2EP6A

Solution structure of the second c2 domain from human mctp2 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
133
structure length
133
Chain Sequence
GSSGSSGDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCTP2 protein
publication title Solution structure of the second C2 domain from human MCTP2 protein
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 9
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2ep6A01
1DQVA 3LJ3A 1DJYA 2Q3XA 2K8MA 3PRZA 5T8IA 3HN8A 2YOAA 1UGKA 3DBSA 3RDJA 1E7UA 4TV3A 2WXJA 4FULA 4MJJA 4KZ0A 4PS8A 4ICWA 2JQZA 2Y3AA 4GB9A 5EDSA 4NS0A 4F92B 2CHXA 2A5UA 1DJXA 3W56A 4DK5A 3NZSA 5CCGE 4TUUA 4EZKA 5JHAA 2UZPA 3GPEA 4ANWA 3L4CA 4DNLA 4FA6A 1TJXA 2BWQA 3PREA 1QATA 3CSFA 4A55A 3TL5A 2X38A 4KITB 1W16A 2D8KA 4HVBA 4ANVA 4XZ4A 1E8XA 4NPKA 2EP6A 2WXKA 1DJWA 4FLHA 5H4ZA 2ENQA 4ICXA 4ANXA 4WWNA 5CCHE 3TJPA 4V11A 3ML9A 3ZW3A 1RSYA 4L1LA 3HHMA 1W15A 2ENPA 2K3HA 3KWUA 3F01A 3QJZA 2A4ZA 2RD0A 4LT7A 2ISDA 3KWTA 1DJIA 1E90A 2ENJA 2LHAA 2WXHA 3PYCA 4FJYA 4F1SA 4OVUA 4OVVA 4F93B 1E7VA 3TWYA 4IHBA 4FADA 2B3RA 5G55A 3NZUA 3IBEA 3PFQA 4PS3A 1DJGA 4QJ5B 2DMGA 4WAFA 4AOFA 2Q0ZX 4L1BA 3DPDA 3FDWA 4QJ3B 4XX5A 4WWOA 2WXFA 2K45A 2N1TE 3L13A 2DMHA 4LCVA 2FK9A 3R7QA 3ZIMA 2Z0UA 3QK0A 4FHKA 3ENEA 3ML8A 1DSYA 4XE0A 1RH8A 4NPJA 3L9BA 3M7FB 2QZQA 5G2NA 3NSJA 1WFMA 2FJUB 2CHZA 2WXRA 3F05A 3QARA 1A25A 3ZVVA 5JHBA 4AJWA 1V27A 1K5WA 3HIZA 4HLEA 1BCIA 3JZYA 4BGDA 3PS6A 1HE8A 1E8WA 1GMIA 4Y1SA 1TJMA 4EZJA 4L2YA 2WXMA 3L16A 3L17A 3SD5A 4ANUA 2CHWA 3N5AA 1YRKA 3IM1A 4QAMB 2CJTA 2KI6A 3L54A 2WXNA 4WEEA 2WXIA 2WXQA 4L23A 3CSTA 4NP9A 3S2AA 3T8MA 4J6IA 4PS7A 2ZKMX 4FJZA 3QR0A 4EZLA 2V4LA 2WXPA 2R83A 3OHMB 4KZCA 3L08A 1RLWA 2NQ3A 3F00A 4LDCA 2CHDA 2QZ5A 4BFRA 2K4AA 5CCJA 3RPBA 1UOWA 2CM6A 4IQHA 1CJYA 5H4YA 4Y1TA 1WFJA 2WXGA 2CJSA 3APFA 3W57A 1E8YA 1UOVA 2NCEA 3APCA 3F04A 4GNKB 2YRBA 3OAWA 1BDYA 1QASA 2WXOA 3QAQA 3B7YA 3P2BA 3FBKA 4URKA 5KJ7E 2WXLA 1DJHA 3MJWA 3R7RA 1DJZA 4JPSA 1BYNA 2NSQA 4TS6A 4FHJA 1E8ZA 4G11A 2CM5A 3QR1A 3APDA 4WWPA 4QJ4B 4F91B
chains in the Genus database with same CATH superfamily
4IBLT 1HSBA 3CPUA 4X8GA 1K6QH 3L7FB 2P5WD 4JAMB 4PJFE 5GISL 5EU6D 3V6ZA 3WS3A 2J2ZA 3MRPA 4OD2A 1KPVB 2GYSA 2ZXEB 3VRIA 3VWKA 4ZMWA 3E80A 2WNKA 1AOHA 1KXHA 3QUZB 5DZ9A 5IJVB 3TXAA 4DO5A 3RILA 1RU9H 4JFTA 3WDHA 2V5RA 2K70A 4ODSL 1MWAA 2MHAB 5AAWC 3H8NA 1JK8B 5IY5B 2MCPH 4PD4K 5KVGE 1KSRA 3KPLB 5FUOH 2KPWA 4W68A 3VFGH 1MZZA 2AZUA 2LU3A 2R4SH 3KL0A 1N3NB 2QV2A 4FN0A 3I9AA 3RJOA 5C0IA 2W0LA 3QUKB 1P69B 1BZ9B 3GBLA 5C0CD 1EH9A 2UVEA 5E5MA 3NACH 3T0EE 3FF8A 4E0RB 4JO4H 2V9QA 2B8OT 2ZKYA 1XGQB 4Z23A 2Z4QA 3CLFL 4H4NA 3L5IA 4IHOA 5AWNH 3BEWB 4G6FB 3I75A 4XMKL 1LVEA 3RJQB 1IM3B 1YEHH 2IAAC 3IN0A 4JN2B 4TRPH 1WUNT 5D1ZD 2VWEE 2CRZA 4LQFH 2V37A 4PJXF 4K94L 1G1YA 4C83B 3NPSB 3T08A 5JUEH 2XXFA 3I2CH 5GRJH 1CVSC 3MV7B 3E7JA 4M7KH 3UAEA 3BUYA 3HBQA 4HEPG 4D7PA 1G9MH 1KBWA 2XV3A 1P7HL 1MFBH 1W6LA 5DHVB 2DLEA 1YEKL 3CZJA 3S3SA 4HHAA 1UG9A 4HWEH 5CLWA 3T8XB 4I2XE 4JGJA 4XN8A 5E8EA 3N41B 4S1RH 4HIHA 3ZBMA 4GMTL 4J5VA 1XF3B 3HE6C 1IX2A 4FQJH 4G43A 4HS3B 1N5YH 5C0AD 2XBZA 4CNIB 5BJTB 4OJFH 3RAJL 3ZE0E 5LXGH 3PHQB 5EF1A 3SD5A 1PZ5B 4PLKD 4ZOCA 2VZSA 4MZ3A 5ES4B 3RDTB 1BQLH 5AOKA 5J13B 3IDYB 4C56E 3QR0A 5D8JH 4DP9X 5FYLL 4TQIA 3MUZ1 4K55A 1HZKA 4PVNA 4G6AC 1AZBA 1U8PA 3WN5C 3FL7A 5D1QA 1CB4A 4Z77B 4P2RE 4F37F 2CO7B 5I2IB 1ITBB 2FATH 1TPXB 1G7QB 2GSIA 4W4OC 2L7JA 3CVHB 4JZOB 5BO0D 4URKA 4H44C 4BV1A 2EDTA 2UY6A 3OC8A 2NW3B 4PJ6A 4P4KA 4EE2A 3G6JE 4IOFD 4JFUA 4TS6A 3KLHD 2Q3AA 3OAZK 4FLSA 1FFOB 2NDGA 1F56A 4HLZG 4F7KA 3S3CB 3VNYA 3ET9F 1UASA 1RZKL 8CGTA 1S5IH 4UZGA 5AVSB 1WJ3A 1XGUB 3VCLB 3CZFA 4LEXH 5HVGB 3FC8A 3FQTA 4IRJD 1RUPL 3Q2VA 4H0IA 1EX0A 5DK3A 4WV1A 3IFLL 2FEJA 2MTAA 2YJLA 2ZJSL 4Y5YB 3BAYA 1PGRB 3NAAH 5F7KC 1JTTA 3CSPA 4PJFB 2WWOA 3ECVA 1Y7VA 3MN8A 5T5FL 2R0KL 3QEQD 2WTRA 4GT0A 4KK5C 5IR1B 2AMUA 2H0FA 5ALCL 3PWLB 5F71A 4HC1A 3T4YA 1UC6A 4CADA 5I18H 4ALAH 2G2RA 3MV8D 5DK2A 1RSYA 4MB4A 4F2EA 4CA4A 2F53A 7FABL 3BVNB 3T5WA 4OI7A 1MFCH 1B4JH 2NY2B 2CO6A 2MKLC 2VDKH 1TTRA 2VRKA 2A1WH 3CDGB 3PABA 3JBG7 1RUKL 3CXHJ 4N6RA 1HQ4B 4UTAA 2CJUL 1Q0YL 4XNQB 3AWGA 5T1LA 4M3JA 4ATTA 2B0SL 4QRQB 4NRXB 1JHKH 3T1FB 3NEOA 1XH0A 4ZNEE 5L4IA 4FI8A 3T0EB 1T89C 1CFBA 1GYCA 1MW3A 4NM8H 2BINA 4X5QA 3ROLB 3QK0A 2R23A 5E6YA 2BWIA 2KLTA 5FHBL 1A4BA 4IKNA 5CN2A 3NPSC 1GGIL 2ZXWB 3MGTB 1L9QA 1F90H 1CLOL 1DL7L 3P30H 3UPRA 3UDWA 2HLAB 3GKWH 1ZXQA 1A7PL 3IGUA 1UTDA 5F8QC 3ZDXF 3CZLA 3IMUA 3EOAB 1DBKH 3BGFB 3RURA 2EXYC 3OPZH 3VXOB 2RALA 3L54A 2BIMA 3W37A 1IT9H 5KEZA 2KZKA 4I0CC 5E2VL 5KSBB 4LFHG 4L0PB 5IB3A 3WTVA 3QG7L 4X7TB 3D0VA 3VXRE 5H94B 1HH6A 3GSOA 1PIFA 4XNDA 1RIUH 3INOA 2AK1H 4I2XB 1J8HA 2J7LA 4DZBA 3OKLB 3IJSA 2F54A 2KMWA 4MHHG 5INCB 1OSZB 2YK1H 3CGTA 1L7IL 4MSWA 5DJAA 2F1EA 4MJIA 2Y1ZA 3D85B 4K71B 3KJ4B 3ZE0B 3V6BR 5M95B 4YGVB 5BZDB 4RGNC 4LLVB 4OZIB 3QULB 4N2AA 2WLZA 4MA8H 1J1XH 4WCYH 5ECJE 3WS6C 5IP4A 2WBJC 4XPBH 1UZ8A 4QHLA 5I0VA 4LCYB 4YAQB 5GGSA 4DT2A 1QWHA 3GSXB 2AJVH 4PJXA 3ASWA 4N1HB 4P2RB 3SKNA 1NAKH 1MFDH 4XWGH 1HVXA 2BMKA 1KCVL 2H2PC 1PU0A 3FZUD 3P54A 3WHE0 1ADQL 4QD2E 1MG3C 3IETA 2NUPA 3SKMA 3D4YA 5CZVL 5I76A 3IK2A 3WXWH 4P5KA 1AQHA 4NX0A 4UQ2A 1ES0A 3OWEA 4A7VA 5LWYL 1XZWA 2LAAA 3REVB 1G87A 3K6FA 3FAXA 2N4IA 1T0NB 1SY6A 2QKIB 3BKML 4PJEE 5JIMA 1UVQA 2ITDA 3HAEA 1HX0A 1BQKA 1VFOA 3KLDA 4BK8A 5HXMA 4CBPA 2C9UA 4HXAL 3P0GB 3CVBA 2HT4D 4I8DA 3F01A 4GSUA 4ENEC 4PJ8C 2GY5A 4Y19E 3GRGA 4QRPA 3U46B 3IDIA 4UT9A 5G55A 3GJFA 3DXAA 4FABH 3WCYA 3TFKC 35C8L 4IRZL 4KKLC 4M1CC 4XCCH 5DLML 3AXLA 3MLWH 5D5ME 4OCXH 2JKIS 2R0LL 5F7NC 1SLWA 3LNFA 3VXTA 4IU3A 4L3AA 4S0HA 4ZODA 3CBJB 3V9EA 3T0EC 1RULL 4HIQA 3KXFD 4ZXBC 3AM8A 5CIPB 4RAHA 2KZWA 3H9HA 3GMMA 4QAMB 4HT1H 1ID5I 2X88A 5GRUH 5SX5H 2WQ8A 1L3NA 4P4RB 5HYJD 2DLGA 4OAWA 1CG9B 4YPGA 1GIGL 4NM4H 3UG3A 4HKZA 3RUGF 5DVPA 4D0BA 4FZEL 3I9PA 3L08A 2VWEC 3QDGE 5DZNA 4M3HA 4OLZH 1CL7L 1T6VN 1NAML 2CU9A 5IJCC 4ZUSB 4XP5H 1JDCA 3ZIYA 3QNYB 3FCTB 2EH8H 2R2CA 3TV8A 2ZYRA 2XPYA 3GLAA 5BS0A 4P23D 2BOBA 1Z32X 3M17B 4DEPC 4OQTL 4LSPH 2Z92B 3TONA 4QXUH 2DQDL 32C2B 2UXTA 2G4GA 4WSKA 5IKCB 4QR7A 4PRIA 1MCKA 2VRQA 4G3YL 5IQLA 3VXRB 5LN8A 1LEGA 4HFUH 1PZAA 1T2XA 2DQUL 5CJBA 5E5RB 4Y9FA 4NBZB 1FSKB 3FT3B 1KPUB 3VI3E 4KO9A 2DQEH 2KL6A 4N86A 4XN7A 1NC4A 5DSCA 5IF0A 2WN3A 4CJ0A 4XP1H 3JVFC 2JKRM 4HLZH 1QSFE 4ZUUA 3GIZH 3HG3A 1CGWA 5BRPA 2R0ZL 4XC3H 3CXDH 2Q5BA 3GUTB 1YNTF 3H4HA 4ZRGA 4B9PA 4N9OB 4FQCH 4OZHE 1RK1A 5J57B 1MQKH 2ZWSA 1QZNA 4QPEA 1MWOA 1XGYH 2CNZA 1LD9B 1MJJA 2OX5B 3CHSA 4LK4A 2CRIA 3L7EB 5J6HB 2W94A 3QS3A 3UC0H 1BZ7A 2EACA 2WZPA 1WLHA 4G42B 4NYLB 3TN0B 2O5XL 3RHWF 3RFZC 1QLEL 4X9IA 1BPVA 2RD0A 4MQXD 2QKIC 4LE8A 2X42A 4Y4FD 1KXVA 2J6EH 4LCCC 4N5UA 4XI5C 4PS3A 4FADA 4C8XA 1BD2B 4YHOL 2IXQB 4PLOB 5D6CB 1HCYA 3WL9A 1OAKH 3NSCA 4I0PB 3IFOB 5I8EA 4PJEB 3SDAD 1C16B 5KVEH 1O0VA 3LTVA 1NCGA 4X4YA 1L9NA 2Z0UA 4TVSa 1MWAH 1GSKA 3V0WL 4BELD 2G75B 1U42A 2VH5L 3QCTL 4X6CB 2ZUWA 4AJYV 4RX4A 4PB9H 4KZEH 5A2JH 2I5YH 2QV4A 3DC0A 4UV4L 5DHXB 4JHWH 4FYQA 4XNBA 5C0BE 4Y19B 4J8RA 4MASA 3QZMA 3PCYA 5DI8B 3KMDA 4EQ3A 4ODHH 1EAPB 1OB1B 1VEOA 2X4PB 4JO1H 4AEIH 3BP4A 4LAQH 1RFDH 2P46B 3HFFA 3MRJB 4U31A 2X7LA 3BVVA 2OYMA 4L1HA 1E4XH 4KWUA 5EOCH 1I8MB 5DD3H 5D5MB 4Y4KA 3TTYA 2CAKA 5DHYB 4LLUB 2AQTA 1WFTA 2DI9A 1WIOA 4ZUTA 3WXVH 5J89A 4MKTA 4XZUA 3ZOAA 3ULUE 5L4FA 1YLBB 4X6DB 1J0KA 1VERA 2IPKB 5DS8B 1AZVA 4QYAA 5GGVY 2IOMA 5I8KH 5SWZE 4Z3IA 5AB9A 4B9YA 1B0IA 4KJPD 3B7YA 4GP8B 3LN4B 3MRGB 3N1PC 2G3NA 1GZPA 4X5WB 3O2VL 5F0MB 5T1KB 2BS71 3DARA 3OHXB 4E36A 5DJYB 3SDCD 2N01B 4IYKA 4JQIL 3D7PA 4YBHA 2PKDA 3FU8A 1BFOA 3QDGB 3N42B 3WGUB 4PRDB 5E00B 3G5VA 2IQ9L 5T1MA 3GXMA 3WU1A 3OJMB 3DPBB 2BFVH 4ODVH 3S6CA 3SY0A 4TNFA 3AABA 5KYYA 2E8YA 3K0YA 4GQPH 3MA7B 4XGZB 3UTZA 2HT2C 4MA1B 2VM4A 1JPSH 1N8ZB 2NX5E 2J57A 5GRXG 5ITBL 1XDTT 4TQEH 4GW4B 3Q13A 2CKBL 3MZGB 4PV8A 5K9JH 4LBEB 3L9EA 2BVTA 3GUFA 1RJZA 4PYHA 4WJ5A 1UYWH 3N40F 2G0KA 3NJHA 1BF2A 1UA7A 1A1OA 2X1WL 3MRBB 3T0VA 2G2PA 4YDKH 3I6GB 3O6FB 2RIKA 3EOTL 4HOXA 4NCC2 1KN4L 5FLVA 1PMYA 3BIAX 3BWUC 3VI3B 4ZMAT 1XF2A 3LQZA 5E8OA 1KENL 2CIKB 4NSKA 3FKUS 3MRKA 5CUSL 3RUGA 1QSFB 3O6MH 1YC7A 3MLSH 3H3PL 4JFHE 4JLRA 4HH8A 3LEYL 4V1DE 1T7XA 3TIEB 3FFCE 1D7CA 1EPFA 2E7MA 4UAHA 2AJUH 3EH5B 4OZHB 4TXVB 3REWB 4J4PC 5BQ7A 1W0WB 1KYFA 3TN0C 4Z8FH 2WXFA 2R1YB 2BSRA 2MH4A 5HPMB 5GGVL 2EKJA 2GQHA 3CQFA 1OPGL 1CD9B 2QHRL 5IQ7L 3NK3A 1Z0MA 2AK4B 4HS6B 4NO0A 1SMOA 5EU5A 1Y07A 4P0DA 3LQMA 1GS7A 2EINB 3KBPA 4QAWA 1SYVB 3X1NA 3IU4H 1THCA 6PAZA 3MRRA 4KPHH 5IT2L 3V4UL 2NSXA 3PIQB 3CHQA 43C9B 4BWWA 4WO4A 3VXQA 3RVUD 2ATPB 1T1XB 4LU5L 5I1KH 3UC2A 2BW5A 5JDSB 5BXFB 3LH2L 3EO1A 5D7JA 1LEIA 5DMGC 3S88L 1FFNB 3AM8C 4HC1H 4MVBD 4S1SH 5J12B 4Z7OB 4MAZA 1VADA 3WIHH 1SJHB 2HRGA 1YEJH 5AB2A 4BSWB 2Y06L 4HIJA 3BT2L 4B50A 3RGHA 4TLKA 4ETQA 2O72A 1CGYA 4QRUB 4PJCE 4UAOC 1PLBA 3M07A 1JGDB 2YBRA 1DDHB 4LNVA 4UTAH 1UJ3B 1EV2E 3J07A 5C0BB 5GS2H 3VSUA 5ICUA 5BNXD 2EC9U 1AD9A 1W72A 2D2CC 2NY6C 4JPWL 2EZ0C 4LESA 4ZPVB 1LP9F 4Z7UE 2NXZB 4N9GA 4UT6L 4FTVB 3FSVA 1LQSR 2YKLH 4XPGH 4HX1B 4MMZA 3S2CA 2NY0D 4B0MB 3V4PB 4XXCA 5JTWA 1X5JA 2AANA 4JL2A 4JW3A 2DYPD 5D71L 5BOJA 2VDOL 2ROXA 3B3IA 4M6OL 4A7SA 5FA3B 3X17A 1MW0A 1A6AB 3GMRB 2X0VA 5SWZB 3MHZA 5J06A 1GS8A 4XOEA 3CQPA 4Q6KA 5E2TL 1J48A 2WVVB 2X3BA 3O2DA 2LW3A 5E9AA 4AXWA 3LEXA 4O2EB 3KL3A 1A4AA 2JKLA 1KMGA 4KMTH 5LQBL 1D6EB 2FLRT 4U1HA 5DJ6B 5JOFA 1HCVA 2X38A 3UZEC 4GAFB 2UV3A 5D2LF 4KK9D 3LS5H 3DV6A 1ETZB 3PDOB 1HEJC 4HG4J 3PP4L 4NZFA 5IROD 1ILUA 5LHDA 3WTSA 1JGEB 1DR9A 4MXQD 2WZ6A 3T6QC 2NX5B 3MODH 3PYCA 4IGBD 3SBWA 3WKYA 5KYWA 1BJ8A 3HMXA 4ONGH 3P3UA 5IOKA 1E3FA 3FMGL 5I17A 2Y7QA 2H8PB 5D55A 4BGLA 3RZCA 3HZKA 3EF4A 3JXAA 1IRAY 1NBYB 3OKOB 2VGLM 4KVCH 4AK2A 1KXVC 1KIQB 3B9KD 3DVGB 5DJZB 2DQGL 3JV4B 4YLBA 3W0WA 1ITCA 5BZXA 1JWUA 1MFNA 3WNLA 2B2XH 4JO3L 4TSAL 5KSAA 4G72B 4HJTA 3S37L 3F05A 1PLGL 5HHNA 3EJQA 1DJSA 5LKNA 2BP0B 1GVIA 4I0KA 3AREC 3JWNC 4TSCH 1HH9B 4ADJA 1N67A 5B8CA 5IV2A 3W5MA 4EO5A 3D25B 4R0LC 4U1SA 4V1DB 5EA0H 5KJRL 1NLDL 2Z4TA 3FFCB 5B4MC 4KNTA 2APSA 5E70A 1SY6H 4DUXA 5E6ID 2W0KA 1W6WA 1E65A 3LRSB 3HAEH 2BZCA 4LEBA 5FHAL 3AUWB 3ZY7A 4A6YL 5FW7A 3KPNB 3DX7A 3LZPA 1HE7A 3WYRA 3GMQB 4ZTOH 2UYLA 2FLBT 4OUUA 2WIIB 3FQ4A 4XMLH 3QJFB 3SDXE 5BRZE 1MVUA 4LSTL 4OZFA 5DMKB 4HUXB 4GJTB 4NNXB 5FB8A 5J12C 4UT9H 1ZSHA 3BZFB 3VDCA 4GW5B 5I8CB 5J6GA 3GJFH 3ETTA 3HPJA 3UG4A 4FMFA 1XCXA 4Y5XB 3LHAA 5CD3A 3FB6B 4HWZB 4ABUA 1W0VA 2XN0A 2PW2A 4POZC 1DUZB 1C1EL 3X12A 3VE0A 5B1KA 1OD9A 2XQBH 3M1CA 3HNTL 2KZBA 3D3VD 3RWEB 3MRHA 5GGTL 1ZHNB 4C54A 1AP2A 3TIDA 2GC7C 4A7TA 3NFPA 2BNQD 3ARXA 4L3ED 4PB0L 1MIMH 4CUCA 1NFIB 2Q2LA 3QG6B 5IW3A 4RMQA 3KDMB 4MJJA 4I18B 3U4AA 3QQ3A 1RUMH 2E27L 3RVVD 2D7OA 4K9EC 4GEIA 3D4GA 5T33H 1U8LA 3IDXL 1YYMH 2IOIA 1CLCA 2XNAB 4QCIA 5IBTH 2IFFL 1E9QA 2FQFA 4JDTH 4GUPA 2AJSL 3OLIA 4IDLA 5DRWB 4LCUB 3QPQC 4AYID 3CLEH 5JIQA 4PJ9B 1TLMA 4OJAA 4YNYA 4PBXA 4QUOA 1SXNA 1HQRB 2L04A 4F5CE 1X44A 4DKEL 1A65A 1U8MB 3PXLA 1QSEA 4O00A 3T0AA 2E47A 3MNZB 1BVLB 1KJVB 2L3BA 4AIOA 2Z6FA 3SPJA 1BIIA 1WWCA 3WIIL 3MOBL 2H0JA 2Z7ZA 1CGSL 3DX4A 3TVMB 5EU4A 3M88A 4JDVA 4TL5A 1JUFA 3K8KA 5L88H 3OXRB 3TGXA 3FOLA 3DKHA 1HZHH 1IBGL 3QFDB 1TEGA 1KBKA 4K7FB 1LP9A 3T3ME 2CA4A 1CQYA 1QR4A 4KAQL 4WWKD 3AUVA 1JI1A 4J3VA 4BWTA 4CC4A 2WC7A 5I66B 1NBCA 3ARBD 4LASH 1YHPA 2LABA 1UQSB 3V6FB 1ETJA 3FAWA 2R29A 1V55B 4U1MB 1N59B 2WXMA 4M62L 4AW7A 3IMVA 3KVDD 4MQ7A 2ADGB 5C3TA 5HHQA 4AEIL 4A7GF 1UXSA 1U4FA 4WKZB 4NBXB 2O61B 1Y18B 2VZ1A 1NGZB 3NJFA 5A7EA 2QZ5A 3ARWA 3G5YA 5AUMB 3EYQC 3Q8EA 3QW9A 5CGMA 1FVCB 1HXKA 3ZUNC 4A2LA 5KW9H 1EFXD 1UWXH 3AGWA 1EDHA 4H8WL 1DZBA 4UCFA 2C3HA 2H6OA 4N8CL 5D2LA 2CGYA 1H0DB 2C7UA 4FLRA 5F7HA 2VDPB 3EBAA 1WSST 4RFOL 4U1JB 1G5AA 2IGTA 2XZQL 3NTCH 5T3ZE 5JW4Q 2MFNA 3JWNH 1CTMA 1A3LH 1TYJA 4NRZA 2VKWA 1UUSA 1ZHBB 4Z1PA 1L4IA 1E6JH 3GRWL 3OGCB 4OT1H 1HOCB 4Y4HA 3SDXB 2EEDA 1I8LC 3LZFH 4QY8B 4ZMXA 1FVEA 1N26A 2E74C 3A47A 2IANA 1NL0L 1P9MC 1TJGL 1I7TA 2WXJA 1QSZA 1MCJA 1NMBH 1AKJB 2OULB 4J2QA 4X42A 4X4MA 4NDMB 1NGPL 4KX8A 1WFUA 4OKVB 5JHAA 4Z0XB 1TJXA 4CMHC 2Y7SA 4I18C 1CE6B 1JZFA 1DSWA 2ADFH 2QQLL 1OGPA 2HFGL 1U21A 2ZOKB 3KLAA 4UNTA 5D72L 4HOZA 2D03L 1SXSA 1JV5A 2C4FU 3KLLA 4JG1H 4FG2A 3K80A 2Y23A 1OCCB 3AT8A 4Q4IA 3GSNL 1NCDL 4X6EA 1UACH 3LQAC 4G9FD 1MCWW 2FBJL 3HRZC 2UXVA 1FAIL 4UDUA 1HHIA 1NKOA 5AZ2H 4HKBB 1R5WA 1M6UA 3GSRB 4FNRA 1AMXA 3LNHA 2Y36L 4U3SA 3STLB 5I1IH 1JK9B 5D7KD 3GMOB 4X5RA 3ENEA 5F6IB 5MENA 3TVMC 3WIFB 1KJMB 1J87A 1WFMA 5IJDC 2J1YA 3GHBL 2WD0A 3ECBA 1WAAF 4JMXA 1H3UA 4MJ6B 5I6OA 2FYYA 5C9JA 1EXUB 4FQQB 4OM1H 5KSAC 2F18A 2XXMB 3EGDA 4PGBB 3GZOA 1NEUA 4LNRB 4RFNC 5CF3A 3QRGL 3K1DA 4R6UA 5ESVB 1Z2KA 3N06B 3V8OA 3DLQR 1PDKB 3NP3A 1IM9B 2R9HD 4Y1AB 2B1HL 5E8NB 2W07B 3T8MA 3T3MB 1KEGL 1TUPA 3WG7B 1RJLB 3BDYL 3H6AA 3TF7C 2VZOA 3KS0H 3RP1A 3Q3GA 4E9LA 1Z3GL 4BIKA 2K4AA 1Q90A 1QX1A 4UINL 2WGNB 2CM6A 5EHFA 5H4YA 5TE6H 3JV5A 4MX7B 2CDGB 1KGIA 5B21A 3N85H 3D2TA 4KRNA 4WNQA 5KBLA 2FD6L 2OXGB 3C08L 3WO4B 5FFOA 4B97A 5KJ7E 1BW8A 2OR9H 1I53A 5KBNC 4Z18A 2CR6A 4GXUM 2VABB 4HETA 5DC2A 1AR2A 4M7LH 2AV7A 4LSSL 2BY1A 5ERWA 2Z34A 2A9BA 1J10A 1I1FA 2EILB 5JHLA 2XQ0A 1F1GA 1QWNA 1VGEL 4KGLA 5TE7H 3N50A 3RU8L 2ZX9A 3C5ZB 3ELAT 3CSGA 4N8VB 2JE8A 4MTMA 4K8RL 4UIMA 5DD5H 4F33A 2GK2A 4DJMA 3QUZD 4AE1A 2WUBH 4JPVH 5F1IB 4HHGA 4L8DB 4OI8A 1IGMH 4X7FC 4GMSL 3UX9B 1AYRA 5FW6A 2IALB 1A14H 3CNKA 3TNNA 2X40A 3IEAA 3TV3H 1Q9WA 4TVPD 5T5FA 4XNMA 1TZHB 4YDZA 4A7GA 3BZDA 3K3QA 4HJ0D 2NYZA 3UP6A 1W72H 2P7TA 3CVCA 2EYSA 4QTHB 2XRAH 3WDJA 3BRFA 1BZQK 1IUZA 2HLEB 4YMPA 4H88L 4TPRH 4G6FD 4ZNCD 5DHEA 4XRCB 4NJAH 5DRNA 4YHPA 2B16A 5E99H 3ILPB 2LE9A 4ZYKA 4QOKA 3S5LG 4MLIA 1NWOA 1OPOA 2WKOF 3LZQA 1ZV9A 1YMME 3ISRA 3MV7D 1LO5A 3O2DH 1VACA 2VZ3A 2WVUA 4Q0XH 5K33A 1B6DA 1CFNB 1OL0A 3NCYS 3AAZB 4KNSA 1JTPA 2BO0A 2XPGB 4UM8B 1BQSA 4QHKI 4FHBD 5FUZL 1WWWX 4MRBA 2GY7B 3O9WC 4KMLB 2Q8AL 4KQ3L 3KPPA 2KDYA 5K9QI 5DGQA 3FQXB 2G9HA 4OCNC 1G0YR 1CC3A 1J0JA 1EFQA 5FYKH 3RDTD 3MLRH 4KO5A 2EC9T 1J5CA 2H5UA 3MUJA 2PO6C 4KI5F 4HISA 4KKPA 1UA6H 3ZN6A 3HMXH 1S8DB 3DX9A 3HS9A 1HXMA 3U6XA 4JHAH 5IOPA 4UU9A 3FH7A 4YFLF 2W9LA 4NZUL 3B5GA 5FGRA 2OZNA 4X7CC 5T3XH 3UO1L 4YHZL 4ZUVB 4UNVA 4G59C 2J20A 3ARTA 1OAZL 1M4KA 1YY8A 3GZKA 3ZKNC 3QRBA 3GHEH 15C8L 2H2PD 1ZS8A 3FONA 4EN3A 1JF5A 3EDEA 2C26A 1NM4A 3WO4C 3P4NB 5H8DA 3QZBA 1R5VA 2HFEA 2X2HA 3ARGB 5FFGA 1OSYA 1A22B 1MREH 5EG6C 3WFHA 3MRMB 2JKJA 3RFRA 4Y4HC 1RVFL 1WF5A 3B5TA 4ZQTA 4K3EH 4KZ0A 4IEFB 1PSKL 4XP4H 3VH8A 2PCPA 1MRCL 5DQJB 4G2AA 1DVUA 4L0YA 1L7TL 4LLQB 1WAAA 3HW7A 4YDIL 3WNIA 1A6VH 4ZDHB 1JCVA 4OZFH 3OLDA 2ERJB 3HE7A 1ZGLM 1AQKH 5KOMC 1CFVL 3C6SB 1Q0EA 5I30L 4JR9H 4L4VA 1P4IL 4UM9A 1HWHB 1KLUB 2A0LC 4LSRL 4R4FL 3EO0B 3WO3B 3Q06A 4JFFA 5I1EL 3MLUH 4D9LL 3IDMA 5DQDL 1F4YL 4XCFH 3PV7A 3CX2A 4L8SA 1OANA 2PXYB 1X5FA 3K7UA 3WJMB 4CVZB 2P5EE 4PRBA 3D69A 3RX9A 2E46A 2NY2D 3H3BC 3MRQA 1E50A 5ID1B 5C2UB 4XB8A 2PTUA 2HN7B 1GGTA 3IGAA 4PLJC 5JPNB 1YNKH 2BS9A 1SF3A 5JHMA 4Z5RB 3WE6B 5C6TH 3E0GA 3T0ED 4NPJA 4DO6A 2YPVL 4AYMC 4DN4H 5D4QA 1TQCC 2CUIA 1S7WA 5AZ2L 3UAJC 4M5YH 4MS6A 3EYOA 1H15A 3T65A 1D9KB 3RA7L 1AYOA 1CFQA 4PVBA 3GZPA 1KN2L 1MIEH 3HHSA 2NNAA 4LPCA 2A77H 1PG7W 2VDNH 2EXSA 2CJTA 2W91A 3T0WA 1XGZA 5GS0L 1DFBH 4IK7A 1QYGH 3BAKA 4BH8A 3QIBA 1MJ8H 1YMMB 2NLJA 5AW2B 3MV11 3S96A 1RZIA 4G80B 4NIYE 5IB5A 5K1JA 1OAYL 1AOZA 2OXHB 4BUQA 1NAMA 2FJFA 2DTSA 2FGWL 1SXZA 1HHKB 2KQMA 2RFXA 3R06B 1KLGB 5C0DA 1IKFH 1UXLA 3D85D 4M02A 1U9KA 3O2WH 1OTUC 3DUUB 5FCUH 3VFRA 4NNPH 3APDA 4OQTA 3RQ3A 1E27B 3UTSE 4AIZB 1YJDL 3INUL 4R90H 1DZ0A 3CZKA 3CPLB 3DNKA 1PEZA 2RBLA 2B7DT 3G5XB 1TDQA 5DO2C 1UGKA 2R29H 3CJJA 1IAMA 1C08B 4U1GB 4P2RD 2WKOA 1R3LA 1XVSA 3T8VA 1AS8A 1BMZA 1RK7A 2F6AA 3NFNB 1CBJA 3W82A 4L29A 4KRPB 4EAEA 4P3DA 2WIMA 4GQ9H 3WSQL 2JJTA 3IDJA 4W93A 4WTQA 2HKHH 3TO2A 4H20H 1ANUA 2FL5B 2KDGA 4LAJH 4JM2F 5ILTL 2VXUL 1M1XB 1EWHA 2OZ4H 1EHNA 1JWMA 3C60A 3OKNA 1A4JB 3Q48A 4DAGL 1ED3A 5IVOA 3G5ZA 3TBSA 3HR5B 5EO1B 3ZYJA 1WAPA 1MCLA 1U58A 3HHMA 5BQDA 3BQUC 1VFBA 5INDA 3MZTA 2AEPH 4P5TA 2DLHA 3MACH 2FECL 3ZKMC 2IPTH 3RVTD 3FT2B 4MDIB 5MI0B 4ZQKB 4KOBA 5D70H 3S5ZA 5GISH 1AGDB 3MUHL 1KZQA 2BPBA 1TO4A 3BZ4B 2DQIL 3O3BA 1HXYA 1HL8A 1I8IB 2E8ZA 5HVHB 5IG7A 1KYUA 2F19L 2A83B 3RWFB 3WKML 2APFA 4Z78A 2ZOUA 3P73B 1RUAL 1SJEB 1RURH 2P5EB 2Q86B 3G04A 4R7DA 2V8MA 5HDBE 2OYPA 4QKXB 3CVDA 2J1ZA 2JCCE 1DVFA 1YA5A 4IBSA 4F27A 1ZHLB 1FVDA 3ARDC 5JA8B 3SE3A 4GLRH 4P2QA 3VUAA 4JFVA 3TESA 4CGTA 5DU7A 4ZMLA 1D9KC 2NMSA 5C2BH 4CVUA 2O6DA 3A0OA 4Z95L 1TZAA 1D2PA 1A3RH 1EIBA 3MRCA 1MCBA 3LSOB 3QUHA 1JGLL 5JPMB 1CD0A 2AEOA 2QGBA 2WXGA 3TBVA 2FNWA 5FECA 4TNWK 1VEPA 3GSWB 3NQIA 4ZMPA 4QWWD 1ZY9A 4PJHF 1QR1B 1TQUA 2H26B 1RERA 1UWGL 3OKEA 2CDEA 5L2KA 2FSEA 2V2WA 2ZZUT 3GMPA 5HGDB 3SJVE 3EFOA 5IEHA 2D7NA 2HXAA 3HC0A 4TQPA 2AVGA 1QZ1A 1QEWB 3VJ6A 4RMWA 4GMTH 4WHDA 2V7NA 3VXRD 4DKTA 1K3ZA 3UGXA 3P4MB 4ZMOA 2JJVA 4NZRH 5E9DA 3ZO9A 1I85A 5JR1L 4NQDE 1GXEA 3RAJH 3GMNA 1KT2B 3ZK0A 1ZWIB 2JV6A 3OX8A 1BWWA 4KHXH 1WCQA 4MNQE 3N43B 4WI0A 2E4TA 1KV7A 4ZFFB 4JY5L 1KTKE 1SQ2N 1RPQA 3ZTJH 5GRYA 5CEXA 2X41A 1SQMA 2J8OA 2WWKT 1SBSH 5T1JA 2CKBA 1FIEA 5C0GB 3UTSB 4BKSC 4XVSL 2BY2A 3FB5A 5LAXB 1HHJA 3JT0A 2R7EA 5IVXE 4HVBA 3PXHA 5LG6A 3F8UB 3RIKA 2N59A 4Y2OA 5EFIA 4TTGA 4PGCB 3EJRA 1E2WA 4POUB 2YXMA 1Q9OB 4LLAA 4PTTB 2WMPA 3GTVA 5DYOB 4WJG3 3TWCL 2QVFB 4PGDB 3I9GH 2HMID 3D12B 3TN0D 1GW0A 1QSVA 2WXHA 2WLYA 3GK8L 4NNYA 5JHLH 1P4UA 4ODXA 3QO0A 4QHUA 1U8IA 3WS3B 1G7IB 1SMAA 1QW9A 2J2ZB 1S9KC 4LZKA 4KTEL 4D7BA 4WWOA 4GIOA 3VRIB 1BD2D 2G9KA 1DP0A 4X6FB 4I0PD 2XACC 5MI0C 1QACA 2FCBA 3MLVH 2V2XA 4K5LA 1VCBC 3M7FB 1ACYL 1B6UA 3IFLH 1MWAB 3FQYA 3KPQA 3PP3K 5JHBA 3H3KA 4R97B 3U6RA 4EUPA 1F58H 2C1PB 5IWLC 4YZFF 1RY7B 2GUOB 2PW1A 4HWUA 5T5FH 5HVHC 5I73B 5LNGA 1AO7A 1NGYA 4Y19D 1IGTA 4JKNA 4TL4A 2UX7A 3VXNA 3QZNA 3VTMA 5K9KA 1FG9C 2IF7A 3JQOB 4ODUA 3QJUB 5E5MB 1GYVA 1I9RH 1MY5A 1PZ2A 3R4RA 2XWTB 4UQEA 1D7FA 1DBBH 1MKFA 5J7CC 1TOXA 1WD9A 3D39A 4FCHA 1XSOA 2Z4QB 3QIBC 3GWJA 1UKSA 2KHAA 2JB6B 5IUCA 3EADA 1URLA 4JM2A 1RUKH 3N0AA 4HH9A 2CJUH 1Q0YH 1GGBL 2QTVA 5DEGA 4GO9A 2B0SH 3NRPA 3G6AA 4MA3B 2JCCB 3NK4A 3CFKB 3BKCL 3TX4A 3UZQA 3RI5K 5HDLA 5L7XH 3SDDC 3U36B 5JPMC 2H2SC 4D0DA 1SN5A 4EVNB 5TQ0L 1SEBA 3NN8B 3BUYB 4UT6A 5T1KD 3B2XA 3V10A 5FHBH 4FQXC 4M3KB 1JZ2A 1OOWA 5CD5D 5CS7A 3T9WA 1WTGT 3TBCA 3QDGD 5EC2A 4E9YA 4HIHB 4GG6E 5D1XC 1A7PH 3P0VH 3QJRB 3QC6X 4O02L 4EBQH 2PTTA 3PL6A 4RDQF 1FNLA 4KUCF 5JW4R 4L8BB 1LJMA 4R2GC 4AENB 2EVJA 2GFBA 5E2VH 1X5MA 4XVOA 3KVPA 3VSVA 3N0PB 3QG7H 3A67L 4KROC 4NP4L 1SXAA 5I1GL 5L6YL 1COBA 2IAMC 1XAKA 3S36X 1U8PB 2JJTC 3X3GL 1TITA 2OMTA 1E30A 4YHLH 1LK3L 2E9GA 3TFBA 1TLKA 1VFAA 4FXKC 4CN1A 2ZQKA 3OKMB 3DSNA 1X5IA 4NPKA 2QSCL 2UZYA 2XKUA 2FWSA 3OR6A 2GSIB 4Y2DA 3C60C 3O6FD 3B2PA 4OCMC 3O0RH 3EBGA 4MNQB 3QORB 2UY6B 2XQYA 3GO1L 4PG2C 3H9SA 4Q9QL 4P4KB 4HQQL 3UYOD 1QSFD 1PAZA 1MCWM 3H42L 4GLRI 1KEML 3ZTNH 2WP3O 4PJHA 5AW6B 3B2MA 1P4BL 4AJ0A 2X4NA 3F6IA 1YSOA 5IVXB 3K5SA 2DMHA 2MPAH 1JCKA 4X7SL 2IH1B 1EUTA 3CZFB 4GIPD 2ATKA 3AMKA 4S1QL 1KGWA 2X44D 4B6ZA 3T4AB 4UYPA 2AK4D 4QRRA 1FPTL 1ZT1A 5DC4B 1B2WH 3VFOA 3BSHA 3ZTDC 5LWYH 3JYBA 4JN1L 4N0FB 1JZJA 4LHUG 1WFOA 3UTOA 4ZMQA 5A6LA 1GC1L 5EZJA 2WYZA 3PWNB 1QRNA 2QPDB 2WTRB 4B9IA 3SKJL 4A6YA 1DVFC 1LNUA 4S0SD 4LIQH 2OJEB 5BW7C 5ISZA 3T4YB 3SGDH 4R97C 2O5ZH 4HXAH 5HI3D 2R83A 4PGZA 2G2RB 3MBXH 1Z5LB 4KZCA 3WDIA 4OM0H 5DK2B 1OP5H 2IBZY 7TAAA 2P4AB 2F53B 5EUOF 3V95A 2XN2A 1I9JH 3CDFA 4MWFA 1E3XA 4JY4A 4N6RB 4POZD 2XZCL 3OAWA 1AR1C 2JQMA 2AJ3A 4M6ML 3OAUH 1RZJC 1CFSB 4JHBA 5C0BD 4CILA 3JV0A 5DLMH 2EDFA 3FO9A 5JW3H 5LNEA 4JDZA 1I1AA 2PR4L 2DTML 1BM7A 2NXZD 5D9SB 3BUPA 4FTVD 1J18A 4R9HA 5GGTA 3S98A 2WLLA 4ZK8A 2VQTA 3P3YA 4OCWL 4OGQC 4CMMB 4YSSA 5I1AA 4U7KA 4JY6A 1NIEA 1ZSDB 3DBSA 2E0PA 1RULH 3MFFB 3UPRB 2Y9RT 4LLYA 3ULUD 2OJ1A 4QYOA 2AKRA 4F8LA 1NDGA 2F1AA 5F9AC 3D33A 4GRLC 3P0YH 3ARUA 3W56A 5SWZD 1BAFL 5BS0E 4L9DA 5GRVL 4P3CL 2IDUA 5IB3B 4TNVK 4XO3A 5I5RA 1X4ZA 2MCAA 1JZ3A 4PRIE 2K8QA 3D0VB 4Y8DC 5HVFB 3PDDA 1KTLA 2EXTA 3GSOB 1NAMH 1J8HB 1DUYA 2W65B 1MFAL 5DZPA 3IJSB 2F54B 2WSDA 3FTWA 4DZBB 3IWUA 4MSWB 4RQQA 2TRYA 1KUMA 2YEZA 1KFGA 5DJAB 5EN2A 3ESOA 3M46A 3AWEA 3PWJA 4H25B 3E38A 5D93B 3JTTA 2DKSA 2I25N 5F3HB 5E08L 4OQTH 3BH8A 2DQDH 2J8UE 1T21B 2ZUTA 4OVUA 1A21A 3LXCA 2BCMA 2APXA 2NX5D 4G3YH 1JHTA 1UD4A 3H7BA 4QHLB 5EIIA 4MCMA 5F9OL 5FOJA 3MBEB 5GGSB 2F68X 4KHTH 1VZGA 3IS0X 3SKNB 2RA1A 4G71B 4AMKL 3QJTB 2R2EB 1XIWB 3ETBF 4IRSA 3QWQB 1RP8A 1VGKB 4L4TA 1JZ8A 4MDRA 4FL4B 2VN4A 1MHCA 1WGVA 2GSGA 4WI8A 2D9QB 3IETB 4M8RA 1MHHA 4P2OA 5ID0A 4HAKA 2NUPB 2PN5A 1KIPA 3OQRA 2R0ZH 2B1AL 2WOBA 3SKMB 3UAAA 4AJWA 5I76B 1KXQE 4P5KB 4CDHA 1DVYA 2ZYHA 1TJMA 1ES0B 5CZKA 2YPLE 4A7QA 2O6CA 2BHUA 1U8CB 3TPKA 3HMWL 2C9RA 2YOCA 4V1DD 3S4SG 3FFCD 2HH0L 3O3EA 1J7VR 3R18A 1Q0XL 3QDAA 4RA0C 3FT0A 4LSUL 4HJGB 1ZTXL 2RCSL 3NH7L 1QLEH 2JKNA 3BW9B 4NKOA 4S10A 1OP3K 3GSQB 3APFA 4GBXC 1H6UA 3DBXB 4WU5A 1PX4A 5DD0L 1LO2H 2E75C 3DO3A 4QRPB 2YXVA 4YHOH 4WLCA 3KLKA 4RVBA 4HPOL 2OL3B 1OCRB 4TN9A 3AXLB 3SOTA 2EIMB 3V0WH 3H9ZA 3X14A 4D94A 3QCTH 4UUJA 3GRWA 5GZOA 2AAVA 3LHPL 4UV4H 3P3TA 5TQ2L 3T04D 4IU3B 1ZA3B 1A4KB 1WWAX 5EZOH 5LGHH 4NZ8A 4NAQA 2DWEB 1X5GA 5TD4A 4DERA 2HAZA 5FXCH 5MEOA 1C5BL 2JQZA 1A66A 3ZE1E 3H9HB 1MCSA 2XVKA 1SPDA 3GMMB 3QH3A 4N2IA 3PL6C 3R8BB 4DP0X 1N0XL 1LE9B 3HCVA 4AM0A 4GRWE 3MDJA 4KH9A 4OAWB 2BZDA 3IPFA 2HRHA 3ZZSA 4HKZB 4JNXA 1R3JA 3SCMB 4HPYL 3UYRL 4D0BB 1R34A 1WFNA 1MCHA 4MXVF 5D2NE 2XTJE 2QLYA 4FA7B 1GOFA 5GZNA 4PJ9D 1UZ6E 4HKXB 4XOBA 2HRPL 2YN3A 5HHOA 3O2VH 1NBVL 4TQHA 1OE2A 3GSNA 3U9WA 4MAYA 4N2NA 4WW2F 4Y2DC 5BS0B 3NZHH 2WNGA 2WB1A 1NZRA 2BW4A 2EYTA 2NTFA 2VXVL 5DA4A 5EUOA 3IXTB 3MAWA 1K72A 4TNWF 4NKIL 5F7BA 5JXEC 4GXUN 3UPAA 4PRIB 4HHWA 3ARYA 4L37A 2IQ9H 3TVMD 3K6SA 4Y89A 1JHLL 3NCBB 1WO2A 4MNHA 3NCFB 4LKXA 3SDYH 1F4WH 3TH4T 1BPLB 2PYFA 4NRYA 3ZR6A 3PV6B 4IOIA 2VLKA 4K5PA 5AKVA 5CHNA 5DSCB 4AUUA 1NC4B 4F8PA 4GAJL 2O6PA 4RAUA 2X53A 4BQCA 3MBEC 3ULVF 5ITBH 2IDQA 3ZQWA 1BZDA 1OAJA 2CKBH 4NQEE 2J8UB 3UIZA 4ZX6A 1H5BA 3QISA 4XTRD 1XIWC 2YD6A 3DX6B 5TK2A 3TJHC 3O0LA 4HUMB 4Y88A 3RWGA 4DSYA 1RK1B 2NY7L 4FL4C 1USQA 3DVIA 1R24A 2WXQA 5DWUL 2H6PB 3CHPA 4PPTA 2DLFL 4HCRL 1S7SA 1PZBA 3MJGX 4MD4A 5FKAA 3CFDB 1G6VK 3CX5J 3P40A 1KENH 4U1IA 3H53A 1CICA 1XCQB 5CUSH 2HUEA 3ZE2E 5DO8A 3IAPA 1ONQB 5HHPB 3H3PH 3X1FA 4AGNA 3LEYH 2EVGA 3P11L 2VM9A 5IESL 1TU2A 1DTUA 2EIJB 3E6HA 3MUGB 5EZIL 5EN3A 2YPLB 4J6RL 3A4AA 3L6FB 2QR0A 4S2SA 1GGUA 2DIBA 3LNEA 4WSGA 3N44F 3PNRB 3T1WA 2H32A 5FO2A 5EULV 5I8EB 3PQYA 5ICZA 3CFCL 1CL7I 1SDAB 5LGJB 2HWZL 3V4VL 4TUOB 1XCTA 2YAHA 4HD5A 3E3QE 3PLYA 3FCBA 1QTSA 2WPGA 3V4UH 4MJ2A 5GRVK 3RWCA 3DO7A 1V7NH 4EUPH 3SY6A 5F1SA 3K81A 3O3AA 5IEKA 4CSSA 3CHXA 3TBTA 4LU5H 1JZ7A 4PRNA 3WNPA 3FB7A 2GI7A 4YSAA 4GQQA 2IWEA 3QUMA 1AKJD 3DX8A 3BP4B 4F9LA 3O41A 4ZO7A 2X7LB 1SDDA 1TTUA 2WV3A 4UQAA 1X4XA 3E8UL 2Y06H 3VA6A 3BT2H 5MEPB 1KYOJ 2OI9B 5I23A 3NIGF 3WFBL 3MV9A 2HFFA 2MQ0A 5AG8A 5F7UA 1WK0A 4XZUB 3AY4A 2R1WA 4PUBL 1R3KB 2N7BA 4BM7A 4WI4A 2ZIDA 3O4LA 1VAHA 4J27A 2IIJA 5IMMA 3KPRE 2DJ4A 1X9QA 4JPWH 3ZE1B 4KNQA 3SCMC 3N2JA 1YEWA 1RZQA 1V7ML 4XWOD 5ESAA 1GZPB 2HLFD 4UT6H 5FO9A 3ZHDA 3OF6D 4GRWB 5AAMC 1P53A 5C0RL 6PCYA 3N91A 5AQ0A 4M4PA 1BVZA 2Y3NA 2V9TA 3G7TA 1BFOB 2Q0ZX 2VIRA 4HMEA 1UATA 3Q9QA 1HWWA 1V10A 3NA4A 2VDOH 5D2NB 2XTJB 3G5VB 3N6YA 4M6OH 2BNRA 3CBRA 5T1MB 3US9A 3W9EA 4KTDH 3WY1A 5AOZA 5IGXH 3SY0B 1MCNA 5KYYB 3V0EA 3L4TA 4O9HL 4YFLI 4IRSC 3KNBB 1S46A 3SE4C 1EO8L 2CCVA 3SN6N 1KGUA 2QVMA 1UT1A 4J3WA 2DQJL 2JI2A 3VU1A 1S7TA 3CFJA 5LQBH 1T5XA 1EEQA 4JFDE 4PV8B 5K1NA 3X3FL 3P9MA 4XMZA 4ZW6A 4WJ5B 1I1CA 1GAFH 4XC1L 2DLIA 3BSZA 3MLTB 3UBGA 4IIZA 2I24N 4NPYB 1H6TA 2V6HA 1XT5A 4Y1AD 1IM9D 4L5FL 3VMOA 5IFHL 2LFEA 3LQZB 5E8OB 5I0YA 1N7MH 3EJTA 5E51A 1G7LA 2VAAA 4NQEB 1OY3B 3FMGH 4OLWH 3WMPA 1M05B 3L3OC 4UYQA 4EJ1C 2YLHA 3KWWB 3CK0L 4JFPA 1DJZA 3JTSA 3T77A 1J5DA 1NOFA 2DQGH 2MRYA 4PH8A 4RRPA 3GF8A 4P57B 3BMWA 2BSRB 5ENWB 4ES8A 1ZVNA 3BEVA 2VB5A 4WW2A 3L81A 4FP8L 2Q3XA 4JO3H 4NO0B 4TSAH 4YIQB 5EB9A 4XXWA 2OCCB 3S37H 1WA1X 4J1UA 3ARFB 4AKQA 1TYRA 1FZOA 4FKKA 2YOAA 1HESA 1NLDH 4FULA 4WO4B 1QABA 3OBAA 4JCMA 3VXQB 3C5ZD 3CBKB 1NCOA 4PP2A 4G5AA 1AI1H 2E7LA 3FUDA 4A6YH 3I50L 3LVTA 5D7JB 1IAOA 1OO2A 5CJ8A 5HGAA 4AQ8A 5J1TC 4F7CB 4C59B 1VADB 2CHNA 4MD5A 4WTZG 3MKGA 2A0LD 2IG2L 1QFPA 1AHWA 3BPLB 4HIJB 1BBJB 3QI9C 3BPOC 4LSTH 2ZKXA 4UOZA 4XCNB 3DTUB 2B4CC 3RB5A 5HY9A 1QQDB 5F21B 2F15A 3NA9H 1IAKA 3ABZA 4XHJC 4IM8A 3N40P 2BCKB 2X3AA 4WHYH 1IC4L 2KPNA 1AD9B 3TYFA 5I9QB 4PTUA 2A9AA 1C1EH 1ML0A 3FTXA 3KW8A 3NSYA 4X50A 4BQ6A 2VW7A 3OB8A 1RU9L 3ESUF 3HNTH 1HKLH 3GB7A 5GGTH 1WV7T 3NCWA 2BSSB 1QTPA 3VSTA 4YWGH 4UIKH 3MBWB 4YSOA 3Q8BA 2X6MA 4BQ8A 5FUOL 3UAJD 3VFGL 3BN9D 2XYBA 4KQ4H 5LAPA 3KPRB 4RAVB 1MRFH 4I48B 2H45A 3C87A 5CSGA 3NACL 5C08E 1Z9OA 2FJUB 3UPCA 3EH1A 1FGVL 3EOYG 3IDXH 5D2NC 2WLNA 4N0CC 4V2BA 5JYLA 5GGRY 2IFFH 3FYEB 1JNLH 1Q9LB 2AJSH 5BV7L 1YY9D 1M6OA 4H5SB 4U1HB 5JOFB 1H5BC 1YEIL 5M94B 1YEHL 4TRPL 3G5WA 1AANA 3MRNB 3PXJA 2APBA 2X87A 2I60L 3LZNA 5E7FA 5JHDE 4H0HB 4HUUB 2HG5B 2Z93B 4IKKA 5GRJL 3IJEA 3AG4B 4GAGH 1TTAA 1N64H 1CTNA 1NFDE 4FZ8L 1ZPUA 2NXYB 1G9ML 2CK2A 3MOBH 1UADC 3O3DA 3UH8A 3WIIH 5KYWB 4C57C 4JFDB 2IH8A 1QI5A 2AGJL 4J3BA 4P3WA 3HZKB 4XCEB 1F11B 1IBGH 3RRQA 3BI9X 4FQJL 2J12B 1ZVSB 1QRKA 1N5YL 4KAQH 1N0LA 1E8ZA 2Y5TA 5DO2D 4AL8C 1SHWA 4Y16B 1LDSA 4NFBA 3N04A 1JWUB 1YAZA 5B39A 2X3CA 2EICA 3KPSE 4BH7A 2MWCA 5CP7B 3F58H 3S8FB 3EDKA 1BQLL 4NN6B 5C8JA 2P8PA 5HHNB 1HK6A 4Z7QE 5D8JL 3S35X 3ZDZF 2YD2A 2XIDA 3CZEA 1KB3A 5DMJB 3DUHA 5B8CB 1CK0H 3ARGD 2Q7NA 4KO7A 4M62H 4MMXC 4L9LC 4U1SB 5CWSA 1BBDL 1X5XA 2CDFB 1BQRA 1U2YA 3MTRA 1ZLEA 1NC2A 5A2BA 4NO3B 3ARFC 2CXGA 1TFHA 1T7ZA 3WENA 5DJDB 2FATL 1JZDC 3DX7B 5I6XB 1JNHA 2UYLB 1KNOB 2GEQA 1AGFB 1E9OA 4OSUH 4U1NB 1G9EA 2EIKB 3AG2B 1MVUB 4NHUA 4UQBA 2XFGB 4P5SA 1XB8A 5FB8B 3L3GB 2R69H 2YWYA 1WD8A 3LS4L 3ML9A 2ZCHH 4RH4A 4LL1A 3UTTA 3TEUA 1S7VA 4QXTA 5CD3B 1E5ZA 4RFOH 1N6UA 2AQ3A 2XZQH 3BP7A 5LVEA 4KKAD 2PXYD 1OW0A 3CSYA 2DM4A 3HB3B 2PNDA 3UCRA 3GRWH 1TZGL 3MRHB 4PQXA 3TIDB 1NLBL 3EH3B 5AD0A 3M8OL 1QUNA 4YC2C 1NL0H 3NFPB 3VGEA 2YAMA 3QP3A 4ZJ9A 4U4IA 1XL4A 4LPYA 3QQ3B 3WNNA 3WKNA 1BGXL 5MP6H 1SHSA 5FO7A 1TQVA 3GLZA 4JFZL 4X7DC 1EZVX 1RZ7L 1YEDA 3KYNB 1U8LB 4Z7VE 4ALAL 1J5IA 4YHKL 1SUHA 5DMIL 2B4CH 4XNZC 1U2CA 3DDGA 1D9KD 3VSQA 2QQLH 4J3XA 4PCTA 1MFCL 3D48R 2XG4A 2VDKL 1OCWH 3FW6A 2A1WL 1OEZW 2D03H 2QPSA 2VDNB 4YNYB 2HKAA 1F6AA 2V4LA 5EU6A 3MCKB 2FHBA 3GSNH 1NCDH 4MMYB 1YMMD 3ZR5A 1BMGA 4NM8L 4UQCA 4OLUL 1BIIB 2GBVA 1A6PA 4PV9B 4JHVA 1ETA1 1WZLA 1JUFB 4DPAX 3GKWL 4JFEE 5GRZA 4D2NA 2QPEB 1H3VA 2WSKA 5E24E 3VGAB 3VD5A 1QHQA 1JERA 5JHDB 2QGDA 3OPZL 5FYLE 4D0CA 5C0CA 1KPRA 5GJTL 1IT9L 2GCYA 3VG0H 4UB0L 4NUMA 3C6LA 3GLDA 4FNUA 2Q8BL 5A16A 3TJEH 4KXAA 3FUIA 4Y16C 3QRGH 1IC1A 1YNLL 1RIUL 5EBLB 2AK1L 4X80H 2IJ0C 4KV5F 3ZGIA 5CCKH 1MUJA 5A2LH 3NZSA 1UXSB 4NN6C 1I7ZA 2JJSC 2UY7B 3C5SA 1BOYA 2P9RA 3OR7A 5D1ZA 1KEGH 1OB0A 3BDYH 4KRPD 3QA3A 1KBBA 3WBDA 2I9TA 2ICEA 2H41A 4AQ8C 3KPSB 5AZEL 3ULVC 3HLAA 3WNOA 4MA8L 1J1XL 4WCYL 2D8KA 3AXIA 3PAZA 4M7JH 4ORZC 1FV1A 4P9MH 4G5ZL 2GABA 4A68A 2XICA 2FD6H 3C08H 4M5TA 2BVQA 1H9VA 5D2LB 2AJVL 3EHBC 2H32H 3K71A 2E9WA 1MFDL 1U3HC 4XWGL 1HILB 2A4ZA 2YJQA 5I5IA 4ES9A 4KMQA 4Y5VB 1BSIA 5C0AA 4LSSH 2VUYA 3VFTB 4WU7A 4OZ4B 3WFDL 1P7QB 4GFTB 4XMTA 5DA0B 3MJ7A 3DK2A 3IRZA 2J8HA 2GEEA 3RU8H 4HZLA 3MRIB 1FVEB 3EOBA 4K8RH 4K3JH 2AJYH 3QUMH 1I7TB 1Z0NA 2A74C 4WUUE 4HGWA 3V6OA 3KHOA 5KANG 1E4HA 2CHZA 1A2YA 4GMSH 3VRJA 4Q9CA 2XT1B 4BINA 2VC2L 2TAAA 1KIUA 3DV4A 3MO1A 2WNWA 2PCYA 2P5ED 4LP4A 2CK0H 2AP2A 4WK2B 1BF5A 2EEAA 2O1AA 4ERSH 5FK9B 5C92A 4W9LC 1KIRA 1UEMA 3DUSA 2XKNA 4PU2A 1INQA 4FABL 1QVOA 1GCYA 3D34A 1AY1L 4H88H 4N2LA 4Z7VB 1IE5A 1C9SA 2FUQA 3VW3L 4IRJA 12E8L 4R4BA 4IIQA 4BJLA 1HHIB 5HI5D 1B0RA 3CFBB 1R5WB 2OYKA 3LKSA 4OV5A 5JXAL 3PWUA 4AYSA 5CKAA 1HYRC 1BQHA 1CYWA 2ZCLL 3FT4A 5IBUB 3ATBA 4W9JC 3O45A 3BXNA 4HDIA 5MENB 4PSPA 5GRUL 3SPGA 1I3RA 2DPKA 3V5KA 5G4OA 1O9ZA 4FXGC 2AF2A 5SWQB 2FYYB 5C9JB 4M1DH 3MV8A 3NFSH 4IBWA 4W9DC 3RTLA 3VGAC 5KVDE 3BSZH 3EGDB 1CS6A 1ASOA 2A5UA 2YAPA 1N19A 1KBGH 4OI9A 1LYQA 4JFEB 2XLLA 3FQUA 1YYLH 3EYVA 4NKMB 4K15A 2RQEA 4XBMA 2E76C 1TZIA 2LU5A 5BZWA 3IN2A 2EE6A 3DWTA 3Q3GB 2FB4H 3TL5A 3WIHA 2AITA 4KITB 4FEMA 4LSPL 3ASNB 3UTSD 3FSAA 2OMUA 4M1GH 5I82A 1GCFA 1CDBA 4NLHA 4ZOAA 5IBUG 3PHSA 3H1ZA 3GI8L 4YHZH 2X4SB 2ZF9A 3K0WA 4QHMB 4HFUL 3JWOC 4F80A 3DA0A 5SWSE 3KWTA 1OAZH 2VZTA 3H2PA 5AVQB 1NCCL 5F7WC 3FCGA 2D9CA 1ZEAL 4A38A 2DWDB 1Y6NR 15C8H 4XP1L 2B3RA 4H2AA 3GIZL 3JV6A 4H8QA 1J0ZA 2WZ5A 2V9RA 4L4VE 1G4RA 3ZIMA 3QJHA 2F7OA 4UIMB 5GS1A 4F33B 1XSIA 1XGYL 1MRCH 1KXTA 5TGBB 2MOVA 3ULVH 4OTXH 2X70B 2C3WA 3UTQA 2VE6A 1L7TH 4JVUA 4LLDA 4YDIH 3UC0L 2XWXA 4M8QB 2MIZA 1IEAB 5DEFA 4EI5A 2WYHA 3TNNB 4HFWA 3CVHL 2P48B 1Q9WB 3BPNB 2WXNA 2CUAA 3FU6A 4WEEA 4XNMB 1S7RA 4R7VA 5DFVC 2J6EL 3VYNA 4Q7DA 5F96L 2D0HA 4AG4L 4D9LH 2P7TB 3U2IA 2MPVA 1F4YH 4WUUB 2QQNL 4I9XA 1I9IL 4BFRA 3GSVA 5KVEL 1A6TB 1CXHA 2JXMA 4FFWD 1P5VA 3RGVB 3AS2A 4GW1B 2IDTA 4P46A 1HFUA 3EF7A 4PN6A 2OTWA 5ANHA 5FGBC 3CU1A 1LMKA 5DRNB 5FM4A 1KFAH 1DO6A 1WIUA 2WJ5A 4PB9L 4R7XA 5G4NA 4KZEL 1BVKB 2XA3A 1ZAGA 5G4MA 1M71A 4F9PA 2KS0A 5IIEA 4ODHL 3SSGA 5IJKA 1P1ZA 4F91B 5D7HA 4IMKA 1RFDL 2QMKA 3F2LA 2Q3ZA 4FQPA 3SOBL 3SZKC 4B53A 4ELMA 1V54B 4CU6A 1E4XL 1AIFA 1R3HB 4YFDB 5IK3A 3AG1B 5E6SB 4GFXA 1OXYA 2LU4A 5A2KH 5DUPL 2GK0B 1JYVA 1ZK9A 3GJEA 3L5HA 5GS0H 3QEGH 3KPPB 3PP3H 4EQ2A 2G9HB 3L4CA 2BX5A 4L3FA 2V2TA 4PMEA 2DH3A 2VR8A 3LMJL 1X7QA 1DDTA 1XO8A 1BX2B 2JJUA 4C58B 1FYHB 4PJBF 3BPCB 2GJPA 4LB8A 3VFMA 3ZKXB 1E8XA 3CWGA 4UU9B 2FGWH 2IADA 2WZ0A 4Q6YA 1RPUA 2E9JA 1EEZA 1HHGB 3FQRB 1MI5A 3CC5A 1W15A 4DP2X 2RB8A 3UBXG 3KH3A 5BRQA 4MNQD 4UOJA 3KXFA 3GI9L 4K9JA 3QORD 4H26A 5F93C 1DQIA 5HDRA 3BWAA 1YY8B 3INUH 2D4FA 4P4KD 1JPSL 2X5PA 1G1KA 5E1IA 1HI6B 3ESPA 1QLFA 1R5VB 5HYJA 3VD0A 3FRUA 3EDFA 4X8JB 4PGEA 4WI7A 4PLKC 5K9JL 4GO8A 2BRRL 2QVKA 1HS6A 2ICWA 4JRXA 4HJIA 4DKDC 2FZ3A 1IBBA 1U91A 5GPRA 4XBEH 3BZ5A 3VH8B 1PKQE 1FL6B 2PCPB 1A7BA 5DYFA 2YAOA 1TTGA 2YN5A 4YDKL 4N24A 5SWSB 4O2FA 5FYKU 1F00I 4KI5E 2HVJB 1WA2X 2KT6A 2OSLA 4FQLL 2N1KA 2O5YL 3QJOA 2X4RA 4OFDA 3LZRA 5K59E 3U4KA 4K7PX 3MLSL 5F1KC 3HE7B 4DN3L 1P7BA 1IV8A 4DAGH 5JA9A 4OFVA 4PS7A 2ODHA 4L4VB 4UM9B 4NHCL 1Y6MR 3ZRFC 5AW5B 2AJUL 4G1EA 4A7UA 4IOFC 2FAUA 3WEMA 3KLHC 4WKXA 4B9ZA 1EXGA 2WZAA 3IDMB 2BDNL 4R7NA 2BVOA 2VISB 1SOSA 4L8SB 3CFTA 3PGCB 4OBSA 4XVUC 5D96C 2AV1A 3C8HA 5CBAA 1NOAA 4JREB 2NT0A 2F53D 3D69B 4D8PA 1MH5A 1TVDA 2P8MA 5L2JA 1L9OA 1WA0X 3WTUA 3QDMA 3MRQB 1NM9A 3BHBA 3POCA 4MJHA 4AV0A 1CGUA 1CXLA 1NMAH 4PJAF 1D5BA 4MBRA 1JRHI 1BOGA 4JFOA 1FUNA 1NOLA 5C07A 5AOIA 1OVZA 2L7QA 4TF4A 3RVWD 4RGOL 5L4MA 1IGCL 1NEZB 3BE1L 3PNWB 4RMSA 1T83C 3WKMH 2ED6A 2J21A 3STBA 1RJYA 4HC1L 4S1SL 1EANA 1EZSA 1WH0A 2XVBA 1DQDL 2ZE0A 3MNWA 4PJ7F 3WIHL 3K4AA 3EYOB 1H15B 1CDUA 1YEJL 4OF8A 3T65B 3II2A 2VLME 2WKGA 2W9DH 3HHSB 1JIBA 2XCMC 2MQCA 3D4CA 4YUEL 3NP4A 2XTLA 4X8CA 4BFEA 4OIBA 3SE9L 1KTBA 4Z95H 2NLJB 2FQEA 3Q1EA 3UP1A 5BOPA 1T4KA 2NTSP 1SLXA 4I1PA 4BKLA 5ETUB 1RZIB 4NCC1 3E9TA 3ZYOA 5I0DA 4CDGC 3SDAA 1BXXA 4AZ8B 3KPOB 5LO7A 3NCCB 2QEJA 4AYFB 1NAMB 3DGGB 3BAXA 5IHWA 1UCTA 1NEZG 1J8HD 4YL9A 4BSJA 2F54D 2FDBP 4NBYB 2FX7L 5JXED 2RFXB 3BDBA 2AFNA 8FABB 1F45A 2YGVA 1CD8A 2XWRA 3I02B 3SHSA 5IHLB 1KG0A 2Z31A 2DW5A 5FDWB 4ZW7A 1UD6A 4IW4C 3N1FC 3O4OC 2B14A 4DFIA 1GYWA 3ZPDA 1UEYA 5GXBB 1SLVA 1P0SE 2K4WA 2G4EA 3MBED 3B43A 3PY9A 1F97A 2M26A 3F7LA 4M93B 2EIZA 1H8NA 1XIWD 1FNEB 4M6AA 4Y9GA 5DRXA 1NPJA 4JY5H 4L29B 3SPVA 3SGJC 4P3DB 3VFUA 5C70A 4WEUD 1GMIA 5CGYD 3IDJB 4AQ1A 3CE1A 2L7EA 1QMUA 4KXZI 3AITA 4XVSH 3C9NA 4ETYA 3L16A 2QLVB 1ZS2A 3ISWA 3MVSA 2A6KA 3C2AL 4Q9BA 4ZAKB 1E67A 2F5AL 4GH7B 4ZW8A 3GBNH 4JRWA 1SF5A 2CKNA 3KLQA 1JWMB 3B6SA 1MCPL 3OKNB 3UG5A 4Z7NE 1ED3B 1VESA 2FR4B 3G5ZB 4FNTA 4HCRA 4KVCL 1IMHC 4OCSL 3TWCH 1U58B 1PKQB 2VMCA 4DP5X 4NUJB 1VFBB 1G84A 3GQFA 2VL5B 2BVPB 3W9DA 2Y1YA 3PHOA 1FYTE 3DGDA 4PJBA 5HJDA 4DQOL 2ESVA 3P69A 4LSQH 1DCLA 4URTB 2XXCB 4KTEH 1AO7E 4TUJB 4JPIB 3FZUC 4TSCL 4DP7X 4QRPD 4W9CC 1T1YA 5EA0L 5AYUL 2I85A 5FYJL 2ZP8A 4DW2L 3O3BB 2FE0A 1OCZB 1HXYB 1ACYH 4PY8I 4DVBA 3PRZA 3D39E 4OH2A 1C8QA 4GG8A 4TKWA 4AEHH 5GIRA 1U2HA 1U36A 5IZ7A 3R8QA 5GHWL 3VX0A 1A7OL 5J1SC 3DTXA 5IB2A 4GAYB 4XMLL 3IJHA 1Z9LA 3RNKA 3RL1A 3ATDA 3DIVA 3CZUB 1YN6A 1AD0A 5KAQG 2V5MA 3M7OA 2P45B 1CXKA 2DDQL 4JO2H 3L3KA 1U95A 3MRCB 5A1AA 3K72A 2FX9H 3SCMD 3VFSB 2XQBL 4XCYB 1GGBH 3CHOA 2DQFA 5CJXC 3U30B 5FECB 1BYOA 1ACZA 4MCZA 5EF0A 3BKCH 4O2CA 2BXYA 4IJ3C 1FAKT 5FW8A 1MIML 3U4EA 3OKEB 1L9MA 1J05B 2FSEB 2V2WB 3GMPB 5PAZA 3FO1B 1RUML 3EFOB 2HX8A 1U3YA 5IEHB 5EZPA 3L4ZA 5BS0D 5J11B 1BREA 4XH2B 1JXKA 3NPZB 1JNJA 3BH9A 4NAMA 4S11A 1DEEA 1TVBA 4M48H 1YYML 3VJ6B 4PRID 4UTBL 3QZLA 2YIHA 1P5UB 2FECI 5G5DB 3DYOA 3QO1A 5EO9A 3ZU8A 1HL4A 3RKPA 3VD7A 2L0DA 4WI0B 4XP6H 1NC4D 3H9SE 4PJ7A 3I6LE 3A22A 1W8NA 2R0WH 3AQZA 5L6YH 1PL3A 4ZSOA 4A2MA 3GIVB 5JNYA 2D4DA 3VWJA 3LNGA 1ZT7A 5I1LB 1LK3H 2DIEA 1F86A 5KYUA 1HJBC 4KTGA 1TZOA 2WWMD 4BFBD 5DJ8B 1AC6A 2QSCH 1N9PA 4P23C 5EFIB 5H2BA 3CCHA 2VLJA 2EO1A 5L88L 5A3IC 4KNUA 3IFPB 2CLVA 3F00A 5L8JB 2ALWA 2ZPKL 4ZAKC 2WZPD 1XSKA 2CJSA 3NJXA 1HNYA 3TU6A 3H42H 3PWPE 3ZT5A 3U7YL 2FQDA 4NNYB 1M1SA 2H1PL 1AHMA 3QO0B 2VSMB 4QHUB 3LPGA 1CN4A 3WEXA 4OQ1A 1GZHA 1G7PA 2YPLD 5CINL 4BFFA 2P24A 4M00A 4X7SH 1ZLUH 2VZVA 5A43C 2D3LA 3OWRA 2WW8A 4S1QH 3WHE1 2F1BA 3RY5A 4ENZA 5C09A 4G7RB 5CEZE 3HZYA 2V2XB 4MAUL 5C7ZA 1FPTH 2C34A 3MRDA 3IDGB 3VTTA 4ANKA 2BP3A 4F15B 1JVOA 3KPQB 1M7XA 2WCPA 3IE9A 1PZDA 1EVTC 1X5AA 2CJ3A 2Z8RA 4IBQA 2X4QA 1FYTB 2CLZB 2Y6SD 4JN1H 5E95B 3PGFH 4EUPB 1IC5L 1C5DA 3U6RB 1GC1H 2JK5B 4LVNC 3SKOA 4YPJA 5DUBB 4NS0A 4PWFA 1AO7B 1JD7A 4IMLA 4IGBA 1TTBA 1N10A 2GKIA 1KC5H 1T7WA 4E5XG 4MQXC 3LYRA 2ZAGA 3KPMA 4Y4FC 3B9KA 3D39B 4PJGF 3O6KH 2FWLB 3B3BA 3NTCL 4R26L 2OP4H 4BZYA 5ACLA 1A3LL 1TEFA 2WY3B 4JM2B 1LGVA 2WXKA 2XZCH 3P77B 4NENB 1YEGH 2BP8A 2ENQA 2CH8A 2FYVA 1E6JL 4M6MH 4OT1L 3ZKSD 5HDOA 4AM0Q 4ZT1A 1L9TA 3G6AB 4YHIA 3MJ8A 3BDXA 1KB5A 3LZFL 5F88A 3EFFB 3UZQB 1PEWA 3LD8B 2PR4H 1ZE3C 2DTMH 5DVKA 4D0DB 1NMBL 2L7UA 3NZ8B 5E6ZA 1TTCA 1SEBB 4YSEA 4ZFOB 2NY1B 4QJ5B 1DJGA 1SFHA 1ZJAA 4OCWH 4AW4A 3PGDA 5IHUL 2MEJB 3P2DA 4KDVA 4PW3A 4D3CL 1OT2A 3FCSA 5EC2B 4L3EE 1XGTB 1JZ5A 3WJJC 1BFTA 2ADFL 2EH7H 2XTJD 4AQEA 2H7WA 5IQ9B 3MCG1 1RLBA 4ZUWA 1OKEA 3U9UB 1D5XB 1TF4A 4B5ZA 2MOQA 1BAFH 4PIBA 3PJSA 4U6YB 2EDMA 3AS3A 5C97A 4U6XA 5EDXA 4RZKA 4JG1L 3PS6A 1JVLA 2QPFA 2BIPA 2RACA 5BVJA 2Q76A 4H1LA 3L4UA 1UACL 1A4CA 2EABA 3HG1A 4KJPC 2XC8A 1MFAH 4JQVA 4JBSA 4BHUI 1LL1A 3DOSA 3QPKA 1CUOA 3D3VA 3DSNB 4OGAD 2K9UA 4Q58C 2N56A 4X4XA 2A4EA 1XR8A 2WXPA 2C9XA 3R4DA 3H0TB 4OFPA 3T09A 3SDCC 3U0TA 3OR6B 4L4TE 5DJCA 3QIUA 3FO2A 4K9EL 5I1IL 1RJCA 5KVMC 5E08H 3QUXB 3S3JA 1X7SA 3QCUL 4AC2A 5E0QA 2FWUA 3D18A 3H9SB 4XPTL 2ED7A 5F97E 5B38B 4GEJA 4I77L 4JM4H 4NQED 1U8KA 2JTYA 2FT6A 5EU7C 5F9OH 3S5YA 4DO4A 2QTEA 3DJTA 1ET8A 4PJHB 2Z64C 2X4NB 2A6DA 3V5HA 4OM1L 3CFEB 3CZSA 4AMKH 3VM5A 1N5AA 3IDNB 3RI5F 3DI2B 1NCBL 5KBMA 3SBPA 1U93B 4F37K 1IO4C 2EDNA 1OP4A 5PCYA 4BFIB 1VIWA 4G6JL 4GKNA 2UWEF 2UVFA 2ZWYA 4NO0D 5I5MA 4WI2A 4QRRB 5HYSA 2YSSA 2XG5A 3ARFD 1ORSA 3PWPB 4YXHH 3HMWH 3KYMB 3OKKA 3TEWA 4M9PA 3IT8D 2HH0H 4WO4D 4J3UA 5C6WH 1QRNB 3BN3B 2V3DA 1Q0XH 4BRVA 4A6YB 3N85L 5D7JD 2DQCL 4LSUH 3BAEH 1N12A 1NA8A 3NH7H 2OR9L 1KGJA 1OWWA 4RGMB 2GC4C 2K9FB 2AJZA 2BS8A 3S8WA 4A2DA 5DVNA 3ESMA 4JZNB 3QWRD 4OR1A 3TEZA 1NCWL 4M7LL 1UXWA 2M2DA 3B2DC 2GT9B 1REIA 4R4NC 3IMSA 3ARBA 4JQXC 1WITA 5TE7L 3T3PF 2C3VA 3FO9B 5DD5L 3L4YA 1I1AB 2IBBA 3FRPB 3EAKA 3WHXA 3RWHB 4QT5A 5J5EA 5B1JC 3WFEL 3RVUC 3QNFA 3IE4A 2WLLB 3LD8C 3OKYA 5I1AB 4EOWL 1A14L 1CFTA 2C1OA 1IGJB 2PMZA 3ML8A 1YO4A 1XH3A 3TV3L 4BK5C 3O8XB 2AKRB 3IXAA 4JCWA 1NDGB 2A9MH 3QT2A 2XA8H 2Y25A 4GAAA 3NCMA 2YRPA 1W2KT 3HS0A 5HHOE 1MFUA 4NQVA 1EFXA 3KPRD 3ZVVA 3VD9A 1L0XA 3CV5A 4FXLA 4XOAA 1W8EA 2HSIA 3UABA 3FU5A 4W9KC 3NRQA 3I85A 1PY4A 4U1KA 4LXFA 4DFHA 3RWJB 2FIRT 2WCGA 4Q89A 2WXIA 4TPRL 3CXHK 4GP5B 1UUNA 4PIRF 3FQWB 5CLXA 3FRPG 3HTLX 4RQQB 1ND0A 2FEDD 2HRPH 3A23A 4PEEA 2NNXA 4WEBL 5EN2B 5IW1A 3I3EA 3PWJB 2ZXQA 4QLWA 1UOWA 5AAWA 1B9ZA 1S9YB 4PJGA 3PJNA 2VXVH 2APWA 1JF1B 3BH8B 3VM7A 1NFKA 4NKIH 5DJ0B 2NXYD 2J55A 2Y07L 3H7BB 2DAVA 1DVZA 5EIIB 1MHPL 1QKZL 1OGTA 1T4WA 3NESA 4OZGF 3T2NH 3OMZA 3QUXC 2CM5A 3WLWD 4RIRA 5EEUA 3KHQA 1UWXK 5AB1A 4L4TB 1VKXA 2BK8A 4Y16D 3K2IA 3LQAL 4LVEA 2WOYA 1LWRA 2HTLC 4EI6B 1T0OA 2Q87A 4J2XA 1MHHB 4P2OB 1LE5B 2IGLA 5FYKL 1BVNP 1PLCA 3MLRL 1ECZA 3L3HB 2WO2B 3IKKA 3DURA 4KK9C 2NY7H 3VDAA 3X11A 4F92B 1IBFA 3PPSA 2HT3D 2DY2A 1A3QA 1OHZA 4M7ZC 3O3EB 1HEHC 5BUAA 3QVAA 5IROC 2DLFH 4HCRH 4J3OG 5E2UL 3PQYE 3AQXA 4MXQC 1OIOA 4P07A 1J86A 2C9AA 2D0FA 3H54A 3QWOA 4N2HA 1MFVA 1MCQA 5D7EA 3RKDD 1MLCA 3RWDA 5C0JA 1ZLVK 3P11H 2OTPA 1IL1A 5IESH 1ZIBA 3B9KC 1IGIL 3SD2A 4JKWA 4PRPA 1AZNA 4J6RH 3SO3B 3LH9A 3L3JA 1A1MA 4LCIL 4XE5B 3DRQB 5HHXL 4OLYL 2P28B 3CFCH 2EDQA 1K8IA 3UYPB 3HC2A 4K3EL 4KDTA 1MPAH 3BT0A 1ZK5A 4XP4L 1RI8A 3MNMA 4DP8X 1DBAL 3X14B 1M57B 4PJFF 3QUYB 1VCAA 3BCDA 4LP8A 3HB3D 4UUJB 3WN5A 3QHTC 3VQ2C 1M2VA 4M29A 5E6IC 43CAA 5JO5B 3WNMA 3EYFB 3O4LE 5MEOB 2XDHA 3RWIA 4W4OA 1AQKL 3CD4A 5FF6B 5C71A 3J27A 5HYQA 2CXKA 4JR9L 1XBDA 2UWEA 4WO0A 4J7RA 4XN2A 1CDGA 3C8KB 1G9NC 2ICWI 1U4EA 2MOGA 4I1NB 3WFBH 2A38A 2H6UA 2YFNA 2Z8SA 4H0GA 1C12B 5IQOA 4NKDB 1NGXA 3KCPB 3RNQB 3QYMA 2E4FA 3A24A 3SPIA 3QXDB 5EO0A 1EQWA 3AT9A 3FF7A 3LV3B 6FABH 4BSVA 2YD4A 3P9LA 5IVNA 3L7FA 5HHOB 1YNKL 1UM5L 2PYEA 3GSNB 5C6TL 1RMFH 2NCMA 3VNZA 4DVRL 4AQZA 2NTFB 3AQDA 5IUSA 5DF0A 3FN0L 3HUJE 3I3DA 1BFSA 4L37B 3UZVB 3BKJL 3KL5A 3RVVC 3K6SB 3DRTB 1JK8A 3MRLB 3GSUB 1MIEL 4LKXB 2JIXA 4J3OC 2A77L 1UM6H 3KM1A 2LGNA 2AJXL 2VJ8A 3KPLA 4HEPA 4O9HH 3MV7E 2A73A 3EJYC 4UNUA 5CHNB 5DEJA 1VPOL 1HNFA 4XBPB 5JHDD 4RAUB 2RH0A 5I71B 3GMLA 1JZIA 2MQ3A 2ZNWA 2DJUA 3D0LB 2EKSA 3X3FH 4DP4X 1B9KA 1KTJA 4E0RA 1SXCA 1JYNA 2BERA 3ZE0F 1TENA 4J8QA 7PAZA 2VN6A 4RCAA 4OF3A 4JZJC 1R24B 3GDCA 1KGCE 3BEWA 1T89A 1A8ZA 3MJ6A 4AYBA 1IM3A 4JN2A 4C4UA 4L5FH 4Q52A 5IFHH 2ZXGA 1T3FB 4MD4B 5FKAB 4U0QB 1OSEA 4U1IB 5GGQH 3O2WL 2EDLA 1DN2A 5FCUL 1OTSC 4WK0B 4YQXH 3CDZB 3KEDA 4C83A 2ZCKL 3KPSD 4NNPL 1TTFA 3BSGA 4O58L 3E6HB 1PX3A 3CK0H 4WWKC 5TE4L 4OLXH 5DHVA 3TYGH 3ARBC 1E90A 3G6JF 3T8XA 4GUQA 3PQYB 1IB5A 4FP8H 4M43L 4HS3A 4CNIA 2VR9A 1XCTB 1TQTA 2NT1A 2Z0BA 4GQ9L 3RWCB 1P7QD 5L8KB 1QHPA 4OZGA 3O3AB 1WUZA 2CR0A 2VLRA 2IPUG 3FUHA 4H20L 5DC0A 3S3PA 3FXIC 5IEKB 4XAWL 4MRCA 1AS6A 4UI2A 3BVWA 2OZ4L 3QUYC 3QZWG 2VDRH 5HYEA 5F7YC 1J0HA 1K5WA 1JV2B 3O41B 5H37G 4OCYH 1U8HB 3WS6A 2IG2H 5I2IA 4Q4EA 2WBJA 2H9GA 3P9WB 2LLNA 3VXME 3SE8H 2NYKA 3WUWG 2AEPL 5ICXA 1HYSC 4AGMA 4OIFA 1I8UA 3CVHA 3B5HA 3MNDA 2HFFB 4LLMA 1AE6L 5D70L 2R1WB 1WISA 4K3GA 3LXBA 2J6EA 3K6OA 1KB5H 3O4LB 4LCWE 5CMAB 5IMMB 1IC4H 1T04A 2EDWA 4YDVB 4NN5C 5ESAB 3D2UA 3C09B 5HDWA 1N6QH 4JFXA 4HK0B 1KULA 3VCLA 4J39A 1RURL 5AEAA 1F41A 2VIRB 3NUKA 3AC0A 3L5WA 1YQ2A 5FAAA 2NQCA 3DX1A 5EU3B 3ZRCC 5T3ZL 3W9EB 3NDYE 3BIKB 3IFNL 4XNUL 5AVTB 1IQWL 1G9NH 1S3RA 2NZIA 5ICYA 1FGVH 4PJFA 4R96A 5MEND 1ID2A 5J9PA 5C2BL 3H2WA 3HRPA 5IB4B 5IR1A 4H1LH 4PJ8A 1TJHH 5BV7H 1S7TB 3CFJB 4NQSB 1B4RA 5T5NG 1T5XB 1A3RL 1G94A 1YEIH 3HUJB 7CGTA 3V0DA 4OF7A 4AKPA 4N2FA 1CLVA 3BVNA 2I60H 5EEZA 2DOCA 3CN2A 1TCRA 2XFXB 4JFED 3T2LA 1U3ZA 4K2UL 3RY4A 1GS6X 5FM5M 5KSBE 4QRQA 4FZ8H 5F0PB 1OF2A 3H9YA 3WEBA 4N2MA 3UJIL 3BP6B 3ATAA 5FYLD 4X9FA 2VAAB 3LCYA 3ECUA 2QADB 2ZX5A 3NJIA 3T0EA 4B9FA 2ZSVA 3ROLA 2AGJH 4LLWB 4ZXBA 1JFHA 2JFCA 5ALBL 1L9PA 4DH2A 1MCFA 2Y1VA 4YHYB 1OGSA 4NZRL 2OMNA 3JTSB 3MX0A 3QZOA 3BWUF 3MGTA 3LRLA 3BEVB 4WW2B 4B27A 2FLMA 4OZIE 4KHXL 4AQAB 3ZQ9A 1OM3L 4KDTC 1A0QH 1I75A 2XPZA 4E9VA 4J1UB 3QQXA 2YRLA 3EOAA 2F8IA 1L5GB 3V4LA 1FZOB 1SBSL 3NSXA 3VXOA 4AX3A 4BE6A 4K7PY 2I69A 1BBDH 2R9HC 3BFQG 2K6YA 2J1XA 5CLYA 5SX4H 1K4CA 2HA1A 2X1OA 1UENA 4PJDE 2FHCA 2XBTA 1I1YA 4P59H 1QPKA 1PTZA 3I9GL 3D85A 3IM1A 1I4FB 2XBDA 2O93L 4OV6F 4TM9A 4YGVA 2H0EA 4PJEF 4XX1E 3TZVB 2JELH 4N26A 4XVUD 1ZVYA 5HY9B 5JHLL 1KTRL 3LS4H 1XB3A 3IWVA 4Q74A 4C56A 1IAKB 4W9GC 2Y7OA 4LCYA 2ZNXA 4WUUD 3ARPA 3CVIL 3GSXA 4PTUB 1GKEA 4Q6IC 5T1DL 3VB9A 3MLVL 4P2RA 3EO9H 2XSKA 1TZGH 3GB7B 3RGVD 3SPCA 3VXMB 1NLBH 1E5CA 1EUUA 3M8OH <