2EP6A

Solution structure of the second c2 domain from human mctp2 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
133
structure length
133
Chain Sequence
GSSGSSGDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCTP2 protein
publication title Solution structure of the second C2 domain from human MCTP2 protein
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 9
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2ep6A01
2NQ3A 2ZKMX 2Q3XA 5G55A 2X38A 3APDA 4WWOA 5JHAA 1E7UA 4XZ4A 4F92B 2A5UA 2CHWA 3F04A 4NS0A 4TUUA 1TJMA 4FA6A 2CHXA 2Q0ZX 3HIZA 4TV3A 1QASA 3FDWA 3S2AA 4ANUA 5CCJA 4IQHA 4WWPA 2B3RA 2WXJA 4F93B 2QZ5A 1DJGA 3DPDA 4A55A 3L54A 2Y3AA 4OVUA 2WXLA 2K8MA 1E90A 4NPJA 3ZW3A 4ANVA 4F1SA 3TJPA 3QK0A 3IBEA 3L9BA 4FLHA 4DK5A 4HVBA 3PFQA 2FK9A 5CCGE 1DJZA 2WXKA 3L13A 4FHKA 2CJSA 4V11A 4IHBA 5G2NA 2WXHA 3L16A 3PRZA 3PS6A 4PS7A 4URKA 4L1BA 4BGDA 4ICWA 2CM6A 2WXIA 4ANWA 4QJ4B 4XX5A 2YOAA 3QARA 3R7RA 4KITB 3F00A 3HHMA 2FJUB 2R83A 2WXRA 1DSYA 2DMHA 3NZUA 4LDCA 3HN8A 4ICXA 4JPSA 5EDSA 3IM1A 3L08A 4HLEA 2WXMA 4L2YA 4WWNA 3PREA 4ANXA 1DJHA 2Z0UA 3L17A 1E8WA 4L23A 3R7QA 3DBSA 3CSFA 4PS8A 3NSJA 2WXNA 1UGKA 4FJZA 3APFA 3ML8A 3LJ3A 1DJXA 2CJTA 3F01A 4KZ0A 3RDJA 3ZVVA 1GMIA 1BDYA 3KWTA 3JZYA 2CHDA 2WXGA 1E8XA 1UOWA 4TS6A 4Y1SA 2LHAA 5CCHE 3W56A 3ML9A 1HE8A 3FBKA 2ENPA 2K45A 2K4AA 3NZSA 4GNKB 1QATA 2QZQA 4NP9A 4QJ3B 3KWUA 4DNLA 4FJYA 2KI6A 3B7YA 4EZLA 1K5WA 2ENQA 2WXFA 3N5AA 4BFRA 1TJXA 4OVVA 1CJYA 3TL5A 3OHMB 2WXPA 5H4YA 1WFMA 4KZCA 2K3HA 2A4ZA 5T8IA 3T8MA 1E7VA 3CSTA 1A25A 2JQZA 5H4ZA 3TWYA 1DJWA 4EZKA 3F05A 3ENEA 4PS3A 4FADA 4LT7A 2N1TE 1DJYA 4Y1TA 2RD0A 1W15A 4GB9A 4J6IA 3RPBA 3W57A 4LCVA 4XE0A 2ISDA 1DQVA 1RLWA 4WAFA 1UOVA 2UZPA 2WXOA 2CM5A 1RH8A 2WXQA 3L4CA 4FULA 2NSQA 3QJZA 1YRKA 3QR1A 4F91B 3M7FB 1WFJA 3QR0A 5JHBA 2D8KA 2V4LA 3PYCA 2YRBA 1V27A 2NCEA 2CHZA 4QAMB 5KJ7E 3P2BA 4AOFA 3GPEA 1W16A 2EP6A 1RSYA 4FHJA 4WEEA 1BCIA 4EZJA 3ZIMA 1BYNA 1E8ZA 4QJ5B 3SD5A 4MJJA 4G11A 1DJIA 4NPKA 3QAQA 2BWQA 3MJWA 3OAWA 4L1LA 2ENJA 1E8YA 4AJWA 2DMGA 3APCA
chains in the Genus database with same CATH superfamily
3VQ1C 1SJHB 5G55A 2ZJSH 1B90A 2OBGA 3ASNB 3QIUB 1T0NB 1N0LB 4NI6A 4U3XA 3BH8A 4YOKA 5F0MB 5LWYH 3IGLA 3X3FH 1EHXA 2BNQA 4P4KA 2DTSA 1J5OH 3FUNA 4V2BA 1U8PA 3DHPA 4X4XA 3GJEB 1U41A 3MZTA 1KACB 3PABA 3IPBA 4FLRA 3NDZE 3SDCC 1LQSR 2YLKA 3IJEB 2IOOA 3GJFH 3U83A 5BVJB 3UC0H 2VR7A 3H9HB 3NSDA 1ILUA 1L9PA 5D93B 3AUWB 1ADQA 1OD9A 1U8HA 1X7QA 5HI4C 1WEJL 4MQSB 4XH2B 3KPTA 1KIQA 2Z1PA 1XIWC 1KN4L 1XSKA 1YNTA 4HLJA 1J1PL 5GGSA 5FOBB 2QKSA 5LN8A 5E24E 1Y18B 2N7AA 5LQBH 1CIDA 3P40A 3FT3A 1G0DA 3WN5B 1HSBB 1R5IA 3WTWA 1LO4L 2VJXA 3HI1A 5ICUA 3O2DA 4R90L 1QSFA 1NCAH 3MNZB 1GZHC 4NO0B 4CADB 2BOLA 4OTXL 3C5SB 2IWKA 1KBGL 4UINL 2R27A 3C60A 2W1NA 3P11H 1M1XB 1OGSA 2XN9D 4O4YH 5F70A 2F8OA 1HL8A 3U79A 4DQOH 5GGRB 5JYMA 4M5YH 3AM8C 3HAEB 3PJLA 32C2B 1U3HD 2ZKHH 1NPUA 3AJ7A 3FQUA 5D8JH 1NWOA 3PNRB 1FC1A 5C3IA 3WFCL 4N0CD 1REIA 2WKOA 1XGQB 2YEVB 4ZFOB 1A4KA 1ZWIA 3FH5A 5JDJA 4HQQL 1N64L 2XG5B 3IT8D 3KXFD 1S9VA 3S7GA 4BQ9A 1BXUA 2X4SB 1ZV2A 2P8PB 4UT6A 2FYYB 4DOHB 3FT4B 3TN0C 1C5DA 4N2OA 4WGVB 4HSAC 1LE9B 1WAAA 3QUYC 3FRPB 1I8LC 1OE3A 2DBLH 2MH4A 3L9RB 2BOCA 4F2MA 4WWKC 1QMUA 2WXQA 3LY6A 3Q5YA 4JB9L 5DRXB 3TBVB 4MD5B 4PB0H 1YY9C 3JXAA 4UTBA 2AV1B 2FEEI 1A5FL 2F74B 2Z35A 3IMVA 4XZUB 2DB8A 4L3EA 1ACCA 3JV4A 1EO5A 2EYSB 4G6JL 3KHOA 4RDQF 2IPKB 1F6AA 2P7TB 1JXDA 1X9UA 2VUKA 1TCMA 2VZTA 3JV0A 3MLUL 3OC5A 2DZEA 4C59B 5I1KL 4EJ1C 3QE5A 1DSFH 2CQVA 1EXUA 2EDBA 2GJ6A 4UILL 4G8GD 4UNIA 2MMXA 5EUOE 1RZ8A 4TUKH 3VFMA 4AJYV 1INEL 5HHOB 3QJUB 1IZKA 4P3DB 1AOZA 2WVUA 2XKUA 2DQTL 3BW9A 3E1F1 3PWLB 4F37K 2A1WL 2EEXA 3N40P 2D31B 3P73B 1FGVL 3UBXI 3U1QA 3IFPB 3U9WA 5CJQH 3LKPB 4HGWA 4JZJA 3WAKA 3WNNA 3OKEB 4KOCA 1Z3RA 4XVUD 4KDWA 4POYA 4FHKA 1IBGL 1RSFA 2HRLA 1KB5L 2V5RA 4M1DL 5BS0A 1NLDH 4CKQA 3DJTA 3D39D 2XWJA 3AU0A 4KOBA 4NUJB 4MS6A 1F2XK 3PWUA 1BSIA 1UB6A 1N19A 5HYJD 1KJ2L 5D70H 1EVUA 2PYEB 4DVRH 3BJ91 4MAYB 4WSKA 4M93C 3P9MA 4MXWH 4YSPA 4P5KA 3RIAK 2KDYA 5B38B 3CFMA 5EEXA 4GRWF 1X3DA 1G7HA 4N8PA 5C09D 5B7MA 3Q01A 1H3UA 2Q8BL 4MNQA 4LCYB 4U7MA 1QHQA 1J8HA 1WT5C 4F58L 3QRFM 5KAQG 5CINH 1E5CA 3JTSA 4BFNA 1MRCL 4HMDA 2VLJB 2NUTB 1R0AH 5SX5K 1AKJD 5F7NC 1Q9KB 1VENA 1OSYA 1NBYB 4LSQL 3NRPA 2G5RA 2FHFA 3SY6A 3WMQA 4LCIL 1LQBC 5KS9B 4GQ9H 1F4XH 3QHTC 2YN3A 3SKJL 3PAZA 4LSVH 3VRLE 1OGTA 1IM9A 1QQDB 1U6AH 2BP5M 3O6ML 1A0QL 4LEOA 5CGMA 2NW3A 3TFBA 2B39A 2B20A 4PS4L 1JHTB 2MNWA 2YD3A 3MREA 2QSVA 3QYNA 4JKKA 5SWZD 1KWKA 1A1MA 4KXZI 1OCOB 3VI4F 1Y1DA 4QRBA 2CDFA 3ULVL 2J5WA 1UXSA 1WBXB 2D0GA 2CJUL 2XA3A 4WWID 1IAKB 4HEPA 5D7SL 5D2LB 5TDOB 3OAZH 3H3PL 4C47A 2DJMA 2WQRA 1I1FB 1KBKA 1RUKH 4IRSC 5DJAA 2ZG1A 3MLSL 3MRMA 3O41A 1CD1A 2IDSA 4Y9GA 1QSEB 4G7VL 3LKNA 4DZ8A 4I13B 3MNWA 2P5EA 4RNRA 1ORQA 1PTZA 4NXSA 4S1SL 2EC9U 2G5BA 3BWAA 1CLCA 4YVUA 4ETYA 2HKHH 1U8IA 2MQ0A 1OAKL 2JWYA 2FO4A 2QGDA 3ILQD 2VDKH 3L3JB 5IESL 3A0OA 4X6BB 4I18A 4KVCL 1MPAL 3P9LA 3WIIH 1G9NH 1EERB 1HQ4A 4RFEA 2J8UF 4Z7OE 3QIWB 3KJ6H 5D5MB 3TBYB 3UP1A 1JZJA 2X0UA 3BJLA 1AJ7L 2VN5A 5IG7B 4A6YB 4WO4D 1O9VA 4I3SL 4G8EB 4L8CB 4MJIA 1AR1D 5F93C 3WUWA 1KZQA 1TJIL 4LSTH 3OJ2C 5GJSH 1M4KA 4G6FD 2DQEH 4LMQI 4BSWA 2F19H 4U1KA 1MFDL 3ASWA 1WBZB 4HSQA 2HVKB 3CXFA 5E8EA 3W9EB 3C5ZA 3L8QA 3CN1A 4R7VA 3DK0A 4WW1A 5EC1B 2P3YA 4Z7VA 5F3HA 3S37X 4Z1PA 2C3VA 1KDJA 3VFSA 1L4IA 4K3EL 2LR4A 4J23A 1KG0A 3UYPA 4F7CB 2OK0L 4MB5A 5I6MA 3BSZH 3TBBA 2CO6A 3WIHH 1B9ZA 1JNLL 2PYFB 3AU1B 3HNSL 1CFTA 2B14A 3IDGB 4LARH 4MMYA 4ZMTA 3NCFB 1RK1B 2YQGA 1OL0A 5AW4B 2CAKA 1MG3C 3QAZB 2VJ0A 4QKTA 2E6JA 5M94B 4G1EB 1XT5A 2VXQL 3GLDA 4I2XA 1AG0A 2UZYB 3NJLA 3W2DL 2J1WA 2EZ0C 1P7KA 2C7UA 1WHPA 1UACL 4YL4A 4Z7AA 1SMOA 2HFGL 5DSCB 1JV2A 4KAQH 4LLMB 2CGZA 4YXLH 5D1XB 3CVHL 1GGCL 4JZOB 2PW1A 3UFIA 5JMRA 2Z65C 4N8UA 4DN3H 4ZI8A 1SRDA 2WW8A 3VG0L 2P42B 3SGDH 5DZNA 2NRDA 1FNEA 2HMIC 5I5MA 3H8NA 1KCBA 1WIPA 1FIEA 2VZSA 12E8H 4HZLA 2EQDA 3ZDYE 3RA7H 3MA9H 3TZVB 4HA1A 1BEXA 1JGDB 4HJGB 3GSVA 3LPFA 4L05A 2F58H 3ZIMA 4Z8FH 3T2LA 1HNFA 1R34A 3EFDH 1KCRL 3CG8A 5LXGL 1A47A 3VXTA 5DJ2B 5I8KH 3QUXB 4XXWA 1COBA 4ZOEA 2WGXA 2W0FB 2W80C 2AJYH 4MA7H 4H8WH 1TCRA 4XP5H 4YDNA 4XGZB 1VGKB 3AFLA 3RGBA 2EECA 4KQ3L 4G6KH 5ESAB 3C09B 3CBKB 4E36A 5IKCA 4NQVA 4BSVB 2FBOJ 2W0KA 3RGVB 3NJNA 4BZYA 5TQ2H 1NGZA 3EYSL 1Q72L 4NN6C 3QZBA 4H5SB 2Y1VA 2CDGB 1G84A 5AAWC 2WIMA 3NZ8B 1TQUA 1NGYA 1R9FA 3ZE0F 4KJYB 1FZOA 5IP4A 1JF1B 4NUGH 4KVNH 3GSXA 5DS2A 3QIUD 1Z5LB 4OKVA 4WSJA 3NJHA 1IM3A 3EOTH 1AQKH 2QKIC 2PXYA 4C56A 2J2ZB 4AK2A 1I3GH 3BT0A 3RILA 1QD0A 4ANXA 4WENB 5LXVA 2VMFA 1OT4A 2XHNA 4DP5X 2AK1L 1I7RB 1KGWA 4YFDB 4NQXB 1NOAA 3BMWA 1KLFA 2YD7A 3AG2B 3PHAA 4F57H 5DMGC 3O8XB 2VZUA 4PWGA 5IV2B 3OHXB 4BFGA 3B8YA 3PCYA 2AZAA 3O0RH 2WCGA 3WLBB 2X4TA 2VDOB 5ITBH 4XVOA 4HWBL 1U3ZA 1WZ1H 4L2LA 2J88L 1S9KC 4I85A 4HEMA 4MNGB 5H8DA 3QEQA 3ZT5A 4MVBC 2HJLB 4FE9A 3DI3B 2IPUG 3VW3L 1JIBA 4IBLT 4G59C 4Z7NF 5JW3H 5ALCL 4DKDC 4NO0D 1DVYA 3MRBB 1JD9A 2FQEA 3OJVC 2YKKA 5TF1L 4XRCA 2KLSA 1QKZH 3BIAX 4NZUL 4G7QB 3U0PB 3NCYS 2VWEC 1AI1H 1GS7A 4U1JB 4LVHC 3LIZL 4XN4A 5ERWB 4ODWA 3VXQA 7CGTA 4XMWA 1LM8V 3C9NB 4K9JA 4HDIA 3U9UA 5EOTA 5TDNB 3O3DA 2JB5H 3CHQA 3SODB 2J1YA 3VD9A 1QOKA 4JG0L 4FQHA 2X4NA 4PY8J 4RFNC 5HHPA 2Y5TB 3V7AG 5HGGS 1AC0A 3OJMB 2VMEA 3V7MA 1A9VA 2A6DB 1M2VB 3VO0A 1QTPA 3PGCA 5FDWA 1XDTT 2OMWB 2YHGA 2DQDH 1MLBA 3MGOA 4UTAL 3BVTA 1U3YA 1H9VA 4EI6A 1CFSB 3Q3GA 2V9RA 1LEGB 5I6NA 3ATAA 1U30A 1NFDE 3ECVA 1SN2A 5E4EC 1AZZC 5BJTB 3FCGA 4HWUA 4TTDD 3V6ZA 4CW1B 3ATBA 4DVBB 2YPVL 2ZX5A 1E4KA 2VRQA 4PVMA 4XPBL 1LEIB 1ZLEA 1DVQA 3QPXL 5EU4B 5CSGA 5AVQB 4PHXA 1A6TA 4Q2ZB 4PRDB 1N26A 4U1LB 2WUCL 4AC2A 3ARBB 1M71A 4JKPL 3JSSA 3SE4A 4I0PC 2C1PB 4OIIH 4DGWC 5MENE 1T04B 2ETWA 2DQUH 1YEEH 4RLDA 4UIMA 5HHOD 3ARFC 2NY2B 1DTUA 4JO5A 3BESR 1W80A 2FHBA 4H8HA 1H9DA 4V2CB 4OZGA 3U46B 1YMHB 4LCUB 1KJMB 4URTB 3EH1A 3T9WA 3CFKB 3D3VE 3GMPA 4L8SB 3MFFA 5AKTA 4APXA 4FXKB 2BSTB 5C0CB 4M1GL 4HXAH 1MRFL 4G5ZL 3KLSA 3PDDA 4DPRA 4HIIB 5FYJD 1K8IA 4J4PA 3SDXB 1GYUA 1N12A 4OCXH 4G8AC 1R3HA 4P4KC 3LZFL 2GBAA 4OCWH 3GUTB 2V7NB 5CKAA 4LSSH 3APMA 1S5HB 1OP5H 4I89A 1AZNA 2FWSA 4U6TA 4N8VG 4TNWK 3KS0J 5KBPA 4N2HA 4TVUA 4KMQA 4AYMC 2PYED 5L6YL 4FYTA 5C0ND 4ABWA 1II4E 4MAYD 5F7YC 1R3KB 4U49A 4Z7UE 2EIKB 2IFFH 4B41A 3HG1E 4AVJA 3ESOA 4IOIB 2N1TE 3IJHB 2ATPB 3OKLA 4DSYA 1BWMA 3MLVL 3R8BB 5HGHB 1TNMA 3F7KA 1EJOL 1B4TA 1A65A 3B2PA 2OA9A 1E67A 1A8ZA 4WFEE 4ACPA 3IFOB 3NIDF 2NY1B 1EEYA 5HHME 1UOKA 1A3ZA 3QORA 3QJZA 2Q8AH 3NACL 2VLJD 1I7UB 1TIUA 4YNYA 3MRPB 5GGSY 3SYCA 3C60C 5I30H 2IAMA 3BD4A 4XNZB 3IDYB 4TTGA 1G7IA 4H25B 3ILDA 2PABA 4GUCA 3EFFB 5DI8B 2BWQA 2XRAL 3CFEA 4NERA 4WHTA 2VDPB 1PL3A 1Z6JT 3L5XH 4Y19A 1P4IL 5IVXF 2WBXA 4JKNA 1QW9A 1M3JA 2BSRA 3HBGA 5EFIA 2Q0ZX 3HLAB 4PTUB 1S8DA 2VH5H 4XXDA 2CA3A 2XLLA 4RWYL 5IFAH 1B3IA 5DZJA 3KYOA 6PAZA 1MLCB 1IKFL 2X12A 4UQEA 3L54A 1RQ5A 2DIAA 5ID0B 4YSCA 1GW6A 5KSAA 4PWHA 4LHUB 1JGIA 4J3XA 2AKRB 2PPFA 2ICWA 3TPKA 1MI5B 2VDNL 1DO6A 2R1WB 2DYRB 2IH9A 3TPUB 4BH8A 2GW5A 4OM1H 4G9FE 4G7RB 2J21A 4J8RB 3RVWC 1JAEA 1PCXA 1P6AB 3T3MB 5E8OA 1UJ3A 3VYOA 3FULA 1R46A 3QXAA 1QSED 4F15C 1JG9A 5HDQL 4X9IA 2FGWL 1ORSA 5AW9B 5DFVD 1YEWA 4KRPB 2YFNA 2Q86A 1RUPL 1WEJH 1YNTF 3MV7E 4NC1E 4ZAKB 5LAXB 4KJPC 3SDYL 1KN4H 1XGRB 4OI8A 5E4AA 1R5VA 2DIJA 1LWRA 1N5YL 4ODSH 4PGZA 5HI5C 1RPKA 4D8PA 3FO1A 3QIWD 4UWQB 1GJWA 1KCUL 1LK2B 1LO4H 3WHE1 3WJJA 4F5CE 1EDYA 3QNYA 4KMTL 3FFDA 3CJJA 3UROR 5E94A 1ZANL 2I5YH 1XBRA 1ZHLB 3VX0A 1P9MA 1H8LA 2C8NA 4JZJC 4EDWL 2ORBH 1S9WA 3LH2L 2CMRL 5C0EA 1OQOA 3L3HB 2KZ1B 4QYOA 3UTQB 2WKOF 4IRJA 3CLEL 3C6EA 4KI5E 3TA4D 2XWBB 2XWTA 1XEDA 2CH8A 5DHYA 2X70B 1Y6KR 3PGDA 1BG1A 4FFZL 4HQQH 1N64H 2OMNA 1WAAF 3QCTL 2B7DT 1L0XA 3T8XA 5GRJL 1VCAA 1CURA 2YEZB 4H13C 3EADA 3BAKA 1XGTB 5DD6A 3TO2B 5AVVB 4IU2A 5KYYA 4FFVD 3ZDZB 1CQKA 2OPCA 4YSQA 4JCWA 4KY2A 4GEJA 5T1MB 3PNWB 5D6DA 5FYLL 3CFQA 4CBZA 2MQGA 5MEOA 3IF1B 2BSDA 4WV1A 3GS7A 1A5FH 5D1XD 1CLOL 4JJ5A 4PJGA 4H8VA 4ZW3A 4YLQT 4MGXA 1Q1PA 3QS3A 1IUZA 4W70A 4QRRE 3L4XA 3HS0B 5TH2A 4B53A 3EJZD 1G9MC 3MLUH 4NFBA 3V4PB 5DQDL 1LO5B 4GKZB 4JVPA 1EK3A 5HY9A 4X5XB 4UILH 4JFDA 1KIUA 3TZVD 1INEH 1RURL 1M42A 1YMME 2AEQL 4XB3A 2BLFA 4ANVA 3SKNB 4YDJB 3FO9B 5CD5D 2GUOB 3GKWH 3QUXD 1X5HA 3ZHKA 4WWKB 3ZE1E 4GQQA 4IKNA 1FGVH 2OJZL 1TO4A 4OD2B 5EF2A 4QRUB 1S7XB 4FF9A 4UUJA 1P7QB 5CIPA 4WCYL 3OXRA 4AW7A 3ZKXB 4NXKA 1IBGH 4M1DH 2FATH 1KUMA 2E74C 3RGVD 4L29B 2V9QA 1VA9A 3W39B 3HNVH 2EVGA 3SJVA 4CSPA 5DFAA 1Q94A 5AVZB 1IIIA 1QRNE 2D2OA 1NWPA 2XZAL 3BKCL 3BZFB 3QO0A 4OZIF 4NN5C 5LNDA 1OSEA 1U93B 5J6HA 4IMLA 3GRWL 5GGTL 2NX5E 5CCHE 2Y23A 2I32A 5DUBA 2Q8BH 5E8PB 4PG2C 1SY6L 3ROLB 3DETD 3ZGIA 3K72A 1ACXA 1MRCH 4X6FA 1IGIL 2OSWA 5FA3B 2RALA 5JIQA 4LOUC 3BN3B 4UOJA 1B0RA 3VFWB 1MDTA 1JTTA 5TE6L 3Q2LA 4LSQH 4FFYL 1TMQA 3O8XD 3EJYC 4UQ3B 1EGJL 4N0UE 1E3FA 3C5ZC 2RAMA 5ELIA 4GUOA 3KPRA 4HWZB 4LCIH 3UMTA 3KLQA 4MQ7A 3VG9C 4PP2B 1NUFA 1VCBC 5CZVL 4JFTA 3SKJH 2O1AA 2V4LA 4M93B 4E41E 4NPYB 5TJWK 3O6MH 1A0QH 1IQDB 4L0ZA 4MSWA 1C12A 1KCLA 4PJIB 4PS4H 4PY7A 3WYRA 4G80B 1OARL 1IARB 1U8JB 2XUWA 1X44A 3VXMA 3HN3A 4Q7DA 5ABAA 3MJ8B 2ENJA 2HJKA 4J28A 3ULVH 4K9EC 2AV7A 2CJUH 2UVFA 3Q8AA 2B5IB 4Z95L 4HJTA 5D7SH 3Q1SL 1AAJA 2YGPA 1QASA 3F62A 3VM7A 3H3PH 1J5HA 3GSNA 4X9YA 3MLSH 4WI0B 1VACA 5DQ9A 1KXTB 2NUPA 4ZOAA 1F1AA 5CMAA 3X12B 3VE0B 2VAAB 5MEQA 4K3DH 4UOW0 3BX7C 4G7VH 4RGOL 3ZRFC 3RFZA 1JN6A 2CUAA 5F0JB 2GITB 5C9KA 2ROXA 2UX6A 2EABA 1PAZA 1IVLA 4BEIA 3KLKA 3MUUA 1OAKH 5IESH 1U2CA 1U8LB 4H8PA 5FCUL 4KVCH 1MPAH 1J9CT 2ITDB 1UD3A 4Q9QH 4D0BB 1JHLL 2BVOA 3LRHA 5KSUA 4CVUA 4JRXA 2X1QA 5B39B 3N55A 4I3SH 4U1MA 1NC2A 4XXWC 1YA5A 1PLGL 3D0VB 5F7AA 3BUPA 2RB8A 4UIKL 4EUPH 2E7MA 5A2FA 2EUVA 4AL8C 1BEYH 4PJAF 3ULVE 1MFDH 2YEQA 5B38G 4MXVE 1H3WM 4QXUL 4R7NA 2DDQL 4JM2F 5KYXA 2H26B 1ZK9A 3ARBD 4WFHD 4K3EH 1RUAL 1DBMH 4HJJL 3HI5L 4O51A 3W38A 3DTXB 5JOPD 1BOGB 5K9KB 2NY2D 3CN2A 4UBDC 1OP3H 3OKKA 2FO1A 3DXAE 1PLCA 1QHOA 1EXHA 1JL8A 4K94L 3EJRA 1GYVA 3HUJE 1FN4B 3G5YB 3V6OE 1YQVH 4WJ5B 1MFEH 2VXQH 2C34A 3RG1C 1BFTA 5C0CD 4R7DB 2PP7A 3W2DH 5CBAB 3B6SB 1KJ3H 2AQNA 1WFTA 3W5NA 1GTNA 2OZNA 1UACH 4M8RA 3DUHA 5FLVA 3GMMA 2PXYC 2R9HC 4FL4C 4HUKB 3ECQA 4XMKL 4EI5B 1A6VL 3KLHC 5E8NB 5CXPA 1QPKA 1PDKA 3HZMB 3RWIA 4QOKB 5EEZA 1RULL 3CVHH 1GGCH 5H37H 1CFMA 3H2QA 2CLRB 1N18A 4X8JA 3VG0H 4N0RA 4QXTB 3RB5A 4ZXBA 3FAWA 3IS0X 5JXED 5DGRA 3MLTA 3N06B 5C2BH 3OAUL 3NIGF 4DPBX 4KNSA 3B37A 4WTZA 2W9EL 1WV7T 4GYBA 5LG1A 4QNPE 5J6GA 2C9XA 3CK0L 1WE5A 2B9BA 3G7TA 5E5MA 1KCRH 3CDFA 5IVZA 5LXGH 4MA1B 1CT8A 5ILTL 1HX0A 2NY1D 3GXUB 3WAJA 4BZ1L 1Q9LB 3T1FB 3C8HA 3O4LB 4UM8B 1AQDB 3ESUF 3GSOB 2VN6A 2NY0B 2ZXCA 4IEFA 4KROB 2MWCA 4XOEA 4FN0A 3EDFA 5JLZA 1FC2D 3BVVA 1CGSH 5B3SB 3QXDB 1OSPH 4PU2A 3BH9A 1TFPA 1AGFA 4N9OB 3OC8A 4NKQB 1DFBL 1NIBA 3EYSH 1Q72H 3FJTA 5JTWA 2IGFL 3Q1EA 4TLKA 2EC8A 3VFUA 4R5VA 2BY3A 4PJFE 3BRFA 4CRPA 4BE5A 5E6YA 4H4NA 3FB6A 5BUAA 4KX7A 1QEWB 1GSMA 4X7CC 5EZLB 1E2WA 5F7EH 1RHHA 2LFEA 1QZ1A 4M5ZL 1QW8A 3RY6A 2H8PB 1P1VA 3V4VB 1B6DA 1WJ3A 4CVZA 5MHSD 3DX4A 3SBQA 4LHUD 4QUOA 1FJ1B 2LTQB 5A43C 1GOFA 1MI5D 4PGJA 3DSFH 1HHKB 4KZ0A 2Y7OA 3O6LL 4IGBB 5ANMA 5ENWA 3STLA 4M48L 2BM3A 1U91A 5CF3A 1ZPUA 1PX8A 3W56A 4TOYL 4PW9A 1E4KC 3T4YA 1BJ8A 4PJEE 4D8OA 2KI6A 4EZLA 2FR4A 1FL5A 3LQAL 3OX8A 4KRPD 3DUSA 5CKGA 4LNRB 5DHVH 3ZOAA 4YPGA 4ZAKD 4X6DA 4PJ9B 1YDPB 3RURA 3KCPA 2PN5A 2QPDB 3SE4C 4JY5L 4PN6A 4HFWB 5T5NF 1CFNA 4PGEA 4HJUA 3QXWA 3SKUD 4HWBH 1LP9A 2J88H 1XCTB 3I6KB 5JIMA 1AD9B 5AYTA 3VW3H 2FSEA 4XCYB 4XE0A 5D4JA 1RI8A 5EO0B 1D5MB 4NIKB 3RVVC 2BOBB 1J05B 1XMWA 2WO4A 5C07B 3FB8A 5TF1H 5F9AC 2J5LB 3GXPA 4OZ4A 3V52L 1MHHB 2KZBA 3PL6A 3E6HB 4NZUH 1YJDC 2E7DA 4Q6IB 4J7RA 1NPJA 3LIZH 3RUGA 4BDVA 3TV3L 4J4PC 5E2WL 4Z3IA 3T2OA 1EZUA 4MJJA 2R23B 4P2CG 5JNYB 3QAQA 4YHYC 1V3KA 4JMXA 1WIUA 4KJWC 1RK7A 5CILH 4G70B 1INQB 4JG0H 1UD2A 3E3QC 3H0TA 5LAXA 3PDOB 4OQ1A 4LLWA 4Y2OA 1LDPL 2XXCB 2A5UA 5FUZL 2P43B 1RZIA 3U0TA 1C16B 1A7NH 5E6RB 4EDXB 2F53E 3ZLQC 3CFDB 5DZLA 4M3HA 4YFLF 4UTAH 3QZOA 1OM9A 4KY1H 4RX4D 4ZDHA 4ZMAT 2MTAA 5E1AA 4PD4J 4M5TA 1M3IA 3F58L 2FDBP 2VM4A 3L9BA 3H42L 4PJHE 2NW2B 4GG6B 4DUWA 5EBMA 1MWAB 1ML0A 3QORC 4G9DB 1EAPB 4YWGL 3CTTA 5C0BB 2ESVE 3ELAT 4FKKA 3UTTB 4A7GA 3K0WA 3QPXH 3FQNB 2OYPA 5KSBE 5KVGL 5KW9H 4GSXA 4QHKI 2AJXL 3TYFB 3K2MC 1UKQA 2WUCH 3QA3B 4JREB 4PGCA 5AAMA 1W2KT 3F7PC 4JHBA 4YHIA 5DC4B 1NCDL 2IAMC 2OYMA 4PYGA 3U48A 5IHZA 5HGDA 3UZVB 3FXIC 5JOFA 3AC0A 3CVDA 4BE6A 1G7QB 1OPGL 2DEXX 4UI2A 2OMZB 4FX5A 3ULUC 1E8WA 2CCVA 3PQYB 2DAVA 4MZRA 4WWKD 1N8ZA 1I3UA 4ZS6C 1GHFL 3QWOA 1CUOA 5BO0D 5E4EB 1BD2B 1PX3A 3WL9B 1YY9D 4M1GH 1MRFH 1P7QD 4D9RD 4G5ZH 3FB7B 4PJCB 1BVOA 2J1XA 2WINA 3OKDB 5KSAC 5C6PB 1AD0A 2UXTA 4TN9A 3LZFH 3LIUA 3W11C 5EU6D 2E0PA 3DRQB 3PWPB 4F8QA 1D7CA 3OHMB 2KQNA 5GSVB 4X7FC 4FKHA 5F9JA 2ADYA 3SKOB 3SZKC 1IE5A 2BNRA 4WI6A 1UJ3C 1NCWL 5DHXB 3TNNA 4NNPL 5L6YH 2XQ0A 1SXSA 5ESVB 4GLRI 2D0HA 4JPIB 4M6ML 5FOJA 4X9BA 2HYMA 1XGPB 4IDJL 1AQ8A 1U8NA 1EJOH 1HEZB 4MX7B 3M6DA 4MBRA 1NFIA 2DQFA 3UIYA 5L9DL 3SPCA 3WNLA 1E9QA 3BH8B 5IMKA 3NACH 3KWWA 3CDCA 1CD0A 1N4XH 4Y5YA 2VLRB 2XBTA 2BNQB 5F6IB 2P28B 3WJJC 2E7CA 3DVIA 1OB1A 4X4XB 2YAMA 3CDGA 1DVUA 1I1AB 1GAFH 2YD1A 3T77A 3PABB 1C5BL 4NYLA 5L88L 2YIHA 1SBBA 4XB7A 1OCRB 1BVLA 2GKIA 4YSSA 4JHUA 4APQA 3NFNA 3VU1A 3ULUF 3SE9L 1H6EA 1VHPA 5F9OL 4XCEA 4BXVA 2EIMB 3BRDA 4X7EC 4N1HB 1P4IH 3HC3L 4IRJC 1U8HB 3WG7B 5J7CC 5EC2A 1HL5A 2VM3A 4ZMOA 4HWEL 2HXAA 5H2BA 3E7JA 4JW3A 1YEGH 4RWYH 1ONQA 2X87A 2ZXQA 4HWNA 4ZO7A 3TJEL 1GXEA 1IKFH 3PWNA 5DC2A 1M6UA 4GG8B 1ZJBA 4TUJA 3W3BA 3D51A 5B4MD 4QRAA 3PE9A 3OF6D 1VPOL 4NCDA 5BUGA 1J0KA 5BPPA 5DA0B 4X98A 3S5LB 2VDNH 3OG6B 4YUEL 1OB0A 5CU9A 4YVNA 4LZKA 1ZSDA 3BQVA 2A9NL 4LKXA 5D6DC 1X5LA 4DEUA 3AB0B 3T08A 3AXLA 4GS7B 4WUUE 4C57C 3ZZSA 3VFPA 4WV1C 3FQUB 5F7LB 5HDQH 3U6RA 3U36B 5CD3A 2YA0A 5E6IA 3MNDA 2AXHA 3ZKQD 2A74A 3SDYH 1JWMA 4LKCA 1E27B 3WY1A 1ZWIB 5CR8A 3DX6A 1N5YH 1S9VB 2NLJA 3DSNB 3QJTB 3GLAA 5F9WC 1IIKA 1C5DB 4GY4A 3UBHA 4UZSA 3H2WA 1KCUH 3F7VA 4K73A 3T2NL 1AMYA 2VR4A 2I26N 4KMTH 4F2MB 5FFLA 4P5SA 2ENSA 2WQUA 1PJWA 1ZANH 4HUVA 3EYVA 3KBPA 1DE4B 1NCJA 4ODHL 4J3VA 4EDWH 2X1XR 2N7BA 5KTEL 2CMRH 4QTHA 3TH4T 3LQZA 5ACZA 5E1GA 4OD3L 2NXZB 5I1AB 4AUUA 4KZDH 3K71A 3QEGH 3EUUA 2ISDA 2BZDA 3LXCA 4L3EB 4GSDL 1A9EA 5L2KE 1UOVA 2HRPL 4NQEB 1JZ5A 3EFOA 3QNXA 3L2NA 2E4FA 5IQNA 4P57A 2MHAB 1ZT1A 2FH6A 3C12A 4N2MA 1A3RL 4O2EA 2IH3A 4PJDB 3F83A 1EXUB 2GJ6B 3L4WA 4HBQA 4LPVA 4PD4K 3QCTH 4AZ8B 1R5WA 3GPEA 2IDTA 1LK3L 2G0KA 2VT0A 4R5TA 2ZKWA 3L1GA 4XXCC 2HVBA 3PIQA 3MOAL 2Y6SC 1SGKA 2DM2A 1G7MA 3NCCB 3PP3H 3CFCH 4TSCL 5SWQA 4ISVA 4EI5D 1DCLA 5FYLH 3QDGE 2KPWA 3RJOA 4QOKD 3OAZK 2JCCE 1E6JH 4L4TE 1CLOH 2IQAA 1DHKA 1I4FB 4PTTB 4CC4A 1EHLL 5C0AB 4XPTL 3FTZA 4BWTA 3DYPA 1BFOB 1SYSA 5EUOA 1A6AA 2AABL 2IAAC 2XWJB 3NPZB 4LHUG 5DQDH 2BW5A 4X2UA 3VQLA 2YJLA 1ZK5A 3TH2T 1E43A 1UB6B 3PWUB 4W9ZA 1J86A 3KEDA 1DN2A 3TM6A 2AEQH 1V3JA 2W0LA 4ESKA 1E4WL 2OSYA 3P9MB 5I24A 4ZFZA 4XP9L 2EZ0D 3JWOC 4FTVB 1PKQB 4GI8A 4YEEA 5KBMA 3MRNB 3HHMA 4QXWA 5DJCB 2OR8A 1XH3B 2Y9RT 4MNQB 4V1DE 3O4LD 2X6AA 1J8HB 2XYBA 2F54E 4WCYH 5E03A 1FVEA 3IJSA 1B6UA 4KROD 1BQHG 3QW9A 3C2SA 1MN4A 4P2RE 4ODTL 4M7JL 2B4CL 5JYLA 1RPQA 2MCG1 4AENA 5C71A 1QWUA 4AEEA 5E2JA 1GPOL 4LRIA 5EBLA 2XSKA 2XZAH 4DP6X 1P5VA 3BKCH 4IM8A 3IDNB 1I8MA 4K71C 3N3EA 4BQCA 2KT6A 2K7QA 1UZ6F 3LCYA 1AQHA 3P9WB 1VERA 2CO7A 5DJ8A 3FUIA 2C5DC 4HIEB 3GRWH 5GGTH 3IXTA 3IRPX 1BZ7B 2NW3B 1HINL 2DEYX 3BKJL 3QJHB 2EO7A 4FFWD 1AO7E 4M8QA 3BZ4B 1O6SA 1CGXA 5C3LD 4BFOA 3MREB 2O5NA 1IC1A 1QSVA 3OZ9L 3G5VB 5HGAA 1NDMB 3R0MA 2WWMD 3IDMA 1EFXB 2AQ3A 4LCVA 1B0GA 2CDFB 4IGBD 1UXSB 1M57B 4LDLB 5G4MA 5PCYA 4QTIL 4NWTL 2IDFA 4Y5XA 1A7BA 5GZND 2CIKA 5TE6H 1FNAA 4FFYH 3DX8A 1EGJH 3MCG1 4JFEB 4NQCB 1DBKL 4JO8A 5CZVH 1XGZA 4PJ9D 3C6LA 2W59A 2XXFA 5D1QC 4RCAA 4DZ8B 3HB3C 3MNWB 4MJ6B 4AEIH 5EZIL 1ORQB 4KKZA 2BVPA 2P8MA 4KK8C 1M05B 1ZLVK 4DO4A 1P2CB 4TNVF 2FO4B 1OARH 4OJEH 5DO2C 4MJ4A 5F7HA 1ETJA 2HFFA 4I18B 2WY3B 1X5ZA 1MFCL 2YAEA 4MKMA 4XO5A 4RFEB 2L7JA 2M2DA 3O9WB 3S2AA 2F8XC 5I5RA 2DQMA 2FEEL 3QC6X 3L48A 4OF3A 1JWUA 2F9BT 2FJGA 2J1ZA 3Q1SH 3RIFK 4L0PB 5DC0A 1ZPLA 3D2UB 1OQXA 2HT3D 3GM0A 1ET5A 2BVUA 3EHBC 4N1CA 4WHDA 4U1KB 2A0LD 2FBJL 4FMKA 5FWRA 5E8EB 1K8DA 4N6RB 3CPLB 4Z7VB 1YEIL 5B21A 3JWDL 2ZYSA 2XVBA 3LKSA 3VFSB 1AZVA 4ZXBC 4N2IA 3ETBJ 3H2PA 5I6LA 1JERA 4LEXL 3DX7B 2ED7A 3UYPB 2I24N 2K4WA 2ADGA 4YHNB 3SQOL 3O6FA 2CO6B 3BP7B 5DRWB 4MMYB 4NO2A 3S0PA 2XOTA 2J1KA 1JHLH 4HGMA 4QRQA 4AQ8A 5DD1L 5IW6A 1BFVL 4ZSOE 4M3KB 3TONA 2YQ2A 5DWUH 2Z31A 4ZFOL 3CLFL 4Z0XA 1OTTD 3NTCL 1PLGH 4B7LA 4ETQA 3UTTD 4MYPA 4UIKH 1U8MA 3ECBB 5C0BD 5A2LH 1IBYA 4PJXF 5CLZA 2WZPD 1YPZE 2HN7B 4QXUH 4PG9B 1JV2B 3B9KA 3TT1L 4A7VA 5IJCC 2DDQH 2X4PA 3NCMA 3W0WE 5DEZA 4LLYA 5AZEL 4NAJA 2BMKB 1M7IA 1RUAH 2UWEB 3MV01 4GJTB 4HJJH 5MEPA 3HI5H 3LRKA 4JDVA 2CUMA 1XXFC 4WFGD 3GI8L 3TIDA 3QIBC 3PQYD 4HZLB 3NSYA 1ZE3H 5D7IB 3MLYH 4WHYG 2HCZX 4K7PX 1FDLL 1QG3A 4Y1TA 3WKQA 3BPLC 2Y36L 5IROA 4LIQH 3T0XA 1BD2D 4MXQC 1T5KA 3BD3A 2NOYA 3HE7A 3KPLA 2ZX6A 3U4BL 4QF1A 1EO8L 1LWHA 2BK8A 1HH9B 3RY6C 2OMUA 4XI5D 3DTDA 2WOBA 3ZTJG 3BD5A 1A6VH 3LEYL 3D69B 4DP1X 3PWPD 4N9GA 3QJSB 1IL1A 4NEHB 5DURB 2IOMA 2UXFA 1FVDA 3OQRA 3BFWA 1H19A 4H20L 5IKCB 4NQVB 5I73C 3D4YA 4LF3B 3JVFC 1WRFA 2WTRA 3LS5H 4BD4A 4UZUA 1NGZB 1HHHB 3OAUH 2XTJE 2WNWA 4KKBD 2DLIA 5FYJL 1ZGLP 2FJFA 3BSZA 3T3PB 1U8QA 2XZCL 1BJ1H 3JZ7A 4GRWE 3WIHA 3US0A 1GGBL 5IB1B 3PPSA 2F1AA 2W88A 3KDPB 3IDUA 1DANU 2QQNL 3FUEA 4IKJA 4ZMWA 1NBZA 3L3KA 4JUTA 1E90A 1TTRA 1BVNT 1HQRA 4LIQE 2VLRD 4K7FA 2BNQD 5GGUA 4XCNA 3U1SL 4FNQA 1XZWA 3VSQA 3ZTJH 5BRZE 4RRPG 2H2SC 1I1AD 2QSCL 2RCSL 1Z0NA 1I31A 2BY1A 3BP6B 4N90E 4NO5A 5IT2L 5F1IB 3RRQA 5JPNB 3PL6C 1OALA 4HOZA 3ESNA 2XX1A 3D18B 4OJDH 5J8OA 1JV5A 1HCYA 1RZQA 2QHRL 3IE4A 1KLFB 2IGFH 1O6TA 4OGYL 1AGBA 2DMBA 4BGLA 1TZ8A 3LOWA 1JMZA 4PJ6A 2FB4L 2ROYA 2E9JA 3RVUC 4EBQL 3HVDA 2J72A 3AS0A 1KF9B 4M5ZH 3RX8A 1F4WL 1DQKA 4I3GA 3ZYIA 3DX3A 1MIEH 4GI9A 1UZ8B 3QCVL 4PREA 5BV7H 3BHBA 1UM6L 4LSRH 1A3LL 3QZPA 5F96H 4RETB 4E9SA 4XRCB 2IOIA 3O6LH 3ZE2E 1TVHB 4OZFH 4Y16B 3T6QC 4RMTA 1BIIA 3QJRB 4ODWB 4TOYH 5EU3B 3VI3B 5HYSG 1IQWH 2JLPA 3U7WH 4BCYA 1E4XI 3LQAH 3VX1A 3RFRA 2E4TA 2XX0A 1KYAA 3EYOA 4H40A 5AAMC 2FIKA 4JPQA 4RZCA 1LP9F 3KNBA 3V6FA 1HL4A 4IBQA 1BVKA 5K9JL 5GRXG 4NZTL 5EUKA 4AJ0A 5E99L 4HSCX 4JKLA 5DRZB 4B5EA 2IADA 3WV0A 1XR8A 1XR9A 2JKLA 3M7FB 2FGZA 3PGCB 5FDWB 1MCHA 1X5KA 2CNZA 2HUEA 2MTPA 2X2IA 3MGOB 3ZU8A 4EO5A 5GS0C 1GGIH 3SGEI 4GAYA 5HHXL 3QEHB 2PPEA 4NAQA 1IEBA 3CBJB 4WNSA 2K3TA 4JFYB 1NMAL 5CNHA 4GW4B 3RB7A 3RVWD 3GNMH 2L7EA 3EGSB 1IC4H 3FPXA 3TV3H 2NXZD 3QQ4A 5EIVA 1MFMA 4LDEB 3CFTA 3CNKA 5E2WH 2YA2A 1OAUL 1N5AA 4L3ED 4WKZA 4JE4B 4QRSA 1A6TB 1H5BC 4NQED 4A6YL 2CR3A 4KJPD 3MXVL 2ZONA 5H35A 5DDHA 4K3JL 4F33A 4MWFB 2GJ6D 5FUZH 2GK2A 2H3NB 1UQSB 3R19A 2CG9X 1C8QA 2FO8A 3MV8E 4PBDA 2EKSB 2DQCL 2GCYB 2ZP8A 1TLKA 4UIMB 3WFEH 5AZUA 1T1XB 1NFDA 1QVOB 1HCFX 4AQ1A 1J7VR 3VFVA 3B7RL 3ASOB 1F3DJ 2EIZB 2Q87A 1EJ8A 1KGIA 3W82A 4XPFL 3GMPB 4MS8D 1MAML 3MFFB 1LMIA 3K6IA 3GHEL 2D7QA 1YY8A 5K69A 2XY2A 4ZUVA 3RNQA 3GO1L 4PHZA 3BAWA 4YWGH 4FFTA 4IJTA 1URLA 1K8IB 1S7QA 4Y5YC 1R3HB 1UATA 2DYSB 3WDIA 1MW3A 3ISRA 5HJBA 1XL6A 5C0AD 2AJXH 2VO8A 5MENA 5EDXA 1BYPA 1KXVA 1NCDH 1E5AA 3D85A 4OLUL 3L45A 4N5EC 3CSYA 2CO2A 1HCVA 3S4SB 3BGAA 3TEXA 4APQC 2ITCB 1QEXA 1OPGH 3GXFA 3UAFA 3EJPA 4XNAA 3CZFA 3RTQA 5JDSA 4TQIA 5GRVL 3D3VA 1TZOA 2HB0A 2XN9E 4R2GB 4ZTPL 5HHVH 1MVFA 4FTVD 1GHFH 3OKLB 4L8DB 5FM8A 5AW0B 1MQ8A 3VSVA 7FABH 1QSZA 4N3TA 4MNQD 4FDWA 3MN8A 1HYSC 1J8HD 2WSPA 4BFRA 1UD4A 3DC0A 3HPLB 3STBA 1EEYB 4NRXA 5BQDA 1URZA 3ARPA 3INOA 3NCXA 5I0XA 1EANA 1ES0B 3N0PB 4NKIL 1G7JA 4XHJD 1L9SA 4ZUWA 5FK9A 4XMVA 3TBCA 2EO9A 3KXFE 1C5CH 1XWVA 4UANA 3I02B 4N87A 4NO3A 3BUQA 3OLDA 3HCVB 4LQ1A 2R69A 4D0CA 1RH8A 4U31A 4Z7UA 5F7KC 2NR6A 3HG1A 1TPXB 2RTTA 1BBJA 4NNPH 5ESQB 4LP4A 3ZE0E 1J8KA 5F89B 2MQ3A 2P5PA 4M6MH 4Y19B 5FC9A 2BSRB 2EJ1A 2A74C 3TVMB 1KGJA 1NPNA 5EFIB 4XXDB 1S8DB 2QL1A 2EE0A 4J3TA 4Q9RH 3KYOB 3S88H 5B22A 3G6JE 3FB5A 5L9DH 1PZ2A 1H3VA 1MCJA 1ZLWH 4AJWA 1EFXD 3APCA 3R1GH 3TCLA 2CCWA 1NBCA 4K3HA 3SHSA 3F84A 4OZHF 2H1PL 4BH8B 1E2VA 1C5BH 4G8GE 3C87A 2ZUXA 3TF7C 4FQLH 2WB1A 3LD8B 5I1DA 4F93B 2X44D 2BC4B 3DWTA 4JFED 4NQCD 3SE9H 2ZG3A 3WI9A 3TASA 3RNKA 3GSRA 3AT8A 3HC3H 4RA3A 1JNHA 2WLLA 1RD6A 1N10A 4JFHD 4Z7NE 1R5VB 2VR5A 1SDDA 2AQPA 5A2JH 3OR6A 2IWEA 1NBQA 2APSA 3O9WD 4KRLB 4XBPA 1LE5A 4G9FA 4GBXB 5IVNA 5IB3B 3D39E 5J3HC 4ZG1A 3QNYB 5LCVL 3KZ8A 2CALA 2BFGA 4JG5A 3L1OL 4LLVB 4WO0A 4YUEH 2VDOL 5HYJE 3D2UD 2DM7A 3K81A 3QNZA 2AAVA 2A9NH 4YQXL 4K2UL 4X4KA 1M7DA 2C4FT 3MV7A 5CGTA 3EJQA 4NFCA 3VJ6A 1EEQA 4WI2A 4CC4C 1OAQL 2ZUVA 3RY5A 3BFOA 3ZKMC 1WYJA 3EYUH 5C09E 5BZDA 2QQKL 3WLWC 1GKOA 2GK0A 4NLAA 4MA8L 1D6EB 5J13C 2OAAA 1YN7A 2DQIL 4F5CA 3FCTB 4C8XA 2WQXA 3FTWA 4XBGA 4GXFA 3T8XB 4JE0A 1V3MA 4MLSA 2L0DA 3T2NH 4GO9A 1HOCA 2X4UA 2Z0BA 4PJ7B 1ZVYA 2NZ1A 5DD6B 3MYZA 2CRMA 1G4RA 2WLNA 5AYQA 4BINA 1D9KB 1LO2H 3ULSA 5F6HI 5DXWA 5B7EA 3P0YH 4ZMXA 4ZQTA 4ODHH 1HWGB 4OD3H 4AMWA 5F8RC 4GAJH 2ZSWB 5EMYA 2OW6A 4NT6A 1F4HA 3IU4L 4OFKA 2JB6B 3KYKH 4BHUA 2EDMA 3LEVL 3WNIA 3IMSA 1NAML 4JCLA 1KT2B 3M17A 3T5WA 3EAKA 1ZLUK 1YC7A 4KVPA 1FZKA 3ZTNL 4S11A 5F7WC 4JFDB 4NPKA 4LRIC 1RMFL 3F6JA 2I07A 4L8BA 3MA7A 5KJ4A 2A77H 1VJSA 4FCHA 3BZEA 3MOAH 4XO3A 3VRJA 2JK5A 4HPOL 4NS0A 4OLZH 5KANI 3B5TA 1MWOA 5E4IA 3MX0A 2ZOLB 4TSCH 1X9QA 1NINA 3STZA 2X6UA 3V5HA 3JV5A 1UC6A 4JJOA 2CBTA 2K8MA 3OXRB 3QGVA 4N0YH 5DURD 4AXWB 4QRRA 2GSMB 1SUHA 3MYJA 3GZPA 4XPTH 4BIKA 4QO1A 3K0YA 3FFOA 4H2CA 2AABH 3EXLA 1GS8A 3NIFB 1SMAA 1YMMA 3SJVB 1FFRA 1UD8A 3IVKB 2BXZA 5GRZA 3SO3B 5DJXA 1KJ2B 5TE7L 2IC2A 4G1MA 1EX0A 2YD5A 3RJDA 1S3KL 3QO0B 4TRPL 1E4WH 1DSYA 3NZUA 4QIRA 3NIDE 5ISZB 5TGBB 4XP9H 4WLCA 4N8CL 4ZJ9A 1SHXA 4Y4HA 4E9VA 5CLTA 2ADJA 1CF8H 4PS8A 3EJSA 2VQTA 1KIRA 2OYKA 5CS7A 2JI3A 1U95B 1OGAB 5L7XL 3BKYL 4QY8A 4JPVL 1T0OA 4U6YB 4N0FA 4R4BA 1XXDC 2EUXA 4M7JH 2B4CH 3GHBL 1AIFA 4H1LB 3UO1L 1QRNA 5IVXE 3OPZH 3ARDA 4MQXC 3FN3A 4AE1A 4AIEA 4NENB 3LHPL 3MJ6A 2JQMA 3DKHA 4YBLC 3VFVB 3BLBA 4MQ7B 4N85A 4EEEA 2NX5A 4HALA 5IBLD 1OP3K 3BI9X 1A3QA 4JKMA 4ALAH 2E7HA 5LBSL 1FL3B 1DVSA 3OD3A 1JYNA 1H8SA 4Y8AA 3WFHB 1U3JA 4LPCA 1C12B 3QHZH 4MSWB 1HINH 2NY5L 3BKJH 4LBEA 3BSHA 4OF0A 4PY7B 5LBGA 5DR5L 3O6FC 2WPGA 2XQYA 2APFA 2VDPL 4XR8C 5FKAB 2EVFA 1DR9A 5I66B 1IFHH 1RZFH 3C8KA 2DICA 4JVUA 3WJLA 4CGTA 1KTLB 1YEKL 1BVZA 4AMXA 5CWSB 3TCXA 3IGUA 4Y16D 3KPMA 2Z31C 3J07A 4QTIH 2R56H 2CKBL 4NWTH 4YFEA 1A14L 2ZOOA 4XNUL 4WNJA 4N0UA 5IQ7L 5FF6B 5DZOA 4TXVB 3VDCA 3BWUC 4S0TD 1A7RL 1S7TA 5FUCE 3NH7L 4E41A 1Q0YL 1DBKH 3B9KC 5CMAB 5I71B 2VQUA 5L8KB 5MEQB 2CKNA 3RFZB 2I25N 1G0YR 4YDMA 3QQ9C 1JN6B 4YDVA 5AYUL 5EZIH 2A73B 1CN4A 3T65B 3ZR6A 1MCPL 1XBDA 3CVBA 2NNAA 1MJ7H 5BRPA 1UEMA 3KDMB 4MMXA 2NCMA 4N2GA 43CAA 5DUML 3ORJA 4JFVA 2YPLE 1N8OE 1QI4A 1T21A 3VH8B 2Y3AA 2BVOB 1MIMH 3PV7A 4A63A 4F1SA 4NPJA 1G9NC 2R0LL 3NABL 5IROC 5IHWA 4G43B 3GIVA 1FBIH 4PCTA 2QHLA 1PD1A 2G75A 4U1MB 3SN6N 1KV3A 2QR0A 1NC2B 3HE7C 5IHBA 2CK0L 5G5DB 1OTSC 2K78A 5F1NB 3TJHD 2NTFB 3M86A 2AHIA 4TVPE 5I1LB 5C0JA 5I1GL 2B16A 5CHNB 5KYXB 1YEIH 3DRTB 3L5WA 4WK0B 3HE6B 5I9QC 3WS6A 4Z7OF 4DKFL 2Z4QA 3HAEH 1P6WA 4LAJH 4LEXH 1DBAL 4O51B 3VACA 1KYUA 5FO7A 3WFDL 3SQOH 1A1NA 4AV5A 4PRIB 1E5UI 4KKAC 2Q76A 3REWA 2X3AA 2ZTBA 3K74B 5DD1H 1NH6A 2V5TA 1S7SA 4YHZL 1BFVH 1I8IB 3TBSB 4H8QA 1VZHA 4U1GC 3WDHA 4AGQA 4S10A 5IIEA 3FUJA 3CLFH 5DJ0B 3NTCH 3P3RA 1UHVA 2X4QA 3DV4B 3BWUF 1TMCB 2YGOA 1BQUA 3OSVA 1KYOJ 2XTSA 1AFVH 1H0DA 4F9PA 2EDRA 1E65A 1NA8A 3NCBB 1GH7A 1FAKT 5I1EL 4J3WA 3QFJB 2EDYA 1PDKB 3RZWA 4KUCD 5CO1A 3FF8A 4KJWD 5D7JA 2BHYA 4PJ8A 4I1NB 3KVDD 1HVXA 5AZEH 3BEVA 4F7PA 3DXAA 3BUYA 3IJYB 3MXWL 3C8DA 3LZQA 3VFNA 3GI8H 3HUJA 1K2DA 2OTWB 2PPDA 3V6OA 5HHQB 3QO1A 1DQJA 5AD0A 4UM9A 3FUDA 4HEPG 1DN0B 4HT1L 1QFPA 1T20A 1RJYA 2XWXA 4R2GD 2I85A 3GF8A 2H47C 5TQ0L 3S6CA 5J6GB 3IGAB 2Y36H 3RL2A 3BLKA 3AGWA 4M7ZB 2P45B 5E5MB 3BEWB 4HLZG 5IVZB 2WIIA 3V4PL 4DKTA 3UPRA 3QJFA 3P0GB 2IALA 3E2HB 1VFMA 2E9BA 1YYML 4EUPA 3LEYH 3FYIB 3MLZH 4H8WC 2FEJA 2IANE 4JDZA 4LLDB 5D9SA 3RWJA 3ZTCC 1LNUA 3MRJA 4IBZA 2DOCA 1BXAA 5CEZE 3CD4A 1XCQA 3BH9B 1U9KA 4TUUA 2ZWZA 2OJ1A 4GP5B 4JCMA 3POCA 2BIOA 1FZJB 4QAWA 4ANUA 4OZIE 2P8LA 4AG4L 2DW5A 2BXYA 2ZXWB 3OJDB 3VFUB 3KPPA 3VRIA 1PAMA 5FYJH 4Y19D 3KW7A 5D7LE 3WD5H 2H32B 2ERJC 3WUWG 3WTUA 3TVMD 5JR1H 2WV3A 4ZS6D 1GGBH 2Q3AA 3IDIA 4KXZH 2FQFA 4S2SB 2JJVA 3FB6B 4OD1L 3H9SE 3IU3A 1WA1X 5F9JB 1JPFB 1OAYL 3P4NA 1LO3L 3MNVA 4JDTL 4M7LL 4U05A 3L3OB 1V5JA 1EWHA 3D7PA 3U1SH 4LP5A 3X1BA 1BLNA 1F4YL 1JPEA 3QQDA 2BVTA 4NP4L 2YOCA 2QSCH 3G5WA 4K8RH 5IT2H 2NNRA 2UWEF 1YN6A 5HHOE 3CVHA 5ANMB 3RJQB 1AMXA 3STLB 2CHNA 2HX7A 2ZAIA 1U91B 1HI6B 5C0IB 1I1RA 4PJFA 5AB0A 1ROCA 2QHRH 2Q9OA 1L9MA 4JFQA 4K4KA 1I85A 4NLHA 2Y7QB 1FL5B 2FZ3A 4GO8A 4FJZA 2UZXA 1P1ZB 2FB4H 2YD4A 3O3BA 4X5PA 4X6DB 2NY4B 3KCPB 5E1IA 4EBQH 1PZDA 3TTYA 5FYJE 3GMRB 1CFNB 4PGEB 5TE4L 1D7FA 1C8PA 3ZSSA 2APTA 4Y2LA 4KUZH 4P4RB 4PWJA 1I3VA 2WVVA 5C8JA 4AYFB 4ONFL 2FSEB 3WMPA 2ZOTA 4GBXD 4QR7A 3QCVH 2L3BA 4KQ4H 3V0WH 4AQ1C 4FQIL 5EBGA 1UM6H 5BVPL 2GYSA 3GT6A 3OXSA 4WI7A 5DTFA 4MDIB 2JIXB 3FB8B 4B9IA 5I6XB 4L18A 1WDAA 2W94A 3E8UH 2PYEE 5GSRA 4PJEA 3F05A 1MCNA 4XN7A 4BDVB 2F7OA 4DESA 5A40E 5FFOA 4C4UA 4U3SB 2E7LA 1EFQA 1N67A 5IJDC 1SVZA 4DGVL 1GW0A 2X9ZA 4LVOB 5FUOL 1IC0A 3UABA 4R8WL 2FT8A 5K9JH 4R4FL 4LLWB 3OMNB 3FUMA 2AXGA 4XHQA 3WOVA 2P80A 3QRLA 3UXFA 5AKRA 4R4NC 3U0TB 3RTQC 2XJLA 3HHSA 3CN4A 1N6QL 2MJWA 3FQXA 2OX5A 2B1HL 1E2ZA 3CPUA 5HHXH 3K2KA 1V7NH 5BO1L 3KBHE 4ZDHB 1D9KD 3ZYOA 1ZHBA 4JGJA 4PJAE 1NKRA 1NMAH 4WTQA 5E1AB 5EEWA 2JLLA 2H7WA 3U7AA 4LMQE 4PSPA 4Y89A 2EDOA 3MUHL 4W9DC 3BPNC 4BH7A 1JPGB 4HZ1A 1JWSB 1OAUH 2ZUQB 3HJ0A 5IK3A 1OAZL 3V5KA 4M6OL 4A6YH 5J9PB 5DA4A 3L3IB 3NPSC 3SGKA 4G7YL 2JMRA 5DHVA 5HYIA 1UKSA 3ELQA 4GO6B 3LVTA 3TEWA 3GDCA 4K3JH 3HJEA 5EF0A 2F53A 3BFQG 4HW6A 4JFDD 5C9JA 5JOFB 1U2HA 3ZUNC 5CSBA 2DQCH 4JX0A 4HWBA 1MVUB 1IFGA 2NR6C 4U6HA 2RR3A 1UM5H 4LGPB 5D2LE 3A4AA 4L37A 3VAEA 3WELA 2VIRB 1KYOK 3NJIA 4P5TA 1G4MA 4PJHA 5I8CA 1AP2A 4P9HH 3N1QC 3T04D 4PV1C 4ATWA 3D0LA 1IFRA 2R83A 3DMMA 2ESVA 2XN1A 2B3IA 1G1OA 2ZCLL 1QSEE 4PR5A 5AVTB 4JPSA 4NCC2 1J87A 5KSBA 5AUMB 1T5XA 2FLRT 3GO1H 2WINB 1U92B 1SF5A 4ERSH 1AD0B 3FHQA 4M03A 4WJKB 1O5PA 5T5NG 1M6OA 3LB6C 4ZZKA 4KO7A 3NIGE 4OLUH 4C4KO 1Y0LA 3PAYA 2NPLX 4K5NA 2RA1A 3SJVD 5BXFB 1NBVL 2C4XA 2JCWA 4G5AA 5D5ME 2BNRB 5GGQL 4QLRA 4XBEL 2QV2A 3BH4A 3O4OC 3P4MB 4H26A 4X5WB 4TL5A 2KHAA 1KIPA 4X9HA 2WXFA 3H7LA 5ISZD 1SF3A 3BC9A 2Y6SD 3VFRB 2ZP9A 1SYVA 2H45A 4KKNA 4UTAA 2TRYA 1D6VL 2R2HB 4RAUA 5J6SA 1A6ZA 3KBFA 4K5MA 4TVSa 4NBZB 4G83A 1NFIB 4BFFA 5E70A 3HC4L 5LN4A 1E9QB 3CC5A 4J1UB 4X9GA 5B8CA 1OGAD 3FOMB 3KWWB 3NN8A 4NKIH 3WKNA 1D5ZB 4Y1AE 2R2CA 1BQRA 4EMZA 4UOZA 3CDGB 5C0GA 5JZ7C 3LKRA 2V3FA 1H15A 1BVLB 2IV8A 1W16A 3NFNB 4JFUA 2V9TA 4MJ5A 4APQB 3P2TA 4NC1C 3FT0A 2X3BA 4TSAL 4MASA 3QP3A 1PZBA 4HIJA 4G42A 5EC2B 3CH1A 1CTOA 4N3UA 4HX1A 3A4DA 4OU3A 1Q9OA 1XL4A 4LSUL 1ONQB 4HKZB 3IE9A 2R29L 3VUAA 4GPVA 4A7SA 1VAHA 4OCYL 2R4SL 2WLZA 2VXUL 1JGUL 4Y4KB 3FC8A 4JM0A 3HMWL 3T4AA 2KKQA 3EJJX 3QWRD 2Y1AA 5IBUB 4DCQB 1TZAA 3ATEA 3OR7B 5ECGA 4KU1A 1CI3M 4YDZA 1EMTH 4BFKA 1OE2A 2IWFA 2H1PH 2ODIA 2WWNA 5EF1A 3CZEA 1FNSL 4S1DD 1X4YA 1FHGA 1ZIAA 3UCQA 1KLGA 5I26A 1ZSDB 1EDHA 2J4WL 4LKXB 3V4VL 3MJ9L 3MLRL 3PUCA 1T2QH 3QH3A 4JY6A 4C83B 3RWFA 4F7TB 2Q5BA 4WW2A 3PHOB 3DA0A 5EOCL 3U6RB 3PRZA 4JY4A 1UWGL 3WCYA 5E6IB 2EDFA 1HEJC 3Q13A 2R1XB 1SN0A 2XVLA 4PFEA 3X11B 2CO3A 1BGXL 1ETZB 4ICXA 5EN2A 2VLLA 1ZMYA 4UMGA 3BQUA 4MD0B 3JYBA 1A4BA 3KH4A 4KRMB 1BJ1J 3KGSA 4Q14A 3F7VB 4O2CA 3PHQB 1J8RA 1HXMA 5LCVH 3OL2A 1NC2D 2IGLA 5HGBA 2VDOH 1XGYL 3C08H 4XNQB 1KC5H 2CUHA 2WLYA 1O75A 1L9NA 4RGNE 4WUUA 4HUVB 1MHPL 5ICXA 1WZKA 4YQXH 1Z32X 2QBWA 5ACZB 1CICC 4U1SB 4NQSA 4JO2L 4OR1A 4JPWH 1P4LA 1F6FB 3W37A 3HE6D 1OAQH 4KKQA 2Q7YB 2QQKH 3EFOB 1ACYL 3QNXB 2WQ8A 3KGRA 4K7PY 4MA8H 5H4YA 4U6XB 5A3IC 2E9WA 3X14B 2ZYHA 4O2EB 4PRID 4X50A 2A38A 5I76B 1T6WA 2D7TL 1R5WB 1LWJA 1LO0H 3MRQA 3LZNA 1A4JA 5GRWA 1WBYB 2DLFL 4E9WA 1H3TA 4P5MA 1QNZL 4IS6A 1CLYL 1VFAA 3IBOA 5KEZA 3BPOC 4JS7A 4NDMA 1MW2A 3DVNB 4Y4HC 5DK2A 4ABQA 5GRYA 3I74A 1T1YB 5D72L 3QFJD 3DYOA 5L2KA 3TIEB 4EI0A 3JV6B 2ZSVA 2EDTA 2IQAB 2E27L 5PAZA 1HSAB 3QS2A 3IU4H 1W8OA 3MLWL 3T2PA 3I9GL 3MOBL 4MNGE 3CWGA 3NEEA 1DQDL 5EUOB 2H2PD 5EPMB 3PV6A 1J1XH 1HDMA 3ESPA 3ARDC 3UPCA 1MWAL 4WJG3 2B59B 4YZWA 1DQQA 4PW3A 3SPJA 2G60L 4HKBB 3HIZA 2P48B 4UV7L 1FA4A 1QFOA 4XPAL 2X1OA 1S7UB 4HPOH 2Y1YA 2VR9A 4ZFZB 5ICYA 3QDGA 5C08B 2H0FA 3ARVA 1XH2A 2BHZA 1MELA 3TJPA 2AJUL 2JCCA 4CVXA 4L4TA 4PRAB 5I2IA 3UAAA 4NRZB 3VXSB 5FO2A 2DD8L 2AXJA 1MCIA 1ITCA 3O81A 2D73A 3BO8B 4LESA 3VYPA 1MCQA 1FVEB 1JGEA 3KWVA 3WJLC 5AL0A 3EYQC 1QI5A 5FM5M 1EUUA 2VABB 3FMGH 1L3WA 2GAZB 3GXTA 4ZMLA 4J3OF 5DMIL 4MMZA 2G3MA 5AW5B 3AMLA 4AENB 4JQVA 3V6BR 2C3XA 5J1AA 3FFCB 1I1CA 5TE7H 3VTTA 4CNIA 5JW4R 1S3KH 3C6SA 5AWNL 1MCEA 3A67L 4PJ7F 4HC1H 3QDJB 4MXQD 1J5DA 3DBSA 4TRPH 4U1NA 2J6EH 4DP9X 2CO7B 3UADA 3MRHB 4V1DA 3N9GL 4N8CH 5BMFH 3BIKA 5GZOA 4MMXC 2F54A 3GB7B 1MF2L 3KCWA 3QQXA 4M8QB 4NQUA 4R5XA 4O02B 4A2EA 4JG1L 5MI0C 2DMCA 3UPAA 4P2RA 2NZ9C 3LVEA 4WI3A 1RXLA 1YECL 2ENPA 1EZVX 5IUCA 5L7XH 3BKYH 5C0DA 3QUZB 2ITFA 4ZTEA 3RDTB 1DLFH 4UQIM 5C2UB 4B9FA 1MNUL 1XF5A 3TFKD 3ULUE 1R75A 4POZC 3UO1H 4Y5XB 5HDOA 2GJZA 2CIKB 5JO5A 4FQCL 4XVSH 2A9ML 4RMUA 1RJCA 1CR9L 3UTSB 4ONGL 5FA4B 1EZSA 3LHPH 5CEXB 1DJYA 3GD1C 5JPMB 1IGML 5C0CE 2DLGA 3C6LB 4L0YA 2NY4D 1RUQL 4TLUA 5LBSH 1AO7A 2D7NA 3WS6C 3SDXE 2AS5M 3WHE0 2P8MB 3NJMA 3QUKB 2NY5H 3W9DB 3ZBMA 3GHPA 3SCMA 3G5XB 1ADWA 5DR5H 1SDAB 1FYTE 5AOJA 5DWPA 4Y2DB 2WMPB 4L4VB 3P2BA 4XMTA 5I17B 1R4XA 4KKCD 4A2FA 4FNPA 5CFAA 1ADQL 1AHWC 4PLKC 3OAYK 5I19L 4OKDA 2H2SD 1WZMA 2JIXD 4DJMA 1YEKH 2YQBA 1MCBA 3TS8A 3HFML 1JHKL 4DEPC 1JWUB 4NQQA 3ULVC 1A14H 2FJGB 4YN3A 4UZGA 5IQ7H 3LN9A 1QFUL 4F9PC 4ODUB 1A7RH 1FFOA 4OIFA 3NH7H 2XC8A 1Q0YH 1V55B 3O2DL 2X89A 3EZJB 2AEIT 3WE6A 3AWFA 4ZNEE 5E5UB 3NFSL 4PJ8C 5CJ8A 4HS6B 1JUFA 3M8OL 3BCFA 3DPDA 5AOZA 1EEUA 1MCPH 3LKSB 2V2TB 3GRWA 4WHCA 5DUMH 5E1QA 1BMWA 4MFHA 1KXHA 3V6OC 1R17A 3F8UB 4QMEA 3I6GA 4NKMA 5BOPA 4OY9A 2R0LH 3IJ8A 4JFFB 5F7MC 5IW6B 4CU7A 1BZEA 5L2JA 2X7LB 3G3LA 1DEDA 4Z0XB 1R3LA 2HLFD 2CK0H 4F8TA 3L6FB 4ETQB 3PJSA 2Z34A 2EVIA 1BQHA 1TG8A 1U8MB 1A66A 2YK1L 2FE0A 2XWDA 4PWIA 1CGUA 3WTVA 4FFYA 4WK4B 1SQ2N 3NRQA 3ZX1A 5I1GH 1DJHA 1EGJA 2X4PB 4ZFFA 1CFQA 2VSDA 4HAFA 4BKSC 4X4YA 3ABZA 4GSQA 3HBQA 5E51A 3VA2C 4LLYB 4A68A 2VN4A 1L7IL 1PEWA 3IAPA 4JDVB 1WK0A 5MHSE 1HNGA 3WFDH 4FNLH 1Y6NR 5T3ZD 2BNUA 5DK3A 4R84A 4UTBL 2HLAB 3S3JA 5CZXD 4ZSOA 5GS0D 4OCMC 4YC2C 4N86A 2LHAA 3EW3B 3NZSA 4YHZH 1OWWA 4JPKL 3IN2A 4GAGL 1A6PA 2HH0L 3ULVF 3B7YA 3DUUA 3ME0A 3B8SA 4ONHA 2AGJL 2DIEA 1QBML 3KPLB 4YO0B 1YPZA 2WJ7A 4QF1B 1LJMA 3UYOD 1NGPL 3AT9A 4UDTB 4YSEA 4Z78A 2WGNB 1SLUA 1R24A 3NCWA 2A6JA 3W0WA 3JQOB 4FADA 5I1EH 1U58A 2AMGA 2GT9A 4N9GB 4O5LL 1KZYA 1IL1B 1WSST 2EVHA 5GGVH 2FYVA 1RUML 3HFFA 4ADGA 4DQAA 4DK3A 3UGUA 2BNRD 2B1OA 5LKNA 1OPOA 1TQWA 4ZX5A 2ZOWA 1I85C 3SE6A 5KJ7E 4JQIL 5IVOA 5A7EA 2FJFB 4HT1H 1RVFL 1U8QB 4FGMA 4CMMA 5TQ0H 1UUNA 4HS8L 5IW1A 3K8LA 5INDA 4U1GB 5DJZA 1UB5A 2FEDC 1MFAL 2NDGA 3B34A 5F71A 3V0JA 3V4PH 1QABA 4U0RC 4AIXA 1NBZB 4GRLA 4X80H 2P9RA 4HS3A 4JFOA 3ZZ1A 1ASPA 4LAQL 1HQRB 4HKJB 4ELKA 3MRLB 1KELL 4XCNB 2WNKA 3WY3A 3CZGA 2XQBL 2UY7B 5DD0H 1KN2L 5C0RH 2QGBA 1X5IA 2KS0A 3N44B 2PWGA 1S9XA 3N42F 3UTOA 4QNPF 3FF7A 5E5RB 3SKMB 3RVXC 1HN1A 3MGTA 3IKKA 3D05A 4JR9L 2WXLA 4APQD 4OT1L 1UZ6E 1L5GA 4AG4H 1UT2A 3BDXA 2RQEA 3RWEB 2E7LC 1CFBA 1WG3A 3ZDZE 4LL1A 4ZPVA 2GG1A 5HDLA 1H6TA 4Q6YA 5A1AA 2B9AA 1V05A 2VC2L 3U6XS 3O0LA 1G9ML 2K1MA 2R1YB 3VXRE 4FXTA 1G6RH 2BSED 1HYSD 4Y4KD 4FQQA 1YCSA 2H6PB 1OAYH 3A22A 4OF7A 3L95A 1LEKA 3BAXA 1EEZA 1LO3H 3QPQD 5BRZA 4JDTH 3ZDXF 3EGXA 2JJWA 2O61A 3UAJD 2A7BA 3V4UL 1DVFA 1PSKL 4XVJL 1CE1L 4KC3B 1F4YH 2DN7A 3VXUE 4ZMQA 3C75A 3DYMA 1L6PA 2HFEA 4XP1L 3K6NA 4MAUL 2WN2A 4WQOA 1M2OA 3U4EA 5AVXB 3QQNA 3WEBA 2P4AB 5E95B 3U30C 1ZA6A 4JFPB 3FZUD 1T0MB 3NYKA 1L0YA 1W8NA 2OM5A 3L7FB 4RQQB 2WXGA 5E6ID 2ERJB 4GW1A 4KKPA 4N24A 2ZX8A 1S7RA 1HE8A 2I27N 4U2YA 3B7UX 3SGKC 2HVJA 3V5DA 2G9HA 4XN5A 5ABDE 5HDBB 3KNBB 3V6FB 4FZEL 5GS1A 2HTLC 3KLDA 1M1SA 2YGQA 4ONFH 3QZWA 1XR9B 3VGHA 1E6OL 3KYNA 3KYAA 5HPMB 4NQTA 1QTYT 1KYDA 4M4RB 3UEZA 1LHZA 3POHA 3Q6FA 4FQIH 3U2JA 4P5TC 5BVPH 4GAYB 3F65A 4CSZA 1L9TA 2CDEB 2ZXDA 1ZHNA 2RACA 3DMMC 2LOEA 3CHXA 4WTZG 2VXTH 4UB0L 4XMLH 3P4LA 1DDTA 2F8VA 4MHHI 1BHGA 4FULA 1XAKA 3B56A 5MP6L 3NSCA 2PF6A 2ED9A 4IOSA 4NQDB 4GKSA 4DGVH 4XN9A 3BGFC 3K4ZA 3VGAC 5FUOH 2I9LA 4QGTA 1BCIA 4X6CB 2W65A 4AMKL 4R8WH 4NZ8A 1VADB 5D1ZA 4GFXA 2MCPL 3CU1A 3SOBL 1C1EL 4EZMA 3K5RA 2BRRH 5H35B 4HXBL 2DQGL 4R4FH 4F33B 4ENZA 1I7ZB 3NK4A 3E9UA 4PRNA 1ET7A 2MPAL 4NB7A 4TUOA 5DFWH 1NFDB 1WCBB 2WKGA 1N6QH 5ACLA 5CZKA 4XZ4A 1PQZA 1Z9NA 2B1HH 5J3HD 1NIAA 5CCJA 1N2RB 3ECWA 5BO1H 3MROB 2X0WA 4PJXE 3WEXB 1ZT7A 5D1QE 1OF2B 3TBTB 3HPJA 4ZUVB 3RBGA 4OZFA 4I8DA 3BUBA 4DERA 4MDJA 4A1RA 4AV4A 1OCZB 5B8CC 5FS5A 1T1WA 5DEGA 4PJIE 4Y5VB 1PYWA 3WMSA 2L4OA 3K4AA 3AG4B 3LPWA 4G7YH 2HX8A 3MV8A 4PGBA 1G9EA 3NQKA 1TF4A 4X99A 1G9HA 3CSYB 1CDJA 1F8TH 3D9AH 3CSPA 3ZQ9A 2ZUYA 4IRSA 2OL3B 3FRUA 5EORH 3TLRA 3DDFA 1DDHB 3RAJH 4AI7A 2WTOA 5JDSB 3GBDA 4PJHF 3K6SA 2V2WB 2QQLH 5C08D 1CZ8L 4NKDB 5C7ZA 2XPGB 1C7TA 2ZCLH 4DK6A 1IGTA 2COQA 3NSJA 3VXSD 3TEYA 4QDGA 4AUYA 3T4AC 1JPTL 5HTSA 2AJVL 3ALXA 1MW0A 1RCYA 2CJ3A 3X3GL 4R7XA 4F8LA 2JKWA 3BAIA 4HJ0D 5EO9A 4X7DC 4ZUWB 5FIEA 5AFAA 3FUHA 4FXGB 4NP9A 1DEEA 3N2JA 5FCSH 5HYSA 2ZOKA 5IQ9B 4RDBA 4IIQA 2YSSA 1NBVH 3F5WB 2OQJB 4OVVA 2IIJA 4D0CB 1XX9C 2XN9A 4Z7UB 3KM1A 1XF3A 1BFSA 1GJUA 4WW2C 1ZVSB 1SHSA 4RIRA 3HG1B 3ZK0A 4BFJA 5IEHB 1BBJB 3DX2A 1K6QL 3QDJD 4YR6A 1VEPA 4FRWA 1U3HA 2VXVL 3MACL 3I6SA 4AKQA 3P3TA 4E9TA 3RWDB 1D6VH 3PGFL 5HJGA 2QFRA 1T4WA 5T1JA 2CPUA 5LGJA 1TQCB 5GQBA 2JSFA 3FONA 3OZLA 3HRZA 3HC4H 4QHMA 3BQUC 4OFVA 4W6WB 3HI6L 3WY2A 2PW2A 3HG4A 3KXFA 3QUZD 2PUQT 4LVEA 3REVA 4Z7QB 4GT0A 4IRZH 5B3NA 4UV4H 4LNVA 1JOIA 4AYDC 2BJML 4Z76B 4Z7WF 1BXVA 1GS6X 3S88L 3EDEA 2A6KB 1OTUC 4ZX4A 1HEHC 4XAWL 4WTXA 5I1DB 4WI9A 2VL5A 3BN9D 2P52A 3UTSD 1TNNA 4U2ZA 2ZNXA 3S9DB 4P48A 3ZN6A 2A83A 1OCWH 3VMNA 1EZLA 1TZGL 3C6LD 3QRGH 4UU9A 2MKLC 2F1EA 4LCCA 2LGNA 1JNHB 1FH5H 3G6JA 4UOQA 3GIZL 5BQ7A 1RU9L 2R29H 4J3SA 4QOKE 3IGKA 3FH7A 2VISA 4OCYH 4Y2DD 5F0PB 4L4VD 2VXUH 1JGUH 4BK8A 3HC0B 2ED6A 2LAAA 3HMWH 5LDUA 1PF3A 3L3GB 1DUZB 3L4TA 3ZKNC 2WNGA 3T0EC 3AQYA 4JM4L 4G8GA 1LE5B 4G9FB 2LE9A 3G5ZB 3EO0B 3DURA 2B2XH 5C0FA 5C86A 2ADFL 3GMNA 3V4LA 1C08A 1N3NB 3W81A 3E6FB 4JRFA 1NCGA 4PS7A 5IFJA 4WW2F 1HE7A 3MBEB 4G6AC 3MJ9H 3MLRH 2VLMD 4ZUUA 5DZVA 5I16B 3MV7B 1OVZA 2X4RB 4N8VB 5EOCH 3VJ6B 3BVXA 3IMTA 3DV6A 3O11A 4BSJA 1BZOA 3L08A 3LN5B 3S3BB 1UENA 1UWXH 5BZDB 5CSZA 1R6VA 3NJKA 1OZUA 1BGXH 1DUYA 3PPEA 4R97C 25C8L 4FQJL 3D39A 4QCIA 4ELDA 2WLIB 4AH2A 4Z18A 4JFFD 1IBDA 2CRIA 2ZKXA 4XMPL 5HYJA 5AAWA 2X4UB 5CP3H 2EINB 1P6FA 1XB3A 3BGMA 3U9PH 2DQJL 3X1NA 5D96B 1XGYH 2GJRA 4WY7H 2CU9A 1SLXA 1ZCRA 2GBTA 3V0VA 3NA9H 3HN5A 4KTDL 4AYBA 4HUUA 4P23B 4CMHB 4DAGL 5C09A 5T3XH 1NGQL 2VNCA 3OKOA 1UXMA 3GEWB 5L0QC 3ENEA 4YL9A 1ACYH 2VN3A 4QHPA 2X28A 1U21A 4MMZC 4KJQD 1LD9A 1UVQA 3WXVL 2GJJA 1YYLL 1MCCA 2D7TH 4FG6C 1HHGA 1Y07A 1UASA 1TQVA 3BOVA 3I75A 3MA7B 4L8BB 1GCFA 3HNTL 1UXWB 4IJ3B 3MOQA 2P24A 4PRHB 4X0KA 4L9LA 1USZA 4IU3A 3SE8H 1JK8A 2DLFH 1BZ9A 2G9KA 4LSPL 5T1LA 1FUNA 4PH8A 3QQ3A 3VRJB 3T1WA 5AVSB 5GZOC 4M8UA 5FW6A 1CLYH 5ABZA 1J88A 4C4BA 1BYNA 3MX0B 3U82B 1CI5A 3MBWA 4AVIA 1WUNT 1Z9PA 3DIVA 1T22B 3K8MA 2XNAA 4HK0B 2OR7A 1ZA3B 2E27H 3APDA 1JP5A 3MLWH 3MYJB 3I9GH 3MOBH 4GLRH 2PR4L 5CP7A 1PIFA 3RKDC 5C6TH 1DQDH 3MRFA 4IQHA 2ALWA 2OP4L 5T3XE 1MWAH 1YMMB 1RJLA 4EIBA 2BIPA 3OWRA 1RZJL 5C07E 4G3YL 4YHLL 1HTYA 4BCZA 4EN3B 4G1MB 5I18L 4QHLB 3WEAA 4DUXA 4XPAH 3PXLA 4QRTA 4XP4L 4JN2B 4OGAD 1KTBA 4HV8A 5FECB 2JCCF 1NSNH 3QG7L 4YK4C 5HI3C 3NDYE 2OTUA 3SCMC 2AJUH 5EULV 2DD8H 3ARGB 4AQAA 4HETA 2RFXA 3INUH 1KIRB 1TKWA 3MRCB 1G7PA 2HP4A 3MVSA 4DTGL 5AG9A 3G6DL 8CGTA 3FQ1A 5EOQL 1AIFB 2FJSA 4ODVL 5DMIH 2E6PA 4F9LA 4ZX3A 4X8CA 1QRNB 4J3BA 5I0VA 4WO4A 1QZNA 4N2FA 1JI1A 1DZBA 4L3CA 2CLVB 1I53A 4U6VL 5AWNH 2IQ9L 2NX5B 3B3BA 5DQJB 3RDJA 2UYLA 2ZD0A 5AW2B 1BREA 2YAOA 3UTTE 5C0BE 3OKMB 3FT2A 2HKFL 1UA3A 3S3SA 1FSKC 1JTPA 3MHZA 5DS8A 3ZO0A 1X5YA 1MF2H 1BMGA 3G04A 3KL0A 4P99A 1E28B 1FNGA 4OZHE 1H3PL 4MB1A 1D5BB 4LOFA 5D2NC 2KC0A 3ROOB 4BKLA 1YECH 4TKWA 2DLTA 2DV6A 5H4ZA 2WWKT 4BQ6A 4KFMA 3KHQA 4UAOC 8FABA 5IVXA 4GP8B 1N0XL 2EIBA 1J8SA 1HNYA 1RFDL 1O7SA 5GHWL 1U8KB 3GYRA 5KUMA 4DF9A 4HCRL 1HT6A 4MCMA 2A9MH 2A9DA 4OV5A 3MUGA 3O2VL 4MQTB 1IGMH 4NHUA 5IB4B 5DEFA 1RUQH 4E9LA 1MXDA 2GC4C 4OFPA 4YDVB 1IC7L 2PNDA 4M61A 2NNAB 3FTGA 4XWOD 2BFVH 5EIQA 2XI9A 1PG7H 1E8ZA 1Q0XL 2YMXL 3PWPE 1I7TA 2LU4A 1FFPA 3O3EA 3OLIA 5I19H 4KO9A 3FCSA 3QI9A 1IGJA 2P5WB 2MOVA 3SPGA 1NGXA 3GIVB 3HFMH 4GRMB 4NM8H 1JHKH 3ZT7A 1ZTMA 3KPQB 5CLYA 1S9YA 3F3HA 4HKXA 1QFUH 1X5FA 4NQDD 35C8L 4A7UA 4XCCH 1P7BA 4AQEB 1BQSA 5C0JB 1XF2A 4X5QA 2JJTA 4EKJA 2DM4A 2O6DA 4JRWA 4QHNB 3M8OH 1K4DA 2YPLA 3GINA 3SZ6A 3BP5A 1PJ9A 5I5IA 2VLRE 3LSOA 2J12B 4JRYB 1ODAA 2UVEA 2CLZA 1A1NB 2OLDA 2R2EB 4PRPB 3SB3A 1CTNA 1JMXA 1B3JA 2Q2EB 4AY0A 4WK2B 1T7XA 4KMLB 5IMOA 1JGLH 2N0MA 1GY2A 1TJGL 5IIEB 1MEXL 2PCPB 1J1OL 3O2WL 3KR3L 4GRLC 5C70A 1F1DA 1SJHA 2YK1H 3R7QA 1H0DB 4J27A 3S37L 3OG4B 1N0LA 3F01A 5D7JB 4PJ8B 5AB1A 3VD2A 2XTJC 4GW5B 2AXFB 3JZYA 1D2OA 3BEVB 4J2XA 1IGFL 3CZLA 1L7IH 1T03L 2K45A 1F90L 2A2QT 4ZBJA 2PCYA 3HUJB 1U33A 2ODHA 2GFBB 3S36L 4E9YA 1NQBA 4HUCA 5BVJA 5AD0B 1N9PA 4NKOB 5DYOB 1ASOA 1ACZA 1RJYB 1MW1A 1XZ0B 3JT0A 1SXAA 1ZE3C 1T3FB 2AJZA 4JPKH 3SEPA 2HH0H 1YPZF 3D25B 2AF2A 4XB8A 1JZDC 1LYQA 2OZ4A 2AGJH 1I8KB 1UFGA 2YUWA 4P59H 2RD0A 3QJFB 5INCB 1NGPH 3N1FC 1T83A 2IALB 2HTKD 4HJSA 1Y18A 1LXMA 2NYZA 2WQSA 1DVFC 4EPSA 2ZXEB 3WN5A 4JDZB 4O5LH 5K9OB 1HSBA 2DIBA 3L9EA 3MUJA 5KYWB 1CXKA 1UD5A 4YDIH 5BZWA 4WFFE 4NO0A 1BMZA 4CADA 2X5PA 3C5SA 5GJTL 4AYID 1OAXL 2QPEB 1M1XA 3AXHA 2NR6D 2P8LB 3HG1D 3HAEA 4UQ9A 3KPPB 5JORA 32C2A 3MO1A 4JQIH 4XMXA 1YLBB 2NYYC 1RVFH 4LCWA 3UBXA 5KJRL 5FV1L 4CJ0A 3MV9B 1HFUA 4WFED 3IDIB 4KHTL 2JI1A 3WNMA 2OXGB 4JGMA 2WYIA 3UTZA 1VEOA 1AQMA 3LNIA 3P0VL 1MDAA 5GS1C 3DOSB 2IANA 3P4NB <