2EP6A

Solution structure of the second c2 domain from human mctp2 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
133
structure length
133
Chain Sequence
GSSGSSGDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second C2 domain from human MCTP2 protein
rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords MCTP2 protein
total genus 9
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2ep6A01
3PRZA 4PS3A 1DJZA 2WXJA 2CJSA 5CCJA 4OVUA 3F04A 4MJJA 3PREA 4L1BA 3KWTA 1E7UA 3JZYA 4WWOA 1UOWA 2NCEA 4L2YA 3QJZA 5CCGE 4XX5A 3PYCA 2CHWA 1WFMA 2WXPA 3QARA 1CJYA 3NZUA 2WXKA 4ICWA 3L4CA 3L13A 3R7QA 4FA6A 4A55A 2WXOA 2EP6A 2ZKMX 1TJXA 4JPSA 3L54A 3S2AA 1DSYA 3ENEA 2K4AA 4TV3A 2WXMA 4F91B 1K5WA 1DJXA 3QK0A 4AJWA 4QAMB 5JHAA 1E8ZA 4OVVA 4DNLA 3LJ3A 4WEEA 3KWUA 4HVBA 4NS0A 2WXFA 2DMGA 1RSYA 1W15A 3IM1A 4NPJA 2WXRA 1BCIA 4GB9A 1DJHA 2A5UA 2JQZA 3L16A 1E8YA 2N1TE 3FBKA 4F93B 3F00A 2DMHA 2WXIA 3TL5A 1QATA 3OHMB 3CSTA 4QJ4B 3FDWA 2ENQA 3PS6A 4QJ5B 3W56A 2CHXA 2Q0ZX 3DBSA 4ICXA 4KZCA 1DJGA 2CM6A 4FJYA 5H4ZA 4LCVA 3APDA 2D8KA 1E8XA 1DQVA 3MJWA 2B3RA 3N5AA 4LT7A 3R7RA 1BDYA 4ANUA 4BFRA 2Y3AA 4F1SA 4EZLA 4F92B 5KJ7E 2YOAA 3ML9A 4KITB 4NP9A 3TWYA 3ML8A 2Z0UA 4XE0A 3DPDA 4GNKB 5T8IA 2ISDA 2K45A 1W16A 4AOFA 3APFA 3B7YA 4J6IA 2K3HA 3TJPA 2QZ5A 2WXLA 2WXNA 3ZW3A 3NZSA 2BWQA 4KZ0A 4XZ4A 4FHJA 4Y1SA 4G11A 1UOVA 3L17A 2CHZA 3CSFA 2NQ3A 1QASA 3M7FB 2V4LA 3OAWA 4FJZA 2CJTA 3QR1A 2CHDA 2YRBA 4V11A 2QZQA 2ENPA 5EDSA 2RD0A 1UGKA 5CCHE 4FULA 4L1LA 1YRKA 2R83A 1GMIA 2CM5A 2WXQA 1TJMA 3L9BA 4ANVA 4WWNA 4WWPA 4PS7A 5H4YA 2K8MA 4Y1TA 3ZIMA 1A25A 4L23A 3PFQA 4IQHA 2LHAA 4DK5A 2FJUB 3NSJA 4FLHA 4LDCA 4EZKA 1RLWA 1E90A 2WXHA 3HN8A 3IBEA 4NPKA 2ENJA 4BGDA 3QAQA 4WAFA 3F05A 4TUUA 2X38A 2NSQA 3GPEA 4ANWA 4EZJA 1BYNA 4PS8A 5G2NA 1DJYA 4FADA 3HHMA 4QJ3B 1HE8A 3APCA 3HIZA 1E7VA 3L08A 4HLEA 5G55A 4ANXA 1DJIA 2KI6A 3F01A 3P2BA 4IHBA 1RH8A 3RPBA 4TS6A 3T8MA 1WFJA 2FK9A 3SD5A 4FHKA 3QR0A 2UZPA 4URKA 3RDJA 2A4ZA 3W57A 2WXGA 1V27A 2Q3XA 3ZVVA 1DJWA 1E8WA 5JHBA
chains in the Genus database with same CATH superfamily
4NQTA 2LT9A 1PU0A 5C0BD 4U1GB 4XP1L 1TVBA 2J12B 2EC8A 2YAMA 4FABL 4BDVA 5IVXE 3F7LA 3H3KA 4RETB 4DQAA 3F3HA 3O6KH 4FNLH 2NLJB 3BIAX 4ODBD 5EU4A 3TA4D 4OGYL 4PV1C 4E9RA 4QHUA 4DUVA 3R7QA 4WKZA 2JB6A 3MXVL 4KHTL 4F7CA 3HLAB 3ZY7A 4DO5A 3VUAA 1VEPA 3KMDA 4K7PH 3BI9X 4HWNA 3EJZC 5DQ9B 3U9UB 4O5LL 5KVDE 4QRRE 1M56B 2Y36H 4FTVB 5D5MA 3HMXA 4EI6B 5IROA 1TFHA 1NLDL 3NN8B 4NKMA 1WTGT 3HJEA 3X17A 3PABA 4I9WD 3RJQB 3CC5A 4P0DA 1NAKL 3FU8A 4H1LB 4JL2A 1GAFL 2GFBA 2DWSA 3J07A 4GQRA 5JW4M 1KJ3H 4HCGA 2R8SH 5LCVH 4IRZH 5GS2H 2XTJC 4F1SA 4CW1A 1XXFC 1G0YR 3CLWA 1F45A 3V0DA 5K9OA 4DT2A 3DMMA 5FYLE 5AVSB 2P80D 4OD3H 3KCWA 4C4BA 2OXHA 3TJPA 3OHXA 5GSVB 2VLJD 5G4OA 5C0AB 3OR6B 1T7ZA 3K81A 5CLXA 1JCKA 2VUKA 4PJAB 5LGHH 3AWFA 4FNLL 4L3EB 1KTRL 3OKKA 5J5EA 1GGCH 4QTFA 4UNTA 3IMVA 2E7LA 4KHTH 2B8OT 2F08A 4AG4H 4UOZA 4WSJA 4K7PL 1J0KA 1NGPH 3LNHA 2KS0A 3BD5A 5F9JB 1UH4A 1FZMB 3D2UB 4JKNA 1E3ZA 4OCMC 2PYEA 4FNTA 3FB7A 1EZLA 1S9YA 3HAEA 4KZDL 2COVD 3W2DL 1ESOA 1DVFD 4ZODA 3W11D 1I1YB 3RDTB 3T3MF 4ANWA 4N25A 3PWJB 5BVJB 1NDMB 1KCKA 2ZYSA 5ITBH 4XN1A 1KTLA 5D9SA 4Y5XC 4I88A 4M4RB 3O4OC 2UZXA 2X0VA 4C56E 5LCVL 3G5ZB 4NDMA 4M03A 3PAZA 5FK9A 3WIHA 4N8VB 3ALWA 3FSAA 4Y4HB 2VERN 1S7TA 5DUML 3H9SE 1KPRB 4TSBL 2L7QA 4D8PA 3CFBB 3C6LB 1YC8A 4TUJA 1VCAA 1IKNA 2YGVA 3O2DH 3LEXA 4KJYA 2LU3A 2E7HA 2EIEA 4X5PA 3GBMH 4WTQA 3JTSA 3MV8B 3MLXH 2Q2LA 3I02A 4YHNA 3MRJB 1BZDA 2QDVA 2BX5A 2BVTA 4ONHA 1S8DA 3L54A 2OV0A 3QUYB 2EDMA 1XT5A 1FC2D 5CS7A 3MV7E 5EC1A 5F1SA 1ZHBA 3IVKB 5MERA 5SX4H 3D8MA 3BOVA 4MYPA 2IBZX 1NUDA 2CG9X 2R0LH 3PWUA 2Y6SC 2BSDA 2GJ6A 3U6XS 3S3BB 2MKLC 5FUZH 1FL6A 2ZX6A 4M6MH 4QRQB 5AD0B 4DPCX 4LAQH 4OY9A 3S3DB 4QAWA 3FFCD 4U1SA 2FWLB 3ZKMC 4OT1H 4FYTA 2HYMA 2XG5A 4JPIB 3D4YA 4QKTA 1NC2A 2VIRA 5GS0L 3D0AA 3RZCB 4ABQA 5I19H 4FQXD 2WGXA 1IAMA 2BHYA 2QV4A 4MB3A 3ZE1F 4GNKB 4FKHA 3BCDA 4P4KC 1OTSC 1QD0A 1FDLL 3OWEA 4RFNC 4NNYB 1CLYL 3CIAA 2ZP9A 2AQPA 3AMKA 3UAFA 3V9EA 1BFSA 1ZHKA 3ECBA 4NUGH 1PYWA 4XAKD 4GXVL 4BFGA 4IBWA 1FZJA 2ENPA 2XZQH 3ELQA 3QUXC 5BV7C 3V0IA 3N0PB 1DJSA 1J1PH 1NTDA 4OQ1A 4IOIA 3V6OC 4RX4D 1G7LB 2VZ3A 4BFIB 3NJLA 1F3DJ 3SDAC 1Z6JT 2X3CA 3W9DB 4PJ7F 2CO6A 3KWVA 4PWGA 2JI3A 1X7SA 1L6PA 1UT9A 5I0XA 3HE7C 4GI8A 3T8XB 4TQHA 3BWUC 4WCYL 3EG9A 5IGXL 1Q9KB 3IDXH 4LAQL 5AOJA 5FYJH 2GBTA 1X6LA 3OKYA 4M6OL 3IWVA 3QNZA 3QFJE 3HHMA 5D1XB 4OT1L 4I3GA 3HIZA 3D50A 3BUYA 2CR0A 3QYMA 3RI5K 1NCAH 4H0GA 3V0JA 4BRVA 2IVFC 5DZJA 3MUUA 5CF3A 4R7NA 3D6GA 2P47B 3MREA 4M1GL 4WI9A 4Z0BH 1ACCA 2BOBB 4NRZB 4R7XA 1NBZA 3TP4A 4LMQE 4RSYA 4GAAA 2WO4A 4J4PA 5BUGA 4UQBA 1K3IA 3LKQB 4L37B 4BA0A 4PJFF 1U58B 3FTVA 1BD2E 3I85A 3D85D 3KGTA 5CCGE 3BSGA 2EUWA 4TUOB 4OB5L 4NQEE 3T77B 4AW4A 4OJDH 4D2NA 5KYWA 3E9TA 4I4WB 2UUDK 3BUQA 5CIPH 2WLJA 1WC7B 1EFXB 2EXYD 2DICA 2ZYRA 4ZMTA 1ZHKB 4GEIA 1AKJA 5FV2A 2VMFA 2XKNA 4DP0X 3CFIC 1VKXA 2R15A 5JHAA 3FCTB 1T0PB 4Q6IA 5DO2C 2MPVA 1KNOA 5EF2A 2WXRA 1V3MA 4GB9A 5AKRA 1I7UA 3TVMA 1LLAA 1QHQA 2J6WA 3GSNH 4YHKH 3I6GB 3S35X 4UWQB 3LOWA 3NRQA 3TT3L 4KK5C 5DHEA 2R56H 4KTEH 4DP6X 2WCPA 4K3GA 3ZDYE 1ZJAA 2XLLA 3LSOB 3TNNB 3WXWH 2YMOA 3G5XB 3P0YH 3MGTA 4YDZA 3WNKA 2NOYA 4HCRA 3MRFB 4M1GH 1LDPH 2BP0A 1AMXA 3BN9D 3OKMB 1J11A 4BQ6A 2V0AA 2PTTA 1UWFA 3ARGB 3D3VA 4J6RL 5C86A 1WG3A 2CDFB 4PJBA 4JPKH 4PRHA 3OB0K 3IJHB 1M7XA 5CIPB 5AVQB 3U1SL 3K4DA 2ZXEB 2VZUA 4DSYA 3V6BR 3PDOB 1Q1JH 2VLKD 1UOVA 2YN3A 3VGAB 2NTSP 1AR1B 5I28A 5B38G 3AABA 1N8ZA 4ZZKA 4UI2A 2DJ4A 2VKWA 1E4XL 3KPQA 4K7FB 4ODHL 3H3BC 2FVNA 1XIWC 4QT5B 5DJDB 2APFA 1FN4B 3MNZA 1YEHH 4Y9GA 4WWNA 4YHYB 5KBDA 1DTUA 1WT5A 3ZIYA 4BD4A 1CF8H 4YHYC 2L04A 4LPUA 3SDXE 2VLKB 2V7NA 3OKEA 3SYAA 2IMMA 3RIKA 1IU1A 4LDCA 2KH2B 4PRPA 4WLCA 1ONQA 4Z7WE 3LNIA 1E27B 5D8JL 1QNIA 2XTJB 3F7QA 4HEME 4O2EB 2I85A 3ZE2E 2CK0L 2ZOKB 2ETWA 2HUEA 5AOIA 2EE9A 2KKQA 2OKMA 3ULVH 3H2PA 4N1HB 1LO3H 1P2CB 3BPCA 3WXWL 1JD9A 1L9NA 4O9HL 4ZSOA 2YD8A 3TBTB 1NL0L 2ZPKH 2EECA 5JHDD 4DZBA 2A1WH 2Z8VC 3N1QC 1A66A 2VXUH 4E5XA 5FFOA 1ET8A 3DYMA 4X42A 4FQQA 2BXYA 4XN8A 1TTFA 1MAML 1AFVH 1JGEB 3KLDA 3NCYP 1ZTMA 1U93A 3PDGA 4MDRA 1TZHB 3BN9C 4JGNA 3FO1A 4JREB 3UTQB 3AITA 2NW3B 4UDTA 3V6OA 1CN4A 1DQQB 1MCDA 2XU9A 1GHFH 3MBXH 3B56A 3L7EA 5F3BA 4M62L 2DQIL 5TF1L 4GI6A 5CFHA 1BJ1H 5I1DA 1T0NB 2GK0A 1I1RA 3EH4B 4QT5A 1RSYA 1DBBL 2CIKB 4DCQA 3PPSA 3QC6X 4MXQC 4ALAL 1A7QL 4QYAA 3DROB 3PWPB 3Q5TA 1XEUA 2FYYB 2GUOA 5F7DA 1PG7H 3ZL1A 5I76B 1PZ2A 3OQRA 3K6DA 3BPOB 3MLPA 5EC2B 5L2JB 1ZLEA 1XMWA 5DJAA 3PABB 5AD0A 5GGTH 4W9HC 5FO2A 1HT6A 2A1WL 3IDYB 5E56A 3KYMA 4WV1A 1P6WA 4JHUA 1U91A 3G6JE 2QZ5A 3BWAA 1FFRA 3K2IA 3QE5A 4YBLC 5KAQG 1FSKC 3OZLA 1H15A 3FU6A 4HCIA 4H20L 3VM7A 1CFVL 1AS6A 3MRKA 4DKDC 3HNSH 1T1XB 1YRKA 1TIUA 1G7IA 2Z93A 5EU4B 3MBED 3ULUF 2MTPA 2NYYD 4PS7A 3S35H 1V7NH 3WFZA 1QFOA 3PWPE 2VQTA 4M62H 1N5YH 2W0LA 3FUHA 1SBSH 1BM3L 5I8OL 1NFIA 3DJTA 4Y4HD 2NXYD 2VLRB 3M1BA 2PO6A 3IBEA 4DP1X 5CJXC 2KDYA 2VCOA 2VXSL 3OC8A 4PWJA 1RJYB 1WZ1H 2ICEB 3HKFA 4AXWA 2NX5E 3D34A 3QWRA 3VU1A 3QUML 1IM9D 3BKML 3DUUB 4K2UH 3SODB 4HIEB 4G7QB 2AVGA 3AAZB 4JRXD 4RFNB 4LE8A 4Z7UE 5DEFA 1UJ3C 4JPWH 3KWXA 4Y7MA 3VXPB 3FQXA 4P05A 4AV4A 3GS4A 3JYBA 3TLRA 3VX1A 2Y7OA 3AY2A 2DM4A 5K9KB 2WWNA 5BRZA 3N43B 2A9ML 5CEYB 3U1QA 2D3NA 2DQUH 4AEIL 4W9JC 5I6OA 5DHYA 3F04A 1AP2A 3RVWD 5CAYB 3FONA 3ARRA 5IV2B 3TEWA 3DV6A 2K0RA 5ETUB 2ZX5A 4CJ1A 4AIXA 1F11B 4YC2C 2EKSB 2FCBA 2X09A 4BUQA 4JJ5A 4PP1D 4MQ7B 3NJMA 2EVHA 1MJJA 3UC2A 5JNYA 3HMWH 2KYIA 5EG6C 3CX5J 1N59A 3ZN6A 2JJWA 4OZHF 4AW7A 4GXUN 1KGUA 5A6IA 1N5YL 1R5IA 3FOMB 4LSUH 2HRLA 4JJHA 4FX5A 5F7EL 1BBJB 2AABH 2QQLH 4I1RA 4R26H 4F27A 1Y7VA 4GT7A 2WQAA 4LLDA 2VXSH 3QORB 2ZIDA 3VFTA 1U3YA 1FAIL 3MROA 3JVGA 3QUMH 4RNRB 3U48A 3DBSA 4LLYA 4KJQD 4FJYA 2Z31B 1DR9A 5DZOA 4YSUA 2OL3A 4PW4A 3D51A 2FYYA 5FM5M 4BBWA 4N0FB 4C83B 1R3KB 4N85A 4X8JB 2QBWA 3RNQB 5SX4I 4UMGA 4R0LC 2ZONA 4UYQA 3QJTB 4FGMA 3UIYA 1DL7H 2DM2A 4W9EC 2KT6A 4X7SL 3S34L 4XVSH 2GK0B 5D7KD 4UQCA 1TCRA 2CH8A 2LFGA 1VADB 3EYVB 5BRPA 3PGDA 1BQHB 5DEFB 3VCLA 1WZKA 2VDOH 3SO3B 3MBWA 2X4NB 4PG9A 5DI8A 3NIFE 4LSDA 2YAPA 4JFQB 2GJPA 4PJ9C 3L1OH 2CM5A 2ADGB 4K5LA 5C08E 2VJ0A 3P30H 3C8DA 2BS9A 3KPNB 4LSUL 5F7EH 4LLWB 3UZVA 1D5XA 4GP4B 1JZ8A 1JRHI 2AABL 2QQLL 4OCXL 3MX0A 1XB3A 5KUMA 3QEHA 4C56A 3D18A 3J27A 1BVOA 3KL0A 1M57B 2IO5A 1PZSA 3AJ7A 3EH1A 1MREH 3DV6B 4NQED 4Y4FC 3BVNA 5ETUA 4B0MB 2DBLL 2Q6WB 1JZHA 4YHOL 2PR4L 3GMOB 2VLME 3BVVA 1IBGL 4O02A 5FECA 3FMGH 1A2YA 4LEBA 5B3NA 1ZHLA 5FYLL 2WQSA 4QHPA 3QUKB 3AREA 1TZGL 1OAUH 4DOHE 1OWRM 1NICA 5DGRA 2Q3XA 5CSBA 5AB9A 3HPLA 2EINB 3QIUB 1UB6A 1GS7A 2CBPA 1G0DA 4A7VA 1TQWA 4JO8A 4HA1A 4FG6D 2JKNA 3VVWA 1BSIA 4P9MH 1HEZA 4K7FA 3SDXA 3ZKMD 5E6IA 3EJTA 1AD9B 1H3UA 2ZD0A 4S1DD 4NRXB 2ZG2A 3FT3B 5E6YA 1SLVA 43C9A 3DXAA 1G7MB 1K9TA 2F7QA 5KS9F 3DOSA 1JPGB 2NY4C 4HKXB 4BQBA 5GGRA 3UPRA 5J3HD 2XIDA 4NS0A 1EGJL 3V52H 1JK9B 5CJXA 1UTDA 3ZDWA 3ZMNA 4LSTL 1YSOA 5T3XE 1AO7A 4J1UB 1G6RL 4HPYH 1MCPH 3DVIA 4UDTB 4XX1G 2NY1C 4XOCA 3SHSA 1FVCB 2LTQC 1MREL 3N44F 1FH5L 1T22B 2IXQA 3V4UH 3AS3A 3P1VA 5M94B 1AXSB 2P8LB 2J1XA 4ESKA 4XAWH 4JRYA 1E8XA 4HZLA 1ZAGA 3VGGA 1E4XI 4EZLA 4M3JA 4PTTB 1OAQH 4QNPF 3DPDA 2B2XL 1H5BA 5DVKA 4PWIA 1OGSA 4GH7B 4Q52A 1WBXA 1DEEB 3BP4B 4BFOA 4MWFA 1ITBB 3EADA 1NAMA 2JVUA 4Y4FB 2X9WA 4A6YL 4ENZA 1JF1A 3MACH 1DVUA 4UQIM 3WU1A 3K1DA 3T77A 4FULA 3IFPB 1KTBA 2ERJC 5EFIB 4DK3A 4CBZA 3MTRA 1M7UA 3VB9A 2CU9A 2VERA 1CL7I 2H47C 4U1NB 1XGPB 1K3ZA 1RZ8A 3G5VA 4L9DA 4N8VG 2VAAB 3ZDYF 2EICA 3CDZA 4Y9BA 4OD1H 3OJ2C 4TYUA 3ZMRA 4HUWB 3E6FB 3WD5L 5JMOC 4OCLC 2HTKD 3LKOB 4KMTL 3SCMD 2EH7L 2WGNB 1ZE3H 2GJ6D 4UDUB 3SQBB 3FT9A 4X80L 2OX5A 4OLVL 1DVFB 1EJ6A 3IDNB 3E6HB 4M4PA 1OCWL 4FA7B 1XF2B 3QIBC 1ZA6A 4YSOA 3WYRA 1KJ2L 3WMSA 2WCSA 1YN6A 4KDTA 3I6LD 1AOZA 3FB7B 2DQFA 1A14H 1RZJH 1N2RB 1YJDC 5ILTH 3GSRA 3K2MC 1WISA 1GW0A 4GW1A 2J5LB 1IAKA 1IZKA 3PXLA 1PLAA 4NQXA 1W72B 4OKDA 1Q4NX 1CG9B 4Q58C 5AW5B 4KXDA 4JDZA 3VWKD 1JZDC 2RR3A 2WLKA 2IXQB 3OBAA 5I18L 5ALBH 3MRHB 1UACH 1GRWA 4DKTA 3MO1B 2W92A 4EBQL 3VB8A 1XCTB 1JBJA 3FH8A 1MRDH 2ICEC 2VC2L 3ZE2F 4QXGH 4U1MA 5SX5H 4CC4C 1SJMA 4P2RB 3CHSA 5HGDA 3QWNA 4G8IB 1JPTH 2WMPA 4ZJ9A 3HE7A 4OCSL 1IARB 2CKNA 2G3XA 3T0ED 3O3DA 3UMNA 1FLRH 3UZQA 5EZOH 1ACYL 1Y18A 1EVTC 4N22A 1W6WA 4BWUA 1OSYA 1OB1A 2JCCE 3VSTA 2VSMB 3KXFD 2Y3AA 1OCWH 1QP1A 4LHUB 5BNXD 4S1SH 3RKDD 2VE6B 3MJ8B 3WAJA 3QUMA 3ETBJ 4A39A 2FHCA 3ARQA 1A14L 1RZJL 4XNXH 3SQBA 1ZXQA 4F7EB 2E4TA 3QQ4B 2R27A 2V9QA 2FNBA 3QUYA 3UJTL 4JNXA 1KIRB 3PDDA 2EUXA 3SKMB 5HGAA 3ZDZE 1HFUA 3VXMA 1RMFH 1GOGA 4TQIA 2IDTA 4Y2NA 4MDJB 4TVPL 3X3GH 3KG5A 4MA3B 2E4FA 3WO4C 1AIFB 1N70A 1V54B 3EG9B 4NFCA 1MRDL 2VC2H 3P4LA 3RTLA 3DHJA 3QFGA 1IGJB 5J3HC 1SEQH 1DBMH 3O2VH 4EDWL 2DY2A 3REVB 3F05A 4AM0B 4ZX5A 5EH1A 4NBXB 4QHLB 4OM0L 2VL4A 3EJQA 1V7MH 4E5XB 1EAPB 1KTLB 1CU4L 1VGKB 2HP4A 4EXPX 1UWXH 4NENB 4ZPVB 3TH2T 2WZPA 3LN5A 4IU2A 4OBRA 4MB4A 1NSNH 3BPCB 4RGNC 2HX8A 2VMJA 4J27A 4YZFE 3W11C 2A4ZA 2FEEI 1MQKH 4JHAL 1X5ZA 2XICA 3B6SB 3C8KB 5FOJA 1SNRA 4JN2A 4P8QA 3P11L 5E9NA 1HINL 3ULUE 4PJFB 4MJID 1FYTD 2X4OB 3FO9A 4KJPD 3FO2B 1S3KL 1TKWA 5D7EA 5F3HA 3UJTH 1LEKB 2QQQA 1I8LA 1U8JB 3ATEA 3L3HB 3UTPE 3ZZQA 1XCXA 1HVXA 3LNDA 3P4OA 4JFWA 5AOMA 4CMHC 2PP7A 6TAAA 5K59E 3VXOB 1HHHA 1DP0A 2FJGB 4PRNB 2NY0C 3WENA 1HX0A 4KJPC 4Y5VC 1FORH 2BNQA 2YAQA 4UV7H 3WTYA 1K5WA 2ZSVA 4UIMB 2XZZA 3LEVH 1A6ZB 4QAMB 5A2AA 1AXTH 3DMMB 1RHFA 4Z3JA 3BSZH 1KB3A 3ZQ9A 2LOEA 2VZVA 1DBML 4NRXA 4EDWH 1AI1H 4QGTA 4S0HA 1C8QA 2HRHA 2MJWA 4PRAA 2P49B 4OU3A 3F00A 1W2KT 1LP9F 3F7YA 5H94A 4OM0H 2DYRB 3LN9A 4FNSA 5HGDB 1YNKH 1OK0A 4BKLB 5HPMA 3P0GB 5K59F 5DS2A 4C59B 2PTTB 1ADWA 3D3VB 2XQBL 1X5JA 2FR4B 4NXKA 1UATA 4LCWB 5I1GH 3QQ3B 1AO7D 3UZEA 3OX8B 3GSWA 3EF7A 1UB6B 4QRBA 4U49A 1MQKL 2GJZB 4OF6A 4MB1A 5JPMC 4R2GC 4U1JA 4B97A 1NC2B 2R29A 1JYNA 4K8RH 5FM8A 1MHEA 4NDMB 3TVMB 3T0XA 4FHJA 5AKSA 5JOPE 1I8IB 3WEXA 2XN9D 3OG6B 2ZXAA 2EE2A 3B5TA 4XVOA 1DCEA 4U1HA 2VMCA 2I07A 2I69A 1GGBL 3O45B 1RJYA 5D7JC 2EAEA 3F84A 4GG8A 5AVZB 4YGVA 4G42B 4MMZA 1SEBA 1T20A 1X4ZA 2LTQB 3IFLL 5EBWB 4PJ9A 3VXRE 1WD9A 4YSAA 3DDFA 3TJEL 1QSFD 3IS1X 2GTWA 4RA3A 2IWGA 4YFLF 4BIKA 1HEJC 3OGCB 4K5PA 5CR1A 3FU5A 1FL3B 1M2VA 1GZHA 2AERT 2UXFA 4AYBA 1TO5A 3CUPA 1FFTB 4OSUH 3OC5A 5EUKA 1D7FA 1DQKA 1P1ZA 2BP8B 2JMRA 3QHTC 1T3FB 3IDYC 2WUCL 3BQUD 4IDJH 5F89B 1WAPA 4IHBA 3N1PC 4WHDA 4OM1L 5DEJA 5AB0A 2J25A 4E9YA 3IJYB 2FIKB 2ICWI 3SKNA 4BXVA 4X4XA 3KLAA 4U3SB 3RNQA 3CSBA 3VXUB 4QY8A 5AW4B 1Z9LA 3U36B 3BT0A 2UZXB 3KPOB 3W0WD 1HC1A 4J3TA 1VFAA 1KCLA 5LKNA 2H2PD 1X3DA 4JN1L 1XBRA 5JYLA 3KH3A 1I9JL 3MUHL 3RWDA 5H94B 2WXPA 3VXSE 2AQQA 2C4XA 5LCVA 2XZAL 4FXKB 3VXUD 1XVSA 2CSPA 3KD4A 2Z6FA 3WIHL 2HFFA 3DHPA 3GIZH 2XWXA 4JPSA 4PBWD 3MRMA 2R1YB 3B9VA 1YNTA 3ES6B 2JKJA 4ELMA 4RA0C 4GAFB 3U2SB 2YQ2A 4U6XB 1ZS2A 1A7PL 1FZJB 4MQXC 4S1RH 2X42A 4LSVH 1SDDA 2FHBA 3FB5A 3KYOA 5IB5B 1F90H 1DEDA 4AKPA 1Z9NA 2P5WB 4MJ6B 4L1TA 5K9JL 1O5PA 1BFVL 1DBAL 4KU1A 3L4ZA 4QJ4B 4OSUL 1QTSA 1QI3A 3WUZA 1J5IA 3GC3A 4GG6F 2QVFB 2O5XH 1CD1B 2YSSA 1RP8A 5BQDA 2QQKL 4CGUB 2B9AA 4M7ZC 4C83A 2VDNB 4MS8C 5ISZB 2EDRA 1BVZA 3EBHA 1UXWA 3TPKA 1RIUL 3IJ7A 3QPQD 4X4ZA 4NUQA 1UENA 4N6QA 4JS7A 1W16A 4W9ZA 1C16B 1YO4A 1VJSA 1ZT4A 2K3HA 4ZW8A 2X4RA 3QIWD 5J57B 5DD6A 2J4WH 3NTCH 3FPYA 4PJEB 4LL1A 3UBXA 2O4EA 4IRSD 4WUUB 5JORA 1MOEA 1H8LA 4PGCA 2Y06L 3S3CB 1ACXA 3WIHH 1NC4B 1G1KA 4GG6E 2ZJSL 1TJMA 4NC2B 1JGUH 1N59B 1WHPA 1U8PA 4J3WA 1B90A 1MFCL 1XGRA 4XR8C 3Q7JA 3TCLA 3BUDA 3QT2A 4GQ9L 4RISL 4BFFA 1PDKA 2P46B 2EZ0D 4KAQL 4LSVL 4XXCA 5CILL 3O3EA 3ZE0B 3UBXG 2FD6H 4XCCH 4WFFD 3N6YA 2WBJC 5EU3B 1SOQA 2C9QA 3IETB 5IHUL 4XMLH 4OZFG 4GXFA 3L2MA 3BO8A 5JUEH 4TSCL 1MWOA 3GF8A 3GK8H 1XGRB 3I2CH 2YFOA 3ETSA 1CLVA 2RAMA 2AJYL 5IM7A 4TPRH 2HH0H 4OCRH 1NIEA 2GY5A 4D9QE 5I1CL 2O5XL 3JTTB 5HYEA 4GG8B 2X4UA 3QZWG 5DURB 1D5MB 3D07A 4QXVA 2AK4E 4D0DB 2E47A 2NY1B 4HUXB 4LSSH 4P4KB 2ZCHL 4XTRC 1QQDB 4M3KB 5JW5B 2ZKWA 4JRXB 1P6FA 3I9GL 4R8WL 1XX9C 3UTTA 1UD6A 3FCSA 3SIKA 1J5OH 1MHEB 1PAZA 3PLYA 4HEPA 4FFYL 2J4WL 3NTCL 4FQ1H 4AVJA 4N1EA 3RVXC 4PLNC 1IM3D 2ITCB 2O6CA 4OLUL 4JM0A 3WFEL 4ES8A 3GBDA 1H8OA 3VXQB 1AZBA 3CBRA 3TF7C 3WXVL 1QFWH 3IKCB 2YLKA 3WKMH 3LB6C 1P9MA 2EP6A 2C3VB 1OALA 4PJ7B 2C7FA 1HXMA 4AY0A 4NHUB 4PJXB 2BSCA 5BZXA 3ASWA 3ZE1E 1OPGH 2XWEA 2X44D 5HYSB 4IRSA 4X5RA 5F93C 4W81A 4QF1A 2JK5A 2Z4QB 2ZNWA 2JB5H 2MHAA 4FFZH 4LLAA 5IJDC 2IH1B 3A67L 5E8PA 5IHUH 2V2XA 2OP4H 4K73A 3FNKA 4TSCH 1R47A 3GK8L 1YZZA 3I2CL 2P48B 2X05A 5AYUL 2Q0ZX 2AJYH 4XP6L 1NMAH 4E41B 3CVIH 1L0XA 1G84A 4LLVB 1BD2D 3UG3A 1ET5A 4NBZB 5BS0B 1RJZB 4YH6A 3SOBL 3CZJA 3B9AA 1TETL 4NOFA 4H1LA 4MZRA 3SGEH 2EDHA 1R5WB 3OGOE 3Q1SH 3UAJD 2R69A 3I9GH 4R8WH 2RIKA 5KZCD 2DTSA 3WJLA 3DSNA 4AL8C 2AZUA 3GRWH 4LBEA 3CSGA 1SMAA 1WE5A 2ZWNA 1CDJA 3WFEH 1I85C 3BZDA 2XWTB 4JDTH 3BDBA 3WUWA 3DMMC 4P2OD 2Y5TB 4WTZA 4NJAL 3WXVH 3CDZB 1OF0A 1YEGH 4FL4B 5FECB 1UH2A 3QUXB 5BV7B 4NXSA 5TGBB 4CC1A 3QUYC 5F0MB 2E46A 2B20A 4JG9A 4ENEC 3EXLA 2Z7ZA 2CDGB 2Y6TE 1KXTB 5FGBC 2R0WL 1L0QA 4CVUA 5EEXA 2PYEE 1RZ7H 3EJPA 5IKCA 4GSQA 3TO2A 4IOIB 2YD1A 3Q06A 2N3JA 1KENH 1ZTXH 2AJUH 2VZSA 2NY3B 1UA7A 1NBYA 1T20B 2WHVA 1URZA 3GMRA 4V2BA 4V1DB 4ERSL 1TTUA 4MFHA 3SBRA 4E36A 3G6AA 4ZYKA 4FQ2H 3FU9A 4MXQD 3KPRB 4LRNH 1WGVA 4OQTH 3H56A 3DO7A 1P4IL 4XMKH 4AEEA 3LS4L 1JNHA 4XNZC 4B96A 2YD5A 3ZDZF 4BQ8A 5AOLA 1J86A 2MPAL 4FTVD 4RRPA 5GISL 5FR3A 1MCQA 4Z7QB 1YDPB 1A7RL 1MRCL 5E7BA 5TFSH 2NCEA 3D0VA 4G5ZL 2JTDA 2EDEA 4HUKB 4BFNA 4XMVA 5D7IF 4QNPE 4ZW3A 3K5RA 5GZND 5CMAB 3WY4A 1M6OB 3DECA 2WVTA 1YYCA 2RCSH 5KS9B 5DJAB 3RVWC 3VI3F 2P26A 2K4AA 2Q2EB 2OZ4L 1MWAH 1I8LC 2WNWA 3LMJL 2CAKA 3NJIA 4NAJA 1A65A 4NQSB 5DR5H 5EOQL 1J12A 2XKNB 4PWFA 5JA9A 1A6VL 1Y07A 4MJIB 2QSQA 1QSEE 3GBNL 4Q2ZB 5IMOB 1QYGH 1BJMA 3JWNG 3AACA 5HHOA 1JDCA 5KYWB 2F8VA 4IK6A 4PJFE 4YZFF 2DMHA 2A6JB 1A6ZA 1G7HA 2AJUL 3KXFE 3NCWA 2NY7L 2E9BA 4FQLH 1WBZA 3T3PF 4ERSH 2JKWA 3QPKA 3MPCA 4LCYB 3CWGA 1JHKL 5FUCE 1WFTA 4GXUM 2NW2A 3SY0A 4FNQA 4ZXBD 3N5AA 1DQQA 1K5NA 2FEDC 3MV7B 3IDGB 1QZNA 2HT2D 4G7SB 3EJCA 3EYFB 1LDSA 3ARFC 3EJYD 5PAZA 4L3AA 1HNGA 4JPQA 1S7TB 4S0TD 2MPAH 1W80A 1G94A 3M1OA 3L9YA 5CJOL 2AQSA 3GTNA 1XGTB 1XR9A 4CVXA 4NQCA 3UIZA 5EEZA 1MJUL 2HMIC 2WY3B 1D9KC 5SWSE 3OJDA 5T3ZL 5JHLH 1JN6A 1CFQA 5C0ND 2VH5L 2D7PA 5HSFA 5IBUB 3P2TA 4LEOA 2OZ4H 1OTUC 1EAPA 2NT0A 2V37A 2DMKA 3GNML 4M5SA 4NQCB 3BLPX 3KPNA 3QS3A 2FB4L 5C0RL 5CZVL 4U0QB 1YUHA 1FZMA 4EZKA 3FQUB 4A38A 4P5MB 4KI5E 3VJ6B 5C0NC 3LB6D 3NJHA 4MB5A 4XWOD 5T5FL 1C08B 4MZIA 1NFIB 4O2CB 4PMEA 3GPEA 4DGIL 5T1KD 5CN3A 2DL9A 4TUKL 2V8LA 1WZMA 4FXTA 1UWEL 4HJJL 1T04A 5IB3B 2LU5A 1LGVA 1AACA 3OVUB 4X9FA 4FLOA 1CE1H 2F7PA 2WINA 3MRCB 4DUWA 1KGIA 4B3EA 3K7UA 1T66D 3VE0B 3VG0H 4GO8A 4F7EA 1YEEH 2AP2A 3T2NL 2J55A 1A7BA 1XSIA 2JELH 1QO3B 1TLKA 1IILE 4PP2B 2ZSVB 4XX5A 4M7JL 3GEWB 3LZRA 4LESA 4PGEB 4PJ5A 5T1LA 1TMQA 3RGHA 4FZEH 1L6XA 5G4NA 2XTSA 4OFDA 3V2AR 3UAJC 3MNMA 4FA8A 2ATKA 2I9LA 3FQTB 3F83A 4RAUB 2DWEA 1TU2A 2RQ8A 3HI6H 3EO0A 4FQCL 4KGJA 2J6EA 4D0CA 4AENB 3T4AB 1V10A 1P53A 5ACLA 1IBDA 5F44A 5JNYB 2BVEA 2CIKA 3NA4A 3R8BB 3K6SB 2WLMA 5DA4A 2WPGA 4G80A 1D9KB 43CAA 2E7MA 3P4NB 3FRUA 3P3UA 1F11A 3CFJB 2CHXA 4ZFGH 1FFOB 4HKBA 3L4XA 5H4ZA 2ZX9A 3MJ9L 5C3TA 1LTXA 2O6EA 3TX4A 5E51A 5I1LA 3EO9L 1DVYA 1VZGA 4YUEL 3GYRA 5LG1A 1ETB1 3MMEB 3OJMB 3VG0L 3U0TA 2DL2A 2GJRA 1L9QA 1YUHB 1IGJA 3VTAA 3QZMA 1H3XA 1ZEAL 4Z7OF 1F3DH 1RD6A 2WN3A 1J5HA 1NEZB 2W8CA 2QDWA 4Y1SA 3L2LA 1DVSA 4AIOA 1U33A 1X5XA 4N24A 5F7HA 1L0YA 4U6YB 1S7WB 5CZXD 3EJUA 5F6HI 1UGKA 2QPUA 2ZXGA 4OZFA 3BPNC 4KO7A 3QW9A 5I1AA 4L3FA 5E95B 2IQ9H 5ADOH 4Y5VA 4OZHB 3LQMA 5CWSA 1EO8L 1WFNA 2VQUA 3JWNH 4R5XA 4PJ6A 4PRBA 4OFQA 3ZYOA 4GBXD 2FLRT 3GI9L 3KVPA 2Y72A 4O58H 4J2XA 3X1GA 5T1LD 2Y07L 4PJBF 4PRPE 1K6QH 2KC0A 4JY6A 1I8MA 2E9GA 1USZA 2VDLH 4GSRA 5CGBA 3OKEB 3RPKA 4R7DA 1ZVHA 1P1VA 4AZ8B 2WWKO 4U1IA 3MLWH 5ESQA 3RWHB 3FOLB 1AVAA 4PCSA 1I1AC 3P2BA 1MFUA 3PJSA 2OXHB 2C26A 2FX9H 4P9HH 3DNKA 3SEPA 5MHSE 1MKFA 4EKJA 2DKMA 3STZA 3KR3L 5JHBA 1QVOA 2MTAA 3S4SA 2VLLA 4DP7X 1WWWX 2NMSA 3FCBA 4Y1AA 3PGDB 1DLHA 3I75B 4AEHL 1FFQA 4IOSD 2XA3A 5HVFB 1I9EA 2DLHA 3KAAA 3D2UA 1VFUA 3ZQXA 2YKLH 2VM3A 4FTVA 3EUUA 2P45B 4QUOA 3EFOB 1RAMA 3FU7A 3T1FB 2XX0A 4HIXH 5J13C 3KPSB 3GRBA 3VA6A 5C0IA 3T3ME 1YDPA 2OSXA 1DO5A 4FQXB 1S7QA 3AADB 4PW3A 5IJCC 2Z64C 1PJWA 1DJXA 4YX2H 3CFUA 4X6BB 4BH8A 1IO4C 4O58L 3OKDA 3BXNB 5EU6A 3VFRA 2ZZUT 5KVGE 1KOAA 4Z7VB 4QHUB 1FJ1A 2WJ5A 1KN4L 5KSVB 1KLGB 1OTUD 2F68X 5DSCB 1BPVA 4ZUTA 2NXZC 4WU5B 3NCJL 15C8L 1J0ZA 3TZVC 1JZ5A 1RK1B 4PU2A 1BBJA 4C57C 1A64A 3P4MA 3LRGA 2HTLD 2VR4A 2I60H 3ZDXB 4PJXE 5DC0A 5LGYA 1RSFA 25C8H 4ODXA 4A68A 4AYFB 4FG4A 4GRWF 3ZR5A 3NA9L 2KMWA 35C8H 5IQ9A 4LZKA 3S88L 4WHTB 3RIAK 5IB3A 1BMWA 3SDCA 3LXBA 4JFXA 4MAYA 5HGHA 3VMOA 2I9TA 4ADGA 3LKQA 4L37A 2N56A 3N85H 4J4PC 5I74B 3BVTA 3VDCA 3TESA 1JYXA 3ROOB 3TCLB 5J56B 3D9AH 4IBQA 1MELA 1KIPB 3WEAA 1WP6A 4TNGA 5C3LD 1REIA 4AQ1C 3II1A 2JJSA 2XFXA 4WV1C 2CHDA 2YUVA 1GIGL 2AK4B 3ARZA 5K5YA 1G7PB 1G1OA 1AY1L 4YLQT 1ADQA 1N5AA 3ETTA 3MXVH 4MXVE 5EIIA 1SQMA 2EUVA 3C6EA 2QTVA 4LF3B 3ZT5A 4UAOC 1J8HB 1U2HA 4AV5A 1M7DB 4QXTA 4DP9X 3WY1A 5E8NB 2AJSL 1NCBH 1P4BL 1CF1A 4WWKD 3VMNA 1IE5A 5E1GA 4Y7OC 4HAGA 3D2UD 3SOTA 3RWCB 4DZ8A 1B3JA 5KZCB 5HDBB 4GMSH 1QR1B 3GLDA 4D9QD 4UTBA 3VD7A 4MRCA 4FNPA 3JV0A 4BDVB 1NLDH 3CX2A 5TDOA 4HP5A 3MV8D 3N44B 3H42L 5I16B 4GKSA 3K8LA 3KYAA 2AC0A 1PTZA 1P69B 2XQYA 2X4QA 1TPXB 4YDMA 3TA3A 3AQZA 2D2OA 1NAKH 3HFML 4NSKB 5JIDA 1GAFH 1RZIB 4OFYD 4U1GC 1R46A 4BSVA 4EAEA 1AXSA 1G5GA 2A77H 2ESVD 3S37L 4AJ0A 2R8SL 2B1HH 3FB8B 1JNLL 3K1KC 3NA9H 5GZOC 4MNHB 4AIZA 3B1TA 1D6VL 3BZ5A 4AVHA 4WUUE 5B39B 4YXKL 3VFRB 2OMWA 5H8DA 1HTYA 4TNWK 2QPFA 4X9HA 2WYHA 1J0YA 3IGKA 4NPYB 4UOW1 5EEUA 4AVKA 4PB0L 4X5WA 2DTMH 3TFKC 1LJMA 5MEND 3D9AL 1NEZG 1SJEB 3BKJL 3TZVB 3VXRA 3FC8A 1Q9OA 1YEKL 4FQIL 2Y7SA 4ZUUB 5CU5A 3KLHD 4GY4A 3P0VH 4K8RD 4Y19B 4MJIA 2WQVA 2C1OB 5D1QA 3TFKD 4AG4L 1TU2B 5CD5C 4TLTA 3DGGA 1CURA 2AJSH 1NCBL 2EE6A 3TIEB 1RURH 1F2XK 3S4SB 1BV8A 2MOGA 4ORZC 5DMJB 3UTSA 1VFAB 5DJZA 4X8XA 2X6VA 2WBJA 2H9GB 4KZDH 5LJYH 1ZIBA 1ROCA 1CFNA 1JJUA 1HDMB 2J6EH 4AUYA 1F8TL 5L0QC 1NFDF 3B7TA 4HIHB 4P3DA 5ITBL 4L9LC 3W9EB 3U0PA 1QFPA 4ZD3L 2VDRB 3PF2A 3GGWB 3LXAA 4H13C 3B7SA 3TEYA 1X9RA 1T04B 3GMPA 3JV5A 3WCYA 5C0JA 1HSBB 1KLUB 4KRPC 3VRIA 3DA0A 1KEGH 4LVOB 1EZVX 3AS1A 4JZNB 4M8RA 4Z8FH 4MQSB 4OFYA 4EN3D 1G43A 4PHXA 3EIFA 4YSPA 4AYEC 1M9WA 2MCPH 4M6NL 4XNUL 3GBML 5AL8A 2VMEA 4DGUA 4YE0A 5IJVA 3IU3A 1RK1A 2W1NA 1O9ZA 4NWTL 2BC4B 4V11A 1JE6A 1H6EA 2DAVA 2OZNA 4XNZB 5HPOA 1F86A 5C2UB 4XP9H 1JERA 1TZIB 3G08B 1MIEH 4JFQA 1PNCA 3RIAF 4AXWB 2VXVH 5CINH 4L23A 3DI2B 2R0LL 4MHHI 3HB3D 3MFFA 4AUJA 4GRLB 4IJ3B 1N9PA 1JTOA 2H5UA 5HDOA 4F80A 1DQDL 2AMUA 4GRLC 4ZUSA 1YLBB 1TJGH 2D3LA 3EF4A 4NUPA 1OT2A 3IK2A 1AS7A 5JO5B 3CZKA 5EA0H 1A6WH 2BSBA 4H44C 3RE0A 3TZVA 4UB0L 3UADA 3VXRB 3UO1H 3LIUA 4ZD3H 2C4FU 5DD0H 5LXGL 2KI6A 2NZ1A 4WY7L 4YPGB 2HN7B 3QO1A 5I19L 1BX2B 2G4GA 4YVNA 3N1FC 4QHMA 4HIJB 3CG8A 3WKYA 1H0DA 2X1XR 1QVOB 2RJMA 4ZG1A 4BQ9A 1OCZB 3H9YA 3QA3B 2GSGB 5C7XL 3CXDH 3C5JB 4L4VD 2PKDA 4ZS6D 1M7IA 2X7LB 4RAUA 3US1A 4U1SB 4EJ1C 3QS2A 5A2BA 3VM5A 4FXKA 1VAHA 2AV1A 3WLBA 4UQ2B 3QZWA 5AALA 3MLUH 2AZAA 5L2JA 4LCUB 4DKAA 2JK5B 2D03L 2GTZA 5DS8B 2CDEB 3ARGD 2VXVL 4QXTB 4ZUUA 1AQHA 3FQNA 5CJ5A 4G7VH 3VFUA 1XH3B 4Z78A 4ODTH 2W80C 3O3AB 4WCYH 2FX7L 4XB8A 4MYWB 4OZGA 5F96H 5JXAL 1URLA 3F7VB 5FYJL 2ITCA 4HUNB 1J8RA 1QNZL 2YO3A 2YRLA 2D0FA 4LIQE 5DQ9A 3CZUB 3GSNB 3OKNB 4A6YA 5KYUB 4HCRH 5EU6D 5DD0L 1KT2A 5EOCJ 3Q05A 2D0GA 2RGSA 3MYJB 5J12C 1OGAB 5KVEE 1TZIA 2PCYA 1LO2H 2F0CA 2X2IA 3PNWA 1JXJA 1JGDA 3EFFB 4QRUB 3SE4A 1NCJA 3LH8A 5K39B 4XCEA 3SPCA 3IMSA 4YSCA 3RLSA 1GA2A 4CL7A 5EN2A 3CXDL 4LIQL 3L4WA 1TITA 5BPPA 3QEQD 2VITA 5IVOA 5BQ7A 2EEFA 4Y4HC 3O6FB 3LCYA 4OB5H 4FJZA 5AW3B 4HJIA 4C4KO 4HXAH 4IGBC 4X4YA 2P7TA 5IB2B 3RX9A 3BD3A 4JKMA 1E2VA 5JXED 1TQTA 5D2NC 4HK0B 4LF3A 3GUTB 1NMCB 4HLJA 1U8PB 4NM4H 3CZLA 3C2AL 2IWKA 4OIBA 4WI2A 1IUZA 3FQRB 4HFUH 1T7XA 1LNUA 4FLHA 3IWUA 2XFXB 5B38A 1U91B 5EULV 1NC4A 1OOWA 1YYLL 4G1EA 1ZJBA 3QJXA 4GSDH 5F96L 3U6XA 4LBEB 1OKEA 1CXIA 5C0GA 4EZJA 1ZLDA 2VDQB 2I7SA 3GSVA 3Q5OA 1XGYL 4EVNB 2R56L 1ILSA 3APCA 4EN3A 2F7RA 3LNEA 4BKLA 1OSZA 2O93L 1CLCA 2SEBB 1XV8A 1QAWA 1WIPA 4JBSA 4I13B 4OAWB 4H8UA 4AI7A 1IM3B 3ZDZB 2Y1VA 3JWDH 4LVHC 1B6UA 5GGRY 3U1SH 3FPXA 5A2CA 3HG1D 3EOTH 5F9OL 3HC0B 5C9KA 4N1CA 4ZXBA 4JZOA 3WL9B 4LPCA 2DLIA 1J48A 5FO9B 4X6EB 4YWGH 5IEKB 3MQIA 4DUXA 4QF1B 5B39A 5GSRA 2EEAA 3FZUC 3QDGA 1XR8A 2KZBA 5DVPA 2NW3A 2QSCH 2V3EA 5I1KH 4I3RL 2ZKMX 2XXFA 3QXAB 1HXMB 1CF8L 4P2CG 1E4WH 1SN5A 3S96B 3ZSSA 1JVLA 4I1NB 4PRBB 3T2OA 4F9PA 2BK8A 4BQCA 2B1AL 4HDIA 3BAYA 5HGBB 4WJG3 5D8JH 4JQIA 3UYPB 1ZSHA 1U92A 2QFRA 5DWPA 3V5KA 1JCVA 4F8NA 2DZEA 3VU2A 1QRNB 2F53E 1K4CB 4DF9A 3GJFK 1MWAA 3CK0L 1O7SA 1TLMA 2W9EH 3APDA 2VDML 2WINB 5CJ8A 1GYAA 4O9HH 1R24A 2VOTA 4W9FC 3IFOA 4FLRA 1EEZB 1OGAA 1YEFH 5HY9B 5SWZD 2YR3A 1EJOL 1NEPA 3WMPA 5HVWA 1U3HC 1YVLA 3HN5A 4YDJB 1MAMH 2HPOA 1RZ8B 3QHFH 1NEUA 4MA3A 1XGPA 4ZW6A 2BVOA 1E4JA 4L29B 1N7ML 3UTPD 2QADD 3NCXA 4MAYC 3QR1A 3US9A 1GGYA 2WB7A 3ILEA 4GP5B 3QNYA 4XNYH 3U7YH 2E56A 3IFPA 4JO2L 1XIWD 1E65A 5L4FA 4YK4C 5J1SC 1GOFA 4FFVC 3BD4A 3Q8AA 1XGQB 4DGYH 4GO6B 4DWHA 2CUAA 3WDJA 5BVJA 1KB5B 1UQSA 3QDGD 1E90A 2WXHA 4AQ8C 1DBBH 4NPKA 2OMNA 5DJ0B 1NKRA 3BEVB 3PL6D 1WS8A 2YK1L 2O5YH 3FB6A 4FI8A 4MJ2A 1B0GA 5EIIG 1NCWL 5IBLC 3TV3L 3VWJB 3ZZSA 5A3ID 2F2HA 4DVBB 4M43L 1F6AB 2B0SH 2GITB 4X6CE 5FCSH 5G55A 4YHIA 3CK0H 4PJDB 1GVIA 4N87A 2Y3NA 1FCCA 2WLYA 3BP7B 1QSEB 2G3ZA 5SWSA 4NPYA 2GJZA 1FVCA 2AJXL 4AX3A 2UXVA 3SE4C 4PEEA 1DCLA 1CBVH 1DLFH 3A4DA 4TQEH 2OR9L 1QFUL 4HIIA 2EVGA 4L1BA 4OJCA 1XCTA 4I9XA 4LCWD 5F88A 3JZYA 4G80B 4PJEF 1G9NH 2WANA 1L7TH 2MCG1 2YBRB 2WXKA 5B4MD 2MNUA 1K85A 3DRQB 4P5MA 1TQBB 1MCFA 3T5WA 4MNGA 2W07A 2XPYA 4QRRD 1YNTB 1V7NL 3S35L 2OJ1A 1EX0A 1I9RL 3AT9A 4RGNE 4CBPA 1KDJA 3DUSB 1LE5B 1SBSL 4EN2A 2Y7MA 1K8DA 4FG0A 2Y4SA 3CVCA 2XXGA 2Y7NA 4CU6A 4GW5B 5MEQA 1KC5L 4H1LH 1I8MB 3BAWA 4PP2A 4GLRI 5TQ2L 1QO3A 4D9LH 3PWUB 1WZ1L 2O5YL 1NMBH 3MJ7A 3QVAA 1CK0H 1OF2A 2VZ1A 3BKMH 4BGLA 4GS7B 4K2UL 1Y0LB 2Y25A 4M43H 1SYVA 5DD5H 1H3GA 2WSDA 3EJSA 1P7HL 1YMMA 3RJOA 3V95A 3ROOA 1EMTH 4Y5VB 2VR5A 4GAJH 4RGMB 5D4JA 3QRGL 4PJGA 3KXFB 4K94H 2AJVL 2OCJA 4ELKA 2J8UE 4L9LA 5JPNA 4PV9A 3MGAA 2ZXDA 2VN5A 4TQEL 2OR9H 3IFNH 3SE9L 2WQRA 3DIFB 1URIA 4RZCA 4QRSB 4CMMA 4OUUA 4XH2B 1FV1A 3CHPA 3W9DA 1GH7A 2CHNA 2CKBL 1MG2C 3E38A 1DQMH 4QRUA 4OGYH 5EBWA 3MKKA 5DC4B 4FDWA 4TTDC 2CR6A 3FSVA 3IE4A 2CCVA 2JJTC 2X6UA 2Y1AA 2YPVH 1OTTD 5D6DA 2DQDL 1U3JA 1DBJH 3UCRA 3T2LA 4CRPA 4FERA 3QUXA 4O5LH 3S5LA 3WY3A 2PCPA 4WU7B 3CN0A 4HDIB 1Q9LB 3H8NA 2YXWA 2ZP8A 3H1ZA 1SVZA 4BUHA 5CBAA 3CDFA 3CVHL 5GRVK 2IC2A 2WVVA 3LD8B 1F3JA 1Q0YH 4GEJA 3D0VB 2F5AH 3SGJA 3OLGA 1SXSA 1JMZA 1TQBC 1CCZA 5CU9A 2ZWZA 5IT2H 1QSZA 4ODUB 1M6UA 3QJFA 2IAMB 3BW9A 1SHMA 1G6VK 4IRZL 3QQ3A 3AXHA 3MJ8A 5DFVC 2ORBH 1PZ5A 3ARVA 3QAZB 5I8KH 1GYCA 2CLRA 2LLNA 4X7SH 3S34H 4AYGA 4OD3L 3OHXB 3LKPB 3GS7A 5GIRA 3FS9A 4QRRB 5AZ2L 3CHQA 5MERB 3V8CA 2HRPL 5JOFA 1Z0NA 4AMKL 2WVUA 1Z1WA 2D7TH 5ID1A 3L1OL 4GRMB 3CFCH 2H6PA 2WXOA 3EO1B 5FM4A 2CBQA 3WFCL 2BNQB 1TMCB 2OW7A 5I30H 4WWKB 1CDYA 3DX6B 3TC9A 2DQDH 3L3OA 2YGOA 4FYSA 1PDKB 2YQGA 4Z7VF 5ESVB 5E2WL 2OTWA 5IVXB 5HVHC 3C6SB 3G6JA 3ULUC 1F4XL 4R84A 1BIIB 1ICTA 4I77H 4ZUSB 4JDZB 1PKQB 4HMCA 4HGWA 3CBKB 5BS0E 5I0DA 4LPTA 3IDIA 2NNXA 3R18A 4AWJC 3MV01 4K0OA 4UTCA 2DBLH 4NQDE 5D7LE 1O0VA 4QRTB 3FUKA 1P1ZB 3QNXA 1UXSA 3LPFA 1BEXA 1L6ZA 4WKZB 2DQFB 5ACZA 4HUVA 3P02A 2IEPA 4KKBD 3SKOB 1NGYB 4AYMC 1OLZA 2FQDA 4QGYA 3MRRB 4Z5RB 5E2TH 3LS5L 3Q01A 4FF9A 5DJ2A 5DUMH 4XI5D 4FAAB 5CZRA 2OTUA 3ECQA 3UTTE 2JTYA 4J6IA 3X12A 1C9SA 2JJUA 3N42F 4KV5E 1UJTA 4D0BA 5J0BA 5I1LB 3T0DA 4QOKB 3A23A 4B9GA 2BMKA 2YA2A 1C7SA 3MRRA 4ZW7A 5HHQA 4NQUA 1T2QL 1DANU 1T1XA 1OGAD 5F6HJ 3CFCL 3DJRA 3HOGA 3OPZH 5BW7A 3RGVD 5I30L 1CTOA 1M1XB 4JQXA 4H1LG 3GT6A 5DJXB 4U1NA 3CDGB 2XBZA 5FF6B 3LKRA 3WS6C 2IADA 1RUAH 32C2A 4NFBA 2D0HA 1KIRA 3PWLA 1J8HD 1IEAA 4IKJA 4ZTOH 4O2FA 3DETD 1ZT7A 3P3SA 4TNWF 1C5BH 5DHMC 2F74B 4RNRA 5E4EB 3S36L 4TLSA 1WHOA 5A6MA 2FRGP 4LDLB 4PJ7E 1OAQL 4AGLA 3LS5H 2EDBA 3MUY1 1MH5A 3MRGA 4QY8B 4WO0A 5T5FA 2Q8AH 3TCXA 5JPNC 5HYFA 1MVUB 2CJSA 3EOAA 5CUSH 2GSGA 4OVUA 1OP5K 1ZVSB 4JFPA 4PJ8A 4IU3A 3SJVA 4A7UA 1E4KC 3RIFK 3QEQB 2HXAA 4Z76A 4F2FA 1T2QH 4KI5D 2P5WA 1JNHB 4FYRA 4MJ6A 4XN7A 1KCRH 1YQVH 3IT8D 1H3PH 4HZAA 5I0ZA 1IQWH 4ZX4A 2VXQH 1SZNA 3NGBB 3FONB 4J3BA 2Q7AA 4U6TA 5F6IC 2BMKB 4LHUG 5IQMA 1KGCE 4YXHL 5DXWA 4X8CA 4JN2B 4OGAC 2WJ7A 4S11A 4NZUL 3U7AA 3Q2WA 1RUAL 5I5JA 1IFGA 1UB5B 4NKDA 2Q87A 5D93C 1TSRA 1F58L 3GUFA 4OLYL 1KIQA 4BFKA 1B88A 1UD8A 3Q8EA 3SYOA 4IRSC 1HN1A 3BZFA 5TJWK 4DVRH 1SN2A 1DDHA 1V5JA 5T5NF 4HUUB 4UOQA 3ZJAA 2CPCA 5IROD 4QXUL 5DEGA 3DYPA 4KROC 4TNEA 1KDIA 4L1SA 3F65A 4I2XE 5HYQA 4LEEA 2K1MA 5CUSL 5ILTL 1TZOA 1B4JL 1ET7A 3DGDA 1AIFA 1HL5A 3RKPA 2YC1B 3DK2A 3O3EB 3L4YA 4JFXB 5HGAB 1AGFA 3LZLA 3E0GA 1SLWA 1U3HA 3IBOA 3R4RA 4PRAB 4QRFA 1KYAA 3SJVD 4JR9H 5ISZE 5DF0A 2TSAA 3ILQC 1IT9H 2BHZA 1HJBC 2EDTA 2QHRL 4YSDA 4ADJA 1OANA 2OMYA 2A74B 3WN6A 1QTPA 2MEJB 4OCSH 3PHOA 4Y8DC 3FSOA 4NKOA 1MCHA 4XN9A 5TD4A 3V4PA 1FLRL 5IR1B 3VG9B 1EHXA 1IZJA 4Q9BA 1F58H 2GJJA 1I8IA 3VX0A 4HQQL 5G2NA 1BZ8A 2JI2A 3OKDB 5EU6B 1D5BA 4UNIA 1V8HA 5KTEL 1T21A 1KPVB 4MJHA 1A4CA 3I3BA 2YJLA 4FP8L 1GZPA 4X7DC 2EDNA 1Q9WB 5ISZA 1KFAL 3HG1E 3KPSA 1U21A 2J5LC 3VFPA 1BHGA 2O26U 1LP9A 2WQUA 2MOQA 5EIVA 1LDPL 2APVA 4FMFA 4JW3A 2ICES 3VXQA 4LQFH 5AW1B 3ZTDC 4PS3A 3K6NA 3NCYS 3RL2B 1GZPB 4AC2A 2W59A 1B4JH 3L7EB 1AHWC 1B2YA 1NANH 2LU4A 3ZO0A 1UGNA 4G83A 1AQKH 4I9WE 3UGUA 2VLLB 4WI8A 4N28A 4JLRB 2B7DT 1T1ZA 3D3VD 4NN6B 1AZRA 4XCNA 3UTQA 4ATWA 4ODHH 1VSCA 2FH6A 1BFTA 5HHQB 1SVCP 1CWVA 2K7QA 4FA6A 2GTWB 4GUCA 1CG9A 1HHGB 3DLQR 4EXKA 3BWUF 4KQ0A 1G7MA 4ETQB 3B9KC 1PJ9A 3ZGHA 1E6OL 5MENA 4M61A 4XRCB 5DFTA 1QLFB 4JUSA 1HEHC 2VB5A 3ME0A 4U1LB 2BSTA 5TH2B 3WS6A 4E42B 4WEEA 1ID2A 5IHBA 2GUYA 5MI0B 3C5ZB 5HD8C 5I74C 3QPXH 2WWMD 1NDTA 3EJRA 3HRZA 5M7QA 3L16A 3N50A 5AWNH 4MJ4A 1MCOH 3TO4B 1AD0A 3MLYH 2ZYHA 4K9EC 1MW3A 3B37A 3DETC 3NIDF 4PYGA 3LKOA 5ERWB 1CI5A 1SYSA 1JWMA 5E2VH 2XWZA 5C08D 3UMTA 1LO3L 5DGQA 5I24A 4LU5H 5GRXG 3M07A 4GRWB 2J8OA 2FT6A 1UH3A 1NL0H 2J43A 2ZPKL 1VACB 1U8NA 1XH1A 2NCMA 3S0PA 1R5WA 1HHKA 3MRQA 3EDEA 5F1IB 4UILL 3LV3A 5H2BB 3P11H 2TSBA 1W0VA 4Y2LA 4LHUA 1BECA 4AIEA 3F58H 1S3KH 4WI6A 5KVFH 1GKOA 3PHQB 3EYOB 1EHKB 1AQKL 2J44A 2Y22A 4P99A 1ZLVH 2GG1A 4QD2E 1FLTX 2PF6A 4AQOA 3UCQA 5LLIC 5ENWA 2GB2A 2ALAA 2IF7A 3QJHA 1X5GA 3ZE2B 4OCYH 4MS8D 5IQ7H 1E6OH 1U8IA 2XY1A 2EXWD 2NDGA 4WHYG 3DARA 5LNEA 4ZOEA 4U4IA 1IE4A 4NT6B 4FLSA 1FH2A 3BVWA 3BISA 1XF3A 3B9DA 4ZT1A 4RGNB 3MLYL 1VDGA 3TNNA 4ISVA 4RMTA 5EZIH 3RRQA 4TTGA 1Q0EA 1YEIL 4H88H 4DN4L 3V0WH 4GKNB 4HPOH 3ZDXF 2BM3A 4PJDA 2X4SA 3MJGX 2DS4A 2IQAB 2FUQA 2LVCA 1E9QB 3VRLF 2ZUQB 2DQEH 5CR8A 1LMIA 3RTQB 5FDWA 1DJWA 3TIDA 2BVPB 4X6EA 3SGJC 4PGJA 4KXAA 3V0HA 2EYTA 5BO1L 2A3TA 4UILH 3O4LD 4MAUL 5CBEA 1OSPH 3LIZA 3GS0A 3QSKB 1FE8L 2L3BA 4HGMA 4H8HA 4YR6A 2GUOB 3ATBA 2XY2A 4WI7A 1OE3A 1CJYA 2ZWYA 2YD6A 4UZUA 2CMRL 4F5CE 1SQ2N 2SEBA 4J4PD 3RZWA 2FL5A 3MLVL 4MDIB 3WFHB 2I26N 3PHQA 4X5XB 3ENEA 5L88L 4F91B 2OMUA 1CGSL 4PRHE 1BM3H 2ITDB 3D48R 2WVSA 4E9VA 5F1IA 5E8DH 5FGBA 4BKSC 1U36A 5DMKA 4H5SA 4MLIA 1P4UA 3KXFA 3ARED 3WFHA 3F6LA 3B2VH 5I15H 5KSAA 3MI6A 4KFZC 3HNTL 1QWUA 5GGVL 5KBNC 5MEOB 1JI2A 3WIFB 3W56A 4JZJB 3LN4A 3KPLA 2OYMA 5CXPA 1Y0LA 4MD4B 1S7UB 1U9KA 2WUCH 1AQDB 1QFWI 2HFGL 3AU1A 1NCCH 4M1DL 5CO1A 1VCBC 3X13A 1WEJL 3CZNA 2VLJE 4JPVH 5F7KC 3QIUC 2OMVB 2J88H 4HIEA 4I1PA 2BSTB 2CE6A 1JPEA 4MAUH 5TH2A 3OLIA 3BSZA 1IL1B 2DQUL 3RHWK 1N6VA 2JSFA 3BAEH 3PQYA 4JDVB 4LP8A 5F9JA 5LGJA 1INQB 1EK3A 1MJ8H 2NQ3A 2LVEA 4A7TA 3H9SB 1TZAA 1B9ZA 2L0DA 1H5BC 4O4YL 3EHBD 5CCHE 1W9XA 3OKKB 2F53B 1K72A 5I5RA 1A9BB 1RQ5A 2WV3A 4W9GC 3TFBA 5BUAA 3VFVA 2JKTM 2QFPA 2VLKA 2FZ3A 1XQ4A 4Q74A 4GAGH 1HI6B 4G6FB 2N4IA 3VWKB 1INDL 1NANI 2R2EB 2C3GA 3KPQB 1HKFA 3ES6A 5K9JH 5DRNA 2A73A 1DBAH 3H54A 3HNTH 1II4E 2J3SA 4HC1A 4YBLB 1MVFA 4WFED 3BWZA 5F0PB 3RWIB 1T21B 2J20A 5JW3H 3PY9A 3KL3A 2EYRA 2W60B 4RBPH 1E50A 2HFGH 1JL8A 3T8MA 4NC1E 4UT6H 4MXVF 4DO6A 1ZT7B 4OI8A 1KXQA 2DQTL 3MV9E 4D0DA 4D9RD 2B1OA 1YN7A 1KB5A 5B1AB 4JKKA 1U8NB 2OX5B 4LL9A 2F54E 3ZL4L 4RMBA 1F02I 4L8SB 1FC1A 4DTGH 5CCJA 2ZG3A 1HYRC 1PSKH 4NQCE 3CVBA 2X1WL 3LX9A 5I17A 1KELH 1U95A 4PHZA 1OP3H 3B6SA 2Y06H 3C8KA 4UNUA 1Z5YD 1CGUA 4N2GA 1UWXK 2Z8RA 1PIFA 3CGTA 4P2AA 1A1NB 4FHBD 2IPTL 1N18A 2VLJA 3L5WA 1LHZA 3NOIA 4JCLA 3S8FB 2QSTA 2WAHA 4HKXA 2Y23A 1DUYB 3UZVB 1JVOA 3F85A 3ME0B 4RISH 3V8OA 2AEQL 4G6KL 4B7IA 1CB4A 4OCXH 5TE7H 5EUOE 1KY6A 3U2JA 2WAQA 4O51B 1EZUA 5D71H 4ZUWA 3SO3C 2ZT9C 4AM0A 3DIVA 1MUJB 4HYTB 3X2QB 1HHGA 3ZHLA 3ZLQC 2H1PL 4Z5RA 4QRSA 3QB7C 1D9KD 1QBBA 2ENQA 2UVEA 5SWQA 4HT1L 3JWNE 4CC4A 3QJSB 3VGDA 2PR4H 1K4CA 4TPRL 1CMOA 1AC0A 5H35B 5I1CH 3QUXD 3HHSB 5D7KE 4MWFB 3GEFA 1YG9A 1P5VA 1UA6L 5FV1L 1F42A 3MODL 1TZGH 1NOAA 5FO8A 4FXGA 1J8SA 4AUUA 4U3HA 2UZIH 2P8PA 4X6DE 3DX0A 2XPGA 3MAWA 5T8IA 2BCMA 2ZCHH 8CGTA 1I82A 1JS4A 5I23A 5EUOF 4P46D 5CJBA 1SFHA 1BYOA 4Y16D 1J5OL 2FR4A 3MJ7B 5MEPB 1MY7A 2J1WA 1KELL 1QBLL 1X5YA 2B4CL 1PCSA 4N0YL 3BRDA 1QFWL 1UZGA 4QIRA 1HWWA 1ZDSA 3OXSA 4G1MA 2DWTA 3MRIB 1KXQE 2E3VA 1XTMA 3QI9D 3T04D 2X40A 1MFAH 5JHDE 4KKLC 4AQ1A 2IH8A 3N3EA 4M6AA 4YDIH 4IBVA 2BIIA 4WSGA 3GMMB 1AGBB 2H9GA 1PLGL 1S78D 4JRFA 5AKVA 3WAKA 5D71L 3MBEA 2X3AA 1G6RH 4HPYL 5KSAC 1JOIA 1IC7H 4F7MB 3L6FA 4PG9B 5DI8B 3A4AA 3PG2A 5C08B 1P84K 2EO1A 4RSVA 3RWGA 4F15B 1VA9A 3I9AA 3DROA 3PWPA 1IQDA 3K72A 3QR0A 2X4OA 3HBGA 4ZBJA 5F1NA 3LHPH 2WO3B 1P5UC 3RY6A 1E8WA 4EI5D 4QHKJ 1LNUB 3Q1SL 2PCPB 4Z7IA 4I87A 1DYZA 1U8LB 4J12A 3ZE0E 3OWRA 1PZAA 3VI4A 5IOPB 5GGQH 2AW2A 3BVNB 2PTVA 3C09C 5EO9B 5IQNA 4DKEL 5C92A 2R59A 5CKAA 4JDTL 3SQRA 3KLKA 4ONGH 5FA4B 1JUFB 2WTOA 4L4TB 3RFZB 4NN5B 5EMYA 1C5CH 2GBUA 3OKOB 1YAIA 3UPCA 2Z7WA 1FCGA 3GO1L 1MFAL 2D31A 2W95A 2Y9RT 1CVSC 3CLEH 3KWWB 4NO0D 3UBGA 5T1KA 5LBSH 1LO5B 4ZUVB 1S8DB 1EDYA 1L9OA 5B4MC 1OY3B 2ZOOA 3RWCA 3ISRA 3GBLA 2R51A 1XF5A 5EWIL 3MCKA 3WE6A 2L8AA 5T1MA 3DTDA 3TN0D 1MXGA 4GW4A 2Z1KA 1CD8A 5E9DE 1T83A 3MN8A 3DC0A 1ERNA 3NJVA 3H85A 3LHPL 2VLRE 1ZK5A 4I3SH 4IMKA 1KJ2H 4UT9L 3BH8B 4MMYB 2HFEB 2HLEB 1NM4A 3HC4H 5GS0D 1E9OB 5GISH 4PPTA 4N8CL 3GLEA 4KK6C 1XGUA 1A7RH 2Y2TA 4U4BA 3V6ZB 3NABH 4G5ZH 1Z3GH 1GGTA 3L6FB 5DD1L 1FPTL 2PW1A 3DO4A 1T5XA 1EDHA 4UNVA 4S2SA 3ULVC 3U6RA 4PV8A 1HH9A 5ALBL 1G0XA 2ZKHH 4JVUA 5CJQH 3E9UA 4P5RA 4IEFB 1MWAL 4EBQH 1W0YT 2BOLA 5DR5L 2QL1A 2Z92A 5EOQH 1RZKL 5HDLA 2N01B 3VWKA 5D7IE 1FZOA 3MRIA 2B77A 4YFEA 2VDRL 2VRKA 4BSJA 1IGCL 3LKNB 3SDAA 1F00I 3QCVH 5C09B 1ACYH 3VXSD 3B2MA 4XVUC 4M9PA 1G9MH 5AOKA 3ILPA 1RJCA 2P24A 3FO2A 2DH2A 1THAA 1E0OB 4BSVB 4UF7C 1BW8A 1VB9A 1AMYA 1GZHC 1SHWA 3VFPB 3TVMD 2VRAA 4S1QL 4G72B 4WJ5A 1L3NA 1NGXA 5F8RC 5D7IA 3HCVB 4A7SA 1WLHA 5IJKC 3L45A 3S36X 2GFBB 3LZFH 4M48L 5HHXL 1L5GB 5BMFL 1IC4H 4YIQA 3VYOA 4ZTPL 3LH9A 4AH2A 4WZ9A 2R2HA 4NO0B 3L9RB 5IMLB 1BMZA 1MFNA 4A7GF 2XV0A 2LAGB 3HRPA 1XH2A 4N8PA 1RL1A 2VH5H 4GKZA 2KZWA 2WBJD 4LNVA 5KJRL 5D55A 1DVTA 2D4DA 4PLOB 2ZKHL 5CJQL 1OQOA 4PSPA 3S2AA 5D2LF 4PRIE 1AZCA 3L7FB 3MTXA 4Z7UB 5B7FA 5J4MA 4H8WC 4XN4A 3MOAL 4PTUA 3KM1A 2VDRH 3TBBA 3EGSB 1E8YA 2EDKA 5JZ7D 4ZMOA 2FQEA 1V7ML 5I0YA 1G9ML 3GXPA 3L2NA 1A9EA 3TA3C 1ETZB 2VJXA 4A67A 4EN3C 4XCEB 1ACZA 3F8UB 4EEEA 1UWEH 2ADGA 2BNQE 2NYYC 2C9UA 4XO9A 3V5KB 2EXWC 2QKSA 1XZ0A 4U7MA 5HI4D 5CD3A 4Z7QF 3STLA 4PGBB 1UXSB 3NSYA 3MGTB 1XWVA 1R34A 3FQYA 3ARBC 1IC4L 2VXTH 3BW9B 4HKZA 2WZPD 5HYJA 1TCMA 4OLWL 3Q8CA 5D7IB 5DS1A 3CMOH 3H7LA 3GLZA 4G8GD 1TCRB 5E0QA 5FAAA 4XE5B 2PO6B 4KY2A 2X4TA 4YEFA 1PEZA 3HHRB 3KJ6L 2BWIA 2Z91B 3C5ZC 3MA9H 4IBSA 1FORL 1WIOA 1N67A 4R4FH 3K3QA 3AUWB 3K6OA 2BFVL 4OJFH 3RB5A 1MPAH 2G9HA 4YSQA 4UTAH 2PPDA 4MVBD 5FA3B 1QFHA 2YMTA 1LL1A 1NPUA 3DXAB 4WAFA 5AB1A 4ZFFA 5KG9B 4OLEA 1H6FA 3WNNA 3HS0B 4X7TB 5BVPL 4I7ZC 3NEXA 4OAWA 1YNKL 3FTXA 1MW2A 3WKQA 3PUCA 3SDXB 1C8PA 5F9AC 4DVBA 4PBXA 5K9OB 4KNQA 4Q9QL 2RA1A 1DJIA 1UKSA 2ATKB 3A4FA 1T83C 3BT2H 3GJFH 3M86A 4PV8B 5C6TL 1FYTE 4RGMC 1D6EA 2PW2A 5FM5O 3RWDB 1WWAX 2A6KB 3F5WA 4YLCA 2XTJE 2EYRB 2W60A 1FHNA 4H4NA 3VWJD 4HS6B 4KNUA 4KGLA 3V4PH 3FT1A 5EZLB 4NZJA 5FDYA 1IBBA 3UG4A 4DPRA 4TNVF 4K8RL 1RZGB 2FX8H 2Z31C 3S37X 1BPLB 2ADJB 1LK3H 4QRAA 2BSRB 3VAEA 3RPIB 4GIOA 2XQ0A 2AQ3A 4JQIL 2OL3H 3CVHA 2P5PA 4Q14A 4X4YB 2WP3O 1MEXH 5GS1C 3EGXB 3MA9L 4LHUD 1CLOH 1XF1A 4Z7OE 3KBEA 5LO7A 4CDGC 4R4FL 5F72S 2BFVH 2RTTA 2OMUB 2COQA 2J8UF 5C09D 4JVWA 3X11B 4MRBA 4DJMA 3CX5K 4LLWA 4PMFA 4UU9B 2Y07H 1YY9D 2CQVA 1XDTT 2CO3A 3RI5F 3FQUA 4Y2DA 5DURD 2FBOJ 2DD8H 4K5MA 5BVPH 3GZPA 1NFDB 2Y7QB 1H8SA 4NO0A 4L8BB 3NIGF 4QJ5B 4POYA 2D31B 4JLRA 4JFZL 1QWNA 2E27L 5AZUA 2Z65C 3QDJA 3DJZA 4LP4A 1S3RA 4KWUA 4NAMA 2FX9L 4P9HL 3DBXB 4A63A 3L81A 5I6XB 3C9NB 4ELKB 1HS6A 3NJKA 4EZMA 4WJ5B 3QNXB 5I6XC 4G8EB 3ESNA 3WFDL 4IGBD 1UEYA 4HZLB 1U8LA 2IPKB 3HMXH 4MX7A 2OJZL 3EXJA 2IMNA 3EDKA 5FIEA 2MIZA 3WKPA 3E2HB 2OL3B 5D7SH 2CUMA 2FYVA 4JQIH 4PRPB 4HS6A 1IBHA 4N2IA 4LCUA 2W0FB 2H32H 1GZQB 1A1OB 1JZEA 1T1YA 1V3LA 2YKLL 5DJZB 4WKXA 1CD0A 3DOHA 3V4PB 1DLHB 5DMGD 1LE5A 1V55B 5C0AA 2X88A 4YL4A 4YX2L 3SGEI 1JPGA 4F7MA 2VDNL 1D5IL 5L4JA 1MVYA 3WN5B 1CE6B 4UOW0 3SCMB 3GINA 1OV8A 4MNQD 3DVNB 1E5ZA 2E9IA 3QA3A 4GAYA 4PLKC 5HHOB 5HVHB 3BLBA 1LVEA 3U6RB 2JQMA 5HGGS 2G5UA 3W37A 4GINA 3PGFH 1WAAA 1IJNA 15C8H 4P2RA 1ZHNA 4JFZH 5BZDB 1ODUA 2P52A 5IMMB 2BVPA 2I60L 3BGAA 3FK3A 3NJXA 4PLKD 4QMEA 5SWZB 3MBEC 1FFPA 4B0MM 35C8L 3QIUD 5IFAH 2PABA 1AQ8A 4OKVA 4HV8A 3TYFA 3FTUA 3ULSB 5FPIA 4XC1H 1M05B 2OTPA 2OJZH 3G9AB 3CBJB 4BK5C 4ZMWA 1SF3A 4CN6A 4JFVA 4D7PA 2UWEA 2GC4C 1RZFL 3BZFB 5IB2A 1GIGH 2ILLA 2WWKT 1XSKA 3NZUA 3FUMA 4IGBA 1KBVA 4FL4C 4R2GD 3T8XA 1OZTG 2GSMB 1NCIA 3X13B 4CNIB 3FT4B 3FKUS 4HZ1A 3IVKA 2WLIA 4AJWA 2J8UB 5I1EH 4KAQH 2XYCA 3WIFA 1CBJA 2G0LA 2HLFC 2WXFA 3AW5A 1BFOA 1WICA 3VFOB 1KYOK 2ARJQ 2QVKA 1KIPA 3PGFL 2WNXA 3BX7C 3O6ML 3LV3B 3MOQA 4NFDA 4PJAA 1B2WL 5H37A 4KUCF 1FGVH 4NKQB 4ACTA 1CFSB 1NGWA 3S37H 1T6VN 5ANMA 5B7EA 3MNZB 1RK7A 3JUYA 4C56D 4BWWA 2XWTA 2VAJA 4IOFC 4X9GA 3K6SA 5HI5D 4NP9A 3SBPA 4WV1B 1JIBA 1CYGA 2VDKL 4ODXB 4AYDC 1NBQA 4XC1L 1Q9WA 2P4AB 3BQUC 4OD2B 1IGIL 3RZCA 4CW1B 1PX3A 4LSRL 4AH2B 2Z8WC 4LKXB 4PB0H 3ZW3A 1BQKA 2HX7A 4QRPA 4K5NA 4FFYH 4LLMA 4FQ1L 4I85A 5I1HL 1O7DC 2CJTA 2CO7A 3LDBC 3QUZB 2DN7A 1LK2A 1ZY9A 1I8KB 3MBEB 5TDNA 5CGMA 3WI9A 4FJ6A 3G5XA 1IV8A 4TOYL 5HTSA 3A6CH 4RFOL 2ZXQA 4MNGB 3GBEA 1NGQH 1S7QB 1LXMA 1H3WM 1T0MA 4H26B 4PWHA 4OZIA 1H6TA 1YJDH 2IPKA 4ONHB 4POZD 4HWZB 3NJFA 3SKUD 3BH9B 2D2CC 4U2ZA 3WUWG 1VGEL 5D93B 4KKBC 4Y4KD 5DVMA 3KZ8A 2DI9A 1FNSH 2IDQA 3KHOA 4HPHA 5FB8B 1RPUA 3O2WH 2NRDA 2BJML 5KS9E 1DE4A 2CBOA 3BCFA 3TGXA 1ZLUH 4KQ3H 4EI0A 3LQZA 1TZHA 1VEMA 2CRMA 2H32A 1D3CA 1ASPA 5ICXA 3CC1A 4ELDA 1FGVL 2D7OA 2OR8A 1BZ9A 5DHYB 1OEZW 5DDHA 2NT1A 4O2CA 5FLUA 5EU5A 5LDUA 3ZYIA 3MRPB 1PPIA 1L9RA 1MIML 3HEIB 3N9GH 1TETH 5C0CB 4OF0A 1KEGL 3FH7A 2UX6A 3KEDA 1A1MB 5B8CC 4Z8FL 1N2RA 4LSRH 3IU4L 2IV8A 4Q0XH 2IAND 3CCHB 3QXDB 4PJAF 1IJ9A 1DHKA 1E5BA 3FN3A 3T3PE 2NUPB 4L8CB 5CCKH 1I53A 5IJKA 1J9CT 1I85A 1JGIA 1NBZB 4FEMA 4ABVA 5L6YL 2BOBA 2X70A 4QWWD 4G43B 4XP9L 3L4CA 3JTTA 4Z3GA 5KYYA 3AREB 4P46A 1E27A 2L7UA 3A6CL 4RFOH 4U6VH 1X44A 1M71B 3R06B 3NG5A 5IVZA 5ID0A 5CINL 3RKDC 4JE4B 1ECYA 4OVVA 3FQNB 4DNLA 3FO0H 4JO3H 5HYJE 1R9FA 1YEJH 2EZ0C 3EDDA 1DQDH 2AJZA 1RUKH 3A3YB 3LZPA 3IDGA 4YDJA 3SPGA 5F7LB 3LDBB 3O2WL 2BJMH 4PRDA 3T09A 3UO1L 1DFXA 3K91A 3SGKA 1JZ7A 2XN1A 4WY7H 4NP4L 1F18A 1TYEB 2V5TA 1WCQA 4FQ2L 4PY8J 4Y2DD 1QRKA 1CXFA 3DTXA 4AE1A 1KLGA 5DSCA 1MIMH 5TE6L 4DIXA 2CJ3A 3ULUH 3P73A 1RJLA 5AEAA 2DDQL 2PXYC 1MFVA 1NCOA 1OK8A 3EGDA 4G9FA 4RQQA 1ZT4B 2LGNA 3VQLA 4HFWB 3NZSA 5DMIL 1MRCH 1U92B 4ES9A 5TFSL 3CFJA 4YMPA 5DHVA 4WW1A 4IBLT 2O30A 2AXFB 5D1XC 4BXSV 5EZJB 3T65A 1T1WA 2VSDA 4KY1H 1KCWA 2PYEB 2ZCKL 4L05A 5L6YH 4XVTL 1Q9OB 3EFOA 3MV11 4JKPL 4P59L 1JXKA 5IFHH 3MLUL 5C6PB 4DCQB 3NCMA 2RCSL 4XHJD 3W5MA 1WF5A 4U6VL 4NLHA 4G3YL 3WFBH 3ZMEA 5CEZH 3QIBD 4G59C 3PHSA 4WW1B 4M3HA 2CNZA 2OMXB 3EH2A 2XWDA 3VFNA 4EIZC 2FNWA 2VN3A 2HTLC 1G9EA 5CZXC 5FYKL 2DLEA 1YEJL 2NZ9D 3DHMA 4KXCA 2EDFA 5CHNB 5EF0A 4NKOB 4YK4B 5JXAH 4Z0XA 3SDDB 3WNIA 4HOXA 4LOEA 3PAVA 4PS8A 2ZUTA 3ZO9A 2NY7H 4FQLL 4LSPL 7PCYA 4P2QA 1PZBA 3KPMB 4ZQKB 1JHKH 3U0WH 3V0AC 1ETZA 2HFFB 5CP3A 4F58L 1S7SA 4YJZL 4AZ8A 2W65B 3UYOD 2JLLA 3BO8B 3D5OF 4W6WB 4PV9B 1IBFA 4OZIE 1LO0H 2CDGA 1KLUA 1QFWM 2HN7A 3QO1B 1I75A 3VRIB 4F8TA 1JZ4A 3G5YA 4Y2OB 3A4EA 1R5VB 4X0NA 1OAZL 5BOPA 4Y5YA 1BGXH 4L0PB 3NAAL 1I7RA 5KVEH 4Y4FD 2XT1B 4H25A 5DJCB 3UACA 4KDWA 2FECI 5G5DA 2XC8A 4X50A 5FKAB 4P59H 2EDOA 1RULH 2GKIA 3C6SA 5E4EC 5D70H 2XXCB 1L0PA 1QG3A 4PJEA 3FFCA 3QJRB 5CEZL 3L3OB 1R3HB 3HNVL 4PBVC 2M8XA 4ENED 3D69A 1IKFH 1U2YA 3WE6B 4W9LC 2WB1A 2P8MB 3PIQB 3RG1C 1JGLH 2XWRA 3VXMD 3FQ1A 4JB9L 3IM1A 1RUML 4XNQA 5FKPA 1C16A 1BCIA 1YYLH 2Q86A 5GPRA 2F8XC 1UA3A 4HXBL 1MUJA 4UAHA 2C1OA 2WXIA 4Y19A 1R33A 3B3IB 5KJ4A 1AOHA 2CCLA 3QFDB 4LSPH 2CM6A 3WS3B 3OKOA 3ZUCA 3BUBA 1HU8A 4HMDA 4QLRA 3U25A 4TUKH 4KPHH 1X5IA 4PJEE 1UHVA 5E8PB 4HJJH 4NO5B 2KZ1B 2IH1A 4PIRF 1JV2A 5EO9A 3MRLB 3O2DA 2OMWB 1KT2B 4OGXL 1MNNA 4DEWA 2LW3A 1LO0L 4G8GE 5K9QG 5HYIA 1TJHH 2VM4A 3T2NH 1NDGA 3AWEA 2X2HA 1INEL 1P7KB 2HWZL 3QH3B 4LNRA 2JELL 1AHWB 5I26A 1BD2A 1DVZA 1BAWA 3B2UD 4JFPB 2ED6A 3CTTA 3LEYL 1EO5A 3WGVB 1F3JB 4J8RB 1DSWA 4IEFA 4AGQA 1BZEA 3GSWB 3NRPA 3P9MA 3G04B 5HHNB 2I9LB 3FQTA 3BFWA 2BWDA 1XHHA 5AAWC 3UAJA 3F12A 5DHVB 4P46C 5DJ0A 3EBGA 1N0LA 3DHUA 3NFPA 5T3XL 1ZXKA 5GXBB 1QR1A 2XTJD 3ABMB 3HI6L 5GGTA 1DBKH 5C2BL 1RUPL 4LLMB 2F74A 2YPLE 2EVFA 2IBBA 3P73B 1UKTA 1JGLL 2V3FA 5F0JB 1E9OA 4L8SC 3KM2A 4IW4C 3JWOL 3DJSA 4HXBH 3B2XA 3PP4L 2A9CA 5JZ7C 3PAYA 3KLAB 4U3SA 1EO7A 1G5AA 3FQ4A 4LOUC 2YPLB 2R2EA 2AK4A 5EEWA 1T0NA 4C8XA 3FYEB 3KGSA 5DK2B 1PBYA 2LQRA 2WYTA 2W9EL 4XB7A 3ZKND 3QO0A 3IDJB 2XNAB 1QI5A 4NWUH 4G9DA 3ETBF 1G87A 1EHLH 5IW1A 1VACA 1FRGL 2VYRE 3LRSB 1W8EA 2NLJA 3S3JA 1PNDA 1W91A 4HS8H 3UEQA 1YEFL 1A8ZA 5EPMB 3NP3A 1YYML 3OMZA 3ARBA 3LPGA 4Q4IA 1A7OH 1MCKA 3FT4A 2OTUB 2YXMA 1UWYA 5ECJE 2AANA 3CPUA 4JFDA 5J9PB 4GPVA 5JLZB 3HHSA 5D2LB 4N4YB 2IQ9L 5BW7C 1B0RA 2GC7C 3OSKA