2EP6A

Solution structure of the second c2 domain from human mctp2 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
133
structure length
133
Chain Sequence
GSSGSSGDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second C2 domain from human MCTP2 protein
rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords MCTP2 protein
total genus 9
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2ep6A01
2N1TE 4PS7A 3F04A 3MJWA 2B3RA 4ICXA 3T8MA 4DK5A 4F1SA 4L1BA 1BDYA 1WFJA 2Q0ZX 1DQVA 5T8IA 2X38A 3N5AA 2QZ5A 2CM5A 2BWQA 1DJYA 1RLWA 4ICWA 3OAWA 4QAMB 4AOFA 2ENQA 3FBKA 3OHMB 1E8XA 1E7UA 3QK0A 3R7QA 4FADA 5KJ7E 3PFQA 2EP6A 4XX5A 3JZYA 2CJTA 4L1LA 3W56A 2ISDA 2CHDA 1QATA 3APCA 2WXFA 3IBEA 1RSYA 2DMHA 3ML8A 4TV3A 4KZCA 5G2NA 4KZ0A 4QJ4B 1HE8A 3QR0A 4OVUA 2NQ3A 1TJXA 4FHKA 4DNLA 4XE0A 1K5WA 5H4YA 3QJZA 1CJYA 2WXJA 2JQZA 4QJ3B 2UZPA 3L9BA 1GMIA 2A5UA 2KI6A 3F00A 1DJZA 5EDSA 2WXNA 4AJWA 3KWTA 3W57A 5JHBA 3HIZA 3DBSA 3R7RA 4GB9A 4BGDA 2WXQA 3GPEA 3M7FB 4EZLA 3QAQA 4ANUA 3PRZA 3F01A 4HVBA 1W15A 4V11A 3B7YA 3PREA 2NCEA 4FA6A 1V27A 2Z0UA 3S2AA 3APDA 4A55A 3ML9A 4NS0A 2WXGA 5H4ZA 2CHWA 3P2BA 4XZ4A 3SD5A 2DMGA 1DJWA 2ENJA 2YRBA 4PS3A 4WWNA 3HHMA 3L54A 4IHBA 2K45A 4URKA 3TL5A 4LDCA 4HLEA 2Q3XA 2FJUB 4QJ5B 1DJIA 5CCGE 4F91B 2Y3AA 1DSYA 3APFA 5G55A 2WXKA 2R83A 1YRKA 3TWYA 1A25A 2YOAA 3ZIMA 1RH8A 4WEEA 3PYCA 4J6IA 1E8YA 3RDJA 4MJJA 4LT7A 4ANWA 2K4AA 5CCHE 3L16A 2WXIA 1DJXA 4IQHA 3LJ3A 3NSJA 3ZVVA 2ZKMX 1UGKA 3ZW3A 2RD0A 2CM6A 2K3HA 2NSQA 4L2YA 3NZSA 2QZQA 2FK9A 4NPKA 4FJYA 1WFMA 2LHAA 1UOVA 3FDWA 4FLHA 4NP9A 4L23A 3KWUA 3QARA 2WXMA 1E8ZA 2WXHA 4PS8A 4WWPA 2V4LA 2ENPA 4BFRA 4EZKA 4F92B 3L17A 2WXPA 3ENEA 3F05A 4KITB 4EZJA 2WXRA 4WWOA 4ANXA 1BCIA 4NPJA 3RPBA 4ANVA 2CJSA 2WXLA 5CCJA 1TJMA 3L4CA 3CSFA 4Y1TA 4FHJA 3NZUA 1BYNA 3L08A 4FJZA 4WAFA 1DJHA 1E90A 2CHZA 1DJGA 2CHXA 3L13A 4G11A 4GNKB 2WXOA 4F93B 4LCVA 2A4ZA 4TUUA 1W16A 3PS6A 2D8KA 3CSTA 3TJPA 2K8MA 3HN8A 4JPSA 1UOWA 3QR1A 3DPDA 5JHAA 1E7VA 4OVVA 1E8WA 4TS6A 4Y1SA 3IM1A 4FULA 1QASA
chains in the Genus database with same CATH superfamily
1DVXA 3WFDL 1Q9WA 2B3RA 2DN7A 4R2GB 4XMPH 1ONQA 2YKKA 2ZOTA 4P2OA 1W2KT 2OMZA 1MXDA 1AY1H 4O58L 4L8SB 4U4BA 3P30L 1NIDA 5EC1B 5IB1B 1IJNA 3QUKB 5DZVA 3WSQL 1NTDA 3D39E 1K3IA 3FB8B 4GAFB 3PIQA 3G6DL 2KKQA 2QHRL 4LLMB 3FQRB 3LIZH 4PWHA 4YDZA 3V0EA 1JTOA 4YLBA 4JY4B 5E9DE 1HHKB 4ISVA 2O5XL 4MXQD 1AD9B 3QI9C 3CFKB 3GSRA 2W94A 1UZ6E 4L29A 1HHGB 3KLHD 4M61B 1K6QH 2R0KL 1X9RA 4QTIH 3QXTA 5AOIA 5EO0B 4ZZFA 1KPVA 3L9BA 1GGBH 1U8PB 1GZQA 3BGFB 3C60B 1P7QD 1HCVA 3CE1A 4N2NA 5GS2D 3GXFA 3CVIL 3VG9C 4QHKI 3FSZA 4TSAH 3CBJB 2ARJA 3DHJA 4LP5A 1AE6H 4X7TB 3U1PA 1NQBA 1XH1A 1RPQA 2MQCA 1KN4L 4ANUA 1PG7W 5I1JH 3VXMD 2BWDA 5F2FA 4ZMYA 4CJ1A 1FZJB 3VXRA 1RZIA 3K0YA 1IFHH 5EBLA 4YZFF 5GIRA 5CM1A 2A9MH 2JKWA 3EYOB 4PTTB 5D72L 1CXFA 2VLLA 3M8OH 5E0QA 4EI6A 3MBEB 2HPTA 1Q94A 1G84A 1KENL 3E3QC 3UIZA 4WWID 5JPNC 3R0NA 4RQQB 5J11C 3P4OB 1NUGA 3O11B 3QCUH 2JH2A 3BP6B 1FPTH 1FYTD 4Y9CA 3DRQB 3JWNH 1VEMA 2ZCHH 1LILA 4NCC1 1I8MB 4YDVB 1BOGB 2Z3FA 3LV3B 1I9IL 5B38G 1IQWL 2WSKA 1VFAA 3QEQD 4GQPH 4P57B 4PJDA 2X28A 4L3EB 4MJHA 2WD0A 5CJXA 5FECB 2MOVA 4Z78B 5ACZA 3QI9B 1ILUA 1O9WA 3MV8D 2FK9A 2B4CH 3JV0A 1B0RB 5CGMA 1FNGA 3E80A 3LEYH 1IQWH 4AQ8C 1G0XA 5ADOH 2PABA 1RULH 1U3HD 2CLZB 2JI1A 4G6MH 4NUGL 4D0DB 3CZKA 2OMXA 4XO8A 1UXWA 4GRMB 3E2HB 3BX7C 1CLOH 5ADPH 4G7SB 5CJQL 1A4JB 1D6EA 2JE8A 1ACCA 2F19L 5KVEE 1AJ7H 3WO4B 4MS6A 5KVGL 1EXUB 1DYZA 3D85A 2BIHA 2Y1YA 3IF1A 4I5BA 25C8H 3WJMA 5J12B 5KSVB 4XX1E 4LPVA 5I6OA 1XCQA 3P0VL 4OGZA 1VACA 5E6YA 3P73B 1FVEA 2XPGA 5AKVA 1JZ2A 4NLAA 1JF1B 3K6IA 3OKKA 4MA8H 1DQLH 4ZFFA 2AI0L 4KGLA 2EIJB 3KDPB 4PJGE 2IBGA 4YS4A 2OL3B 2BFVL 3BAWA 3U2IA 4B50A 5CN2A 1JL8A 2K4WA 3T3MB 5D2LA 4R4FH 1UD2A 3ILDA 4FTVD 1H0DA 1R5WB 4Z7WB 1DQMH 1LNUB 4GW4A 2EVHA 3N1MC 5MEQB 2ZUSA 5I5RA 1GJIA 5KJRL 5L4IA 4YPJA 2PTUA 4N0FA 5FYKH 5E8EA 4BE6A 2P46B 5FV2A 5H4YA 4R7DA 1QWUA 3IDGB 2AP2A 1JXDA 3S37L 1I7TA 1CDHA 1PS3A 3VI4B 5C71A 1O5DT 1TIUA 3PDOB 4XMPL 5KBNC 2QVKA 2FEDC 4HLZG 3X12B 4JDTL 3FONB 1IBYA 1CTNA 1FO0A 1QHPA 3AUWB 4MAYD 5KBLA 5J12C 1SJEB 3U7AA 2V33A 4P4KA 1D9KC 1GS7A 1WIOA 1NFAA 1WD9A 5DD5L 3SPVA 5FF6A 2FLMA 3GSVA 4MAYC 1D5IH 2FX8H 1FZMB 3AWEA 3SHSA 5BRZE 4KRPC 4E5XB 4FFZL 1S6NA 2VL4A 3I6LD 4M43H 3G5ZB 1HH6B 1RXLA 2WINB 3PQYB 1G1OA 4YBQC 3T9WA 4X6DE 4UMGA 3U0TB 4PJ9D 1FZOA 3ME0B 1T2QL 2R0ZL 1QSFD 3N1QC 3U25A 1DR9A 3TU6A 1F45A 3U48A 1SYSB 1HEZA 1KIQB 5JQHC 3THML 5HDBF 2ZUQB 5IMKB 1GA2A 4TNWK 2XTJD 5B1CA 4GO8A 4JR9L 1NWOA 4FABH 3NIGE 3QARA 4ZXBA 3TIDB 1XCTB 2JCCB 3HS0B 4XMWA 2HTLD 2V4LA 4JJ5A 2HX8A 2AFNA 4Y2LA 3FOMB 5IFHL 1XF3B 3O2VH 5AKSA 5I1HH 4EIBA 4Z3GA 5A2FA 2C9PA 1RK0A 2ZCLL 1YYLL 3IPBA 1U8NB 1F3DH 5HHOA 1NFDB 3KHQA 1AACA 1TVBB 5CSZA 3NJNA 1J5DA 5TE6L 1KNOB 4KY2A 4P5SA 3V4UL 3ZQXA 3DWTA 4B9PA 1GZHA 5KSAB 4S2SA 5H35A 1E7VA 3LMJL 5GRJL 2WBJD 3ELQA 1A2YA 1F3RB 4XMKL 1AQKL 1WA0X 1NOLA 1OQOA 4JKPL 3W0WD 3OXSB 2QPSA 1S5IH 4DGYH 5JW5B 5IHBA 4P5MA 4HGMA 1V7MH 3NIGB 3QUZA 3MV8E 4WW1B 4CC4A 5DJ0A 2AITA 1L6XA 4AOFA 1W72A 3GK8H 4Z7UA 3U9UA 4NWTH 4KK5C 4H7VA 2I26N 5AZEH 2XX0A 5H37G 1JZ4A 1BYOA 3ML8A 1W80A 4KZCA 1NC4D 2R15A 3EYQC 3UAAA 1ZOXA 2FJGA 4LAQH 5IHHA 3N91A 5D7IE 3CSYA 4U0RB 2I60L 5E9DB 3OKMA 3C8HA 3X14B 5ITBH 3IDNB 3BSGA 4MYPA 1DVTA 3SO5A 2CJUL 4YZFE 1LP9A 5DCCA 5BS0E 3QWOB 3FULA 3O4LA 1TU2A 2Z65C 3DGGA 1E42A 2Y7QA 2XWCA 2LTQC 4OF7A 3EOAA 3HJEA 2C3WA 4QXTA 4HHAA 3P9MA 4A04A 4LBAA 5F7EH 3VXSE 1SEBB 3CZNA 4PRIB 4X7EC 4B9CA 2ESVB 4J2QA 4JS7A 4WU7B 1XT5A 4NHUA 1HZKA 3S5LA 4H26B 1KB9K 1PCSA 1QEWB 4UIKH 5A2JH 5JXEC 6PAZA 3L4XA 3SGKA 3U46B 4WSGA 5HHXH 4WUUB 3VXOB 2YD2A 1GZQB 1HL8A 1NGPH 2R69L 5GHWH 5AKTA 4OB5H 2MSPA 3QNZA 5IKCB 2QDVA 4K7PX 3IJ7A 1P9MA 1RZQA 5JXED 1E5UI 3BC9A 4MWFB 2K4AA 4JL2A 5DMIH 2N7SA 2PCPA 5CD3B 3KDMB 4KQ3H 4X4KA 4U7KA 4WU5A 2IFGA 3KPTA 3HZYB 2HVBA 3P0YH 4PCKA 2EYSA 4OGAD 4UAHA 4K7PL 4ODTL 3S5LG 3ZKND 3FDWA 5DEZA 4ZG1A 2XN2A 4NO5A 3ZO9A 3DMMA 4WJKB 2H0PA 2MPAL 3MBEA 1NFKA 3PWUA 1TSHA 2XX1A 4QO1B 1W0YT 1GGYA 5FA3A 2G5RA 5IBUB 4AJVA 1DVZA 2VLKB 4UTBH 2O1AA 3KMDA 2WP3O 3AITA 4LLUB 5E1GA 1ONQB 3R1GL 3JWNC 1E2VA 3OGOE 2F5BH 2HT2C 3PHAA 5C0CD 4YDVA 2ZYHA 3U1SL 2YARA 4NQDB 5AUMB 4B9FA 4PRPA 1J5OH 3SDDC 3IU3A 3QZWG 1IC1A 1CI3M 5E9AA 2KZKA 2EIKB 3BQUD 2AJUL 3ATBA 5KVFE 4N2GA 1MW0A 1RU9H 1WAAA 2I69A 3P69A 3PABB 5I9QC 2E74C 2X38A 3OZ9H 3E6HB 3G5YA 3ZHKA 4Y4FC 1B9KA 2NY1D 2O5ZH 4LHUB 1HXMA 6FABL 4N8CH 4M9OA 3KJ6H 3O6LH 2H26B 4FYTA 5JZ7D 5GPRA 5F7HA 4K0OA 2LLNA 5CUSH 3U0WH 4N2AA 2EE0A 3NMEA 4WJG3 3FT3A 4C4BA 1VEPA 2ISDA 2GTWA 3LNHA 4GKSB 5C8JB 3PLYA 4TV3A 3TO2B 4XPFL 1L5GA 1UXSA 1I7ZA 4XVJH 4POYA 2FECI 2VDQB 1XR8B 3CWGA 3SGEI 1WZMA 3TWCH 2J6EH 4Z7NB 5KYUB 4KX9A 2BSRB 1R0AL 2IPTH 2NXYD 3PGDB 1PJ9A 2UZYA 2ZSWB 3LKRA 3DURB 4GXVL 1I1AC 3S3JA 5IGXH 2OMVB 2WLLB 2HTLC 1ZKAA 4AKPA 1B0IA 4FFWC 5FWQA 3O11A 3ET9F 1WQVT 3IFOB 4LRNH 4AV0A 5GRUL 4EF3A 3TFKC 2QQQA 2XCMC 1BMGA 4PRHE 3U36A 3P4NB 3EJSA 2WKOA 5AAWA 3GJFA 3MLTA 1KTJA 3U2SA 3N44F 4NC1C 2PCYA 1D6VH 3MXVL 4NENB 1PSKH 1X4YA 5JPNB 1AG6A 5J89A 4ZPVB 5TDOB 1OCWH 5IMMA 2CPCA 3QNXB 1LDPL 3IDYB 1R24A 3BSZL 3CZEA 1U92A 5JW4R 1NEPA 1D2OA 3K7UA 3QZMA 1TQVA 1JK9B 3NCWA 3RRQA 4IOFD 2OMXB 3ULSB 1F3JA 4DP4X 3D39B 1UM5L 1OSZB 2VM4A 3ZL2A 5B38B 2YIHA 3H3PH 2Y25A 3S35H 3UH8A 1B0GB 4YDJB 3D30A 3B9AA 4OCLC 1B4RA 4JDZB 3MLXL 3HNTL 3RY4A 2WSDA 1I1AA 1NAKH 4GAYA 2J5WA 3TVMD 3HC2A 4XVSH 2P80A 3GB7B 4O9HL 3MA7B 2BY2A 3PGFH 4HIJB 2VSCA 3U9WA 43CAA 4WI6A 1ZE3H 3VJ6A 1KIUB 5TPWH 5C1MB 3OF6D 4OLWL 3TGXA 3KL5A 4U6VH 3QEQE 1YEDB 1GCFA 1KXTB 1TJGH 4OCSH 1JK8B 1ACYH 5T1DH 1HCYA 1ETZB 3MGAA 5JR1L 2EYTA 2VITB 3N43B 4X2UA 1NCUA 4GRWB 4NNXA 2JJSC 4HQQH 1E4HA 4HKBA 3N42B 5TDNB 5JO5B 1CIUA 1MFDH 2Z1PA 1XCTA 3HS0A 5A2LH 4NQCE 1LO5B 1CLYH 3FCSB 3SE8H 4CGUB 3TZVA 3P0GB 3WAJA 1O7VA 4IIQB 4UF7C 3V5DA 2DYRB 1VPOL 3U82B 1FRGL 3VGDA 5IOKA 4FQPA 4JFFA 4TTDD 5IJVB 3QBTB 3VXNB 3B9KB 4LL1A 4X50A 1RIHH 3FHQA 1FNSH 2I32A 2FWLB 1TJXA 1R17A 1BF8A 3O3EB 4B9ZA 1EAJA 1AQDB 4RSYA 5AVVB 4MQ7A 1MJUL 3MDJA 3RGVB 4UOW1 2DBLH 5IHZA 2X70A 3GKWL 5DEJA 4AE1A 3AQYA 2QQNH 2UY6A 3HG0A 3VTAA 1RZGB 3JV4A 3VRLF 4ZQTA 4Q9RL 4HVBA 4IKNA 1OK8A 4FXTA 4JEGB 4KI5F 1FLRL 1U21A 3TIEB 3RWEB 2P5EE 3V6OC 3UPRB 4WFHD 3BUTA 1E4KC 2D0GA 3KM2A 3NIGF 2XVKA 3NOIA 5GSRB 5JZ7C 2X4UA 4HLEA 3B8SA 5T5NF 2EEBA 3I75B 3I3DA 1AZUA 2ALWA 5LBGA 2VSMB 1DJIA 1U8OB 2B5IB 2JV6A 3SPHA 4FF9A 1YMHA 3Q6GL 5MEPA 2B1AH 4YHLH 3IDNA 4JZJC 1NEUA 1UXLA 4J28A 5T5NG 1E6OL 3BRFA 2FLBT 4O2FB 3DSFH 3N41B 3OQRA 3RVWC 1YC8A 3HVDA 5GRJH 1U3HA 2IOOA 5DTFA 4WV1A 5MHSD 4DUXA 1H6UA 2WWOA 5LAXB 4OJYA 1YUHA 4KVNH 2A9ML 1SLUA 2ICEC 3WNOA 2NX5B 3ISYA 4L23A 4DGIL 1GJWA 3M07A 4H5SA 1SBSL 4NIKB 1S7SB 5C0EA 3GKWH 4LPCA 2RIKA 1D5XB 3IMVA 4N8CL 4JFEE 4E0RA 2W0FB 1QFWI 4KKCD 2EE6A 3KPNA 1A2YB 4KKNA 3QH3B 5DVOA 3QNZB 4ORZC 2ICCA 4QTIL 3QQ9C 1OCCB 4NN5B 4FNSA 4ZFQA 1ZCRA 2W5PA 1U8HB 3QDJA 3PWNA 4IYKA 3S4SG 1SN5A 1FYTE 1KB3A 3LN5A 3VVWA 3KWVA 2MTAA 2I24N 1E7UA 3AU1B 3LAFA 4FN0A 1PG7H 1OXYA 3II1A 1KCSH 2VGLM 4MJID 2VSKB 5EF0A 3A6CL 1I4FB 4CVZA 5IMLB 4JPVL 4Z76A 1KC5L 1GYAA 4KI5C 1BIIA 3NIFB 1FSKB 4ABVA 4BWUA 1C16B 2G4EA 4ICWA 4XP4L 5IFJA 2UZXA 3EOYG 3OWEA 3CIAA 4WTQA 5EU6B 4N9OB 2YPLA 2HLFD 5EU4A 1GRWA 1XL6A 4Q6YA 3HFML 4M8UA 5BV7L 2MCPL 4NQDA 5AUMA 1G9HA 2ADJA 4KDTA 1HE8A 1CDIA 2CUIA 3D2UA 4DNLA 4QOKA 4FTDA 2DAVA 5DC4B 5F44A 5LGHH 1ECYA 1G7LA 1BQSA 1FL5A 1F4XH 3FFCA 4S1SL 1X3DA 1R3KB 4TVPE 3ZTNL 2ESVA 1E6JH 1NFDA 2GJPA 1EDHA 4OCRH 3C75A 4H26A 5AENA 1BQHA 4PJIE 3TFBA 4GQ9H 4PV9B 5DHDA 3B8YA 5C9JB 1J8RA 3EZ8A 1WZAA 2Y2WA 3CJJA 1YO4A 2F54A 3VWJA 1W72L 2E7MA 3P3YA 4PJEF 4HKJA 4UTAL 5E4IA 3EZJB 1U95B 1MCDA 3OZ9L 3QO1A 2VLMD 1T1XB 1KXVC 2XQBL 2VL5B 1V3LA 1XIWC 2BSRA 3MKKA 3DC0A 3DIFA 1T1ZB 2VT0A 3DKHA 4G2AA 4Y19D 4EUPH 2ZKXA 4X9BA 3NP3A 5FYLL 2ADFH 3P0VH 3RIKA 2Z9TA 4PRID 5D2NE 1UM4H 4UOW0 3WE6B 1BA9A 1F02I 5E4AA 2CDEA 3GZPA 4JFDA 1NGXA 3MO1B 4IJ3B 1I9JH 2FX8L 5EZJA 5F1KC 1KCRL 3O4LB 3STZB 4UQCA 2VZ3A 3MLVL 3VXUD 3OJMB 1JGUL 5AVXB 3VA6A 1T5WB 3DYPA 1FO0H 4HZ1A 1F6AB 2COQA 3ULAB 4QY8B 3GIVA 4KTDH 4KX7A 3X17A 2YUXA 2P7TB 3RTQB 1AY1L 4QHMB 3L7EB 5CIPH 3FU5A 3L5IA 4LBEB 4NO3B 4F20A 3RY6C 3K1KC 1A6WH 5HHOD 5D2NB 4B0MB 2VDRL 4LIQH 1IAII 1MRDH 4YHMH 3W81A 2HVJB 3RWCA 5BZWB 3W0WB 5F7UA 4LARL 1KLFA 2BOBA 5GJSH 2VKXA 4JZNA 1J9TA 1PZ2A 2GI7A 4XBEH 3UZVA 3TBYA 4AENB 4PRPD 1KPVB 2XTJC 5DRWB 2FHBA 2H3KA 2NY3D 5DJAB 1M7DA 3MRCB 3PNRB 2B08A 2V9TA 4HHWA 2ZOKA 1TR7A 3VDCA 3IFOA 1V3MA 1FA4A 3BFQG 3PHQB 4I2XE 1G7PA 4NQVB 1UT1A 2OQJA 4JQXC 1E27A 4LGPB 2J1WA 5A3IC 1CICD 2FJHB 3J2PA 5I8EB 5KVGH 1LO2H 2HYMA 3W0WE 2K70A 4AYDC 5T1LB 1MHCB 5JLZB 2G4GA 5KYWA 3IAGC 1SVCP 4RVBA 4RIRB 3WELA 3VQ1C 4XXWA 2PP7A 3VFOA 3PPEA 4NRXA 3QHTC 4PJ9B 3ZTJH 4OCSL 5B8CB 1NINA 3GMQB 4IRSA 4UQIM 2QGEA 5D5MB 3V7AG 2FSEB 3QRGL 1XF5B 3PYCA 4UIMA 1S7UB 1E8YA 5LQBL 1KCWA 3AGWA 3IGLA 1ORQB 4YBQD 3DA0A 4B7LA 1I8IB 5FFOA 3QJTB 1PW3A 4HIJA 3RFZA 3LRMA 3L45A 4I2XB 1IBGH 1MH5B 4Y5XA 2FHFA 3TH4T 1JWSA 3DJRA 2FIKA 2B1HH 2V37A 3LKPA 4X6BA 2CO7A 1OHZA 4FLHA 4UANA 5BMFL 3V0DA 3FO1A 3VB9A 1B4JL 2GW5A 1M9WA 2G3NA 2HWZH 1H8NA 4G6KH 4M48H 3TO4D 1TUPA 1HL4A 3TS8A 3SKOA 2NY4B 3IDIB 2A9AA 4TLTA 5D1ZB 1W0VA 3SQBB 1QLEB 1RPUA 1CLVA 2EO1A 5KYXB 1OIOA 3RIFK 3COOA 4Z7NE 3ZQ9A 4S0HA 1HILB 3L08A 4HK0B 3QIWA 4NERA 2CRMA 5DRXB 3BWUF 1MCKA 3PWJA 3FT4A 3NIDB 4O4YH 4U7MA 3ZIYA 3L8QA 4Y2OB 5D6DA 1PZAA 5AW7B 1RK1A 2EIZB 1T22B 2XFXB 4ZSOE 5DTFB 2VZVA 1RERA 3CSPA 1R3JB 5D9SB 2NNRA 1Q0YH 3V6ZA 4ICXA 5IESH 5CMAB 3F7LA 1S8DB 3H6JA 3KGUA 1EQWA 3WIIL 2VQUA 3H56A 4XOCA 4L8CA 5EMYA 3D50A 4XT1C 3QC6X 1IO4C 2B59A 4KJWD 2VXSL 4ZMNA 2W88A 2Z92B 3ULSA 3FTSA 3L7FA 4XO4A 4W9JC 4B97A 1H6FA 4KNUA 2FTAA 2X4NB 2H0JA 2B4CL 5BRPA 4X6CB 5HJ3B 3MACL 4OGXH 1JPGA 1HNGA 1KN2L 2E9GA 2OI9C 3AM8C 4Y2NA 1SNRA 5C07E 2AEIT 5DJDA 3LQAC 3JWOL 2UX6A 1XZ0B 3ZGIA 5KVFL 4KNQA 3NIFF 1Z9SB 4KJWC 1JGVL 1RV6X 4HH9A 1NANI 2X1PA 1QG3A 1YYCA 3KM1A 2R2HB 2X4UB 5ISZD 3PAYA 1IX2A 2R51A 2VW6A 5JNYA 3S48A 4WWKA 3EYVA 2DD8L 4X5QA 3BVTA 3OHXB 4HFWB 1HKLL 4BKLA 3MRIA 1F41A 4RLDA 4FQJL 3NSDA 1NMAH 4PLKD 1FH5L 4U1KA 4IHBA 2ADJB 5E8NB 5B8CC 1Q0EA 3GGWB 1OGPA 3EYOA 4EBQH 2ODHA 1DEDA 1KPRA 2JJUA 3J07A 4G72B 5D6CA 1U8JA 2GK0B 5G55A 2GUYA 2JF1A 3KPPA 3ARDB 5FWRA 4BUGA 4J12A 5DFTA 1PZ5A 2L4OA 1GGBL 2W9EH 3WD5H 5DJXB 3WCYA 3RZCC 3DX0A 3FTZA 2CUAA 2E7HA 3TVMA 4ENED 4ZNCD 3H0TB 1H3UA 3MFGB 3H9HA 1KEMH 3O0RL 3QPXL 2FQDA 2F54B 3Q06A 3AB0C 1RUPL 2X1XR 4Q6IA 1AIFB 1CGXA 3AG3B 3JWOH 3O3BB 1F4XL 4S1SH 4HKJB 3VWKB 5I18L 1D6VL 1SDYA 1GVIA 3PL6D 1N6UA 3G6DH 1PKQB 2CJ3A 1JOIA 4NKMA 4MA7L 4PJEE 3KPSB 1VFOA 4H13C 5H8DA 2IVFC 1OP9A 1BGXL 2DRUA 3CGTA 3DIFB 4GSXA 2R27A 5AVZB 1KJ2A 3VM7A 5A2CA 1HS6A 1K9TA 1I8AA 4O51A 5C0RL 3MRPB 3PWPA 4KKAD 1U8CA 3CFIC 3GNML 1A3LH 3K72A 2CLRB 4J8QA 5GSRA 5L4MA 2P24B 2P45B 4B6ZA 2VDMB 3X3FH 3AAZA 3RWGA 1OVZA 5A3ID 2JI3A 3JTSA 1MELA 3Q9PA 2OR7A 2MKWA 1TZ8A 5K9OA 1NGXB 1HXKA 1NAMA 3S34H 4AMKL 3QYMA 4WI0B 1VDGA 4HCFA 2H5UA 3QHZH 3HRZA 3HA0A 4AC4A 4R5VA 4GG8B 3UZEC 2P5WB 1I1FB 2K7PA 5DD0L 5BW7A 4XPBH 3SDAB 5A2IH 1AS6A 3ULUL 2ZP8A 4LF3A 1QATA 3VAEA 5MEND 5C6PB 2RB8A 1JBJA 1F4HA 1U2HA 2I25N 2ZCZA 1AJ7L 2MH4A 2UUDK 1LP9B 4JN1L 4GUOA 5ID1B 4BKTC 5DZNA 4ABUA 3CN4A 5LUMA 2FBJL 2JKSA 2V5MA 3LRHA 4QRSA 3QH3A 3T77B 2NZ1A 3V0HA 2J1YA 3PDGA 4DP1X 3OKEB 2VDKL 1MCIA 1UZ8B 2ZQKA 1E2WA 2DMBA 1DQKA 4NGHL 3EH2A 3JTBA 4PWKA 1A9EA 4Z3IA 1QFUH 1ES0A 2P8LA 5HHXL 5CEXA 3TYFB 4G6KL 2ENJA 2DQIH 3HHMA 1UD5A 1CU4H 1S9WA 4O58H 4PV8A 3L95B 1L9TA 1SJEA 2YA0A 3MV8A 3RDTD 1FORL 3OMAB 3UZEA 2WUBH 1QWNA 2RH0A 3PWLB 4EPSA 3GI9L 1AO7D 1Z0MA 2CGRH 1KENH 4F3FB 3OPUA 3B37A 4L9DA 5EU4B 5ICUA 3TCLB 4OV5B 4OCYH 5C0JA 4ODWB 1HYRC 5FO7A 4NQQA 1HL5A 5HDQL 1U33A 1PEWA 5D7IA 4BZ2A 2F8IA 1E5ZA 4XPGL 1AMXA 2MTPA 3WFCH 2FYYA 3GMNA 1ZAGA 4AVIA 4HJSA 2F1AA 3VD7A 3BKYH 3VXTA 4BZ1A 1S9VA 2Q3AA 2ODIA 1H3VA 1SDDB 5TH2B 4KJPC 4GUCA 3GMQA 5H37H 3VFSA 2EO9A 3KVPA 3VRJB 3INOA 1PPIA 4KU1A 2XSKA 4YR6A 5DK2A 2L7EA 4HC1L 5TF1L 1CXKA 2PO6D 3R4DA 1JYNA 1GAFL 2ICWA 3MOQA 3KE0A 4TQ8A 1MEXH 4OZFA 5FGBA 1ZSDA 3WN5A 1VLXA 1L0XA 2NY2C 4WSKA 1XR9A 4YZWA 2F1EA 1JHTB 1S9XB 4WFFE 5C2BH 2YPLD 5DJAA 3BRDA 1DCLA 3L2MA 5C0CB 4N90D 4DERA 5KVDH 7PAZA 3MRDA 4XCCL 2N01B 3IWUA 3QDJD 3S3BB 4QAMB 5I1CH 3C5JB 1AFVH 3Q2WA 4OJFL 3RQ3A 3FQWB 2OCFD 1G7PB 4FQIH 1JRHH 5DZAA 4KKZA 2NPLX 2B1HL 2ZNWA 4YGAB 4ZBJA 4AW7A 1U8QA 4L0ZA 2LV4A 2I5YH 1OTTC 1T0NB 4BK5A 4HUUA 4NP4L 2H6OA 3MRRA 4Z7UB 3U9UB 2FB4H 2Y4SA 3NJGA 4QJ4B 2CK0L 1IKNC 4LSQH 3QXDA 5LDUA 4V1DA 4HPOL 4OZGB 4NPYB 1XGUA 2VZ1A 5FHAL 4F15C 1EGJA 4X6CE 1DUZA 3BGFC 3EBGA 4G42B 5EUOA 4JW3A 1OTSC 3OL2A 3ZYIA 1V3JA 4CNIB 1S7WA 3HI6H 3I3BA 4DGVL 2IBZY 1WAEA 4XN4A 3S8WA 2WAQA 4L4JA 5I75B 1CFVL 1AO7B 4LSDA 1KLUA 5AW6B 1EBAA 4PRPE 2KZWA 4FA6A 1KT2A 1YYML 4WNQA 4M1GL 1LDSA 2R23A 4GFXA 3MYZA 4WTWA 1TU2B 1LEKB 4MCZB 3BZDA 4QR7A 3K91A 1ZIAA 4PJIF 3BSZH 4CSZA 4KZEL 3GBML 1I7UA 3BDYH 1SBBA 2FH6A 4F7TB 2Z7ZA 4K15A 4K8RH 1FFNA 3TCTA 4YXLL 5DYFA 2F8XC 3DSNA 2Z0BA 1KEGH 3QUML 4NYLA 4QRTA 1KJMA 3FQXA 5AG9A 1NM4A 3GO1L 3CQQA 5JDJA 4OUUA 1AZCA 5ITBL 4WO4A 1H5BC 5KBKA 1N12A 1URIA 4IRJB 5BZDB 1MCLA 4M3HA 2QFPA 3T5WA 2CGYA 2IH1A 4JFFE 1E8ZA 3FMGL 2CO6A 3NCXA 2ENPA 5K9QI 1BVKB 4NFCA 5EUOF 1AP2B 4N9GA 1OGTA 2BSBA 2FWOA 3SDYL 2RALA 5I15H 2NTSP 3OAYH 5AVUB 4KK8D 3P40A 1HWHB 1L7TH 3S3CB 4GG6B 2WO4A 5F9OH 5DD6B 4NUMA 3LD8B 4GNKB 5I75C 1PKQE 4BWWA 5BRZB 4M1DH 1HINH 1XH0A 4TMPA 2K8MA 3CHQA 2RACA 2VDQH 2Z92A 2EDQA 1JPFB 2ED8A 4Y2DD 3AQZA 2GY5A 5F9OL 5I8CB 4JBSA 3FTWA 1MG3C 4OFVA 1WDAA 4Y7OC 3GPSA 5E99L 5FO9B 4HOZA 3JYBA 4PJGA 1ED3B 1IGML 2QTVA 5ICYB 1F4WH 2YXFA 4BZ1L 4XOEA 2CBPA 4KK8C 2M8XA 3GSUB 2FE0A 2FQGA 4YIQA 2IWKA 5DLML 4JG9A 5IJCC 5AW5B 1ZHLA 3QCVL 5FLUA 1HTYA 1XX9C 3KPSA 2D3LA 2DMCA 3D0VB 5DHVA 4D0CA 1QSZA 5I66B 2FIKB 1BWWA 5DK3A 4AYEC 5D5MF 1VGKB 4QKXB 3BFOA 3QR0A 5EZIH 3DJSA 4DT2A 2ZXCA 1MFCH 2DQUL 2TAAA 3NQIA 4KUZL 1ICTA 1IKOP 3ZE1B 1JNNH 4WEMB 3NFPB 2DV6A 1WBZB 5L2JB 1TEGA 2AQNA 1IBHA 3P54A 5DJ2B 3E8VA 4JQVA 4HCRH 4QTHB 5D6CB 4OT1H 1U8JB 4RAVB 3PU7A 3P9WB 4MZ2A 3X11A 3G3LA 4P2YA 2O5XH 1LLAA 4ZFGH 4AQ1C 1QX1A 4NC0B 2BY1A 5C07D 4I89A 3NJIA 1JRHL 1AS7A 1ND0A 2X7LA 2Q7AA 4JKMA 1QWHA 1SY6A 3GXTA 3IXAB 4ZAKC 4GRLD 4AK2A 1I9EA 2VWEE 3D85D 3JT0A 4GLRH 3ARDC 4OGXL 1U3HB 4LOFA 4NENA 1YNLL 4JFOB 5EPMA 1CE1L 3P2TA 2YRPA 1CYXA 3FN0L 3WXWL 1U3JA 3KPMB 4XXDA 3GHBH 4ZPVA 4HWZA 3S97C 1K4DA 5ALBH 2VTFA 5HJ3A 2E8YA 1BQ5A 2GC4C 3BP7A 4HXAL 2NQDA 2GEEA 3MBXH 3QWNA 4G6AC 2BM3A 1IB5A 4K5NA 1QW8A 4WUKL 1JNHA 2YPLE 2UY7A 3MJGX 2YAPA 3BPOC 3U2JA 2DOCA 1OSZA 4Z1PA 4XCYB 1TEFA 3FZUD 1AD0B 3GSQB 1WG3A 4CADB 4W9EC 3Q9QA 3K2UL 1B0WA 2BFVH 4FXGA 3UAEA 1AHWB 3RJOA 4L1TA 2WIIB 4V2CB 5I19H 4HDIA 5KS9E 5DZ9A 1GC1C 2P5EA 2OTWB 2ESVE 3TA3C 4MD4A 1N5AB 3N41F 3DX6B 1WK0A 3RTLA 4JFZH 5E8PA 3BVVA 1WWAX 1WS7A 3MA9H 4NQSB 3DX9A 1FDLL 4KY1L 2O4EA 3FYEB 4MZRA 5J1SC 4GPVA 1HDMB 3CVIH 3R4RA 3ZJAA 2F68X 4XP5H 2EE3A 3QDGD 2FVNA 3QZOA 2PP8A 2GJ6D 3UP1A 4KKAC 3W5MA 4YGVA 1JI2A 4W9DC 4WEBH 3NJJA 2HWZL 3H4HA 2BJMH 4P3DB 1KCUL 2GUOB 1OPGH 3B5GA 1X7SA 1QRNB 4Y5YB 3DX3A 1M7IA 1N3NA 3HE7C 2BVUA 1MIML 4W9FC 1E67A 4Y4FA 2Z35A 1DO5A 2FYVA 2ZOWA 3GLAA 3OKLB 1XGPB 2BSEA 3QZBA 4JRYE 4FG0A 3VFRA 5JIIA 1DSFL 3WFEH 3CV5A 1ADQH 5D4HA 3O2DA 2SEBB 3KNBB 5ALCH 3RVUD 1AXTH 1EZVX 4QRUA 2H6UA 2ZCKH 2IAND 5ABAA 3U0WL 3DRTA 4FNQA 5E94B 1QFOA 5E51A 2ITFA 1XR9B 2R8SL 1I9IH 2FO4A 3MRMB 5GGTA 4MD0A 3UROR 4YWGH 3HG1B 1J86A 3QPKA 2WPGA 3IU4L 3B3IB 5CINH 3WNJA 4F9PC 3IE9A 4JFZL 5EEWA 4GSUA 2DM7A 5CP7A 3ZXAC 4QCIA 3EO0B 3QZLA 5IQNA 1P5UB 5DJYA 2ORBH 3FQWA 2GC7C 3HBGA 4PGEB 4YHZL 3ABZA 2XNAB 3H55A 1EEUA 5IHWA 5FO7B 1BSIA 3RG1C 5AAMA 4XPBL 4HYTB 4UU9B 5ISZA 3UPRA 4XNAA 2ITEA 2R0ZH 5A2KH 4FQQA 5CSGA 3GMNB 2JB6A 1GAFH 4J3XA 5EZIL 4MB1A 1WA1X 3FW6A 3QPQC 3I6SA 4H8WC 5JW3H 3Q44A 1RK7A 2YXWA 1OGSA 1H6EA 2WN2A 1SDDA 4JPIA 5TJWK 2CWRA 4JDTH 3T1WA 4DP5X 5EIQA 4I77L 3JVGA 1LO4H 5KG9B 4YR6B 2LAGB 2G60H 2AK4A 2ZYRA 4NZTH 1I3RB 3KWUA 3MX0A 3RWIB 3SJVA 2NCMA 4RWYH 1BGXH 2HFFA 4QXVA 1ZSDB 2OTPA 1ZTXL 2NY5L 2AV7A 1TFHA 2OR8A 5CCJA 3H54A 3ATFA 5JPMA 2D9CA 2Q6WB 4DPRA 3ISRA 1UKSA 5T3ZD 1BYPA 4EI5B 4HIEA 2D31A 4YSUA 3TBTB 3L5HA 1O9VA 1NSNL 3WS6C 5TE4H 2HT4C 3EOTL 1CN4A 1OANA 4ADGA 3EJTA 2YRZA 3B34A 4XPTH 4KAQL 3UOAB 3F2LA 4ZFOA 2EDBA 3NPSB 5JOPD 3Q05A 4NQTA 4Y5YC 4KTGA 5LBSL 4TVPH 4EAEA 2XTLA 5E24E 4N86A 3V0IA 4JQIH 4GW5B 3RZWA 4L8DB 1YMMD 3MXWH 4OZGA 5FM4A 2DWEB 1XH3B 4O00A 2Z8RA 3BVNA 3NDYE 4GKOA 4G42A 4GBXB 2PYEA 1DBKL 2UVEA 3QQXA 3BPLB 1URLA 2PUQT 5J4MA 4XMZA 3BGMA 4NT6A 2R1YA 4NDMB 5D93C 4CJ0A 3F12A 4M7JL 3ZLQC 4XAWH 4WFFD 3JWNE 1MCEA 3FHEA 3PP3H 4WNQB 5BMFH 4QJ3B 4NQXA 4DJMA 4O02B 3D0LB 5FO9A 4U1IB 3EO9L 4WDIB 4E9XA 3M88A 1RIHL 1YY9D 1B6DA 2JK5B 2FJFA 3FSOA 3RUGA 2VDPH 1MREH 4O2EA 3PWVA 5ESVB 2JIXA 3HAEH 1R3LA 4LQ1A 1FL5B 3FFCB 4A2DA 1MFBH 3ABKB 2PCFB 1FFNB 3SCMB 3WMQA 2VDPB 3QAZB 2ZPKL 5DHVB 4D0CB 5I66A 4OF8A 4NQCB 3IYLW 5KTEH 3MBWA 1EH9A 2VZSA 2QMJA 2XWTA 3UYPA 2PLTA 2Y7NA 4WO4B 1VEOA 4A1RA 4AJYV 3MGOA 4CU8A 2E4TA 2MMXA 2XQYG 1QABA 3ZE0F 3WUWG 2ZUTA 3CFBB 4FHBD 1YSOA 1NICA 4KQ3L 2EXWC 1GHFH 4PVNA 1N2RB 3CXFA 4HJJL 4K5OA 5CEZL 1WFIA 1KFGA 3NPZB 3FB8A 1T1XA 1Q1JL 2WZ5A 4X6BB 5KAQG 2XXFA 4X4ME 2VN5A 1D7FA 4Z3JA 3AXIA 2EDYA 3QIUA 4F9PA 4I3SL 3ULUD 4GBXC 1O7DC 1YEJH 4GG6A 4KQ4H 2OI9B 4Y89A 1AD9A 5DVKA 4FA8A 4WY7L 4G8FA 2P8PA 3B6SB 4PRBA 2R2EA 3IGUA 3QFGA 1AYRA 3LSOB 3FQ4A 2RMNA 3IB4A 3EBHA 3SDDA 4YAQB 3GTVA 3HE7D 4IU2A 5E8OA 5EO0A 4KTEL 2O6CA 1I75A 1X5LA 4YL9A 1NGQH 4YXKH 1T7YA 3BH8A 3P3TA 4TULH 2YQBA 2PYED 3QUXB 2XKSA 1WTLA 1U91B 4GQRA 4PRNB 1ZHLB 2E86A 5F0MB 1I85A 1AO7E 1KGIA 2IWEA 2Q5BA 1TYEB 1XFPA 2Y5QA 2QKIC 4R8WL 1GYWA 4L3EE 4X8JA 3ZTNH 3HMWH 3DSNB 2Y07L 4M6OH 2YUWA 4LBEA 3FQXB 4KRLB 4KXCA 1UVQA 3RGVD 4YSAA 4JFXB 4W9IC 4I3RL 1S9YA 1F58H 3IFLH 1BQKA 4OUOA 4J27A 4LCUB 1BF5A 2APFA 2WVVB 5IFAL 5I5MA 1I8MA 1G4RA 2YMXL 5F7FA 4HUWB 32C2B 5IROA 1EO7A 3V4VA 3IFLL 4BGLA 3GSNA 5KVFH 2W91A 3R06B 4HKXA 4JFEB 1IE4A 2G9KA 4JZNB 4Y16A 1W9XA 2QVMA 4G8EB 5G2NA 3SKNA 1IT9H 4P9HL 2X88A 2A1WL 3L3GA 3GRGA 5EC2B 3AG1B 1Y0LB 8PAZA 1OAJA 2NXZD 4LKCB 2ERJC 5FW6A 3K2MC 4UDUB 2GT9A 3RGVC 4EDWH 4W9KC 1USQA 3HB3D 4HFWA 2Y36L 5FCUH 2HJLA 3K6SA 1YYLH 1IGYB 3HC4L 5GGQH 3IVKB 5AKRA 2DJMA 4I77H 3FTUA 3TPUA 2BZ7A 3V9CA 3ZSSA 5LO7A 1WEJH 5H4ZA 1UGNA 3Q3GB 3AMKA 3SD5A 3ARGB 4N85A 4U1LB 4DUVA 2H6PB 4QRUB 1A0QH 5G5DB 4AVHA 2JTDA 5J11B 3T3ME 2H1PL 2W9EL 2Z93A 4S1DD 1DSYA 1KCVL 1MCQA 3IJSB 1FFOB 4RBPK 3TVMB 3UTSA 5KW9L 1ZHBA 2YGQA 3C6LB 2NXYB 2WMPB 1EAPB 1TZIB 3BUQA 4GIOA 1NIAA 4M62L 4AVKA 4PJBF 5DD0H 5CP7B 2DQEH 3RAJL 2DKUA 4UIMB 1Z6JT 4PG2C 1FAIL 1LNUA 3D05A 4GW4B 4N1HB 3WJLA 4EUPB 2HLAA 1SRDA 1I1RA 4C59B 3C6SA 1MFDL 4HKZA 1G9MC 4MNGB 4DPAX 5GS0C 2WXPA 4OQTL 1WZLA 1TJGL 4Z23A 2Z6FA 1IC4H 4UINL 2J2ZB 4U05A 1INQA 1LK3L 2ERJB 5E4OA 5HHVH 3ELAT 4APQA 4ODUA 3CFDA 3L3OB 3DK0A 3LPWA 4HALA 1D3CA 1XXFC 2MKLC 4ZMQA 5KYXA 4PWJA 2O93L 2DQJL 4GYBA 2KPNA 2J8UF 4KPHL 1ML0A 4XVUD 5K93A 1LYQA 2DMKA 4AEHH 3CLFH 1FH2A 1MFEH 4ONFH 4HT1H 3UJTH 3WFHA 1SDAB 4MB3A 4AV5A 4UNVA 4GAGH 2NYYC 1C5CH 3VH8B 5EF1A 1ZWIB 2NY1C 1QBBA 2UXVA 5F7MC 3FRPB 5LB1A 4KXZI 4XXDB 3ARSA 5AYUH 5I1HL 1I1AD 1DDHB 1REIA 2WINA 4IGBC 5EA0H 5E08L 4DO6A 3U30B 3SPCA 1P53A 1NFDF 2FD6L 2J12B 3TBSA 1LQBC 3NRPA 1YN6A 2DQUH 2IAMB 2QMKA 4PJ6A 2NTFA 4OU3A 4U6XA 4IEFA 4XCFL 5FYJU 4YSSA 5JIMA 3NCBB 4H8WH 4QRSB 3T77A 4H20L 5T3XD 4O4YL 4CADA 2ZKHL 2F1BA 3OKEA 4J3OC 4HBQA 2JLPA 3D69B 4JRXA 5ITFB 1JPGB 3FXIC 2Z31D 3SCMD 3DECA 3KJ4B 2F58H 4OTXL 3TLRA 3MJ9A 1KCLA 4M00A 5SWSE 3VI3A 1XZ0A 1FBIL 2BNRB 3LNGA 1A64A 4ZS7H 2WYHA 3T4AB 3HMXL 5I8OH 5L4JA 5IVZB 4F80A 3APDA 4FYRA 4N5EC 4KI5E 2FAUA 1FNGB 3DUUA 3IJYB 4TVPD 1E30A 1PU0A 4MJ4A 4JZOA 5ADOL 4YHIA 1EJ6A 4B9JA 3WKQA 3PWLA 3HHRB 1ZMYA 1XIWA 5FYKU 1CE1H 5FW7A 1XL4A 5I76A 5D7JA 4X5PA 4S11A 4GLRI 3FQ1A 2P49B 4UBDC 3TBVA 4ACTA 2ZCKL 2BP8A 2AF2A 4ZD3L 4G6FD 2O5ZL 4PCTA 1R1CA 2WTRA 4I5BB 5AW2B 5HVFB 1ZLDA 4WW2A 5DJ0B 5HI3C 4AGOA 5JQ6H 3GRWA 1JZJA 1OL0A 3KPPB 2BOLA 5IMOB 4X80H 2CR6A 2GAZA 4JN1H 1FYHB 3HCVB 4WHTB 1SLXA 3KLAA 4N0CD 1CD1A 5T1KD 4HWNA 4N2MA 5FGCB 3WIIH 3EYUH 1BZQK 3OVUB 3SOBH 1ZANL 2F5BL 3TH2T 1JWUA 1T6BX 3I6GB 3H9YA 2HT2D 3N43F 2YEQA 4Q6IB 5D2LB 3FRUA 4F5CE 1HVXA 1JYWA 5DQ9B 3FB5A 4IHOB 4QPEA 3GSWB 3FO9A 4X99A 3GKZA 1JZFA 4HHAB 3BQUB 1IGTB 3QA3A 2A1WH 4OVVA 3MNDA 4N8VB 5EU5B 1CTOA 5GQBA 3VXUE 2Y7SA 3ZQWA 3ZE2B 2V2XB 1TTBA 5B7FA 4LCWD 1JJUA 1V10A 1WFJA 1Q4NX 3VFNA 3L6FB 1G5GA 4L37B 3D48R 1Z9PA 2B2XL 2E8ZA 1CURA 3SDCB 1NBYB 4AJ0A 4NQEB 4PJ7E 3U30C 5BVPL 5JA9A 1M9SA 2R1XA 4PJ7F 4DK3A 4RWYL 2VLRD 4AX3A 4XCNB 5EN2A 3GMOB 5CCKH 3MUJA 3RL2A 1E3XA 1HOCB 2B15A 2VLKE 3LXBA 5FYLE 4PI2A 1NCAH 3N40P 2DI8A 2VMCA 1CL7L 3N0PB 3PXLA 5DHYA 1UQSB 5C70A 5K9KB 2CE6A 4XHJC 4OSUH 3M1CA 2ZF8A 5AG8A 2AABH 1X6NA 4FS0A 3GRWL 4HIHA 3L5JA 3QCTH 5FYKL 4X7DC 2A4CA 3VSQA 3UO1H 3PY9A 3G9VA 4K71B 3UIYA 4XBMA 2YFNA 4WV1C 4JHZA 4P5KB 1PD0A 1MKFA 2D7PA 2XI9A 4K2UH 3VGHA 1BIHA 4OF0A 4Z0XB 2GPZA 2WVSA 3I2CL 4PJ7B 5IIEB 1OCWL 3MXWL 1TJIL 5H2BB 1JZEA 4GUPA 5LDSA 4PIBA 5D7EA 4MMZA 2YWZA 5GGQL 2IQ9L 1C1EH 2NY3C 3IU3B 3LX9A 4LDCA 1FFPB 4AM0A 2OP4H 2W38A 1UEYA 2OULB 5F1OB 3ZYJA 1ZHNA 4I4WB 4HISA 2UXFA 4K8RC 3CDFA 5IY5B 1URZA 5EH1A 3NFNA 5DMKB 4PGDA 3C5ZC 3DPBB 1B3JA 5F7WC 1FVDB 3TPKA 4LSSL 1HXMB 3V6BR 43C9B 4HG4J 4GKNB 4ORGA 3PL6A 4OIAA 1MUJA 3QCVH 5C07B 3ASNB 1DL7L 5A2AA 4XPHH 2MCG1 4XHJD 2E75C 2DLHA 5FO8B 4GI9A 4OLXL 1MG2C 2YD1A 4L2YA 5D7SH 4ZQKA 4AL8H 2TSBA 5G4NA 2J6EL 1OT4A 3X13B 3WTXA 1P0SE 4EOWH 2VB5A 1F58L 1S46A 1MHPL 1PLBA 1WT5C 1XR8A 1YVLA 3MOBL 3O0LA 1EJFA 1RZPA 3DUSA 1MFAH 1DANT 5E4EB 3JV5A 3V79C 3EKCA 2AVFA 2NXZC 3VU1A 4K23H 3UPCA 4KMTL 1A7NH 2XG5A 4J3VA 2PCFA 3VUAA 3E3QE 4LCCA 5TE7L 3G9AB 4LCYA 1YEEL 1NUNB 1YNTA 4IS6A 3WMSA 1ED3A 1G5AA 2FECL 1ZEAL 2E9BA 3QJFA 1AGDB 1QA9B 4Y19E 3RPIA 3EFFA 2CDGB 4ZFGL 3HUJF 4OAWA 1OKEA 1PLGL 4KJYA 3GT6A 1ESOA 2ZX7A 3X1GA 5AOZA 3HNVL 3MR9A 5IQ9A 3IN2A 2PN5A 3AT9A 2ENYA 4MCYB 4CW1A 3K71A 2GIMA 4YBLB 3CLWA 2W8CA 4PUBH 3FBKA 5F3FA 1G6RL 2G75A 2WNXA 4BSJA 1X9QA 4OGQC 1AI1H 5E6IB 1NFIB 5DHXB 1ZS8B 1T1YA 2A6DB 4QIRA 5L2KE 5IB1A 3VH8G 1EDYA 1ILSA 2RCSH 3MCLH 4JO3L 4L3ED 1RJCA 1OAXL 1IL1B 5D4QA 5SWZA 3ULUH 3UTQA 4DEWA 4ETQB 1IFRA 3E2HC 1DFBL 1I1AB 3KVDD 4A37A 3GBLA 4KMTH 1N10A 1W6LA 5E4EC 3WUWB 4MSWA 2VDLL 1KBBA 2YN3A 3PHSA 1XGUB 4JAMA 4WU5B 5I6MA 5JQ6L 2HKAA 2J56A 1SGKA 4FQXC 4M1DL 4XI5D 3TT3L 3IJSA 2EC8A 3KYAA 3TBSB 2GTZB 4X6DB 4WKZA 4HMEA 1UZ6F 4BUHA 2BP0B 5IEKA 1PQZA 4U6XB 3ARGC 3TBWA 3EH1A 5ANME 1E9OB 2JMRA 3D09A 4FLRA 5DHMC 4LMQE 2WWMC 5FA3B 2BRQA 3GSNL 4N6QA 4GEIA 4NOBA 5J1AA 4N2KA 5JORB 2WWMD 2IOMA 2IFFH 5B1AB 5KVEH 1KFAL 4XNMB 5D71H 1DJXA 3QFJD 4EZMA 2X2UA 3D06A 3SDDD 2ADGA 3HE7A 2DL2A 5T5FL 4UT9A 1GXEA 4NBZB 3CFDB 2YAFA 3IRCA 2A9DA 3MRHA 1A1MB 3VM5A 4HWBL 4PD4J 4ZODA 4E41A 3PABA 1DSWA 1SZNA 2IG2H 35C8L 4IRJA 4F92B 1L6ZA 4Y2DB 5I71B 3I6LE 3O3EA 2IALA 3FN9A 1NMAL 4BHUA 4WFEE 3TNNB 5HGHB 3FOLA 4R96B 1L9RA 4MNQD 3GMLB 5G4MA 4D7BA 2A73B 2X70B 1WBXA 3VQLA 1E4XI 3BD4A 3IU4H 4S10A 2NYYD 4FYQA 3VFUA 2MRYA 2EVJA 3CFCH 3CSTA 3TJPA 1N5YL 1DDHA 1TNNA 3DI3B 1HESA 3BVDB 4HIIB 5G5DA 3WLBB 1DANU 4LMQI 4ZUVB 1TO4A 3EDKA 2OYLA 2IAMA 3CAFA 3QUZC 5LGJB 4ZMVA 5I8CA 4PP1C 3ULUE 1UB5A 3IETB 3F8UB 4IGBB 3W1ZA 3ULUF 2Y7MA 5EO1B 3ULVC 3KNBA 4OGYL 4DK6A 5DEGB 4LPYA 2EEDA 3KPRD 5FOJA 1KIPA 3UC2A 4OQ1A 4QXWA 5ABDE 1IT9L 3PCYA 1BQHG 2OW7A 3BWAB 2VISB 3VD0A 1S9KC 1Q9LB 2BINA 3T0EC 2DWYA 2CKNA 2DKMA 4X99B 1T5XA 4PHXA 3CBKB 1HEHC 5CJ8A 4P3CH 3CXHK 4GXUM 1F11B 3OKDB 4NAMA 1RMFL 2ADYA 4Q52A 4O2CA 5E2JA 2VMDA 5KUMA 3FAXA 5I24A 2E4FA 2Z8VC 3KJ4C 1H0DB 4JX0A 5KEZA 4PYHA 5KUKA 1KC5H 4MNGE 1FYTB 3HAEB 3EGSA 3S98A 3DARA 3UP6A 5IVXA 2OZ4H 3A3YB 4QDGA 2CO3A 1G6RA 1LVEA 3NFSH 4DH2A 2YPVH 5F71A 2BHZA 1M05A 15C8L 1CLOL 5ADPL 5I2IB 1N0XH 3AROA 4IRJD 5DRZA 4ZUWB 5ILTL 5K9KA 4JANB 3QUYC 3R8BB 5I23A 1IEAB 3GD1C 5JHLA 1NANH 2AQSA 3WGUB 5A2BA 2QPUA 1AGCB 3F6IA 2WYIA 4G1EA 3FYIB 4ANWA 2WXIA 3MJ8B 1RY7B 5B22A 4P5TA 1VZHA 3UGUA 4XAKE 1K85A 3ZRFC 2BNQD 3WTVA 4J3WA 1UUNA 1FGNL 3FC8A 1YG9A 4HIQA 3QIBC 4UWQB 1O6TA 5CBAA 4AYGA 1Q72H 2J8UA 3HMXA 4HPOH 4DZBA 1F4YH 4X6FA 4PS8A 4WI3A 3NA9H 3O9WD 2DQTL 2XWJB 4AGPA 4PWEA 2O5NA 3NEOA 3WUZA 4H25A 1CFQA 3CMOL 2UY7B 1DQML 3QPQD 3O8XA 2LU5A 1CLZL 2NNFA 5EU3A 3RDTC 3TA3B 1BX2B 1ZHKB 4ZMAT 2Y23A 3QG6B 5IVZA 3NFNB 5DMKA 1HJBC 4JFYB 1CBVH 5IK3B 2HT3C 1QO3B 2AQRA 4GKNA 4ORGB 1NGPL 2R69H 2X53A 5AQ0A 1NGYB 2YRLA 4R2GD 1TCRB 3AY2A 4OLWH 1N5AA 5EZOL 3H7LA 3M1BB 3ARTA 2HT3D 3A6BH 4MQ7B 4CVWA 3DX1A 1LO0L 4IW4C 4PJ9C 2ZWYA 1RUPH 1DFBH 2WTPA 2YOCA 4QT5B 4QHKJ 1KB5B 4MHHI 3BZEA 1M6OA 3IDMB 2EINB 2NUTB 4OZHB 2EICA 3DX8A 3OMNB 1N6VA 4LSVL 5JUEL 1BMZA 1A4BA 2C9UA 5DVPA 2H3XC 4M93B 3U9PL 1QI4A 1Y6KR 1IKNA 2OMBA 3O9WB 2NX5D 1JGDA 4RGOH 1EUTA 3D0LA 3B2UD 1YY8A 1ZT4A 1PJWA 4JM4L 4Y4HB 1KYDA 3PAZA 4YO0B 1XGPA 4LCWE 5C08A 2E27L 2R2BA 1ZA6B 4KV5E 4GG6E 1CFSA 1S5HA 4L18A 4LSTH 1TVHB 3WOVA 4MD5B 2KI6A 1JYVA 3BKCL 3OAZH 5JOPE 2VN7A 1YMMB 4E68A 3FRUB 3BAIA 2P42B 3OKOB 1PVHA 3H3KA 3DDFA 4FQCH 3IJHA 3NTCH 5AB1A 2YAEA 3QUXC 2FO4B 3MRMA 4ERSH 4OJAA 2I07A 4HXAH 3UJIL 3VGGA 2PTVA 2DQMA 3OPZH 1KZYA 3HOGA 1YUKB 3QWRD 3T2PA 3ZZ1A 3IRPX 1BQLL 3V95A 2EXSA 3IAPA 1FORH 3DXAD 1DJWA 1OP3K 3NCYP 4JKLA 3L54A 5E23A 2K45A 3H7BB 3BHBB 3P2DA 4NJAH 3QUYB 1BAGA 3L7EA 5LQBH 1PDKB 4PGEA 2W0FA 4MNQB 5ALCL 1VADA 2IADB 2Y5TA 3ARDD 3TA3D 3UTQB 3UBFA 2ZXEB 1NEZB 3SKUD 3RB5A 1MCJA 2VQTA 4P0DA 1YY9C 3RWCB 3C5ZB 3P3RA 5INCA 5M7QA 4G8FB 1BD2E 4RDQG 1AC0A 2WKLA 4YNYB 3S36L 6PCYA 3BZ4B 4QLRA 2AZAA 4N0CC 1P69B 1RCYA 2BHUA 1AXSA 3MUZ1 4MKTA 4ATTA 1J9QA 4ENEC 4LCCB 4LK4A 4DVRH 5T3XL 2ZTBA 4U4IA 4M7LH 5FGBC 1PQZB 4H40A 1JTTA 3X3GL 2F19H 4MQSB 4HJIA 3ZDXF 1P84J 4B41A 2CPUA 3KDMA 4RZKA 4KK6C 4ELME 5IFJB 4KI5D 5FKAA 1UH4A 3V8OA 4KJYB 4F58H 4OCNC 2WQ8A 2XUWA 3EGDA 3UBXG 1BECA 1A8JH 1Z1WA 2K3TA 3IGFA 4C83B 4Z5RA 1OQXA 4NO5B 5DUML 3SY0A 4LLMA 3INUL 2FJHA 3FQRA 1PNCA 3FU8A 5C09B 3WJJC 5IQOA 4AG4H 3LY6A 2PWGA 5DWPA 3WTSA 2WNGA 1WZKA 5AYQA 1UVQB 4ADIA 2P48B 4JM2F 4PV1C 1CLCA 4DK5A 1YHPA 3GS7A 1T1YB 1XD1A 4ABQA 3A22A 2LR4A 1SM3L 1ZK5A 2RBLA 2R4SH 5C6TH 1LO3H 2W07B 2Z91B 2ROXA 3N04A 2OR9H 2ZX6A 4Z7VB 4MJ6B 4FA7B 3I9AA 2QVFB 4A2MA 1Y0LA 1HIML 1LO3L 2BSTB 3T0AA 1PCXA 1RZKH 4KHXH 2J88L 3FO0L 2P26A 3NZHH 3SBQA 2H32A 3MLWH 4FZ8H 5KANG 1QHQA 3D2TA 1N19A 1A1OB 3OAYK 5IESL 5FDYA 5E2WL 3L2LA 4EI6B 2XG5B 4M6AA 5I17B 4FQXA 3IDIA 4GRLA 3SQBA 4JREB 3LHPH 1P5VA 3GS0A 3UL4A 4XN5A 4FTVE 1NCCL 3RBGA 5J1AB 1TETL 1I85C 2BW4A 4APQC 5HYJB 4BQ6A 3F58H 3IRZA 2D03L 3VWKD 4DGWC 5DS2A 2OSYA 3MBEC 2XZAH 3T4YA 1VPOH 3FUMA 2WWNA 4UQ2B 1RK1B 2EIZA 2A6KB 4P57A 5EU7C 3SO3C 3VWJC 2D03H 4POZD 1RUML 3PNWB 3RHWK 4QRQB 4HUVB 1NCBL 1DQQB 1OCRB 1RHFA 1XMEB 5IOPA 2YFOA 3TA4D 1RIUH 1B0RA 2BHFA 5CMAA 3WNNA 2NX5E 4YPGA 2KQNA 2J3SA 2JJTC 4BQBA 1DVFD 3P4NA 4IDJL 4LRIC 4UT7L 1MLBB 4NKOA 4K55A 3RJDA 1AHKA 4NO0D 1ZT7B 3BH9B 2CCLA 4R96A 3ZVVA 2ICEA 4JO5A 1FC2D 2PWDA 2VABB 1GTNA 2DYPD 2OV0A 2PWFA 3NCJL 1JNLH 3QRLA 4XXWC 3AJ7A 1IL1A 2DEWX 1INQB 1UOVA 2DTSA 2A6JA 3BZ5A 4MA7H 5D1QB 1A6WL 3ETBJ 2EDFA 1MWAL 2AGJH 4WK2B 2M1KA 1CVRA 3BUYA 2W80C 2EXTA 1XSIA 2GY7B 3D5OF 3CH1B 4WHDA 5L2KB 1IEAA 2IV8A 2TRHA 4R5TA 2XBDA 3ECUA 2JCCE 3P73A 3QXVA 2HN7A 2BPBA 3T4AC 2COVD 3OAUL 3C8KB 3ARBB 5ES4B 2AQQA 1ZLUH 1W16A 1U58A 4FCAA 1JXGA 3ULVE 2BSED 1MLCB 2VWEC 4ZS7L 1LTXA 3P3UA 3CC1A 5DJ8A 1E9OA 3CN0A 2HH0L 4BCXA 3V7AE 3CZFB 3VFPB 2Q87A 4HOXA 3GMPA 4ZYKB 1M6UA 4WHYG 3GXUB 4LPWA 4RESB 4G8GA 4DVBB 1TQSA 3F84A 2G5UA 4K9EC 2YA1A 2X2JA 4HWBA 2PWEA 2Y5EA 1ZLVK 3K6DA 4Q9QL 1T0PB 1F11A 2DEXX 4U6TA 1H3WM 1IGFL 2GK0A 5CEZD 5I1JL 2Z7YA 4FQ1H 3MYJB 2IQ9H 1BBJA 3LQZB 3KR3H 4TM9A 5DJZB 1X7TA 3UDWA 5T1MB 1JTPA 1CICB 4C56A 5HVGB 1U93A 3H6AA 2GABA 4LARH 1KELL 2NR6D 1NGYA 5E6ID 4JHWH 4DKFL 2IALB 32C2A 5I16A 1H19A 4L1HA 3KBHE 3KCPA 3VGAC 1JDCA 2EJ1A 3C60D 1WBXB 4DGYL 2ZUWA 4LCWB 1AKJA 2H45A 3LZQA 2WLIA 4I2XA 3T71A 3CVHB 1OTSD 3VG0H 4BFBD 4HIIA 5CJ5A 4U33A 3S2AA 5FEBA 3TO4B 1UURA 7TAAA 3BKJL 2D4DA 4BQ9A 3L1OL 4XVSL 3TEWA 2OR9L 2HVKA 2DLTA 5HGGS 2UVFA 4PGZA 1R5VA 1OOWA 4LLWA 3LZLA 4X0KB 3QQ3A 1OK0A 1ACYL 1Y7VA 4X4YB 5EO1A 5BV7H 4MAUH 2HMIC 5IT2H 3ROOA 1PX8A 1NAMB 1HILA 4W93A 5DRXA 4JDEA 5T33L 3HR5B 3NCCB 1MJJA 2VN6A 5GZOA 2YEZA 3JVGC 3G5WA 3CHRA 4H25B 5KBPA 4U1MB 3WIAA 1F90L 1SPDA 3B9EA 2A6IB 1ZHBB 4KO9A 5E00A 3DBXB 5ESQB 5AWNH 2AQ3A 3T2OA 3SDAA 1JDDA 4GO9A 5HHOB 4LASH 5F96H 2EH8H 1ITBB 1FCCA 5CHNB 3I6GA 4PG9A 4KDWA 1FVCB 4PJFB 3D4CA 4Q14A 3MRFA 4CDHA 2K8QA 4C57C 4PB9H 5EOQL 1HC1A 4ZTPL 1IIKA 1NLDH 4IKLA 4LLYB 4NM8H 3AZUA 3Q8BA 3DGDA 3DTXB 1ZVNA 4UCFA 1JZDC 4ANVA 3C6SB 3QQDA 4K71C 3U79A 4M7LL 5FUOL 4I18B 2HKHH 3O4OB 4C55A 3ILQC 1EK3A 5LCVL 2HFGL 1DN2A 4LCVA 4H5SB 4AQAA 3OBAA 2WBJB 4J6RL 3HR6A 1A9EB 2VERA 4NJ9L 5HSFA 4W68A 3E6FA 4P2OC 5EOTA 5K5YA 3H8NA 1JPTH 4FULA 1ASQA 4G7YL 4OGYH 5DXWA 1TNMA 3T0EA 3LKOB 2VQ4A 1QD0A 5JMRA 4NN6B 1FNLA 1MWAA 3IWVA 4GXFA 4HUKB 1NUDA 5D2NC 3ZTDC 3BQVA 2CM5A 5I6KA 1EO5A 1S7TB 3HPJA 2NT1A 3KPQA 4UYQA 1SF5A 5E9DA 4IBVA 1QAWA 3OAWA 4IBWA 5GS0L 3R0MA 3H2WA 4BKLB 3MJ7A 4MYWB 1ETA1 2XBTA 4K9EH 2YZ1A 4DHLA 4R3SA 2Y24A 5T3ZE 4Y4HC 2ZOOA 5T1KB 1S7RA 3SY0B 1U2YA 4KY1H 3RTQD 2CH8A 5JIHA 5KAQF 2FYYB 3LZNA 4GSDL 4Q58C 4Y16C 5DC9B 2Z4TA 1V54B 3SKMB 3FMGH 4P5KA 1XSOA 2V7NA 4UB0L 5I0WA 2VJ8A 2AV1A 3I2CH 4GH7B 3MRGB 4CMHC 2XOTA 4GUPB 1OLLA 4WUUA 3SQOH 3VXOA 1WISA 1PZDA 3BDYL 2NY6C 2BCKB 4HX1B 4PYGA 3K2KA 1OAUH 2E5EA 2OM5A 4J5VA 4HJGA 1E9QA 2APWA 2AJ3A 3WIHH 2ATKB 3CPUA 4NKMB 4J8RB 1WEJL 2RHEA 1EHLL 2XTJE 3EGXB 3DX2A 1D2PA 4JPWL 4LCIH 3ATDA 1FH5H 4X4MA 3LRSB 1KYUA 1OCOB 3ILEA 5GS0H 4FYSA 3SSGA 5EIIB 1ZVSB 2VRKA 2X3BA 3UGEA 3ZY7A 1YEKL 2OBGA 2ENSA 5LJYH 1U95A 2FB4L 2KQMA 2BXZA 2VC2B 4PJ5E 2A0LC 2DLEA 3TBCA 5BRQA 2VXQH 4F1ZA 1SM3H 1DBJL 4XWOC 5F1NA 4GW1B 3VVVA 4J1UB 3EXJA 2LVEA 2WKOF 3OGCB 3BWSA 4BFRA 1YMMA 4U3HA 2XWZA 5IMOA 2IO5A 4RMTA 5I1KH 5DI8A 3UTOA 5D1ZC 4GG8A 2OTUA 1I1FA 2B16A 5FB8A 1EANA 4NO2A 4R6UA 5JMOC 1DJSA 3JUZA 1EZVY 3DRQA 5CLXA 1JAEA 4G11A 3MROB 1P7BA 3HUJA 3B2VL 1VHPA 4P2OB 1DVUA 2H26A 1QTSA 3D4ZA 3EUDA 3GLDA 4PGCB 4L3EA 5HYEA 2QT6A 3ZTEA 3PWPE 3K80A 3QI9A 1Q0XH 1GGIH 1QRKA 1ZA3A 3HPLA 4H2CA 4N28A 5E1AB 4AGMA 4NNPH 2D7QA 1FUNA 2GQHA 1NJ9A 4JM0A 1ID2A 1UH3A 2DH2A 4BH7A 2VZOA 1MI5D 1AE6L 4GMSL 3GMMB 4QY8A 1O7DE 2DBJA 3AMLA 3AY4A 4R26L 5I73B 4DVRL 3BJ91 1A6ZA 3RILA 1KXQE 4JDVA 4K94C 4ZW8A 4CSTA 4NUGH 2X6AA 3BH4A 3RWHA 3ABLB 1A02N 2DB8A 1NGQL 1AXSB 5CEXB 1OSPH 2QHRH 1U8PA 5HPOA 5I0DA 4Q4EA 3F7PC 4TXVB 4RGMC 1JMZA 4OD3H 5CFAA 3FRPG 4Y2DC 2K6ZA 5I71C 3W9DA 2DYPB 4BHUI 3VFPA 1GH7A 1JWMA 1YPZF 2OX5A 1BVKA 1L7TL 1YLBB 4KGJA 3OKKB 1P4LB 3ECBA 5EBLB 2X5PA 2FWOB 4PAZA 4F33B 1HZHL 5TE6H 1O0VA 1YEEH 1DN0A 2ZE0A 1A3RL 2WZ6A 3MYJA 1GYVA 1J8SA 3DVNA 4TVUA 4JVUA 4AVJA 3KBFA 3LOWA 2DTMH 4R4FL 4X98A 1U93B 1JPFA 4XOBA 2V6HA 1MSPA 3BESR 4X83A 3UJJL 1QFUL 2QLYA 1U42A 1IFHL 3QUKA 3QS2A 1I3GL 5BXFA 3QDHA 1JPSH 4KMQA 5C97A 4FQXD 3PIQB 2WC7A 4KUZH 5ICYA 1GKOA 1VSCA 2J7LA 3HE7B 5D7KE 5HHNB 4ELDA 3DJTA 3FTVA 4FQ1L 3CLEH 4M1CD 4HUXB 4JN2B 5TDPB 1Y1UA 1KBWA 1UC6A 3KVQA 1YEFH 1BP3B 4QRAA 2JJVA 3WJLC 4Q9RH 4P2OD 5BV7B 4OD2A 4JRFA 1KELH 2EDNA 4Y2DA 3KXFA 4X6DF 2H32B 5HGHA 3ARBA 3OD3A 2VQ1B 2XVGA 4PJ8D 5EBGA 1ZLUK 4PSRA 1XF5A 1FE8H 4HAKA 1UD3A 2K9UA 3Q01A 1D5BB 2BS9A 1EERB 3MNMA 3O6KH 3LNFA 4P07A 1KB9J 5DC2A 5AZ2L 5HHOE 3WFCL 2DLIA 2QQKH 2R29H 2R39A 3CBRA 3QQ3B 5FYKD 4EIUA 2LQRA 3D4YA 1GY1A 1TJMA 4L4VA 4X9HA 3FU0A 3VDAA 4HF5L 2ADIB 1A6TB 3BVXA 5I5JA 3NK3A 1P5UC 4GQZA 2QR0A 4MXWL 3CIQA 4M43L 3BISA 1CE6B 4PTTA 4PW4A 4W6WB 2WOBA 3FZUC 3MRRB 4UTBL 1MJ7H 4HPYL 2HX7A 2C5DC 3BAEL 5B39A 5EF2A 3L3DA 3DBXA 1TQBB 4M4RA 1ZDSA 2P3YA 1IILE 1SF3A 3MRKB 2A3TA 4F1SA 5IOPB 3AREC 5DEGA 5KOVC 1EZSA 3M7OA 3QUXD 1YAIA 3PWJB 1ULVA 3FT4B 3GHEL 3UTZA 4AH2B 1UUSA 2VISA 3D9AH 3E1ZA 5I82A 1X5IA 3QR2A 3QDME 5DGRA 4GRLC 5IHZB 1TVBA 5CSZB 1MCRA 5BV7C 1IC7L 3PHOB 5BVPH 1QI3A 4QNPF 3CDGA 5KS9B 5JYLA 1YECH 2ZX9A 1I53A 2P1YA 2EZ0C 5GGSA 1Q9KA 1KUMA 4YN3A 3IMWA 1U8IB 2Y06L 2ZUXA 4AQ8A 5KSUA 3T3PF 2GYSA 3K6NA 4LSSH 4PWIA 4YHPA 2AK1H 4BSVA 5LCVH 5DFAA 1U36A 4UV7L 4X6CA 3S36X 3WKNA 1ZLWK 4YDNA 4IK6A 4MAZA 1XEUA 1YMHB 3MA9L 4WO0A 1INDL 2UV3A 3HC3L 4YSDA 4UB0H 1RSFA 3GINA 1Y6NR 2N0KA 4IBQA 2CR3A 3QDMB 2V5RA 2V3DA 4N8UA 5GIRB 3RB7A 3CSYB 1C5BL 2IH3A 1UA7A 3CHSA 1G1YA 1TLKA 4YGVB 4YQXH 1AAJA 4K9JA 1SMAA 4KVPA 4FD0A 4A2LA 5E2WH 4FMFA 4MB4A 4IMKA 2MQ3A 5IQ7L 5DD3H 3ZT7A 3VW3L 3DTXA 3C08H 5IW1B 5D96C 1F4YL 3N44B 2EVGA 2ZX8A 3VYOA 3EOAB 2XWJA 2ICES 4OZ4B 3SODB 1XXDC 1HH9B 2NSMA 2H3NA 5DD3L 5DFVD 2YEVB 3L81A 5AW1B 1K8IA 2IF7A 1I7TB 4LHUG 4OIIH 5FC9A 1M57B 1MAML 3WV0A 5FECA 1S7VA 3OSVA 2XY2A 1X5XA 1QLRB 2EILB 5DUPL 5DQDH 4F5CA 5IB5B 4LCWA 4ZX6A 1FJ1B 4N0UA 3SGJC 1QNZH 1KBPA 2IH8A 1IJ9A 5KW9H 5CU9A 4YE4H 3IMTA 3MNVA 4D0DA 2NNXA 2EIDA 4BFGA 2NQCA 3O3AB 1NC4B 5EZLB 4ZTOH 5LNEA 5BNXD 5AEAA 4TVSa 1PKQA 2AKRB 4LLAA 5AVQB 1LWRA 2NY6D 1IBZA 3UAFA 1JZIA 3UBHA 4PM1A 4M8QA 2BHYA 4NN7B 4GW1A 1CXLA 5FM5O 5I0YA 4R5XA 3QUMH 4ACPA 4C56D 4H1LB 3TH3T 1OF0A 1P4IL 5F88B 4LHUD 1Z5YD 3A4DA 1TMQA 3TC9A 4QD2E 2WCGA 3IXTA 3NJVA 1A7OH 2B39A 5J6HA 2IIJA 1Q1JH 1ASPA 5DFVC 5D96B 4PLJC 3FFDB 4OZHE 1TCMA 4EI0A 3D51A 1OAQH 4ZXBB 3CFQA 5DVLA 1TFPA 1IBBA 2GBUA 3OKOA 4PRPB 3ARYA 1BW8A 3MU3A 2GSMB 5TQ0H 2VM3A 2UWEB 2ED6A 2XWDA 2NY4C 2V17L 4XN7A 2YC1A 4M48L 1ODAA 2GFBA 2B1AL 2I07B 3D1MC 1T5XB 1RULL 2D0FA 5TGBA 5HY9A 2Z7WA 3EJQA 2VH5H 2ZUUA 1MAKA 2AXHA 4RZCB 4JB9L 4N4YB 2GB2A 2DQFB 3I9GL 2VDLH 2WXGA 1ZVSA 1AGFA 1LK3H 2VR6A 4TUKL 2P5WE 3OJ2C 4GKSA 4AZUA 2ZZUT 2QKIB 3N9GH 3WNLA 3JQOB 4NZUH 2ZCHL 2PETA 4OFYD 3TTSA 5JW5A 4DKFH 1AHWA 3S3SA 2H9GA 3SDAD 1KV3A 4MD4B 2CJUH 1Z5LA 1DVFC 8FABB 3JWDH 5IJKC 1ES0B 4OFKA 1EJ8A 4HC1H 4YFDB 5TF1H 4LT7A 2X4TA 2OMVA 4ZO6A 4L4TD 1QACA 1MHHB 5KSAD 1EVUA 3K6FA 4LIQE 5E70A 1S9WB 2ZXBA 2ALAA 3EG9B 1T5WA 2QZQA 1NC2B 4I48B 3GJEA 3F85A 3DVNB 5IB3B 3K71B 4ZMLA 1ZLEA 2V7HA 5C2UB 4DQOL 3N42F 1IAOA 5AW3B 2OFQA 2LU4A 2CIIA 2AJSH 4P2QE 1L9PA 4EXPX 1E3FA 4CC1A 2J8UB 3KS0J 2Y7QB 15C8H 4OM0H 3TIDA 3GJFK 1EX0A 4Z3HA 4A2GA 3VACA 4MVBC 3ARQA 3ETTA 4IBYA 3J27A 4UQEA 4Y19A 4EI5C 3T6XA 5I28A 1AHMA 4FXGC 2NR6C 3ZE2E 1IGCL 1CL7H 1I9RL 3SCMA 5D7HA 3GXPA 5FA4B 5DMGD 4WTXA 5EG6C 1M2VB 3P02A 4E5XG 4Q7DA 2F7QA 3LKSA 3U46A 2OLDA 3PQYD 5CZVH 1R6VA 1TENA 4TSCH 1C9SA 1CF8H 1XB6A 2XZCH 2D73A 1YNLH 3MFFB 1MCSA 3QJHA 4HW6A 4P59H 2G2PA 2V3FA 3VNZA 2WB1A 3B7UX 3DSFL 3KH3A 4JY6B 3MLUH 5DO2D 3Q0HA 4YBLC 2NZIA 4LSRH 2CIKA 5CKAA 2M2DA 1CK0L 3O9WC 1IEBA 1P9MC 2XWXA 2C1OA 2VE6A 3T08A 4OFPA 1FNEA 4F33A 2NOYA 4XXCA 4ZFOL 5E6IC 3NCMA 3THMH 4M6NL 5C0CA 1UM4L 3I85A 3RFRA 4ILDA 2DWXA 4P46D 3TYGL 1SOSA 5J57B 4NZJA 2IANE 4H1LH 5AALA 1HHIB 4KDTC 5LNGA 4ZPTA 3KW8A 5KYWB 4NO2B 3AXLB 3LS5H 5HYJA 1QRND 1HSBA 1NBVL 1T0NA 1TJIH 3GM0A 4PTUB 4X5RA 4HUUB 5L2KD 1UM5H 3QSKB 2DW5A 4OBRA 2Z64C 4PGCA 3WIHL 1VFBA 3QDGB 4X5XB 2YUZA 2NW2B 3IJHB 4P2AA 1I3RA 2MNJB 1A6VL 1ORQA 2OK0H 1K2DA 1TPXC 1V05A 4IJTA 4WZ9A 2D7TH 4IM8A 4MLSA 2OZ4L 3RFZB 3K8MA 1S7WB 1UXMA 1WWWX 2PYFB 5J3HD 1F4AA 2HXAA 3DROB 4ZMOA 1JE6A 5CCGE 2YLHA 1XGYL 3BHBA 1KIRB 3II3A 4DSYA 4POZC 2H1LM 4GT7A 4MNQA 1B2YA 2E9IA 1JXJA 2UY6B 3IDJA 4XXCC 5DFWH 1W0VB 4IRZL 2IXQA 5F8RC 3FS9A 5CLWA 5JYMA 5ELIA 2FX7H 4PRAB 2WLKA 3RP1A 4FI8A 5T1LD 4NSKB 5IKCA 3KEDA 2EDDA 3BUYB 3MZGB 2F7PA 5I1KL 4LCCC 4NPKA 3ES6B 2DQGH 4K73A 1VZGA 4A7GF 3C08L 4DCQA 1BXXA 4PJXF 1JZHA 2VLRA 3L9RA 4QRTB 3H42H 3L3GB 1YEDA 1SJXA 1P4LA 4R97B 4M02A 4H0IA 4MBRA 1NKRA 2DQGL 2JKTM 3MV9A 2R1WB 4WI4A 3QIUC 2YGOA 2VSDA 2F53B 4NBXB 3VXSA 3QDJE 1J5CA 4UYPA 1M3JA 4R9HA 5D8JL 4F93B 5IJKA 2W59A 5FKAB 3Q1EA 4AQ1B 1MFMA 3HN8A 4S1RH 2JFCA 4ZNEE 1TQBC 4J4PD 2BVPA 4A7UA 1YDPA 1MHEA 2JXMA 1OZTG 1QLEH 2NX5A 3BIBX 3CC5A 3WGVB 5KN5A 4FLQA 1W6WA 4BQ8A 4WUKH 5C0EB 2DQDL 2WVTA 5GGUB 4JFFB 4LPXA 4F2ME 5T1MA 4GI8A 1Q9KB 1AR2A 3BKML 1WHPA 3VE0B 3VCLA 4X5LA 4PRHD 3LN4A 4X42A 4Q0XH 3CPLA 3QG7L 4JCWA 2C3XA 2BC4B 2GSIB 4Q8BA 5DJCB 2DMHA 3H85A 3EDFA 2DQJH 4JDZA 4PLJD 4HOWA 2BW5A 4OVUA 5JW4M 5IZ7A 5HI5D 2XXCB 4D8PA 1WTGT 2PP9A 1CZ8H 3ASWA 4G9FB 5F7KC 3VG0L 4I0PA 2EEXA 4X7FC 3OG4B 4NRZB 1I4FA 2VDKB 4AQOA 3HIZA 1RUQL 2IPKB 5IVXE 4FZEL 4CGTA 5B4MC 1VGKA 4GRMA 4FL4B 3QIUB 4JRWA 3K6OA 3L3OA 4MS8D 2X6CA 4HWEH 2WBKA 2Z0UA 4P5TD 3BQUC 1P5VB 4PRBB 4UT6H 2ZF9A 2CBMA 4G8GE 4G5ZH 3CZSA 1ETJA 5JO5A 4HMCA 2QHLA 1A22B 3UJIH 3SO3B 4URKA 1FIEA 5CNHA 4JFQA 3T3MF 2UWEF 4X0NA 2H2PC 1L4IA 3K81A 3GBDA 2IGLA 1U4EA 3KEHA 1ZXKA 5B3JE 2Y3AA 3E7JA 3T0EE 2A6KA 1ZWIA 5A6MA 5I6XC 2IQAB 3W39B 3PJLA 4Q0XL 1IGCH 3RZCB 3CFCL 5IB5A 4PG9B 3ZDZE 3EFOA 1FJ1A 3GUTA 1CQYA 1CDJA 3QS3A 3QUYD 3GBNL 1CD8A 4RSVA 5DT1H 1O6VA 4XAWL 1BQUA 4FXKB 1ID5I 4WFGE 5EEXA 4MHHG 3WXVH 1KBVA 4MDJB 3MRQA 5I30H 2ZUYA 4JFOA 4U1GC 1QSVA 5EPMB 5EZLA 4XH2A 4PUBL 4OJDH 1VGEH 1CB4A 4E9TA 2VZTA 1F86A 4EN3A 1NCOA 3LEYL 2DWDA 1JGIA 2VLJA 4LEXL 2NLJA 1JPEA 3JTSB 5D1XD 3SKJL 4TSBH 4X7CC 2XKUA 4PRHA 2OYKA 2E47A 1TO5A 3KPLB 1BREA 2DIJA 3HG5A 3BVUA 1VF5C 2D8KA 3JUYA 3R06A 4J3OF 1RZ7H 4HEME 3ATAA 1UOWA 3L3IB 4WUUE 3RY6A 1D5MA 3JV6A 4JM2D 1KXTA 1ODUA 4P3CL 4LDLB 4LKCA 3L3HA 4RAUB 3V6OA 3KZ8A 4DW2L 1NH6A 1HZHH 3VFVA 4K3EL 2UZXB 4DUWA 1GHFL 1XIWB 3UYOD 2ARJB 2XG4A 3KWXA 4JFUA 1AVAA 2ATPA 1MNUL 4HKBB 2YUVA 4MJ5A 5EZJB 1MRCL 4D9RE 4KJQC 1J0ZA 1NCAL 1MW2A 3OB0H 4TOYH 1RZIB 2ENQA 4XO9A 1LO5A 3US9A 4JZJA 2NNAA 3GO1H 3WNMA 3Q3GA 2IAAC 2V3EA 5C08E 2JQMA 5D2LE 2A4EA 3SKMA 4A39A 4J39A 1RFDH 4LOUC 1C08B 2NY2D 4MMYB 2H0FA 5IG7B 4RGND 3SYOA 2EUXA 3LXAA 4HUMB 4QHMA 4WHTA 1GL4B 1XCWA 4O5LL 4PJCE 4U1GB 4LLQB 3LKSB 5ECGA 4Z0BL 3SYAA 5K59E 1AMYA 3KPNB 4QRFA 1SFHA 2YAOA 2EDJA 4QF1A 4F7PA 5K69A 3M1OA 1BOGA 3D3VD 1UA3A 2ROYA 2O6FA 3WD5L 3RGVA 3WEOA 3FH8A 2F5AH 3ESNA 5JDSA 1V27A 2J71A 4DN4H 3VX1A 2CIKB 1T80A 4TQIA 4CDGC 3AU1A 2X4TB 4X4XB 2HG5B 4XO5A 1NDTA 1MJ8L 3NPSC 4HJ1A 1EMTH 3QA3B 2BNQB 5PCYA 1EAOA 2BK8A 3RWEA 2JI2A 2G0KA 3WMPA 2JKRM 3MRLA 5JHDD 4FQJH 2V2XA 1J0JA 4P04A 3TWYA 2BNRD 4TPRH 1FF5A 4QXUL 4DETA 1MW3A 4ZPTB 4L37A 4AMKH 2OAAA 2VR4A 3T3PB 4PVBA 4UNUA 3ZRCC 2C4XA 4HETA 4WF7A 1KXQA 3ROLA 5KSVA 5KJRH 2KPWA 1CC3A 4H88H 3GMOA 4OF6A 2DJ4A 4XBPB 5TK2A 4M5TA 2VR7A 2F6AA 4ELMF 1P7KA 2MHAA 1X5FA 1CD0A 4AC2A 4KUCD 3O6FC 1OW0A 2J1KA 5C6WH 2KUTA 5FKPB 2BIQA 1MI5A 4M4PA 4W81A 4Z95H 2XJLA 5FYJD 3EJPA 3RPBA 3BCDA 1BQHB 4WW2C 1E4XH 4PJAB 4G8GD 1N67A 3SOTA 3WHXA 3CTTA 4G6JL 2WANA 3DETC 3DGGB 3DVGA 5DC0A 3TURA 4PLNC 3V10A 3ESVF 2ESVD 2QKIA