OB 2CDEB 3PDGA 2Y7QB 4UILH 3G6AB 5JHDB 4EOWH 4JO1H 2X9YA 3BRDA 4Q9RH 5FB8A 1B3JA 3KJ6L 2VERN 3LKSB 4O2CB 2R56L 1KTLB 4MA8L 1F3DJ 4NN6C 3RP1A 1FC1A 4HZAA 1AFVL 4YHPA 4OCYH 1F6LL 4OZIA 4N0UB 32C2A 3PWNA 5BS0B 3RZCC 2Y07L 5AYUH 2WINA 1LNUB 4GFTB 1FAIL 3WFZA 5KN5B 1S7QA 4HLZG 3IAPA 4OZHA 3VXRB 3GSRB 2X4RA 4HH8A 5IWLA 4I18C 1GGYA 3QUYD 4OZGA 5IFJA 1NGYB 4GAJL 1UZ6F 2AJVL 1BFOA 3S35H 4X8JA 1FZKB 1YY9C 3T2QA 1IBGH 3O4OC 4LRNL 3ZYIA 4U4BA 3O6LL 5TE7L 1JE6A 5JORA 4HWNA 4OD1H 2Q8BL 4NKIH 2F58L 1RQ5A 2F19L 5CMAA 4UNUA 5KSVA 1FZJA 3FMGH 5BJTB 1XIWD 4FNLL 2OP4H 4GAYB 5B3JF 3P3YA 5CKAA 1LGVA 1OM3L 2FH8A 1HQ4B 1H8SA 1J87A 1QO3B 4LIQE 3O3EA 5ETUA 2QQKH 4PRBA 3MO1B 4L4TA 3IB4A 3MMEA 2M1KA 4GG6A 4PRPB 3ARFD 3CFKB 1OSZA 3CFDB 3KPRE 2R8SH 3X13A 4HUNB 3MX0A 3FT4A 4KH2A 1KCSH 4BM7A 1DVFA 4LMQE 3U4EA 5HGGS 3PWJB 3VXSB 1SYVB 4NNXA 3L5WB 3T08A 2HAZA 2EDQA 5GGRY 3ULSA 5JW4N 4PJHF 5I18H 4KAQH 2OSLB 2YOCA 4POUB 5KSAA 1VKXB 5E08H 1X4ZA 4HIEA 1KLFA 1OAZL 1OARL 5EIVA 4G8FB 5SWZA 1MJ7H 1IRAY 1LE9B 3HG1B 4NBZB 2APBA 2OJEA 3B9DA 5TDOA 1HIMH 2DLIA 1KACB 5HSFA 2F53E 1OB1A 4XC3L 5J12C 1GC1H 4ODWA 3T4AB 3P77B 1OP3H 3BQUC 2EYTB 3CDGA 4GW1A 3EW3B 5I1HL 3KLHC 1T22B 3SKUD 1I8KB 3VD9A 1TFHA 3QUZD 4I4WA 1HKLH 2DBLH 4KZDH 2RHEA 4NJAH 1Q0YL 1UACL 5FOJA 5JO5B 5E8OB 2XKSA 9CGTA 2GAZA 4HW6A 2P5WD 3QUMH 4MD4A 2LQRA 1JZ8A 2AERT 2HMID 2CGRL 4PPTA 2DQCH 2QEJA 2VSDA 4WFFD 2QSCH 5HHVH 1T83C 3HNTH 2WBJB 3DIFB 1WAAE