2EP6A

Solution structure of the second c2 domain from human mctp2 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
133
structure length
133
Chain Sequence
GSSGSSGDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords MCTP2 protein
publication title Solution structure of the second C2 domain from human MCTP2 protein
rcsb
source organism Homo sapiens
total genus 9
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2ep6A01
2JQZA 1DQVA 2B3RA 1DJHA 1RSYA 2DMHA 2QZ5A 2ZKMX 3T8MA 4QJ4B 5H4YA 2WXRA 4F91B 2WXOA 3B7YA 2LHAA 1YRKA 5CCHE 5CCGE 1TJMA 4QJ3B 1E8WA 3ZW3A 2FJUB 3IBEA 4XZ4A 2K3HA 4MJJA 5CCJA 4BGDA 4L1LA 4OVVA 4LCVA 4TS6A 4EZLA 4PS8A 1K5WA 1DSYA 4QJ5B 2CHWA 1UOWA 3NZUA 3L54A 5EDSA 4GB9A 1E8YA 3P2BA 1DJXA 1BYNA 1DJIA 4WWPA 4IQHA 4ANUA 1BCIA 3F01A 3TL5A 4WAFA 4F1SA 3HHMA 3ML9A 4IHBA 3SD5A 1RLWA 4NPJA 2CHDA 1RH8A 4Y1TA 3KWTA 3RDJA 3F00A 3OHMB 4G11A 3NZSA 1UOVA 1W15A 3APFA 3QAQA 4FHJA 2WXIA 4L2YA 3KWUA 4F92B 2D8KA 4HVBA 4FLHA 4OVUA 4WWNA 1W16A 3TWYA 3LJ3A 4EZKA 1QATA 4ICXA 4PS3A 2WXNA 3ZIMA 3QR1A 3L13A 3PREA 4A55A 2Q0ZX 3F04A 4LDCA 2Z0UA 2WXPA 2ENQA 2YOAA 2YRBA 1DJYA 3APDA 1QASA 1DJWA 2Y3AA 5G2NA 4XE0A 2K8MA 2DMGA 1UGKA 3FDWA 1DJGA 2R83A 4KZ0A 3QARA 3HN8A 3PYCA 3L17A 2NQ3A 3FBKA 4EZJA 2Q3XA 3DBSA 4FJZA 3S2AA 2WXKA 3PRZA 2NCEA 3ENEA 1TJXA 3L4CA 3MJWA 4FJYA 4FA6A 4FADA 3ZVVA 2BWQA 1E7VA 3DPDA 3N5AA 4LT7A 4PS7A 3CSTA 2ISDA 2FK9A 2CHXA 2WXMA 1WFJA 5JHBA 2WXLA 1HE8A 3L9BA 2V4LA 4ANXA 3R7RA 2WXHA 4ICWA 4URKA 4ANVA 3RPBA 2CM6A 4GNKB 3M7FB 2K4AA 4AOFA 1E8ZA 2A5UA 4V11A 1GMIA 4WEEA 1E8XA 4KZCA 3GPEA 2N1TE 4JPSA 3TJPA 2CJSA 2CJTA 2KI6A 1E90A 3L16A 4NP9A 3IM1A 4DK5A 5H4ZA 3ML8A 1DJZA 2X38A 4Y1SA 1WFMA 2UZPA 4F93B 2K45A 3QJZA 1E7UA 2NSQA 4TV3A 5KJ7E 3R7QA 4AJWA 3PS6A 4KITB 2WXQA 4L23A 3QK0A 2ENPA 3QR0A 3CSFA 3APCA 4NS0A 2A4ZA 4QAMB 4XX5A 1BDYA 2ENJA 4ANWA 2WXGA 2QZQA 3JZYA 4TUUA 4BFRA 4WWOA 3NSJA 3HIZA 4J6IA 2WXJA 1CJYA 4FHKA 3W56A 4HLEA 1A25A 3F05A 4L1BA 2CHZA 2RD0A 5JHAA 5G55A 3L08A 3OAWA 4NPKA 3W57A 2WXFA 3PFQA 5T8IA 4DNLA 2EP6A 2CM5A 4FULA 1V27A
chains in the Genus database with same CATH superfamily
4XO3A 2IFGA 3MQIA 4Y5VA 5DQJB 4RWHA 3I9AA 3UG3A 5B7FA 5F0JB 1J86A 1WUZA 3MRGA 2VRAA 2XV2A 3V7MA 1IEHA 4ATTA 2GW5A 4K9EH 2Q9OA 2AS5M 1AZCA 1HHKA 4HK3N 4LIQE 3CPUA 5AD0B 3GMLA 4A38A 1T0PB 1QFWM 1GCYA 1JSYA 1KGXA 3QPXH 2XVGA 4ZMTA 4TPRL 1RZQA 3MRQA 1AP2B 2OR8A 4X7TA 2QELA 4Y1TA 5GGRY 4UB0H 3S4SA 3EYFB 2NY4B 1FORH 4L4TE 3T71A 1BLIA 1SXCA 1U36A 1ZXKA 3C6LB 2Z4QA 2V0AA 3CWGA 4IRSB 4L05A 4NQDE 4HT1L 1I1AD 3HAEA 3OXRB 3EGDB 4IHOA 1KN2H 4DK3A 3WIHL 1UFUA 2WLIB 1BJMA 1UXWB 2AEOA 4KAQL 4O2EA 1TTFA 1HZHH 3IKKA 3SDYH 4PBWD 3WXWH 4PMFA 4IKKA 4MMXA 1ZT7A 1CB4A 5IJDC 1CICA 1FVCB 4UOW1 1YJDC 3DX3A 4NAMA 2R1YB 3F65A 5HI3C 3GKWL 3L8QA 1P9MC 3TONA 4JGMA 1JHTB 1LEGA 4U1GC 3UAJC 3I50L 3UYPB 4NKOA 1NCDL 1PYWA 3P0GB 4FA6A 2E47A 1FN4A 4NRXB 3SDAB 2OL3B 2C9UA 4HULB 1Z0NA 1XFPA 3ZZ1A 4RA3A 4HKBB 2BCKA 5FHAH 1TQBB 2WXHA 1XV8A 3S36L 1YYML 3N50A 3WAKA 4OV5B 1SGKA 2DWDA 2VSCA 5I5IA 4R97C 4FC3E 5AW0B 3MHZA 3TOPA 1F8TL 1MLBA 4M00A 3G5ZA 4UDTB 3X11B 4PJCA 1H15B 5D1XC 5FUOL 4JFFB 4ZJ9A 3WKQA 3BUPA 3BESR 2BJML 1TR7A 2X5PA 1OARH 5GS1C 3IRZA 4FA8A 2Y23A 5BPPA 1CG9B 5A6MA 3FFDA 1E5UI 2OR9H 5KYWB 2P44B 4HD9A 3O3BB 3NIDE 4YAQB 4LE8A 4JPVL 4ZUTB 1VFUA 4KXBA 2X3AA 1OXYA 4LLUA 5A43C 3KCPA 1RXLA 4N0RA 1EAPB 3QNYB 1BOGA 2WHVA 4LVOB 3O6ML 1SJVA 2KLTA 3SE8L 3ZE1B 4TUUA 1R3JB 2QADB 4AYID 4IBYA 2Z1PA 3X1GA 4JS7A 2VWEE 2JIXD 3FSAA 4TQEL 2F61A 4PVLA 3COOA 5HVGB 2P24A 3V4PH 3EBAA 3WKMH 1V27A 2W81C 4X4XA 3O8XC 4PRPD 1OPOA 1L5GA 4NT6B 4P5KA 3JWDH 2PO6B 2O6EA 4PJCE 1K4DB 2DLFL 1MG2C 3MA7B 4AYFB 5CR1A 3OR7A 2D7MA 1QYGH 1ZGLM 4G80A 3FCTB 2VDPB 3PNWA 3UTZA 4Z1PA 3RWEA 1DL7L 3FOMB 3RZWA 4WTXA 4K5LA 1EXUA 4XN7A 2YN5A 2MQ3A 2IH3B 2PWHA 5KSVA 3VYOA 2V7NA 2PPFA 5E1QA 4QT5B 3ZDWA 2G3ZA 2FX8H 2ALWA 1K8DA 3KM2A 5IVZB 2Y24A 4JW3A 3MO1A 4XP6H 1GOGA 3RZCC 3G6JA 5FYJE 4HIHA 5I1LA 1AZNA 1N67A 3LNHA 3PREA 4XP9H 3U2SA 4NP4H 5IW6B 1JF5A 3V0AC 4Z77A 1MCJA 1SXAA 4HSAC 2ZAGA 3GSRA 2GTZA 3KPOB 1XGUA 1QSED 2DM7A 5D2NC 5LNDA 4EN2A 3BSZA 3VFOA 2B20A 5EBLB 5A3ID 1QR1B 3ECBA 4LEOA 1ML0A 2JI3A 4WHYH 4J3OH 4HJSA 4TSAL 5HHOD 5DQDL 5E2WH 3SCMB 1T7WA 1X9UA 2ZKYA 2WANA 2D4DA 5EC2A 3ARBA 3CSTA 1BP3B 1HX0A 3M1OA 3B6SB 2HYMA 2QEJA 4MJHA 5C09E 5IW3A 1G0DA 4N90E 2EICA 4CVXA 4LPYA 5EZLB 5F7KC 3OF6D 1GYVA 1LQSR 4RBPH 3MBEB 5I8KH 4D9QE 2H6PA 2X1WL 1B90A 1XIWC 3VFGL 1YNTA 2E9WA 3AG3B 2XWEA 5GS3A 4KH2A 4WU7A 2WLHA 4YSTA 1V10A 1FFNA 4PRHD 3NABH 1AR2A 4NRZB 5KVDH 5GZND 4JFEE 1CWVA 3DBXA 4ERSH 4G7VL 1FGVH 2VLRA 3CDCA 1KIRB 1OCCB 3GO1L 1GA2A 1A14L 2YBRB 1GGCL 4QRRD 1BFVL 2A4ZA 4OZFH 5F0PB 3FSOA 5ITBH 4KNTA 4ACTA 1WISA 3DRTA 4JREB 4Z3EA 6TAAA 3FRPG 1C8PA 3F5WA 4Y2OB 2CHZA 1U58A 2VH5L 3QZOA 3A3YB 3HKZA 3U6RA 1FAIL 3LD8C 4NO2A 4RMVA 1I31A 3L95A 3QQ9D 4LOFA 3MOBH 3HR5B 1AXSB 2OM5A 3GTVA 4G2AA 1DVFD 2ZKXA 5MEPB 4ODWA 1AIFA 5EU3B 4PTUB 3HB3D 1DDTA 2KBGA 3A6CH 1TJMA 1HAUA 2P4AB 4JEGB 5CIPH 3VMOA 4RRPG 1OAJA 5CBEA 1YNKH 2W95A 1ILUA 4OW6A 4TL4A 3DIVA 2ARJQ 5CEXA 5MHSE 1ZEAL 2I26N 5EUOE 1VEPA 1Q0YL 1MNUH 1Y07A 2IAND 1M7DB 2Y7QB 3V79C 4WFGE 4QJ5B 1MF2H 3CFUA 1PZ5A 2WLMA 5IIEA 5ADPH 2C1OB 1UTDA 3QFGA 3K2MC 4F15C 3J7HA 5HDBE 4OB5L 1S7TA 2XICA 4BKTC 4DGIL 3U7WH 5IB3A 1CLOL 2Y07L 5T3XE 4JM4L 1KBBA 1NGPH 3NK4A 3NYKA 1T2QH 3PDOA 3QHFL 4GMTH 4TQHA 3U9PL 5L6YL 4LDEB 4LAJH 2BK8A 3LS5H 1E43A 3FCSA 3LZRA 1OV8A 4BDVA 2GEEA 3BN9C 3NZHL 1AR1D 1JPGB 4O58L 4WHDA 4AQOA 4OCMC 4UT9H 3LKSB 1HSBA 2W07A 3VXRB 3WTYA 4WQOA 2QR0B 2K6ZA 3GZOA 3FC8A 4FEMA 4G8GE 4BH8A 1NBZB 1KC5H 1CGSL 3U4EA 3BAJA 1W72H 5C3IA 4XH2B 4F8OA 2ZSWB 2J7LA 2A9AA 3I9PA 5KOMC 2F8OA 3MGAA 4TSCL 1P7QB 1XF4B 2JKJA 3IF1B 3QUZB 5JHBA 2IPUG 1RU9H 4RNRA 4IKJA 4PGCA 4HOWA 1TCMA 2FBOJ 5DHEA 3I75A 2BO0A 5L4IA 5MP6L 1R3HA 1N70A 5BZXA 2MNUA 2WOYA 3OAYH 1UZ6E 1DE4A 1BAFH 5FOBB 4CVWA 3WS3B 2ED8A 4HHGA 5T1DL 1MVYA 1YVLA 4D9RD 3FN0H 3RDTC 2FJGB 1YPZB 1WFIA 3TIDA 4JRWA 3BDBA 4ODHL 4WFED 4UT7H 1MFBL 5EPMB 3FO0L 4O2FB 2BHFA 3C6SB 4NYLB 1TUPA 4N9OB 4OZIF 2VR6A 3ET9F 1YHPA 3VDCA 1IQWL 3OQ3B 5BJTA 5HVHC 2VL4A 3ARXA 3H7LA 4OLVH 1CJYA 2QHLA 3B2PA 4CADA 1BVLA 3O4OB 2X0VA 5I6XB 4QRUA 3RHWK 3GHEL 4XN2A 4L4VD 5DK2B 1G6RL 2ESVE 4GUCA 4PG9A 1ZHBB 3K8KA 1CXIA 2IBZX 1GZHC 3IDUA 5I71B 1T7YA 3QDJB 4ZTOL 4ETQA 3ME0B 1UD2A 3IT8D 3NCWA 5H37H 1CE1L 5INCB 3HZKB 4ZXBA 1A6TB 4MB3A 3RY6A 4HXBL 2FJUB 3C5ZB 3VDBA 4HIJB 4CC4C 1BXAA 3WY1A 1P5UA 1D9KB 2BDNH 5SV4A 1FPTL 3RX7A 3US9A 4OJFH 1Q9KA 1MCOH 3TTSA 2CLRB 1BWWA 1U41A 2CAKA 2OXHA 4LIQL 2OSXA 1PD6A 1JMXA 2EKSA 4L9LA 4WUUA 3QQDA 1M57B 3G5VA 3QI9A 1FIEA 5IMMB 2WKLA 4NFDA 4NO0A 1JGLH 4YR6A 1JGIA 5AVWB 1FC1A 2YN3A 2GC7C 2KLSA 2V9RA 1HZLA 4WZ9A 5D1QC 1QRNA 1WT5A 1YYCA 5CEYA 1AE6L 2DB8A 4IRJB 2CIIB 3JT0A 5E99L 2ZX7A 1N26A 1EH9A 4GKNB 5TD4A 4JMXA 2F1BA 4D0BA 2Z31C 2J1ZA 2WGNB 1OAYH 4HS8L 5C7XL 1LD9A 3BMWA 1IGCL 4ZUSB 2J1YA 1MCPH 5BS0B 4HWEL 5GGTA 2WNWA 4ELKA 1TENA 4OLZL 3VXTA 1Y7VA 2PCYA 3ABLB 1ROCA 3L1FA 1JZHA 1PLGH 1HL8A 3LNGA 4FJZA 3S2AA 4JFQB 1U8PA 4XP1H 3TYGL 2NCEA 1G43A 4ZYKA 1AO7D 3V5DB 1P69B 3OX8A 4WU5B 3FFCD 3MNZB 4NZUL 2IDSA 2B08A 4PS7A 3HBPA 3UC0L 2QGBA 1FG2A 2WVVA 3GNML 1EEYA 3UJTH 3N40P 4CUCA 4FQHB 1BVNP 5C0AB 4M3KB 4YS4A 2JB6A 1AFVH 1F4YL 2B1HL 3DX9B 1LLAA 1F4XH 4M3HA 1OSYA 3UEQA 2I7OA 4IBTA 1OGAB 1ZANH 3IGKA 2CO7A 5FYKE 3C2SA 5JMOC 4MMZB 3IM1A 5KYUA 1MIEH 1P4LB 2QT6A 3QXAB 5D7IB 5L2KB 1JAEA 2NSXA 4MNQB 4EXKA 4ZAKB 2CJUH 2AJSL 4GBXD 2BRRL 2R1WB 2G75A 5DS8B 4FFYL 1OD7A 4GRLD 1WDAA 1RP9A 5LQBL 2FR4B 1PS3A 4OCRL 3HN5A 1D3CA 3VGBA 2G3NA 2HRGA 4QHUA 3JWOL 4L3EB 4H8VA 5D7KE 5IMOA 4I9WD 1VERA 1E6JH 3IMTA 1YCSA 1XH3B 3RGBA 2WXFA 2O5ZH 1U4FA 4L37A 3WFDL 1NM9A 5AAWC 3D05A 2FJHA 2EXYC 4F91B 5I73C 4MMYB 4XPGL 3P4LA 4M48H 1YRKA 5FYLD 1C5CL 4R5XA 4A2MA 4MJIA 1FE8H 3NRQA 5HHME 1HYRC 4J3XA 4MVBC 2Z6FA 2ZXEB 1MFUA 3GRGA 1AGCB 5DEJA 1S3KL 2FGWH 3ABZA 4K3JH 1RUMH 3ZQXA 3KMDA 3MI6A 5SWSE 5I2IA 2ENSA 4PJ5E 5TQ0L 3PGDA 3INUH 3JBG7 1MWAH 1HXKA 1X5FA 1BCIA 3W0WD 2FT7A 3CBRA 4XRCB 4B9PA 3V5HB 2LQRA 4ETYA 1E5ZA 3WY2A 2HFEB 5EU6D 5C9KA 2XHNA 4JO4L 5I76B 3S35X 2EUVA 3CJJA 4XP4H 1TT6A 1I82A 4HJGB 2OP4H 3LZOA 4G5ZL 3TWYA 3SPHA 2V9QA 4LCWD 5F2FA 5BO0D 1JDAA 2FT8A 5F1IB 3W1ZA 1XH2A 3EO1B 2ZUTA 1NMAL 3HMXA 5IK3B 5FYJL 3ZR5A 3NMEA 2P43B 1T2XA 1X5GA 4IU2A 3ETBF 3QIBA 3SKMA 4KDWA 5DD0L 3PQYB 5JOFA 4DW2L 3MZGB 3EZJB 2Q3AA 1Q0XH 1WRFA 1G0YR 3KJ6H 1LEKA 2UZIL 2VAJA 3D9AH 3ULVE 5IWLC 1PQZA 1MXDA 4K7FB 5DZLA 3SPGA 1IJNA 2NY0C 4EDXB 3FSWA 3FB7A 5BMFL 1R3LB 3IXTB 1KEMH 4U1JB 5E6YA 4RX4D 3A6BH 2DKSA 4FCAA 1IGMH 1PAMA 4XVUD 3BUTA 2OBGA 4LDLB 1UWGL 4M4RA 2ZUWA 2H1PH 2OTWA 3E8UL 4K7PH 2FIKB 4QWWC 3RWDB 1V5JA 3LRSA 4PQXA 3FB5A 4F7EB 1NGQL 4K3GA 1JNHA 3CHOA 1CFVH 4IW4C 1MH5B 4MSWA 1NPUA 4N8CH 5E8DL 4DVRH 4K5PA 4U7MA 5KVEH 1QW8A 4W68A 2HH0L 3BJ91 4HU2A 2P8MA 4KRPD 3Q9QA 4F8TA 3FONB 3HBZA 2YPLB 2ITDB 5J12B 2DQUH 2AP2A 2MKLC 5EN3A 3SGJC 1XB8A 1M53A 5GRJL 3EYSL 1MI5A 3S37H 3I3DA 4MA1B 1FO0B 1ADWA 4S2SB 2R29L 3P0VH 4JY4A 3LPGA 1NCIA 2R9HD 3GINA 5D9SA 5DTFB 1HHHB 2N0KA 3UGXA 3ZKMC 1VSCA 3X1EA 1B3JA 1GJWA 2BIMA 4Y19A 4DGUA 4HXAH 2D73A 4OJDH 3O11B 1TZGL 2XBTA 4MZ2A 5I66B 5JW5A 4P2RB 4F8NA 5JIDA 2XZCL 3STLB 1WF5A 3QHZH 3QORB 2IDUA 3CSGA 3NCJH 4A7SA 4M5SA 2BSRA 1ULVA 2EO7A 2HFFB 4OLYL 3WHE1 2F19H 1HIML 1KTRL 3M1BA 1QSFE 2CMRH 2BVUA 4OTXL 4YDKL 4Y5VC 2V3DA 3VWJB 2D03L 4AQEB 5AL8A 1XR9B 4Z7OE 4AEHL 3HHMA 1JOIA 2Y72A 1U2YA 4RWYH 3ZZQA 1RH8A 4JRYB 2B4CH 1XT5A 4N1EA 1NFDA 3DOSA 3OHMB 4HBQA 5K39B 4M7KL 2XWBB 4M7JH 4ZUUA 2I7SA 1BQSA 3U9WA 4CJ0A 4MDRA 4ZD3H 1D6VH 5HHNA 1C12A 3VFRA 4K4KA 1H5BA 4Z76A 1DQML 2JKRM 4Z7WF 5T3XL 1PX3A 4XMKL 3PGCA 4BCZA 4Y19E 3QQ3A 4PU2A 2J8OA 3F6JA 1OAUL 3GS0A 4BKLA 4W4OC 1N6QH 4CDHA 4JHWH 1KF9B 1NBVL 5BRZB 1FI8C 1X5KA 1CI5A 4QF1B 1DN0A 3IYLW 3BUYA 5G4OA 1KB9K 2IQAA 5FYLH 1COBA 2SODB 4KHTL 4NBZB 3JWOC 2VXQL 1PEWA 3Q8AA 1Y6MR 3IMVA 1D7CA 4LSVH 1IVTA 4X6DB 1NFDE 3PHOA 4MRBA 2QDVA 2Y1VA 3H9SD 3SDCD 4Z95L 2G5RA 5EDXA 1AOHA 1YAZA 4HFWA 4NO3A 5HYJE 2VWEC 5KSUB 5AALA 3RRQA 4XCYA 1E2VA 4XCCH 1WFUA 4DGVH 4OCWH 4IBZA 2UVFA 1G7QB 2X4PA 2X05A 4X8XA 1E5CA 4WW2C 3MRKA 1RUAL 1E7UA 4OQ1A 1F86A 1ZVSB 3W38A 4L29B 1YN6B 3KWWB 2H45A 5D96B 2Z8SA 3LQZB 1JWSA 2QQKL 3GD1C 3FF8A 1GYAA 4HLZH 2VERA 3SDXE 3VI3B 4BFRA 3W9EA 1I7TB 3NSJA 5LN4A 1GZQB 2DQJL 1DQJA 3UZVB 1X5XA 3WTXA 1A4KA 2GJ6E 5KVMC 1NCBL 5IB5B 4LAQL 3B9EA 3Q44A 3CVBA 2VO5A 4KJQC 1DEEA 1XZ0A 1HHGA 1UASA 4ZMPA 3GXTA 1ED3A 3HE6D 3KVPA 2ZJSL 1RK1A 5H94B 4GAGH 5FS5A 2VSDA 2IDCA 2Z35B 2EUZA 2XN1A 3K0YA 1P4IH 1TZOA 2K3HA 4JANB 3WAJA 3SE4C 4S0SD 1IKFH 1C08B 3KBEA 2PYED 2GUOA 1SHXA 3GB7B 3QJSB 4P5RA 3VWKA 4ZFOA 4G6KH 4M6NH 1F0LA 1VCAA 1KZQA 3C8KA 3QXWA 3PIQA 4GG8B 1CXLA 3VD7A 4WNJA 1DO6A 3RGVC 2YFNA 2E6QA 5ESVB 4EBQL 5CZXD 1ZS2A 4WKZA 1GTFA 1QI4A 3TPUA 3QZBA 1R17A 1HXMA 2ZPKH 1SBSH 2XI9A 1QNZL 4KFMA 4DN4L 3RIAF 3Q6GH 5IQ7L 4MS8D 5EU5B 1QASA 4NKIL 4YDJB 1J5IA 2C9PA 1EGJH 3ROLA 2OMWB 3NA9H 4FAAB 2A74B 4M5ZH 2AJZB 3PG2A 1UUSA 2PABA 4P4RB 3T3ME 3WFHB 1LK3L 4OZ4B 5L8KB 3PWPD 1FFOA 3EHBD 5F9WC 1TJGH 5FAAA 2VSMB 2O6PA 1OOAA 3EGSA 2B77A 2BRQA 4LQFL 5B4MC 1FYTA 1KCUL 1CLYH 5GRVL 1ZLDA 4KJYA 3NFNB 3OMNB 4H13C 4EQ3A 3ZDXF 4XPAL 4I87A 4UYPA 4AYEC 1MQKH 4HF5H 3CFKB 3OG6B 5F7NC 4GT7A 2NQCA 2GK0A 4TQPA 3S9DB 2I9TA 4N6RA 3PJNA 1ORSA 1T21A 1Q72L 3QHTC 2NUTA 1JZ8A 3RU8L 2W80C 3NCCB 2EEXA 3NCMA 1B0RB 1BFSA 4FX5A 3DDGA 4ODTL 3ZQWA 4HS6A 3MMEA 2VM9A 4KPHL 2BP5M 3BT0A 3E0GA 4QOKE 5J13C 3SBWA 2R8SL 5FYKL 3JYCA 5F70A 1HH9A 3L6FA 3QDGE 4LLMA 3V10A 3L5WB 2VR4A 4YFLI 1T5XB 2FGZA 1RIHH 4PJ7E 3L3JB 2W1NA 1IILE 3S5LB 2H26A 2MCPH 3LPFA 3TIEA 4Y16A 3TBYA 1IM9B 4F7PA 3N06B 2H0FA 1JTOA 3OJDB 4YSEA 3LKOA 1T66D 4PS4L 3RGHA 4MAUH 1NC4D 2Y9RT 3QEHB 4XVSH 5DSCA 5BO1H 1XD0A 3QUYC 3W37A 1TO4A 4M7LH 3FN9A 4Z3IA 2DMHA 1XGTB 3RWHA 2EDMA 3O0RH 3T5WA 2ARWA 4U1IB 5CUSL 5DQJA 5MEND 4XMWA 5DEGB 1KNOB 4G42B 2MTAA 4F7CA 5JR1H 4HJIA 3MJ6A 1KWKA 5IJVA 4L8DA 3FK3A 3OAZK 3MNMA 5E8PB 2V3EA 5F7FA 5C2BL 1P4UA 4XMVA 4DVBA 5CWSA 3SQBB 4KMLB 5AD0A 1FNSL 1A1OB 5DHYA 3JTSB 3IU4L 4UDUB 4ANUA 3P3RA 1IQDB 3IE4A 1PLCA 1AS7A 1KEGH 4XC1L 3CVHB 3KPPB 4KNUA 3WNOA 5EEWA 5IVXF 3O2WL 4I7ZC 3EYFA 3SBPA 2D7TL 1CE6A 2Y5TB 4ZDHB 3U2IA 4HVBA 1AC6A 3MODL 5E00A 3SJVB 3EXLA 3C6LA 4IRSA 3HJEA 1BF2A 3KPRE 1EEZB 3EGDA 4FTVE 2GG1A 2CGYA 4OQTL 1AHKA 4OF5A 2WSKA 2XKSA 1F2QA 3AG2B 4LEXL 2XA3A 5BUAA 4N8UA 4LHUD 1MWOA 3PPSA 4NQTA 4IOIB 4X7FC 5HJ3A 5L9DH 5I15H 3MRPB 1AGDA 2P5PA 1I53A 3E6HB 1OE3A 3IDYB 1BYOA 5GJSH 3TNMB 5D7IF 4D0DA 4GG6B 3MR9B 5LG1A 1NCDH 1QFUH 1S4IA 5GGSY 3V5KB 1ID5I 4C4KO 3M45A 3TU6A 4KDTA 4Z0BH 3U83A 4HZ1A 1N19A 2YGNA 5AVRB 4PUBH 1IX2A 3RPIB 4NRXA 5T5NG 2B16A 1K9TA 3SDAA 2OL3A 3ARDA 3GSVA 3ULVL 1MOEA 2AAVA 1WUNT 3PU7A 2VMEA 5LNGA 1D5BA 4MQXD 2XV6B 2VDLH 1M2VB 5BS0E 1KGYE 1SRDA 4UDTA 4YN3A 4GMSH 1H15A 5LBGA 4KQ3H 4JFFA 3SPCA 4Y9CA 4URTB 1M42A 4HUUB 4OUUB 4LVHB 1XVSA 2J5LB 3D2UB 1GGBL 4HGMA 4Q0XL 1OT4A 4N87A 4YGVA 3PNRB 3N42F 4U6XB 5CFHA 5KYWA 3MV7B 3SN6N 4UV4H 1OP5K 3GI9H 4YAQA 2DTSA 4FLRA 3ISWA 3PWVA 1GOFA 1ECYA 4P46D 4UTAH 2X2HA 1ADQA 2NY2D 2WXGA 3E38A 3MRBB 2NYYD 1JHLL 1KUMA 5LXGH 5KG9A 1MAJA 1NAML 2W60B 4F7MA 2MWCA 4NGHL 1R3JA 1OSZB 4BQ6A 2PYFB 5T8IA 1U6AH 2KC0A 5IESH 2CM5A 4NC1E 4IBUA 2DL2A 4LOVA 2WBKA 2WXRA 3QS3A 3F12B 4E5XB 2HLFC 2VDOH 1QWUA 3ARPA 1J87A 2HJFA 5DT1L 2PO6A 3G08A 3IKCB 1K4DA 3GMRA 2GBUA 3MA7A 4JFFE 5A2LH 1DZBA 1GC1H 1LE5A 2D31B 2HTLC 1TFPA 1U42A 4XWGH 3ZYZA 1EERB 4OY9A 4PW3A 3GHBL 3FOMA 1M71A 3NJIA 2I5YL 4FN0A 3AWEA 2JIXA 1XR8B 3LN5B 4IHBA 3UJJH 2IH3A 2DEYX 4R7NB 5DYFA 3DX7B 2FJFB 1ZV2A 3DV4A 4QT5A 2VW6A 4AKQA 4ATWA 1W15A 4PRPA 3BFWA 3ZE1E 4KVCL 5IVZA 1PEZA 4GUQA 4DO5A 1EEUA 1CYWA 5AOLA 5TF1H 3X1BA 1KCVL 1HILB 1IKNA 4UT6H 5A6IA 1CL7L 4NQEB 3QUMA 3K1DA 5IW6A 4NN7C 3P3YA 5HYFA 2AJYH 3ZMNA 3GLEA 4OGAC 3KPOA 3AGWA 4N2EA 3IETA 1XSJA 3VFPB 5EBLA 3IJSB 3HG1B 4X6CB 2WXKA 5E4AA 4M5YL 4I0PD 4FXLA 2OYLA 3ZVVA 4WKXA 4YHZL 3US1A 4HGWB 1UXMA 4XN9A 4B3VA 2XIBA 4QTHA 3PCYA 4M5TA 3TA3C 3BWAB 1L3NA 3HI6H 1ACYH 2IOIA 4PRBB 5JHLA 3RY5A 2FQGA 4LOUD 2GHWB 3MRLB 4PHZA 4LSPH 5L88L 1JGEA 4KJPC 4Z7WA 3BWUC 2FLBT 3T77B 1IEAA 4M1DL 3NPSC 2HMIC 5GGVY 3MBEA 4UYQA 5EF1A 3LZPA 3F2LA 1LP9B 4PTTB 1KB9J 4K3DL 1EANA 1WTGT 4Q2ZB 4G7SB 2BY1A 4QRQB 4J3SA 1FLRL 2UZPA 3K1KC 1DUZB 3BPOC 1G9ML 1V54B 3AM8A 3JV4A 3DX8B 4JRFA 3V0WH 4NRZA 4QRPB 3FO1A 3RBGA 4ZMOA 1IV8A 2HLEB 2J56A 4HISA 4A6YB 4YC2B 1SEBB 2YXMA 3QFJD 5HVWA 1FBIL 4APQB 1KIRA 3CFDA 3ATEA 3UYRH 3KPSA 2BOCB 1E9PA 4POZC 2EH7L 4G9FA 4BK5C 4UIKH 4JJHA 4PJBB 3CDZB 3QUXD 3PXJA 4FYTA 1UGNA 2ZSVA 4UU9B 1KIQA 3V4LA 3WKYA 1A6AB 2PW1B 4HHAB 3VGAC 2L7UA 4Y2OA 2KT6A 1PX8A 4ZFZB 1NAKL 1DQVA 1TLKA 2J3SA 1JNLH 3HR5A 1AXSA 5CCHE 5EU3A 4PTUA 1J7VR 3SGKA 3MREA 4JPWL 2HRLA 4XVOA 5TDOB 3D2TA 2DI8A 5D55A 1QNIA 1NKRA 5E0QA 4AEIL 3CC5B 2X1PA 4NZTL 3BQUB 4UI2A 3CFBB 2VR8A 3T0EB 4BYHA 1MJ7L 1KCSL 1QQDB 1UYWH 3KGSA 1XCTB 1M7DA 2Y7QA 3KW7A 5K33A 2HT2D 2LLGA 4OB5H 3UTTD 2OZNA 5IR1B 1OZTG 2LU4A 4M6AA 1B2WH 3RDJA 5MEOB 2XN9D 4HIEB 4MCMA 4YHKL 2UUDK 3ULVC 1OE1A 3X13A 1N59B 4QHKI 2IV8A 2A6KA 3MLVL 4XB8A 1HWGB 5DHVB 1KPVA 1UFGA 2ADIA 1K2DB 1RZIB 2BXZA 4X6DF 4DUWA 1KMGA 2ENQA 3AQYA 3FZUC 2BVTA 3I3EA 2VB5A 5IQLA 1U3HC 1QSZA 5F0MB 3FDWA 4AITA 1JPGA 4J5VA 4C83B 2WBXA 3LKSA 3CBJB 2HJLA 1KBPA 3QB7C 2RQ8A 1PPIA 2HLAB 4GQZA 1YC7A 2E9JA 3EDFA 3FN3A 2XBZA 1NBZA 2W94A 2ZNXA 3DTUB 4M8QA 2L7EA 2BVPB 3VTAA 4ONOA 3BAEH 3O6FC 4P2YA 5E95B 4XH2A 5B39G 2ZSWA 4PLKD 5C8JA 3VXSD 4UOQA 1HE8A 2A77L 1TOXA 3MBWB 1ACCA 3BVNB 1XF4A 3OZ9H 4JFZH 3ROOB 3IF1A 1N64L 3VI3F 2XYCA 4G6AC 3BCFA 1TVHA 2KLRA 3MNVB 4ZQKB 4YVUA 3LVTA 5IG7B 3KLHC 3HPJA 2RFXB 3CN4A 3R19A 4N68A 4XB3A 3GPEA 3FH5A 3TGXA 3UX9B 3X17A 3B2UC 5FOBA 2F74A 4NI3A 3WS3A 2PNDA 2J6EA 3IS1X 5CMAB 4OLXL 3T4AB 4CC0A 1T7ZA 1JXFA 3T2LA 3LIZH 4OSUH 4E9SA 3ETTA 2FJGA 3P77B 3P9MB 4I0CC 4LSUL 1KIPB 4HPYL 4MXWL 4JAMB 3VNZA 5EOTB 1CTNA 3VXRE 5EPMA 1FAKT 5F93C 5C0CB 4O2FA 2HKFL 2Z8RA 4WWKC 2AK4D 4JQVA 3L3OC 3CHXA 4U7KA 4Y4KC 1HT6A 4NO5B 1ZRUA 4P3CH 4MBRA 3OAWA 4P99A 2E6PA 2H1LM 1A2YB 3Q1SH 5DK2A 3QGVA 2YK1H 4TVPE 3TH3T 3T8MA 3WFZA 4WK2B 4EF3A 4Y1AB 1QKZH 3EJCA 4KKQA 4ZW6A 5EO1B 3TS8A 2DM4A 4KVPA 1EEQA 5TQ2L 2XFGB 4LKXA 4O51B 5CBAA 3KD4A 3ISRA 3LXBA 5INCA 2AC0A 3MYJA 4ZX5A 4NBXB 3BDYL 3ZIYA 4LEEA 2IH1B 2E7LA 4FP8L 1D9KA 3AREC 5FPIA 4F37F 2R2CA 2CPUA 1YPZE 2WQUA 4E9YA 5E5MA 2H32H 2DTML 2OX5B 3M6DA 4GXFA 4KH9A 4EI6B 2ADYA 1NOAA 2FLMA 1DFBH 3V4PB 5T5FA 5FO8A 1S3RA 5IM7A 2VABB 3ARFC 4JN1H 2FWSA 3Q9PA 4JDZB 5CZVL 3KWUA 1J5OL 3TCLB 2CXKA 4KMTL 5IMMA 5LG6A 3M7OA 4MAYC 3KEHA 3UBXG 4B6ZA 3AT0A 4MX7A 1MDAA 2O26U 4CKVX 3I6LD 5LJYH 3BAKA 2WWMD 4ALAL 2V2TA 3B83A 2CIIA 4GKNA 5J6SA 2AXHA 3EDEA 1J0ZA 2GAZB 3LNDA 3QDJE 1JZJA 2EUWA 2LFGA 1CLCA 4ZUSA 1G9MC 3P3TA 3FQWA 1YEWA 1CCZA 4XHJC 1BIIB 4XI5C 2HA1A 2K8QA 3BVTA 4JUSA 3FQTA 4NZUH 1Z32X 4JE0A 4F2EA 5IVXA 2AV1A 3T08A 3UTSB 3WFEH 3R7RA 3MNZA 3DI2B 4EIUA 5JXEC 5C0IB 5J06A 2NNCA 2Z7WA 3HI5H 2Z7YA 3OMZA 1UKSA 5JTWA 4FQHA 3MJ7B 3IDIA 1MRDL 3DGCR 3L4YA 2NXZD 5IHWA 1RI8A 3DX9A 4X4MA 2V6HA 1XGZA 3OPUA 1E90A 4X5WA 1ZAGA 1OGAA 2Z8WC 2X6BA 4MMZA 5AL0A 5D7IA 2WTRB 2ZD0A 4KXCA 3HR6A 3DSFL 4DGWC 5AW3B 3EDDA 4XWOC 4XBGB 4TUOA 4U31A 4KJWD 2EYSB 4ZO9A 1A6VL 2J4WH 2JF1A 1A7QL 2QPDB 1ZA3A 2DJSA 4L3EA 2OK0L 1GY2A 1DTUA 1MFNA 1RIVL 2B2XL 3NCFB 2ADFL 2BFVH 1XH3A 3TT1H 3VGFA 3HVNA 4KK9C 3UP1A 1GAFL 4W9JC 2F7PA 5LDUA 1L0XA 4KZEL 2NY3C 3ASWA 3WE6A 3QRBA 2WNXA 4GP4B 2BZCA 2E9IA 3B2VL 3QFDB 4JDEB 2K6WA 4MJ5A 1I1AB 4OLUH 1HH6B 2D3LA 3N9GL 1YY8B 1MPAH 3AB0C 4EI0A 2WB1A 2PTVA 3GQFA 4OZFB 4XHQA 2AZUA 1NSNH 3RAJL 5DEFB 2IV9A 5BCAA 1KJ2A 1OGAE 1RQ5A 1TIUA 2DYRB 5IVOA 1AGCA 3NZUA 4JVPA 3OJVC 4NJ9L 5L2KE 5LDSA 4MNQE 4U7SA 4UTBH 4G7YH 1PX4A 1A7OL 2WBJB 3DHUA 4IJ3C 4M7LT 4YK4B 25C8H 2UVEA 4OCYL 1S9XB 1OP3K 1YQVL 5DWUL 1U8NB 3ZXAC 2TAAA 2L04A 4ZOBA 3TBWB 3WL9A 4XNQB 2FJSA 1T4KB 5CIPB 1XH1A 2HFEA 2J72A 1D7DA 3PHQA 8PAZA 4L3EE 5I76A 4Z7QB 1DSFL 2C7UB 4O5LH 3V0DA 4ZFGL 1VPOL 3VWKC 4TTDD 5AKRA 1NCNA 2BNQB 2MPAL 1I7RA 1YEJL 4HJ0D 1RUKH 3TVMB 4CBPA 2UXVA 3N41F 2DBJA 2AXJA 4QIRA 5F1IA 2RQEA 3EO1A 5JW3L 4A2HA 4TLSA 4BE5A 4I1NB 1DJGA 3KGRA 5F96H 3O6LH 3BT2L 5IK3A 4DW2H 1JPSH 3JQOB 1ZTMA 4HAKA 4W9GC 4L4JA 4WDIB 3W0WA 4C54A 4F3FA 3BGMB 3THMH 4AC4A 1NOLA 4RMUA 3PQYA 1E42A 4NQSB 4Z18A 1EZUA 2CZNA 3PWUA 4AQ1B 1T5WB 2EXSA 3SO3B 2BS71 4EDXA 3EJTA 3EYQC 1R3LA 4XMZA 3QULB 5DVNA 2V4LA 1P5VB 4LNRB 5KBLA 5DUJA 2VDPL 4HK0B 4LKCA 5JOPE 1I9JL 3ZX1A 5KYYB 4ZMZA 1VFBB 3JVGA 3MLXH 1E8ZA 3FRUA 4F57H 3FQUB 4LBEB 1I3RB 3RWDA 1DQLL 1WTLA 3VD2A 3A0OA 3CD4A 3B7TA 4KKBC 1HC1A 2B14A 4L9DA 2B1OA 5IHZB 1W72B 5C0BE 1BBDL 2EE9A 4WO4D 2BWDA 4R7DA 3UEZA 1D5XB 3FTXA 4POUB 3MRFA 3VU2A 3QRLA 1THCA 2SEBB 3FQYA 2B3IA 3H56A 3OM3B 3BUDA 4CC1A 3MLTB 3FONA 3L4UA 2ITDA 1NMCB 3PQYE 1L7IL 1YMHA 4PD4K 5A2CA 4G8IA 5KTEL 5KZCD 1I8LC 2ORBL 5B3JE 3N85H 3ARWA 3TN0B 1TQCC 4L1HA 4PGDB 2AQTA 3QAZC 3RURA 1WBYA 5C0GA 3NDZE 2Q76A 1JL8A 4NHUB 1KLGB 6PAZA 2R7EB 1A4BA 3RUGF 1OAXL 3CCHB 1UVQB 1M9WA 3D85D 4XBMA 2ZF9A 4ALAC 4HPOL 3FUKA 2XWCA 4LL9A 3LHPH 4Y16C 2FAUA 1IBZA 3CSBA 1KBGL 4L1SA 2A9NL 5D6CA 5I66A 5ALBH 5AZEL 4P2RA 3W3BA 2C3HA 1AJ7L 3STLA 2AMGA 4R3SA 3UABA 1FZJA 2EDHA 3QORA 1MAMH 4BK8A 5B8CC 2PWFA 2D03H 2BP0A 2HFFA 4MA8H 3RKPA 1T0MA 1D5RA 1SMDA 3A47A 2QHRL 4JM2D 3F7PC 4P59L 4ZTPH 4XGZB 4EQ2A 1AKJD 3VWJA 1KV7A 2C9SA 1XR9A 2YPLE 3RHWF 5CU9A 3Q2LA 1M05A 4GRWF 2B1AH 1GGIL 3ZHDA 3GMQA 3L2MA 1QFWH 2UY7B 2JCCF 3GC3A 1XCXA 2HJKB 1DQMH 1WK0A 4Z6AT 4PRID 3MUJA 2LTQB 4IBLT 3F04A 3U36B 1C5DB 4Y4HC 5FLVA 3ASOB 3GXNA 1YEGL 2X09A 3P11L 1YNLH 2X0UA 2Y1AA 2R0LL 2NY4C 4PJ9D 4ZFQA 1I9RL 3MLSL 2ZCLH 2XV0A 2NQ3A 1NCOA 1L9MA 4PLNC 3X12B 2GSMB 1SY6L 4NIKB 5DUMH 3RG1C 1RUPL 4JKLA 4FERA 5BRZA 4QF1A 3S88H 2GIXA 3KLAA 3P0YH 2CG9X 4JL2A 3QW9A 4ZW8A 2YAEA 4FQIL 4G1MB 4JRYE 1YUHB 4MXQD 4PJBF 4GO8A 4X6DA 4BE6A 2ZCKL 4AKPA 5IHBA 3H7BB 1LE9B 4WEEA 1OSPH 4XAWH 4NWTL 2XG5A 3BEWA 1A6UL 4WNQA 3ES6B 4OZGF 2IPUK 4UF7C 2ZCZA 1FNLA 1UJ3A 1KJVB 1DVFB 1IIIA 2ZXQA 1TQBC 4NC1C 4NM8H 3RWJA 3BKJL 1G7QA 4FQLH 1XL6A 4PIBA 5EOQH 3HTLX 3U1QA 3AT8A 4JFHD 5TE7H 4L29A 3BRGC 1RFDH 4TKWA 1YN6A 4IIQB 2VOTA 1DANU 5DJCA 3F62A 3LQZA 3UBFA 2OSYA 4QXGL 3SDCA 1G7MB 3POHA 3VI3A 2APTA 5AYUH 2BHZA 1GZQA 4JGNA 1YECL 3L5XL 2EZ0D 2NY1C 5LCVA 3JTBA 2ZUQC 1UWEL 4RA0C 3TBSB 4PJXF 5IB5A 3QA3A 9PCYA 4N0CD 1QLFB 2BNRB 3B7YA 4KROD 4BGLA 4RAUB 15C8L 2GSIB 2J8UE 2WN3A 4OF6A 4E0RB 2WYZA 5H94A 5I82A 1OTUD 4MLIA 1BVKB 4HQQH 3WJJA 2NUPA 3DX2A 5EU4B 1K6QH 3QNZB 3CFMA 2CKBL 1TYRA 6FABH 4IGBD 3C9NB 2XACC 5DLMH 1S5HA 1AR1B 5AAMC 4DGYH 3AGVA 2ED7A 2EXTA 4I8DA 2R51A 4HKXA 4ZMAT 5F1KC 3B9AA 5D7JA 4UM9D 3MLZL 3BPLB 3FT3B 5AZ2H 3P9LB 1MCIA 3L3DA 3PXHA 4LRNL 5DJ8B 5FF6B 4GG8A 1B0WA 3HNSH 5ICXB 4YHML 5HYIA 1E5AA 4G59C 2CO6B 1BBJB 3FTYA 5DI8B 3QIUB 1UACL 4NZRH 3QR1A 3EW3B 3L13A 2H3NA 4GKOA 1NCAH 1BLNB 2VDRL 2J1XA 1AGFB 1WS8A 4NKIH 4FNRA 4OFDA 4QAWA 5C0EB 2P5WB 1MEXL 1XB6A 5JXAH 4JG1L 4V1DB 1ZLVK 3ZTNH 2D7QA 5EU5A 4JHVA 5EU7E 1CZ8H 1KGCE 1VZIA 2OMWA 2B59B 3HZMA 1D6EA 2A6IB 3FL7A 2V5RA 4IJTA 1P1ZB 4KO5A 3ULUH 1O9ZA 4ONGH 2EDOA 3QDHA 4MAZA 4OZ4A 2DS4A 3VRLF 4BZ2A 4LFHG 3ARRA 5F9OH 1KCUH 3EUUA 3H2PA 5L2JA 4LESA 2WV3A 5C0AE 3WJLC 3N0AA 5AW7B 4KK5D 1DBMH 3NFNA 2G9HA 3E6FB 3FQNB 3SDDD 4HKZB 4TSBL 3ZTJG 5E9DD 3FH7A 4K2UL 1WE5A 3OWRA 4DWHA 1BJ8A 5FXCH 2I60L 4BFIB 3RU8H 3SCMC 1TMCB 4XVTL 3SKOB 1RHFA 1T89A 2YXVA 2BSBA 2GITA 3HBGA 3ZHLA 5IHLB 3JSSA 1NUNB 4HKJB 4Y9BA 1F90H 1QG3A 2BSSB 5JQIB 2FQFA 2NPLX 5I1IL 2FQEA 2E4FA 3EO0B 3T6WA 5CCKL 3QCTL 4XPHH 4HUMB 1ETZA 3CMOH 3MBEC 4AK2A 4KFZC 3TFKC 2WQ8A 1AGEB 1IAIL 3BVWA 3KNBB 4KTDH 9CGTA 1XL4A 4N5ED 2VLJA 1Z7JA 1FGNL 3HIZA 3N6YA 3NIFB 4TLKA 4B9CA 5LWYL 3MJ9H 2DLEA 4BFEA 1Z5HA 2HT4C 3DSNA 2RD0A 4AMWA 3OAZH 5K59E 2LT9A 3SOBH 2EEDA 3K72A 4E41B 4I48B 5BW7A 3OJDA 4YHYB 4KKCD 4AC2A 1E28A 1OAZH 2ZKMX 5E7BA 4ADGA 2AAAA 4UIMB 4X6FB 2X4SA 4O02H 2HB0A 3MBXH 3WCYA 1OWWA 4MZ3A 4U1IA 4JREC 2CDFB 1Z5LB 3ZHFA 3NRFA 1NEPA 3KJ4B 2JKXA 4OGQC 1E5YA 4LCUB 4JBSA 2J88L 3TASA 3EGXB 3NAAH 3FUFA 4KX7A 4U6VL 5E8PA 4WO0A 1BF5A 3BAXA 3P73B 4BUGA 3LKNB 5E6SB 3SQBA 1BD2A 1BMGA 2BVQA 1A1OA 4RZKA 4UDUA 3L1OL 4IS6B 1OZUA 1F45A 1QEWB 2ZTBA 1I1FB 5I1CH 4PBXA 3MODH 3UG5A 3VU1A 1V3MA 3LQMA 4ZX6A 4JFTA 2L8AA 3RL2A 5LGYA 4KX8A 5F71A 3ZE2B 3EUDA 4NSKB 5FUCE 1EPFA 3H9HB 2DQHH 3LYRA 4YDIH 1BW8A 1EEZA 4RGND 1CR9H 4MZIA 3WXVL 2YUWA 1WEJH 3H9ZA 4QNPF 3KYNB 4NQUA 1WFOA 2L7QA 2D9QB 2R69L 2DLIA 1WIUA 3BFOA 2R4SH 4IOIA 5J5EA 4XNUH 3MRPA 1BX2B 2DQFB 3TNMA 1CMOA 5A2FA 2O5NA 4CU8A 1ES0B 4UINL 3BZFB 4GUOA 4GRLB 3RTQC 1HN1A 1TU2B 3RPIA 4YSDA 4QHLB 5HDLA 2AKRB 3FUJA 3OPZH 3RWFB 1AHWA 1HL9A 3F8UB 1TXKA 4NRYA 3RL1B 3U0WL 3SJVE 3F7RA 1M2VA 1C9SA 7CGTA 2AQRA 2XQBL 4F8PA 1J48A 1FH5H 3S4SG 3DK2A 3MCYA 3QUZC 4LRIC 5DEZA 5FA3B 1RZFH 1Z9NA 3BXNA 1L6XA 4MBOA 3DO3A 5IROA 4OUUA 4BRVA 3ARGB 4HUWB 4Q89A 1F6AB 1G4MA 2PPCA 3D2UA 3ZLQC 4S0HA 5CD5C 4PP1D 5HHQA 3EDKA 3PL6D 3KYOA 1A7PL 3KYKH 3MRCA 1XCWA 1XF3A 4NUPA 4U6XA 3OMAB 3MV7A 4LSRL 1E30A 1L7TH 4TQIA 4GG6E 2X2IA 4KXZH 1PVHA 2WN2A 4JB9L 4PJ8A 2NX5B 1DBJL 2QFPA 1KB5L 1D2PA 1SYVB 3V4VH 4YDLB 1CIUA 3IGAB 5ADOH 2ZAHA 2VDKL 1MRCL 3NOIA 3Q2CA 5DD3H 4ZMYA 1OSZA 1ZK5A 3TURA 2PYFA 4Q9CA 3T3PB 3QUGA 5EU6B 5DT1H 5CR8A 4U1GB 4PD4J 2PTTB 4JVUA 1T0NB 4GLRI 2YUXA 2B0SL 3IKCA 3O4OC 4ZUWB 2E59A 1FVEB 3D39D 5F1NB 2D31A 3C5JB 5B22A 1OW0A 1GYUA 1NEZA 4R97B 3SKUD 2WWNA 1U8KA 5KW9L 3MV7E 2NW3B 3I2CL 3LN5A 4H1LG 3C5ZC 4R7NA 3VI4F 2VN4A 4QMEA 1VAHA 4KVCH 4R8WH 3RUGA 3EF7A 3MPCA 1GS6X 5GS1B 1D9KC 5JHDB 3QJFB 1SM3H 5HDOA 4GSDL 3FMGH 4XE5B 2NY5L 1H8LA 4DO4A 4I18C 1WVZA 3I6SA 3U7YL 1CL7H 1ERNA 2X2JA 1N2RA 3OB8A 1QFWI 2F54E 1HILA 1FO0L 1Y18B 5KSAD 1P7KA 3BSZL 1T6VN 2AQSA 2OTUB 3QARA 5E4EB 1GW6A 5LAXA 1NFKA 3E1ZA 3VFPA 1LWHA 2VYRE 3IJSA 4IRJC 1PG7L 4C56D 3HG1A 4R0LC 4YXLH 2AK1H 4P3DB 4ABQA 2MMXA 4JFDE 2MQ0A 2ZCHL 4GW5B 4MZRA 5HHPA 2ADJB 2PCPB 4IRZA 1GYWA 2JCCA 5JQ6L 5TE6L 1G7JB 3AY4A 3BWAA 4OGYL 2OZ4A 2JKWA 1EHKB 1HQ4B 3GM8A 1JPST 5DJ2A 1ET8A 2Q8AH 1IFRA 4IU3A 1JZ7A 4RISH 5EA0L 5DS2A 1MFAL 3A4FA 3BE1L 4HMDA 2EKJA 1RZKL 2JELH 4NOBA 4GKZB 4FYQA 3L2NA 4NQEE 3VUAA 3TBBA 4Q2ZA 4W93A 4J2QA 5C0RH 1J05B 3CZKA 1W2KT 3OLIA 4QI3A 5LBSH 1HDMA 4AV0A 2QQNH 4UBDD 4ANWA 4A6YA 3K7UA 3WTUA 1VEMA 2NT0A 3HG1E 4X6CE 5I8OH 4APQA 4EUPH 3ZK0A 3MXVL 1H3XA 2C3XA 3FO9A 1SMOA 4Q9QL 2A9CA 1G94A 1ZS8A 4IBSA 4PJHB 5DD5H 3BO8A 4PJBA 3ZL4H 3CDZA 3EJPA 5D2NB 4ZAKC 2BIHA 4UU9A 2EP6A 2WZPD 2YAFA 1A6AA 2PW1A 4K8RL 2FWOB 4LCIL 1FV1A 3CVDA 1HE7A 3O3AB 4ZFZA 3TBTB 1XGQB 2Z7UA 4FA7B 4OZGA 4Y9EA 5ISZD 3KXFD 4H0IA 4XPFH 5EZOH 3QQNA 3ZHKA 2KERA 2OMYA 4UQBA 5D1ZD 4AEIH 4XZ4A 3VRIB 3A4AA 5TDOA 3QFJA 4JM2F 5J6GA 1LP9E 1A1MA 3U0PB 3CC5A 3BQUA 3CFBA 3T0EA 1GS7A 1QQDA 3GSOA 1M2OA 4QRPE 3L5IA 3IDJB 2PPDA 3GPSA 2H4EA 1WFNA 1XIWB 4R7XA 1Q9LB 1WH0A 5IFAH 4WCYL 3MYZA 4PJXA 4RAVA 3P40A 3QPKA 4ZRGA 5KJRL 4U3XA 4Z7UF 4YVNA 5GSRB 5DR5L 2ODIA 4PM1A 2QFRA 3KPQA 4JKWA 3MUZ1 1VENA 4X80H 5AKVA 4ZSOB 5AW4B 5DHVA 1NUFA 4UUJA 3SE3C 4YXKH 1RZIA 4Q4EA 3ZGHA 1RK7A 4NNPH 3GS7A 2MOVA 1PFOA 4FXKB 3WDIA 3AT9A 2HG0A 1ZSDB 3PJSB 3BFQG 3DXAD 1SHMA 1G7PB 2EIZB 2VM4A 4WGWB 1PMYA 3N1PC 3WO4B 1XF2B 4HH9A 3WD5L 4FXGB 2VAAB 1EJFA 3IJ9A 4AGPA 5FW8A 5AB9A 1KLUA 1NIAA 4KUCD 3DTXB 2BVPA 2WXMA 4KQ0A 3ILPA 1UT1A 4E9XA 1J8RA 4OUOA 3GGWB 3MBWA 3ROOA 3BVNA 1DLFH 2XN2A 1T2JA 3QQ4B 1II4E 1N7ML 2WUCL 3UMNA 3WHXB 4DEPB 3WY4A 5JA9A 4KZDH 2BNUB 4UAHA 4HJJL 3FTVA 3C8HA 2Y5QA 3BN9D 3W11C 2RFXA 2DWSA 3B3IB 3R4DA 3GIZL 4YFLF 3FSZA 1RZJH 5DRZB 2ZYSA 2HX9A 4MCYB 4F93B 2WVUA 5KBDA 1M3JA 4O2CB 4XAKD 1OCOB 2UZXB 3P9MA 4U6YB 1SFHA 1UT2A 3QIWD 4FZEL 3B7SA 3VXSA 4JAMA 1GHFH 5EOTA 4DPAX 2DKMA 3ARYA 4PJEF 5C0CA 4UV7H 4WIQA 3IFLL 3S0PA 1LDPL 3QG7H 1RLBA 1NCCH 2L3BA 2PYEB 3CFTA 3OC8A 3W39B 4LCCB 4NO5A 5IJKC 4U1MB 1NCWL 1IGFH 4DETA 3EOBB 1JUFB 4HUKB 5J12C 3GXDA 4HC1L 1JZDC 3T8XB 3U9UA 5KN5A 5T1KB 4FQXC 4W9LC 5HGAA 4BBWA 1A2YA 1EQWA 1MVFA 4HWUA 3ZKQD 2YD1A 4OFYD 3VH8G 3LB6D 2UWEB 4ODUA 1CFNA 1L9PA 1WCBB 4MA1C 1B0IA 3WUZA 4UNTA 5JNYA 3GSNH 5EO1A 1EO7A 2CHNA 1ZVHA 1NWOA 1B0GA 2HVKB 5DHDA 2KZ1B 4W9HC 1CFQB 1CYXA 1FIGH 4FFZA 2VLLA 4FKKA 2ENYA 2XLLA 1MJ8L 4IOFD 4H25B 1JPTL 4PJ6A 2IH1A 5I30L 4YWGH 2LFEA 2IPTH 2W9EH 4BJLA 5KVGH 3EH5B 4YHNB 3ZGIA 2OX5A 4EI6A 3HPLB 1HESA 2N7BA 4PFEA 1UM4L 2VDOB 4H20H 3APFA 3RDTB 4ODSH 4CVUA 5I1GL 3N55A 4S11A 4JDZA 3O3DA 3T6ZA 3TCLA 5GS2D 4JE4B 5FDYA 3ZY7A 3AITA 4PJDE 1T1XB 2Q0ZX 3EJUA 3EJZC 4J12A 5EOCH 5TH2B 2FEDD 4N2GA 4P2QD 4R4FL 4XB7A 4FTDA 4Y1AE 4PLJD 3FAXA 5I8EB 2Q2LA 2YIHA 1N9PA 1G9NL 2GAZA 5A40E 1AH1A 2XZQL 3DBSA 4U1LA 1IBYA 1PNDA 2DQTL 5KS9F 5JORB 1PZ2A 1S6NA 4JG0L 1QZ1A 2YKLL 4U1KA 4FQ1L 3IDNA 5DFWH 2FK9A 4GT0A 3QJXA 3FCUB 4P5TC 4Z7NB 4I2XB 2P5ED 2EC8A 3U36A 4OBRA 3FRPB 5FCUL 3WFBL 1Z3RA 4MNGB 4K8RC 1OAKL 3K6IA 3KDMB 5F6HI 3CN3A 4AL8H 2ZP8A 1CLVA 3KS0J 2QPEB 5E6ID 3RX8A 4KNQA 2KZKA 2CK0L 3MJ7A 4PCYA 1MFEH 4YXHH 3HRPA 3CVHL 2XWTB 1V8HA 3OKOB 4JCWA 5C0DB 1X7QA 3D3VD 4JGJA 5MENB 2PW2B 2YD8A 2YD4A 1JHKH 3ZZSA 1A47A 1CF8H 4AZUA 2PCFB 5FR3A 3NESA 4PG2A 4WV1C 1NGZA 2EYSA 2Z31B 1USQA 3HNTL 1N0LB 3BVUA 3S5LG 5FM5O 2P8LB 1X5ZA 4KC3B 4Y0GA 2IIJA 1HEJC 4PY8J 2I25N 4FQ2H 2ZG2A 2E27L 3AQZA 3ZMRA 1N8ZA 5E5LA 3N3EA 4X0KB 3GZKA 5DO2D 3UTSE 4ENED 1UB6B 5C0ND 2M26A 1OCWH 4DZ8A 3DETC 1TNNA 5D96C 5CM1A 1OP3H 4Y2DD 1FZMB 5F72S 4OKVA 1YLBB 3BKMH 3QFDA 1U92B 4NKQB 1HH6A 2PUQT 4BZYA 1YY8A 4QHNA 2JB5H 2HPOA 1I1YB 4P2OD 3REWA 3TPKA 5IEKB 5DEFA 5K9JH 4ZQTA 3D08A 4HWBL 1JPEA 2O5XL 4N0YH 1TNMA 4X7DC 2E4TA 1UXSB 2ZOOA 3BX7C 3WUWG 4AG4H 2OV0A 2WBJA 5EU7C 4A67A 5K93A 3TJEH 1G6VK 1OF0A 3CMGA 2GBTA 1S9XA 2VZVA 3HS0A 4JKPL 4QCIA 4ZNCD 2WLKA 4G3YH 3TJHC 2YUZA 2UYLA 5JW4Q 2PP8A 1CS6A 3TBWA 2GEQA 3X3GL 3C60C 2R0KL 4XNQA 1T4KA 3BKCL 5F9JB 3S8WA 3SODB 3RIKA 4JZJB 1JNNH 1MHEB 1OL0A 1YEJH 2BS9A 1GL4B 2OTPA 5J9PA 1XGPB 2CCWA 3TVMA 5D5MB 4TRPH 5JW3H 5KVDE 4X50A 4F80A 3GBLA 4PGBA 3CFEA 3UROR 2E46A 1XWVA 3WKPA 2XKNB 5E2TL 4LSQL 1CL7I 3B2XA 3GF8A 3UXFA 4PJGB 4F2MB 2JTYA 1KTCA 2VC2H 4DUXA 3BGMA 1MCFA 2JLPA 5GS0D 4PN6A 1NPJA 5TDPA 3ZKXB 5DMYA 4Z0XB 5I73B 2QVTA 1T5WA 3OKEA 3SD2A 3VI4A 3Q13A 3VFSB 4F7TB 2GUYA 3WENA 2KDGA 3EOYG 3ARVA 1P5VA 2K4AA 2NY2B 4LNRA 2A74C 4UAOB 4FQJH 4JFXB 4LPUA 4HK0A 1ZT1A 3SGDH 4XPBL 3HC2A 4HEME 2FEEI 4B53A 3WGVB 1BZ7A 3JXAA 4Z7QE 4XNXL 1A4JB 2YC1B 5ELIA 3DMMD 3O3EA 2MOGA 2BNQE 4AIOA 4I89A 1RKRA 2YZ8A 1EZSA 2HT3C 3ZPDA 3DJZA 1D5XA 5CP3H 4Y8AA 2F9BT 5GS2H 1IBFA 3R1GH 4Y9GA 2GC4C 4IOSD 5B1AB 4WNSA 4L3CB 2ENJA 1IIKA 1RZPA 1FL6A 5GSVB 1MHCB 5B38A 2VQTA 4XOAA 5EORH 1XCQB 4HLEA 3TN0A 2QMJA 4OFIA 2YPVH 3D7PA 4XP5H 4MQ7B 3PAVA 4AYGA 4NPKA 3OXSB 1LK2A 4QGTA 4QWWD 2PWDA 1OTTC 1KLGA 4DEUA 5ALCL 3K2KA 4MXVE 1DYZA 5I6NA 1T1ZB 4EDWH 3CCHA 1P6WA 2AANA 2C1PB 4GAYB 4NUGH 1J88A 1YMMD 2NY0B 2Y06H 3KVQA 3M17B 2DYPB 1AJ7H 2VDMH 4YO0B 3U4BH 1BVZA 5F7UA 4B50A 5FUCC 2GTWA 1JZGA 1G9NC 1MHPH 2EXWD 2ZX5A 4TUJB 2G0KA 1U93B 4WWPA 1G6RB 3QRFM 3EJYD 4GXVL 3MOAL 4WTZA 2ZUSA 2EDEA 4P23C 1KIUB 5BRPA 4JRLA 4R90L 3BH8B 3HG4A 3D85A 4HDIB 2VZSA 4QXTB 4WWNA 4OGXL 2UY7A 3V0JA 1S2EA 4JO1L 3H42L 2VL5A 1MLCB 7FABL 4NQDD 4BQ9A 3X14B 3HE7B 5AWNL 2K6YA 2Z8VC 2R0LH 4I4WB 1MW0A 1C16A 5D8JL 1FG9C 1HCZA 2X4TB 4K07A 3NCEB 1I8AA 2DMGA 3OLGA 1RL1A 3WSQL 2FWUA 2F53B 2P80A 1URLA 4EI5C 2B15A 5JDJA 2G5BB 3L9YA 1QO3B 1ZT4A 4NNXB 4OIIL 5C92A 3MJWA 1XBDA 4YLBA 3JYBA 4PRDB 1RMFL 3MRRB 4EMZA 4OM0L 1A6WH 1E7VA 1QSEE 1HWHB 4GSXA 2E8ZA 1BAWA 4FQIH 2DIAA 3IMWA 4Z7UA 2W38A 4PRIA 2CM6A 1UD5A 4R2GC 1KGJA 3NACL 2VN7A 3IDYC 4K0OA 3PP4H 4G1MA 5IBLD 4AYDC 1U8HB 1YUHA 4PJHF 2AITA 5E7FA 1A6UH 4YUEL 4BFBD 1TETL 1LE9A 3T8VA 5DRXB 3WGUB 1JI2A 1VGKB 2FL5B 1E4WH 3ES6A 2DKUA 4EVNA 3GUTB 1CQYA 5IUCA 3GBMH 4H0GA 4K9EL 4AJWA 4PV8B 3IN2A 4KRNA 1NGXB 2OSLB 5EIIG 4JX0A 3TZVB 1E67A 3NJNA 4LHJB 4LK4A 3UBGA 4XNMA 4OI8A 3MUUA 3UBXI 1IM3B 3LV3B 4XO5A 5DMGC 3TH2T 2CGRL 4IIQA 1E6OH 3QPXL 2MFNA 4PRHE 1J8HB 1J1XH 2PXYA 4NNYB 2J5LC 4HJEA 1G7MA 3GYRA 3QJOA 3BRDA 5CF3A 1P53A 5ANHA 4UB0L 1FORL 2BP3A 2YQ3A 3TBSA 1JYXA 2JJVA 5GS0H 3AXHA 5C0FA 2WWKT 1F1AA 4C4UA 1KN2L 4CL7A 3T4YB 5J11B 1QTPA 4RAUA 4KX9A 1VACB 7PAZA 4JY6B 3LN9A 3NH7H 5IB2B 4GS7C 5DGQA 1E3ZA 5FV2A 3VXOB 1HZHL 4KKRA 5LGKA 3SDYL 1BVKA 4OD2A 1D7FA 4ZOEA 3WXWL 1VF5C 3QNZA 5IJBC 4FXTA 2WIIB 3RJQB 4PJEA 1N5AB 4NPYB 2V2XB 1EXHA 3TL5A 2V3FA 4UM8B 4AEFA 5FGBC 5J6HA 3K4ZA 3P30H 1OK8A 1BQLH 1Y0LB 2QPFA 4NQCB 1ZLVH 4H8WH 3SPVA 3ALWA 4K71C 4BH7B 4ELMB 2IANE 3FT3A 1RIUH 3LS4H 1OW0C 4LBAA 4JO5A 4KOCA 3KLSA 5DJ8A 5FHAL 5FF6A 1UG9A 2HRPH 4D0CB 2CO6A 1BBJA 3QIUA 2WXPA 3WMPA 5K5YA 2NNXA 4IGBA 5ANME 1AGFA 2HG5B 5C0EA 5I0ZA 2BNRE 3QZWA 1JJUA 4FLOA 5C07B 3GHPA 1OARL 4MD4B 1BM3H 3FYIB 1OGTB 4KUCF 4UWQB 5E4OA 1BQRA 1S9VB 2H2SC 2BERA 4UM9A 4J4PA 4HCRH 2A6IA 1EJOH 3VXPB 2ZUYA 1P1ZA 1ACXA 4BQCA 4MYPA 4PJFF 5F3BB 4CMHC 4PJAB 4KKAC 4AUUA 4EOWH 5DK0B 1AYRA 5J3HC 3B9VA 5HI4D 1S7RB 3HG3A 2ZAIA 3CK0L 3MROB 5D2LE 5DHMC 2AK4B 2CXGA 2WD0A 5C09D 4UCFA 4G71B 4HKZA 4OD3H 1PG7W 4N90D 1M7UA 2YAMA 5D1ZI 3V4PL 1MFCH 2GB2A 4Q52A 4XNDA 3WKML 4AGNA 4BFIA 4XMUA 4D7PA 1OCZB 4JL1A 3SKOA 1DQIA 1NA8A 3JWDL 4RFEB 4D9QD 4PCTA 1BFTA 2P5WE 5KS9A 2QPSA 4CSTA 4XXDB 4V1DE 4GW4B 1QYGL 1KJMB 2H3XC 3V0VB 3VFMB 3RGVB 1A02N 1MSPA 5JZ7D 5GZOC 4D9RE 3CNKA 2J43A 2BP8B 5BRQA 4JQIA 5B4MD 1AGEA 3KNBA 4BA8A 4Z78B 3BIAX 5EHFA 5GGSA 4WFEE 5G55A 2PP7A 2FX8L 5FGSA 2QV4A 4E41A 1U2CA 2XJKA 4I48A 3ARBD 2R23B 3IWVA 4XP6L 4APQC 1JTTA 2C3VB 4WTQA 1H6UA 1CTOA 4BHUA 4EN3C 3IBEA 4IMKA 3WN5C 1RVFH 3AUWB 4N0FB 4XP9L 1TTCA 4X5RA 4NP4L 1JF6A 2EDNA 4JFEB 4EZLA 4O4YH 2J55A 1ZLEA 3BWSA 1Z5LA 5CO1A 2XUWA 4HS3B 1R0AH 1UB5B 3GRWA 1NPNA 2YPKA 3EGXA 1TYJA 4AXWB 3V6OC 2VGLM 3IFPB 5MHSD 2VJXA 3P73A 5DJAA 3TXAA 3LKNA 5KSBF 3HC0A 3WFCH 5E2WL 3MRNA 4IS6A 4TLUA 3HAEH 1QEWA 1ZE3H 3CFQA 5DZAA 5IP4A 3NIFE 3KS0H 3KM1A 5D71H 3N43B 3BZ5A 5KVEE 3PJLA 2EVGA 1UEMA 1KXTA 3H9HA 4DJMA 4KK8C 2X4UB 3I6GB 3DX0A 1TCRB 5CXPA 2DIBA 3PV6A 5EUOB 5IB4A 5LN8A 5JPNB 4G8EB 3KYNA 3LEXB 1U3NA 1ZDQA 4PW4A 2JKSA 4K9EC 1J1OH 1CIDA 1NANH 3D33A 3VDAA 1X9QA 4NI6A 3NABL 1E2ZA 5KVDL 5TTRA 3RVTC 2EDJA 5IF0B 1BX2A 2W0PA 5TE4H 4ERSL 2DQFA 1FGVL 5D4QA 5AB1A 1QACA 1ASPA 3QYCA 8FABB 5HPMB 2N7AA 5HYQB 5ITBL 5CSBA 1E40A 1U9KA 2DI9A 4MB4A 3SHSA 2Q1EA 2QLYA 4I3RH 2AKRA 4QHLA 5G4NA 3RWFA 1N8OE 2XPYA 1ZY9A 3RL1A 3FFCE 3ZE2E 1VFMA 3MOBL 4WHYG 4YPGB 1ZWIA 4J3OG 5ERWB 1BIHA 3SGDI 4GSQA 3WNLA 2VDQH 5EF2A 1O9WA 3A6CL 1FWXA 1KENH 1ZPLA 3QZMA 3WV0A 2G4EA 4HZLB 2FT6A 4KI5E 3H2WA 1YNKL 4L23A 4WK4B 4YSUA 3WN6A 2VXSH 2DEXX 3LZQA 2YA0A 1S78D 5HI5C 1MNUL 3MACH 1SQ2N 2FZ3B 3WNPA 1MF2L 5IOPA 3T4AC 3TCTA 4AM0Q 3Q2WA 2OXGB 3IJEB 1KOAA 4TL5A 1X6LA 2NX5A 4QYAA 5JIIA 5JW4M 3U7WL 2B39A 3A21A 1ZTXH 1LWRA 2YJQA 3D5OF 3P02A 3SPIA 1OGSA 4U1NB 4GMTL 1P9MA 3H6JA 3AFLA 4M9OA 2NR6C 3LS5L 4I9WE 1PJ9A 3UAJA 2PTTA 5I1EH 3C8DA 2BCMA 1WG3A 4TS6A 4YBQD 1K5WA 4OZFG 5C6TH 3UPCA 4M02A 5E24E 5D5MF 2BW5A 4XO8A 4OLEA 2F0CA 4UT9L 4MNHB 1NQBA 5DRNB 3ELAT 5F1NA 4KTYA 1M7XA 4ELDA 2Q5BA 1ZV9A 2X12A 4OFPA 1KC5L 4H5SB 5I8CA 1YZZA 3E9UA 2WO3B 1KBKA 4UQ3B 5D1XA 5ACMA 1WLHA 4XMTA 1W72L 2NW3A 2WXIA 4GSDH 3QWRA 2ESVB 4WJKB 4AT6A 2NY5H 4G6FD 5GS1A 5JHDA 2NX5E 1RU9L 2FATH 3QDMB 2XBDA 1DBAH 3QJFA 1YG9A 4I0KA 5IMLB 2WMPA 2J73A 2YOAA 2YSTA 3BSZH 3T3PE 1HL4A 1BAFL 2GABA 2NOYA 2JWYA 5EU6E 3JWDC 4I77H 5FECA 1ZGLB 2NDGA 3FN0L 5F7HA 2Q3XA 5DRWB 2OTUA 1H3TA 2Y1YA 4KNSA 3BGFB 4YHIA 3UH8A 5CN3A 4ZXBD 4D9LH 4ISVB 2A1WH 5AEAA 3FQRB 2QSQA 4UT7L 5I0YA 3ASNB 3T09A 4P3DA 1ETA1 2EIDA 3K2UH 3L4WA 4LLYB 3O8XA 4FJ6A 2PCPA 5JHLL 4TF4A 3WY3A 4FI7A 2JJWA 1JVKA 2Q10A 3BP7B 1G7JA 5IKCA 4YIQB 1JE6A 4OLVL 1BJ1H 2Z91B 4NUJB 4WUUD 1KT2B 1Z6JT 5JHDE 1AHMA 3QI9D 3BE1H 4AMKH 1RZKH 4NO0D 5GJTH 3FU0A 3OKMA 4NCC2 5C3LD 2D4FA 4IDJH 3PWLB 2CO2A 3JZ7A 3Q2VA 4OT1H 3FAWA 3UOAB 3D6GA 2WXQA 3TBCA 4OBSA 2QKIC 4F5CA 5EEYA 3SKJH 1QI5A 5AW6B 1HQRA 1R5IB 5M94B 1J05A 5I1DB 2BDNL 3HBQA 4RMBA 4DO6A 5A16A 3RZCA 3MXVH 4PW9A 3TA3D 4OJFL 1V7NH 2JXMA 4J3OC 5A2AA 1MCOL 3GXUB 3V55A 4IBWA 4Q9QH 3RNQB 1AKJB 4NN7B 3NFPB 3FU3A 3TEXA 4PJHA 2K70A 5D2NA 3ZRFC 2H47C 3ARUA 5EZJB 4AH2B 2XWJB 1JGLL 3BCDA 3KW8A 5K9QI 2FWOA 3S37X 3ZTCC 3V6ZB 3TBTA 3MV8B 3BAIA 3K0WA 1XGQA 1TZAA 1MCWM 3BEVB 2EH8H 4PP2B 4F92B 1GR7A 2OMVB 4NQXB 3T2QA 2VZ3A 2R2EB 2ICEB 1OAYL 3PAYA 2GJZB 3TO2B 3VRIA 1MCPL 2HKHH 2I9LA 4PJ9B 4MA7H 3GS4A 3Q3GB 1YN7B 4JHAH 4POZD 1KYOK 1G7IB 2VQ1B 3NPSB 1I1AC 1PLGL 2V17H 3QDAA 4UQIM 4YL9A 4ZOCA 5SWSD 4XP1L 3IDJA 1GXEA 5E03A 1JTPA 4RVBA 3WI9A 1WV7T 2NCMA 1I8UA 2X42A 1XIWA 2TRHA 3VJ6B 2DQMA 5ISZA 3BPOB 1FLTX 4AIXA 4FKHA 1Z9MA 5D2NE 4ZW5A 5E08H 3UJTL 3S35H 4YK4C 3U0TB 3N1GC 5FO7B 3AAZB 4ZSOA 4JFWA 1LVEA 4JZNB 4OJAA 2DD8H 1AFVL 1AC0A 1F4XL 4LLQB 1A0QH 1LILA 3BYTA 3HFMH 3WEOA 4FXKA 2IWKA 1ZSDA 1ZANL 3PJSA 2V8MA 5DZ9A 1G7PA 1MIEL 2EIZA 3KR3H 4FJYA 4MJID 2CJUL 4X98B 3H8NA 2FBJL 5JDSB 5IGXL 1TKWB 1T04B 4QPEA 1GMEA 3WIHA 3ABMB 5AOKA 2L4OA 2MPVA 4UILH 1Z66A 3MGOB 4ICWA 3V6FB 5J0BA 2PR9A 3ULVD 3VFTA 5HGGS 2YAOA 1N7MH 4RMQA 1F11B 2YLKA 2ZWLT 5DFVD 4G83A 3GGWA 1E6JL 3H3PL 3GSXB 3PWNB 3QQ4A 1NC2A 2IGFH 3FZUD 3WHXA 4AQ1C 3UAFA 3F7VB 1RJCA 2O5ZL 2BNUA 3DXAA 3UCRA 5KVFH 3RFZC 3SO3C 2F15A 3BUBA 4H0LC 1WFMA 3ZDZB 4ZSOE 3SEPA 3MCKA 4FZ8H 3ESVF 4M48L 1H19A 4OZHB 2XPGA 3WS6C 3H9SE 3ILEA 3RVWC 1FE8L 3IFNL 5KEZA 3F6IA 4U6YA 2UZXA 2RGSA 4YZWA 2CLVA 4X5XA 3NIDF 4P2CG 2EUXA 1TZIA 4K3EH 2FGWL 4JCMA 4K3JL 1RUML 4MDJA 4ORGA 2ZICA 3B7RL 4OCXH 3QIBD 3INUL 2IMMA 1MWAL 3I9GH 4L1BA 5CGTA 4X7SH 3MRMA 5EFIB 1IAII 5GRUH 2EJ1A 4JM0A 5AVQB 3KLHD 3W39A 2YMTA 4QJ4B 4S1DD 5IW1B 3EOBA 2ICWJ 4DHLA 1JUFA 3B2UD 5F3HB 1NMCC 1IAKB 3BD5A 2OP4L 4WW2F 2NW2A 2CRZA 3VD1A 2UWEA 5JLZA 4PJCF 1WCBA 1UKTA 2VN5A 3O6FB 4NEHB 5TDNA 2H0PA 3LN4B 2HAZA 4X4YB 1PD0A 5D7LA 2DJMA 5D7SH 3TBVB 1HHIB 1U95B 2HVKA 5I30H 4A63A 3P2BA 1CFQA 4KOBA 2IXQA 4H25A 3T0VA 3ZN6A 2G2PA 1Q0XL 3KJ6L 3NZ8A 3KWTA 3EFDH 4YHNA 3D9AL 2XRAH 4X6BB 1JGUH 4AYMC 3OLEA 3MV9A 3RDTA 1S7SA 3A6BL 2W91A 3I6KB 3IXAA 4Q6IC 5E9AA 1IGML 2AMUA 2PYEE 1MI5D 2Q2EB 3BW9A 1K8IB 1EZVX 5E8EB 4G6JH 4NCC1 2EO9A 1MW2A 3IPBA 4TQ8A 2H1PL 4K7PL 1PZUB 3SDDB 1VKXB 1XDTT 4R4BA 2EYRB 5E9DB 2K9UA 5GGTH 4WWKB 1CFVL 4XT1C 3B56A 2QQLH 3D50A 5TH2A 3NFSH 2UWEE 4Y4KB 4N8CL 5FA4B 4DVRL 4EZJA 1QSFB 3U2JA 1Y1DA 5KVEL 1KXQA 2DQTH 4Y19D 5DJZB 4WI7A 3CFIC 1CDGA 1J11A 4IDLA 5ECJE 5KSBA 2YKLH 3IU3A 5C7ZA 2IJ0C 4NFBA 2DQUL 3ARFD 2VISB 4HSQA 1GZHA 3WLBA 2O72A 3LH2H 5EUKA 3G5YB 2DQGH 2PWGA 2QMKA 2IMNA 4MD5B 2QSCL 3BRFA 3RQ3A 1V7MH 1HK6A 3O4LB 2I07A 3P0VL 4JGUA 3FRPA 4ZMWA 3PWPE 5I1AB 4CC4A 1K72A 4P2QA 1U8QB 2QVIA 1NMBH 2X4QB 3NSYA 4X5QA 5KJ4A 3KDMA 5GZNC 1E65A 4HX1A 2RTTA 4H26B 2ZOWA 3D51A 4XCEA 4W1TA 1XXFC 2AI0H 4HXAL 4GP8B 2K45A 2VLKB 3UP6A 3EKCA 4RRPA 4XHJD 4BFGA 2Z3FA 2CR6A 3NCJL 1KXQE 3FULA 2QPUA 4PBVC 4MAYB 1JGVH 4G6MH 4N8VA 2F19L 1VRSA 2F5AH 4FG0A 2CMRL 1FZOB 2DQCH 5D1QA 2Q20A 2ITCA 3GSQA 3GJEB 3MKGA 3D25A 4XOBA 5JXED 2VMCA 4CVZB 1OIOA 2Z31A 1DVFC 1N0LA 2P26A 4I85A 3HB3C 4I5BB 2IADA 3GT6A 3LTVA 2NNAA 4PWIA 2B4CL 4RWYL 3P4OB 4LCYB 1NLDH 3B2MA 4Z7NE 4X0KA 4I2XE 1N0XH 4M7JL 3AXLB 4AM0B 5HYJB 4M8UA 3DGGB 2Y36H 2XIDA 4MNGE 2JSFA 1D6VL 4ZD3L 1SDDB 3TV3H 4JUTA 3N43F 3CQPA 1EFXB 1FZMA 1YEHH 1XQ4A 2P7TB 2XSKA 3QCVH 1R9FA 2MHAA 2QSTA 1U92A 1AY1H 5DUPH 4X8JA 1F3DH 4K94H 4RGNB 3B37A 3FT1A 1BSIA 2EIEA 2C9AA 5EUOF 3K6SB 1N6QL 1CDHA 3DPBB 3QS2A 4WFFD 5MENE 1WZKA 4QTIH 1H6TA 1UXSA 1XSIA 3WIIH 4P05A 5B39B 4XXCC 4JKNA 3T9WA 5HDBF 1U91A 2P48B 5FYLL 3C2AH 5GHWH 1W16A 3D1MC 32C2A 5AENA 3HZYB 2OW7A 2C7FA 5F6IB 3GFUA 5EO0A 4R84A 1AR1C 2NY3D 4LSVL 4G1EB 5F9JA 1JFQH 2HTKD 5IY5B 3HMXH 4ZNEE 3DURA 4WRLA 1QLRB 3DIDA 4E2OA 2CDGA 1XGPA 3VFWB 1NZRA 5D5MA 3BPLC 5CINH 2P45B 3KYAA 3N1MC 1PZSA 3BZ4B 1NIBA 4XCCL 2VIRA 3EFOA 4DGVL 3OKKB 4OCWL 3FCBA 5J1AB 4CMMB 4JCLA 3NGBC 4FI8A 3L4CA 3DA0A 1H8OA 1SOXA 3KEDA 4XX1E 1BECA 3D4ZA 5AAWA 2WINA 3RWGA 12E8H 3PL6B 1HCVA 3VFSA 3AB0B 5F21B 2YQGA 2DOCA 3SPJA 2WVSA 1CDJA 3A24A 3VB8A 3VWKD 4DAGH 3FKUS 3B9DA 4JFXA 4Q9RH 1EWHA 3EJQA 5J56B 4N4YB 3L5HA 2XY1A 1UZ6F 5L7XH 4G8FA 5IV2A 4FKEA 2GT9A 3S36X 4CGUB 1A4JA 4GAGL 1B9ZA 1QMUA 2YC1A 4YZFE 4ZW7A 1AQDA 4RDBA 3T65B 1T5KA 1P4IL 2JE8A 2Z65C 3PWJB 2VDNH 4G7QB 3ABGA 4U49A 3ZTJH 2XG4B 4Z5RB 3LIUA 4PJGE 4AJ0A 4F2ME 4L3CA 1IKFL 1Q1PA 1MZZA 3DJTA 3QJTB 5GSVA 1MHCA 1YEKH 5D4JA 1DSWA 2OCJA 1H9VA 1XCQA 4W81A 3MLUH 3PABA 3UAAA 1UCTA 4G6KL 4WEUD 3NA4A 3OXSA 3T1FA 3IDXH 2FO8A 1UADC 2VRKA 4GKSB 5AW1B 3TP4A 3UBXB 4TNGA 2PTUA 4IKLA 3LEYH 4LLWA 1FYTD 1BQHA 2IEPA 1GCFA 4GXUM 4GAYA 5IWLA 1F02I 3G7TA 3QVAA 3W81A 4E9TA 3DC0A 3M17A 4BWUA 1R24B 2DYPA 5GIRB 3Q6GL 2LW3A 4QOKB 3FTZA 4HLZG 5KSAB 3QDGB 1EGJL 1FH2A 3NA9L 4JFUA 5HGDB 1KPUB 5FV1L 1U8IA 3RE0A 4D8PB 3DI3B 3ML9A 4M5ZL 5F8QC 4HZAA 3Q6FB 1G6RA 4RDQG 2ZIDA 3QWOB 1F1GA 5CJOH 4C56B 1WZMA 4YBHA 1TJGL 2Q7NA 1N3NB 3KJ4C 3RWCA 3GSNB 1RK0B 2UV3A 1MAKA 2YAPA 3H2QA 5F89A 1CLYL 5ICUA 3MOQA 5SWZA 5SWQB 3F58H 1CU4H 4NQVB 5I6LA 1JZ3A 1T1YB 4Y16D 4ZW3A 1MQKL 3IJYA 4UQ2B 1IGTB 3HLAB 1MLCA 4QR7A 4PYGA 1KYOJ 1KG0A 4PBDA 3WSQH 2CQVA 3X14A 5BOJA 3LRKA 3FTGA 3SGJA 1RZ8A 1TZ8A 3NN8B 4NM4H 5I1KH 3G5WA 3HHSA 4XC3H 5AB2A 3GI8H 4EKXA 2OJEB 2UY6B 4UQAA 4DT2A 2G5BA 4P06A 5DURB 3K71B 2RCSH 4D3CH 1QO3A 1RMFH 3H3KA 1F42A 1Z0MA 3NT0A 3FS9A 5EC1B 2VJ0A 3CU7A 1N5YH 4XVJL 3FU8A 3U46B 1WQVT 6PCYA 2R0WH 3MRRA 4KI5C 1WAAE 2X53A 4A1RA 4L4TA 3EYUH 3NSDA 2EC9T 3GZQA 1Q9WB 1SXZA 4Y5XC 2MCPL 1R4XA 2B4CC 2A5UA 1QLEH 4V11A 2ZE0A 4WJ5B 1N4XL 1HYSD 5EEXA 5DJDB 1MKFA 5BV7H 4MA3B 4MAUL 4XVSL 4GBXC 2VT0A 4GQPH 5C08B 4M7LL 1ZA6B 3ALXA 1LO3H 3N44B 4Y1SA 4GRLC 4KKZA 3QYMA 5DRXA 3O0RL 4PLOB 4ZI8A 1SEQH 3C6LD 4IRSD 4OJCA 5EWIH 1VGKA 3GMNB 4PPTA 3CZGA 4RETB 1HJBC 2V2WA 4KITB 4I88A 1EO8H 1GY1A 5DUBA 5JR1L 3BSHA 4X7CC 3NCYP 4QRSB 4RMRA 5D1ZB 5KBPA 2F53E 1NGXA 2CGRH 3CFJB 3KBPA 2YLHA 4FYRA 3W56A 3V2AR 1LHZA 3L7EA 4Y4HB 3LV3A 4ECNA 5I1HH 3RVXD 2YXWA 1NTDA 3NIGB 3BWUF 2IWGA 4XMXA 2BOBB 3KPTA 4ZMQA 3AG4B 2BX5A 3ARGC 4NNYA 5DO8A 1KEGL 3C5XA 3TNNA 1MCNA 4Y5YC 5C0JB 2QZ5A 4NAJA 2IF7A 1OF2B 4PI0A 4W4OA 1EXGA 2DI7A 3FUIA 3WU1A 3SDAD 3ARDD 2PWEA 4N2CA 5CLYA 2EO1A 4FFYA 2GSGA 2RA1A 4BGDA 1VACA 4R96B 4YDLC 3VXNB 2ARJB 3CXFA 2CHWA 1QA9B 3HCVB 5GGUB 3BHBB 5L9DL 4JFFD 1ORQB 5I15L 4QHMB 3NDYE 1F2XK 3OMIB 4PHXA 4PB9H 2YMXH 2WIIA 3IAQA 4PWFA 4WI0B 2WQWA 5GJSL 2V2XA 4NN5B 4OCNC 4UM8A 3ESPA 5DD6A 2XNAA 1VFOA 5JQHC 1QFUL 1HI6B 1JIBA 5TFSH 2F7IA 4Z0BL 2H9GB 4PUBL 3L9EA 3VXQB 1J8HE 1YEDB 4ELMA 5CJXC 3MV11 1UHVA 2VE6A 2WPGA 5E8NB 3S5ZA 2WQXA 1BYPA 3UTTE 1JZ5A 4WW2A 4FG4A 2H2PD 5HGHA 3APDA 43C9B 3BUIA 4N2LA 4OFQA 5EN2B 2QADD 2XN9E 3MDJA 2VDLL 3HA0A 4MQSB 3AU1A 3F7QA 1W8EA 5B3NA